Forum "ORF finding"

Sujet de discussion: ORF finding of GOS_2360010

[ Retour aux forums ]
ORF finding of GOS_2360010
Adil
28 Apr 2011 10:29
Contribution non évaluée
544 atggcagtcgaagatccacccatacctaccgtacccttaggtgtc
        M  A  V  E  D  P  P  I  P  T  V  P  L  G  V
    589 catgttctaggtgggttgtatttaggagccgttaatttacatctt
        H  V  L  G  G  L  Y  L  G  A  V  N  L  H  L
    634 ggatctagaggcattgtaaaaggaagtccaggccaaaaacctaag
        G  S  R  G  I  V  K  G  S  P  G  Q  K  P  K
    679 gaagcgacccagtattcagttccagagtga 708    
        E  A  T  Q  Y  S  V  P  E  *

The result was taken from one IRF finder tool given by NCBI, showing 54 Amino Acids,
from the reading frame +1 of 544-708 bases, making a total length of 167. The result
from SMS was taken and matched with the NCBI result, the following was the upshot
from SMS:

ORF Finder results
Results for 932 residue sequence "GOS_2360010 Genomic DNA (Galapagos Islands: Wolf Island)" starting "GGAACAGATT"

>ORF number 1 in reading frame 1 on the direct strand extends from base 544 to base 708.
ATGGCAGTCGAAGATCCACCCATACCTACCGTACCCTTAGGTGTCCATGTTCTAGGTGGG
TTGTATTTAGGAGCCGTTAATTTACATCTTGGATCTAGAGGCATTGTAAAAGGAAGTCCA
GGCCAAAAACCTAAGGAAGCGACCCAGTATTCAGTTCCAGAGTGA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
MAVEDPPIPTVPLGVHVLGGLYLGAVNLHLGSRGIVKGSPGQKPKEATQYSVPE*