MPLDPRCKLTAPKYNPPRTWTPKGTVGMGGSSTAIYPDRLPGGYQIFGRTPVPIWDPEKRFDVFKDSICLFRPGDRIKFNPCSYEEFEMIEKKIEDQSYKYDLIEDQKFSI NKYKKWLKSLDYKKKF, this is the result of codon sequences chosen from the -1 frame through ORF finder using one of the NCBI tools, as the SMS toold did not presented any result using the following settings:
1. Return ORF only 60 codons long
2. ORF can begin with ATG
the above protein is taken from the longest ORF result, from 264-647, i.e. 384 in length, below is the actual result. There are a total of 127 amino acids

    647 atgcctctagatccaagatgtaaattaacggctcctaaatacaac
        M  P  L  D  P  R  C  K  L  T  A  P  K  Y  N
    602 ccacctagaacatggacacctaagggtacggtaggtatgggtgga
        P  P  R  T  W  T  P  K  G  T  V  G  M  G  G
    557 tcttcgactgccatatatccagatcgactgcctggaggttatcaa
        S  S  T  A  I  Y  P  D  R  L  P  G  G  Y  Q
    512 atatttggtagaaccccagtgcctatttgggatcctgaaaaaagg
        I  F  G  R  T  P  V  P  I  W  D  P  E  K  R
    467 tttgatgtttttaaagatagtatctgtctatttagacctggcgat
        F  D  V  F  K  D  S  I  C  L  F  R  P  G  D
    422 agaattaaatttaatccatgtagctacgaagaatttgagatgatt
        R  I  K  F  N  P  C  S  Y  E  E  F  E  M  I
    377 gaaaagaaaatagaagatcaatcttataagtatgatctaattgaa
        E  K  K  I  E  D  Q  S  Y  K  Y  D  L  I  E
    332 gatcaaaaattttctattaacaaatataaaaaatggcttaagagt
        D  Q  K  F  S  I  N  K  Y  K  K  W  L  K  S
    287 ctagattataaaaaaaaattttga 264    
        L  D  Y  K  K  K  F  *