| Adil 28 Apr 2011 10:29
 Non evaluated contribution
 | 544 atggcagtcgaagatccacccatacctaccgtacccttaggtgtcM  A  V  E  D  P  P  I  P  T  V  P  L  G  V
 589 catgttctaggtgggttgtatttaggagccgttaatttacatctt
 H  V  L  G  G  L  Y  L  G  A  V  N  L  H  L
 634 ggatctagaggcattgtaaaaggaagtccaggccaaaaacctaag
 G  S  R  G  I  V  K  G  S  P  G  Q  K  P  K
 679 gaagcgacccagtattcagttccagagtga 708
 E  A  T  Q  Y  S  V  P  E  *
 
 The result was taken from one IRF finder tool given by NCBI, showing 54 Amino Acids,
 from the reading frame +1 of 544-708 bases, making a total length of 167. The result
 from SMS was taken and matched with the NCBI result, the following was the upshot
 from SMS:
 
 ORF Finder results
 Results for 932 residue sequence "GOS_2360010 Genomic DNA (Galapagos Islands: Wolf Island)" starting "GGAACAGATT"
 
 >ORF number 1 in reading frame 1 on the direct strand extends from base 544 to base 708.
 ATGGCAGTCGAAGATCCACCCATACCTACCGTACCCTTAGGTGTCCATGTTCTAGGTGGG
 TTGTATTTAGGAGCCGTTAATTTACATCTTGGATCTAGAGGCATTGTAAAAGGAAGTCCA
 GGCCAAAAACCTAAGGAAGCGACCCAGTATTCAGTTCCAGAGTGA
 
 >Translation of ORF number 1 in reading frame 1 on the direct strand.
 MAVEDPPIPTVPLGVHVLGGLYLGAVNLHLGSRGIVKGSPGQKPKEATQYSVPE*
 |