Difference between revisions of "TO85M 4670010"

From Metagenes
m (AutoExport)
 
(No difference)

Latest revision as of 12:40, 26 March 2015

Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : 85M_scaffold31_1
Annotathon code: TO85M_4670010
Sample :
  • GPS :-61,976275N -49,452633E
  •  : Ushuaia-Puerto Williams station 85 MESO -
  • (-MESOm, 0°C, 0.2-3 microns)
Authors
Team : BioCell2014
Username : Messro
Annotated on : 2015-01-26 13:15:33
  • Messina Tangui
  • Romette Andréa

Synopsis

  • Taxonomy: Alteromonadales (NCBI info)
    Rank: order - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 135622
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Gammaproteobacteria - Order: Alteromonadales
    Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;

Genomic Sequence

>85M_scaffold31_1 TO85M_4670010 Genomic DNA
CTGGTGACCACTAAGAAAAGTCTAATATAATTATAAGGATGAGTTCTTTCATCTGTCTAGTTATAACAGATTTATCATTTATTCTAAAATGGACTAGGTG
GTGGAGCTTATGGTTAAAAATTGGAACCAACTCCTATCTAAGTTTATTTTCCTGCATAAACATTTGGAGGGTAGCTTATAATGATGTAGAGAATTGGGTT
TGAAAATGAGTAAACAAATAACACGTCGTGATTTCTGTAATAGTATAGCTATCAGCACAGGAGTGAATACGAATCAATATCACCATAGATGAGTCATTCC
GAGAACATTTTCAACTTCTTCAGGGACTATAAATCGGTCACTATCCAAAGAGTGCTTTAAAACCGATGTACCTATACACTCATCCTGATTGTGAAAACCA
CAAACTTGCTCAACATCCGGAAAGACCGGAGCGTTTAAGGGCTGTGATCAACCGCCTGGTAGAAACAGGCATGACTCAGGACATGAAGGTCAAACTGGCA
GAGGAGCTTTCTGATGATGTTCTAATTCACGTGCACCCTTCGAAGTATGTAGAGACCATTAATCGGAGTGAACCGACGATCTCAACCGTTCGCCTTGATC
CCGATACCTACATGAGCCCCGGTAGCCTTAGAGCCGCAAAACTCGCCGCTGGCGCTTGTGTCGCGGCGGTCAGCGATATTCTTCAAGAAAAGACAGACCG
AGCTTTCTGTGCTATTAGACCACCTGGCCATCATGCAGAAGTTGCTGCCGCTATGGGTTTCTGCATCTTCAATAATATTGCCCTAGCAGCAGAGACAGCA
CTTGCCCATCCGGACATCAACCGAGTCGCCATCGTTGATTTCGATGTCCATCATTGCAACGGCACCGTTGATATTTTCAAAAACAGACCTGAAGTATTGG
TTTGTTCCAGCTTCCAGGAAAATTATT

Translation

[366 - 926/927]   direct strand
>TO85M_4670010 Translation [366-926   direct strand]
MYLYTHPDCENHKLAQHPERPERLRAVINRLVETGMTQDMKVKLAEELSDDVLIHVHPSKYVETINRSEPTISTVRLDPDTYMSPGSLRAAKLAAGACVA
AVSDILQEKTDRAFCAIRPPGHHAEVAAAMGFCIFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVDIFKNRPEVLVCSSFQENY

[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

Notre recherche d'ORF nous a donné 3 séquences A,B et C. Les ORF A et C étant complet en 5' et en 3 ' et ne mesurant pas 60 a.a de la première méthionine jusqu'au dernier a.a. Nous avions conclus qu'il ne devaient pas être codant, ou du moins qu'ils n'étaient pas d'aussi bon candidat que l'ORF B.

En effet ce dernier fait 593 nucléotide sur les 927 de notre séquence, soit 64% de la séquence. Il se trouve sur le brin direct et est complet en 5'. Il possède donc le codon d'initiation.



Prédiction de la fonction:


Le BLAST nous a donné 5 000 hit (maximum que nous avions demandé) regroupant tout l'arbre du vivant (Protéo, Archeae, Eucharyotae). La majorité de ces séquences étaient des Histone déacetylase avec plusieurs annotations différentes (données dans les analyse du BLAST). Nous avions donc prédit que notre ORF serait surement codant pour une protéine ayant la même fonction. Soit une Histone déacetylase, enzyme qui catalyse les octamères d'histones qui par la perte de leur groupement acétyle vont se désassembler pour permettre un relâchement de l'ADN lorsque les gènes présent dans la région qui se décondense puisse être transcrits puis traduits.

La recherche de domaine protéique a conforté cette prédiction. En effet nous avons trouver un domaine d'une centaine (sur les 187 a.a de notre ORF) d'a.a conservé entre les séquences choisi lors du rapport taxonomique.



Origine Taxonomique:


Le séquençage qui nous a été fournie provient d'un échantillon d'eau. La phylogénie de cette séquence nous a permis de dire que l'organisme d'où provient cette séquence est surement une Alteromonadales. Mais le BLAST donnée des séquences appartenant à l'ensemble de l'arbre du vivant.

Cela est facilement explicable compte tenue de la fonction de la protéine codé par notre ORF. L'histone déacetylase intervient dans la régulation de l'expression des gène (d'ou le choix GO du processus biologique) en agissant sur le degré de condensation de l'ADN (d'où le choix de DNA Binding dans la fonction moléculaire).

Tout les organismes vivant possède de l'ADN (je met volontairement les organismes ARN de coté) qui se condense, se décondense, se transcrit et se traduit. L'expression des gènes est une fonction biologique essentielle à la survie de tout organisme. C'est pourquoi le domaine que nous avions trouvé se retrouve chez de nombreux organisme. Cette protéine provient surement d'une bactérie ancestrale avant l'apparition des eucharyote. Même si les histone deacetylase de tout les organismes vivant ont divergé au niveau de leur séquence protéique, la pression de sélection fut si forte que le domaine catalytique a quand à lui été très conservé au cours de l'évolution pour permettre la survie de chacun des organismes  


ORF finding

PROTOCOLE:


SMS ; ORF Finder ; rentrer la séquence nucléotidique ; any codon ; reading frame 1, 2, 3 ; brin direct ; min a.a _ 60 ; SUBMIT


Refaire exactement le même protocole que celui précédemment mais en remplaçant le brin direct par le brin indirect.


ANALYSE DES RÉSULTATS:


        |    Taille     |  Taille  |  Brin   | position  |  position  |  ORF complet  |  ORF complet  | nombre de hits   |

        | (nucléotides) |   (aa)   |         | de début  |   de fin   |     en 5'     |     en 3'     |blast NR EV<1E-10 |

  ______|_______________|__________|_________|___________|____________|_______________|_______________|__________________|

        |               |          |         |           |            |               |               |                  |

  ORF A |      188      |    62    |  direct |     15    |     203    |      non      |      non      |         ?        |

  ______|_______________|__________|_________|___________|____________|_______________|_______________|__________________|

        |               |          |         |           |            |               |               |                  |

  ORF B |      593      |   198    |  direct |    333    |     926    |      non      |      non      |      2e-15       |

  ______|_______________|__________|_________|___________|____________|_______________|_______________|__________________|

        |               |          |         |           |            |               |               |                  |

  ORF C |      200      |    66    | reverse |    146    |     346    |      oui      |      non      |      1E-10       |

  ______|_______________|__________|_________|___________|____________|_______________|_______________|__________________|






   Schématisation de la position des ORF : ATTENTION ECHELLE NON RESPECTÉE


Légende:


           *: Codon Stop

           |: Début ou fin de séquence sans codon

           _: ORF


                    1                                                                                                        927

   Brin Direct      |---------------------------------------------------------------------------------------------------------|

   Brin Indirect    |---------------------------------------------------------------------------------------------------------|



                    1 15                              203                                                                    927

   Brin Direct      |-*_ ORF A _*----------------------------------------------------------------------|

   Brin Indirect    |---------------------------------------------------------------------------------------------------------|        

          


                    1                                               333                                                    926

   Brin Direct      |------------------------------------------------*_ ORF B _|-|

   Brin Indirect    |---------------------------------------------------------------------------------------------------------|




                    1                                                                                                        927

   Brin Direct      |---------------------------------------------------------------------------------------------------------|

   Brin Indirect    |------------------*_ ORF C _*------------------------------------------------------|

                                      146                             346



  


   Description




                      *_ ORF A _*

                                                                      *_ ORF B _|

   Brin Direct      |---------------------------------------------------------------------------------------------------------|

   Brin Indirect    |---------------------------------------------------------------------------------------------------------|

                                      *_ ORF C _*




    

     ORF A:

    

     L'ORF A possède un codons stop à la fin de sa séquence. Il est donc complet en 3'. Il commence au 15éme nucléotide, il y a donc un stop avant. De plus le 9ème a.a de l'ORF A est une méthionine qui rappelons le est l'a.a codé par le codons d'initiation AUG. Il semble donc qu'il soit aussi complet en 5'. Mais il ne ferait que 54 a.a ce qui est court pour une protéine. Le vrai codon d'initiation pourrait se trouver en amont de notre séquence et le stop qui précède l'ORF pourrait être une mutation ponctuelle non-sens. Mais ce serait peu probable.

L'ORF A étant complet et ne faisant que 54 a.a, il y a peu de chance qu'il soit codant.


     ORF B:

    

     L'ORF B est incomplet en 3' car il ne possède pas de codon stop et il s'arrête au 926 éme nucléotides sur 927. Le dernier nucléotide étant un T (soit un U au niveau de l'ARN) il y a une probabilité de 13/16 que le prochain codon code un a.a et 3/16 qu'il soit un codon stop.

En revenche il est complet en 5' car il y a un codon stop en amont. La première méthionine de la séquence protéique est le 12 ème a.a ce qui ferait un fragment de protéine (car incomplète en 3') de 187 a.a ce qui est suffisant pour dire que l'ORF B semble être codant.


     ORF C:


     L'ORF C possède un codon stop en amont et en aval, il est donc complet en 5' et en 3'. La première méthionine se trouve en 17 ème position sur la séquence protéique. Cela ferait donc une protéine de 50 a.a ce qui semble peu pour que cet ORF soit réellement codant.


    

     Choix de l'ORF


     La recherche d'ORF avait donné 4 résultats. L'un d'entre eux ne faisait pas 50 a.a, nous l'avons donc tout de suite éliminé car étant complet en 5' et en 3', nous l'avons jugé trop court pour être codant.

Les 3 ORF qui restent (A, B et C) font tous plus de 60 a.a. De plus ils ne se chevauchent pas, on ne peut donc pas les discriminer par rapport à cela. Les ORF A et C étant complet, nous avons regardé la position de la première méthionine qui correspond au premier a.a de toutes protéines avant transformation post-traductionnelle. Si cette dernière était bien le premier a.a de nos ORF, alors ceux-ci faisaient moins de 60 a.a ce qui nous permet de dire qu'il est peu probable qu'ils soient codant. L'ORF B qu'en à lui est complet en 5', il est le plus long car s'étend sur 187 a.a et est incomplet en 3'. Il est donc notre meilleur candidat pour effectuer un BLAST.






      





RÉSULTATS BRUTS:


A

>ORF number 1 in reading frame 3 on the direct strand extends from base 15 to base 203.
GAAAAGTCTAATATAATTATAAGGATGAGTTCTTTCATCTGTCTAGTTATAACAGATTTA
TCATTTATTCTAAAATGGACTAGGTGGTGGAGCTTATGGTTAAAAATTGGAACCAACTCC
TATCTAAGTTTATTTTCCTGCATAAACATTTGGAGGGTAGCTTATAATGATGTAGAGAAT
TGGGTTTGA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
EKSNIIIRMSSFICLVITDLSFILKWTRWWSLWLKIGTNSYLSLFSCINIWRVAYNDVEN
WV*


__________________________________________________________________________________________________________________________


B

>ORF number 2 in reading frame 3 on the direct strand extends from base 333 to base 926.
ATCGGTCACTATCCAAAGAGTGCTTTAAAACCGATGTACCTATACACTCATCCTGATTGT
GAAAACCACAAACTTGCTCAACATCCGGAAAGACCGGAGCGTTTAAGGGCTGTGATCAAC
CGCCTGGTAGAAACAGGCATGACTCAGGACATGAAGGTCAAACTGGCAGAGGAGCTTTCT
GATGATGTTCTAATTCACGTGCACCCTTCGAAGTATGTAGAGACCATTAATCGGAGTGAA
CCGACGATCTCAACCGTTCGCCTTGATCCCGATACCTACATGAGCCCCGGTAGCCTTAGA
GCCGCAAAACTCGCCGCTGGCGCTTGTGTCGCGGCGGTCAGCGATATTCTTCAAGAAAAG
ACAGACCGAGCTTTCTGTGCTATTAGACCACCTGGCCATCATGCAGAAGTTGCTGCCGCT
ATGGGTTTCTGCATCTTCAATAATATTGCCCTAGCAGCAGAGACAGCACTTGCCCATCCG
GACATCAACCGAGTCGCCATCGTTGATTTCGATGTCCATCATTGCAACGGCACCGTTGAT
ATTTTCAAAAACAGACCTGAAGTATTGGTTTGTTCCAGCTTCCAGGAAAATTAT

>Translation of ORF number 2 in reading frame 3 on the direct strand.
IGHYPKSALKPMYLYTHPDCENHKLAQHPERPERLRAVINRLVETGMTQDMKVKLAEELS
DDVLIHVHPSKYVETINRSEPTISTVRLDPDTYMSPGSLRAAKLAAGACVAAVSDILQEK
TDRAFCAIRPPGHHAEVAAAMGFCIFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVD
IFKNRPEVLVCSSFQENY

__________________________________________________________________________________________________________________________


C

>ORF number 1 in reading frame 2 on the reverse strand extends from base 146 to base 346.
GGCAATATTATTGAAGATGCAGAAACCCATAGCGGCAGCAACTTCTGCATGATGGCCAGG
TGGTCTAATAGCACAGAAAGCTCGGTCTGTCTTTTCTTGAAGAATATCGCTGACCGCCGC
GACACAAGCGCCAGCGGCGAGTTTTGCGGCTCTAAGGCTACCGGGGCTCATGTAGGTATC
GGGATCAAGGCGAACGGTTGA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
GNIIEDAETHSGSNFCMMARWSNSTESSVCLFLKNIADRRDTSASGEFCGSKATGAHVGI
GIKANG*

Multiple Alignement

PROTOCOLE:

Muscle, Copie/colle les séquences défini ci-dessous



ANALYSE DES RÉSULTATS:


Format FASTA des séquences présentent dans le Bloc Note.

                                                



     Hormis les séquences  Bac_Pro_Alp_13, Bac_Pro_Bet_21, Bac_Pro_Bet_9, Bac_Pro_Bet_10, Bac_Pro_Bet_16, Bac_Pro_Bet_8. Les autres homologues ainsi que notre ORF ont une méthionine entre la position 35 et 38. Notre ORF étant complet en 5' et la position de sa première méthionine étant proche de la première du plus grand nombre de ses homologues, nous pouvons supposer qu'elle est bien le premier a.a traduit codé par le codon start AUG (11 a.a de notre ORF, 38éme de notre alignement).


  

Notre ORF est incomplet en 3' nous ne pouvons donc pas déterminer sa taille mais nous pouvons la supposer en comparant la taille de ses homologue. Ses homologues font en moyenne 300 a.a (oscillations entre 309 et 280) soit 120 a.a de plus La présence d'une insertion de 6 a.a des séquences Bac_Pro_Bet_21, Bac_Pro_Gam_21 en position 357 (sur l'alignement) décale la fin des séquences mais la majorité finisse en position 364. Mais la totalité des ORF ont un stop compris entre les positions 363 et 404 (la présence de gap augmente la taille de l'alignement mais non celle des séquences qui est plus faible).

Si notre ORF est suffisament proche de ses homologues, il devrait avoir une taille similaire comprise entre 280 et 310 a.a (en partant de sa première méthionine en position 38 et en enlevant les différents gap des différentes séquences).


     On peut voir sur chacun des alignements multiples (Muscle & le premier GBlock) qu'il y a une région très conservé de 100 a.a (coupé par 2 In Del, Bac_Pro_Alp_13 a une insertion de 2 a.a aux positions 168 et 169 et Bac_Pro_Gam_19 apporte un a.a en position 163).  L'alignement n'étant possible que si les séquences sont homologues, les différentes séquences sélectionnées sont donc bien des homologues de notre ORF du faite de la conservation de ce domaine de 100 a.a. Mais aussi par les substitutions conservatrices. Il y a des divergences de séquences mais les différents a.a pour une position donnée dans les différentes séquences ont une structure ou une charge similaire dans ce cas là (ce n'est pas une généralité).

Il y a également un autre domaine conservé de 25 a.a aux positions 42 à 69 malgrès une délétion en position 54 apporté par notre ORF ce qui donne 2 a.a non conservé au sein de cette région qui est sans doute un résidu du même domaine.


Nous avons réalisé un troisème alignement beaucoups moins stringent en autorisant les paramètres suivant :

                                        

                                      Allow smaller final blocks,

                                      Allow gap positions within the final blocks,

                                      Allow less strict flanking positions.


L'alignement obtenue donne de nombreuses régions conservées non pas à l'acide aminé prêt mais en prenant compte du type d'acide aminé. Par exemple la glycine et l'alanine étant proche au niveau structural et de la charge, ces 2 a.a à la même position sera considéré comme conservé car ils joueront le même rôle.

Soit il y a plusieurs régions conservées ayant chacune une fonction différente ce qui est peu probable compte tenu de la taille des séquences.

Ou bien il ne s'agit que d'un seul domaine plus ou moins bien conservé compte tenue de la divergences lors de l'évolution de chacun des organismes où se trouve cette protéine. De plus la distance séparant les régions conservées étant faible (20 a.a pour la plus grande) confirme le fait qu'il ne s'agit que d'un seul domaine qui a subit de nombreuse mutation aux sain de chaque organisme durant leur évolution respective.









CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


B.P.Bet_21      --------------MMQIPQLHKRMPDTLPKDWRLLPTGYFTHQLVGLPNPLDDAPESPD
B.P.Bet_9       ----------------MKNLIRRLRIILRRILGVRARTVWISHPIFLRHEPGGTHPESPQ
B.P.Bet_13      -------------------------------MGKNARTVWISHPVFAQHQPGTGHPDSPE
B.P.Bet_10      --------------MSLTRLILKFYALLRLFLCKNARTAWISHPACAGHEPGANHPDSPD
B.P.Bet_16      --------------MFLTRLILKFYALLRLFLGKNARTAWISHPACAGHEPGANHPDSPE
B.P.Bet_8       --------------MPPIRLILKFYSLLRLFSGKNARTVWISHPACAGHEPGANHPDSPE
B.P.Alp_1       -----------------------------------MTTALFTHPDCLNHLTPEGHPEQVA
B.P.Alp_5       -----------------------------------MATALFTHDDSLRHLTPPGHPERVE
B.P.Alp_2       -----------------------------------MKTALLTHADCLNHATPEGHPERVA
B.P.Alp_3       ---------------------------------MTSKTALLTHADCLAHVTPDGHPEQVA
B.P.Gam_20      -----------------------------------MRTLYYSHPDFLLHATGAGHPERPA
B.P.Gam_21      -----------------------------------MKTLYYSHADFLLHDTGIDHPESAD
B.P.Alp_8       -----------------------------------MTTILFENPIFLEHQVPEGHPERPD
B.P.Alp_10      -----------------------------------MTTLFLTHSACLEHHTPEGHPERAE
B.P.Alp_4       -----------------------------------MSTLYLHHPSFLEHLTPLGHPERPD
B.P.Alp_12      -----------------------------------MTTLYVSHPASFDHEVPEGHPERPA
B.P.Alp_9       ---------------------------------MHMSTLYIAHPASLEHQTPIGHPERPD
B.P.Alp_13      MSGPTHAGPTRRGLVAGSAAFGLTAGSGRAAEPATGRTLLITHPAFAGHETGLGNPERPA
B.P.Alp_7       -----------------------------------MSVSLFTHPDMIAHAPGAGHPERPE
B.P.Alp_11      -----------------------------------MDLLLLTHRACLGHDMGFEAMERPA
B.P.Gam_17      ------------------------------------MIRLYTHPACLQHDPGPGHPESPA
B.P.Gam_16      -------------------------------------MLAYTHPACLEHDTGPDHPECPQ
B.P.Gam_18      -------------------------------------MLVFTHPACLGHDAGPEHPESPA
B.P.Gam_8       -----------------------------------MRTAIISHPHCRKHKMIDDHPECPE
B.P.Gam_6       -----------------------------------MTTAFFSHDDCLKHNMGPEHPECPE
T.o.ORF_nu      --------------------------IGHYPKSALKPMYLYTHPDCENHKLAQ-HPERPE
B.P.Gam_14      -----------------------------------MQIGFISHKDCLLHDMGDFHPEQPD
B.P.Gam_15      ------------------------------------MLAFISHRDCLLHDMGASHPECPE
B.P.Gam_4       -----------------------------------MITSFITHEDCALHDMGPWHPENPM
B.P.Gam_3       -----------------------------------MITAYITHPHCMRHLMGPTHPESPK
B.P.Gam_1       -----------------------------------MITAYLTHPDCALHHMGPEHPESPQ
B.P.Gam_2       -----------------------------------MITAYLTHPDCSLHHMGPEHPESPQ
B.P.Gam_9       -----------------------------------MTTTFITHGDYLLHSMGEQHPECPE
B.P.Gam_5       -----------------------------------MTTALISHVDCELHQMSAGHPESPE
B.P.Gam_7       -----------------------------------MPITFISSPKCLLHDMDPEHPEQPA
B.P.Gam_19      -----------------------------------MTIAIITHSDCLKHEMGIGHPERPQ
B.P.Gam_11      -----------------------------------MAITIFSHAICRQHVAGDDHPECPA
B.P.Gam_12      ----------------------------------MTHTAYISHPDCLLHDSGPHHPERAD
B.P.Bet_15      -----------------------------------MATAYYSHPACRTHDMGDGHPECPQ
B.P.Bet_11      -----------------------------------MPTAFYTHPDCLLHEMGEWHPESPA
B.P.Bet_17      -----------------------------------MATAFYTHPDCMLHEMGEWHPECPA
B.P.Bet_18      -----------------------------------MATAFYTHPDCMLHEMGEWHPECPA
B.P.Gam_13      -----------------------------------MKLFFISHPNCSRHRGPGYHPESPE
B.P.Bet_3       ----------------------------MKNGLQSGLTAYITHSDCMLHNVGDMHPECPQ
B.P.Bet_2       -----------------------------------MHTAYLTHADCLMHDMGSWHPESPA
B.P.Bet_14      -------------------------------MRPASHTAFISHPDCLLHEMDFYHPESPA
B.P.Bet_7       -----------------------------------MTTAFVTHPIYLKHDMKHGHPECPE
B.P.Bet_1       -----------------------------------MHTAYITHPDCLKHDMGADHPECPA
B.P.Bet_5       ----------------------------------------MSHSSCSMHDMGKGHPECPE
B.P.Bet_6       ----------------------------------MTSTAFITHRDCQLHDMGSYHPEAPE
B.P.Bet_4       ----------------------------------MTTTAFITHRDCWLHDMGSMHPECPD
                                                                        :   

B.P.Bet_21      RIEAIEARLMLAGLEGRVRRVECGPAPREA--VLLAHDSQYVDDLEHASLGDPEA-----
B.P.Bet_9       RITAILEELKRRKIWRRLQAAEAEEVSDAQ--LALVHPRRYLRFLESVQ---PQE---GK
B.P.Bet_13      RTAVIEAELKRQDIWRHLQTAEAEEISDTR--LALVHPRKYLRSLEACQ---PQP---DK
B.P.Bet_10      RILCIEQALRRAGIWQHLQTIEAEEISDTH--LALVHSSKYLNRLESCL---PQK---GK
B.P.Bet_16      RISSIEQALRRSGVWQHLQTVEAEEISDMH--LALAHTSKYLNRLESCR---PEN---DK
B.P.Bet_8       RIGSIEQALRRSGVWRRLQTLDAEEISDAR--LALAHTSKYLNRLESRL---PED---GK
B.P.Alp_1       RLSRVLSALEGK----ALDRHEAPLAEEAD--LLLCHPQGYIDRVRGAE---PAE---G-
B.P.Alp_5       RAQAMAAALAAPRF-DGLVRRASPLAAEAE--VLRAHPARHLEAIRANI---PLT---G-
B.P.Alp_2       RLEHILHALEDL----DLQRVTAPLAADDD--LLRVHPQSHISDILDQR---PSD---G-
B.P.Alp_3       RLEHVLYALQPL----EVARITAPLAADDD--ILRIHPASYLAELRRAS---PSE---G-
B.P.Gam_20      RLKAIGQALEQAEF-AKLIRVLAPLGTEQQ--ATLIHPAAHIQHLRDAL---PNQ---R-
B.P.Gam_21      RLRSIAKALAAPEF-SGLIRASPPPGTEQQ--IRLIHTQAHIDAILNAV---PLH---G-
B.P.Alp_8       RLKALNLALEHERF-SSLSRLEAPQGNEDL--VLLAHPEEHLRTVMSAM---PEE---G-
B.P.Alp_10      RLIAVNKTLTAERF-ATLARGEAPIGSLEH--IALCHTDHHIVEMRHMS---PST---G-
B.P.Alp_4       RLRAIDRILENERF-HTLERDRAAVGRFVD--AARVHPPAYINQLHRMR---PDE---G-
B.P.Alp_12      RMRAVERALEDERF-AGLVRATAPRGEIEA--VTLAHPRAYVDALVAAV---PEH---G-
B.P.Alp_9       RIRAIERALEKERF-TSLVRELAPMAEMES--LTLAHPQDYIVRLRDIS---PRE---G-
B.P.Alp_13      RMRAVDQALSAQDF-AALRREEAPMRDDAQTAILRVHSPVHLDRIRAAA---AGTRA-G-
B.P.Alp_7       RLAAVLAALDDSDL--SLDRCAATEAAVTD--LERIHPAAYVSRMIEAS---PAQ---G-
B.P.Alp_11      RLRVVLEALEAQCF-SMLAREEAPRATREQ--LMRVHPASYVDTILATR---PEGD--G-
B.P.Gam_17      RLRAVLDALDHDSF-AALDRVEAPRASRLQ--LLRTHTLEHVARILEAR---PDE---N-
B.P.Gam_16      RLRAVLDALGRA--WPALQWREAPMALRGD--LLRVHSGELVDQVLA-----PVAE--G-
B.P.Gam_18      RLEAVVQALR--GAFPDLDWREAPLAKLGD--LCRVHEREQVDAVLETA----FD---G-
B.P.Gam_8       RLDAINDRLLASGLDIAIEQKQAPKAQREH--YLLAHDESLVSFVESKI---PTQ---G-
B.P.Gam_6       RISAILSYLAETGLDQSLDWVRPEEITRDQ--LLTVHPEQYLHQLDLMQ---PTR---G-
T.o.ORF_nu      RLRAVINRLVETGMTQDMKVKLAEELSDDV--LIHVHPSKYVETINRSE---PTI---S-
B.P.Gam_14      RLRSIEQAVKASDLNKVITYYEAPLATREQ--LLRVHDEEYVDFIFKIA---PSQ---G-
B.P.Gam_15      RLKVIADAVKHSQLEEKIHYYNAPLAKKED--LLRVHDKQYIDYLFNIN---PGE---K-
B.P.Gam_4       RLNAIIEQLKLSGLMNQLMQYKARPVTDEQ--LFRAHPKAHVRSLQLSL---PEE---G-
B.P.Gam_3       RLEAIRARLALTGILTHTMQSDAPPVTRET--LALAHSPQYLDALEAHA---PTQ---G-
B.P.Gam_1       RLEAIRARLSLAGLLQQTMQADAKEACDEA--LARVHPTRHLNALEKCL---PKE---G-
B.P.Gam_2       RLEAIRARLSLAGLLQQTMQADAKEACEEA--LARVHPLRHLRSLDKCL---PTE---G-
B.P.Gam_9       RLGAITSYLASTELGNQVTWLSAESATNEQ--LERVHPADYIRRLDSMQ---PQR---G-
B.P.Gam_5       RLRAIHRQLELSGMLERLDLLVASPASRAQ--LELAHPDHYIDAICDLH---PER---G-
B.P.Gam_7       RLHSINDQIISSGVEFAINFVDTPPVQLAQ--LYRAHDNQFVDKIIKEA---PTE---G-
B.P.Gam_19      RIRAIEDQLITSGIGDFMHYYDAPLATPEQ--LELAHSRKHIDYIFGKSP--PDD---SM
B.P.Gam_11      RLDAINDQLIRSGLDYVLQQKDASPASKTD--LCRAHSTRYVSELYAKA---PAD---G-
B.P.Gam_12      RLHAVRNALLDEGLMEGLHLLDAPPATDAQ--LQRVHTPTHVARIRANA---PAL---GH
B.P.Bet_15      RLDAIADHLIATGLDIALEQREAPPVDEGT--LALAHESLYVANLRGFM---EQVEATGQ
B.P.Bet_11      RLSAIQDQLIASRIDDLIVHETAPFASETA--LARVHTQAHIDYIRSRI---PKE---G-
B.P.Bet_17      RLSAIQDQLIASRIDDLIVHETAPFASEVA--LGRVHTQAHIDYIRGMT---PVD---G-
B.P.Bet_18      RLSAIQDQLIASRIDDLIVHETAPFASEVA--LGRVHTQAHIDYIRSMT---PVD---G-
B.P.Gam_13      RLSAIDDQLIAAGVEPWLRHREAPLASREQ--LLRVHSPEYLDALAEGA---PGP---GE
B.P.Bet_3       RLVAIRDQLMASQIFDSLHEVEAPEVTDEQ--LARVHTPRYLEYLEMSQ---PLT---G-
B.P.Bet_2       RLRAIDDRLHAAHLFDHLAHHEAPRVQRAQ--LLRVHDAAYVDFIEASS---PEH---G-
B.P.Bet_14      RLKAIEDELSASGLMDKLRRYQAPLATVGQ--LERVHTREHIARLHAAA---SRAASGG-
B.P.Bet_7       RLLAIQEQLVATDTLPRLQQYEAPRATDDQ--LMRAHTESYVHEIKSAA---PQQ---G-
B.P.Bet_1       RLRAIEDQLIASGLLTFLQHHDAPLATFEQ--LARVHKPQYIEAVQAAA---PQH---G-
B.P.Bet_5       RLAAIQDRLIAAGLWDYLLHVDAPPALREQ--IERVHCADYLDDLARRS---PAV---G-
B.P.Bet_6       RLNAINDHMIAQGLDSYFVYHDAPLVTFQQ--LHRVHTAAHLERLKRAS---PEL---G-
B.P.Bet_4       RLSAINDRLIAAGLDMYISFYDAPVATREQ--IIRAHPENYLDELLDSV---PEH---G-
                *   :   :                           *    :  :               

B.P.Bet_21      LKRFTEPDTRVGEDTFSCAMASAGAVARAVDAIYGRS--VKN-AFCAVRPPGHHASRSRA
B.P.Bet_9       IYRLD-DDTVISNRSLEAARFAAGAVIKAVNMVMDKK--ACH-AFCAVRPPGHHAQSSQA
B.P.Bet_13      IYRID-NDTVMSHGSLKAARYAAGAVVQAVDMVMNKK--AWH-AFCAIRPPGHHAHSDKA
B.P.Bet_10      IFRLD-NDTAISTGSLSAAHFAAGSAVQAVDMVMNRK--AWH-AFCAARPPGHHAGSGKA
B.P.Bet_16      IFRLD-DDTVISKNSLSAARFSVGSVVQAIDMVMNRQ--AWH-AFCAARPPGHHAGSGNA
B.P.Bet_8       IYRLD-DDTVISKNSLSAARFSAGSVVQAVDMVMKRK--AWH-AFCAARPPGHHAKSGKA
B.P.Alp_1       QVQMD-PDTWMSPGSYRAALRSAGGAIAAVDAVLDGR--ADN-AFVATRPPGHHAETESP
B.P.Alp_5       FNPVD-GDTFMSEGSFDAALRAVGGCGAAVDAVLAGE--VTN-AFVACRPPGHHAERSRS
B.P.Alp_2       FKQID-GDTFMSPGSVDAAYRAAGAVVRAVDLVLGGE--APN-AFCAIRPPGHHAETEAA
B.P.Alp_3       HRALD-ADTWMSPGSLDAAFRGAGAMVRAVDMVLGGE--APN-AFAAVRPPGHHAETDTP
B.P.Gam_20      RYPLN-PDTVLSPGSLTAAFRAVGAVCDAVDRIMADT--ADN-AFCAVRPPGHHAEPMQA
B.P.Gam_21      LRYLD-SDTVLSPGSGKAALRAVGTVCDAVDRILADE--ADN-AFCAVRPPGHHAESERA
B.P.Alp_8       INAIE-ADTYASPASLQAALTGIGGAVAAVDAVFSGK--ADN-AFVAARPPGHHAEKNQA
B.P.Alp_10      IVYVD-GDTSMSPGTFEAALRGVGGAVSAVDAVMKGS--AAN-AFVATRPPGHHAEVTKP
B.P.Alp_4       LVHVD-HDTTMSPGTWDAAMRGVGASCQAVDEVMSGR--VVN-AFCALRPPGHHAERQRA
B.P.Alp_12      MVGID-SDTILSAGSLEATLRAVGGGMHAVDAVVGGE--CRN-AFVAMRPPGHHAERTRA
B.P.Alp_9       LVRID-EDTVMSPGTYEAALRGAGGAVLAVDEVMSGR--ATN-AFVAMRPPGHHAERTRA
B.P.Alp_13      PVHLD-PDTVVSAGTWEAVIRAVGAGLRAVDAVMDRGSGIAN-AFCQIRPPGHHAGRDTA
B.P.Alp_7       LAQLD-ADTILSSGSVRAARLAAGAVIDAVRAVAEGR--TAR-AFAAVRPPGHHAEPDQA
B.P.Alp_11      HVVID-GDTAMGSGSAEAALHAAGAGIAAVDAVMRGE--FAR-AFCAVRPPGHHAEPARA
B.P.Gam_17      GLRLD-EDTVMSPGSAEAALRAAGAVVAAVDAVMTGA--CER-AFCAVRPPGHHATADTA
B.P.Gam_16      LHRLD-PDTVVGPGSGRAALYAAGAGIAAVDGVMDGR--ERT-AFCAVRPPGHHATADAA
B.P.Gam_18      YRQLD-VDTRMVPASRAAALRAAGAGIAAVDALMQDQ--TRT-AFCAVRPPGHHATAQVS
B.P.Gam_8       LVDLD-GDTWLCPDSLKAIERAVGAGILAVDEILEGN--LDA-AFCSVRPPGHHANRTTS
B.P.Gam_6       RVFTD-PDTAMMPDTLRAARLSAGANVQAVDMIMSGQ--VTN-AFVCARPPGHHAERAKS
T.o.ORF_nu      TVRLD-PDTYMSPGSLRAAKLAAGACVAAVSDILQEK--TDR-AFCAIRPPGHHAEVAAA
B.P.Gam_14      LVPLD-PDVWMNPHSLQAALRAAGAVVYGVELILKNE--IDA-AFCNVRPPGHHAERNKA
B.P.Gam_15      IIPLD-PDTWMNQHTLQAALRAAGSVILAVDLVMNKT--CEA-AFCNVRPPGHHAEKSQA
B.P.Gam_4       FTSIE-DETLLAPRSLEAASYAAGAVVRGVDQIFKNQ--ADN-VFCAVRPPGHHAERVES
B.P.Gam_3       LHELD-GDTHMGQDTLTAARLAAGAVVRGVDQVFRHQ--ADN-VFCAVRPPGHHAERGTA
B.P.Gam_1       IVTLD-SDTMMNPDSLKAARVAAGAVIRGVDQVFKRQ--ADN-VFCAVRPPGHHAEAADA
B.P.Gam_2       IVTLD-SDTMMNPDSLKAARVAAGAVIRGVDQVFKRQ--ADN-VFCAVRPPGHHAEASDA
B.P.Gam_9       LVYAD-PDTALNPHTMHAARLAAGAVTMATELVLSGK--ISN-AFCAVRPPGHHAEHNTA
B.P.Gam_5       LSYAD-PDTALNPHSLRAADLAAGAVVQGVDRVLDGL--ADN-VFCAVRPPGHHAEHDAA
B.P.Gam_7       HKWLD-DDTLMMPQSLDAAMHAAGAGIHAVDLIMNGD--SNK-AFCAVRPPGHHAEYAKS
B.P.Gam_19      MAHID-PDTFMNEFTLQAALRSAGSAISAVDKVLGDK--TEKRVFCNVRPAGHHAERDAA
B.P.Gam_11      HIWLD-PDTQMMSKTLQAALYAAGSGINAVDDVMQAS--DKQ-AFCAIRPPGHHATHDQA
B.P.Gam_12      HALLD-PDTAMGEHSLQAALRAAGAGIEGVRAVMEED--VDN-AFCAIRPPGHHAERERA
B.P.Bet_15      RRALD-PDTVAGPGTWAAALHAAGAAVAATDAVLDGE--IEN-AFCAVRPPGHHATRRQA
B.P.Bet_11      YVEID-PDTSLNRYTWRAALRAAGAAVEATDAVLEGR--YDN-AFCSVRPPGHHAEPARA
B.P.Bet_17      YVEID-PDTLMNRDTWRAALRAAGAAIAATDAVIEGR--YAN-AFCSVRPPGHHAEPARA
B.P.Bet_18      HVEID-PDTLMNRDTWRAALRAAGAAIAATDAVIEGR--YAN-AFCGVRPPGHHAEPARA
B.P.Gam_13      WTTLDGGDTYFGEHSLDAAHHAAGAVVLAVDLVLANS--THT-AFCSVRPPGHHAGADYG
B.P.Bet_3       TFRVD-PDTALMPNTLKAARRAAGGVVKAVDMVCQGQ--APN-AFCAIRPPGHHAESSKA
B.P.Bet_2       VRALD-ADTSMNPHTLSAALRAAGGAAMAVDLVMGDD--TAN-AFVACRPPGHHATRRRA
B.P.Bet_14      FVYLD-PDTAMNRHSLGAAYRAAGAVVLAADLVIEGA--AEN-AFCSIRPPGHHAERGYP
B.P.Bet_7       LVCLD-NDTAMNPFTLEAAYYAAGAVVLATDLVIDKQ--VKN-AFCAVRPPGHHATRNQA
B.P.Bet_1       LVYLD-PDTAMNPFTLNAALRAAGAVVLATDLVLERK--VEN-AFCAIRPPGHHAESGRA
B.P.Bet_5       TVQLD-PDTAINAYTLRAAYHAAGAGIKAVDLIMSGR--AQN-AFCAIRPPGHHAERARS
B.P.Bet_6       IVHLD-PDTAMNRHTWQAALRAAGAGIKAVDLVMAGE--VEN-AFCAVRPPGHHAERAAA
B.P.Bet_4       IRHLD-PDTAMSPGTMKAALRSAGAGVMATDLVMAGE--IEN-AFCAVRPPGHHAERAKA
                       :.     :  .   . *    .   :          .*   **.****     

B.P.Bet_21      SGFCYLNNAAIGALWAQKRWRAERVMVLDFDAHHGDGTEEILADRPGVRFLSLFQWPLFP
B.P.Bet_9       GGFCLLNNVAVGAMHAIAEYRLQRIAIIDFDVHYGDGTAEIFKDDPRILFFNAFETDLFP
B.P.Bet_13      GGFCLLNNVAAGVMHAIAEYRLQRIAVIDFDVHYGDGTAEIFKDDPRVLFMNLFETDLFP
B.P.Bet_10      GGFCLLNNVAAGVMNAIAEYRLKRIAVIDFDVHYGDGTAEIFKDDPRILFFNLFETDLFP
B.P.Bet_16      GGFCLLNNAAVGTMYALAEYRLNRIAVIDFDVHYGDGTAEILKNDSRILFFNLFETDLFP
B.P.Bet_8       GGFCLLNNVAAGAMYALAEYRLNRIAVIDFDVHYGDGTAEILKNNPNILFFNLFETDLFP
B.P.Alp_1       MGFCLFGNVALAAKHALERRGLQRVAIFDPDVHHGNGTQDLVQSDPRILFISTHQQPLYP
B.P.Alp_5       MGFCLFGNIAIAAKRALDLHGLHRVAIVDFDVHHGNGTQDILWDDPRVLFISSHQWPLYP
B.P.Alp_2       MGFCLFGNAALAAKHALDHHGLNRVAVVDFDVHHGNGTQDLLWDEKRALVITSQQMPLWP
B.P.Alp_3       MGFCLFGNAALGVKHALDHHGLNRVAVVDFDVHHGNGTQDLLWDEPRALLISSQQIPLFP
B.P.Gam_20      MGFCLFNNIAIAAEHARQHYHLQRVAIVDFDVHHGNGTQAAFYHQPQVFYASSHEMPHYP
B.P.Gam_21      MGFCLFNNIAIAAEYARTHHQLKRIAIVDFDVHHGNGTQTAFYEQPAVLYASSHEVPHYP
B.P.Alp_8       MGFCFFNTIAIAARHAQRRHGAERVAIVDWDVHHGNGTQDIFWDDPSVLFCSTHQMPLYP
B.P.Alp_10      MGFCFFGNAAIAARYAQRKYGIERAAVVDFDVHHGNGTQDIFWGDRTVMYCSTHQMPLFP
B.P.Alp_4       MGFCYFNNAAVAARHAQEVHGADRVAIMDFDVHHGNGTQEIFWDDPTVMYTSTHQMPLYP
B.P.Alp_12      MGFCLFNHAAIAARHARQKHGAERVALVDWDVHHGNGSQDIFWNDASVLYCSTHQMPLYP
B.P.Alp_9       MGFCFFNNAAIAARHAQKRYGAERVAIFDWDVHHGNGTQDIFWSDASVLYCSTHEAPLYP
B.P.Alp_13      MGFCLFNAVAIAARHARVRHGAERVAVVDFDVHHGNGTQEAFRSDRSLFYGSTHRMPWFP
B.P.Alp_7       MGFCLFSNVAVAARVAQTL-GMARVAVVDFDVHHGNGTQAAFEADDSLFLASIHQMPLYP
B.P.Alp_11      MGFCLFSNIAVAARHAQEVHGAGRVAILDFDVHHGNGTQAVFERDPSVFFASSHQMPLYP
B.P.Gam_17      MGFCLFNSVAVAAAHAIAEHRLKRVAIVDFDVHHGNGTQDIFAREPKVLYVSSHQAPLYP
B.P.Gam_16      MGFCLFNNIAVAAAHARDRHGLERVAIVDFDVHHGNGTQAIFQRDPAVAYFSTHQSGLYP
B.P.Gam_18      MGFCLFNNIAVAAAHARDRHGLERITIVDFDVHHGNGTQAIFERDPAVQYLSTHQSGLYP
B.P.Gam_8       SGFCVFNNLAIAVKYAQSK-GVKRIAIVDFDVHHGNGTQDIFIDDKNVLFCSLFQHPFYP
B.P.Gam_6       MGFCFYNNIALAAMRALTFHQLERVAIIDFDVHQGNGTVDIVGGDERILMCSSFQHPFYP
T.o.ORF_nu      MGFCIFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVDIFKNRPEVLVCSSFQENY--
B.P.Gam_14      MGFCIFNNVALGVAHALEQLDLERVAIVDFDVHHGNGTEDIFKRDERVLYCSTFQHPFYP
B.P.Gam_15      MGFCFFNNIAVGAAYALARYDLKRIAIIDFDVHHGNGTENIFQNNEHILLCSSFQYPFYP
B.P.Gam_4       MGFCFYNNVAVGALHALEHHKLDRVAIFDFDVHHGNGTVDVFRNDPRVLVCSSFQHPFYP
B.P.Gam_3       MGFCFYNNIAVGLAHARQRHGVERVAVLDFDVHQGNGTVDIFKNDPGVLICSSFQSPFYP
B.P.Gam_1       MGFCFYNNIAVGAAHAKAKYGAKRIAILDFDVHQCNGTIDIFKNDPEVLVCTSFQYPFYP
B.P.Gam_2       MGFCFYNNIAVGAAHARAKYGAKRIAILDFDVHQCNGTIDIFKNDPEVLICTSFQYPFYP
B.P.Gam_9       MGFCFFNNIAVGVEQALTHYEIERVAILDFDVHHCNGTVDAFKDRPEVLVCSTFQHPFYP
B.P.Gam_5       MGFCLFNNVATGAGWALQRPGVKRVAVLDFDVHHGNGTVDIFKDRPDVLVCSSFQFPFYP
B.P.Gam_7       GGFCIFNNIAVAALHALDHYGMKKVAIIDFDVHHGNGTEDIFKDDPRVLFCSSFQHPFYP
B.P.Gam_19      MGFCFFNNAAIAARHAVRDYGLERVAIVDFDVHHGNGTEDIVGDDPQILFCSTYQHPLYP
B.P.Gam_11      MGFCFFNNIAIAAEYALNQYSLKRVAIVDFDVHHGNGTEDIFKNEPRVLFCSSFEYPLYP
B.P.Gam_12      MGFCLFNNIAVAAAHALEHYALSRVAIADFDVHHGNGTEDIFRDDPRVLYCSSFQHPFYP
B.P.Bet_15      MGFCFFNNVAVAARHALDRRGLERVAIIDFDVHHGNGTEDIIANDDRVLMCSFFQHPLYP
B.P.Bet_11      MGFCFFNNVAVAARHALEIHGLERVAIIDFDVHHGNGTEAAFANDERVLMCSFFQHPLYP
B.P.Bet_17      MGFCFFNNVAIAARHALDVHGIERVAIIDFDVHHGNGTEAAFANDERVLMCSFFQHPLYP
B.P.Bet_18      MGFCFFNNVAIAARHALDVYGIERVAIIDFDVHHGNGTEAAFANDERVLMCSFFQHPLYP
B.P.Gam_13      MGFCVFNNVAVGAAHAMEGHGLSRVAIADFDVHHGNGTEDIFRDEPRVLFCSSFQHPFYP
B.P.Bet_3       MGFCYFNNVAVGIRHALAVHGLERAAVIDFDVHHGNGTEEIFRDDPQVMMASIFQHPFFP
B.P.Bet_2       MGFCIFNNVAVAAAQALDVHGLERVAIVDFDVHHGNGTEDIFRDDPRVMLCSTFQHPFYP
B.P.Bet_14      MGFCLFNNIAVAVAHALETHALKRVAVVDFDVHHGNGTEDIFQHDPRVMMVSTFQHPFYP
B.P.Bet_7       MGFCFFNNVAIGAAHALAHHGLQRVAIVDFDVHHGNGTEDIFQDEPRVLFCSTFQHPFYP
B.P.Bet_1       MGFCLFNNVAVGVAHAIEHYGLKRVAIADFDVHHGNGTEEIFHDDPRVMLCSTFQSPFYP
B.P.Bet_5       MGFCFFNNVAVAAQHAMDAYGLERVAIIDFDVHHGNGTEDIWAGDPRVLMVGIFQHPFYP
B.P.Bet_6       MGFCFFNNIAVAAAHALGAHHLSRVAIVDFDVHHGNGTEDCFKGDPRVLMVGTFQHPFYP
B.P.Bet_4       MGFCFMNNVAIAARHALDAHGLERVAIVDFDVHHGNGTEDIFRDDPRVMMAGIFQHPFYP
                 ***  .  * .   *       .  : * *.*  :*:                      

B.P.Bet_21      HRRMEPTP---SNAVLSPLPAGAGGEDIRNVVENVWLPEIDKFQPDLMILSAGFDAHCEE
B.P.Bet_9       FPDLDNGITGSANMLHTPFAAGTDSPTFRDTIRKQWLPRLAAFKPELVLLCAGFDAHRDD
B.P.Bet_13      FPETNHSANG-ANMLHLPFASNTGSRVFRTTVREQWLHKLTAFKPELVLLSAGFDGHKQD
B.P.Bet_10      FPENNDMPDG-GNMVHLPLPPGTGSRTFREAVRRQWLPRLAAFKPELVLLSAGFDAHRLD
B.P.Bet_16      FPGNNNMPDG-DNMVHLPFPPGTGSRAFRKAVRRQWLPRLAAFKPELVLLSAGFDAHRSD
B.P.Bet_8       FPENNDMPDG-SNMVHLPLLPGTGSVAFREAVRRQWLPGLAAFKPELVLLSAGFDAHRSD
B.P.Alp_1       GTGNRDEFGPHDTIRNIPLSAGTDGEVYRMIVTQQVLPKIRSFAPELILLSSGFDAHRDD
B.P.Alp_5       GTGRASETGAHGNVLNIPLRAGTDGAAMRAAYDLQVWPELEEFEPELILVSAGFDAHEAD
B.P.Alp_2       GSGRTDETGAYETVLNIPLAPGTGGAEMRAAYEAQAFPRLRAFKPELIIVSAGFDAHQDD
B.P.Alp_3       GTGRASETGAHDNILNLPLPPESGGAHMRREYQHKALPRLRDFAPQLIIISAGFDAHADD
B.P.Gam_20      GTGYPSETGA-GNIVNVPLRAGDTGIEFREKYQSLILPALDHFKPQLLLVSAGFDAHRDD
B.P.Gam_21      GTGYPSETGV-GNIINVPLAAGESGLEFRQKYSRIILPALRAFKPELLLVSAGFDAHRDD
B.P.Alp_8       GTGAKSETGA-GNIVNAPLSPDTGSDHFREAFKSRVLPALEEFRPDFILISAGFDAHHRD
B.P.Alp_10      GTGSAGERGEHDNIVNAPLASEDGGKEFRFAFETAILPQLKRFAPELIVISAGFDAHYRD
B.P.Alp_4       GTGHKNERGEHDTIVNAPLVEGMGGDEFRDAMNSVILPRIRSFDPDLIVISAGFDAHHRD
B.P.Alp_12      GTGSPSERGEKDTIVNVPLRPNDDGEVFREAFETGILSRLEAFRPDVIVISAGFDAHKLD
B.P.Alp_9       GTGALSETGAHGTIVNAPLNAGDGSEAFREAVETAILPRIHDFAPDLIVISAGFDAHWRD
B.P.Alp_13      GTGAASETGV-GNVWNAPLSEGDDCGPFRAAWTDRILPALDAFRPDLVLVSAGFDAHEGD
B.P.Alp_7       GTGAPSETGV-GNIVNVAVEPHAARESWRASFAGGLMPALDDFAPDLILISAGFDAHRRD
B.P.Alp_11      GTGAASERGM-GNILNVALPPGAKGDEFRAAWSERILPAVEGFSPGLILVSAGFDAHARD
B.P.Gam_17      GTGDAIETGV-GNIVNAPLPPDTRSQEFRQIWDGLLLPRLHDFRPQLVLISAGFDAHRLD
B.P.Gam_16      HTGSVYERGV-GNMHNVLLPPGSDGFRFRNTWADTLLPGLEEFRPQLVLVSAGFDAHLAD
B.P.Gam_18      HSGSVYERGA-GNIHNLLLPPGSDGLRFRNVWEDEMLPLVDAFRPQLILISAGFDAHLRD
B.P.Gam_8       NTVVENN----TTLVNSPLPIASDGNDLKAVFEQQWLPKLNAFKPDMLFISAGFDAHLED
B.P.Gam_6       HSHVHSQA---SNIINTPIAAGCAAIEYRKTIENAWMQKLRDFDPQLILISAGFDGHALD
T.o.ORF_nu      ------------------------------------------------------------
B.P.Gam_14      FRGANTQE---KNIINIPLPAYTTGKTYREHVEKLWFKQIEDFSPDMIFFSAGFDAYYKD
B.P.Gam_15      HHELLTKQ---DHIIHTPLPAGTEGKQFRKQIEKQWLGKIDAFKPQMIFISAGFDGHRQD
B.P.Gam_4       WRYAETEW---ENIVNTPLDAHSGSLEFRRAIEASWLPAIQKFKPQLILVSAGFDAHRED
B.P.Gam_3       WRYQQGQW---DNVLNTPLSAGADGHEFRRRVEAQWLPALQAFKPQLVLLSAGFDAHRDD
B.P.Gam_1       WRYLRSEW---QNVVNTPLEVGTDSKEFRRIIERQWLPALHAFKPDLVMLSAGFDAHRDD
B.P.Gam_2       WRYLRSEW---QNVINTPLEVGTDGPEFRRIIENHWLPALHAFKPDLVMLSAGFDAHRDD
B.P.Gam_9       LRYYDIQR---PNIVNSPLRAGTTGYQFRNVIEQDWLPALHYHQPQMIFVSAGFDAHKAD
B.P.Gam_5       FRFQDIDK---PNIVNTPLPAGTGSAAFRQAIERDWLPALATHRPDMILVSAGFDAHRDD
B.P.Gam_7       FSGDKPTN---QHILNIPIPAGTKGDEYRQMI-MPWFDKLNDFVPEMIFISAGFDGHAED
B.P.Gam_19      ERALPSKP---GFLINAPLPEGAGGAEFRETITEHWLPELNAFKPQLVIISAGFDAHLED
B.P.Gam_11      HTGADTVS---DHIINLPLPGGCKASQWRAAVSSEWLPALDAFAPELILVSAGFDGHAED
B.P.Gam_12      DTPRAER----DHLIHTPLAAGTTGAQFRAAVRHDWLPALEQFRPQLVLVSAGFDAHRDE
B.P.Bet_15      NSGAQPLG---DNMVNLPVPAYTKGSEIRELIDRHWLPRLEAFRPQMLFISAGFDAHRED
B.P.Bet_11      FSGVDHQA---PNMVNLPMAARTNGMAVREAVDLMWLPRLDAFRPQMLFVSAGFDAHRED
B.P.Bet_17      FSGADHQA---PNMVNLPMPARSNGMAIREAVDMFWLPRLDAFKPQMLFVSAGFDAHRED
B.P.Bet_18      FSGVDHQA---PNMVNLPMPARSNGMAIREAVDMFWLPRLDAFKPQMLFVSAGFDAHRED
B.P.Gam_13      HSGADTVS---DHILNLPLPAGTDGAALRAAVEQHWLPALEAFRPELILVSAGFDGHLED
B.P.Bet_3       YSGDVPMG---PNMVNIPMKAGSTGADFRDAVMDGWLPRLREFKPQILFISAGFDAHRED
B.P.Bet_2       FAGADTAS---AHIVNVPLPAGTDGARYRDAFRAQIVPRLDAFAPQMLFCSAGFDGHRED
B.P.Bet_14      YSGIAGRS---ERMVNIPLPAGSNGKVFRKAVDEFWLPALERFKPQMLFVSAGFDAHADD
B.P.Bet_7       YCGTDSGG---DHIINVPLAAHTNGQAFRVAVTHYWLPALEAFKPEIIFISAGFDAHRED
B.P.Bet_1       YCGADSGN---DHIINVPLPAGTDGAAFRQAVSERWLPALERFQPEMLFISAGFDAHWED
B.P.Bet_5       YSGDIPKG---SNMHNVPLPRASTGQQFREAVCEQWLPRLNEFAPEMLFISAGFDAHLED
B.P.Bet_6       YSGTEHPA---FNMLNVPLSRGTDGEEFRNVVSDIWMPRLREFQPEMILISAGFDGHYED
B.P.Bet_4       YCGADDPP---AHMCNVPLPAGTRGDGFRQVFGDVVIPALRAHNPQMIFISAGFDAHYED
                                                                            

B.P.Bet_21      RIAQLKAGEMDYACVTRLLVEASFAYCEGRLVSVLEGGYELRSLARSVFTHLQGLIRNPL
B.P.Bet_9       ETGRLKLHEADFAWLTHKIVQTASS-CKGKIVSALEGGYTLDSLAKSAAEHIHVLA----
B.P.Bet_13      ETGRLNLHEADFAWLTHKIIQAASS-CPGRIVSVLEGGYTLEPLAKSAAAHIGVLA----
B.P.Bet_10      ESGRLNLHEADFAWLTHKIIQTASG-CPGKIVSVLEGGYTLEPLAQSAAEHIRVLA----
B.P.Bet_16      ESGRLNLHEADFAWLTYKIIQTASS-CPGKIVSVLEGGYTLESLSKSAVEHIRVLA----
B.P.Bet_8       ESGRLNLHEADFGWLTHKIIQTASG-CPGKVVSVLEGGYTLESLSKSAAEHIRVLA----
B.P.Alp_1       PLASISLETQDFRWLTDQVAALAGEVCGGRLVSCLEGGYNLEALAEAAAVHVDGLI----
B.P.Alp_5       PLANLDWDTEDFAWLTRRLCEIAQDHCGGRLVSALEGGYDLDALAASAAAHVAELM----
B.P.Alp_2       PLANLNWSTGDFAWITAELCKIADEVCDGRIVSTLEGGYDLNALAEATRAHVEELM----
B.P.Alp_3       PLAQLNWSTEDFAWLTAEICEIAADVCQGRVVSTLEGGYDLNALSASVRAHVQELM----
B.P.Gam_20      PLSSIRLVEEDYRWVTQALKEIAGRHCQGRIVSVLEGGYNLKALAASVAVHVRGLM----
B.P.Gam_21      PLSSIRLVEDDYRWLTQELMEIAGIYCGGRMISILEGGYNLNALAASVAVHVKTLLASEV
B.P.Alp_8       PLAQINLVADDFDWATGRLLDAAGKTANNRIVSLLEGGYDLQGLAESAGTHIYRLM----
B.P.Alp_10      PLASLNLHAEDFAWVTQQLMEVADQTAGGRIVSVLEGGYDLQGLSESVAAHVGALM----
B.P.Alp_4       PLGGLRLKEVDFAWATQALMEIADKRCNRRVVSLLEGGYDLEGLARSVAAHVMTLM----
B.P.Alp_12      PLANLRLEAEDFGWATRRLMDLAERCAGGRIVSILEGGYSLEGLGKSVAAHVDALM----
B.P.Alp_9       PLASLNLMESDFAWATQKLMALAERHCGQRIVSVLEGGYDLEGLARSTAFHLDALM----
B.P.Alp_13      PLGGLRLVEDDFAWVTTRVAEVAHRHCGGRIVSMLEGGYVLDALARSSAAHVRALA----
B.P.Alp_7       PLAHQSLEAEDFAWATRAVLEVARRRCGGKVVSSLEGGYDLEGLGRSALAHIRALG----
B.P.Alp_11      PLAHLRLTEADFAWVTGEICAVARRVCGGRVVSMLEGGYDLDALARSVAAHVRALM----
B.P.Gam_17      PLAQLQLETEDYAWLTDRLMHLADAHAHGRLVSSLEGGYDLAALAAASAAHVRELM----
B.P.Gam_16      PLADLMLDAEDFAWLTTELLGIARRHCDGRLVSTLEGGYNIEALAECATAHVGALL----
B.P.Gam_18      PLADLMLDDDDFAWLTGALRTLADRHARGRVVSMLEGGYDLQALRESSVAHVAALR----
B.P.Gam_8       DMASLKFVEEDYRWLTEQLARFSEQHNCRGIVSYLEGGYALSALGRSAIAHVKALV----
B.P.Gam_6       PLAELNLEVEDYRWLTEMIVGVARDHANDRVISTLEGGYHLKALAESVAAHVQVLK----
T.o.ORF_nu      ------------------------------------------------------------
B.P.Gam_14      ELANLLLTPDDYLWITQKVKQIADKTSNGRMLSVLEGGYNLQGLGECAVAHLHGLL----
B.P.Gam_15      IMANFQLEDDDYVWITKKIKQLADKHCPGHLISVLEGGYALSVLGQSVLQHICHLV----
B.P.Gam_4       PMGELNLEDDDYHWITNFLMDQAKSQCDGRLVSVLEGGYDLNSLARSVHRHIEALQ----
B.P.Gam_3       PMGGLNLLEDDYYWVTQLALDIARVYAEGRLVSALEGGYHLDSLATSVEAHLKALL----
B.P.Gam_1       PMGDICLEDEDFYWITHLAMEIAALYAENRVVSVLEGGYNPKTLASGAEAHLKALL----
B.P.Gam_2       PMGDICLEDEDFYWITHLAMEIATLYADNRIVSVLEGGYNPKSLASGVEAHLKALL----
B.P.Gam_9       PLGQLLLDESDYRWVTKLIVDAAACYADNRIVSTLEGGYDLEALAHSVHTHIDVLV----
B.P.Gam_5       PLAELMLDDEDFGWIGGLIMDAAKRYCEGRVVSVLEGGYNLNALGRSVQAYIEAML----
B.P.Gam_7       ALGHLRLVEADYEWVTLQIKNIADKHCGGKIVSMLEGGYALSALSRSVVSHIKALM----
B.P.Gam_19      EMAGLRLVEADYAWVTKELRKIADEYSEGRIISLLEGGYDTSALARSVVAHLKVLM----
B.P.Gam_11      DMAHFMLREEDYHWLATELKTVANKHCQGRVVAMLEGGYALSALGRSVVAFLKGLM----
B.P.Gam_12      ALAGLNLDADDFSWITHELTRIAARYAGARLVSMLEGGYALPALGRSAAAHVRALC----
B.P.Bet_15      DLGQLGLVESDYAWITRRLKGVAERHADGRIVSCLEGGYALSALARSVASHVRVLA----
B.P.Bet_11      DIGGMGLVEADYEWLTQQICEVARRHAQGRIVSCLEGGYNLSALGRSVVAHLRVLA----
B.P.Bet_17      DIGNLGLVESDFEWLTAQVVDVARRHAQGRIVSCLEGGYNLSALGRSVVAHLRVLA----
B.P.Bet_18      DIGNLGLVEADFEWLTAQIVDVARRHAQGRIVSCLEGGYNLSALGRSVVAHLRVLA----
B.P.Gam_13      DLAGFRLVESDYAWLTGALYDIAKRHCDGRLVSVLEGGYNLSALGRSVAAHLKVLS----
B.P.Bet_3       DMGMMGLVEADYEWVTRQLLKFADEYCEGRVVSVLEGGYDLSALGRSVTAHVRVLT----
B.P.Bet_2       DMAQFGLLEADYVWITEQVMAVAARHACGRIVSVLEGGYDLSSLGRSAAAHIKTLA----
B.P.Bet_14      ELASLNLVEDDYAWVTEKIKEVARAYAGKRIVSVLEGGYALAALARSVAAHIEVLM----
B.P.Bet_7       TLAQLNLVEADYVWITRQIMAIAEKHAQNRIVSVLEGGYALGALGRSVTTHIRTLA----
B.P.Bet_1       DMAMFKLKEADYAWVTQQVKDVAEKHAQGRIVSALEGGYELHALGRSVAAHIKVLS----
B.P.Bet_5       DMGSLGLVEADYAWVTRQLMKVAEVHSSRRIVSMLEGGYELSALGRSVAEHVRVLT----
B.P.Bet_6       EMGGLKLLEKDYAWVTVQLKQLAEEFAQKRIVSILEGGYSLSALARSVVAHIRVLA----
B.P.Bet_4       DMGSMGLLEADYVWATEQIKAVANDCGHKRIVSLLEGGYSLSSLARSVVAHIKSLA----
                                                                            

B.P.Bet_21      PAETCKDPN-----------------------------------
B.P.Bet_9       --GMKKSDAAVQYDHFLKNDGRKKILNKLSMRPSEKTGNTSKSP
B.P.Bet_13      --GLPKAGYVAAYQKHLKRGGQKKENTAPASQIGRLKTENRF--
B.P.Bet_10      --GLGKSDAATAYQKTLDPTKKRFAKPKTGQVRQPTQSDRYDI-
B.P.Bet_16      --GLGKSDTVTAYQKNLYRNRNKRFAKPKSL-------------
B.P.Bet_8       --GLGKSETAAAYQAELDRNREHVPPGPNPA-------------
B.P.Alp_1       --AAAA--------------------------------------
B.P.Alp_5       --EHSR--------------------------------------
B.P.Alp_2       --KAAQ--------------------------------------
B.P.Alp_3       --KAAT--------------------------------------
B.P.Gam_20      --GQ----------------------------------------
B.P.Gam_21      QAGK----------------------------------------
B.P.Alp_8       --RG----------------------------------------
B.P.Alp_10      --GA----------------------------------------
B.P.Alp_4       --NQ----------------------------------------
B.P.Alp_12      --GR----------------------------------------
B.P.Alp_9       --GRETGA------------------------------------
B.P.Alp_13      --ASAS--------------------------------------
B.P.Alp_7       --EA----------------------------------------
B.P.Alp_11      --DA----------------------------------------
B.P.Gam_17      --A-----------------------------------------
B.P.Gam_16      --A-----------------------------------------
B.P.Gam_18      --------------------------------------------
B.P.Gam_8       --DYE---------------------------------------
B.P.Gam_6       --SVS---------------------------------------
T.o.ORF_nu      --------------------------------------------
B.P.Gam_14      --S-----------------------------------------
B.P.Gam_15      --NPPV--------------------------------------
B.P.Gam_4       --KM----------------------------------------
B.P.Gam_3       --GLPLGHP-----------------------------------
B.P.Gam_1       --GLPFTDVP----------------------------------
B.P.Gam_2       --GLPFAEVP----------------------------------
B.P.Gam_9       --NG----------------------------------------
B.P.Gam_5       --EG----------------------------------------
B.P.Gam_7       --N-----------------------------------------
B.P.Gam_19      --NI----------------------------------------
B.P.Gam_11      --------------------------------------------
B.P.Gam_12      --EAPRR-------------------------------------
B.P.Bet_15      --GLTD--------------------------------------
B.P.Bet_11      --GV----------------------------------------
B.P.Bet_17      --GI----------------------------------------
B.P.Bet_18      --GI----------------------------------------
B.P.Gam_13      --ET----------------------------------------
B.P.Bet_3       --DI----------------------------------------
B.P.Bet_2       --AL----------------------------------------
B.P.Bet_14      --KP----------------------------------------
B.P.Bet_7       --E-----------------------------------------
B.P.Bet_1       --GL----------------------------------------
B.P.Bet_5       --GE----------------------------------------
B.P.Bet_6       --EI----------------------------------------
B.P.Bet_4       --DL----------------------------------------



Gblocks 0.91b Results

Processed file: input.fasta
Number of sequences: 51
Alignment assumed to be: Protein
New number of positions: 125 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Bet_21   --------------MMQIPQLHKRMPDTLPKDWRLLPTGYFTHQLVGLPNPLDDAPESPD
Bac_Pro_Bet_9_[  ----------------MKNLIRRLRIILRRILGVRARTVWISHPIFLRHEPGGTHPESPQ
Bac_Pro_Bet_13   -------------------------------MGKNARTVWISHPVFAQHQPGTGHPDSPE
Bac_Pro_Bet_10   --------------MSLTRLILKFYALLRLFLCKNARTAWISHPACAGHEPGANHPDSPD
Bac_Pro_Bet_16   --------------MFLTRLILKFYALLRLFLGKNARTAWISHPACAGHEPGANHPDSPE
Bac_Pro_Bet_8_[  --------------MPPIRLILKFYSLLRLFSGKNARTVWISHPACAGHEPGANHPDSPE
Bac_Pro_Alp_1_[  -----------------------------------MTTALFTHPDCLNHLTPEGHPEQVA
Bac_Pro_Alp_5_[  -----------------------------------MATALFTHDDSLRHLTPPGHPERVE
Bac_Pro_Alp_2_[  -----------------------------------MKTALLTHADCLNHATPEGHPERVA
Bac_Pro_Alp_3_[  ---------------------------------MTSKTALLTHADCLAHVTPDGHPEQVA
Bac_Pro_Gam_20   -----------------------------------MRTLYYSHPDFLLHATGAGHPERPA
Bac_Pro_Gam_21   -----------------------------------MKTLYYSHADFLLHDTGIDHPESAD
Bac_Pro_Alp_8_[  -----------------------------------MTTILFENPIFLEHQVPEGHPERPD
Bac_Pro_Alp_10   -----------------------------------MTTLFLTHSACLEHHTPEGHPERAE
Bac_Pro_Alp_4_[  -----------------------------------MSTLYLHHPSFLEHLTPLGHPERPD
Bac_Pro_Alp_12   -----------------------------------MTTLYVSHPASFDHEVPEGHPERPA
Bac_Pro_Alp_9_[  ---------------------------------MHMSTLYIAHPASLEHQTPIGHPERPD
Bac_Pro_Alp_13   MSGPTHAGPTRRGLVAGSAAFGLTAGSGRAAEPATGRTLLITHPAFAGHETGLGNPERPA
Bac_Pro_Alp_7_[  -----------------------------------MSVSLFTHPDMIAHAPGAGHPERPE
Bac_Pro_Alp_11   -----------------------------------MDLLLLTHRACLGHDMGFEAMERPA
Bac_Pro_Gam_17   ------------------------------------MIRLYTHPACLQHDPGPGHPESPA
Bac_Pro_Gam_16   -------------------------------------MLAYTHPACLEHDTGPDHPECPQ
Bac_Pro_Gam_18   -------------------------------------MLVFTHPACLGHDAGPEHPESPA
Bac_Pro_Gam_8_[  -----------------------------------MRTAIISHPHCRKHKMIDDHPECPE
Bac_Pro_Gam_6_[  -----------------------------------MTTAFFSHDDCLKHNMGPEHPECPE
Translation_of   --------------------------IGHYPKSALKPMYLYTHPDCENHKLAQ-HPERPE
Bac_Pro_Gam_14   -----------------------------------MQIGFISHKDCLLHDMGDFHPEQPD
Bac_Pro_Gam_15   ------------------------------------MLAFISHRDCLLHDMGASHPECPE
Bac_Pro_Gam_4_[  -----------------------------------MITSFITHEDCALHDMGPWHPENPM
Bac_Pro_Gam_3_[  -----------------------------------MITAYITHPHCMRHLMGPTHPESPK
Bac_Pro_Gam_1_[  -----------------------------------MITAYLTHPDCALHHMGPEHPESPQ
Bac_Pro_Gam_2_[  -----------------------------------MITAYLTHPDCSLHHMGPEHPESPQ
Bac_Pro_Gam_9_[  -----------------------------------MTTTFITHGDYLLHSMGEQHPECPE
Bac_Pro_Gam_5_[  -----------------------------------MTTALISHVDCELHQMSAGHPESPE
Bac_Pro_Gam_7_[  -----------------------------------MPITFISSPKCLLHDMDPEHPEQPA
Bac_Pro_Gam_19   -----------------------------------MTIAIITHSDCLKHEMGIGHPERPQ
Bac_Pro_Gam_11   -----------------------------------MAITIFSHAICRQHVAGDDHPECPA
Bac_Pro_Gam_12   ----------------------------------MTHTAYISHPDCLLHDSGPHHPERAD
Bac_Pro_Bet_15   -----------------------------------MATAYYSHPACRTHDMGDGHPECPQ
Bac_Pro_Bet_11   -----------------------------------MPTAFYTHPDCLLHEMGEWHPESPA
Bac_Pro_Bet_17   -----------------------------------MATAFYTHPDCMLHEMGEWHPECPA
Bac_Pro_Bet_18   -----------------------------------MATAFYTHPDCMLHEMGEWHPECPA
Bac_Pro_Gam_13   -----------------------------------MKLFFISHPNCSRHRGPGYHPESPE
Bac_Pro_Bet_3_[  ----------------------------MKNGLQSGLTAYITHSDCMLHNVGDMHPECPQ
Bac_Pro_Bet_2_[  -----------------------------------MHTAYLTHADCLMHDMGSWHPESPA
Bac_Pro_Bet_14   -------------------------------MRPASHTAFISHPDCLLHEMDFYHPESPA
Bac_Pro_Bet_7_[  -----------------------------------MTTAFVTHPIYLKHDMKHGHPECPE
Bac_Pro_Bet_1_[  -----------------------------------MHTAYITHPDCLKHDMGADHPECPA
Bac_Pro_Bet_5_[  ----------------------------------------MSHSSCSMHDMGKGHPECPE
Bac_Pro_Bet_6_[  ----------------------------------MTSTAFITHRDCQLHDMGSYHPEAPE
Bac_Pro_Bet_4_[  ----------------------------------MTTTAFITHRDCWLHDMGSMHPECPD
                                                           ##########  ######


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Bet_21   RIEAIEARLMLAGLEGRVRRVECGPAPREA--VLLAHDSQYVDDLEHASLGDPEA-----
Bac_Pro_Bet_9_[  RITAILEELKRRKIWRRLQAAEAEEVSDAQ--LALVHPRRYLRFLESVQ---PQE---GK
Bac_Pro_Bet_13   RTAVIEAELKRQDIWRHLQTAEAEEISDTR--LALVHPRKYLRSLEACQ---PQP---DK
Bac_Pro_Bet_10   RILCIEQALRRAGIWQHLQTIEAEEISDTH--LALVHSSKYLNRLESCL---PQK---GK
Bac_Pro_Bet_16   RISSIEQALRRSGVWQHLQTVEAEEISDMH--LALAHTSKYLNRLESCR---PEN---DK
Bac_Pro_Bet_8_[  RIGSIEQALRRSGVWRRLQTLDAEEISDAR--LALAHTSKYLNRLESRL---PED---GK
Bac_Pro_Alp_1_[  RLSRVLSALEGK----ALDRHEAPLAEEAD--LLLCHPQGYIDRVRGAE---PAE---G-
Bac_Pro_Alp_5_[  RAQAMAAALAAPRF-DGLVRRASPLAAEAE--VLRAHPARHLEAIRANI---PLT---G-
Bac_Pro_Alp_2_[  RLEHILHALEDL----DLQRVTAPLAADDD--LLRVHPQSHISDILDQR---PSD---G-
Bac_Pro_Alp_3_[  RLEHVLYALQPL----EVARITAPLAADDD--ILRIHPASYLAELRRAS---PSE---G-
Bac_Pro_Gam_20   RLKAIGQALEQAEF-AKLIRVLAPLGTEQQ--ATLIHPAAHIQHLRDAL---PNQ---R-
Bac_Pro_Gam_21   RLRSIAKALAAPEF-SGLIRASPPPGTEQQ--IRLIHTQAHIDAILNAV---PLH---G-
Bac_Pro_Alp_8_[  RLKALNLALEHERF-SSLSRLEAPQGNEDL--VLLAHPEEHLRTVMSAM---PEE---G-
Bac_Pro_Alp_10   RLIAVNKTLTAERF-ATLARGEAPIGSLEH--IALCHTDHHIVEMRHMS---PST---G-
Bac_Pro_Alp_4_[  RLRAIDRILENERF-HTLERDRAAVGRFVD--AARVHPPAYINQLHRMR---PDE---G-
Bac_Pro_Alp_12   RMRAVERALEDERF-AGLVRATAPRGEIEA--VTLAHPRAYVDALVAAV---PEH---G-
Bac_Pro_Alp_9_[  RIRAIERALEKERF-TSLVRELAPMAEMES--LTLAHPQDYIVRLRDIS---PRE---G-
Bac_Pro_Alp_13   RMRAVDQALSAQDF-AALRREEAPMRDDAQTAILRVHSPVHLDRIRAAA---AGTRA-G-
Bac_Pro_Alp_7_[  RLAAVLAALDDSDL--SLDRCAATEAAVTD--LERIHPAAYVSRMIEAS---PAQ---G-
Bac_Pro_Alp_11   RLRVVLEALEAQCF-SMLAREEAPRATREQ--LMRVHPASYVDTILATR---PEGD--G-
Bac_Pro_Gam_17   RLRAVLDALDHDSF-AALDRVEAPRASRLQ--LLRTHTLEHVARILEAR---PDE---N-
Bac_Pro_Gam_16   RLRAVLDALGRA--WPALQWREAPMALRGD--LLRVHSGELVDQVLA-----PVAE--G-
Bac_Pro_Gam_18   RLEAVVQALR--GAFPDLDWREAPLAKLGD--LCRVHEREQVDAVLETA----FD---G-
Bac_Pro_Gam_8_[  RLDAINDRLLASGLDIAIEQKQAPKAQREH--YLLAHDESLVSFVESKI---PTQ---G-
Bac_Pro_Gam_6_[  RISAILSYLAETGLDQSLDWVRPEEITRDQ--LLTVHPEQYLHQLDLMQ---PTR---G-
Translation_of   RLRAVINRLVETGMTQDMKVKLAEELSDDV--LIHVHPSKYVETINRSE---PTI---S-
Bac_Pro_Gam_14   RLRSIEQAVKASDLNKVITYYEAPLATREQ--LLRVHDEEYVDFIFKIA---PSQ---G-
Bac_Pro_Gam_15   RLKVIADAVKHSQLEEKIHYYNAPLAKKED--LLRVHDKQYIDYLFNIN---PGE---K-
Bac_Pro_Gam_4_[  RLNAIIEQLKLSGLMNQLMQYKARPVTDEQ--LFRAHPKAHVRSLQLSL---PEE---G-
Bac_Pro_Gam_3_[  RLEAIRARLALTGILTHTMQSDAPPVTRET--LALAHSPQYLDALEAHA---PTQ---G-
Bac_Pro_Gam_1_[  RLEAIRARLSLAGLLQQTMQADAKEACDEA--LARVHPTRHLNALEKCL---PKE---G-
Bac_Pro_Gam_2_[  RLEAIRARLSLAGLLQQTMQADAKEACEEA--LARVHPLRHLRSLDKCL---PTE---G-
Bac_Pro_Gam_9_[  RLGAITSYLASTELGNQVTWLSAESATNEQ--LERVHPADYIRRLDSMQ---PQR---G-
Bac_Pro_Gam_5_[  RLRAIHRQLELSGMLERLDLLVASPASRAQ--LELAHPDHYIDAICDLH---PER---G-
Bac_Pro_Gam_7_[  RLHSINDQIISSGVEFAINFVDTPPVQLAQ--LYRAHDNQFVDKIIKEA---PTE---G-
Bac_Pro_Gam_19   RIRAIEDQLITSGIGDFMHYYDAPLATPEQ--LELAHSRKHIDYIFGKSP--PDD---SM
Bac_Pro_Gam_11   RLDAINDQLIRSGLDYVLQQKDASPASKTD--LCRAHSTRYVSELYAKA---PAD---G-
Bac_Pro_Gam_12   RLHAVRNALLDEGLMEGLHLLDAPPATDAQ--LQRVHTPTHVARIRANA---PAL---GH
Bac_Pro_Bet_15   RLDAIADHLIATGLDIALEQREAPPVDEGT--LALAHESLYVANLRGFM---EQVEATGQ
Bac_Pro_Bet_11   RLSAIQDQLIASRIDDLIVHETAPFASETA--LARVHTQAHIDYIRSRI---PKE---G-
Bac_Pro_Bet_17   RLSAIQDQLIASRIDDLIVHETAPFASEVA--LGRVHTQAHIDYIRGMT---PVD---G-
Bac_Pro_Bet_18   RLSAIQDQLIASRIDDLIVHETAPFASEVA--LGRVHTQAHIDYIRSMT---PVD---G-
Bac_Pro_Gam_13   RLSAIDDQLIAAGVEPWLRHREAPLASREQ--LLRVHSPEYLDALAEGA---PGP---GE
Bac_Pro_Bet_3_[  RLVAIRDQLMASQIFDSLHEVEAPEVTDEQ--LARVHTPRYLEYLEMSQ---PLT---G-
Bac_Pro_Bet_2_[  RLRAIDDRLHAAHLFDHLAHHEAPRVQRAQ--LLRVHDAAYVDFIEASS---PEH---G-
Bac_Pro_Bet_14   RLKAIEDELSASGLMDKLRRYQAPLATVGQ--LERVHTREHIARLHAAA---SRAASGG-
Bac_Pro_Bet_7_[  RLLAIQEQLVATDTLPRLQQYEAPRATDDQ--LMRAHTESYVHEIKSAA---PQQ---G-
Bac_Pro_Bet_1_[  RLRAIEDQLIASGLLTFLQHHDAPLATFEQ--LARVHKPQYIEAVQAAA---PQH---G-
Bac_Pro_Bet_5_[  RLAAIQDRLIAAGLWDYLLHVDAPPALREQ--IERVHCADYLDDLARRS---PAV---G-
Bac_Pro_Bet_6_[  RLNAINDHMIAQGLDSYFVYHDAPLVTFQQ--LHRVHTAAHLERLKRAS---PEL---G-
Bac_Pro_Bet_4_[  RLSAINDRLIAAGLDMYISFYDAPVATREQ--IIRAHPENYLDELLDSV---PEH---G-
                 #########                                                   


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Bet_21   LKRFTEPDTRVGEDTFSCAMASAGAVARAVDAIYGRS--VKN-AFCAVRPPGHHASRSRA
Bac_Pro_Bet_9_[  IYRLD-DDTVISNRSLEAARFAAGAVIKAVNMVMDKK--ACH-AFCAVRPPGHHAQSSQA
Bac_Pro_Bet_13   IYRID-NDTVMSHGSLKAARYAAGAVVQAVDMVMNKK--AWH-AFCAIRPPGHHAHSDKA
Bac_Pro_Bet_10   IFRLD-NDTAISTGSLSAAHFAAGSAVQAVDMVMNRK--AWH-AFCAARPPGHHAGSGKA
Bac_Pro_Bet_16   IFRLD-DDTVISKNSLSAARFSVGSVVQAIDMVMNRQ--AWH-AFCAARPPGHHAGSGNA
Bac_Pro_Bet_8_[  IYRLD-DDTVISKNSLSAARFSAGSVVQAVDMVMKRK--AWH-AFCAARPPGHHAKSGKA
Bac_Pro_Alp_1_[  QVQMD-PDTWMSPGSYRAALRSAGGAIAAVDAVLDGR--ADN-AFVATRPPGHHAETESP
Bac_Pro_Alp_5_[  FNPVD-GDTFMSEGSFDAALRAVGGCGAAVDAVLAGE--VTN-AFVACRPPGHHAERSRS
Bac_Pro_Alp_2_[  FKQID-GDTFMSPGSVDAAYRAAGAVVRAVDLVLGGE--APN-AFCAIRPPGHHAETEAA
Bac_Pro_Alp_3_[  HRALD-ADTWMSPGSLDAAFRGAGAMVRAVDMVLGGE--APN-AFAAVRPPGHHAETDTP
Bac_Pro_Gam_20   RYPLN-PDTVLSPGSLTAAFRAVGAVCDAVDRIMADT--ADN-AFCAVRPPGHHAEPMQA
Bac_Pro_Gam_21   LRYLD-SDTVLSPGSGKAALRAVGTVCDAVDRILADE--ADN-AFCAVRPPGHHAESERA
Bac_Pro_Alp_8_[  INAIE-ADTYASPASLQAALTGIGGAVAAVDAVFSGK--ADN-AFVAARPPGHHAEKNQA
Bac_Pro_Alp_10   IVYVD-GDTSMSPGTFEAALRGVGGAVSAVDAVMKGS--AAN-AFVATRPPGHHAEVTKP
Bac_Pro_Alp_4_[  LVHVD-HDTTMSPGTWDAAMRGVGASCQAVDEVMSGR--VVN-AFCALRPPGHHAERQRA
Bac_Pro_Alp_12   MVGID-SDTILSAGSLEATLRAVGGGMHAVDAVVGGE--CRN-AFVAMRPPGHHAERTRA
Bac_Pro_Alp_9_[  LVRID-EDTVMSPGTYEAALRGAGGAVLAVDEVMSGR--ATN-AFVAMRPPGHHAERTRA
Bac_Pro_Alp_13   PVHLD-PDTVVSAGTWEAVIRAVGAGLRAVDAVMDRGSGIAN-AFCQIRPPGHHAGRDTA
Bac_Pro_Alp_7_[  LAQLD-ADTILSSGSVRAARLAAGAVIDAVRAVAEGR--TAR-AFAAVRPPGHHAEPDQA
Bac_Pro_Alp_11   HVVID-GDTAMGSGSAEAALHAAGAGIAAVDAVMRGE--FAR-AFCAVRPPGHHAEPARA
Bac_Pro_Gam_17   GLRLD-EDTVMSPGSAEAALRAAGAVVAAVDAVMTGA--CER-AFCAVRPPGHHATADTA
Bac_Pro_Gam_16   LHRLD-PDTVVGPGSGRAALYAAGAGIAAVDGVMDGR--ERT-AFCAVRPPGHHATADAA
Bac_Pro_Gam_18   YRQLD-VDTRMVPASRAAALRAAGAGIAAVDALMQDQ--TRT-AFCAVRPPGHHATAQVS
Bac_Pro_Gam_8_[  LVDLD-GDTWLCPDSLKAIERAVGAGILAVDEILEGN--LDA-AFCSVRPPGHHANRTTS
Bac_Pro_Gam_6_[  RVFTD-PDTAMMPDTLRAARLSAGANVQAVDMIMSGQ--VTN-AFVCARPPGHHAERAKS
Translation_of   TVRLD-PDTYMSPGSLRAAKLAAGACVAAVSDILQEK--TDR-AFCAIRPPGHHAEVAAA
Bac_Pro_Gam_14   LVPLD-PDVWMNPHSLQAALRAAGAVVYGVELILKNE--IDA-AFCNVRPPGHHAERNKA
Bac_Pro_Gam_15   IIPLD-PDTWMNQHTLQAALRAAGSVILAVDLVMNKT--CEA-AFCNVRPPGHHAEKSQA
Bac_Pro_Gam_4_[  FTSIE-DETLLAPRSLEAASYAAGAVVRGVDQIFKNQ--ADN-VFCAVRPPGHHAERVES
Bac_Pro_Gam_3_[  LHELD-GDTHMGQDTLTAARLAAGAVVRGVDQVFRHQ--ADN-VFCAVRPPGHHAERGTA
Bac_Pro_Gam_1_[  IVTLD-SDTMMNPDSLKAARVAAGAVIRGVDQVFKRQ--ADN-VFCAVRPPGHHAEAADA
Bac_Pro_Gam_2_[  IVTLD-SDTMMNPDSLKAARVAAGAVIRGVDQVFKRQ--ADN-VFCAVRPPGHHAEASDA
Bac_Pro_Gam_9_[  LVYAD-PDTALNPHTMHAARLAAGAVTMATELVLSGK--ISN-AFCAVRPPGHHAEHNTA
Bac_Pro_Gam_5_[  LSYAD-PDTALNPHSLRAADLAAGAVVQGVDRVLDGL--ADN-VFCAVRPPGHHAEHDAA
Bac_Pro_Gam_7_[  HKWLD-DDTLMMPQSLDAAMHAAGAGIHAVDLIMNGD--SNK-AFCAVRPPGHHAEYAKS
Bac_Pro_Gam_19   MAHID-PDTFMNEFTLQAALRSAGSAISAVDKVLGDK--TEKRVFCNVRPAGHHAERDAA
Bac_Pro_Gam_11   HIWLD-PDTQMMSKTLQAALYAAGSGINAVDDVMQAS--DKQ-AFCAIRPPGHHATHDQA
Bac_Pro_Gam_12   HALLD-PDTAMGEHSLQAALRAAGAGIEGVRAVMEED--VDN-AFCAIRPPGHHAERERA
Bac_Pro_Bet_15   RRALD-PDTVAGPGTWAAALHAAGAAVAATDAVLDGE--IEN-AFCAVRPPGHHATRRQA
Bac_Pro_Bet_11   YVEID-PDTSLNRYTWRAALRAAGAAVEATDAVLEGR--YDN-AFCSVRPPGHHAEPARA
Bac_Pro_Bet_17   YVEID-PDTLMNRDTWRAALRAAGAAIAATDAVIEGR--YAN-AFCSVRPPGHHAEPARA
Bac_Pro_Bet_18   HVEID-PDTLMNRDTWRAALRAAGAAIAATDAVIEGR--YAN-AFCGVRPPGHHAEPARA
Bac_Pro_Gam_13   WTTLDGGDTYFGEHSLDAAHHAAGAVVLAVDLVLANS--THT-AFCSVRPPGHHAGADYG
Bac_Pro_Bet_3_[  TFRVD-PDTALMPNTLKAARRAAGGVVKAVDMVCQGQ--APN-AFCAIRPPGHHAESSKA
Bac_Pro_Bet_2_[  VRALD-ADTSMNPHTLSAALRAAGGAAMAVDLVMGDD--TAN-AFVACRPPGHHATRRRA
Bac_Pro_Bet_14   FVYLD-PDTAMNRHSLGAAYRAAGAVVLAADLVIEGA--AEN-AFCSIRPPGHHAERGYP
Bac_Pro_Bet_7_[  LVCLD-NDTAMNPFTLEAAYYAAGAVVLATDLVIDKQ--VKN-AFCAVRPPGHHATRNQA
Bac_Pro_Bet_1_[  LVYLD-PDTAMNPFTLNAALRAAGAVVLATDLVLERK--VEN-AFCAIRPPGHHAESGRA
Bac_Pro_Bet_5_[  TVQLD-PDTAINAYTLRAAYHAAGAGIKAVDLIMSGR--AQN-AFCAIRPPGHHAERARS
Bac_Pro_Bet_6_[  IVHLD-PDTAMNRHTWQAALRAAGAGIKAVDLVMAGE--VEN-AFCAVRPPGHHAERAAA
Bac_Pro_Bet_4_[  IRHLD-PDTAMSPGTMKAALRSAGAGVMATDLVMAGE--IEN-AFCAVRPPGHHAERAKA
                        #############################       #################


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Bet_21   SGFCYLNNAAIGALWAQKRWRAERVMVLDFDAHHGDGTEEILADRPGVRFLSLFQWPLFP
Bac_Pro_Bet_9_[  GGFCLLNNVAVGAMHAIAEYRLQRIAIIDFDVHYGDGTAEIFKDDPRILFFNAFETDLFP
Bac_Pro_Bet_13   GGFCLLNNVAAGVMHAIAEYRLQRIAVIDFDVHYGDGTAEIFKDDPRVLFMNLFETDLFP
Bac_Pro_Bet_10   GGFCLLNNVAAGVMNAIAEYRLKRIAVIDFDVHYGDGTAEIFKDDPRILFFNLFETDLFP
Bac_Pro_Bet_16   GGFCLLNNAAVGTMYALAEYRLNRIAVIDFDVHYGDGTAEILKNDSRILFFNLFETDLFP
Bac_Pro_Bet_8_[  GGFCLLNNVAAGAMYALAEYRLNRIAVIDFDVHYGDGTAEILKNNPNILFFNLFETDLFP
Bac_Pro_Alp_1_[  MGFCLFGNVALAAKHALERRGLQRVAIFDPDVHHGNGTQDLVQSDPRILFISTHQQPLYP
Bac_Pro_Alp_5_[  MGFCLFGNIAIAAKRALDLHGLHRVAIVDFDVHHGNGTQDILWDDPRVLFISSHQWPLYP
Bac_Pro_Alp_2_[  MGFCLFGNAALAAKHALDHHGLNRVAVVDFDVHHGNGTQDLLWDEKRALVITSQQMPLWP
Bac_Pro_Alp_3_[  MGFCLFGNAALGVKHALDHHGLNRVAVVDFDVHHGNGTQDLLWDEPRALLISSQQIPLFP
Bac_Pro_Gam_20   MGFCLFNNIAIAAEHARQHYHLQRVAIVDFDVHHGNGTQAAFYHQPQVFYASSHEMPHYP
Bac_Pro_Gam_21   MGFCLFNNIAIAAEYARTHHQLKRIAIVDFDVHHGNGTQTAFYEQPAVLYASSHEVPHYP
Bac_Pro_Alp_8_[  MGFCFFNTIAIAARHAQRRHGAERVAIVDWDVHHGNGTQDIFWDDPSVLFCSTHQMPLYP
Bac_Pro_Alp_10   MGFCFFGNAAIAARYAQRKYGIERAAVVDFDVHHGNGTQDIFWGDRTVMYCSTHQMPLFP
Bac_Pro_Alp_4_[  MGFCYFNNAAVAARHAQEVHGADRVAIMDFDVHHGNGTQEIFWDDPTVMYTSTHQMPLYP
Bac_Pro_Alp_12   MGFCLFNHAAIAARHARQKHGAERVALVDWDVHHGNGSQDIFWNDASVLYCSTHQMPLYP
Bac_Pro_Alp_9_[  MGFCFFNNAAIAARHAQKRYGAERVAIFDWDVHHGNGTQDIFWSDASVLYCSTHEAPLYP
Bac_Pro_Alp_13   MGFCLFNAVAIAARHARVRHGAERVAVVDFDVHHGNGTQEAFRSDRSLFYGSTHRMPWFP
Bac_Pro_Alp_7_[  MGFCLFSNVAVAARVAQTL-GMARVAVVDFDVHHGNGTQAAFEADDSLFLASIHQMPLYP
Bac_Pro_Alp_11   MGFCLFSNIAVAARHAQEVHGAGRVAILDFDVHHGNGTQAVFERDPSVFFASSHQMPLYP
Bac_Pro_Gam_17   MGFCLFNSVAVAAAHAIAEHRLKRVAIVDFDVHHGNGTQDIFAREPKVLYVSSHQAPLYP
Bac_Pro_Gam_16   MGFCLFNNIAVAAAHARDRHGLERVAIVDFDVHHGNGTQAIFQRDPAVAYFSTHQSGLYP
Bac_Pro_Gam_18   MGFCLFNNIAVAAAHARDRHGLERITIVDFDVHHGNGTQAIFERDPAVQYLSTHQSGLYP
Bac_Pro_Gam_8_[  SGFCVFNNLAIAVKYAQSK-GVKRIAIVDFDVHHGNGTQDIFIDDKNVLFCSLFQHPFYP
Bac_Pro_Gam_6_[  MGFCFYNNIALAAMRALTFHQLERVAIIDFDVHQGNGTVDIVGGDERILMCSSFQHPFYP
Translation_of   MGFCIFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVDIFKNRPEVLVCSSFQENY--
Bac_Pro_Gam_14   MGFCIFNNVALGVAHALEQLDLERVAIVDFDVHHGNGTEDIFKRDERVLYCSTFQHPFYP
Bac_Pro_Gam_15   MGFCFFNNIAVGAAYALARYDLKRIAIIDFDVHHGNGTENIFQNNEHILLCSSFQYPFYP
Bac_Pro_Gam_4_[  MGFCFYNNVAVGALHALEHHKLDRVAIFDFDVHHGNGTVDVFRNDPRVLVCSSFQHPFYP
Bac_Pro_Gam_3_[  MGFCFYNNIAVGLAHARQRHGVERVAVLDFDVHQGNGTVDIFKNDPGVLICSSFQSPFYP
Bac_Pro_Gam_1_[  MGFCFYNNIAVGAAHAKAKYGAKRIAILDFDVHQCNGTIDIFKNDPEVLVCTSFQYPFYP
Bac_Pro_Gam_2_[  MGFCFYNNIAVGAAHARAKYGAKRIAILDFDVHQCNGTIDIFKNDPEVLICTSFQYPFYP
Bac_Pro_Gam_9_[  MGFCFFNNIAVGVEQALTHYEIERVAILDFDVHHCNGTVDAFKDRPEVLVCSTFQHPFYP
Bac_Pro_Gam_5_[  MGFCLFNNVATGAGWALQRPGVKRVAVLDFDVHHGNGTVDIFKDRPDVLVCSSFQFPFYP
Bac_Pro_Gam_7_[  GGFCIFNNIAVAALHALDHYGMKKVAIIDFDVHHGNGTEDIFKDDPRVLFCSSFQHPFYP
Bac_Pro_Gam_19   MGFCFFNNAAIAARHAVRDYGLERVAIVDFDVHHGNGTEDIVGDDPQILFCSTYQHPLYP
Bac_Pro_Gam_11   MGFCFFNNIAIAAEYALNQYSLKRVAIVDFDVHHGNGTEDIFKNEPRVLFCSSFEYPLYP
Bac_Pro_Gam_12   MGFCLFNNIAVAAAHALEHYALSRVAIADFDVHHGNGTEDIFRDDPRVLYCSSFQHPFYP
Bac_Pro_Bet_15   MGFCFFNNVAVAARHALDRRGLERVAIIDFDVHHGNGTEDIIANDDRVLMCSFFQHPLYP
Bac_Pro_Bet_11   MGFCFFNNVAVAARHALEIHGLERVAIIDFDVHHGNGTEAAFANDERVLMCSFFQHPLYP
Bac_Pro_Bet_17   MGFCFFNNVAIAARHALDVHGIERVAIIDFDVHHGNGTEAAFANDERVLMCSFFQHPLYP
Bac_Pro_Bet_18   MGFCFFNNVAIAARHALDVYGIERVAIIDFDVHHGNGTEAAFANDERVLMCSFFQHPLYP
Bac_Pro_Gam_13   MGFCVFNNVAVGAAHAMEGHGLSRVAIADFDVHHGNGTEDIFRDEPRVLFCSSFQHPFYP
Bac_Pro_Bet_3_[  MGFCYFNNVAVGIRHALAVHGLERAAVIDFDVHHGNGTEEIFRDDPQVMMASIFQHPFFP
Bac_Pro_Bet_2_[  MGFCIFNNVAVAAAQALDVHGLERVAIVDFDVHHGNGTEDIFRDDPRVMLCSTFQHPFYP
Bac_Pro_Bet_14   MGFCLFNNIAVAVAHALETHALKRVAVVDFDVHHGNGTEDIFQHDPRVMMVSTFQHPFYP
Bac_Pro_Bet_7_[  MGFCFFNNVAIGAAHALAHHGLQRVAIVDFDVHHGNGTEDIFQDEPRVLFCSTFQHPFYP
Bac_Pro_Bet_1_[  MGFCLFNNVAVGVAHAIEHYGLKRVAIADFDVHHGNGTEEIFHDDPRVMLCSTFQSPFYP
Bac_Pro_Bet_5_[  MGFCFFNNVAVAAQHAMDAYGLERVAIIDFDVHHGNGTEDIWAGDPRVLMVGIFQHPFYP
Bac_Pro_Bet_6_[  MGFCFFNNIAVAAAHALGAHHLSRVAIVDFDVHHGNGTEDCFKGDPRVLMVGTFQHPFYP
Bac_Pro_Bet_4_[  MGFCFMNNVAIAARHALDAHGLERVAIVDFDVHHGNGTEDIFRDDPRVMMAGIFQHPFYP
                 #################   #####################################   


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Bet_21   HRRMEPTP---SNAVLSPLPAGAGGEDIRNVVENVWLPEIDKFQPDLMILSAGFDAHCEE
Bac_Pro_Bet_9_[  FPDLDNGITGSANMLHTPFAAGTDSPTFRDTIRKQWLPRLAAFKPELVLLCAGFDAHRDD
Bac_Pro_Bet_13   FPETNHSANG-ANMLHLPFASNTGSRVFRTTVREQWLHKLTAFKPELVLLSAGFDGHKQD
Bac_Pro_Bet_10   FPENNDMPDG-GNMVHLPLPPGTGSRTFREAVRRQWLPRLAAFKPELVLLSAGFDAHRLD
Bac_Pro_Bet_16   FPGNNNMPDG-DNMVHLPFPPGTGSRAFRKAVRRQWLPRLAAFKPELVLLSAGFDAHRSD
Bac_Pro_Bet_8_[  FPENNDMPDG-SNMVHLPLLPGTGSVAFREAVRRQWLPGLAAFKPELVLLSAGFDAHRSD
Bac_Pro_Alp_1_[  GTGNRDEFGPHDTIRNIPLSAGTDGEVYRMIVTQQVLPKIRSFAPELILLSSGFDAHRDD
Bac_Pro_Alp_5_[  GTGRASETGAHGNVLNIPLRAGTDGAAMRAAYDLQVWPELEEFEPELILVSAGFDAHEAD
Bac_Pro_Alp_2_[  GSGRTDETGAYETVLNIPLAPGTGGAEMRAAYEAQAFPRLRAFKPELIIVSAGFDAHQDD
Bac_Pro_Alp_3_[  GTGRASETGAHDNILNLPLPPESGGAHMRREYQHKALPRLRDFAPQLIIISAGFDAHADD
Bac_Pro_Gam_20   GTGYPSETGA-GNIVNVPLRAGDTGIEFREKYQSLILPALDHFKPQLLLVSAGFDAHRDD
Bac_Pro_Gam_21   GTGYPSETGV-GNIINVPLAAGESGLEFRQKYSRIILPALRAFKPELLLVSAGFDAHRDD
Bac_Pro_Alp_8_[  GTGAKSETGA-GNIVNAPLSPDTGSDHFREAFKSRVLPALEEFRPDFILISAGFDAHHRD
Bac_Pro_Alp_10   GTGSAGERGEHDNIVNAPLASEDGGKEFRFAFETAILPQLKRFAPELIVISAGFDAHYRD
Bac_Pro_Alp_4_[  GTGHKNERGEHDTIVNAPLVEGMGGDEFRDAMNSVILPRIRSFDPDLIVISAGFDAHHRD
Bac_Pro_Alp_12   GTGSPSERGEKDTIVNVPLRPNDDGEVFREAFETGILSRLEAFRPDVIVISAGFDAHKLD
Bac_Pro_Alp_9_[  GTGALSETGAHGTIVNAPLNAGDGSEAFREAVETAILPRIHDFAPDLIVISAGFDAHWRD
Bac_Pro_Alp_13   GTGAASETGV-GNVWNAPLSEGDDCGPFRAAWTDRILPALDAFRPDLVLVSAGFDAHEGD
Bac_Pro_Alp_7_[  GTGAPSETGV-GNIVNVAVEPHAARESWRASFAGGLMPALDDFAPDLILISAGFDAHRRD
Bac_Pro_Alp_11   GTGAASERGM-GNILNVALPPGAKGDEFRAAWSERILPAVEGFSPGLILVSAGFDAHARD
Bac_Pro_Gam_17   GTGDAIETGV-GNIVNAPLPPDTRSQEFRQIWDGLLLPRLHDFRPQLVLISAGFDAHRLD
Bac_Pro_Gam_16   HTGSVYERGV-GNMHNVLLPPGSDGFRFRNTWADTLLPGLEEFRPQLVLVSAGFDAHLAD
Bac_Pro_Gam_18   HSGSVYERGA-GNIHNLLLPPGSDGLRFRNVWEDEMLPLVDAFRPQLILISAGFDAHLRD
Bac_Pro_Gam_8_[  NTVVENN----TTLVNSPLPIASDGNDLKAVFEQQWLPKLNAFKPDMLFISAGFDAHLED
Bac_Pro_Gam_6_[  HSHVHSQA---SNIINTPIAAGCAAIEYRKTIENAWMQKLRDFDPQLILISAGFDGHALD
Translation_of   ------------------------------------------------------------
Bac_Pro_Gam_14   FRGANTQE---KNIINIPLPAYTTGKTYREHVEKLWFKQIEDFSPDMIFFSAGFDAYYKD
Bac_Pro_Gam_15   HHELLTKQ---DHIIHTPLPAGTEGKQFRKQIEKQWLGKIDAFKPQMIFISAGFDGHRQD
Bac_Pro_Gam_4_[  WRYAETEW---ENIVNTPLDAHSGSLEFRRAIEASWLPAIQKFKPQLILVSAGFDAHRED
Bac_Pro_Gam_3_[  WRYQQGQW---DNVLNTPLSAGADGHEFRRRVEAQWLPALQAFKPQLVLLSAGFDAHRDD
Bac_Pro_Gam_1_[  WRYLRSEW---QNVVNTPLEVGTDSKEFRRIIERQWLPALHAFKPDLVMLSAGFDAHRDD
Bac_Pro_Gam_2_[  WRYLRSEW---QNVINTPLEVGTDGPEFRRIIENHWLPALHAFKPDLVMLSAGFDAHRDD
Bac_Pro_Gam_9_[  LRYYDIQR---PNIVNSPLRAGTTGYQFRNVIEQDWLPALHYHQPQMIFVSAGFDAHKAD
Bac_Pro_Gam_5_[  FRFQDIDK---PNIVNTPLPAGTGSAAFRQAIERDWLPALATHRPDMILVSAGFDAHRDD
Bac_Pro_Gam_7_[  FSGDKPTN---QHILNIPIPAGTKGDEYRQMI-MPWFDKLNDFVPEMIFISAGFDGHAED
Bac_Pro_Gam_19   ERALPSKP---GFLINAPLPEGAGGAEFRETITEHWLPELNAFKPQLVIISAGFDAHLED
Bac_Pro_Gam_11   HTGADTVS---DHIINLPLPGGCKASQWRAAVSSEWLPALDAFAPELILVSAGFDGHAED
Bac_Pro_Gam_12   DTPRAER----DHLIHTPLAAGTTGAQFRAAVRHDWLPALEQFRPQLVLVSAGFDAHRDE
Bac_Pro_Bet_15   NSGAQPLG---DNMVNLPVPAYTKGSEIRELIDRHWLPRLEAFRPQMLFISAGFDAHRED
Bac_Pro_Bet_11   FSGVDHQA---PNMVNLPMAARTNGMAVREAVDLMWLPRLDAFRPQMLFVSAGFDAHRED
Bac_Pro_Bet_17   FSGADHQA---PNMVNLPMPARSNGMAIREAVDMFWLPRLDAFKPQMLFVSAGFDAHRED
Bac_Pro_Bet_18   FSGVDHQA---PNMVNLPMPARSNGMAIREAVDMFWLPRLDAFKPQMLFVSAGFDAHRED
Bac_Pro_Gam_13   HSGADTVS---DHILNLPLPAGTDGAALRAAVEQHWLPALEAFRPELILVSAGFDGHLED
Bac_Pro_Bet_3_[  YSGDVPMG---PNMVNIPMKAGSTGADFRDAVMDGWLPRLREFKPQILFISAGFDAHRED
Bac_Pro_Bet_2_[  FAGADTAS---AHIVNVPLPAGTDGARYRDAFRAQIVPRLDAFAPQMLFCSAGFDGHRED
Bac_Pro_Bet_14   YSGIAGRS---ERMVNIPLPAGSNGKVFRKAVDEFWLPALERFKPQMLFVSAGFDAHADD
Bac_Pro_Bet_7_[  YCGTDSGG---DHIINVPLAAHTNGQAFRVAVTHYWLPALEAFKPEIIFISAGFDAHRED
Bac_Pro_Bet_1_[  YCGADSGN---DHIINVPLPAGTDGAAFRQAVSERWLPALERFQPEMLFISAGFDAHWED
Bac_Pro_Bet_5_[  YSGDIPKG---SNMHNVPLPRASTGQQFREAVCEQWLPRLNEFAPEMLFISAGFDAHLED
Bac_Pro_Bet_6_[  YSGTEHPA---FNMLNVPLSRGTDGEEFRNVVSDIWMPRLREFQPEMILISAGFDGHYED
Bac_Pro_Bet_4_[  YCGADDPP---AHMCNVPLPAGTRGDGFRQVFGDVVIPALRAHNPQMIFISAGFDAHYED
                                                                             


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Bet_21   RIAQLKAGEMDYACVTRLLVEASFAYCEGRLVSVLEGGYELRSLARSVFTHLQGLIRNPL
Bac_Pro_Bet_9_[  ETGRLKLHEADFAWLTHKIVQTASS-CKGKIVSALEGGYTLDSLAKSAAEHIHVLA----
Bac_Pro_Bet_13   ETGRLNLHEADFAWLTHKIIQAASS-CPGRIVSVLEGGYTLEPLAKSAAAHIGVLA----
Bac_Pro_Bet_10   ESGRLNLHEADFAWLTHKIIQTASG-CPGKIVSVLEGGYTLEPLAQSAAEHIRVLA----
Bac_Pro_Bet_16   ESGRLNLHEADFAWLTYKIIQTASS-CPGKIVSVLEGGYTLESLSKSAVEHIRVLA----
Bac_Pro_Bet_8_[  ESGRLNLHEADFGWLTHKIIQTASG-CPGKVVSVLEGGYTLESLSKSAAEHIRVLA----
Bac_Pro_Alp_1_[  PLASISLETQDFRWLTDQVAALAGEVCGGRLVSCLEGGYNLEALAEAAAVHVDGLI----
Bac_Pro_Alp_5_[  PLANLDWDTEDFAWLTRRLCEIAQDHCGGRLVSALEGGYDLDALAASAAAHVAELM----
Bac_Pro_Alp_2_[  PLANLNWSTGDFAWITAELCKIADEVCDGRIVSTLEGGYDLNALAEATRAHVEELM----
Bac_Pro_Alp_3_[  PLAQLNWSTEDFAWLTAEICEIAADVCQGRVVSTLEGGYDLNALSASVRAHVQELM----
Bac_Pro_Gam_20   PLSSIRLVEEDYRWVTQALKEIAGRHCQGRIVSVLEGGYNLKALAASVAVHVRGLM----
Bac_Pro_Gam_21   PLSSIRLVEDDYRWLTQELMEIAGIYCGGRMISILEGGYNLNALAASVAVHVKTLLASEV
Bac_Pro_Alp_8_[  PLAQINLVADDFDWATGRLLDAAGKTANNRIVSLLEGGYDLQGLAESAGTHIYRLM----
Bac_Pro_Alp_10   PLASLNLHAEDFAWVTQQLMEVADQTAGGRIVSVLEGGYDLQGLSESVAAHVGALM----
Bac_Pro_Alp_4_[  PLGGLRLKEVDFAWATQALMEIADKRCNRRVVSLLEGGYDLEGLARSVAAHVMTLM----
Bac_Pro_Alp_12   PLANLRLEAEDFGWATRRLMDLAERCAGGRIVSILEGGYSLEGLGKSVAAHVDALM----
Bac_Pro_Alp_9_[  PLASLNLMESDFAWATQKLMALAERHCGQRIVSVLEGGYDLEGLARSTAFHLDALM----
Bac_Pro_Alp_13   PLGGLRLVEDDFAWVTTRVAEVAHRHCGGRIVSMLEGGYVLDALARSSAAHVRALA----
Bac_Pro_Alp_7_[  PLAHQSLEAEDFAWATRAVLEVARRRCGGKVVSSLEGGYDLEGLGRSALAHIRALG----
Bac_Pro_Alp_11   PLAHLRLTEADFAWVTGEICAVARRVCGGRVVSMLEGGYDLDALARSVAAHVRALM----
Bac_Pro_Gam_17   PLAQLQLETEDYAWLTDRLMHLADAHAHGRLVSSLEGGYDLAALAAASAAHVRELM----
Bac_Pro_Gam_16   PLADLMLDAEDFAWLTTELLGIARRHCDGRLVSTLEGGYNIEALAECATAHVGALL----
Bac_Pro_Gam_18   PLADLMLDDDDFAWLTGALRTLADRHARGRVVSMLEGGYDLQALRESSVAHVAALR----
Bac_Pro_Gam_8_[  DMASLKFVEEDYRWLTEQLARFSEQHNCRGIVSYLEGGYALSALGRSAIAHVKALV----
Bac_Pro_Gam_6_[  PLAELNLEVEDYRWLTEMIVGVARDHANDRVISTLEGGYHLKALAESVAAHVQVLK----
Translation_of   ------------------------------------------------------------
Bac_Pro_Gam_14   ELANLLLTPDDYLWITQKVKQIADKTSNGRMLSVLEGGYNLQGLGECAVAHLHGLL----
Bac_Pro_Gam_15   IMANFQLEDDDYVWITKKIKQLADKHCPGHLISVLEGGYALSVLGQSVLQHICHLV----
Bac_Pro_Gam_4_[  PMGELNLEDDDYHWITNFLMDQAKSQCDGRLVSVLEGGYDLNSLARSVHRHIEALQ----
Bac_Pro_Gam_3_[  PMGGLNLLEDDYYWVTQLALDIARVYAEGRLVSALEGGYHLDSLATSVEAHLKALL----
Bac_Pro_Gam_1_[  PMGDICLEDEDFYWITHLAMEIAALYAENRVVSVLEGGYNPKTLASGAEAHLKALL----
Bac_Pro_Gam_2_[  PMGDICLEDEDFYWITHLAMEIATLYADNRIVSVLEGGYNPKSLASGVEAHLKALL----
Bac_Pro_Gam_9_[  PLGQLLLDESDYRWVTKLIVDAAACYADNRIVSTLEGGYDLEALAHSVHTHIDVLV----
Bac_Pro_Gam_5_[  PLAELMLDDEDFGWIGGLIMDAAKRYCEGRVVSVLEGGYNLNALGRSVQAYIEAML----
Bac_Pro_Gam_7_[  ALGHLRLVEADYEWVTLQIKNIADKHCGGKIVSMLEGGYALSALSRSVVSHIKALM----
Bac_Pro_Gam_19   EMAGLRLVEADYAWVTKELRKIADEYSEGRIISLLEGGYDTSALARSVVAHLKVLM----
Bac_Pro_Gam_11   DMAHFMLREEDYHWLATELKTVANKHCQGRVVAMLEGGYALSALGRSVVAFLKGLM----
Bac_Pro_Gam_12   ALAGLNLDADDFSWITHELTRIAARYAGARLVSMLEGGYALPALGRSAAAHVRALC----
Bac_Pro_Bet_15   DLGQLGLVESDYAWITRRLKGVAERHADGRIVSCLEGGYALSALARSVASHVRVLA----
Bac_Pro_Bet_11   DIGGMGLVEADYEWLTQQICEVARRHAQGRIVSCLEGGYNLSALGRSVVAHLRVLA----
Bac_Pro_Bet_17   DIGNLGLVESDFEWLTAQVVDVARRHAQGRIVSCLEGGYNLSALGRSVVAHLRVLA----
Bac_Pro_Bet_18   DIGNLGLVEADFEWLTAQIVDVARRHAQGRIVSCLEGGYNLSALGRSVVAHLRVLA----
Bac_Pro_Gam_13   DLAGFRLVESDYAWLTGALYDIAKRHCDGRLVSVLEGGYNLSALGRSVAAHLKVLS----
Bac_Pro_Bet_3_[  DMGMMGLVEADYEWVTRQLLKFADEYCEGRVVSVLEGGYDLSALGRSVTAHVRVLT----
Bac_Pro_Bet_2_[  DMAQFGLLEADYVWITEQVMAVAARHACGRIVSVLEGGYDLSSLGRSAAAHIKTLA----
Bac_Pro_Bet_14   ELASLNLVEDDYAWVTEKIKEVARAYAGKRIVSVLEGGYALAALARSVAAHIEVLM----
Bac_Pro_Bet_7_[  TLAQLNLVEADYVWITRQIMAIAEKHAQNRIVSVLEGGYALGALGRSVTTHIRTLA----
Bac_Pro_Bet_1_[  DMAMFKLKEADYAWVTQQVKDVAEKHAQGRIVSALEGGYELHALGRSVAAHIKVLS----
Bac_Pro_Bet_5_[  DMGSLGLVEADYAWVTRQLMKVAEVHSSRRIVSMLEGGYELSALGRSVAEHVRVLT----
Bac_Pro_Bet_6_[  EMGGLKLLEKDYAWVTVQLKQLAEEFAQKRIVSILEGGYSLSALARSVVAHIRVLA----
Bac_Pro_Bet_4_[  DMGSMGLLEADYVWATEQIKAVANDCGHKRIVSLLEGGYSLSSLARSVVAHIKSLA----
                                                                             


                        370       380       390       400
                 =========+=========+=========+=========+====
Bac_Pro_Bet_21   PAETCKDPN-----------------------------------
Bac_Pro_Bet_9_[  --GMKKSDAAVQYDHFLKNDGRKKILNKLSMRPSEKTGNTSKSP
Bac_Pro_Bet_13   --GLPKAGYVAAYQKHLKRGGQKKENTAPASQIGRLKTENRF--
Bac_Pro_Bet_10   --GLGKSDAATAYQKTLDPTKKRFAKPKTGQVRQPTQSDRYDI-
Bac_Pro_Bet_16   --GLGKSDTVTAYQKNLYRNRNKRFAKPKSL-------------
Bac_Pro_Bet_8_[  --GLGKSETAAAYQAELDRNREHVPPGPNPA-------------
Bac_Pro_Alp_1_[  --AAAA--------------------------------------
Bac_Pro_Alp_5_[  --EHSR--------------------------------------
Bac_Pro_Alp_2_[  --KAAQ--------------------------------------
Bac_Pro_Alp_3_[  --KAAT--------------------------------------
Bac_Pro_Gam_20   --GQ----------------------------------------
Bac_Pro_Gam_21   QAGK----------------------------------------
Bac_Pro_Alp_8_[  --RG----------------------------------------
Bac_Pro_Alp_10   --GA----------------------------------------
Bac_Pro_Alp_4_[  --NQ----------------------------------------
Bac_Pro_Alp_12   --GR----------------------------------------
Bac_Pro_Alp_9_[  --GRETGA------------------------------------
Bac_Pro_Alp_13   --ASAS--------------------------------------
Bac_Pro_Alp_7_[  --EA----------------------------------------
Bac_Pro_Alp_11   --DA----------------------------------------
Bac_Pro_Gam_17   --A-----------------------------------------
Bac_Pro_Gam_16   --A-----------------------------------------
Bac_Pro_Gam_18   --------------------------------------------
Bac_Pro_Gam_8_[  --DYE---------------------------------------
Bac_Pro_Gam_6_[  --SVS---------------------------------------
Translation_of   --------------------------------------------
Bac_Pro_Gam_14   --S-----------------------------------------
Bac_Pro_Gam_15   --NPPV--------------------------------------
Bac_Pro_Gam_4_[  --KM----------------------------------------
Bac_Pro_Gam_3_[  --GLPLGHP-----------------------------------
Bac_Pro_Gam_1_[  --GLPFTDVP----------------------------------
Bac_Pro_Gam_2_[  --GLPFAEVP----------------------------------
Bac_Pro_Gam_9_[  --NG----------------------------------------
Bac_Pro_Gam_5_[  --EG----------------------------------------
Bac_Pro_Gam_7_[  --N-----------------------------------------
Bac_Pro_Gam_19   --NI----------------------------------------
Bac_Pro_Gam_11   --------------------------------------------
Bac_Pro_Gam_12   --EAPRR-------------------------------------
Bac_Pro_Bet_15   --GLTD--------------------------------------
Bac_Pro_Bet_11   --GV----------------------------------------
Bac_Pro_Bet_17   --GI----------------------------------------
Bac_Pro_Bet_18   --GI----------------------------------------
Bac_Pro_Gam_13   --ET----------------------------------------
Bac_Pro_Bet_3_[  --DI----------------------------------------
Bac_Pro_Bet_2_[  --AL----------------------------------------
Bac_Pro_Bet_14   --KP----------------------------------------
Bac_Pro_Bet_7_[  --E-----------------------------------------
Bac_Pro_Bet_1_[  --GL----------------------------------------
Bac_Pro_Bet_5_[  --GE----------------------------------------
Bac_Pro_Bet_6_[  --EI----------------------------------------
Bac_Pro_Bet_4_[  --DL----------------------------------------
                                                             






Parameters used
Minimum Number Of Sequences For A Conserved Position: 26
Minimum Number Of Sequences For A Flanking Position: 43
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes

Flank positions of the 5 selected block(s)
Flanks: [43  52]  [55  69]  [128  156]  [164  197]  [201  237]  

New number of positions in input.fasta-gb:  125  (30% of the original 404 positions)



Gblocks 0.91b Results

Processed file: input.fasta
Number of sequences: 51
Alignment assumed to be: Protein
New number of positions: 263 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Bet_21   --------------MMQIPQLHKRMPDTLPKDWRLLPTGYFTHQLVGLPNPLDDAPESPD
Bac_Pro_Bet_9_[  ----------------MKNLIRRLRIILRRILGVRARTVWISHPIFLRHEPGGTHPESPQ
Bac_Pro_Bet_13   -------------------------------MGKNARTVWISHPVFAQHQPGTGHPDSPE
Bac_Pro_Bet_10   --------------MSLTRLILKFYALLRLFLCKNARTAWISHPACAGHEPGANHPDSPD
Bac_Pro_Bet_16   --------------MFLTRLILKFYALLRLFLGKNARTAWISHPACAGHEPGANHPDSPE
Bac_Pro_Bet_8_[  --------------MPPIRLILKFYSLLRLFSGKNARTVWISHPACAGHEPGANHPDSPE
Bac_Pro_Alp_1_[  -----------------------------------MTTALFTHPDCLNHLTPEGHPEQVA
Bac_Pro_Alp_5_[  -----------------------------------MATALFTHDDSLRHLTPPGHPERVE
Bac_Pro_Alp_2_[  -----------------------------------MKTALLTHADCLNHATPEGHPERVA
Bac_Pro_Alp_3_[  ---------------------------------MTSKTALLTHADCLAHVTPDGHPEQVA
Bac_Pro_Gam_20   -----------------------------------MRTLYYSHPDFLLHATGAGHPERPA
Bac_Pro_Gam_21   -----------------------------------MKTLYYSHADFLLHDTGIDHPESAD
Bac_Pro_Alp_8_[  -----------------------------------MTTILFENPIFLEHQVPEGHPERPD
Bac_Pro_Alp_10   -----------------------------------MTTLFLTHSACLEHHTPEGHPERAE
Bac_Pro_Alp_4_[  -----------------------------------MSTLYLHHPSFLEHLTPLGHPERPD
Bac_Pro_Alp_12   -----------------------------------MTTLYVSHPASFDHEVPEGHPERPA
Bac_Pro_Alp_9_[  ---------------------------------MHMSTLYIAHPASLEHQTPIGHPERPD
Bac_Pro_Alp_13   MSGPTHAGPTRRGLVAGSAAFGLTAGSGRAAEPATGRTLLITHPAFAGHETGLGNPERPA
Bac_Pro_Alp_7_[  -----------------------------------MSVSLFTHPDMIAHAPGAGHPERPE
Bac_Pro_Alp_11   -----------------------------------MDLLLLTHRACLGHDMGFEAMERPA
Bac_Pro_Gam_17   ------------------------------------MIRLYTHPACLQHDPGPGHPESPA
Bac_Pro_Gam_16   -------------------------------------MLAYTHPACLEHDTGPDHPECPQ
Bac_Pro_Gam_18   -------------------------------------MLVFTHPACLGHDAGPEHPESPA
Bac_Pro_Gam_8_[  -----------------------------------MRTAIISHPHCRKHKMIDDHPECPE
Bac_Pro_Gam_6_[  -----------------------------------MTTAFFSHDDCLKHNMGPEHPECPE
Translation_of   --------------------------IGHYPKSALKPMYLYTHPDCENHKLAQ-HPERPE
Bac_Pro_Gam_14   -----------------------------------MQIGFISHKDCLLHDMGDFHPEQPD
Bac_Pro_Gam_15   ------------------------------------MLAFISHRDCLLHDMGASHPECPE
Bac_Pro_Gam_4_[  -----------------------------------MITSFITHEDCALHDMGPWHPENPM
Bac_Pro_Gam_3_[  -----------------------------------MITAYITHPHCMRHLMGPTHPESPK
Bac_Pro_Gam_1_[  -----------------------------------MITAYLTHPDCALHHMGPEHPESPQ
Bac_Pro_Gam_2_[  -----------------------------------MITAYLTHPDCSLHHMGPEHPESPQ
Bac_Pro_Gam_9_[  -----------------------------------MTTTFITHGDYLLHSMGEQHPECPE
Bac_Pro_Gam_5_[  -----------------------------------MTTALISHVDCELHQMSAGHPESPE
Bac_Pro_Gam_7_[  -----------------------------------MPITFISSPKCLLHDMDPEHPEQPA
Bac_Pro_Gam_19   -----------------------------------MTIAIITHSDCLKHEMGIGHPERPQ
Bac_Pro_Gam_11   -----------------------------------MAITIFSHAICRQHVAGDDHPECPA
Bac_Pro_Gam_12   ----------------------------------MTHTAYISHPDCLLHDSGPHHPERAD
Bac_Pro_Bet_15   -----------------------------------MATAYYSHPACRTHDMGDGHPECPQ
Bac_Pro_Bet_11   -----------------------------------MPTAFYTHPDCLLHEMGEWHPESPA
Bac_Pro_Bet_17   -----------------------------------MATAFYTHPDCMLHEMGEWHPECPA
Bac_Pro_Bet_18   -----------------------------------MATAFYTHPDCMLHEMGEWHPECPA
Bac_Pro_Gam_13   -----------------------------------MKLFFISHPNCSRHRGPGYHPESPE
Bac_Pro_Bet_3_[  ----------------------------MKNGLQSGLTAYITHSDCMLHNVGDMHPECPQ
Bac_Pro_Bet_2_[  -----------------------------------MHTAYLTHADCLMHDMGSWHPESPA
Bac_Pro_Bet_14   -------------------------------MRPASHTAFISHPDCLLHEMDFYHPESPA
Bac_Pro_Bet_7_[  -----------------------------------MTTAFVTHPIYLKHDMKHGHPECPE
Bac_Pro_Bet_1_[  -----------------------------------MHTAYITHPDCLKHDMGADHPECPA
Bac_Pro_Bet_5_[  ----------------------------------------MSHSSCSMHDMGKGHPECPE
Bac_Pro_Bet_6_[  ----------------------------------MTSTAFITHRDCQLHDMGSYHPEAPE
Bac_Pro_Bet_4_[  ----------------------------------MTTTAFITHRDCWLHDMGSMHPECPD
                                                           ##################


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Bet_21   RIEAIEARLMLAGLEGRVRRVECGPAPREA--VLLAHDSQYVDDLEHASLGDPEA-----
Bac_Pro_Bet_9_[  RITAILEELKRRKIWRRLQAAEAEEVSDAQ--LALVHPRRYLRFLESVQ---PQE---GK
Bac_Pro_Bet_13   RTAVIEAELKRQDIWRHLQTAEAEEISDTR--LALVHPRKYLRSLEACQ---PQP---DK
Bac_Pro_Bet_10   RILCIEQALRRAGIWQHLQTIEAEEISDTH--LALVHSSKYLNRLESCL---PQK---GK
Bac_Pro_Bet_16   RISSIEQALRRSGVWQHLQTVEAEEISDMH--LALAHTSKYLNRLESCR---PEN---DK
Bac_Pro_Bet_8_[  RIGSIEQALRRSGVWRRLQTLDAEEISDAR--LALAHTSKYLNRLESRL---PED---GK
Bac_Pro_Alp_1_[  RLSRVLSALEGK----ALDRHEAPLAEEAD--LLLCHPQGYIDRVRGAE---PAE---G-
Bac_Pro_Alp_5_[  RAQAMAAALAAPRF-DGLVRRASPLAAEAE--VLRAHPARHLEAIRANI---PLT---G-
Bac_Pro_Alp_2_[  RLEHILHALEDL----DLQRVTAPLAADDD--LLRVHPQSHISDILDQR---PSD---G-
Bac_Pro_Alp_3_[  RLEHVLYALQPL----EVARITAPLAADDD--ILRIHPASYLAELRRAS---PSE---G-
Bac_Pro_Gam_20   RLKAIGQALEQAEF-AKLIRVLAPLGTEQQ--ATLIHPAAHIQHLRDAL---PNQ---R-
Bac_Pro_Gam_21   RLRSIAKALAAPEF-SGLIRASPPPGTEQQ--IRLIHTQAHIDAILNAV---PLH---G-
Bac_Pro_Alp_8_[  RLKALNLALEHERF-SSLSRLEAPQGNEDL--VLLAHPEEHLRTVMSAM---PEE---G-
Bac_Pro_Alp_10   RLIAVNKTLTAERF-ATLARGEAPIGSLEH--IALCHTDHHIVEMRHMS---PST---G-
Bac_Pro_Alp_4_[  RLRAIDRILENERF-HTLERDRAAVGRFVD--AARVHPPAYINQLHRMR---PDE---G-
Bac_Pro_Alp_12   RMRAVERALEDERF-AGLVRATAPRGEIEA--VTLAHPRAYVDALVAAV---PEH---G-
Bac_Pro_Alp_9_[  RIRAIERALEKERF-TSLVRELAPMAEMES--LTLAHPQDYIVRLRDIS---PRE---G-
Bac_Pro_Alp_13   RMRAVDQALSAQDF-AALRREEAPMRDDAQTAILRVHSPVHLDRIRAAA---AGTRA-G-
Bac_Pro_Alp_7_[  RLAAVLAALDDSDL--SLDRCAATEAAVTD--LERIHPAAYVSRMIEAS---PAQ---G-
Bac_Pro_Alp_11   RLRVVLEALEAQCF-SMLAREEAPRATREQ--LMRVHPASYVDTILATR---PEGD--G-
Bac_Pro_Gam_17   RLRAVLDALDHDSF-AALDRVEAPRASRLQ--LLRTHTLEHVARILEAR---PDE---N-
Bac_Pro_Gam_16   RLRAVLDALGRA--WPALQWREAPMALRGD--LLRVHSGELVDQVLA-----PVAE--G-
Bac_Pro_Gam_18   RLEAVVQALR--GAFPDLDWREAPLAKLGD--LCRVHEREQVDAVLETA----FD---G-
Bac_Pro_Gam_8_[  RLDAINDRLLASGLDIAIEQKQAPKAQREH--YLLAHDESLVSFVESKI---PTQ---G-
Bac_Pro_Gam_6_[  RISAILSYLAETGLDQSLDWVRPEEITRDQ--LLTVHPEQYLHQLDLMQ---PTR---G-
Translation_of   RLRAVINRLVETGMTQDMKVKLAEELSDDV--LIHVHPSKYVETINRSE---PTI---S-
Bac_Pro_Gam_14   RLRSIEQAVKASDLNKVITYYEAPLATREQ--LLRVHDEEYVDFIFKIA---PSQ---G-
Bac_Pro_Gam_15   RLKVIADAVKHSQLEEKIHYYNAPLAKKED--LLRVHDKQYIDYLFNIN---PGE---K-
Bac_Pro_Gam_4_[  RLNAIIEQLKLSGLMNQLMQYKARPVTDEQ--LFRAHPKAHVRSLQLSL---PEE---G-
Bac_Pro_Gam_3_[  RLEAIRARLALTGILTHTMQSDAPPVTRET--LALAHSPQYLDALEAHA---PTQ---G-
Bac_Pro_Gam_1_[  RLEAIRARLSLAGLLQQTMQADAKEACDEA--LARVHPTRHLNALEKCL---PKE---G-
Bac_Pro_Gam_2_[  RLEAIRARLSLAGLLQQTMQADAKEACEEA--LARVHPLRHLRSLDKCL---PTE---G-
Bac_Pro_Gam_9_[  RLGAITSYLASTELGNQVTWLSAESATNEQ--LERVHPADYIRRLDSMQ---PQR---G-
Bac_Pro_Gam_5_[  RLRAIHRQLELSGMLERLDLLVASPASRAQ--LELAHPDHYIDAICDLH---PER---G-
Bac_Pro_Gam_7_[  RLHSINDQIISSGVEFAINFVDTPPVQLAQ--LYRAHDNQFVDKIIKEA---PTE---G-
Bac_Pro_Gam_19   RIRAIEDQLITSGIGDFMHYYDAPLATPEQ--LELAHSRKHIDYIFGKSP--PDD---SM
Bac_Pro_Gam_11   RLDAINDQLIRSGLDYVLQQKDASPASKTD--LCRAHSTRYVSELYAKA---PAD---G-
Bac_Pro_Gam_12   RLHAVRNALLDEGLMEGLHLLDAPPATDAQ--LQRVHTPTHVARIRANA---PAL---GH
Bac_Pro_Bet_15   RLDAIADHLIATGLDIALEQREAPPVDEGT--LALAHESLYVANLRGFM---EQVEATGQ
Bac_Pro_Bet_11   RLSAIQDQLIASRIDDLIVHETAPFASETA--LARVHTQAHIDYIRSRI---PKE---G-
Bac_Pro_Bet_17   RLSAIQDQLIASRIDDLIVHETAPFASEVA--LGRVHTQAHIDYIRGMT---PVD---G-
Bac_Pro_Bet_18   RLSAIQDQLIASRIDDLIVHETAPFASEVA--LGRVHTQAHIDYIRSMT---PVD---G-
Bac_Pro_Gam_13   RLSAIDDQLIAAGVEPWLRHREAPLASREQ--LLRVHSPEYLDALAEGA---PGP---GE
Bac_Pro_Bet_3_[  RLVAIRDQLMASQIFDSLHEVEAPEVTDEQ--LARVHTPRYLEYLEMSQ---PLT---G-
Bac_Pro_Bet_2_[  RLRAIDDRLHAAHLFDHLAHHEAPRVQRAQ--LLRVHDAAYVDFIEASS---PEH---G-
Bac_Pro_Bet_14   RLKAIEDELSASGLMDKLRRYQAPLATVGQ--LERVHTREHIARLHAAA---SRAASGG-
Bac_Pro_Bet_7_[  RLLAIQEQLVATDTLPRLQQYEAPRATDDQ--LMRAHTESYVHEIKSAA---PQQ---G-
Bac_Pro_Bet_1_[  RLRAIEDQLIASGLLTFLQHHDAPLATFEQ--LARVHKPQYIEAVQAAA---PQH---G-
Bac_Pro_Bet_5_[  RLAAIQDRLIAAGLWDYLLHVDAPPALREQ--IERVHCADYLDDLARRS---PAV---G-
Bac_Pro_Bet_6_[  RLNAINDHMIAQGLDSYFVYHDAPLVTFQQ--LHRVHTAAHLERLKRAS---PEL---G-
Bac_Pro_Bet_4_[  RLSAINDRLIAAGLDMYISFYDAPVATREQ--IIRAHPENYLDELLDSV---PEH---G-
                 ##########################      #############               


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Bet_21   LKRFTEPDTRVGEDTFSCAMASAGAVARAVDAIYGRS--VKN-AFCAVRPPGHHASRSRA
Bac_Pro_Bet_9_[  IYRLD-DDTVISNRSLEAARFAAGAVIKAVNMVMDKK--ACH-AFCAVRPPGHHAQSSQA
Bac_Pro_Bet_13   IYRID-NDTVMSHGSLKAARYAAGAVVQAVDMVMNKK--AWH-AFCAIRPPGHHAHSDKA
Bac_Pro_Bet_10   IFRLD-NDTAISTGSLSAAHFAAGSAVQAVDMVMNRK--AWH-AFCAARPPGHHAGSGKA
Bac_Pro_Bet_16   IFRLD-DDTVISKNSLSAARFSVGSVVQAIDMVMNRQ--AWH-AFCAARPPGHHAGSGNA
Bac_Pro_Bet_8_[  IYRLD-DDTVISKNSLSAARFSAGSVVQAVDMVMKRK--AWH-AFCAARPPGHHAKSGKA
Bac_Pro_Alp_1_[  QVQMD-PDTWMSPGSYRAALRSAGGAIAAVDAVLDGR--ADN-AFVATRPPGHHAETESP
Bac_Pro_Alp_5_[  FNPVD-GDTFMSEGSFDAALRAVGGCGAAVDAVLAGE--VTN-AFVACRPPGHHAERSRS
Bac_Pro_Alp_2_[  FKQID-GDTFMSPGSVDAAYRAAGAVVRAVDLVLGGE--APN-AFCAIRPPGHHAETEAA
Bac_Pro_Alp_3_[  HRALD-ADTWMSPGSLDAAFRGAGAMVRAVDMVLGGE--APN-AFAAVRPPGHHAETDTP
Bac_Pro_Gam_20   RYPLN-PDTVLSPGSLTAAFRAVGAVCDAVDRIMADT--ADN-AFCAVRPPGHHAEPMQA
Bac_Pro_Gam_21   LRYLD-SDTVLSPGSGKAALRAVGTVCDAVDRILADE--ADN-AFCAVRPPGHHAESERA
Bac_Pro_Alp_8_[  INAIE-ADTYASPASLQAALTGIGGAVAAVDAVFSGK--ADN-AFVAARPPGHHAEKNQA
Bac_Pro_Alp_10   IVYVD-GDTSMSPGTFEAALRGVGGAVSAVDAVMKGS--AAN-AFVATRPPGHHAEVTKP
Bac_Pro_Alp_4_[  LVHVD-HDTTMSPGTWDAAMRGVGASCQAVDEVMSGR--VVN-AFCALRPPGHHAERQRA
Bac_Pro_Alp_12   MVGID-SDTILSAGSLEATLRAVGGGMHAVDAVVGGE--CRN-AFVAMRPPGHHAERTRA
Bac_Pro_Alp_9_[  LVRID-EDTVMSPGTYEAALRGAGGAVLAVDEVMSGR--ATN-AFVAMRPPGHHAERTRA
Bac_Pro_Alp_13   PVHLD-PDTVVSAGTWEAVIRAVGAGLRAVDAVMDRGSGIAN-AFCQIRPPGHHAGRDTA
Bac_Pro_Alp_7_[  LAQLD-ADTILSSGSVRAARLAAGAVIDAVRAVAEGR--TAR-AFAAVRPPGHHAEPDQA
Bac_Pro_Alp_11   HVVID-GDTAMGSGSAEAALHAAGAGIAAVDAVMRGE--FAR-AFCAVRPPGHHAEPARA
Bac_Pro_Gam_17   GLRLD-EDTVMSPGSAEAALRAAGAVVAAVDAVMTGA--CER-AFCAVRPPGHHATADTA
Bac_Pro_Gam_16   LHRLD-PDTVVGPGSGRAALYAAGAGIAAVDGVMDGR--ERT-AFCAVRPPGHHATADAA
Bac_Pro_Gam_18   YRQLD-VDTRMVPASRAAALRAAGAGIAAVDALMQDQ--TRT-AFCAVRPPGHHATAQVS
Bac_Pro_Gam_8_[  LVDLD-GDTWLCPDSLKAIERAVGAGILAVDEILEGN--LDA-AFCSVRPPGHHANRTTS
Bac_Pro_Gam_6_[  RVFTD-PDTAMMPDTLRAARLSAGANVQAVDMIMSGQ--VTN-AFVCARPPGHHAERAKS
Translation_of   TVRLD-PDTYMSPGSLRAAKLAAGACVAAVSDILQEK--TDR-AFCAIRPPGHHAEVAAA
Bac_Pro_Gam_14   LVPLD-PDVWMNPHSLQAALRAAGAVVYGVELILKNE--IDA-AFCNVRPPGHHAERNKA
Bac_Pro_Gam_15   IIPLD-PDTWMNQHTLQAALRAAGSVILAVDLVMNKT--CEA-AFCNVRPPGHHAEKSQA
Bac_Pro_Gam_4_[  FTSIE-DETLLAPRSLEAASYAAGAVVRGVDQIFKNQ--ADN-VFCAVRPPGHHAERVES
Bac_Pro_Gam_3_[  LHELD-GDTHMGQDTLTAARLAAGAVVRGVDQVFRHQ--ADN-VFCAVRPPGHHAERGTA
Bac_Pro_Gam_1_[  IVTLD-SDTMMNPDSLKAARVAAGAVIRGVDQVFKRQ--ADN-VFCAVRPPGHHAEAADA
Bac_Pro_Gam_2_[  IVTLD-SDTMMNPDSLKAARVAAGAVIRGVDQVFKRQ--ADN-VFCAVRPPGHHAEASDA
Bac_Pro_Gam_9_[  LVYAD-PDTALNPHTMHAARLAAGAVTMATELVLSGK--ISN-AFCAVRPPGHHAEHNTA
Bac_Pro_Gam_5_[  LSYAD-PDTALNPHSLRAADLAAGAVVQGVDRVLDGL--ADN-VFCAVRPPGHHAEHDAA
Bac_Pro_Gam_7_[  HKWLD-DDTLMMPQSLDAAMHAAGAGIHAVDLIMNGD--SNK-AFCAVRPPGHHAEYAKS
Bac_Pro_Gam_19   MAHID-PDTFMNEFTLQAALRSAGSAISAVDKVLGDK--TEKRVFCNVRPAGHHAERDAA
Bac_Pro_Gam_11   HIWLD-PDTQMMSKTLQAALYAAGSGINAVDDVMQAS--DKQ-AFCAIRPPGHHATHDQA
Bac_Pro_Gam_12   HALLD-PDTAMGEHSLQAALRAAGAGIEGVRAVMEED--VDN-AFCAIRPPGHHAERERA
Bac_Pro_Bet_15   RRALD-PDTVAGPGTWAAALHAAGAAVAATDAVLDGE--IEN-AFCAVRPPGHHATRRQA
Bac_Pro_Bet_11   YVEID-PDTSLNRYTWRAALRAAGAAVEATDAVLEGR--YDN-AFCSVRPPGHHAEPARA
Bac_Pro_Bet_17   YVEID-PDTLMNRDTWRAALRAAGAAIAATDAVIEGR--YAN-AFCSVRPPGHHAEPARA
Bac_Pro_Bet_18   HVEID-PDTLMNRDTWRAALRAAGAAIAATDAVIEGR--YAN-AFCGVRPPGHHAEPARA
Bac_Pro_Gam_13   WTTLDGGDTYFGEHSLDAAHHAAGAVVLAVDLVLANS--THT-AFCSVRPPGHHAGADYG
Bac_Pro_Bet_3_[  TFRVD-PDTALMPNTLKAARRAAGGVVKAVDMVCQGQ--APN-AFCAIRPPGHHAESSKA
Bac_Pro_Bet_2_[  VRALD-ADTSMNPHTLSAALRAAGGAAMAVDLVMGDD--TAN-AFVACRPPGHHATRRRA
Bac_Pro_Bet_14   FVYLD-PDTAMNRHSLGAAYRAAGAVVLAADLVIEGA--AEN-AFCSIRPPGHHAERGYP
Bac_Pro_Bet_7_[  LVCLD-NDTAMNPFTLEAAYYAAGAVVLATDLVIDKQ--VKN-AFCAVRPPGHHATRNQA
Bac_Pro_Bet_1_[  LVYLD-PDTAMNPFTLNAALRAAGAVVLATDLVLERK--VEN-AFCAIRPPGHHAESGRA
Bac_Pro_Bet_5_[  TVQLD-PDTAINAYTLRAAYHAAGAGIKAVDLIMSGR--AQN-AFCAIRPPGHHAERARS
Bac_Pro_Bet_6_[  IVHLD-PDTAMNRHTWQAALRAAGAGIKAVDLVMAGE--VEN-AFCAVRPPGHHAERAAA
Bac_Pro_Bet_4_[  IRHLD-PDTAMSPGTMKAALRSAGAGVMATDLVMAGE--IEN-AFCAVRPPGHHAERAKA
                        #############################       #################


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Bet_21   SGFCYLNNAAIGALWAQKRWRAERVMVLDFDAHHGDGTEEILADRPGVRFLSLFQWPLFP
Bac_Pro_Bet_9_[  GGFCLLNNVAVGAMHAIAEYRLQRIAIIDFDVHYGDGTAEIFKDDPRILFFNAFETDLFP
Bac_Pro_Bet_13   GGFCLLNNVAAGVMHAIAEYRLQRIAVIDFDVHYGDGTAEIFKDDPRVLFMNLFETDLFP
Bac_Pro_Bet_10   GGFCLLNNVAAGVMNAIAEYRLKRIAVIDFDVHYGDGTAEIFKDDPRILFFNLFETDLFP
Bac_Pro_Bet_16   GGFCLLNNAAVGTMYALAEYRLNRIAVIDFDVHYGDGTAEILKNDSRILFFNLFETDLFP
Bac_Pro_Bet_8_[  GGFCLLNNVAAGAMYALAEYRLNRIAVIDFDVHYGDGTAEILKNNPNILFFNLFETDLFP
Bac_Pro_Alp_1_[  MGFCLFGNVALAAKHALERRGLQRVAIFDPDVHHGNGTQDLVQSDPRILFISTHQQPLYP
Bac_Pro_Alp_5_[  MGFCLFGNIAIAAKRALDLHGLHRVAIVDFDVHHGNGTQDILWDDPRVLFISSHQWPLYP
Bac_Pro_Alp_2_[  MGFCLFGNAALAAKHALDHHGLNRVAVVDFDVHHGNGTQDLLWDEKRALVITSQQMPLWP
Bac_Pro_Alp_3_[  MGFCLFGNAALGVKHALDHHGLNRVAVVDFDVHHGNGTQDLLWDEPRALLISSQQIPLFP
Bac_Pro_Gam_20   MGFCLFNNIAIAAEHARQHYHLQRVAIVDFDVHHGNGTQAAFYHQPQVFYASSHEMPHYP
Bac_Pro_Gam_21   MGFCLFNNIAIAAEYARTHHQLKRIAIVDFDVHHGNGTQTAFYEQPAVLYASSHEVPHYP
Bac_Pro_Alp_8_[  MGFCFFNTIAIAARHAQRRHGAERVAIVDWDVHHGNGTQDIFWDDPSVLFCSTHQMPLYP
Bac_Pro_Alp_10   MGFCFFGNAAIAARYAQRKYGIERAAVVDFDVHHGNGTQDIFWGDRTVMYCSTHQMPLFP
Bac_Pro_Alp_4_[  MGFCYFNNAAVAARHAQEVHGADRVAIMDFDVHHGNGTQEIFWDDPTVMYTSTHQMPLYP
Bac_Pro_Alp_12   MGFCLFNHAAIAARHARQKHGAERVALVDWDVHHGNGSQDIFWNDASVLYCSTHQMPLYP
Bac_Pro_Alp_9_[  MGFCFFNNAAIAARHAQKRYGAERVAIFDWDVHHGNGTQDIFWSDASVLYCSTHEAPLYP
Bac_Pro_Alp_13   MGFCLFNAVAIAARHARVRHGAERVAVVDFDVHHGNGTQEAFRSDRSLFYGSTHRMPWFP
Bac_Pro_Alp_7_[  MGFCLFSNVAVAARVAQTL-GMARVAVVDFDVHHGNGTQAAFEADDSLFLASIHQMPLYP
Bac_Pro_Alp_11   MGFCLFSNIAVAARHAQEVHGAGRVAILDFDVHHGNGTQAVFERDPSVFFASSHQMPLYP
Bac_Pro_Gam_17   MGFCLFNSVAVAAAHAIAEHRLKRVAIVDFDVHHGNGTQDIFAREPKVLYVSSHQAPLYP
Bac_Pro_Gam_16   MGFCLFNNIAVAAAHARDRHGLERVAIVDFDVHHGNGTQAIFQRDPAVAYFSTHQSGLYP
Bac_Pro_Gam_18   MGFCLFNNIAVAAAHARDRHGLERITIVDFDVHHGNGTQAIFERDPAVQYLSTHQSGLYP
Bac_Pro_Gam_8_[  SGFCVFNNLAIAVKYAQSK-GVKRIAIVDFDVHHGNGTQDIFIDDKNVLFCSLFQHPFYP
Bac_Pro_Gam_6_[  MGFCFYNNIALAAMRALTFHQLERVAIIDFDVHQGNGTVDIVGGDERILMCSSFQHPFYP
Translation_of   MGFCIFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVDIFKNRPEVLVCSSFQENY--
Bac_Pro_Gam_14   MGFCIFNNVALGVAHALEQLDLERVAIVDFDVHHGNGTEDIFKRDERVLYCSTFQHPFYP
Bac_Pro_Gam_15   MGFCFFNNIAVGAAYALARYDLKRIAIIDFDVHHGNGTENIFQNNEHILLCSSFQYPFYP
Bac_Pro_Gam_4_[  MGFCFYNNVAVGALHALEHHKLDRVAIFDFDVHHGNGTVDVFRNDPRVLVCSSFQHPFYP
Bac_Pro_Gam_3_[  MGFCFYNNIAVGLAHARQRHGVERVAVLDFDVHQGNGTVDIFKNDPGVLICSSFQSPFYP
Bac_Pro_Gam_1_[  MGFCFYNNIAVGAAHAKAKYGAKRIAILDFDVHQCNGTIDIFKNDPEVLVCTSFQYPFYP
Bac_Pro_Gam_2_[  MGFCFYNNIAVGAAHARAKYGAKRIAILDFDVHQCNGTIDIFKNDPEVLICTSFQYPFYP
Bac_Pro_Gam_9_[  MGFCFFNNIAVGVEQALTHYEIERVAILDFDVHHCNGTVDAFKDRPEVLVCSTFQHPFYP
Bac_Pro_Gam_5_[  MGFCLFNNVATGAGWALQRPGVKRVAVLDFDVHHGNGTVDIFKDRPDVLVCSSFQFPFYP
Bac_Pro_Gam_7_[  GGFCIFNNIAVAALHALDHYGMKKVAIIDFDVHHGNGTEDIFKDDPRVLFCSSFQHPFYP
Bac_Pro_Gam_19   MGFCFFNNAAIAARHAVRDYGLERVAIVDFDVHHGNGTEDIVGDDPQILFCSTYQHPLYP
Bac_Pro_Gam_11   MGFCFFNNIAIAAEYALNQYSLKRVAIVDFDVHHGNGTEDIFKNEPRVLFCSSFEYPLYP
Bac_Pro_Gam_12   MGFCLFNNIAVAAAHALEHYALSRVAIADFDVHHGNGTEDIFRDDPRVLYCSSFQHPFYP
Bac_Pro_Bet_15   MGFCFFNNVAVAARHALDRRGLERVAIIDFDVHHGNGTEDIIANDDRVLMCSFFQHPLYP
Bac_Pro_Bet_11   MGFCFFNNVAVAARHALEIHGLERVAIIDFDVHHGNGTEAAFANDERVLMCSFFQHPLYP
Bac_Pro_Bet_17   MGFCFFNNVAIAARHALDVHGIERVAIIDFDVHHGNGTEAAFANDERVLMCSFFQHPLYP
Bac_Pro_Bet_18   MGFCFFNNVAIAARHALDVYGIERVAIIDFDVHHGNGTEAAFANDERVLMCSFFQHPLYP
Bac_Pro_Gam_13   MGFCVFNNVAVGAAHAMEGHGLSRVAIADFDVHHGNGTEDIFRDEPRVLFCSSFQHPFYP
Bac_Pro_Bet_3_[  MGFCYFNNVAVGIRHALAVHGLERAAVIDFDVHHGNGTEEIFRDDPQVMMASIFQHPFFP
Bac_Pro_Bet_2_[  MGFCIFNNVAVAAAQALDVHGLERVAIVDFDVHHGNGTEDIFRDDPRVMLCSTFQHPFYP
Bac_Pro_Bet_14   MGFCLFNNIAVAVAHALETHALKRVAVVDFDVHHGNGTEDIFQHDPRVMMVSTFQHPFYP
Bac_Pro_Bet_7_[  MGFCFFNNVAIGAAHALAHHGLQRVAIVDFDVHHGNGTEDIFQDEPRVLFCSTFQHPFYP
Bac_Pro_Bet_1_[  MGFCLFNNVAVGVAHAIEHYGLKRVAIADFDVHHGNGTEEIFHDDPRVMLCSTFQSPFYP
Bac_Pro_Bet_5_[  MGFCFFNNVAVAAQHAMDAYGLERVAIIDFDVHHGNGTEDIWAGDPRVLMVGIFQHPFYP
Bac_Pro_Bet_6_[  MGFCFFNNIAVAAAHALGAHHLSRVAIVDFDVHHGNGTEDCFKGDPRVLMVGTFQHPFYP
Bac_Pro_Bet_4_[  MGFCFMNNVAIAARHALDAHGLERVAIVDFDVHHGNGTEDIFRDDPRVMMAGIFQHPFYP
                 ############################################################


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Bet_21   HRRMEPTP---SNAVLSPLPAGAGGEDIRNVVENVWLPEIDKFQPDLMILSAGFDAHCEE
Bac_Pro_Bet_9_[  FPDLDNGITGSANMLHTPFAAGTDSPTFRDTIRKQWLPRLAAFKPELVLLCAGFDAHRDD
Bac_Pro_Bet_13   FPETNHSANG-ANMLHLPFASNTGSRVFRTTVREQWLHKLTAFKPELVLLSAGFDGHKQD
Bac_Pro_Bet_10   FPENNDMPDG-GNMVHLPLPPGTGSRTFREAVRRQWLPRLAAFKPELVLLSAGFDAHRLD
Bac_Pro_Bet_16   FPGNNNMPDG-DNMVHLPFPPGTGSRAFRKAVRRQWLPRLAAFKPELVLLSAGFDAHRSD
Bac_Pro_Bet_8_[  FPENNDMPDG-SNMVHLPLLPGTGSVAFREAVRRQWLPGLAAFKPELVLLSAGFDAHRSD
Bac_Pro_Alp_1_[  GTGNRDEFGPHDTIRNIPLSAGTDGEVYRMIVTQQVLPKIRSFAPELILLSSGFDAHRDD
Bac_Pro_Alp_5_[  GTGRASETGAHGNVLNIPLRAGTDGAAMRAAYDLQVWPELEEFEPELILVSAGFDAHEAD
Bac_Pro_Alp_2_[  GSGRTDETGAYETVLNIPLAPGTGGAEMRAAYEAQAFPRLRAFKPELIIVSAGFDAHQDD
Bac_Pro_Alp_3_[  GTGRASETGAHDNILNLPLPPESGGAHMRREYQHKALPRLRDFAPQLIIISAGFDAHADD
Bac_Pro_Gam_20   GTGYPSETGA-GNIVNVPLRAGDTGIEFREKYQSLILPALDHFKPQLLLVSAGFDAHRDD
Bac_Pro_Gam_21   GTGYPSETGV-GNIINVPLAAGESGLEFRQKYSRIILPALRAFKPELLLVSAGFDAHRDD
Bac_Pro_Alp_8_[  GTGAKSETGA-GNIVNAPLSPDTGSDHFREAFKSRVLPALEEFRPDFILISAGFDAHHRD
Bac_Pro_Alp_10   GTGSAGERGEHDNIVNAPLASEDGGKEFRFAFETAILPQLKRFAPELIVISAGFDAHYRD
Bac_Pro_Alp_4_[  GTGHKNERGEHDTIVNAPLVEGMGGDEFRDAMNSVILPRIRSFDPDLIVISAGFDAHHRD
Bac_Pro_Alp_12   GTGSPSERGEKDTIVNVPLRPNDDGEVFREAFETGILSRLEAFRPDVIVISAGFDAHKLD
Bac_Pro_Alp_9_[  GTGALSETGAHGTIVNAPLNAGDGSEAFREAVETAILPRIHDFAPDLIVISAGFDAHWRD
Bac_Pro_Alp_13   GTGAASETGV-GNVWNAPLSEGDDCGPFRAAWTDRILPALDAFRPDLVLVSAGFDAHEGD
Bac_Pro_Alp_7_[  GTGAPSETGV-GNIVNVAVEPHAARESWRASFAGGLMPALDDFAPDLILISAGFDAHRRD
Bac_Pro_Alp_11   GTGAASERGM-GNILNVALPPGAKGDEFRAAWSERILPAVEGFSPGLILVSAGFDAHARD
Bac_Pro_Gam_17   GTGDAIETGV-GNIVNAPLPPDTRSQEFRQIWDGLLLPRLHDFRPQLVLISAGFDAHRLD
Bac_Pro_Gam_16   HTGSVYERGV-GNMHNVLLPPGSDGFRFRNTWADTLLPGLEEFRPQLVLVSAGFDAHLAD
Bac_Pro_Gam_18   HSGSVYERGA-GNIHNLLLPPGSDGLRFRNVWEDEMLPLVDAFRPQLILISAGFDAHLRD
Bac_Pro_Gam_8_[  NTVVENN----TTLVNSPLPIASDGNDLKAVFEQQWLPKLNAFKPDMLFISAGFDAHLED
Bac_Pro_Gam_6_[  HSHVHSQA---SNIINTPIAAGCAAIEYRKTIENAWMQKLRDFDPQLILISAGFDGHALD
Translation_of   ------------------------------------------------------------
Bac_Pro_Gam_14   FRGANTQE---KNIINIPLPAYTTGKTYREHVEKLWFKQIEDFSPDMIFFSAGFDAYYKD
Bac_Pro_Gam_15   HHELLTKQ---DHIIHTPLPAGTEGKQFRKQIEKQWLGKIDAFKPQMIFISAGFDGHRQD
Bac_Pro_Gam_4_[  WRYAETEW---ENIVNTPLDAHSGSLEFRRAIEASWLPAIQKFKPQLILVSAGFDAHRED
Bac_Pro_Gam_3_[  WRYQQGQW---DNVLNTPLSAGADGHEFRRRVEAQWLPALQAFKPQLVLLSAGFDAHRDD
Bac_Pro_Gam_1_[  WRYLRSEW---QNVVNTPLEVGTDSKEFRRIIERQWLPALHAFKPDLVMLSAGFDAHRDD
Bac_Pro_Gam_2_[  WRYLRSEW---QNVINTPLEVGTDGPEFRRIIENHWLPALHAFKPDLVMLSAGFDAHRDD
Bac_Pro_Gam_9_[  LRYYDIQR---PNIVNSPLRAGTTGYQFRNVIEQDWLPALHYHQPQMIFVSAGFDAHKAD
Bac_Pro_Gam_5_[  FRFQDIDK---PNIVNTPLPAGTGSAAFRQAIERDWLPALATHRPDMILVSAGFDAHRDD
Bac_Pro_Gam_7_[  FSGDKPTN---QHILNIPIPAGTKGDEYRQMI-MPWFDKLNDFVPEMIFISAGFDGHAED
Bac_Pro_Gam_19   ERALPSKP---GFLINAPLPEGAGGAEFRETITEHWLPELNAFKPQLVIISAGFDAHLED
Bac_Pro_Gam_11   HTGADTVS---DHIINLPLPGGCKASQWRAAVSSEWLPALDAFAPELILVSAGFDGHAED
Bac_Pro_Gam_12   DTPRAER----DHLIHTPLAAGTTGAQFRAAVRHDWLPALEQFRPQLVLVSAGFDAHRDE
Bac_Pro_Bet_15   NSGAQPLG---DNMVNLPVPAYTKGSEIRELIDRHWLPRLEAFRPQMLFISAGFDAHRED
Bac_Pro_Bet_11   FSGVDHQA---PNMVNLPMAARTNGMAVREAVDLMWLPRLDAFRPQMLFVSAGFDAHRED
Bac_Pro_Bet_17   FSGADHQA---PNMVNLPMPARSNGMAIREAVDMFWLPRLDAFKPQMLFVSAGFDAHRED
Bac_Pro_Bet_18   FSGVDHQA---PNMVNLPMPARSNGMAIREAVDMFWLPRLDAFKPQMLFVSAGFDAHRED
Bac_Pro_Gam_13   HSGADTVS---DHILNLPLPAGTDGAALRAAVEQHWLPALEAFRPELILVSAGFDGHLED
Bac_Pro_Bet_3_[  YSGDVPMG---PNMVNIPMKAGSTGADFRDAVMDGWLPRLREFKPQILFISAGFDAHRED
Bac_Pro_Bet_2_[  FAGADTAS---AHIVNVPLPAGTDGARYRDAFRAQIVPRLDAFAPQMLFCSAGFDGHRED
Bac_Pro_Bet_14   YSGIAGRS---ERMVNIPLPAGSNGKVFRKAVDEFWLPALERFKPQMLFVSAGFDAHADD
Bac_Pro_Bet_7_[  YCGTDSGG---DHIINVPLAAHTNGQAFRVAVTHYWLPALEAFKPEIIFISAGFDAHRED
Bac_Pro_Bet_1_[  YCGADSGN---DHIINVPLPAGTDGAAFRQAVSERWLPALERFQPEMLFISAGFDAHWED
Bac_Pro_Bet_5_[  YSGDIPKG---SNMHNVPLPRASTGQQFREAVCEQWLPRLNEFAPEMLFISAGFDAHLED
Bac_Pro_Bet_6_[  YSGTEHPA---FNMLNVPLSRGTDGEEFRNVVSDIWMPRLREFQPEMILISAGFDGHYED
Bac_Pro_Bet_4_[  YCGADDPP---AHMCNVPLPAGTRGDGFRQVFGDVVIPALRAHNPQMIFISAGFDAHYED
                                #############################################


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Bet_21   RIAQLKAGEMDYACVTRLLVEASFAYCEGRLVSVLEGGYELRSLARSVFTHLQGLIRNPL
Bac_Pro_Bet_9_[  ETGRLKLHEADFAWLTHKIVQTASS-CKGKIVSALEGGYTLDSLAKSAAEHIHVLA----
Bac_Pro_Bet_13   ETGRLNLHEADFAWLTHKIIQAASS-CPGRIVSVLEGGYTLEPLAKSAAAHIGVLA----
Bac_Pro_Bet_10   ESGRLNLHEADFAWLTHKIIQTASG-CPGKIVSVLEGGYTLEPLAQSAAEHIRVLA----
Bac_Pro_Bet_16   ESGRLNLHEADFAWLTYKIIQTASS-CPGKIVSVLEGGYTLESLSKSAVEHIRVLA----
Bac_Pro_Bet_8_[  ESGRLNLHEADFGWLTHKIIQTASG-CPGKVVSVLEGGYTLESLSKSAAEHIRVLA----
Bac_Pro_Alp_1_[  PLASISLETQDFRWLTDQVAALAGEVCGGRLVSCLEGGYNLEALAEAAAVHVDGLI----
Bac_Pro_Alp_5_[  PLANLDWDTEDFAWLTRRLCEIAQDHCGGRLVSALEGGYDLDALAASAAAHVAELM----
Bac_Pro_Alp_2_[  PLANLNWSTGDFAWITAELCKIADEVCDGRIVSTLEGGYDLNALAEATRAHVEELM----
Bac_Pro_Alp_3_[  PLAQLNWSTEDFAWLTAEICEIAADVCQGRVVSTLEGGYDLNALSASVRAHVQELM----
Bac_Pro_Gam_20   PLSSIRLVEEDYRWVTQALKEIAGRHCQGRIVSVLEGGYNLKALAASVAVHVRGLM----
Bac_Pro_Gam_21   PLSSIRLVEDDYRWLTQELMEIAGIYCGGRMISILEGGYNLNALAASVAVHVKTLLASEV
Bac_Pro_Alp_8_[  PLAQINLVADDFDWATGRLLDAAGKTANNRIVSLLEGGYDLQGLAESAGTHIYRLM----
Bac_Pro_Alp_10   PLASLNLHAEDFAWVTQQLMEVADQTAGGRIVSVLEGGYDLQGLSESVAAHVGALM----
Bac_Pro_Alp_4_[  PLGGLRLKEVDFAWATQALMEIADKRCNRRVVSLLEGGYDLEGLARSVAAHVMTLM----
Bac_Pro_Alp_12   PLANLRLEAEDFGWATRRLMDLAERCAGGRIVSILEGGYSLEGLGKSVAAHVDALM----
Bac_Pro_Alp_9_[  PLASLNLMESDFAWATQKLMALAERHCGQRIVSVLEGGYDLEGLARSTAFHLDALM----
Bac_Pro_Alp_13   PLGGLRLVEDDFAWVTTRVAEVAHRHCGGRIVSMLEGGYVLDALARSSAAHVRALA----
Bac_Pro_Alp_7_[  PLAHQSLEAEDFAWATRAVLEVARRRCGGKVVSSLEGGYDLEGLGRSALAHIRALG----
Bac_Pro_Alp_11   PLAHLRLTEADFAWVTGEICAVARRVCGGRVVSMLEGGYDLDALARSVAAHVRALM----
Bac_Pro_Gam_17   PLAQLQLETEDYAWLTDRLMHLADAHAHGRLVSSLEGGYDLAALAAASAAHVRELM----
Bac_Pro_Gam_16   PLADLMLDAEDFAWLTTELLGIARRHCDGRLVSTLEGGYNIEALAECATAHVGALL----
Bac_Pro_Gam_18   PLADLMLDDDDFAWLTGALRTLADRHARGRVVSMLEGGYDLQALRESSVAHVAALR----
Bac_Pro_Gam_8_[  DMASLKFVEEDYRWLTEQLARFSEQHNCRGIVSYLEGGYALSALGRSAIAHVKALV----
Bac_Pro_Gam_6_[  PLAELNLEVEDYRWLTEMIVGVARDHANDRVISTLEGGYHLKALAESVAAHVQVLK----
Translation_of   ------------------------------------------------------------
Bac_Pro_Gam_14   ELANLLLTPDDYLWITQKVKQIADKTSNGRMLSVLEGGYNLQGLGECAVAHLHGLL----
Bac_Pro_Gam_15   IMANFQLEDDDYVWITKKIKQLADKHCPGHLISVLEGGYALSVLGQSVLQHICHLV----
Bac_Pro_Gam_4_[  PMGELNLEDDDYHWITNFLMDQAKSQCDGRLVSVLEGGYDLNSLARSVHRHIEALQ----
Bac_Pro_Gam_3_[  PMGGLNLLEDDYYWVTQLALDIARVYAEGRLVSALEGGYHLDSLATSVEAHLKALL----
Bac_Pro_Gam_1_[  PMGDICLEDEDFYWITHLAMEIAALYAENRVVSVLEGGYNPKTLASGAEAHLKALL----
Bac_Pro_Gam_2_[  PMGDICLEDEDFYWITHLAMEIATLYADNRIVSVLEGGYNPKSLASGVEAHLKALL----
Bac_Pro_Gam_9_[  PLGQLLLDESDYRWVTKLIVDAAACYADNRIVSTLEGGYDLEALAHSVHTHIDVLV----
Bac_Pro_Gam_5_[  PLAELMLDDEDFGWIGGLIMDAAKRYCEGRVVSVLEGGYNLNALGRSVQAYIEAML----
Bac_Pro_Gam_7_[  ALGHLRLVEADYEWVTLQIKNIADKHCGGKIVSMLEGGYALSALSRSVVSHIKALM----
Bac_Pro_Gam_19   EMAGLRLVEADYAWVTKELRKIADEYSEGRIISLLEGGYDTSALARSVVAHLKVLM----
Bac_Pro_Gam_11   DMAHFMLREEDYHWLATELKTVANKHCQGRVVAMLEGGYALSALGRSVVAFLKGLM----
Bac_Pro_Gam_12   ALAGLNLDADDFSWITHELTRIAARYAGARLVSMLEGGYALPALGRSAAAHVRALC----
Bac_Pro_Bet_15   DLGQLGLVESDYAWITRRLKGVAERHADGRIVSCLEGGYALSALARSVASHVRVLA----
Bac_Pro_Bet_11   DIGGMGLVEADYEWLTQQICEVARRHAQGRIVSCLEGGYNLSALGRSVVAHLRVLA----
Bac_Pro_Bet_17   DIGNLGLVESDFEWLTAQVVDVARRHAQGRIVSCLEGGYNLSALGRSVVAHLRVLA----
Bac_Pro_Bet_18   DIGNLGLVEADFEWLTAQIVDVARRHAQGRIVSCLEGGYNLSALGRSVVAHLRVLA----
Bac_Pro_Gam_13   DLAGFRLVESDYAWLTGALYDIAKRHCDGRLVSVLEGGYNLSALGRSVAAHLKVLS----
Bac_Pro_Bet_3_[  DMGMMGLVEADYEWVTRQLLKFADEYCEGRVVSVLEGGYDLSALGRSVTAHVRVLT----
Bac_Pro_Bet_2_[  DMAQFGLLEADYVWITEQVMAVAARHACGRIVSVLEGGYDLSSLGRSAAAHIKTLA----
Bac_Pro_Bet_14   ELASLNLVEDDYAWVTEKIKEVARAYAGKRIVSVLEGGYALAALARSVAAHIEVLM----
Bac_Pro_Bet_7_[  TLAQLNLVEADYVWITRQIMAIAEKHAQNRIVSVLEGGYALGALGRSVTTHIRTLA----
Bac_Pro_Bet_1_[  DMAMFKLKEADYAWVTQQVKDVAEKHAQGRIVSALEGGYELHALGRSVAAHIKVLS----
Bac_Pro_Bet_5_[  DMGSLGLVEADYAWVTRQLMKVAEVHSSRRIVSMLEGGYELSALGRSVAEHVRVLT----
Bac_Pro_Bet_6_[  EMGGLKLLEKDYAWVTVQLKQLAEEFAQKRIVSILEGGYSLSALARSVVAHIRVLA----
Bac_Pro_Bet_4_[  DMGSMGLLEADYVWATEQIKAVANDCGHKRIVSLLEGGYSLSSLARSVVAHIKSLA----
                 #######################################################     


                        370       380       390       400
                 =========+=========+=========+=========+====
Bac_Pro_Bet_21   PAETCKDPN-----------------------------------
Bac_Pro_Bet_9_[  --GMKKSDAAVQYDHFLKNDGRKKILNKLSMRPSEKTGNTSKSP
Bac_Pro_Bet_13   --GLPKAGYVAAYQKHLKRGGQKKENTAPASQIGRLKTENRF--
Bac_Pro_Bet_10   --GLGKSDAATAYQKTLDPTKKRFAKPKTGQVRQPTQSDRYDI-
Bac_Pro_Bet_16   --GLGKSDTVTAYQKNLYRNRNKRFAKPKSL-------------
Bac_Pro_Bet_8_[  --GLGKSETAAAYQAELDRNREHVPPGPNPA-------------
Bac_Pro_Alp_1_[  --AAAA--------------------------------------
Bac_Pro_Alp_5_[  --EHSR--------------------------------------
Bac_Pro_Alp_2_[  --KAAQ--------------------------------------
Bac_Pro_Alp_3_[  --KAAT--------------------------------------
Bac_Pro_Gam_20   --GQ----------------------------------------
Bac_Pro_Gam_21   QAGK----------------------------------------
Bac_Pro_Alp_8_[  --RG----------------------------------------
Bac_Pro_Alp_10   --GA----------------------------------------
Bac_Pro_Alp_4_[  --NQ----------------------------------------
Bac_Pro_Alp_12   --GR----------------------------------------
Bac_Pro_Alp_9_[  --GRETGA------------------------------------
Bac_Pro_Alp_13   --ASAS--------------------------------------
Bac_Pro_Alp_7_[  --EA----------------------------------------
Bac_Pro_Alp_11   --DA----------------------------------------
Bac_Pro_Gam_17   --A-----------------------------------------
Bac_Pro_Gam_16   --A-----------------------------------------
Bac_Pro_Gam_18   --------------------------------------------
Bac_Pro_Gam_8_[  --DYE---------------------------------------
Bac_Pro_Gam_6_[  --SVS---------------------------------------
Translation_of   --------------------------------------------
Bac_Pro_Gam_14   --S-----------------------------------------
Bac_Pro_Gam_15   --NPPV--------------------------------------
Bac_Pro_Gam_4_[  --KM----------------------------------------
Bac_Pro_Gam_3_[  --GLPLGHP-----------------------------------
Bac_Pro_Gam_1_[  --GLPFTDVP----------------------------------
Bac_Pro_Gam_2_[  --GLPFAEVP----------------------------------
Bac_Pro_Gam_9_[  --NG----------------------------------------
Bac_Pro_Gam_5_[  --EG----------------------------------------
Bac_Pro_Gam_7_[  --N-----------------------------------------
Bac_Pro_Gam_19   --NI----------------------------------------
Bac_Pro_Gam_11   --------------------------------------------
Bac_Pro_Gam_12   --EAPRR-------------------------------------
Bac_Pro_Bet_15   --GLTD--------------------------------------
Bac_Pro_Bet_11   --GV----------------------------------------
Bac_Pro_Bet_17   --GI----------------------------------------
Bac_Pro_Bet_18   --GI----------------------------------------
Bac_Pro_Gam_13   --ET----------------------------------------
Bac_Pro_Bet_3_[  --DI----------------------------------------
Bac_Pro_Bet_2_[  --AL----------------------------------------
Bac_Pro_Bet_14   --KP----------------------------------------
Bac_Pro_Bet_7_[  --E-----------------------------------------
Bac_Pro_Bet_1_[  --GL----------------------------------------
Bac_Pro_Bet_5_[  --GE----------------------------------------
Bac_Pro_Bet_6_[  --EI----------------------------------------
Bac_Pro_Bet_4_[  --DL----------------------------------------
                                                             






Parameters used
Minimum Number Of Sequences For A Conserved Position: 26
Minimum Number Of Sequences For A Flanking Position: 43
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 5
Allowed Gap Positions: With Half
Use Similarity Matrices: Yes

Flank positions of the 5 selected block(s)
Flanks: [43  86]  [93  105]  [128  156]  [164  240]  [256  355]  

New number of positions in input.fasta-gb:  263  (65% of the original 404 positions)

Protein Domains

PROTOCOLE:


Interpro, séquence protéique au format FASTA, paramètres par défauts


ANALYSE DES RÉSULTATS:



  ______________________________________________________________________________________________________________________________________

|  Code Interpro  |    Banque   |  position  |  position  |           |  Intitulé banque d'origine |         Intitulé Interpro         | 
|   (IPRxxxxxx)   |  d'origine  |  de début  |   de fin   |  E-value  |  (premier sur la ligne)    |         (en fin de ligne)         |
|_________________|_____________|____________|____________|___________|____________________________|___________________________________|
|                 |             |            |            |           |                            |                                   |
|     IPR000286   |   PANTHER   |     21     |     195    |  9.7E-57  |   PTHR10625                |   Histone deacetylase superfamily |
|_________________|_____________|____________|____________|___________|____________________________|___________________________________|
|                 |             |            |            |           |                            |                                   |
|     IPR023801   |   Gene3D    |     10     |     196    |  2.1E-61  |   G3DSA:3.40.800.20        |   Histone deacetylase domain      |
|_________________|_____________|____________|____________|___________|____________________________|___________________________________|
|                 |             |            |            |           |                            |                                   |
|     Néant       | SUPERFAMILY |     11     |     197    |  1.44E-61 |   SSF52768                 |   Néant                           |
|_________________|_____________|____________|____________|___________|____________________________|___________________________________|
|                 |             |            |            |           |                            |                                   |
|     IPR023801   |    Pfam     |     23     |     196    |  4.6E-50  |   PF00850                  |   Histone deacetylase domain      |
|_________________|_____________|____________|____________|___________|____________________________|___________________________________|



     Lors du BLAST nous avions vue que la majorité des séquences obtenues étaient des deacetylase, et elles apartennaient plus particulierement à une super famille de protéine, les Histone deacetylase.

Ces protéines ont pour rôle d'enlever un groupement acétyl (COCH3) sur la partie N-ter des histones. En effet lors de la condensation de l'ADN les histones de classe H2A, H2b H3 et H4 vont former les histones de "coeur". 2 protéine de chaque classe s'associent pour former un octamère autour duquel s'enroule la double hélice d'ADN. La perte de se groupement perturbe l'octamère ce qui permet la décondensation de l'ADN.

Cette enzyme intervient donc principalement dans la régulation de l'expression des gènes mais aussi lors de la réplication. Elle semble donc essentielle ce qui semble cohérent du fait qu'elle semble être présente dans la totalité du vivant d'après le BLAST


     La recherche de domaine protéique conservé sur notre ORF nous a donné les résultats dans le tableau précédent.

Si l'on compare ces résultats entre eux, ont peut voir que la position de début n'est pas tout a fait la même car elle varie de 10 à 23. En revenche la position de fin est semblable car elle ne varie que de 2 nucléotide (195 à 197). Les a.a positionnés avant le domaine ont peut être un rôle sur l'adressage de la protéine mais ce domaine est tout de même relativement bien conservé.

Le fait qu'il n'y ai qu'un seul type de domaine conservé malgré les différentes nominations (domain ou superfamily) vient du fait que la séquence protéique doit être extrêmement spécifique à cette famille de protéine. Un kinase par exemple a pour rôle de déphosphoriler, mais les cibles peuvent être multiples car toute les kinases n'ont pas les mêmes cibles mais leur site catalytique est semblable car il a le même rôle. Les résultats obtenues ici donne des information sur la fonction qui est une deacétylation mais aussi sur le substrat qui est une (ou des) histones.

De plus les E-value sont très faibles (2.1E-61 à 4.6E-50) ce qui montre que notre séquence est très proche des domaines présentés dans ces banques de données et que même si elle est incomplète en 3', la séquence code bien pour une histone deacetylase.

RÉSULTATS BRUTS:

TRANSLATION	ff954c717c60ac5922399f3e7bfacea7	198	PANTHER	PTHR10625		10	184	9.7E-57	T	02-10-2014	IPR000286	Histone deacetylase superfamily		
TRANSLATION	ff954c717c60ac5922399f3e7bfacea7	198	Gene3D	G3DSA:3.40.800.20	1	185	2.1E-61	T	02-10-2014	IPR023801	Histone deacetylase domain		
TRANSLATION	ff954c717c60ac5922399f3e7bfacea7	198	SUPERFAMILY	SSF52768	1	186	1.44E-61	T	02-10-2014
TRANSLATION	ff954c717c60ac5922399f3e7bfacea7	198	PANTHER	PTHR10625:SF97		10	184	9.7E-57	T	02-10-2014
TRANSLATION	ff954c717c60ac5922399f3e7bfacea7	198	Pfam	PF00850	Histone deacetylase domain	12	185	4.6E-50	T	02-10-2014	IPR023801	Histone deacetylase domain		

Phylogeny

PROTOCOLE:

a) Phylogeny.fr / méthode PhyML / pas de bootstrap / default substitution model / groupe extérieur: alpha


b) Phylogeny.fr / méthode BioNJ / groupe extérieur: alpha


ANALYSE DES RÉSULTATS:


PhyML:


Nous avons enraciné l'arbre sur la branche 2 du groupe externe (soit les alpha).

chacune des 3 classes sont regroupées dans 3 branche bien distinctes avec les gamma (branche 1) et les béta (branche 2) d'une part, et les alpha de l'autre (branche 3).

Les meilleurs hit lors du BLAST étaient obtenue par les gamma au sein desquelles on retrouve notre ORF dans la branche 1


La première branche se scinde en 2 donnant la branche 1 avec les gamma et la branche 2 avec les beta donnant 2 paralogues. l'arbre étant formé sur l'étude d'un seul gène, ce dernier a subit une duplication puis une spéciation vers les gamma d'une part et les beta d'autre part.


Il y a tout de même 2 béta (Bac_Pro_Bet_5 et Bac_Pro_Bet_7) qui se trouvent dans la branche 3 mais elle sont en dessous des autres béta et non en plein milieu des alpha (comme la Bac_Pro_Gam_14). La position de cette Neisseriales et cette Nitrosomonadales au sein des alpha est due:

                     - Soit a un faible différentiel de E-value avec les alpha qui fait qu'elles sont classées dans le groupe extérieure

                     - Soit il s'agit d'Alpha mais dont le gène en question a divergé en se rapprochant de celui des béta.

                     - Soit il s'agit de Beta mais dont le gène en question a divergé en se rapprochant de celui des Alpha


En revanche la gamma (Bac_Pro_Gam_14) qui est une Legionellales étant en plein milieu de la branche 3, la différence de E-value ne peut expliquer ce positionnement. Au cour de sont évolution, il y a surement eu un transfert horizontale de gène entre une alpha et cette gamma. Plus précisement d'une Rhodobacterales (ou un ancêtre proche) vers une Legionellales    




Neightbor:


On retrouve un arbre semblable a celui obtenue avec PhyML. Il semble qu'il y ai eu 2 phénomène de duplication. Une première duplication qui a donné 2 copies du gènes qui on divergé par la suite (paralogie). Puis l'une de ces 2 copie a encore subit une duplication donnant deux nouvelles copies qui ont à leur tour divergées.




                                             SCHÉMATISATION DU PHÉNOMÈNE DE DUPLICATION AVEC UN GÈNE ARBITRAIRE




     X: duplication aboutissant à 2 copies

     -: divergence par spéciation au cour de l'évolution

     B, C: sont paralogues issus d'une duplication

     D, E: sont paralogues issus d'une duplication

     D, D' et D sont des orthologue issu d'une spéciation



                                                                                 _

                                                             +-------D            |

                                                             |        D'          |-(Gammaprotéobactérie)

                                                             |          D      _|

                                                   +----B----X                   _

                                                   |         |          E       |

                                                   |         |        E'          |-(Bétaprotéobactérie)

                                               A---X         +-------E           _|

                                                   |

                                                   |

                                                   +--------C  (Alphaprotéobactérie)



Il y a encore la même gamma au sein des alpha mais ici notre ORF partage un ancêtre commun avec trois autre organisme (Bac_Pro_Gam_4 Bac_Pro_Gam_9 Bac_Pro_Gam_7) et non pas un seul (Bac_Pro_Gam_5) comme dans le premier arbre.


La lecture des 2 arbres nous permet de dire que notre ORF appartient a la classe des Gammaprotéobactérie  mais nous ne pouvons dire avec l'arbre obtenue par Neighbor s'il s'agit d'une Oceanospirillales, d'une Alteromonadales ou d'une Vibrionales.

En revanche l'arbre de PhyMl place notre ORF sur la même branche qu'une Alteromonadales (une Marinobacterium). EN revérifiant la E-value de cette séquence ainsi que l'homologie avec la recherche de domaine protéique, il semble que notre ORF soit très proche de cette séquence et donc que le gène associé provient bien d'une protéobactérie, gammaprotéobactérie, ALteromonadales.






Arbre obtenue avec PhyML:


            +----------------------------33_Bac_Pro_Gam_13_Bacteria_Proteobacteria_Gammaproteobacteria_Eval
     +------+
     |      +-------------32_Bac_Pro_Gam_10_Bacteria_Proteobacteria_Gammaproteobacteria_Eval
     |
     |       +----------31_Bac_Pro_Gam_3_Bacteria_Proteobacteria_Gammaproteobacteria_Evalu
  1+-+   +---+
   | |   |   +------------30_Bac_Pro_Gam_8_Bacteria_Proteobacteria_Gammaproteobacteria_Evalu
   | |   |
   | |   |    +---------------------29_ORF_B_Translation_of_ORF_number_2_in_reading_frame_3_on_th
   | +---+ +--+
   |     | |  +---------------28_Bac_Pro_Gam_5_Bacteria_Proteobacteria_Gammaproteobacteria_Evalu
   |     | |
   |     | |
   |     +-+     +---------------27_Bac_Pro_Gam_4_Bacteria_Proteobacteria_Gammaproteobacteria_Evalu
   |       |  +--+
   |       |  |  +----------26_Bac_Pro_Gam_9_Bacteria_Proteobacteria_Gammaproteobacteria_Evalu
   |       |  |
   |       +--+        +--------------25_Bac_Pro_Gam_6_Bacteria_Proteobacteria_Gammaproteobacteria_Evalu
   |          |  +-----+
   |          |  |     |  +-------24_Bac_Pro_Gam_1_Bacteria_Proteobacteria_Gammaproteobacteria_Evalu
   |          |  |     +--+
 +-+          +--+        +--------23_Bac_Pro_Gam_2_Bacteria_Proteobacteria_Gammaproteobacteria_Evalu
 | |             |
 | |             +-----------22_Bac_Pro_Gam_7_Bacteria_Proteobacteria_Gammaproteobacteria_Evalu
 | |
 | |                                     +21_Bac_Pro_Bet_6_Bacteria_Proteobacteria_Betaproteobacteria_Evalue
 | |                  +------------------+
 | |                  |                  +-20_Bac_Pro_Bet_8_Bacteria_Proteobacteria_Betaproteobacteria_Evalue
 | |           +------+
 | |           |      +---19_Bac_Pro_Bet_3_Bacteria_Proteobacteria_Betaproteobacteria_Evalue
 | |    +------+
 | |    |      +-18_Bac_Pro_Bet_2_Bacteria_Proteobacteria_Betaproteobacteria_Evalue
 | |  +-+
 | |  | +-----17_Bac_Pro_Bet_1_Bacteria_Proteobacteria_Betaproteobacteria_Evalue
 | |+-+
 | || |
 |2++ +----------------16_Bac_Pro_Gam_11_Bacteria_Proteobacteria_Gammaproteobacteria_Eval
 |  |
 |  |+---------------15_Bac_Pro_Gam_12_Bacteria_Proteobacteria_Gammaproteobacteria_Eval
 |  ++
 |   +----------14_Bac_Pro_Bet_4_Bacteria_Proteobacteria_Betaproteobacteria_Evalue
 |
 |       +-----13_Bac_Pro_Bet_5_Bacteria_Proteobacteria_Betaproteobacteria_Evalue
 | +-----+
 | |     +-----12_Bac_Pro_Bet_7_Bacteria_Proteobacteria_Betaproteobacteria_Evalue
 | |
 | |                             +-----------------11_Bac_Pro_Alp_8_Bacteria_Proteobacteria_Alphaproteobacteria_Evalu
 | |     +-----------------------+
 | |     |                       +--------------------10_Bac_Pro_Alp_10_Bacteria_Proteobacteria_Alphaproteobacteria_Eval
 +3+   +-+
   |   | |     +----------9_Bac_Pro_Alp_1_Bacteria_Proteobacteria_Alphaproteobacteria_Evalu
   |   | +-----+
   |   |       +-------------8_Bac_Pro_Alp_2_Bacteria_Proteobacteria_Alphaproteobacteria_Evalu
   |   |
   |   |     +--------------------7_Bac_Pro_Alp_4_Bacteria_Proteobacteria_Alphaproteobacteria_Evalu
   +---+  +--+
       |  |  |
       |  |  +----------------6_Bac_Pro_Gam_14_Bacteria_Proteobacteria_Gammaproteobacteria_Eval
       |  |
       |  |        +-------------5_Bac_Pro_Alp_6_Bacteria_Proteobacteria_Alphaproteobacteria_Evalu
       +--+     +--+
          |   +-+  +--------------4_Bac_Pro_Alp_9_Bacteria_Proteobacteria_Alphaproteobacteria_Evalu
          |   | |
          |+--+ +---------3_Bac_Pro_Alp_3_Bacteria_Proteobacteria_Alphaproteobacteria_Evalu
          ||  |
          ++  +--------------2_Bac_Pro_Alp_5_Bacteria_Proteobacteria_Alphaproteobacteria_Evalu
           |
           +---------------------1_Bac_Pro_Alp_7_Bacteria_Proteobacteria_Alphaproteobacteria_Evalu

________________________________________________________________________________________________________________________

Arbre obtenue avec Neighbor:

           +--------33_Bac_Pro_Bet_7_Bacteria_Proteobacteria_Betaproteobacteria_Evalue
   +-------+
   |       +--------32_Bac_Pro_Bet_5_Bacteria_Proteobacteria_Betaproteobacteria_Evalue
   |
   |     +--------------------31_Bac_Pro_Gam_5_Bacteria_Proteobacteria_Gammaproteobacteria_Evalu
   |     |
   |   +-+ +-------------------30_Bac_Pro_Gam_10_Bacteria_Proteobacteria_Gammaproteobacteria_Eval
   |   | +-+
   |   |   +-------------------------------29_Bac_Pro_Gam_13_Bacteria_Proteobacteria_Gammaproteobacteria_Eval
   |   |
   |   |      +-----------------28_Bac_Pro_Gam_7_Bacteria_Proteobacteria_Gammaproteobacteria_Evalu
   |   |      |
 +-+   |    +-+
 | |  ++    | |+----------------27_Bac_Pro_Gam_9_Bacteria_Proteobacteria_Gammaproteobacteria_Evalu
 | |  ||  +-+ ++
 | |  ||  | |  +-------------------26_Bac_Pro_Gam_4_Bacteria_Proteobacteria_Gammaproteobacteria_Evalu
 | |  ||  | |
 | |  || ++ +-----------------------25_ORF_B_Translation_of_ORF_number_2_in_reading_frame_3_on_th
 | |  || ||
 | |  || ||    +---------------24_Bac_Pro_Gam_3_Bacteria_Proteobacteria_Gammaproteobacteria_Evalu
 | |  || |+----+
 | |  |+-+     +-------------------23_Bac_Pro_Gam_8_Bacteria_Proteobacteria_Gammaproteobacteria_Evalu
 | |  |  |
 | |  |  |    +-----------------22_Bac_Pro_Gam_6_Bacteria_Proteobacteria_Gammaproteobacteria_Evalu
 | +--+  |    |
 |    |  +----+    +------------21_Bac_Pro_Gam_1_Bacteria_Proteobacteria_Gammaproteobacteria_Evalu
 |    |       +----+
 |    |            +------------20_Bac_Pro_Gam_2_Bacteria_Proteobacteria_Gammaproteobacteria_Evalu
 |    |
 |    |+---------------------19_Bac_Pro_Gam_11_Bacteria_Proteobacteria_Gammaproteobacteria_Eval
 |    ||
 |    |++---------------18_Bac_Pro_Bet_4_Bacteria_Proteobacteria_Betaproteobacteria_Evalue
 |    |++
 |    | +------------------17_Bac_Pro_Gam_12_Bacteria_Proteobacteria_Gammaproteobacteria_Eval
 |    |
 |    |
 |    |  +-----------16_Bac_Pro_Bet_1_Bacteria_Proteobacteria_Betaproteobacteria_Evalue
 |    |  |
 |    +--+  +----------15_Bac_Pro_Bet_2_Bacteria_Proteobacteria_Betaproteobacteria_Evalue
 |       |  |
 |       +--+  +----------14_Bac_Pro_Bet_3_Bacteria_Proteobacteria_Betaproteobacteria_Evalue
 |          +--+
 |             |                       +13_Bac_Pro_Bet_8_Bacteria_Proteobacteria_Betaproteobacteria_Evalue
 |             +-----------------------+
 |                                     +12_Bac_Pro_Bet_6_Bacteria_Proteobacteria_Betaproteobacteria_Evalue
 |
 |                          +-------------------------11_Bac_Pro_Alp_10_Bacteria_Proteobacteria_Alphaproteobacteria_Eval
 |  +-----------------------+
 |  |                       +------------------------10_Bac_Pro_Alp_8_Bacteria_Proteobacteria_Alphaproteobacteria_Evalu
 | ++
 | ||     +-----------------9_Bac_Pro_Alp_1_Bacteria_Proteobacteria_Alphaproteobacteria_Evalu
 | |+-----+
 | |      +---------------8_Bac_Pro_Alp_2_Bacteria_Proteobacteria_Alphaproteobacteria_Evalu
 | |
 +-+  +--------------------7_Bac_Pro_Gam_14_Bacteria_Proteobacteria_Gammaproteobacteria_Eval
   | ++
   | ||
   | |+-----------------------6_Bac_Pro_Alp_7_Bacteria_Proteobacteria_Alphaproteobacteria_Evalu
   +-+
     |  +------------------------5_Bac_Pro_Alp_4_Bacteria_Proteobacteria_Alphaproteobacteria_Evalu
     |  |
     +--+ +--------------4_Bac_Pro_Alp_3_Bacteria_Proteobacteria_Alphaproteobacteria_Evalu
        |++
        ||+--------------------3_Bac_Pro_Alp_5_Bacteria_Proteobacteria_Alphaproteobacteria_Evalu
        ++
         |  +-----------------2_Bac_Pro_Alp_9_Bacteria_Proteobacteria_Alphaproteobacteria_Evalu
         +--+
            +-----------------1_Bac_Pro_Alp_6_Bacteria_Proteobacteria_Alphaproteobacteria_Evalu

Taxonomy report

PROTOCOLE:


Blast contre NR puis copie/colle des résultats brutes sur TaxReports,


ANALYSE DES RÉSULTATS:



     Le rapport taxonomique a pour rôle de classer les Hit obtenus lors du BLAST en fonction de l'espèce dont est issue la séquence et de sa e-value. Notre rapport taxonomique possède 887 séquences au total dont une partie des organismes est présenté dans le tableau ci-dessous. Pour facilité l'analyse et la lisibilité, nous n'avons pas mis la totalité des Archeae et des Eucaryote.


___________________________________________________________________________________________________________________

|                       |                       |                          |                  |                     |  

| phylum                | classe                | Ordre                    | gamme de e-value | nombre de résultats |

|_______________________|_______________________|__________________________|__________________|_____________________|___________

|                       |                       |                          |                  |                     |           |

| [Proteobacteria]      | [Gammaproteobacteria] | [Oceanospirillales]      |   6e-57 - 5e-25  |         13          |           |

|                       |                       |__________________________|__________________|_____________________|           |

|                       |                       |                          |                  |                     |           |

|                       |                       | [Alteromonadales]        |   2e-53 - 4e-38  |         48          |           |

|                       |                       |__________________________|__________________|_____________________|           |

|                       |                       |                          |                  |                     |           |

|                       |                       | [Xanthomonadales]        |   3e-48 - 2e-20  |         24          |           |

|                       |                       |__________________________|__________________|_____________________|           |

|                       |                       |                          |                  |                     |           |

|                       |                       | [Chromatiales]           |   4e-48 - 2e-34  |         11          |           |

|                       |                       |__________________________|__________________|_____________________|           |

|                       |                       |                          |                  |                     |           |

|                       |                       | [Thiotrichales]          |   1e-43 - 9e-23  |          7          |           |

|                       |_______________________|__________________________|__________________|_____________________|           |

|                       |                       |                          |                  |                     |           |

|                       | [Betaproteobacteria]  | [Hydrogenophilales]      |       4e-51      |          1          |           |

|                       |                       |__________________________|__________________|_____________________|     B     |

|                       |                       |                          |                  |                     |     A     |

|                       |                       | [Neisseriales]           |   4e-50 - 1e-22  |          45         |     C     |

|                       |_______________________|__________________________|__________________|_____________________|     T     |

|                       |                       |                          |                  |                     |     E     |

|                       | [Alphaproteobacteria] | [Rhodobacterales]        |   4e-46 - 1e-34  |          27         |     R     |

|_______________________|_______________________|__________________________|__________________|_____________________|     I     |

|                       |                       |                          |                  |                     |     E     |

| [Nitrospirae]         | [Nitrospira]          | [Nitrospirales]          |   3e-41 - 5e-18  |           4         |     S     |

|_______________________|_______________________|_____________________________________________|_____________________|           |

|                       |                       |                          |                  |                     |           |

| [Actinobacteria]      | [Actinobacteria]      | [Actinomycetales]        |   8e-40 - 8e-16  |          23         |           |

|_______________________|_______________________|__________________________|__________________|_____________________|           |

|                       |                       |                          |                  |                     |           |

| [Bacteroidetes]       | [Flavobacteriia]      | [Flavobacteriales]       |       3e-36      |           1         |           |

|_______________________|_______________________|__________________________|__________________|_____________________|           |

|                       |                       |                          |                  |                     |           |

| [Spirochaetes]        | [Spirochaetia]        | [pirochaetale]           |   1e-34 - 1e-15  |          23         |           |

|_______________________|_______________________|__________________________|__________________|_____________________|           |

|                       |                       |                          |                  |                     |           |

|[Thermodesulfobacteria]|[Thermodesulfobacteria]|[Thermodesulfobacteriales]|   2e-34 - 3e-27  |           4         |           |

|_______________________|_______________________|__________________________|__________________|_____________________|           |    

|                       |                       |                          |                  |                     |           |

| [Planctomycetes]      | [Planctomycetacia]    | [Planctomycetales]       |   5e-33 - 9e-25  |           8         |           |

|_______________________|_______________________|__________________________|__________________|_____________________|           |

|                       |                       |                          |                  |                     |           |

| [Chloroflexi]         | [Chloroflexi]         | [Chloroflexales]         |   8e-31 - 6e-27  |           4         |           |

|_______________________|_______________________|__________________________|__________________|_____________________|           |

|                       |                       |                          |                  |                     |           |

| [Spirochaetes]        | [Spirochaetia]        | [pirochaetale]           |   1e-34 - 1e-15  |          23         |           |

|_______________________|_______________________|__________________________|__________________|_____________________|___________|

|                                                                          |                  |                     |           |

|  Archeae                                                                 |   1e-33 - 2e-15  |          58         |  ARCHEAE  |

|__________________________________________________________________________|__________________|_____________________|___________|

|                                                                          |                  |                     |           |

|  Eukaryota                                                               |   3e-29 - 2e-15  |         130         | EUCARYOTE |

|__________________________________________________________________________|__________________|_____________________|___________|




     Nous voyons que ce rapport taxonomique effectué contre NR regroupe la totalité de l'arbre du vivant. Et bien que la différence de e-value est progressive entre chacun des organismes, il y a un différentiel non négligeable de 1e-22 entre le meilleur hit des Proteobacteria et celui des Archeae. L'écart est encore plus grand avec les Eukaryota 1e-28.


Cet écart étant important nous pouvons dire que notre groupe d'étude ne sera pas les Archeae ou les Eukaryota. Mais ils restent des homologues ne l'oublions pas.


Notre meilleur Hit étant une Gammaproteobacteria (6e-57; 9e-23) nous allons choisir plusieurs ordre au sein de cette classe comme groupe intérieur. Nous avions  pris dans un premier temps les Betaproteobacteria comme groupe extérieur car c'est celui qui partage le plus proche ancêtre commun avec les Gammaproteobacteria. Mais nous avions obtenue un arbre au sein duquel les 2 classes étaient mélangé peut importe l'enracinement. Cela peut s'expliquer par le faible différentiel de e-value entre chacune de ces séquences.


Nous avons donc décider d'élargir notre groupe d'étude (ou intérieur) au Gammaproteobacteria et Betaproteobacteria en prennant comme groupe extérieur les Alphaproteobacteria qui partagent le plus proche ancêtre commun avec les deux autres classes.  

De plus nous avons choisi des séquences au sein de ses groupes qui présente la même fonction d'après le BLAST soit deacetylase, Histone deacetylase ou acetoin utilization protein car nous avions vue qu'elles appartenaient toutes à la super famille des histone deacetylase.





                            SÉQUENCES RETENUES LORS DU RAPPORT TAXONOMIQUE POUR RÉALISER L'ALIGNEMENT MULTIPLE


___________________________________________________________________________________________________________________________________________

|                                                                                                                     |         |           |

| Désignation                                                                                                         |  Score  |  E-value  |

|_____________________________________________________________________________________________________________________|_________|___________|


Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: deacetylase [Halomonas campaniensis]                       194       2e-57  


Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: deacetylase [Halomonas boliviensis]                        193       6e-57      


Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: deacetylase [Chromohalobacter salexigens]                  169       1e-47  

        

Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: deacetylase [Marinospirillum minutulum]                    177       6e-51    


Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales:   deacetylase [Marinobacterium                               192       9e-57  


Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Marinobacter sp. A3d10]                         184       3e-53

  

Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: histone deacetylase superfamily [Glacieco...                 164       7e-46


Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Pseudoalteromonas haloplanktis]                 156       9e-43  


Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: histone deacetylase superfamily [Photobac...                     191       3e-56


Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Histone deacetylase-like amidohydrolase [...                     114       2e-26


Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: deacetylase [Rheinheimera perlucida]                            175       4e-50


Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: MULTISPECIES: hypothetical protein [Thioa...                    173       2e-49


Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: Deacetylase, including histone deacetylas...                    147       2e-39

  

Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: deacetylase [Legionella lansingensis]                          171       1e-48


Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: deacetylase [Legionella oakridgensis RV-2-2007]                163       2e-45    


Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Pseudoxantho...                 150       3e-40


Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Xanthomonadaceae                132       7e-34    


Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Xanthomonas                     121       1e-29  


Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: deacetylase [Leucothrix mucor]                                 157       4e-43  


Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: hypothetical protein [Methylovulum miyako...                 158       2e-43


Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: acetoin utilization protein [Methylobacte...                 142       4e-37


Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: acetoin utilization protein [Pseudomonas ...                 123       8e-30


Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: acetoin utilization protein [Serratia ply...               119       2e-28


Bacteria:Proteobacteria:Betaproteobacteria:Hydrogenophilales: deacetylase [Sulfuricella denitrificans]                    178       4e-51


Bacteria:Proteobacteria:Betaproteobacteria:Hydrogenophilales: deacetylase [Thiobacillus denitrificans]                    132       1e-33      


Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Aquaspirillum serpens]                              170       6e-48

  

Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: histone deacetylase [Thauera linaloolentis]                     165       3e-46


Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Chitinilyticum aquatile]                            162       5e-45


Bacteria:Proteobacteria:Betaproteobacteria: Histone deacetylase-like amidohydrolase [Candi...                             158       2e-43


Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: deacetylase [Nitrosomonas eutropha]                          155       2e-42

      

Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria lactamica]                                154       2e-41

        

Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria sp. oral taxon 014]                       153       6e-41  


Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: histone deacetylase domain protein [Neiss...                     150       6e-40


Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: histone deacetylase domain protein [Burkholder...             149       6e-40  


Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase, including yeast histone deacetyl...              149       7e-40


Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria macacae]                                  149       8e-40  

            

Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: deacetylase [Nitrosospira multiformis]                       145       1e-38

        

Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Methylibium petroleiphilum]                      145       2e-38  


Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria cinerea]                                  145       5e-38    

      

Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Burkholderia ambifaria]                          144       4e-38      


Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Burkholderia cenocepacia]                        144       4e-38      


Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Acidovorax sp. JHL-3]                            130       7e-33      


Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Comamonadaceae bacterium URH...                  127       2e-31


Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Sutterella wadswort...                  105       2e-23


Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Burkholderia...                  92.4      7e-19


Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Burkholderia...                  88.6      1e-17


Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: histone deacetylase domain protein [Burkholder...             88.6      1e-17


Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Oceanicola s...                 165       5e-46


Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Ruegeria sp....                 164       1e-45


Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Leisingera n...                 150       3e-40


Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Nesiotobacte...                 141       6e-37

        

Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Catellibacte...                 135       6e-35


Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: histone deacetylase superfamily protein [...                     157       7e-43


Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: acetoin utilization protein [Brevundimona...                 151       5e-41


Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Rhizobium gi...                     148       1e-39


Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Microvirga l...                     144       6e-38


Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Rhodopseudom...                     130       4e-33


Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: MULTISPECIES: acetoin utilization protein...                129       2e-32


Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Methylobacte...                     124       1e-30


Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: histone deacetylase [Methylobacterium ext...                     115       4e-27


Bacteria:Proteobacteria:Alphaproteobacteria: histone deacetylase [Candidatus Puniceisp...                                 88.2      2e-17



RÉSULTATS BRUTS:

.LUCA
. Bacteria
. .Proteobacteria
. . Gammaproteobacteria
. . .Oceanospirillales
. . . Halomonadaceae
. . . .Halomonas
. . . . Halomonas boliviensis........................ 193  6e-57  9 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: deacetylase [Halomonas boliviensis]            
. . . . Halomonas sp. TD01........................... 192  1e-56  18 hits Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: deacetylase [Halomonas sp. TD01]               
. . . . Halomonas sp. HAL1........................... 191  3e-56  18 hits Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: deacetylase [Halomonas sp. HAL1]               
. . . . Halomonas sp. KM-1........................... 183  3e-53  9 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: deacetylase [Halomonas sp. KM-1]               
. . . . Halomonas sp. GFAJ-1......................... 168  3e-47  10 hits Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: deacetylase [Halomonas sp. GFAJ-1]             
. . . . Halomonas elongata........................... 164  1e-45  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: deacetylase [Halomonas elongata]               
. . . . Halomonas boliviensis LC1.................... 111  1e-25  9 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: histone deacetylase [Halomonas boliviensis]    
. . . . Halomonas elongata DSM 2581.................. 90.1 3e-18  10 hits Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: histone deacetylase [Halomonas elongata]     
. . . Marinomonas mediterranea....................... 169  1e-47  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: deacetylase [Marinomonas mediterranea]         
. . . Marinomonas sp. MWYL1.......................... 162  4e-45  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: deacetylase [Marinomonas sp. MWYL1]            
. . . Marinomonas posidonica......................... 162  5e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: deacetylase [Marinomonas posidonica]           
. . . Bermanella marisrubri.......................... 157  3e-43  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: Deacetylases, including yeast histone dea...   
. . . Alcanivorax dieselolei......................... 109  5e-25  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: histone deacetylase [Alcanivorax dieselolei]   
. . .Marinobacterium stanieri........................ 184  2e-53  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Marinobacterium stanieri]         
. . .Marinobacter hydrocarbonoclasticus.............. 182  8e-53  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Marinobacter hydrocarbonocla...   
. . .Alishewanella jeotgali.......................... 178  4e-51  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Alishewanella jeotgali]           
. . .Alishewanella aestuarii......................... 175  5e-50  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Alishewanella aestuarii]          
. . .Alishewanella agri.............................. 173  2e-49  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Alishewanella agri]               
. . .Glaciecola sp. 4H-3-7+YE-5...................... 170  4e-48  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Glaciecola sp. 4H-3-7+YE-5]       
. . .Glaciecola chathamensis......................... 170  5e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: histone deacetylase family protein [Glaci...   
. . .Glaciecola agarilytica.......................... 169  7e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: histone deacetylase family protein [Glaci...   
. . .Glaciecola pallidula............................ 164  6e-46  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: histone deacetylase superfamily [Glacieco...   
. . .Marinobacter.................................... 162  4e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: MULTISPECIES: deacetylase [Marinobacter]       
. . .Marinobacter sp. ELB17.......................... 162  5e-45  18 hits Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Marinobacter sp. ELB17]           
. . .Glaciecola nitratireducens...................... 161  7e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Glaciecola nitratireducens]       
. . .Marinobacter sp. BSs20148....................... 160  4e-44  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Marinobacter sp. BSs20148]        
. . .Glaciecola polaris.............................. 159  8e-44  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: histone deacetylase/AcuC/AphA family prot...   
. . .Marinobacter algicola........................... 150  1e-40  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Marinobacter algicola]            
. . .Glaciecola mesophila............................ 149  3e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: histone deacetylase 14 [Glaciecola mesoph...   
. . .Glaciecola psychrophila......................... 140  1e-36  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: histone deacetylase 14 [Glaciecola psychr...   
. . .Glaciecola punicea.............................. 131  3e-33  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Glaciecola punicea]               
. . .Alteromonas macleodii........................... 130  5e-33  20 hits Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: Histone deacetylase/AcuC/AphA family prot...   
. . .Alteromonas macleodii str. 'Balearic Sea AD45'.. 130  6e-33  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Alteromonas macleodii]            
. . .Alteromonas macleodii str. 'English Channel 673. 130  7e-33  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Alteromonas macleodii]            
. . .Alteromonas macleodii ATCC 27126................ 130  7e-33  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Alteromonas macleodii]            
. . .Alteromonas macleodii str. 'Black Sea 11'....... 130  9e-33  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Alteromonas macleodii]            
. . .Alteromonas sp. SN2............................. 129  3e-32  12 hits Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Alteromonas sp. SN2]              
. . .Glaciecola pallidula DSM 14239 = ACAM 615....... 110  3e-25  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: histone deacetylase 5 [Glaciecola pallidula]   
. . .Marinobacter algicola DG893..................... 109  5e-25  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: histone deacetylase [Marinobacter algicola]    
. . .Marinobacter manganoxydans...................... 90.1 3e-18  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: histone deacetylase [Marinobacter mangano... 
. . .Marinobacter adhaerens.......................... 88.2 2e-17  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: histone deacetylase [Marinobacter adhaerens] 
. . .Idiomarina sp. A28L............................. 164  5e-46  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Idiomarina sp. A28L]              
. . .Teredinibacter turnerae......................... 162  3e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Teredinibacter turnerae]          
. . .Pseudoalteromonas............................... 158  1e-43  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: MULTISPECIES: deacetylase [Pseudoalteromo...   
. . .Pseudoalteromonas undina........................ 157  2e-43  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Pseudoalteromonas undina]         
. . .Pseudoalteromonas sp. BSi20311.................. 156  7e-43  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: MULTISPECIES: deacetylase [Pseudoalteromo...   
. . .Pseudoalteromonas rubra......................... 156  1e-42  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Pseudoalteromonas rubra]          
. . .Alteromonadales bacterium TW-7.................. 155  2e-42  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Alteromonadales bacterium TW-7]   
. . .Pseudoalteromonas marina........................ 154  6e-42  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Pseudoalteromonas marina]         
. . .Pseudoalteromonas sp. BSi20480.................. 152  3e-41  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Pseudoalteromonas sp. BSi20480]   
. . .Pseudoalteromonas citrea........................ 152  3e-41  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Pseudoalteromonas citrea]         
. . .Pseudoalteromonas flavipulchra.................. 152  3e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Pseudoalteromonas flavipulchra]   
. . .Pseudoalteromonas sp. BSi20495.................. 152  3e-41  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Pseudoalteromonas sp. BSi20495]   
. . .Pseudoalteromonas sp. BSi20429.................. 152  4e-41  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Pseudoalteromonas sp. BSi20429]   
. . .Pseudoalteromonas arctica....................... 152  4e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Pseudoalteromonas arctica]        
. . .Pseudoalteromonas sp. BSi20652.................. 152  4e-41  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Pseudoalteromonas sp. BSi20652]   
. . .Pseudoalteromonas sp. Bsw20308.................. 151  5e-41  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: histone deacetylase superfamily [Pseudoal...   
. . .Pseudoalteromonas piscicida..................... 150  1e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Pseudoalteromonas piscicida]      
. . .Pseudoalteromonas haloplanktis.................. 150  2e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Pseudoalteromonas haloplanktis]   
. . .Pseudoalteromonas spongiae...................... 145  9e-39  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Pseudoalteromonas spongiae]       
. . .Psychromonas ingrahamii......................... 144  4e-38  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: deacetylase [Psychromonas ingrahamii]          
. . .Hydrocarboniphaga effusa........................ 170  3e-48  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: deacetylase [Hydrocarboniphaga effusa]         
. . .Rhodanobacter fulvus............................ 134  2e-34  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Rhodanobacte...   
. . .Rhodanobacter thiooxydans....................... 132  1e-33  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Rhodanobacte...   
. . .Rhodanobacter sp. 115........................... 131  3e-33  12 hits Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Rhodanobacte...   
. . .Xanthomonas gardneri............................ 130  7e-33  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Xanthomonas ...   
. . .Rhodanobacter spathiphylli...................... 127  7e-32  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Rhodanobacte...   
. . .Stenotrophomonas sp. CF318...................... 125  5e-31  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: deacetylase [Polaromonas sp. CF318]            
. . .Xanthomonas campestris.......................... 125  6e-31  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Xanthomonas ...   
. . .Rhodanobacter sp. 2APBS1........................ 124  1e-30  20 hits Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Rhodanobacte...   
. . .Xanthomonas oryzae.............................. 122  6e-30  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Xanthomonas ...   
. . .Xanthomonas oryzae pv. oryzicola BLS256......... 122  7e-30  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Xanthomonas ...   
. . .Xanthomonas axonopodis.......................... 122  8e-30  12 hits Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: histone deacetylase [Xanthomonas axonopodis]   
. . .Xanthomonas axonopodis pv. punicae str. LMG 859. 122  8e-30  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Xanthomonas ...   
. . .Xanthomonas sacchari............................ 121  1e-29  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Xanthomonas ...   
. . .Frateuria aurantia.............................. 121  2e-29  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Frateuria au...   
. . .Xanthomonas vesicatoria......................... 120  3e-29  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Xanthomonas ...   
. . .Xanthomonas alfalfae............................ 119  5e-29  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Xanthomonas ...   
. . .Pseudoxanthomonas spadix........................ 117  5e-28  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Pseudoxantho...   
. . .Pseudoxanthomonas suwonensis.................... 115  2e-27  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Pseudoxantho...   
. . .Xanthomonas citri............................... 99.8 9e-22  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Xanthomonas ... 
. . .Stenotrophomonas maltophilia.................... 99.8 1e-21  20 hits Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Stenotrophom... 
. . .Pseudomonas geniculata.......................... 97.8 6e-21  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [ [Pseudomona... 
. . .Stenotrophomonas maltophilia R551-3............. 96.7 1e-20  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Stenotrophom... 
. . .Stenotrophomonas maltophilia D457............... 96.3 2e-20  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: acetoin utilization protein [Stenotrophom... 
. . .Ectothiorhodospira sp. PHS-1.................... 170  4e-48  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: deacetylase [Ectothiorhodospira sp. PHS-1]     
. . .Thioalkalivibrio thiocyanoxidans ARh 4.......... 163  2e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: deacetylase [Thioalkalivibrio thiocyanoxidans ...   
. . .Thiorhodospira sibirica......................... 153  1e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: deacetylase [Thiorhodospira sibirica]          
. . .Rheinheimera nanhaiensis........................ 161  7e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: deacetylase [Rheinheimera nanhaiensis]         
. . .Thiorhodovibrio sp. 970......................... 155  2e-42  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: deacetylase [Thiorhodovibrio sp. 970]          
. . .Thiocapsa marina................................ 155  2e-42  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: deacetylase [Thiocapsa marina]                 
. . .Thiorhodococcus drewsii......................... 149  4e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: deacetylase [Thiorhodococcus drewsii]          
. . .Marichromatium purpuratum 984................... 149  6e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: deacetylase [Marichromatium purpuratum 984]         
. . .Allochromatium vinosum.......................... 143  6e-38  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: deacetylase [Allochromatium vinosum]           
. . .Rheinheimera sp. A13L........................... 134  2e-34  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: deacetylase [Rheinheimera sp. A13L]            
. . .Thiocystis violascens........................... 134  2e-34  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: deacetylase [Thiocystis violascens]            
. . .gamma proteobacterium HIMB30.................... 162  5e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: deacetylase [gamma proteobacterium HIMB30]     
. . .Methylophaga aminisulfidivorans................. 158  1e-43  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: deacetylase [Methylophaga aminisulfidivor...   
. . .Methylophaga frappieri.......................... 97.4 8e-21  12 hits Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: histone deacetylase [Methylophaga sp. JAM7]  
. . .Methylophaga nitratireducenticrescens........... 94.0 1e-19  12 hits Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: histone deacetylase [Methylophaga sp. JAM1]  
. . .Cycloclasticus sp. P1........................... 128  3e-32  12 hits Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: deacetylase [Cycloclasticus sp. P1]            
. . .Beggiatoa alba.................................. 140  1e-36  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: deacetylase [Beggiatoa alba]                   
. . .Thiothrix nivea................................. 134  3e-34  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: deacetylase [Thiothrix nivea]                  
. . .Beggiatoa sp. PS................................ 100  9e-23  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: Histone deacetylase domain [Beggiatoa sp. PS]       
. . .marine gamma proteobacterium HTCC2080........... 157  2e-43  10 hits Bacteria:Proteobacteria:Gammaproteobacteria: deacetylase [marine gamma proteobacterium...   
. . .gamma proteobacterium IMCC3088.................. 110  3e-25  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria: histone deacetylase superfamily [gamma pr...   
. . .uncultured gamma proteobacterium................ 156  8e-43  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: histone deacetylase [uncultured gamma proteob...   
. . .uncultured gamma proteobacterium HF0500_07A21... 99.4 2e-21  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria: deacetylases, including yeast histone deacetyl... 
. . .Cellvibrio sp. BR............................... 147  2e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: deacetylase [Cellvibrio sp. BR]                
. . .Pseudomonas aeruginosa.......................... 123  8e-30  36 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: acetoin utilization protein [Pseudomonas ...   
. . .Pseudomonas aeruginosa CIG1..................... 123  9e-30  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: acetoin utilization protein [Pseudomonas ...   
. . .Pseudomonas aeruginosa NCGM2.S1................. 123  9e-30  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: acetoin utilization protein [Pseudomonas ...   
. . .Pseudomonas aeruginosa BL09..................... 123  9e-30  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: acetoin utilization protein [Pseudomonas ...   
. . .Pseudomonas aeruginosa BWHPSA001................ 123  9e-30  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: acetoin utilization protein [Pseudomonas ...   
. . .Pseudomonas sp. 2_1_26.......................... 122  1e-29  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: acetoin utilization protein [Pseudomonas ...   
. . .Pseudomonas syringae............................ 114  2e-27  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: putative acetylpolyamine aminohydrolase [...   
. . .Pseudomonas chlororaphis........................ 114  1e-26  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: acetoin utilization protein [Pseudomonas ...   
. . .Pseudomonas sp. GM17............................ 112  7e-26  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: acetoin utilization protein [Pseudomonas ...   
. . .Pseudomonas chlororaphis O6..................... 111  9e-26  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: acetoin utilization protein [Pseudomonas ...   
. . .Pseudomonas sp. GM33............................ 109  5e-25  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: deacylase [Pseudomonas sp. GM33]               
. . .Pseudomonas synxantha........................... 108  2e-24  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: acetoin utilization protein [Pseudomonas ...   
. . .Pseudomonas sp. GM78............................ 106  5e-24  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: deacylase [Pseudomonas sp. GM78]               
. . .Pseudomonas fluorescens......................... 105  9e-24  16 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: acetoin utilization protein [Pseudomonas ...   
. . .Pseudomonas fluorescens A506.................... 103  4e-23  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: acetoin utilization protein [Pseudomonas ...   
. . .Pseudomonas fluorescens SBW25................... 102  2e-22  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: acetoin utilization protein [Pseudomonas ...   
. . .Pseudomonas fluorescens SS101................... 102  3e-22  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: acetoin utilization protein [Pseudomonas ...   
. . .Pseudomonas sp. PAMC 25886...................... 100  1e-21  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: acetoin utilization protein [Pseudomonas ...   
. . .Pseudomonas..................................... 95.9 3e-20  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: acetoin utilization protein... 
. . .Pseudomonas aeruginosa ATCC 700888.............. 79.3 1e-15  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: acetylpolyamine aminohydrolase [Pseudomon... 
. . .Methylobacter tundripaludum..................... 144  5e-38  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: acetoin utilization protein [Methylobacte...   
. . .Methylomonas methanica.......................... 134  3e-34  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: acetoin utilization protein [Methylomonas...   
. . .Methylomicrobium alcaliphilum................... 122  9e-30  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: acetoin utilization protein [Methylomicro...   
. . .Methylomicrobium album.......................... 105  2e-23  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: deacetylase, histone deacetylase/acetoin ...   
. . .Simiduia agarivorans............................ 133  5e-34  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria: deacetylase [Simiduia agarivorans]             
. . .gamma proteobacterium SCGC AAA007-O20........... 122  7e-30  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria: histone deacetylase family protein [gamma...   
. . .Salinisphaera shabanensis....................... 122  9e-30  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Salinisphaerales: histone deacetylase [Salinisphaera shaban...   
. . .Xenorhabdus nematophila......................... 121  2e-29  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: acetoin utilization protein [Xenorhabdus ...   
. . .Providencia burhodogranariea.................... 121  2e-29  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: histone deacetylase family protein [Provi...   
. . .Serratia........................................ 120  4e-29  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: acetoin utilization protein...   
. . .Serratia plymuthica............................. 119  1e-28  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: acetoin utilization protein [Serratia ply...   
. . .Serratia proteamaculans......................... 117  1e-27  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: acetoin utilization protein [Serratia pro...   
. . .Providencia stuartii............................ 115  3e-27  12 hits Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: acetoin utilization protein [Providencia ...   
. . .Providencia stuartii ATCC 25827................. 115  5e-27  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: acetoin utilization protein [Providencia ...   
. . .Klebsiella sp. MS 92-3.......................... 108  8e-25  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: histone deacetylase-like amidohydrolase [...   
. . .Klebsiella pneumoniae........................... 108  9e-25  44 hits Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Deacetylases, including yeast histone dea...   
. . .Klebsiella pneumoniae KCTC 2242................. 108  1e-24  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: acetoin utilization protein [Klebsiella p...   
. . .Klebsiella pneumoniae subsp. pneumoniae HS11286. 108  1e-24  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: acetoin utilization protein [Klebsiella p...   
. . .Klebsiella pneumoniae subsp. pneumoniae ST258-K. 108  1e-24  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Deacetylases, including yeast histone dea...   
. . .Klebsiella pneumoniae subsp. pneumoniae NTUH-K2. 108  1e-24  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: acetoin utilization protein [Klebsiella p...   
. . .Klebsiella pneumoniae subsp. pneumoniae JC2877.. 108  1e-24  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: acetoin utilization protein [Klebsiella p...   
. . .Klebsiella sp. 4_1_44FAA........................ 108  1e-24  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: acetoin utilization protein [Klebsiella s...   
. . .Klebsiella pneumoniae subsp. pneumoniae MGH 785. 108  1e-24  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: acetoin utilization protein [Klebsiella p...   
. . .Klebsiella oxytoca.............................. 108  1e-24  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: acetoin utilization protein [Klebsiella o...   
. . .Photorhabdus asymbiotica........................ 107  2e-24  12 hits Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: acetoin utilization protein [Photorhabdus...   
. . .Enterobacter aerogenes.......................... 106  5e-24  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: acetoin utilization protein [Enterobacter...   
. . .Escherichia coli ISC56.......................... 90.5 1e-18  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Deacetylases, including yeast histone deacety... 
. . .Vibrio nigripulchritudo......................... 115  5e-27  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: acetoin utilization protein [Vibrio nigri...   
. . .Vibrio sp. EJY3................................. 91.3 1e-18  12 hits Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: histone deacetylase [Vibrio sp. EJY3]        
. . .Oceanimonas sp. GK1............................. 98.2 4e-21  12 hits Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: histone deacetylase [Oceanimonas sp. GK1]    
. . Sulfuricella denitrificans....................... 178  4e-51  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Hydrogenophilales: deacetylase [Sulfuricella denitrificans]       
. . Neisseria shayeganii............................. 176  4e-50  5 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria shayeganii]             
. . Methylotenera mobilis............................ 172  1e-48  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: deacetylase [Methylotenera mobilis]            
. . Pseudogulbenkiania sp. NH8B...................... 172  1e-48  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Pseudogulbenkiania sp. NH8B]      
. . Thauera.......................................... 169  1e-47  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: MULTISPECIES: deacetylase [Thauera]            
. . Laribacter hongkongensis......................... 166  2e-46  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Laribacter hongkongensis]         
. . Azoarcus sp. KH32C............................... 164  6e-46  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: hypothetical protein [Azoarcus sp. KH32C]      
. . Azoarcus sp. BH72................................ 163  1e-45  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: deacetylase [Azoarcus sp. BH72]                
. . Bordetella petrii................................ 162  5e-45  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Bordetella petrii]                
. . Burkholderia rhizoxinica......................... 162  2e-44  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Burkholderia rhizoxinica]         
. . Nitrosomonas sp. AL212........................... 159  5e-44  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: deacetylase [Nitrosomonas sp. AL212]           
. . Bordetella avium................................. 159  6e-44  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Bordetella avium]                 
. . Azospira oryzae.................................. 159  8e-44  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: deacetylase [Azospira oryzae]                  
. . Gallionella capsiferriformans.................... 158  2e-43  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Gallionellales: deacetylase [Gallionella capsiferriformans]    
. . Methylovorus glucosotrophus...................... 156  8e-43  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: deacetylase [Methylovorus glucosotrophus]      
. . Candidatus Accumulibacter phosphatis............. 155  1e-42  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: deacetylase [Candidatus Accumulibacter ph...   
. . Sideroxydans lithotrophicus...................... 155  2e-42  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Gallionellales: deacetylase [Sideroxydans lithotrophicus]      
. . Methylovorus sp. MP688........................... 155  3e-42  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: deacetylase [Methylovorus sp. MP688]           
. . Rubrivivax gelatinosus........................... 155  3e-42  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Rubrivivax gelatinosus]           
. . Neisseria lactamica ATCC 23970................... 154  2e-41  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: histone deacetylase domain protein [Neisseria ...   
. . Neisseria lactamica.............................. 154  2e-41  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria lactamica]              
. . Neisseria meningitidis........................... 154  2e-41  24 hits Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria meningitidis]           
. . Neisseria lactamica 020-06....................... 154  3e-41  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria lactamica]              
. . Neisseria meningitidis alpha522.................. 154  3e-41  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: histone deacetylase 1 HD1 [Neisseria meningit...   
. . Neisseria meningitidis NM255..................... 153  3e-41  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria meningitidis]           
. . Neisseria meningitidis NM233..................... 153  3e-41  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: histone deacetylase family protein [Neiss...   
. . Neisseria sp. oral taxon 014..................... 153  6e-41  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria sp. oral taxon 014]     
. . Neisseria meningitidis alpha704.................. 152  8e-41  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria meningitidis]           
. . Neisseria meningitidis NM3081.................... 152  1e-40  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria meningitidis]           
. . Neisseria meningitidis 93003..................... 152  1e-40  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria meningitidis]           
. . Neisseria meningitidis WUE 2594.................. 152  1e-40  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria meningitidis]           
. . Neisseria meningitidis 80179..................... 152  2e-40  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria meningitidis]           
. . Neisseria meningitidis alpha710.................. 151  2e-40  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria meningitidis]           
. . Neisseria meningitidis NM2657.................... 151  2e-40  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria meningitidis]           
. . Neisseria meningitidis H44/76.................... 151  3e-40  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria meningitidis]           
. . Neisseria meningitidis ATCC 13091................ 151  3e-40  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: histone deacetylase family [Neisseria meningit...   
. . Neisseria weaveri................................ 151  4e-40  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria weaveri]                
. . Neisseria meningitidis alpha153.................. 150  5e-40  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: histone deacetylase family protein [Neisseria...   
. . Neisseria meningitidis 98008..................... 150  6e-40  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria meningitidis]           
. . Neisseria meningitidis 053442.................... 150  6e-40  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria meningitidis]           
. . Neisseria meningitidis NM220..................... 150  6e-40  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: histone deacetylase family protein [Neiss...   
. . Neisseria meningitidis FAM18..................... 150  7e-40  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria meningitidis]           
. . Neisseria polysaccharea.......................... 150  7e-40  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria polysaccharea]          
. . Neisseria macacae................................ 149  8e-40  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria macacae]                
. . Neisseria meningitidis alpha275.................. 149  1e-39  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: histone deacetylase family protein [Neisseria...   
. . Neisseria sicca.................................. 149  2e-39  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria sicca]                  
. . Neisseria meningitidis 961-5945.................. 149  2e-39  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria meningitidis]           
. . Ralstonia solanacearum........................... 148  1e-39  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Ralstonia solanacearum]           
. . Burkholderia sp. SJ98............................ 148  1e-39  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Burkholderia sp. SJ98]            
. . Burkholderia xenovorans.......................... 148  2e-39  5 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Burkholderia xenovorans]          
. . Ralstonia sp. PBA................................ 147  2e-39  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Ralstonia sp. PBA]                
. . Burkholderia phymatum............................ 147  3e-39  5 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Burkholderia phymatum]            
. . Burkholderia terrae.............................. 147  3e-39  5 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Burkholderia terrae]              
. . Neisseria sicca ATCC 29256....................... 147  6e-39  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria sicca]                  
. . Neisseria sp. GT4A_CT1........................... 147  7e-39  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria sp. GT4A_CT1]           
. . Neisseria meningitidis NM3001.................... 146  2e-38  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria meningitidis]           
. . Neisseria meningitidis M01-240355................ 146  2e-38  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria meningitidis]           
. . Burkholderia..................................... 145  1e-38  5 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: deacetylase [Burkholderia]       
. . Achromobacter piechaudii......................... 145  1e-38  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Achromobacter piechaudii]         
. . Burkholderia phytofirmans........................ 145  2e-38  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Burkholderia phytofirmans]        
. . Neisseria gonorrhoeae............................ 145  5e-38  24 hits Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria gonorrhoeae]            
. . Burkholderia cepacia............................. 144  3e-38  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Burkholderia cepacia]             
. . Burkholderia ambifaria........................... 144  3e-38  16 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Burkholderia ambifaria]           
. . Burkholderia cenocepacia......................... 144  4e-38  16 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Burkholderia cenocepacia]         
. . Achromobacter xylosoxidans....................... 144  4e-38  12 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Achromobacter xylosoxidans]       
. . Burkholderia multivorans......................... 143  6e-38  17 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Burkholderia multivorans]         
. . Burkholderia phenoliruptrix...................... 143  6e-38  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Burkholderia phenoliruptrix]      
. . Nitrosomonas sp. Is79A3.......................... 143  7e-38  12 hits Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: deacetylase [Nitrosomonas sp. Is79A3]          
. . Burkholderia ubonensis........................... 143  1e-37  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Burkholderia ubonensis]           
. . Achromobacter xylosoxidans C54................... 142  2e-37  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Achromobacter xylosoxidans]       
. . Burkholderia sp. TJI49........................... 142  3e-37  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: histone deacetylase superfamily protein [Burkh...   
. . Neisseria gonorrhoeae MS11....................... 142  6e-37  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria gonorrhoeae]            
. . Neisseria gonorrhoeae 1291....................... 142  9e-37  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: histone deacetylase [Neisseria gonorrhoeae 1291]    
. . Methyloversatilis universalis.................... 139  2e-36  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: Histone deacetylase [Methyloversatilis un...   
. . Burkholderiaceae................................. 138  6e-36  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: deacetylase [Burkholderiaceae]   
. . Cupriavidus necator.............................. 138  7e-36  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Cupriavidus necator]              
. . Neisseria mucosa................................. 138  2e-35  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria mucosa]                 
. . Kingella kingae.................................. 137  3e-35  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: histone deacetylase [Kingella kingae]          
. . Simonsiella muelleri............................. 137  3e-35  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: hypothetical protein [Simonsiella muelleri]    
. . Kingella kingae PYKK081.......................... 136  1e-34  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: histone deacetylase superfamily protein [...   
. . Bordetella parapertussis......................... 135  5e-35  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: histone deacetylase family protein [Borde...   
. . Bordetella bronchiseptica........................ 135  6e-35  12 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: histone deacetylase family protein [Borde...   
. . Burkholderia sp. BT03............................ 135  6e-35  16 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Burkholderia sp. BT03]            
. . Bordetella bronchiseptica 1289................... 135  7e-35  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: histone deacetylase family protein [Borde...   
. . Oxalobacter formigenes........................... 135  7e-35  16 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Oxalobacter formigenes]           
. . Burkholderia pseudomallei........................ 134  2e-34  24 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Burkholderia pseudomallei]        
. . Comamonas testosteroni........................... 134  3e-34  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Comamonas testosteroni]           
. . Comamonas testosteroni ATCC 11996................ 134  3e-34  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Comamonas testosteroni]           
. . Bordetella bronchiseptica MO149.................. 134  3e-34  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: histone deacetylase family protein [Borde...   
. . Hydrogenophaga sp. PBC........................... 133  4e-34  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Hydrogenophaga sp. PBC]           
. . Cupriavidus necator N-1.......................... 133  4e-34  16 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Cupriavidus ...   
. . Burkholderia xenovorans LB400.................... 133  6e-34  10 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Burkholderia xenovorans]          
. . Neisseria flavescens............................. 133  9e-34  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: deacetylase [Neisseria flavescens]             
. . Achromobacter xylosoxidans AXX-A................. 132  1e-33  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Achromobacter xylosoxidans]       
. . Burkholderiales bacterium JOSHI_001.............. 132  1e-33  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Burkholderiales bacterium JO...   
. . Kingella denitrificans........................... 132  3e-33  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: histone deacetylase [Kingella denitrificans]   
. . Methyloversatilis universalis FAM5............... 130  3e-33  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: deacetylase [Methyloversatilis universalis]    
. . Burkholderia cenocepacia H111.................... 130  6e-33  16 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Burkholderia cenocepacia]         
. . Advenella kashmirensis........................... 130  6e-33  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Advenella kashmirensis]           
. . Herbaspirillum sp. GW103......................... 129  2e-32  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Herbaspirillum sp. GW103]         
. . Hylemonella gracilis............................. 128  4e-32  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Hylemonella ...   
. . Ramlibacter tataouinensis........................ 128  5e-32  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Ramlibacter tataouinensis]        
. . Oxalobacter formigenes HOxBLS.................... 126  2e-31  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Oxalobacter formigenes]           
. . Verminephrobacter aporrectodeae.................. 125  5e-31  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Verminephrobacter aporrectod...   
. . Hylemonella gracilis ATCC 19624.................. 125  7e-31  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Hylemonella gracilis]             
. . Janthinobacterium lividum........................ 124  1e-30  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Janthinobacterium lividum]        
. . Burkholderia phymatum STM815..................... 124  1e-30  10 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Burkholderia...   
. . Acidovorax sp. CF316............................. 124  1e-30  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Acidovorax sp. CF316]             
. . Janthinobacterium sp. Marseille.................. 124  2e-30  12 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Janthinobact...   
. . Collimonas fungivorans........................... 124  3e-30  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Collimonas fungivorans]           
. . Thiomonas intermedia............................. 123  2e-30  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Thiomonas intermedia]             
. . Burkholderia terrae BS001........................ 123  2e-30  5 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Burkholderia...   
. . Acidovorax sp. KKS102............................ 123  2e-30  12 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Acidovorax sp. KKS102]            
. . Leptothrix cholodnii............................. 123  3e-30  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Leptothrix cholodnii]             
. . Acidovorax citrulli.............................. 123  3e-30  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Acidovorax citrulli]              
. . Verminephrobacter eiseniae....................... 122  4e-30  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Verminephrobacter eiseniae]       
. . Polaromonas sp. JS666............................ 122  5e-30  12 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Polaromonas sp. JS666]            
. . Acidovorax sp. JS42.............................. 122  6e-30  12 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Acidovorax sp. JS42]              
. . Sutterella wadsworthensis........................ 122  8e-30  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: histone deacetylase [Sutterella wadsworth...   
. . Acidovorax radicis............................... 121  2e-29  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Acidovorax radicis]               
. . Acidovorax sp. NO-1.............................. 121  2e-29  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Acidovorax sp. NO-1]              
. . Variovorax paradoxus............................. 121  2e-29  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Variovorax paradoxus]             
. . Herbaspirillum sp. CF444......................... 120  2e-29  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Herbaspirillum sp. CF444]         
. . Alicycliphilus denitrificans..................... 120  2e-29  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Alicycliphilus denitrificans]     
. . Oxalobacter formigenes OXCC13.................... 119  1e-28  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Oxalobacter ...   
. . Methylophilales bacterium HTCC2181............... 119  1e-28  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: histone deacetylase [Methylophilales bact...   
. . Burkholderiales bacterium 1_1_47................. 118  2e-28  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: histone deacetylase [Burkholderiales bact...   
. . Delftia.......................................... 117  4e-28  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: deacetylase [Delftia]            
. . Oxalobacteraceae bacterium IMCC9480.............. 116  9e-28  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Oxalobacteraceae bacterium I...   
. . Acidovorax delafieldii........................... 115  1e-27  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: deacetylase [Acidovorax delafieldii]           
. . Parasutterella excrementihominis................. 115  3e-27  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: histone deacetylase [Parasutterella excre...   
. . Alcaligenes faecalis............................. 109  5e-25  5 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: histone deacetylase [Alcaligenes faecalis]     
. . Sutterella wadsworthensis 3_1_45B................ 107  3e-24  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: histone deacetylase [Sutterella wadsworth...   
. . Burkholderia oklahomensis........................ 106  7e-24  17 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Burkholderia...   
. . Sutterella parvirubra............................ 105  8e-24  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: histone deacetylase [Sutterella parvirubra]    
. . Burkholderia cepacia GG4......................... 104  4e-23  16 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Burkholderia...   
. . Burkholderia multivorans ATCC BAA-247............ 103  1e-22  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Burkholderia...   
. . Neisseria shayeganii 871......................... 102  1e-22  5 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: histone deacetylase [Neisseria shayeganii]     
. . Alcaligenes sp................................... 102  1e-22  16 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Chain A, Crystal Structure Of A Hdac-like Protein ...   
. . Burkholderia cenocepacia MC0-3................... 102  2e-22  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Burkholderia...   
. . Burkholderia cenocepacia K56-2Valvano............ 101  5e-22  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Burkholderia...   
. . Burkholderia ambifaria IOP40-10.................. 99.8 1e-21  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Burkholderia... 
. . Burkholderia ambifaria MEX-5..................... 99.0 3e-21  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Burkholderia... 
. . Burkholderia sp. JV3............................. 97.4 6e-21  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Stenotrophom... 
. . Burkholderia thailandensis....................... 92.8 4e-19  21 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: histone deacetylase [Burkholderia thailan... 
. . Burkholderia multivorans ATCC 17616.............. 92.4 6e-19  20 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Burkholderia... 
. . Burkholderia multivorans CF2..................... 90.1 4e-18  5 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Burkholderia... 
. . Burkholderia thailandensis 2002721723............ 89.4 6e-18  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Burkholderia... 
. . Burkholderia pseudomallei NCTC 13179............. 88.6 1e-17  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Burkholderia... 
. . Burkholderia pseudomallei MSHR305................ 88.6 1e-17  16 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Burkholderia... 
. . Burkholderia mallei.............................. 88.6 1e-17  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Burkholderia... 
. . Burkholderia thailandensis MSMB43................ 87.4 3e-17  9 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: acetoin utilization protein [Burkholderia... 
. . Burkholderia pseudomallei 305.................... 82.8 2e-15  8 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: histone deacetylase [Burkholderia pseudom... 
. . Burkholderia pseudomallei MSHR346................ 82.8 2e-15  8 hits  Bacteria:Proteobacteria:BGammaproteobacteriaetaproteobacteria:Burkholderiales: histone deacetylase [Burkholderia pseudom... 
. . Oceanicola sp. S124.............................. 165  4e-46  5 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Oceanicola s...   
. . Ruegeria conchae................................. 164  1e-45  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Ruegeria sp....   
. . Roseobacter sp. SK209-2-6........................ 153  2e-41  10 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Roseobacter ...   
. . Roseovarius sp. TM1035........................... 152  3e-41  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Roseovarius ...   
. . Labrenzia aggregata.............................. 152  3e-41  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Labrenzia ag...   
. . Roseibium sp. TrichSKD4.......................... 149  3e-40  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Roseibium sp...   
. . Rhodobacteraceae bacterium HTCC2150.............. 148  9e-40  10 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Rhodobactera...   
. . Jannaschia sp. CCS1.............................. 146  6e-39  15 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Jannaschia s...   
. . Rhodovulum sp. PH10.............................. 146  8e-39  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Rhodovulum s...   
. . Ahrensia sp. R2A130.............................. 143  9e-38  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Ahrensia sp....   
. . Pelagibaca bermudensis........................... 142  2e-37  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Pelagibaca b...   
. . Rhodobacter sphaeroides.......................... 141  5e-37  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Rhodobacter ...   
. . Roseobacter sp. AzwK-3b.......................... 140  1e-36  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Roseobacter ...   
. . Phaeobacter gallaeciensis........................ 138  5e-36  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Phaeobacter ...   
. . Phaeobacter gallaeciensis 2.10................... 137  1e-35  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Phaeobacter ...   
. . Sagittula stellata............................... 137  2e-35  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Sagittula st...   
. . Pseudovibrio sp. FO-BEG1......................... 135  1e-34  12 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Pseudovibrio...   
. . Thalassiobium sp. R2A62.......................... 133  6e-34  16 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Thalassiobiu...   
. . Dinoroseobacter shibae........................... 131  3e-33  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Dinoroseobac...   
. . Rhodobacter sphaeroides ATCC 17025............... 105  1e-23  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: histone deacetylase [Rhodobacter sphaeroi...   
. . Celeribacter baekdonensis........................ 105  2e-23  4 hits  Bacteria:Proteobacteria:AGammaproteobacterialphaproteobacteria:Rhodobacterales: acetoin utilization protein [Celeribacter...   
. . Roseobacter sp. CCS2............................. 91.3 1e-18  10 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: histone deacetylase [Roseobacter sp. CCS2]   
. . Roseobacter litoralis............................ 84.3 4e-16  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: histone deacetylase [Roseobacter litoralis]  
. . Roseobacter denitrificans........................ 84.0 5e-16  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetylpolyamine aminohydrolase [Roseobact... 
. . Roseobacter denitrificans OCh 114................ 84.0 5e-16  16 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: histone deacetylase [Roseobacter denitrif... 
. . Oceanibulbus indolifex........................... 83.6 9e-16  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: histone deacetylase [Oceanibulbus indolifex] 
. . Rhodobacterales bacterium HTCC2255............... 134  1e-34  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: acetoin utilization protein [Rhodobactera...   
. . Polymorphum gilvum............................... 160  2e-44  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: acetoin utilization protein [Polymorphum ...   
. . Phyllobacterium sp. YR531........................ 156  6e-43  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Phyllobacter...   
. . Nitratireductor indicus.......................... 156  8e-43  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Nitratireduc...   
. . Mesorhizobium alhagi............................. 156  1e-42  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Mesorhizobiu...   
. . Ochrobactrum anthropi............................ 155  4e-42  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Ochrobactrum...   
. . Mesorhizobium ciceri............................. 154  7e-42  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Mesorhizobiu...   
. . Brucella......................................... 153  1e-41  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: acetoin utilization protein...   
. . Brucella melitensis.............................. 153  1e-41  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Brucella mel...   
. . Brucella canis ATCC 23365........................ 153  1e-41  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: acetoin utilization protein...   
. . Brucella canis HSK A52141........................ 153  2e-41  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: acetoin utilization protein...   
. . Xanthobacter autotrophicus....................... 152  3e-41  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Xanthobacter...   
. . Mesorhizobium amorphae........................... 151  5e-41  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Mesorhizobiu...   
. . Brucella sp. 83/13............................... 151  6e-41  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: acetoin utilization protein...   
. . Brucella abortus................................. 151  8e-41  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Brucella abo...   
. . Aurantimonas manganoxydans....................... 151  8e-41  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Aurantimonas...   
. . Nitratireductor aquibiodomus..................... 151  8e-41  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Nitratireduc...   
. . Brucella abortus A13334.......................... 151  9e-41  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Brucella abo...   
. . Brucella inopinata............................... 150  1e-40  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Brucella ino...   
. . Ochrobactrum anthropi ATCC 49188................. 150  1e-40  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Ochrobactrum...   
. . Agrobacterium sp. ATCC 31749..................... 150  1e-40  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Agrobacteriu...   
. . Brucella neotomae................................ 150  2e-40  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Brucella neo...   
. . Sinorhizobium fredii............................. 149  4e-40  9 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Sinorhizobiu...   
. . Starkeya novella................................. 149  4e-40  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Starkeya nov...   
. . Brucella ovis.................................... 149  5e-40  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Brucella ovis]    
. . Nitratireductor pacificus........................ 149  7e-40  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Nitratireduc...   
. . Agrobacterium tumefaciens........................ 148  1e-39  5 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Agrobacteriu...   
. . Ochrobactrum intermedium......................... 148  1e-39  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Ochrobactrum...   
. . Brucella sp. BO2................................. 148  1e-39  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Brucella sp....   
. . Rhizobium sp. CF080.............................. 147  2e-39  10 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Rhizobium sp...   
. . Rhizobium........................................ 147  4e-39  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: acetoin utilization protein...   
. . uncultured SAR11 cluster bacterium HF4000_37C10.. 146  5e-39  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: deacetylases, including yeast histone deacetyl...   
. . Fulvimarina pelagi............................... 146  5e-39  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Fulvimarina ...   
. . Agrobacterium sp. H13-3.......................... 146  6e-39  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Agrobacteriu...   
. . Agrobacterium.................................... 146  7e-39  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: acetoin utilization protein...   
. . Bradyrhizobium sp. STM 3843...................... 146  7e-39  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Bradyrhizobi...   
. . Mesorhizobium australicum........................ 145  1e-38  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Mesorhizobiu...   
. . Bradyrhizobium japonicum......................... 145  1e-38  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Bradyrhizobi...   
. . Hoeflea phototrophica............................ 145  2e-38  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Hoeflea phot...   
. . Caulobacter sp. AP07............................. 145  2e-38  16 hits Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: acetoin utilization protein [Caulobacter ...   
. . Methylosinus trichosporium....................... 145  2e-38  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Methylosinus...   
. . Agrobacterium tumefaciens CCNWGS0286............. 144  3e-38  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Agrobacteriu...   
. . Azospirillum lipoferum........................... 144  3e-38  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: acetoin utilization protein [Azospirillum...   
. . Bradyrhizobium sp. YR681......................... 144  3e-38  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Bradyrhizobi...   
. . Hyphomicrobium denitrificans..................... 144  4e-38  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: histone deacetylase [Hyphomicrobium denit...   
. . Rhizobium leguminosarum.......................... 144  4e-38  24 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Rhizobium le...   
. . Bradyrhizobium sp. S23321........................ 144  5e-38  12 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Bradyrhizobi...   
. . Microvirga lotononidis........................... 144  6e-38  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Microvirga l...   
. . Hyphomicrobium denitrificans 1NES1............... 143  7e-38  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: histone deacetylase [Hyphomicrobium denit...   
. . Rhizobium sp. CCGE 510........................... 143  7e-38  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Rhizobium sp...   
. . Bradyrhizobium sp. WSM1253....................... 143  1e-37  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Bradyrhizobi...   
. . Bradyrhizobium sp. CCGE-LA001.................... 142  1e-37  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein BCCGELA001_19480 [Bradyrh...   
. . Bradyrhizobium sp. WSM471........................ 142  1e-37  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Bradyrhizobi...   
. . Bradyrhizobium sp. ORS 285....................... 142  2e-37  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Bradyrhizobi...   
. . Bradyrhizobium sp. STM 3809...................... 142  2e-37  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Bradyrhizobi...   
. . Bradyrhizobium sp. ORS 375....................... 142  3e-37  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Bradyrhizobi...   
. . Rhizobium leguminosarum bv. trifolii WSM2297..... 142  3e-37  4 hits  Bacteria:Proteobacteria:AGammaproteobacterialphaproteobacteria:Rhizobiales: acetoin utilization protein [Rhizobium le...   
. . Bradyrhizobium sp. ORS 278....................... 141  4e-37  12 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Bradyrhizobi...   
. . Afipia........................................... 141  4e-37  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: hypothetical protein [Afipia]    
. . Rhizobium sp. CF142.............................. 141  4e-37  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Rhizobium sp...   
. . Rhizobium leguminosarum bv. trifolii WSM2012..... 141  5e-37  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Rhizobium le...   
. . Azospirillum amazonense.......................... 140  7e-37  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: acetoin utilization protein [Azospirillum...   
. . Rhizobium mesoamericanum......................... 140  8e-37  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Rhizobium me...   
. . Rhizobium sp. Pop5............................... 140  8e-37  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Rhizobium sp...   
. . Rhizobium leguminosarum bv. trifolii WSM1325..... 140  1e-36  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Rhizobium le...   
. . Rhizobium leguminosarum bv. viciae WSM1455....... 140  1e-36  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Rhizobium le...   
. . Sinorhizobium.................................... 140  1e-36  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: acetoin utilization protein...   
. . Rhizobium sp. CF122.............................. 140  2e-36  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Rhizobium sp...   
. . Azospirillum brasilense.......................... 140  2e-36  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: acetoin utilization protein [Azospirillum...   
. . Rhizobium sp. PDO-076............................ 139  3e-36  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Rhizobium sp...   
. . Oceaniovalibus guishaninsula..................... 139  3e-36  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria: acetoin utilization protein [Oceaniovalib...   
. . Thalassospira xiamenensis........................ 139  4e-36  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: acetoin utilization protein [Thalassospir...   
. . Tistrella mobilis................................ 139  5e-36  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: acetoin utilization protein [Tistrella mo...   
. . Beijerinckia indica.............................. 139  9e-36  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Beijerinckia...   
. . Bradyrhizobiaceae bacterium SG-6C................ 138  7e-36  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Bradyrhizobi...   
. . Sinorhizobium fredii NGR234...................... 138  8e-36  8 hits  Bacteria:Proteobacteria:AGammaproteobacterialphaproteobacteria:Rhizobiales: acetoin utilization protein [Sinorhizobiu...   
. . Methylobacterium sp. 4-46........................ 137  1e-35  24 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Methylobacte...   
. . Rhizobium etli CNPAF512.......................... 137  1e-35  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: putative deacetylase protein [Rhizobium etli C...   
. . alpha proteobacterium HIMB5...................... 137  2e-35  12 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: histone deacetylase [alpha proteobacteriu...   
. . Methylobacterium nodulans........................ 137  2e-35  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Methylobacte...   
. . Oceanibaculum indicum............................ 136  3e-35  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: acetoin utilization protein [Oceanibaculu...   
. . Afipia felis..................................... 136  3e-35  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Afipia felis]            
. . Agrobacterium albertimagni....................... 136  3e-35  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Agrobacteriu...   
. . Rhodospirillum photometricum..................... 136  3e-35  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: acetoin utilization protein [Rhodospirill...   
. . Candidatus Pelagibacter ubique................... 136  4e-35  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: histone deacetylase [Candidatus Pelagibac...   
. . Rhizobium leguminosarum bv. viciae 3841.......... 136  4e-35  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Rhizobium le...   
. . Magnetospirillum gryphiswaldense MSR-1........... 136  7e-35  12 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: histone deacetylase superfamily [Magnetospiri...   
. . Azospirillum lipoferum 4B........................ 133  5e-34  16 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: acetoin utilization protein [Azospirillum...   
. . Oligotropha carboxidovorans...................... 133  5e-34  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Oligotropha ...   
. . Sinorhizobium meliloti........................... 132  1e-33  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Sinorhizobiu...   
. . Sinorhizobium meliloti Rm41...................... 132  1e-33  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Sinorhizobiu...   
. . Azorhizobium caulinodans......................... 132  2e-33  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Azorhizobium...   
. . Methylobacterium populi.......................... 132  2e-33  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Methylobacte...   
. . Sinorhizobium fredii HH103....................... 130  5e-33  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Sinorhizobiu...   
. . Parvibaculum lavamentivorans..................... 130  6e-33  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Parvibaculum...   
. . uncultured SAR11 cluster alpha proteobacterium .. 130  7e-33  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: deacetylase protein [uncultured SAR11 cluster ...   
. . Magnetospirillum gryphiswaldense................. 130  7e-33  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: Histone deacetylase superfamily [Magnetos...   
. . Acidiphilium multivorum.......................... 129  2e-32  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: acetoin utilization protein [Acidiphilium...   
. . Rhodopseudomonas palustris....................... 129  2e-32  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Rhodopseudom...   
. . Methylobacterium extorquens...................... 129  2e-32  28 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Methylobacte...   
. . Azospirillum brasilense Sp245.................... 128  4e-32  16 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: acetoin utilization protein [Azospirillum...   
. . Rhodopseudomonas palustris TIE-1................. 127  7e-32  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Rhodopseudom...   
. . Hyphomicrobium sp. MC1........................... 127  7e-32  12 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: histone deacetylase [Hyphomicrobium sp. MC1]   
. . Roseomonas cervicalis............................ 125  4e-31  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: acetoin utilization protein [Roseomonas c...   
. . Thalassospira profundimaris...................... 125  6e-31  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: acetoin utilization protein [Thalassospir...   
. . Methylobacterium sp. GXF4........................ 125  7e-31  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Methylobacte...   
. . Methylobacterium radiotolerans................... 124  1e-30  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Methylobacte...   
. . alpha proteobacterium HIMB59..................... 122  5e-30  12 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: histone deacetylase family protein [alpha...   
. . Micavibrio aeruginosavorus....................... 121  1e-29  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria: acetoin utilization protein [Micavibrio a...   
. . Methylocella silvestris.......................... 120  5e-29  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: histone deacetylase [Methylocella silvest...   
. . Methylobacterium extorquens DM4.................. 120  6e-29  24 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Methylobacte...   
. . Methylocystis sp. SC2............................ 119  8e-29  24 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Methylocysti...   
. . Methylobacterium extorquens AM1.................. 115  1e-27  16 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Methylobacte...   
. . Phaeospirillum molischianum...................... 115  2e-27  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: acetoin utilization protein [Phaeospirill...   
. . Methylobacterium extorquens DSM 13060............ 115  3e-27  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: histone deacetylase [Methylobacterium ext...   
. . Pelagibacterium halotolerans..................... 113  1e-26  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: acetoin utilization protein [Pelagibacter...   
. . SAR 116 cluster alpha proteobacterium HIMB100.... 112  4e-26  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria: deacetylase, histone deacetylase/acetoin ...   
. . alpha proteobacterium BAL199..................... 108  8e-25  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria: acetoin utilization protein [alpha proteo...   
. . Gluconacetobacter europaeus...................... 107  2e-24  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: acetoin utilization protein [Gluconacetob...   
. . Acidocella sp. MX-AZ02........................... 103  4e-23  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: acetoin utilization protein [Acidocella s...   
. . Acetobacteraceae bacterium AT-5844............... 102  1e-22  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: acetoin utilization protein [Acetobactera...   
. . Mesorhizobium.................................... 102  2e-22  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: histone deacetylase [Mesorh...   
. . Mesorhizobium australicum WSM2073................ 100  7e-22  16 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: histone deacetylase [Mesorhizobium austra...   
. . Sphingomonas wittichii........................... 100  1e-21  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: acetoin utilization protein [Sphingomonas...   
. . Sphingomonas sp. Y57............................. 97.1 1e-20  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: propanil hydrolase [Sphingomonas sp. Y57]         
. . Caulobacter sp. K31.............................. 93.6 2e-19  24 hits Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: histone deacetylase [Caulobacter sp. K31]    
. . Sphingomonas wittichii RW1....................... 92.4 6e-19  16 hits Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: acetoin utilization protein [Sphingomonas... 
. . uncultured Desulfobacterium sp................... 150  3e-40  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: hypothetical protein N47_D28340 [uncultured D...   
. . Desulfococcus oleovorans......................... 108  8e-25  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: histone deacetylase superfamily protein [...   
. . Desulfobulbus propionicus........................ 113  2e-26  12 hits Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: histone deacetylase [Desulfobulbus propio...   
. . Desulfobulbus propionicus DSM 2032............... 108  1e-24  24 hits Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: histone deacetylase [Desulfobulbus propio...   
. . SAR324 cluster bacterium JCVI-SC AAA005.......... 139  4e-36  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria: histone deacetylase [SAR324 cluster bacte...   
. . SAR324 cluster bacterium SCGC AAA001-C10......... 130  6e-33  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria: histone deacetylase [SAR324 cluster bacte...   
. . Desulfobacca acetoxidans......................... 130  6e-33  8 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Syntrophobacterales: histone deacetylase [Desulfobacca acetoxi...   
. . Haliangium ochraceum............................. 119  1e-28  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: histone deacetylase [Haliangium ochraceum]     
. . Myxococcus fulvus................................ 119  2e-28  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: histone deacetylase [Myxococcus fulvus]        
. . Desulfobacca acetoxidans DSM 11109............... 118  3e-28  16 hits Bacteria:Proteobacteria:Deltaproteobacteria:Syntrophobacterales: histone deacetylase [Desulfobacca acetoxi...   
. . Myxococcus xanthus............................... 116  2e-27  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: histone deacetylase [Myxococcus xanthus]       
. . Desulfomonile tiedjei............................ 114  6e-27  12 hits Bacteria:Proteobacteria:Deltaproteobacteria:Syntrophobacterales: deacetylase, histone deacetylase/acetoin ...   
. . Myxococcus sp. (contaminant ex DSM 436).......... 112  3e-26  8 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: histone deacetylase [Myxococcus sp. (cont...   
. . Desulfomonile tiedjei DSM 6799................... 110  2e-25  24 hits Bacteria:Proteobacteria:Deltaproteobacteria:Syntrophobacterales: deacylase [Desulfomonile tiedjei]              
. . Sorangium cellulosum............................. 109  7e-25  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: histone deacetylase [Sorangium cellulosum]     
. . Desulfarculus baarsii............................ 101  4e-22  8 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfarculales: histone deacetylase superfamily protein [...   
. . Corallococcus coralloides........................ 100  7e-22  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: histone deacetylase [Corallococcus corall...   
. . Desulfarculus baarsii DSM 2075................... 96.3 2e-20  16 hits Bacteria:Proteobacteria:Deltaproteobacteria:Desulfarculales: histone deacetylase superfamily protein [... 
. . Stigmatella aurantiaca........................... 93.6 2e-19  8 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: histone deacetylase [Stigmatella aurantiaca] 
. . Stigmatella aurantiaca DW4/3-1................... 93.2 1e-18  12 hits Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: histone deacetylase/AcuC/AphA family prot... 
. . delta proteobacterium MLMS-1..................... 90.5 2e-18  16 hits Bacteria:Proteobacteria:Deltaproteobacteria: histone deacetylase [delta proteobacteriu... 
. . Desulfovibrio africanus.......................... 85.1 5e-16  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: histone deacetylase [Desulfovibrio africa... 
. . Sulfurovum sp. AR................................ 124  1e-30  8 hits  Bacteria:Proteobacteria:Epsilonproteobacteria: acetoin utilization protein [Sulfurovum s...   
. . Sulfurovum sp. NBC37-1........................... 114  6e-27  12 hits Bacteria:Proteobacteria:Epsilonproteobacteria: acetoin utilization protein [Sulfurovum s...   
. . Nitratiruptor sp. SB155-2........................ 104  3e-23  12 hits Bacteria:Proteobacteria:Epsilonproteobacteria: acetoin utilization protein [Nitratirupto...   
. .Candidatus Nitrospira defluvii.................... 152  3e-41  3 hits  Bacteria:Nitrospirae:Nitrospira:Nitrospirales: histone deacetylase [Candidatus Nitrospir...   
. .Leptospirillum ferrooxidans....................... 110  2e-25  4 hits  Bacteria:Nitrospirae:Nitrospira:Nitrospirales: histone deacetylase superfamily [Leptospi...   
. .Leptospirillum rubarum............................ 89.7 2e-18  4 hits  Bacteria:Nitrospirae:Nitrospira:Nitrospirales: probable histone deacetylase family protein [L... 
. .Leptospirillum ferriphilum........................ 89.4 5e-18  4 hits  Bacteria:Nitrospirae:Nitrospira:Nitrospirales: histone deacetylase family protein [Lepto... 
. .Mycobacterium xenopi.............................. 149  8e-40  1 hit   Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: histone deacetylase superfamily protein [...   
. .Mycobacterium avium............................... 137  2e-35  12 hits Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: acetoin utilization protein [Mycobacteriu...   
. .Mycobacterium avium subsp. silvaticum ATCC 4988... 136  3e-35  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: acetoin utilization protein [Mycobacteriu...   
. .Mycobacterium avium 104........................... 136  3e-35  8 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: acetoin utilization protein [Mycobacteriu...   
. .Mycobacterium smegmatis........................... 133  6e-34  8 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: acetoin utilization protein [Mycobacteriu...   
. .Mycobacterium smegmatis str. MC2 155.............. 133  8e-34  16 hits Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: acetoin utilization protein [Mycobacteriu...   
. .Mycobacterium colombiense......................... 128  4e-32  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: acetoin utilization protein [Mycobacteriu...   
. .Mycobacterium sp. MOTT36Y......................... 127  1e-31  12 hits Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: acetoin utilization protein [Mycobacteriu...   
. .Mycobacterium intracellulare...................... 127  1e-31  12 hits Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: acetoin utilization protein [Mycobacteriu...   
. .Mycobacterium indicus pranii...................... 127  1e-31  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: acetoin utilization protein [Mycobacteriu...   
. .Mycobacterium intracellulare MOTT-64.............. 126  1e-31  8 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: acetoin utilization protein [Mycobacteriu...   
. .Rhodococcus opacus................................ 105  2e-23  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: histone deacetylase [Rhodococcus opacus]       
. .Corynebacterium glucuronolyticum.................. 98.2 6e-21  8 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: histone deacetylase [Corynebacterium gluc... 
. .Corynebacterium glucuronolyticum ATCC 51867....... 97.4 1e-20  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: histone deacetylase [Corynebacterium gluc... 
. .Gordonia terrae................................... 93.6 2e-19  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: histone deacetylase [Gordonia terrae]        
. .Verrucosispora maris.............................. 105  1e-23  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: histone deacetylase [Verrucosispora maris]     
. .Saccharothrix espanaensis......................... 105  8e-23  8 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: hypothetical protein [Saccharothrix espan...   
. .Salinibacterium sp. PAMC 21357.................... 100  7e-22  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: histone deacetylase [Salinibacterium sp. ...   
. .Saccharothrix espanaensis DSM 44229............... 94.0 2e-19  16 hits Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: putative deacetylase [Saccharothrix espan... 
. .Leucobacter chromiiresistens...................... 90.5 3e-18  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: histone deacetylase [Leucobacter chromiir... 
. .Actinosynnema mirum............................... 88.6 1e-17  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: histone deacetylase superfamily [Actinosy... 
. .Streptomyces sp. S4............................... 83.6 8e-16  4 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: histone deacetylase [Streptomyces sp. S4]    
. .Patulibacter medicamentivorans.................... 122  1e-29  8 hits  Bacteria:Actinobacteria:Actinobacteria:Solirubrobacterales: histone deacetylase [Patulibacter sp. I11]     
. .Acidimicrobium ferrooxidans....................... 98.2 5e-21  4 hits  Bacteria:Actinobacteria:Actinobacteria:Acidimicrobiales: histone deacetylase superfamily [Acidimic... 
. .uncultured marine bacterium 313................... 146  5e-39  1 hit   Bacteria::                               histone deacetylase family protein [uncultured...   
. .uncultured bacterium.............................. 123  2e-30  20 hits Bacteria::                               hypothetical protein ACD_75C00026G0007 [uncult...   
. .uncultured Acetothermia bacterium................. 92.4 4e-19  8 hits  Bacteria::                               histone deacetylase superfamily protein [uncu... 
. .Flavobacterium sp. CF313.......................... 139  3e-36  16 hits Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: deacetylase [Variovorax sp. CF313]             
. .Rhodothermus marinus.............................. 126  4e-31  4 hits  Bacteria:Bacteroidetes:Bacteroidetes Order II. Incertae sedis: histone deacetylase [Rhodothermus marinus]     
. .Bacteroidetes..................................... 125  5e-31  4 hits  Bacteria:Bacteroidetes:                  MULTISPECIES: histone deacetylase [Bacter...   
. .Haliscomenobacter hydrossis....................... 88.2 1e-17  4 hits  Bacteria:Bacteroidetes:Sphingobacteriia:Sphingobacteriales: histone deacetylase superfamily protein [... 
. .Verrucomicrobium spinosum......................... 137  2e-35  4 hits  Bacteria:Verrucomicrobia:Verrucomicrobiae:Verrucomicrobiales: histone deacetylase [Verrucomicrobium spi...   
. .Pedosphaera parvula............................... 85.1 1e-16  4 hits  Bacteria:Verrucomicrobia:Verrucomicrobiae:Verrucomicrobiales: histone deacetylase superfamily [Pedospha... 
. .Methylacidiphilum fumariolicum.................... 123  2e-30  4 hits  Bacteria:Verrucomicrobia:Methylacidiphilales: deacetylase [Methylacidiphilum fumariolicum]   
. .Leptospira broomii................................ 135  1e-34  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: histone deacetylase [Leptospira broomii]       
. .Leptospira inadai................................. 130  9e-33  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: histone deacetylase [Leptospira inadai]        
. .Leptospira licerasiae............................. 116  1e-27  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: histone deacetylase [Leptospira licerasiae]    
. .Leptospira biflexa................................ 112  4e-26  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: histone deacetylase [Leptospira biflexa]       
. .Leptospira meyeri................................. 101  4e-22  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: histone deacetylase [Leptospira meyeri]        
. .Leptospira borgpetersenii......................... 98.2 4e-21  12 hits Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: histone deacetylase family protein [Lepto... 
. .Leptospira........................................ 97.4 7e-21  8 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: MULTISPECIES: histone deacetylase [Leptos... 
. .Leptospira santarosai............................. 97.1 9e-21  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: histone deacetylase [Leptospira santarosai]  
. .Leptospira weilii................................. 97.1 9e-21  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: histone deacetylase family protein [Lepto... 
. .Leptospira borgpetersenii serovar Castellonis s... 96.7 1e-20  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: MULTISPECIES: histone deacetylase family ... 
. .Leptospira borgpetersenii serovar Hardjo-bovis ... 96.7 1e-20  8 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: histone deacetylase [Leptospira borgpeter... 
. .Leptospira borgpetersenii str. 200801926.......... 96.3 2e-20  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: histone deacetylase family protein [Lepto... 
. .Leptospira interrogans............................ 94.7 6e-20  20 hits Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: histone deacetylase [Leptospira interrogans] 
. .Leptospira interrogans str. UI 08452.............. 93.6 1e-19  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: histone deacetylase [Leptospira interrogans] 
. .Leptospira noguchii............................... 93.6 1e-19  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: histone deacetylase [Leptospira noguchii]    
. .Leptospira interrogans serovar Canicola str. Fi... 93.6 2e-19  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: histone deacetylase [Leptospira interrogans] 
. .Leptospira interrogans serovar Pomona str. Kenn... 93.6 2e-19  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: histone deacetylase [Leptospira interrogans] 
. .Leptospira kirschneri serovar Grippotyphosa str... 92.4 5e-19  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: histone deacetylase family protein [Leptospira... 
. .Leptospira kirschneri str. 2008720114............. 92.4 5e-19  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: histone deacetylase family protein [Leptospira... 
. .Leptospira interrogans str. Brem 329.............. 91.7 8e-19  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: histone deacetylase family protein [Lepto... 
. .Leptospira kirschneri str. 200802841.............. 82.0 1e-15  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: histone deacetylase family protein [Leptospira... 
. .Leptospira kirschneri str. H2..................... 82.0 1e-15  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: histone deacetylase family protein [Leptospira... 
. .Leptospira kirschneri str. H1..................... 82.0 1e-15  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: histone deacetylase family protein [Leptospira... 
. .Thermodesulfatator indicus........................ 135  2e-34  8 hits  Bacteria:Thermodesulfobacteria:Thermodesulfobacteria:Thermodesulfobacteriales: histone deacetylase [Thermodesulfatator i...   
. .Thermodesulfatator indicus DSM 15286.............. 94.0 1e-19  16 hits Bacteria:Thermodesulfobacteria:Thermodesulfobacteria:Thermodesulfobacteriales: histone deacetylase superfamily [Thermode... 
. .Thermodesulfobacterium geofontis.................. 115  3e-27  4 hits  Bacteria:Thermodesulfobacteria:Thermodesulfobacteria:Thermodesulfobacteriales: histone deacetylase [Thermodesulfobacteri...   
. .Schlesneria paludicola............................ 130  5e-33  4 hits  Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: acetoin utilization protein [Schlesneria ...   
. .planctomycete KSU-1............................... 126  2e-31  8 hits  Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: histone deacetylase [planctomycete KSU-1]      
. .Planctomyces brasiliensis......................... 125  5e-31  4 hits  Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: acetoin utilization protein [Planctomyces...   
. .Singulisphaera acidiphila......................... 121  2e-29  4 hits  Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: acetoin utilization protein [Singulisphae...   
. .Planctomyces maris................................ 120  2e-29  8 hits  Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: acetoin utilization protein [Planctomyces...   
. .Planctomyces maris DSM 8797....................... 119  1e-28  8 hits  Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: acetoin utilization protein [Planctomyces...   
. .Candidatus Kuenenia stuttgartiensis............... 108  9e-25  4 hits  Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: similar to histone deacetylase [Candidatus Ku...   
. .Phycisphaera mikrensis............................ 112  2e-26  4 hits  Bacteria:Planctomycetes:Phycisphaerae:Phycisphaerales: putative deacetylase [Phycisphaera mikure...   
. .Roseiflexus sp. RS-1.............................. 125  8e-31  12 hits Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: histone deacetylase [Roseiflexus sp. RS-1]     
. .Roseiflexus castenholzii.......................... 110  2e-25  4 hits  Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: histone deacetylase [Roseiflexus castenho...   
. .Chloroflexus aggregans............................ 122  7e-30  4 hits  Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: histone deacetylase [Chloroflexus aggregans]   
. .Oscillochloris trichoides......................... 114  6e-27  4 hits  Bacteria:Chloroflexi:Chloroflexi:Chloroflexales: histone deacetylase [Oscillochloris trich...   
. .Nitrolancea hollandica............................ 124  9e-31  4 hits  Bacteria:Chloroflexi:Thermomicrobia:Sphaerobacterales: histone deacetylase [Nitrolancetus hollan...   
. .Sphaerobacter thermophilus........................ 123  3e-30  8 hits  Bacteria:Chloroflexi:Thermomicrobia:Sphaerobacterales: histone deacetylase [Sphaerobacter thermo...   
. .Ktedonobacter racemifer........................... 122  1e-29  8 hits  Bacteria:Chloroflexi:Ktedonobacteria:Ktedonobacterales: Histone deacetylase [Ktedonobacter racemi...   
. .Dehalococcoides ethenogenes....................... 109  6e-25  4 hits  Bacteria:Chloroflexi:Dehalococcoidetes:  histone deacetylase [Dehalococcoides mcca...   
. .Caldilinea aerophila.............................. 105  8e-24  4 hits  Bacteria:Chloroflexi:Caldilineae:Caldilineales: histone deacetylase [Caldilinea aerophila]     
. .Herpetosiphon aurantiacus......................... 102  2e-22  4 hits  Bacteria:Chloroflexi:Chloroflexi:Herpetosiphonales: histone deacetylase superfamily protein [...   
. .Sphaerobacter thermophilus DSM 20745.............. 92.4 6e-19  16 hits Bacteria:Chloroflexi:Thermomicrobia:Sphaerobacterales: Histone deacetylase [Sphaerobacter thermo... 
. .Ktedonobacter racemifer DSM 44963................. 90.1 4e-18  8 hits  Bacteria:Chloroflexi:Ktedonobacteria:Ktedonobacterales: Histone deacetylase [Ktedonobacter racemi... 
. .Candidatus Chloracidobacterium thermophilum....... 123  4e-30  4 hits  Bacteria:Acidobacteria:                  deacetylase [Candidatus Chloracidobacteri...   
. .Desulfurobacterium thermolithotrophum............. 122  5e-30  4 hits  Bacteria:Aquificae:Aquificae:Aquificales: acetoin utilization protein [Desulfurobac...   
. .Thermovibrio ammonificans......................... 115  1e-27  4 hits  Bacteria:Aquificae:Aquificae:Aquificales: acetoin utilization protein [Thermovibrio...   
. .Sulfurihydrogenibium yellowstonense............... 119  6e-30  4 hits  Bacteria:Aquificae:Aquificae:Aquificales: histone deacetylase 5 [Sulfurihydrogenibi...   
. .Sulfurihydrogenibium sp. YO3AOP1.................. 116  7e-28  12 hits Bacteria:Aquificae:Aquificae:Aquificales: acetoin utilization protein [Sulfurihydro...   
. .Hydrogenivirga sp. 128-5-R1-1..................... 116  1e-27  8 hits  Bacteria:Aquificae:Aquificae:Aquificales: acetoin utilization protein [Hydrogenivir...   
. .Hydrogenobaculum sp. Y04AAS1...................... 116  1e-27  12 hits Bacteria:Aquificae:Aquificae:Aquificales: acetoin utilization protein [Hydrogenobac...   
. .Cyanothece sp. PCC 7424........................... 122  5e-30  12 hits Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Cyanothece sp. PCC ...   
. .Cyanothece sp. CCY0110............................ 106  4e-24  8 hits  Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Cyanothece sp. CCY0...   
. .Cyanothece........................................ 102  1e-22  4 hits  Bacteria:Cyanobacteria:Chroococcales:    MULTISPECIES: hypothetical protein [Cyano...   
. .Acaryochloris marina.............................. 118  2e-28  4 hits  Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Acaryochloris marina]    
. .Acaryochloris sp. CCMEE 5410...................... 115  3e-27  4 hits  Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Acaryochloris sp. C...   
. .Crocosphaera watsonii............................. 114  5e-27  4 hits  Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Crocosphaera watsonii]   
. .Microcystis aeruginosa............................ 113  1e-26  44 hits Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Microcystis aerugin...   
. .Microcystis aeruginosa PCC 9809................... 112  2e-26  4 hits  Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Microcystis aerugin...   
. .Microcystis aeruginosa PCC 9443................... 111  5e-26  4 hits  Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Microcystis aerugin...   
. .Microcystis sp. T1-4.............................. 111  6e-26  8 hits  Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Microcystis sp. T1-4]    
. .Microcystis aeruginosa PCC 9808................... 111  6e-26  4 hits  Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Microcystis aerugin...   
. .Microcystis aeruginosa PCC 7941................... 111  6e-26  4 hits  Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Microcystis aerugin...   
. .Microcystis aeruginosa PCC 9701................... 111  6e-26  4 hits  Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Microcystis aerugin...   
. .Microcystis aeruginosa PCC 9807................... 111  6e-26  4 hits  Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Microcystis aerugin...   
. .Microcystis aeruginosa PCC 9432................... 111  7e-26  4 hits  Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Microcystis aerugin...   
. .Microcystis aeruginosa PCC 9717................... 111  8e-26  4 hits  Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Microcystis aerugin...   
. .Microcystis aeruginosa PCC 7806................... 110  1e-25  4 hits  Bacteria:Cyanobacteria:Chroococcales:    histone deacetylase domain protein [Micro...   
. .Microcystis aeruginosa PCC 9806................... 108  6e-25  4 hits  Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Microcystis aerugin...   
. .Synechococcus sp. PCC 7002........................ 104  2e-23  12 hits Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Synechococcus sp. P...   
. .Lyngbya sp. PCC 8106.............................. 122  7e-30  8 hits  Bacteria:Cyanobacteria:Oscillatoriales:  hypothetical protein [Lyngbya sp. PCC 8106]    
. .Moorea producta................................... 120  3e-29  4 hits  Bacteria:Cyanobacteria:Oscillatoriales:  hypothetical protein [Moorea producens]        
. .Arthrospira sp. PCC 8005.......................... 117  3e-28  12 hits Bacteria:Cyanobacteria:Oscillatoriales:  hypothetical protein [Arthrospira sp. PCC...   
. .Oscillatoriales cyanobacterium JSC-12............. 115  3e-27  8 hits  Bacteria:Cyanobacteria:Oscillatoriales:  deacetylase, histone deacetylase/acetoin ...   
. .Anabaena sp. 90................................... 114  4e-27  12 hits Bacteria:Cyanobacteria:Nostocales:       histone deacetylase-like protein [Anabaen...   
. .Nodularia spumigena............................... 113  1e-26  4 hits  Bacteria:Cyanobacteria:Nostocales:       hypothetical protein [Nodularia spumigena]     
. .Microcoleus vaginatus............................. 113  1e-26  4 hits  Bacteria:Cyanobacteria:Oscillatoriales:  hypothetical protein [Microcoleus vaginatus]   
. .Kamptonema........................................ 112  3e-26  4 hits  Bacteria:Cyanobacteria:Oscillatoriales:  MULTISPECIES: hypothetical protein [Kampt...   
. .Fischerella....................................... 109  3e-25  4 hits  Bacteria:Cyanobacteria:Stigonematales:   MULTISPECIES: hypothetical protein [Fisch...   
. .Candidatus Desulforudis audaxviator............... 119  1e-28  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: histone deacetylase superfamily protein [...   
. .Pelotomaculum thermopropionicum................... 106  8e-24  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: deacetylases [Pelotomaculum thermopropion...   
. .Desulfotomaculum acetoxidans...................... 85.1 5e-16  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: histone deacetylase [Desulfotomaculum ace... 
. .Desulfotomaculum kuznetsovii...................... 83.2 5e-16  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: acetylpolyamine aminohydrolase [Desulfoto... 
. .Caldicellulosiruptor kronotskyensis............... 98.6 6e-21  4 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: histone deacetylase [Caldicellulosiruptor... 
. .Caldicellulosiruptor lactoaceticus................ 98.6 6e-21  4 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: histone deacetylase [Caldicellulosiruptor... 
. .Caldicellulosiruptor kristjanssonii............... 96.7 3e-20  4 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: histone deacetylase [Caldicellulosiruptor... 
. .Caldicellulosiruptor hydrothermalis............... 95.1 1e-19  4 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: histone deacetylase [Caldicellulosiruptor... 
. .Caldicellulosiruptor obsidiansis.................. 94.7 2e-19  4 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: histone deacetylase [Caldicellulosiruptor... 
. .Caldicellulosiruptor owensensis................... 93.6 4e-19  4 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: histone deacetylase [Caldicellulosiruptor... 
. .Lentibacillus jeotgali............................ 103  7e-23  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  histone deacetylase [Lentibacillus jeotgali]   
. .Sporosarcina newyorkensis......................... 102  2e-22  8 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  histone deacetylase [Sporosarcina newyork...   
. .Bacillus alcalophilus............................. 100  1e-21  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  histone deacetylase [Bacillus alcalophilus]    
. .Phascolarctobacterium sp. YIT 12068............... 85.5 3e-16  4 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: histone deacetylase [Phascolarctobacteriu... 
. .Waddlia chondrophila.............................. 117  5e-28  4 hits  Bacteria:Chlamydiae:Chlamydiales:        histone deacetylase [Waddlia chondrophila]     
. .Waddlia chondrophila 2032/99...................... 115  2e-27  4 hits  Bacteria:Chlamydiae:Chlamydiales:        uncharacterized protein slr0245 [Waddlia chon...   
. .Parachlamydia acanthamoebae....................... 112  3e-26  4 hits  Bacteria:Chlamydiae:Chlamydiales:        hypothetical protein [Parachlamydia acant...   
. .Caldithrix abyssi................................. 112  3e-26  4 hits  Bacteria::                               histone deacetylase superfamily [Caldithr...   
. .Gemmatimonas aurantiaca........................... 106  4e-24  4 hits  Bacteria:Gemmatimonadetes:Gemmatimonadetes:Gemmatimonadales: histone deacetylase family protein [Gemma...   
. .Flexistipes sinusarabici.......................... 103  8e-23  4 hits  Bacteria:Deferribacteres:Deferribacteres:Deferribacterales: acetoin utilization protein AcuC [Flexist...   
. .Fervidobacterium nodosum.......................... 88.6 8e-18  4 hits  Bacteria:Thermotogae:Thermotogae:Thermotogales: histone deacetylase [Fervidobacterium nod... 
. .Fervidobacterium pennivorans...................... 84.0 4e-16  4 hits  Bacteria:Thermotogae:Thermotogae:Thermotogales: histone deacetylase [Fervidobacterium pen... 
. .Mesotoga prima.................................... 85.1 2e-16  4 hits  Bacteria:Thermotogae:Thermotogae:Thermotogales: histone deacetylase [Mesotoga prima]         
. .Thermosipho melanesiensis......................... 82.4 1e-15  4 hits  Bacteria:Thermotogae:Thermotogae:Thermotogales: histone deacetylase superfamily protein [... 
. .Thermotoga lettingae.............................. 82.0 2e-15  4 hits  Bacteria:Thermotogae:Thermotogae:Thermotogales: histone deacetylase [Thermotoga lettingae]   
. Methanobacterium formicicum........................ 132  1e-33  4 hits  Archaea:Euryarchaeota:Methanobacteria:Methanobacteriales: histone deacetylase [Methanobacterium for...   
. Methanobacterium sp. Maddingley MBC34.............. 124  2e-30  8 hits  Archaea:Euryarchaeota:Methanobacteria:Methanobacteriales: deacetylase, histone deacetylase/acetoin ...   
. Methanobacterium paludis........................... 118  3e-28  12 hits Archaea:Euryarchaeota:Methanobacteria:Methanobacteriales: histone deacetylase [Methanobacterium sp....   
. Methanothermobacter marburgensis................... 116  2e-27  4 hits  Archaea:Euryarchaeota:Methanobacteria:Methanobacteriales: hypothetical protein [Methanothermobacter...   
. Methanothermus fervidus............................ 97.4 7e-21  4 hits  Archaea:Euryarchaeota:Methanobacteria:Methanobacteriales: hypothetical protein [Methanothermus ferv... 
. Methanosalsum zhilinae............................. 131  4e-33  4 hits  Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: histone deacetylase [Methanosalsum zhilinae]   
. Methanosaeta concilii.............................. 114  1e-26  4 hits  Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: histone deacetylase [Methanosaeta concilii]    
. Natronobacterium gregoryi.......................... 113  2e-26  4 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: acetoin utilization protein [Natronobacte...   
. Natrinema pellirubrum.............................. 113  2e-26  8 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: acetoin utilization protein [Natrinema pe...   
. Methanospirillum hungatei.......................... 113  2e-26  8 hits  Archaea:Euryarchaeota:Methanomicrobia:Methanomicrobiales: hypothetical protein [Methanospirillum hu...   
. Halopiger xanaduensis.............................. 112  6e-26  4 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: acetoin utilization protein [Halopiger xa...   
. Methanoplanus limicola............................. 112  6e-26  4 hits  Archaea:Euryarchaeota:Methanomicrobia:Methanomicrobiales: hypothetical protein [Methanoplanus limic...   
. Methanoculleus marisnigri.......................... 111  8e-26  8 hits  Archaea:Euryarchaeota:Methanomicrobia:Methanomicrobiales: histone deacetylase [Methanoculleus maris...   
. Halorubrum lacusprofundi........................... 111  9e-26  4 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: acetoin utilization protein [Halorubrum l...   
. Halobiforma lacisalsi.............................. 110  2e-25  4 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: acetoin utilization protein [Halobiforma ...   
. Methanoculleus marisnigri JR1...................... 109  4e-25  16 hits Archaea:Euryarchaeota:Methanomicrobia:Methanomicrobiales: histone deacetylase [Methanoculleus maris...   
. Archaeoglobus veneficus............................ 109  5e-25  4 hits  Archaea:Euryarchaeota:Archaeoglobi:Archaeoglobales: hypothetical protein [Archaeoglobus venef...   
. Natrinema sp. J7................................... 108  9e-25  12 hits Archaea:Euryarchaeota:Halobacteria:Halobacteriales: acetoin utilization protein [Natrinema sp...   
. Methanoculleus bourgensis.......................... 107  2e-24  8 hits  Archaea:Euryarchaeota:Methanomicrobia:Methanomicrobiales: histone deacetylase [Methanoculleus bourg...   
. Methanohalobium evestigatum........................ 107  2e-24  8 hits  Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: histone deacetylase [Methanohalobium eves...   
. Thermococcus zilligii.............................. 107  3e-24  4 hits  Archaea:Euryarchaeota:Thermococci:Thermococcales: hypothetical protein [Thermococcus zilligii]   
. Methanosaeta harundinacea.......................... 104  2e-23  4 hits  Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: histone deacetylase [Methanosaeta harundi...   
. Thermococcus gammatolerans......................... 104  2e-23  4 hits  Archaea:Euryarchaeota:Thermococci:Thermococcales: hypothetical protein [Thermococcus gammat...   
. Methanocella arvoryzae............................. 103  5e-23  4 hits  Archaea:Euryarchaeota:Methanomicrobia:Methanocellales: acetoin utilization protein [Methanocella...   
. Thermococcus sp. CL1............................... 103  8e-23  12 hits Archaea:Euryarchaeota:Thermococci:Thermococcales: hypothetical protein [Thermococcus sp. CL1]    
. Halobacterium sp. DL1.............................. 103  9e-23  4 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: acetoin utilization protein [Halobacterium sp....   
. Thermococcus sp. 4557.............................. 102  1e-22  12 hits Archaea:Euryarchaeota:Thermococci:Thermococcales: hypothetical protein [Thermococcus sp. 4557]   
. Methanofollis liminatans........................... 102  1e-22  4 hits  Archaea:Euryarchaeota:Methanomicrobia:Methanomicrobiales: histone deacetylase [Methanofollis limina...   
. Haloferax sp. B-1.................................. 101  4e-22  4 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: acetoin utilization protein [Halogranum s...   
. Halococcus hamelinensis............................ 100  7e-22  4 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: histone deacetylase superfamily protein [...   
. Halorhabdus tiamatea............................... 100  7e-22  4 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: acetoin utilization protein [Halorhabdus ...   
. Natrinema pellirubrum DSM 15624.................... 100  1e-21  24 hits Archaea:Euryarchaeota:Halobacteria:Halobacteriales: acetoin utilization protein [Natrinema pe...   
. Methanohalobium evestigatum Z-7303................. 100  2e-21  16 hits Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: histone deacetylase superfamily protein [...   
. Haloquadratum walsbyi.............................. 98.6 3e-21  4 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: acetoin utilization protein [Haloquadratu... 
. Pyrococcus sp. NA2................................. 98.6 4e-21  12 hits Archaea:Euryarchaeota:Thermococci:Thermococcales: hypothetical protein [Pyrococcus sp. NA2]    
. Haladaptatus paucihalophilus....................... 97.4 8e-21  4 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: acetoin utilization protein [Haladaptatus... 
. Halorhabdus utahensis.............................. 97.1 1e-20  4 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: acetoin utilization protein [Halorhabdus ... 
. Pyrococcus yayanosii............................... 95.9 3e-20  4 hits  Archaea:Euryarchaeota:Thermococci:Thermococcales: hypothetical protein [Pyrococcus yayanosii]  
. Halogeometricum borinquense........................ 94.4 8e-20  4 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: acetoin utilization protein [Halogeometri... 
. Methanoculleus bourgensis MS2...................... 94.0 1e-19  16 hits Archaea:Euryarchaeota:Methanomicrobia:Methanomicrobiales: histone deacetylase [Methanoculleus bourg... 
. Halalkalicoccus jeotgali........................... 93.6 2e-19  4 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: acetoin utilization protein [Halalkalicoc... 
. Haloarcula hispanica............................... 91.7 9e-19  4 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: acetoin utilization protein [Haloarcula h... 
. Methanolobus psychrophilus......................... 89.7 4e-18  8 hits  Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: histone deacetylase superfamily [Methanol... 
. Halomicrobium mukohataei........................... 89.7 4e-18  4 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: acetoin utilization protein [Halomicrobiu... 
. Methanolobus psychrophilus R15..................... 89.4 3e-17  16 hits Archaea:Euryarchaeota:Methanomicrobia:Methanosarcinales: histone deacetylase superfamily [Methanol... 
. Haloferax mediterranei............................. 84.0 3e-16  4 hits  Archaea:Euryarchaeota:Halobacteria:Halobacteriales: acetoin utilization protein [Haloferax me... 
. Pyrococcus sp. ST04................................ 84.0 4e-16  12 hits Archaea:Euryarchaeota:Thermococci:Thermococcales: hypothetical protein [Pyrococcus sp. ST04]   
. Methanospirillum hungatei JF-1..................... 83.2 6e-16  16 hits Archaea:Euryarchaeota:Methanomicrobia:Methanomicrobiales: histone deacetylase superfamily protein [... 
. uncultured archaeon GZfos26D8...................... 130  9e-33  4 hits  Archaea::                                acetoin utilization protein [uncultured archae...   
. uncultured archaeon GZfos19A5...................... 129  2e-32  4 hits  Archaea::                                acetoin utilization protein [uncultured archae...   
. uncultured archaeon GZfos9D1....................... 129  2e-32  4 hits  Archaea::                                acetoin utilization protein [uncultured archae...   
. uncultured archaeon GZfos26F9...................... 127  2e-31  4 hits  Archaea::                                acetoin utilization protein [uncultured archae...   
. Ignicoccus hospitalis.............................. 119  2e-28  4 hits  Archaea:Crenarchaeota:Thermoprotei:Desulfurococcales: histone deacetylase superfamily protein [...   
. Vulcanisaeta distributa............................ 116  1e-27  4 hits  Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: histone deacetylase [Vulcanisaeta distrib...   
. Vulcanisaeta moutnovskia........................... 116  2e-27  4 hits  Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: histone deacetylase [Vulcanisaeta moutnov...   
. Pyrolobus fumarii.................................. 109  6e-25  4 hits  Archaea:Crenarchaeota:Thermoprotei:Desulfurococcales: histone deacetylase superfamily protein [...   
. Ignisphaera aggregans.............................. 94.7 7e-20  4 hits  Archaea:Crenarchaeota:Thermoprotei:Desulfurococcales: histone deacetylase [Ignisphaera aggregans]  
. Staphylothermus marinus............................ 93.2 2e-19  4 hits  Archaea:Crenarchaeota:Thermoprotei:Desulfurococcales: histone deacetylase [Staphylothermus mari... 
. Thermoproteus tenax................................ 90.9 2e-18  4 hits  Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: acetylpolyamine aminohydrolase [Thermopro... 
. Pyrobaculum oguniense.............................. 90.9 2e-18  4 hits  Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: acetylpolyamine aminohydrolase [Pyrobacul... 
. Pyrobaculum arsenaticum............................ 90.9 2e-18  4 hits  Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: acetylpolyamine aminohydrolase [Pyrobacul... 
. Acidianus hospitalis............................... 90.1 2e-18  4 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: deacetylase [Acidianus hospitalis]           
. Pyrobaculum islandicum............................. 90.1 3e-18  4 hits  Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: acetylpolyamine aminohydrolase [Pyrobacul... 
. Hyperthermus butylicus............................. 89.7 5e-18  4 hits  Archaea:Crenarchaeota:Thermoprotei:Desulfurococcales: histone deacetylase [Hyperthermus butylicus] 
. Caldivirga maquilingensis.......................... 89.0 8e-18  4 hits  Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: histone deacetylase superfamily protein [... 
. Candidatus Korarchaeum cryptofilum................. 85.5 1e-16  4 hits  Archaea:Korarchaeota:                    histone deacetylase superfamily protein [... 
. halophilic archaeon DL31........................... 85.5 1e-16  12 hits Archaea::                                acetoin utilization protein [halophilic a... 
. Thermoproteus uzoniensis........................... 83.6 5e-16  4 hits  Archaea:Crenarchaeota:Thermoprotei:Thermoproteales: acetylpolyamine aminohydrolase [Thermopro... 
. Sulfolobus islandicus.............................. 82.0 2e-15  16 hits Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: deacetylase [Sulfolobus islandicus]          
. Sulfolobus islandicus M.14.25...................... 81.6 2e-15  8 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: deacetylase [Sulfolobus islandicus]          
. Sulfolobus islandicus L.S.2.15..................... 81.6 2e-15  8 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: deacetylase [Sulfolobus islandicus]          
. Sulfolobus islandicus Y.G.57.14.................... 81.6 2e-15  8 hits  Archaea:Crenarchaeota:Thermoprotei:Sulfolobales: deacetylase [Sulfolobus islandicus]          
. Glycine max........................................ 124  3e-29  16 hits Eukaryota:Streptophyta:Fabales:          PREDICTED: histone deacetylase 5-like [Gl...   
. Medicago truncatula................................ 99.8 2e-21  8 hits  Eukaryota:Streptophyta:Fabales:          Histone deacetylase [Medicago truncatula]    
. Lotus japonicus.................................... 97.8 1e-20  4 hits  Eukaryota:Streptophyta:Fabales:          unknown [Lotus japonicus]                         
. Vitis vinifera..................................... 116  3e-28  8 hits  Eukaryota:Streptophyta:Vitales:          hypothetical protein VITISV_041025 [Vitis vin...   
. Arabidopsis thaliana............................... 114  5e-26  68 hits Eukaryota:Streptophyta:Brassicales:      histone deacetylase 5 [Arabidopsis thaliana]      
. Arabidopsis lyrata subsp. lyrata................... 113  1e-25  48 hits Eukaryota:Streptophyta:Brassicales:      hypothetical protein ARALYDRAFT_919345 [A...   
. Zea mays........................................... 116  1e-26  76 hits Eukaryota:Streptophyta:Liliopsida:Poales: probable histone deacetylase 19 [Zea mays]     
. Sorghum bicolor.................................... 114  7e-26  24 hits Eukaryota:Streptophyta:Liliopsida:Poales: hypothetical protein SORBIDRAFT_02g038550...   
. Brachypodium distachyon............................ 114  7e-26  16 hits Eukaryota:Streptophyta:Liliopsida:Poales: PREDICTED: histone deacetylase 5-like [Br...   
. Oryza sativa Japonica Group........................ 114  1e-25  64 hits Eukaryota:Streptophyta:Liliopsida:Poales: Os07g0602200 [Oryza sativa Japonica Group]     
. Triticum aestivum.................................. 102  2e-22  4 hits  Eukaryota:Streptophyta:Liliopsida:Poales: histone deacetylase HDAC4 [Triticum aestivum]       
. Hordeum vulgare.................................... 102  1e-21  4 hits  Eukaryota:Streptophyta:Liliopsida:Poales: histone deacetylase RPD3/HDA1 class II [Hordeu...   
. Oryza sativa Indica Group.......................... 102  1e-21  12 hits Eukaryota:Streptophyta:Liliopsida:Poales: Os07g0164100 [Oryza sativa Japonica Group]     
. Hordeum vulgare subsp. vulgare..................... 96.7 3e-20  8 hits  Eukaryota:Streptophyta:Liliopsida:Poales: predicted protein [Hordeum vulgare subsp. vul... 
. Picea abies........................................ 84.0 9e-17  4 hits  Eukaryota:Streptophyta:Coniferopsida:Coniferales: histone deacetylase superfamily protein [Picea... 
. Selaginella moellendorffii......................... 112  2e-25  72 hits Eukaryota:Streptophyta:Isoetopsida:Selaginellales: hypothetical protein SELMODRAFT_169296 [S...   
. Physcomitrella patens.............................. 113  8e-26  32 hits Eukaryota:Streptophyta:Bryopsida:Funariales: class II RPD3 type histone deacetylase pr...   
. Bathycoccus prasinos............................... 119  3e-28  8 hits  Eukaryota:Chlorophyta:Mamiellophyceae:Mamiellales: histone deacetylase superfamily [Bathycoc...   
. Volvox carteri f. nagariensis...................... 105  1e-22  24 hits Eukaryota:Chlorophyta:Chlorophyceae:Chlamydomonadales: hypothetical protein VOLCADRAFT_120505 [V...   
. Chlamydomonas reinhardtii.......................... 102  3e-22  8 hits  Eukaryota:Chlorophyta:Chlorophyceae:Chlamydomonadales: histone deacetylase [Chlamydomonas reinha...   
. Micromonas sp. RCC299.............................. 102  1e-21  8 hits  Eukaryota:Chlorophyta:Mamiellophyceae:Mamiellales: histone deacetylase [Micromonas sp. RCC299]    
. Ostreococcus lucimarinus CCE9901................... 95.9 2e-19  16 hits Eukaryota:Chlorophyta:Mamiellophyceae:Mamiellales: predicted protein [Ostreococcus lucimarin... 
. Coccomyxa subellipsoidea C-169..................... 94.4 1e-19  24 hits Eukaryota:Chlorophyta:Trebouxiophyceae:  Arginase/deacetylase [Coccomyxa subellips... 
. Micromonas pusilla CCMP1545........................ 90.1 2e-17  24 hits Eukaryota:Chlorophyta:Mamiellophyceae:Mamiellales: histone deacetylase [Micromonas pusilla C... 
. Chlorella variabilis............................... 88.2 2e-17  16 hits Eukaryota:Chlorophyta:Trebouxiophyceae:Chlorellales: hypothetical protein CHLNCDRAFT_24556 [Ch... 
. Ostreococcus tauri................................. 84.3 1e-15  16 hits Eukaryota:Chlorophyta:Mamiellophyceae:Mamiellales: histone deacetylase HDA110 isoform 2 (ISS... 
. Oxytricha trifallax................................ 117  6e-27  24 hits Eukaryota::Spirotrichea:Sporadotrichida: Histone deacetylase family protein [Oxytricha ...   
. Culex quinquefasciatus............................. 117  2e-26  8 hits  Eukaryota:Arthropoda:Insecta:Diptera:    histone deacetylase [Culex quinquefasciatus]   
. Anopheles gambiae str. PEST........................ 117  2e-26  24 hits Eukaryota:Arthropoda:Insecta:Diptera:    AGAP000532-PA [Anopheles gambiae str. PEST]       
. Papio anubis....................................... 115  4e-26  32 hits Eukaryota:Chordata:Mammalia:Primates:    PREDICTED: histone deacetylase 10 isoform...   
. Macaca mulatta..................................... 115  5e-26  52 hits Eukaryota:Chordata:Mammalia:Primates:    hypothetical protein EGK_03191 [Macaca mulatta]     
. Macaca fascicularis................................ 114  5e-26  44 hits Eukaryota:Chordata:Mammalia:Primates:    hypothetical protein EGM_02833 [Macaca fascicu...   
. Aedes aegypti...................................... 114  1e-25  16 hits Eukaryota:Arthropoda:Insecta:Diptera:    histone deacetylase [Aedes aegypti]            
. Bombus terrestris.................................. 114  3e-25  8 hits  Eukaryota:Arthropoda:Insecta:Hymenoptera: PREDICTED: histone deacetylase 6-like [Bo...   
. Pan troglodytes.................................... 113  2e-25  24 hits Eukaryota:Chordata:Mammalia:Primates:    PREDICTED: histone deacetylase 10 isoform 2 ...   
. Pan paniscus....................................... 113  2e-25  28 hits Eukaryota:Chordata:Mammalia:Primates:    PREDICTED: histone deacetylase 10 isoform...   
. Daphnia pulex...................................... 113  4e-25  16 hits Eukaryota:Arthropoda:Branchiopoda:Diplostraca: putative histone deacetylase HDAC6 protein [Da...   
. Sus scrofa......................................... 112  3e-25  16 hits Eukaryota:Chordata:Mammalia:             PREDICTED: histone deacetylase 10 isoform...   
. Homo sapiens....................................... 112  3e-25  212 hitsEukaryota:Chordata:Mammalia:Primates:    histone deacetylase 10 isoform alpha...   
. Nomascus leucogenys................................ 112  3e-25  12 hits Eukaryota:Chordata:Mammalia:Primates:    PREDICTED: histone deacetylase 10 [Nomasc...   
. Saimiri boliviensis boliviensis.................... 112  4e-25  28 hits Eukaryota:Chordata:Mammalia:Primates:    PREDICTED: histone deacetylase 10 [Saimir...   
. Clonorchis sinensis................................ 112  5e-25  12 hits Eukaryota:Platyhelminthes:Trematoda:Opisthorchiida: histone deacetylase 6/10 [Clonorchis sinensis]     
. Drosophila melanogaster............................ 112  1e-24  168 hitsEukaryota:Arthropoda:Insecta:Diptera:    histone deacetylase 6 isoform A [Drosophila me...   
. Bombus impatiens................................... 111  2e-24  8 hits  Eukaryota:Arthropoda:Insecta:Hymenoptera: PREDICTED: histone deacetylase 6-like [Bo...   
. Amphimedon queenslandica........................... 110  1e-24  8 hits  Eukaryota:Porifera:Demospongiae:Haplosclerida: PREDICTED: histone deacetylase 6-like [Am...   
. Ectocarpus siliculosus............................. 110  1e-24  8 hits  Eukaryota:Phaeophyceae:Ectocarpales:     conserved unknown protein [Ectocarpus silicul...   
. Cricetulus griseus................................. 110  2e-24  40 hits Eukaryota:Chordata:Mammalia:Rodentia:    Histone deacetylase 10 [Cricetulus griseus]         
. Candida orthopsilosis Co 90-125.................... 110  2e-24  8 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: Hda1 hypothetical proteinistone deacetyla...   
. Schistosoma mansoni................................ 110  3e-24  8 hits  Eukaryota:Platyhelminthes:Trematoda:Strigeidida: histone deacetylase,putative [Schistosoma man...   
. Apis florea........................................ 110  5e-24  8 hits  Eukaryota:Arthropoda:Insecta:Hymenoptera: PREDICTED: LOW QUALITY PROTEIN: histone d...   
. Phanerochaete carnosa HHB-10118-sp................. 109  5e-24  8 hits  Eukaryota:Basidiomycota:Agaricomycetes:Corticiales: hypothetical protein PHACADRAFT_196818 [P...   
. Candida parapsilosis............................... 109  5e-24  4 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: hypothetical protein CPAR2_800680 [Candida pa...   
. Heterocephalus glaber.............................. 108  7e-24  20 hits Eukaryota:Chordata:Mammalia:Rodentia:    Histone deacetylase 10 [Heterocephalus glaber]      
. Megachile rotundata................................ 108  1e-23  8 hits  Eukaryota:Arthropoda:Insecta:Hymenoptera: PREDICTED: histone deacetylase 6-like [Me...   
. Mus musculus....................................... 107  2e-23  176 hitsEukaryota:Chordata:Mammalia:Rodentia:    histone deacetylase 10 [Mus musculus]             
. Otolemur garnettii................................. 107  2e-23  20 hits Eukaryota:Chordata:Mammalia:Primates:    PREDICTED: histone deacetylase 10 [Otolem...   
. Millerozyma farinosa CBS 7064...................... 107  2e-23  16 hits Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: Piso0_004685 [Millerozyma farinosa CBS 7064]   
. Lodderomyces elongisporus NRRL YB-4239............. 107  5e-23  8 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: histone deacetylase HDA1 [Lodderomyces el...   
. Crassostrea gigas.................................. 106  6e-23  12 hits Eukaryota:Mollusca:Bivalvia:Ostreoida:   Histone deacetylase 6 [Crassostrea gigas]           
. Capsaspora owczarzaki ATCC 30864................... 106  1e-22  8 hits  Eukaryota::Ichthyosporea:                histone deacetylase [Capsaspora owczarzak...   
. Bos taurus......................................... 105  8e-23  40 hits Eukaryota:Chordata:Mammalia:             histone deacetylase 10 [Bos taurus]            
. Pongo abelii....................................... 105  9e-23  24 hits Eukaryota:Chordata:Mammalia:Primates:    PREDICTED: histone deacetylase 10 isoform...   
. Paramecium tetraurelia strain d4-2................. 105  9e-23  8 hits  Eukaryota::Oligohymenophorea:Peniculida: hypothetical protein [Paramecium tetraure...   
. Punctularia strigosozonata HHB-11173 SS5........... 105  1e-22  8 hits  Eukaryota:Basidiomycota:Agaricomycetes:Corticiales: histone deacetylase clr3 [Punctularia str...   
. Torulaspora delbrueckii............................ 105  1e-22  8 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: hypothetical protein TDEL_0G02160 [Torula...   
. Vanderwaltozyma polyspora DSM 70294................ 105  1e-22  16 hits Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: hypothetical protein Kpol_1039p32 [Vander...   
. Danaus plexippus................................... 105  1e-22  8 hits  Eukaryota:Arthropoda:Insecta:Lepidoptera: putative histone deacetylase 7A [Danaus plexip...   
. Candida albicans................................... 105  1e-22  4 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: histone deacetylase HDA1 [Candida albicans]         
. Acromyrmex echinatior.............................. 105  2e-22  8 hits  Eukaryota:Arthropoda:Insecta:Hymenoptera: Histone deacetylase 6 [Acromyrmex echinatior]       
. Ailuropoda melanoleuca............................. 105  3e-22  20 hits Eukaryota:Chordata:Mammalia:Carnivora:   PREDICTED: histone deacetylase 6-like [Ai...   
. Serpula lacrymans var. lacrymans S7.3.............. 104  3e-22  8 hits  Eukaryota:Basidiomycota:Agaricomycetes:Boletales: hypothetical protein SERLA73DRAFT_72261 [Serpu...   
. Serpula lacrymans var. lacrymans S7.9.............. 104  3e-22  16 hits Eukaryota:Basidiomycota:Agaricomycetes:Boletales: hypothetical protein SERLADRAFT_436772 [S...   
. Camponotus floridanus.............................. 104  4e-22  8 hits  Eukaryota:Arthropoda:Insecta:Hymenoptera: Histone deacetylase 6 [Camponotus floridanus]       
. Scheffersomyces stipitis CBS 6054.................. 104  4e-22  8 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: hypothetical protein PICST_71431 [Scheffe...   
. Solenopsis invicta................................. 104  4e-22  8 hits  Eukaryota:Arthropoda:Insecta:Hymenoptera: hypothetical protein SINV_07643 [Solenopsis in...   
. Candida albicans WO-1.............................. 103  5e-22  4 hits  Eukaryot
. Caenorhabditis brenneri............................ 103  7e-22  28 hits Eukaryota:Nematoda:Chromadorea:Rhabditida: hypothetical protein CAEBREN_16084 [Caenorhabd...   
. Ogataea parapolymorpha DL-1........................ 103  8e-22  4 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: Histone deacetylase HDA1 [Ogataea parapolymorp...   
. Takifugu rubripes.................................. 102  9e-22  24 hits Eukaryota:Chordata:Actinopterygii:Tetraodontiformes: PREDICTED: histone deacetylase 10-like [T...   
. Naumovozyma castellii CBS 4309..................... 102  9e-22  8 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: hypothetical protein NCAS_0G03800 [Naumov...   
. Dichomitus squalens LYAD-421 SS1................... 102  9e-22  8 hits  Eukaryota:Basidiomycota:Agaricomycetes:Polyporales: histone deacetylase complex protein [Dich...   
. Coniophora puteana RWD-64-598 SS2.................. 102  9e-22  8 hits  Eukaryota:Basidiomycota:Agaricomycetes:Boletales: histone deacetylase clr3 [Coniophora pute...   
. Ichthyophthirius multifiliis....................... 102  9e-22  8 hits  Eukaryota::Oligohymenophorea:Hymenostomatida: hypothetical protein IMG5_162410 [Ichthyo...   
. Sarcophilus harrisii............................... 102  1e-21  28 hits Eukaryot
. Perkinsus marinus ATCC 50983....................... 102  1e-21  8 hits  Eukaryota::Perkinsida:                   histone deacetylase hda1, putative [Perki...   
. Zygosaccharomyces rouxii CBS 732................... 102  1e-21  4 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: ZYRO0A01870p [Zygosaccharomyces rouxii CB...   
. Felis catus........................................ 102  2e-21  16 hits Eukaryota:Chordata:Mammalia:Carnivora:   PREDICTED: histone deacetylase 6 isoform ...   
. Harpegnathos saltator.............................. 102  2e-21  8 hits  Eukaryota:Arthropoda:Insecta:Hymenoptera: Histone deacetylase 6 [Harpegnathos saltator]       
. Spathaspora passalidarum NRRL Y-27907.............. 102  3e-21  8 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: histone deacetylase HDA1 [Spathaspora pas...   
. Cavia porcellus.................................... 102  3e-21  16 hits Eukaryota:Chordata:Mammalia:Rodentia:    PREDICTED: histone deacetylase 6 isoform ...   
. Xenopus (Silurana) tropicalis...................... 101  3e-21  8 hits  Eukaryota:Chordata:Amphibia:Anura:       PREDICTED: histone deacetylase 10-like [X...   
. Cryptococcus gattii WM276.......................... 101  4e-21  8 hits  Eukaryota:Basidiomycota:Tremellomycetes:Tremellales: histone deacetylase clr3 [Cryptococcus ga...   
. Caenorhabditis elegans............................. 101  4e-21  32 hits Eukaryota:Nematoda:Chromadorea:Rhabditida: Protein HDA-6, isoform a [Caenorhabditis ele...   
. Dictyostelium purpureum............................ 101  5e-21  16 hits Eukaryota::Dictyosteliida:               hypothetical protein DICPUDRAFT_147871 [D...   
. Rattus norvegicus.................................. 101  5e-21  96 hits Eukaryota:Chordata:Mammalia:Rodentia:    histone deacetylase 6 [Rattus norvegicus]           
. Loxodonta africana................................. 101  6e-21  16 hits Eukaryota:Chordata:Mammalia:Proboscidea: PREDICTED: histone deacetylase 6-like [Lo...   
. Equus caballus..................................... 100  6e-21  28 hits Eukaryota:Chordata:Mammalia:Perissodactyla: PREDICTED: histone deacetylase 6 isoform ...   
. Rhodotorula glutinis ATCC 204091................... 100  7e-21  4 hits  Eukaryota:Basidiomycota:Sporidiobolales: Histone deacetylase clr3 [Rhodotorula glutinis...   
. Komagataella pastoris GS115........................ 100  1e-20  8 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: Putative catalytic subunit of a class II ...   
. Meyerozyma guilliermondii ATCC 6260................ 100  1e-20  4 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: hypothetical protein PGUG_03879 [Meyerozy...   
. Strongylocentrotus purpuratus...................... 99.8 2e-20  8 hits  Eukaryota:Echinodermata:Echinoidea:Echinoida: PREDICTED: histone deacetylase 4-like [Stron... 
. Canis lupus familiaris............................. 99.8 2e-20  8 hits  Eukaryota:Chordata:Mammalia:Carnivora:   PREDICTED: histone deacetylase 6 isoform X6 ... 
. Naumovozyma dairenensis CBS 421.................... 99.4 1e-20  8 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: hypothetical protein NDAI_0G00650 [Naumov... 
. Ashbya gossypii ATCC 10895......................... 99.0 2e-20  8 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: ADL216Cp [Ashbya gossypii ATCC 10895]           
. Xenopus laevis..................................... 99.0 4e-20  8 hits  Eukaryota:Chordata:Amphibia:Anura:       histone deacetylase 6 [Xenopus laevis]       
. Saccharomyces cerevisiae AWRI796................... 98.2 3e-20  4 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: Hda1p [Saccharomyces cerevisiae AWRI796]          
. Kazachstania naganishii CBS 8797................... 98.2 4e-20  4 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: hypothetical protein KNAG_0H02010 [Kazachstan... 
. Saccharomyces cerevisiae VL3....................... 98.2 4e-20  4 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: Hda1p [Saccharomyces cerevisiae VL3]              
. Saccharomyces cerevisiae Vin13..................... 98.2 4e-20  4 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: Hda1p [Saccharomyces cerevisiae Vin13]            
. Saccharomyces cerevisiae x Saccharomyces kudria.... 98.2 4e-20  4 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: Hda1p [Saccharomyces cerevisiae x Saccharomyce... 
. Caenorhabditis remanei............................. 98.2 5e-20  32 hits Eukaryota:Nematoda:Chromadorea:Rhabditida: CRE-HDA-4 protein [Caenorhabditis remanei]   
. Trichinella spiralis............................... 98.2 5e-20  16 hits Eukaryota:Nematoda:Enoplea:Trichocephalida: putative histone deacetylase 4 [Trichinel... 
. Ustilago hordei.................................... 97.8 5e-20  4 hits  Eukaryota:Basidiomycota:Ustilaginomycetes:Ustilaginales: related to HDA1-histone deacetylase A [Ustila... 
. Saccharomyces kudriavzevii IFO 1802................ 97.8 6e-20  4 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: HDA1-like protein [Saccharomyces kudriavzevii ... 
. Loa loa............................................ 97.8 6e-20  8 hits  Eukaryota:Nematoda:Chromadorea:Spirurida: histone deacetylase 4 [Loa loa]                   
. Metaseiulus occidentalis........................... 97.8 6e-20  8 hits  Eukaryota:Arthropoda:Arachnida:Mesostigmata: PREDICTED: histone deacetylase 4-like [Me... 
. Sporisorium reilianum SRZ2......................... 97.4 7e-20  4 hits  Eukaryota:Basidiomycota:Ustilaginomycetes:Ustilaginales: related to HDA1-histone deacetylase A [Sporis... 
. Magnaporthe oryzae 70-15........................... 96.7 1e-19  8 hits  Eukaryota:Ascomycota:Sordariomycetes:Magnaporthales: histone deacetylase HDA1 [Magnaporthe ory... 
. Albugo laibachii Nc14.............................. 96.7 2e-19  8 hits  Eukaryota::Albuginales:                  histone deacetylase putative [Albugo laibachi... 
. Tetrapisispora phaffii CBS 4417.................... 96.3 2e-19  8 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: hypothetical protein TPHA_0C03390 [Tetrap... 
. Babesia bovis T2Bo................................. 95.9 4e-19  4 hits  Eukaryota:Apicomplexa:Aconoidasida:      histone deacetylase [Babesia bovis T2Bo]     
. Trypanosoma cruzi.................................. 95.5 3e-19  4 hits  Eukaryota::Kinetoplastida:               histone deacetylase, putative [Trypanosoma cruzi] 
. Tetrapisispora blattae CBS 6284.................... 95.5 4e-19  8 hits  Eukaryota:Ascomycota:Saccharomycetes:Saccharomycetales: hypothetical protein TBLA_0B06950 [Tetrap... 
. Theileria orientalis strain Shintoku............... 95.5 5e-19  8 hits  Eukaryota:Apicomplexa:Aconoidasida:      uncharacterized protein TOT_030000917 [Theile... 
. Leishmania mexicana MHOM/GT/2001/U1103............. 94.7 5e-19  8 hits  Eukaryota::Kinetoplastida:               putative histone deacetylase [Leishmania ... 
. Stereum hirsutum FP-91666 SS1...................... 94.7 5e-19  8 hits  Eukaryota:Basidiomycota:Agaricomycetes:Russulales: histone deacetylase complex protein [Ster... 
. Meleagris gallopavo................................ 94.7 9e-19  16 hits Eukaryota:Chordata:Aves:Galliformes:     PREDICTED: histone deacetylase 9-like [Me... 
. Tremella mesenterica DSM 1558...................... 94.4 7e-19  8 hits  Eukaryota:Basidiomycota:Tremellomycetes:Tremellales: hypothetical protein TREMEDRAFT_34982 [Tr... 
. Cordyceps militaris CM01........................... 94.0 9e-19  8 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: histone deacetylase [Cordyceps militaris ... 
. Neurospora crassa.................................. 94.0 1e-18  4 hits  Eukaryota:Ascomycota:Sordariomycetes:Sordariales: related to histone deacetylase A [Neurospora ... 
. Neurospora crassa OR74A............................ 94.0 1e-18  4 hits  Eukaryota:Ascomycota:Sordariomycetes:Sordariales: hypothetical protein NCU01525 [Neurospora cr... 
. Neurospora tetrasperma FGSC 2508................... 93.6 2e-18  4 hits  Eukaryota:Ascomycota:Sordariomycetes:Sordariales: hypothetical protein NEUTE1DRAFT_147039 [Neuro... 
. Trichosporon asahii var. asahii CBS 2479........... 93.2 2e-18  4 hits  Eukaryota:Basidiomycota:Tremellomycetes:Tremellales: histone deacetylase clr3 [Trichosporon asahii ... 
. Trichosporon asahii var. asahii CBS 8904........... 93.2 2e-18  4 hits  Eukaryota:Basidiomycota:Tremellomycetes:Tremellales: histone deacetylase clr3 [Trichosporon asahii ... 
. Gallus gallus...................................... 92.8 3e-18  12 hits Eukaryota:Chordata:Aves:Galliformes:     histone deacetylase 9 [Gallus gallus]        
. Pyrenophora tritici-repentis Pt-1C-BFP............. 92.4 4e-18  8 hits  Eukaryota:Ascomycota:Dothideomycetes:Pleosporales: histone deacetylase 4 [Pyrenophora tritic... 
. Macrophomina phaseolina MS6........................ 92.4 5e-18  4 hits  Eukaryota:Ascomycota:Dothideomycetes:Botryosphaeriales: Histone deacetylase superfamily [Macrophomina ... 
. Piriformospora indica DSM 11827.................... 92.0 5e-18  4 hits  Eukaryota:Basidiomycota:Agaricomycetes:Sebacinales: related to HDA1-histone deacetylase A [Pirifo... 
. Arthrobotrys oligospora ATCC 24927................. 92.0 5e-18  4 hits  Eukaryota:Ascomycota:Orbiliomycetes:Orbiliales: hypothetical protein AOL_s00083g509 [Arthrobot... 
. Sclerotinia sclerotiorum 1980 UF-70................ 92.0 5e-18  8 hits  Eukaryota:Ascomycota:Leotiomycetes:Helotiales: hypothetical protein SS1G_07799 [Scleroti... 
. Beauveria bassiana ARSEF 2860...................... 92.0 6e-18  8 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: histone deacetylase [Beauveria bassiana A... 
. Acyrthosiphon pisum................................ 92.0 6e-18  4 hits  Eukaryota:Arthropoda:Insecta:Hemiptera:  PREDICTED: histone deacetylase 4 isoform ... 
. Apis mellifera..................................... 92.0 6e-18  4 hits  Eukaryota:Arthropoda:Insecta:Hymenoptera: PREDICTED: histone deacetylase 5 isoform X11... 
. Verticillium dahliae VdLs.17....................... 91.7 7e-18  4 hits  Eukaryota:Ascomycota:Sordariomycetes:Glomerellales: histone deacetylase clr3 [Verticillium dahliae... 
. Bipolaris zeicola 26-R-13.......................... 91.7 8e-18  8 hits  Eukaryota:Ascomycota:Dothideomycetes:Pleosporales: hypothetical protein COCCADRAFT_82967 [Bi... 
. Danio rerio........................................ 91.7 8e-18  24 hits Eukaryota:Chordata:Actinopterygii:Cypriniformes: histone deacetylase 4 [Danio rerio]          
. Nasonia vitripennis................................ 91.3 1e-17  4 hits  Eukaryota:Arthropoda:Insecta:Hymenoptera: PREDICTED: histone deacetylase 5 [Nasonia... 
. Fusarium oxysporum Fo5176.......................... 90.9 1e-17  4 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein FOXB_04328 [Fusarium oxys... 
. Oreochromis niloticus.............................. 90.9 2e-17  8 hits  Eukaryota:Chordata:Actinopterygii:Perciformes: PREDICTED: histone deacetylase 7-like iso... 
. Auricularia delicata TFB-10046 SS5................. 90.1 2e-17  8 hits  Eukaryota:Basidiomycota:Agaricomycetes:Auriculariales: hypothetical protein AURDEDRAFT_82103 [Au... 
. Marssonina brunnea f. sp. 'multigermtubi' MB_m1.... 90.1 2e-17  8 hits  Eukaryota:Ascomycota:Leotiomycetes:Helotiales: hypothetical protein MBM_05498 [Marssonin... 
. Wallemia sebi CBS 633.66........................... 90.1 2e-17  8 hits  Eukaryota:Basidiomycota:Wallemiomycetes:Wallemiales: hypothetical protein WALSEDRAFT_59725 [Wa... 
. Phytophthora sojae................................. 90.1 4e-17  12 hits Eukaryota::Peronosporales:               hypothetical protein PHYSODRAFT_562727 [Phytop... 
. Botryotinia fuckeliana T4.......................... 89.7 3e-17  4 hits  Eukaryota:Ascomycota:Leotiomycetes:Helotiales: hypothetical protein BofuT4_P005330.1 [Botryo... 
. Dictyostelium fasciculatum......................... 89.4 6e-17  8 hits  Eukaryota::Dictyosteliida:               histone deacetylase family protein [Dicty... 
. Caenorhabditis briggsae............................ 89.0 6e-17  8 hits  Eukaryota:Nematoda:Chromadorea:Rhabditida: Protein CBR-HDAC-6 [Caenorhabditis briggsae]     
. Mixia osmundae IAM 14324........................... 88.6 7e-17  12 hits Eukaryota:Basidiomycota:Mixiales:        hypothetical protein E5Q_00886 [Mixia osmunda... 
. Pyrenophora teres f. teres 0-1..................... 88.6 8e-17  8 hits  Eukaryota:Ascomycota:Dothideomycetes:Pleosporales: hypothetical protein PTT_13889 [Pyrenopho... 
. Claviceps purpurea 20.1............................ 88.6 9e-17  4 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: related to histone deacetylase A [Claviceps p... 
. Arthroderma gypseum CBS 118893..................... 88.2 1e-16  8 hits  Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: histone deacetylase clr3 [Arthroderma gyp... 
. Trichophyton rubrum CBS 118892..................... 88.2 1e-16  4 hits  Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: histone deacetylase [Trichophyton rubrum ... 
. Coccidioides posadasii C735 delta SOWgp............ 88.2 1e-16  8 hits  Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: histone deacetylase clr3, putative [Cocci... 
. Trichophyton tonsurans CBS 112818.................. 88.2 1e-16  4 hits  Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: histone deacetylase HdaA [Trichophyton tonsura... 
. Coccidioides immitis RS............................ 88.2 1e-16  4 hits  Eukaryota:Ascomycota:Eurotiomycetes:Onygenales: histone deacetylase clr3 [Coccidioides immitis... 
. Gaeumannomyces graminis var. tritici R3-111a-1..... 87.8 1e-16  4 hits  Eukaryota:Ascomycota:Sordariomycetes:Magnaporthales: histone deacetylase HDA1 [Gaeumannomyces grami... 
. Bos grunniens mutus................................ 87.8 2e-16  4 hits  Eukaryota:Chordata:Mammalia:             PREDICTED: histone deacetylase 5 isoform ... 
. Leptosphaeria maculans JN3......................... 87.4 2e-16  8 hits  Eukaryota:Ascomycota:Dothideomycetes:Pleosporales: hypothetical protein LEMA_P066770.1 [Lept... 
. Babesia microti strain RI.......................... 87.4 3e-16  4 hits  Eukaryota:Apicomplexa:Aconoidasida:      unnamed protein product [Babesia microti stra... 
. Fusarium pseudograminearum CS3096.................. 86.3 4e-16  4 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein FPSE_01499 [Fusarium pseu... 
. Nectria haematococca mpVI 77-13-4.................. 86.3 4e-16  8 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: histone deacetylase [Nectria haematococca... 
. Trichoderma virens Gv29-8.......................... 86.3 5e-16  4 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein TRIVIDRAFT_88835 [Trichod... 
. Chaetomium thermophilum var. thermophilum DSM 1.... 85.9 6e-16  8 hits  Eukaryota:Ascomycota:Sordariomycetes:Sordariales: hypothetical protein CTHT_0004840 [Chaeto... 
. Callithrix jacchus................................. 85.9 8e-16  8 hits  Eukaryota:Chordata:Mammalia:Primates:    PREDICTED: histone deacetylase 5 isoform ... 
. Trichoderma atroviride IMI 206040.................. 85.5 8e-16  4 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: hypothetical protein TRIATDRAFT_39952 [Trichod... 
. Trypanosoma congolense IL3000...................... 85.5 8e-16  4 hits  Eukaryota::Kinetoplastida:               unnamed protein product [Trypanosoma congolen... 
. Neospora caninum Liverpool......................... 85.5 1e-15  8 hits  Eukaryota:Apicomplexa:Coccidia:Eucoccidiorida: hypothetical protein NCLIV_023370 [Neospo... 
. Podospora anserina S mat+.......................... 85.1 1e-15  12 hits Eukaryota:Ascomycota:Sordariomycetes:Sordariales: hypothetical protein [Podospora anserina ... 
. Metarhizium anisopliae ARSEF 23.................... 84.7 2e-15  8 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: putative histone deacetylase A [Metarhizi... 
. Trichoderma reesei QM6a............................ 84.3 2e-15  8 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: histone deacetylase [Trichoderma reesei Q... 
. Metarhizium acridum CQMa 102....................... 84.3 2e-15  8 hits  Eukaryota:Ascomycota:Sordariomycetes:Hypocreales: putative histone deacetylase A [Metarhizi... 


BLAST

PROTOCOLE:

Sur le site NCBI allez dans l'onglet BLASTp. Entrer la séquence protéique FASTA dans le champs demandé.

Sélection des paramètre: - Database: Non-Redundant

                         - Algorithm: blastp

                         - Max target sequences : 5 000

                         - Autre paramètre par défaut.


Le second BLAST est fait contre la base de données SwissProt. C'est donc le seul paramètre que l'on change par rapport au protocole ci-dessus

_

ANALYSE DES RÉSULTATS:


_______________________________________________________________

|       |  Base de  |  nombre de  | e-value | e-value | e-value |

|  ORF  |  Données  |  résultats  |   min   |   max   |  seuil  |

|_______|___________|_____________|_________|_________|_________|

|       |           |             |         |         |         |  Identité 1er hit:     51%

|       |    NR     |    5000     |  2e-57  |  2e-16  | >2e-16  |  Recouvrement 1er hit: 90%

|   B   |___________|_____________|_________|_________|_________|

|       |           |             |         |         |         |  Identité 1er hit:     37%

|       |    SP     |     95      |  5e-28  |   9.9   |  0.002  |  Recouvrement 1er hit: 91%

|_______|___________|_____________|_________|_________|_________|



     Choix du seuil de e-value pour NR: |

     ___________________________________|


     Nous avons obtenue 5 000 hit lors du BLAST. Il n'y a pas de saut de e-value. De plus le dernier hit possède une e-value de 2e-26 ce qui est très faible et a la même fonction que notre meilleur hit, nous pouvons donc penser qu'il est bien un homologue de notre séquence d'étude. On ne peut donc pas déterminer de e-value dans la liste de ces résultats car nous risquerions d'exclure de réel homologues. Il faudrait effectuer un BLAST en augmentant le nombre de séquences a aligner. Par soucis technique, nous dirons seulement que le seuil sera supérieur à 2e-16.


     Choix du seuil de e-value pour SwissProt: |

     __________________________________________|


     La base de donné SwissProt est certes mieux annotée mais est moins conséquente que NR ce qui explique le faible nombre de Hit par rapport à la base NR

Le choix de la e-value est plus dur dans ce cas. Une des séquences données à un recouvrement de 93% avec une identité de 23%. Sur les 198 a.a de notre séquence ce résultat est non négligeable. Mais la e-value n'est que de 0.002 et même si cette séquence a la même fonction que le meilleur Hit contre NR et SwissProt, cela ne signifie pas pour autant que ces séquences sont homologues. Dans un premier temps nous allons donc laisser 0.002 comme seuil mais nous réaliserons par la suite 2 alignements multiples, un avec et un sans cette séquence pour voir si elle est bien homologue à notre ORF.



     Prédiction des fonctions protéiques pour NR: |

     _____________________________________________|



   ___________________________________________________________________________________________________

  |                                                                       |             |             |

  |    descriptions :                                                     | min e-value | max e-value |

  |_______________________________________________________________________|_____________|_____________|

  | • deacetylase                                                         |    2e-57    |    2e-16    |

  | • acetoin utilization protein                                         |    5e-46    |    2e-16    |    

  | • HDA1-like protein                                                   |    6e-20    |    6e-20    |

  | • HDAC4, isoform I                                                    |    1e-19    |    1e-19    |

  | • HDAC4, isoform G                                                    |    1e-19    |    1e-19    |

  |_______________________________________________________________________|_____________|_____________|


     Lors du BLAST nous avons obtenue plus de 4 000 deacetylase (ou histone deacetylase). Il y a également un autre groupe de protéine récurent (HDA ou HDAC) avec de nombreux isoforme dans leur dénomination, mais il semble que ces protéines aient la même fonction car nous avons cherché le rôle de certaines sur PubMed d'où est tiré l'article suivant:


              - Histone deacetylase (HDAC) inhibitor activation of p21WAF1 involves changes in promoter-associated proteins, including HDAC1

                CY Gui, L Ngo, WS Xu, VM Richon… - Proceedings of the …, 2004 - National Acad Sciences




     Il y a également dans nos résultats des acetoins ou des acetoin deacetylase qui sont homologues car elles appartiennent à la  superfamille (histone deacetylase) comme le montre l'article suivant:


               - Histone deacetylases, acetoin utilization proteins and acetylpolyamine amidohydrolases are members of an ancient protein superfamily.

                 Leipe DD1, Landsman D.






_



     Prédiction des fonctions protéiques pour SwissProt: |

     ____________________________________________________|




   ___________________________________________________________________________________________________

  |    descriptions :                                                     | min e-value | max e-value |

  |_______________________________________________________________________|_____________|_____________|

  | • Histone deacetylase                                                 |    5e-28    |    2e-3     |

  | • acetoin utilization protein                                         |    1e-09    |    5e-05    |

  | • Uncharacterized protein                                             |    2e-26    |    7e-08    |

  | • Flap endonuclease 1                                                 |    5.5      |    6.2      |

  | • N-acetyltransferase                                                 |    9.3      |    9.3      |

  | • ligase                                                              |    9.9      |    9.9      |

  |_______________________________________________________________________|_____________|_____________|


     Les Hit obtenus contre SwissProt sont moins nombreux mais semble avoir des fonctions bien plus variées. les article trouvés sur la Flap endonucléase 1 ou encore la N-acetyltransferase présentent les fonctions de ces protéines qui sont différentes des Histone Deacetylase trouvées aussi bien sur SwissProt que sur NR.

De plus ces résultats possèdent des e-value au dessus du seuil que nous avions fixé. Ces séquences ne sont donc pas homologues, ou alors leur origine commune est si lointaine que chacune de ces séquences ont subie de nombreuses mutations qui seraient la cause de leurs divergences aujourd'hui.




     Synthèse: |

     __________|



     Les séquences obtenues aussi bien sur NR que sur SwissProt ayant des e-value supérieures aux seuils que nous avions fixé (NR:>2e-16, SwissProt: 0.002) appartiennent toutes à la super famille des histones deacetylase. De plus l'identité et le recouvrement des 1er Hits sont élevè (Recouvrement: 90% sur NR et 91% sur SwissProt; Identité: 51% sur NR 32 sur SwissProt)  compte tenue de la longueur de notre séquence (198 a.a). Cela vient appuyer la recherche du domaine protéique et nous pouvons fortement supposer que notre ORF est codant et qu'il code un protéine appartient à la super famille des histone deacetylase et qu'elle aura donc une fonction deacetylase.



RESULTATS BRUTS:



BLAST sur NR

                                                                  Score     E
Sequences producing significant alignments:                       (Bits)  Value

gb|AIA76113.1|  deacetylase [Halomonas campaniensis]                 194   2e-57
ref|WP_007114266.1|  deacetylase [Halomonas boliviensis]             193   6e-57
gb|KEA64810.1|   deacetylase [Marinobacterium ...                    192   9e-57
ref|WP_009724395.1|  deacetylase [Halomonas sp. TD01]                192   1e-56
ref|WP_007462293.1|  histone deacetylase superfamily [Photobac...    191   3e-56
ref|WP_008957937.1|  deacetylase [Halomonas sp. HAL1]                191   4e-56
ref|WP_008042647.1|  Deacetylase, including yeast histone deac...    189   1e-55
ref|WP_009287865.1|  MULTISPECIES: Histone deacetylase superfa...    189   3e-55
ref|WP_022523452.1|  hypothetical protein [Halomonas sp. A3H3]       189   3e-55
ref|WP_011398575.1|  deacetylase [Hahella chejuensis]                187   1e-54
gb|EWG99154.1|  deacetylase [Halomonas sp. BC04]                     187   2e-54
ref|WP_027335768.1|  deacetylase [Halomonas sp. HL-48]               187   2e-54
ref|WP_019623013.1|  deacetylase [Amphritea japonica]                186   2e-54
gb|EWG98886.1|  deacetylase [Halomonas sp. BC04]                     186   3e-54
ref|WP_028471137.1|  deacetylase [Neptunomonas japonica]             185   7e-54
ref|WP_010322722.1|  deacetylase [Marinobacterium stanieri]          184   2e-53
gb|AHI29727.1|  deacetylase [Marinobacter sp. A3d10]                 184   3e-53
ref|WP_010628571.1|  deacetylase [Halomonas sp. KM-1]                183   3e-53
ref|WP_019017715.1|  deacetylase [Halomonas lutea]                   183   5e-53
ref|WP_028670123.1|  deacetylase [Saccharospirillum impatiens]       183   6e-53
ref|WP_014421964.1|  deacetylase [Marinobacter hydrocarbonocla...    182   8e-53
ref|WP_011785962.1|  deacetylase [Marinobacter hydrocarbonocla...    182   8e-53
ref|WP_022992893.1|  MULTISPECIES: deacetylase [Marinobacter]        182   9e-53
ref|WP_020681346.1|  hypothetical protein [Marinobacterium rhi...    181   2e-52
ref|WP_031383548.1|  deacetylase [Halomonas zincidurans]             181   3e-52
gb|KFZ29516.1|  deacetylase [Idiomarina sp. MCCC 1A10513]            181   3e-52
ref|WP_029655615.1|  deacetylase [Marinobacter daepoensis]           179   9e-52
ref|WP_026860655.1|  deacetylase [Idiomarina sediminum]              179   1e-51
gb|KGE79042.1|  deacetylase [Halomonas salina]                       179   2e-51
gb|EXJ12088.1|  Histone deacetylase-like amidohydrolase [Nitri...    178   2e-51
ref|WP_027961862.1|  deacetylase [Halomonas halodenitrificans]       179   3e-51
ref|WP_022989636.1|  deacetylase [Marinobacter sp. ES-1]             178   4e-51
ref|WP_008949987.1|  deacetylase [Alishewanella jeotgali]            178   4e-51
ref|WP_009204948.1|  deacetylase [Sulfuricella denitrificans]        178   4e-51
ref|WP_027848568.1|  deacetylase [Marinospirillum minutulum]         177   6e-51
ref|WP_017509902.1|  deacetylase [beta proteobacterium L13]          177   8e-51
ref|WP_030073023.1|  deacetylase [Halomonas alkaliantarctica]        177   1e-50
ref|WP_027851461.1|  deacetylase [Marinospirillum insulare]          175   4e-50
ref|WP_019677085.1|  deacetylase [Rheinheimera perlucida]            175   4e-50
ref|WP_009117739.1|  deacetylase [Neisseria shayeganii]              176   4e-50
ref|WP_009020445.1|  deacetylase [Luminiphilus syltensis]            175   5e-50
ref|WP_008608907.1|  deacetylase [Alishewanella aestuarii]           175   6e-50
ref|WP_027312804.1|  deacetylase [Balneatrix alpica]                 174   2e-49
ref|WP_018988912.1|  deacetylase [Azoarcus toluclasticus]            173   2e-49
ref|WP_027858798.1|  deacetylase [Marinobacterium jannaschii]        173   2e-49
ref|WP_018916156.1|  deacetylase [Halomonas zhanjiangensis]          174   2e-49
ref|WP_018170073.1|  MULTISPECIES: hypothetical protein [Thioa...    173   2e-49
ref|WP_008985685.1|  deacetylase [Alishewanella agri]                173   2e-49
ref|WP_028302342.1|  deacetylase [Oceanospirillum beijerinckii]      173   2e-49
ref|WP_018144207.1|  MULTISPECIES: hypothetical protein [Thioa...    173   4e-49
ref|WP_011137233.1|  deacetylase [Chromobacterium violaceum]         173   4e-49
gb|KDE40520.1|  Acetylspermidine deacetylase [Nitrincola lacis...    172   5e-49
ref|WP_027966833.1|  deacetylase [Halomonas halocynthiae]            172   6e-49
ref|WP_008953409.1|  deacetylase [Pseudogulbenkiania ferrooxid...    172   8e-49
ref|WP_015832298.1|  deacetylase [Methylotenera mobilis]             172   1e-48
ref|WP_028374017.1|  deacetylase [Legionella lansingensis]           171   1e-48
ref|WP_014085990.1|  deacetylase [Pseudogulbenkiania sp. NH8B]       172   1e-48
gb|KEA64339.1|  Acetylspermidine deacetylase [Marinobacterium ...    171   2e-48
dbj|BAO30206.1|  histone deacetylase [Sulfuritalea hydrogenivo...    171   2e-48
ref|WP_027670756.1|  deacetylase [Rheinheimera baltica]              171   3e-48
ref|WP_016854944.1|  deacetylase [Halomonas smyrnensis]              171   3e-48
ref|WP_007184086.1|  deacetylase [Hydrocarboniphaga effusa]          170   3e-48
ref|WP_016415174.1|  deacetylase [Halomonas anticariensis]           170   4e-48
ref|WP_013753487.1|  deacetylase [Glaciecola sp. 4H-3-7+YE-5]        170   4e-48
ref|WP_020681789.1|  hypothetical protein [Marinobacterium rhi...    170   4e-48
ref|WP_008933065.1|  deacetylase [Ectothiorhodospira sp. PHS-1]      170   4e-48
ref|WP_007991648.1|  histone deacetylase family protein [Glaci...    170   5e-48
ref|WP_027405075.1|  deacetylase [Aquaspirillum serpens]             170   6e-48
ref|WP_007022096.1|  deacetylase [Neptuniibacter caesariensis]       169   7e-48
gb|KFZ90935.1|  Histone deacetylase domain [Thiobacillus prosp...    170   7e-48
ref|WP_008302812.1|  histone deacetylase family protein [Glaci...    169   8e-48
ref|WP_004314944.1|  MULTISPECIES: deacetylase [Thauera]             169   1e-47
ref|WP_011507203.1|  deacetylase [Chromohalobacter salexigens]       169   1e-47
ref|WP_013662691.1|  deacetylase [Marinomonas mediterranea]          169   2e-47
ref|WP_028500012.1|  deacetylase [Microvirgula aerodenitrificans]    169   2e-47
ref|WP_009095156.1|  deacetylase [Halomonas sp. GFAJ-1]              168   3e-47
gb|KGK42985.1|  deacetylase [Nitrincola sp. A-D6]                    167   4e-47
ref|WP_024023733.1|  deacetylase [Marinomonas sp. D104]              167   6e-47
ref|WP_011288248.1|  deacetylase [Dechloromonas aromatica]           167   1e-46
ref|WP_018506687.1|  deacetylase [Thiobacillus thioparus]            166   1e-46
ref|WP_025869669.1|  deacetylase [Methylobacillus glycogenes]        166   2e-46
ref|WP_026287056.1|  deacetylase [Gilvimarinus chinensis]            166   2e-46
ref|WP_027823557.1|  deacetylase [Laribacter hongkongensis]          166   2e-46
ref|WP_005018987.1|  histone deacetylase family protein [Borde...    166   2e-46
ref|WP_018955157.1|  deacetylase [Thioalkalivibrio sp. ALJ17]        166   2e-46
ref|WP_028537235.1|  deacetylase [Paludibacterium yongneupense]      166   2e-46
ref|WP_012696142.1|  deacetylase [Laribacter hongkongensis]          166   3e-46
ref|WP_027330533.1|  deacetylase [Marinimicrobium agarilyticum]      166   3e-46
ref|WP_026685412.1|  deacetylase [Azovibrio restrictus]              165   3e-46
ref|WP_021817589.1|  hypothetical protein [Halomonas sp. BJGMM...    166   3e-46
ref|WP_004336413.1|  histone deacetylase [Thauera linaloolentis]     165   3e-46
ref|WP_005012456.1|  histone deacetylase family protein [Borde...    165   4e-46
ref|WP_020406895.1|  deacetylase [Hahella ganghwensis]               165   4e-46
ref|WP_012639595.1|  deacetylase [Thioalkalivibrio sulfidophilus]    165   4e-46
ref|WP_006954367.1|  deacetylase [Idiomarina baltica]                165   4e-46
ref|WP_010141703.1|  acetoin utilization protein [Oceanicola s...    165   5e-46
ref|WP_007420945.1|  deacetylase [Idiomarina sp. A28L]               164   5e-46
ref|WP_027831595.1|  deacetylase [Marinobacter sp. HL-58]            164   6e-46
gb|KCB38842.1|  histone deacetylase family protein [Bordetella...    164   6e-46
ref|WP_024953156.1|  deacetylase [Cobetia crustatorum]               166   6e-46
ref|WP_015437110.1|  hypothetical protein [Azoarcus sp. KH32C]       164   6e-46
ref|WP_006013815.1|  histone deacetylase superfamily [Glacieco...    164   7e-46
ref|WP_029131932.1|  deacetylase [Sedimenticola selenatireducens]    164   7e-46
gb|EWM51892.1|  histone deacetylase domain protein [Bordetella...    164   8e-46
gb|AHE66982.1|  deacetylase [Legionella oakridgensis ATCC 3376...    163   8e-46
ref|WP_002923940.1|  MULTISPECIES: histone deacetylase [Thauera]     164   9e-46
ref|WP_010443128.1|  acetoin utilization protein [Ruegeria sp....    164   1e-45
ref|WP_024301409.1|  deacetylase [Pseudogulbenkiania sp. MAI-1]      164   1e-45
ref|WP_013332373.1|  deacetylase [Halomonas elongata]                164   1e-45
ref|WP_011479698.1|  deacetylase [Methylobacillus flagellatus]       164   1e-45
gb|KEF31732.1|  Deacetylase [Marinobacter sp. AK21]                  164   1e-45
ref|WP_011764829.1|  deacetylase [Azoarcus sp. BH72]                 163   2e-45
gb|AHE97728.1|  deacetylase [Thioalkalivibrio thiocyanoxidans ...    163   2e-45
ref|WP_028995790.1|  deacetylase [Azonexus hydrophilus]              163   2e-45
gb|ETO93343.1|  deacetylase [Legionella oakridgensis RV-2-2007]      163   2e-45
gb|KCB21547.1|  histone deacetylase family protein [Bordetella...    162   3e-45
ref|WP_004259585.1|  histone deacetylase [Thauera sp. 63]            162   3e-45
ref|WP_015819325.1|  deacetylase [Teredinibacter turnerae]           162   4e-45
ref|WP_011978469.1|  deacetylase [Marinomonas sp. MWYL1]             162   4e-45
ref|WP_008171440.1|  MULTISPECIES: deacetylase [Marinobacter]        162   4e-45
ref|WP_023005466.1|  deacetylase [Halomonas sp. PBN3]                162   4e-45
ref|WP_028451207.1|  deacetylase [Chitinilyticum aquatile]           162   5e-45
ref|WP_007349674.1|  deacetylase [Marinobacter sp. ELB17]            162   5e-45
gb|AHI32034.1|  deacetylase [Marinobacter sp. R9SW1]                 162   5e-45
ref|WP_010548246.1|  deacetylase [gamma proteobacterium HIMB30]      162   5e-45
ref|WP_012248821.1|  deacetylase [Bordetella petrii]                 162   5e-45
ref|WP_027855789.1|  deacetylase [Marinobacterium litorale]          162   5e-45
ref|WP_028454629.1|  deacetylase [Chitinilyticum litopenaei]         162   5e-45
ref|WP_013794867.1|  deacetylase [Marinomonas posidonica]            162   6e-45
ref|WP_032955110.1|  deacetylase [Bordetella hinzii]                 162   6e-45
ref|WP_018014870.1|  deacetylase [Teredinibacter turnerae]           162   6e-45
ref|WP_018697988.1|  hypothetical protein [Amorphus coralli]         162   6e-45
ref|WP_019601973.1|  deacetylase [Teredinibacter turnerae]           162   7e-45
ref|WP_024896153.1|  acetoin utilization protein [Ochrobactrum...    162   7e-45
ref|WP_019810469.1|  histone deacetylase superfamily protein [...    162   7e-45
ref|WP_029063849.1|  acetoin utilization protein [Labrenzia sp...    161   7e-45
ref|WP_014109765.1|  deacetylase [Glaciecola nitratireducens]        161   8e-45
ref|WP_008218967.1|  deacetylase [Rheinheimera nanhaiensis]          161   8e-45
ref|WP_026224081.1|  deacetylase [Marinobacter lipolyticus]          161   8e-45
dbj|BAP87905.1|  histone deacetylase [Burkholderiales bacteriu...    161   8e-45
ref|WP_024848201.1|  acetoin utilization protein [Aminobacter ...    161   8e-45
ref|WP_018415398.1|  deacetylase [Teredinibacter turnerae]           161   1e-44
ref|WP_019604747.1|  deacetylase [Teredinibacter turnerae]           161   1e-44
gb|ETX12474.1|  deacetylase [Marinomonas ushuaiensis DSM 15871]      161   1e-44
ref|WP_018274141.1|  deacetylase [Teredinibacter turnerae]           161   1e-44
ref|WP_023414637.1|  deacetylase [uncultured Thiohalocapsa sp....    161   1e-44
ref|WP_013434477.1|  deacetylase [Burkholderia rhizoxinica]          162   2e-44
ref|WP_027458223.1|  deacetylase [Dechloromonas agitata]             160   2e-44
ref|WP_013654027.1|  acetoin utilization protein [Polymorphum ...    160   2e-44
ref|WP_027235852.1|  acetoin utilization protein [Phaeobacter ...    160   3e-44
ref|WP_004359876.1|  histone deacetylase [Thauera phenylacetica]     159   3e-44
ref|WP_026226955.1|  acetoin utilization protein [Hoeflea sp. ...    160   3e-44
ref|WP_008562335.1|  acetoin utilization protein [Ruegeria sp....    160   3e-44
ref|WP_019898136.1|  deacetylase [Methylotenera mobilis]             160   4e-44
ref|WP_014870677.1|  deacetylase [Marinobacter sp. BSs20148]         160   4e-44
ref|WP_028718507.1|  acetoin utilization protein [Paracoccus y...    159   4e-44
ref|WP_011799493.1|  deacetylase [Polaromonas naphthalenivorans]     159   5e-44
ref|WP_011236258.1|  deacetylase [Aromatoleum aromaticum]            159   5e-44
ref|WP_026353397.1|  deacetylase [Vitreoscilla stercoraria]          160   5e-44
ref|WP_013648794.1|  deacetylase [Nitrosomonas sp. AL212]            159   6e-44
ref|WP_012417044.1|  deacetylase [Bordetella avium]                  159   6e-44
ref|WP_025512402.1|  deacetylase [Bordetella trematum]               159   7e-44
ref|WP_008937900.1|  hypothetical protein [Marinobacter santor...    159   7e-44
ref|WP_021251192.1|  deacetylase [Thauera terpenica]                 159   8e-44
ref|WP_007106452.1|  histone deacetylase/AcuC/AphA family prot...    159   9e-44
ref|WP_019297547.1|  acetoin utilization protein [Phaeobacter ...    159   9e-44
ref|WP_014237046.1|  deacetylase [Azospira oryzae]                   159   9e-44
emb|CCK76058.1|  Histone deacetylase superfamily protein [Olei...    158   1e-43
ref|WP_007144465.1|  deacetylase [Methylophaga aminisulfidivor...    158   1e-43
ref|WP_026482964.1|  MULTISPECIES: deacetylase [Alcaligenes]         158   1e-43
ref|WP_027245165.1|  acetoin utilization protein [Phaeobacter ...    158   1e-43
ref|WP_013465971.1|  MULTISPECIES: deacetylase [Pseudoalteromo...    158   2e-43
ref|WP_033534512.1|  deacetylase [Bordetella trematum]               158   2e-43
gb|KFB73010.1|  Histone deacetylase-like amidohydrolase [Candi...    158   2e-43
ref|WP_031568329.1|  deacetylase [Rheinheimera texasensis]           158   2e-43
ref|WP_013293345.1|  deacetylase [Gallionella capsiferriformans]     158   2e-43
ref|WP_019865072.1|  hypothetical protein [Methylovulum miyako...    158   2e-43
ref|WP_010391769.1|  deacetylase [Pseudoalteromonas undina]          157   2e-43
ref|WP_007236037.1|  deacetylase [marine gamma proteobacterium...    157   3e-43
ref|WP_005979590.1|  acetoin utilization protein [Ruegeria lac...    157   3e-43
gb|KGM50037.1|  acetoin utilization protein [Oceanicola sp. 22...    157   3e-43
ref|WP_029350467.1|  acetoin utilization protein [Bosea sp. 117]     157   3e-43
ref|WP_007017745.1|  Deacetylases, including yeast histone dea...    157   3e-43
ref|WP_028819135.1|  deacetylase [beta proteobacterium SCGC AA...    157   3e-43
ref|WP_022951461.1|  deacetylase [Leucothrix mucor]                  157   4e-43
ref|WP_024601706.1|  deacetylase [Pseudoalteromonas atlantica]       157   5e-43
ref|WP_008557791.1|  acetoin utilization protein [Rhodobactera...    157   5e-43
ref|WP_012139629.1|  hypothetical protein [Marinobacter lipoly...    157   5e-43
ref|WP_005493352.1|  Acetylspermidine deacetylase [Pseudoalter...    157   5e-43
ref|WP_029526785.1|  deacetylase [Polaromonas sp. Cr4-12]            157   6e-43
ref|WP_008125257.1|  acetoin utilization protein [Phyllobacter...    156   6e-43
ref|WP_007873759.1|  histone deacetylase superfamily protein [...    157   7e-43
ref|WP_008114852.1|  MULTISPECIES: deacetylase [Pseudoalteromo...    156   7e-43
ref|WP_009451367.1|  acetoin utilization protein [Nitratireduc...    156   8e-43
ref|WP_012486692.1|  deacetylase [Cellvibrio japonicus]              157   9e-43
dbj|BAL52864.1|  histone deacetylase [uncultured gamma proteob...    156   9e-43
ref|WP_015830134.1|  deacetylase [Methylovorus glucosotrophus]       156   9e-43
ref|WP_011327049.1|  deacetylase [Pseudoalteromonas haloplanktis]    156   9e-43
ref|WP_011574571.1|  deacetylase [Pseudoalteromonas atlantica]       156   9e-43
ref|WP_008839322.1|  acetoin utilization protein [Mesorhizobiu...    156   1e-42
gb|EXI84220.1|  Histone deacetylase-like amidohydrolase [Candi...    156   1e-42
ref|WP_009816664.1|  acetoin utilization protein [Roseovarius ...    156   1e-42
ref|WP_010383256.1|  deacetylase [Pseudoalteromonas rubra]           156   1e-42
ref|WP_022571178.1|  deacetylase, histone deacetylase/acetoin ...    156   1e-42
ref|WP_022703282.1|  acetoin utilization protein [Pseudorhodob...    155   1e-42
ref|WP_027256905.1|  acetoin utilization protein [Leisingera a...    155   1e-42
gb|EXI69403.1|  Histone deacetylase-like amidohydrolase [Candi...    155   1e-42
ref|WP_028287071.1|  acetoin utilization protein [Oceanicola n...    155   1e-42
ref|WP_033103750.1|  deacetylase [Pseudoalteromonas sp. ND6B]        155   2e-42
ref|WP_015765924.1|  deacetylase [Candidatus Accumulibacter ph...    155   2e-42
ref|WP_028874297.1|  deacetylase [Tepidiphilus margaritifer]         155   2e-42
ref|WP_016708463.1|  deacetylase [Pseudoalteromonas haloplanktis]    155   2e-42
ref|WP_009147491.1|  deacetylase [Thiorhodovibrio sp. 970]           155   2e-42
ref|WP_004581745.1|  hypothetical protein [Marinobacter nanhai...    155   2e-42
ref|WP_011634849.1|  deacetylase [Nitrosomonas eutropha]             155   2e-42
ref|WP_007194832.1|  deacetylase [Thiocapsa marina]                  155   2e-42
ref|WP_025426150.1|  acetoin utilization protein [Ensifer adha...    155   2e-42
ref|WP_006791169.1|  deacetylase [Alteromonadales bacterium TW-7]    155   2e-42
ref|WP_013029674.1|  deacetylase [Sideroxydans lithotrophicus]       155   2e-42
ref|WP_028835586.1|  MULTISPECIES: deacetylase [Pseudoalteromo...    155   3e-42
dbj|BAP56211.1|  deacetylase [Thioploca ingrica]                     155   3e-42
emb|CDX34800.1|  conserved hypothetical protein [Mesorhizobium...    156   3e-42
ref|WP_013442298.1|  deacetylase [Methylovorus sp. MP688]            155   3e-42
ref|WP_029060127.1|  acetoin utilization protein [Stappia stel...    155   3e-42
ref|WP_029772755.1|  deacetylase [Pseudoalteromonas sp. TB51]        155   3e-42
ref|WP_014429654.1|  deacetylase [Rubrivivax gelatinosus]            155   3e-42
ref|WP_004588637.1|  histone deacetylase [Pseudoalteromonas ag...    154   4e-42
ref|WP_008192575.1|  acetoin utilization protein [Labrenzia al...    155   4e-42
gb|KFB69466.1|  Histone deacetylase-like amidohydrolase [Candi...    155   4e-42
ref|WP_024031421.1|  deacetylase [Pseudoalteromonas sp. NW 4327]     154   4e-42
ref|WP_010658362.1|  acetoin utilization protein [Ochrobactrum...    155   4e-42
ref|WP_025280361.1|  MULTISPECIES: deacetylase [Ectothiorhodos...    154   4e-42
gb|EXI80206.1|  Histone deacetylase-like amidohydrolase [Candi...    154   5e-42
gb|EWM44408.1|  histone deacetylase domain protein [Bordetella...    154   5e-42
ref|WP_010556648.1|  deacetylase [Pseudoalteromonas marina]          154   6e-42
ref|WP_017430387.1|  deacetylase [Halomonas jeotgali]                154   7e-42
ref|WP_011046012.1|  acetoin utilization protein [Ruegeria pom...    154   7e-42
ref|WP_028034262.1|  acetoin utilization protein [Chelativoran...    154   7e-42
ref|WP_013532793.1|  acetoin utilization protein [Mesorhizobiu...    154   8e-42
gb|KFB77204.1|  Histone deacetylase-like amidohydrolase [Candi...    154   8e-42
ref|WP_007229677.1|  deacetylase [marine gamma proteobacterium...    154   8e-42
gb|EWY39790.1|  acetoin utilization protein [Skermanella stibi...    154   8e-42
ref|WP_025603221.1|  acetoin utilization protein [Proteobacter...    154   8e-42
gb|KHF24797.1|  deacetylase [Solemya velum gill symbiont]            154   9e-42
ref|WP_024589058.1|  acetoin utilization protein [Aliihoeflea ...    154   9e-42
ref|WP_028448919.1|  deacetylase [Chitinibacter tainanensis]         153   1e-41
ref|WP_013090132.1|  deacetylase [Burkholderia sp. CCGE1002]         153   1e-41
ref|WP_027035957.1|  acetoin utilization protein [Mesorhizobiu...    153   1e-41
ref|WP_024610495.1|  deacetylase [Pseudoalteromonas haloplanktis]    153   1e-41
ref|WP_026596432.1|  acetoin utilization protein [Methylohalob...    154   1e-41
ref|WP_006786983.1|  deacetylase [Thiorhodospira sibirica]           153   1e-41
ref|WP_027164154.1|  acetoin utilization protein [Mesorhizobiu...    153   1e-41
ref|WP_020288235.1|  histone deacetylase/AcuC/AphA family prot...    153   1e-41
ref|WP_029925576.1|  acetoin utilization protein [Ochrobactrum...    153   1e-41
ref|WP_006160694.1|  MULTISPECIES: acetoin utilization protein...    153   1e-41
ref|WP_024851422.1|  hypothetical protein [Thiomicrospira kuen...    153   1e-41
ref|WP_024503603.1|  acetoin utilization protein [Mesorhizobiu...    153   1e-41
ref|WP_012734961.1|  deacetylase [Burkholderia glumae]               153   1e-41
ref|WP_023716906.1|  acetoin utilization protein [Mesorhizobiu...    153   1e-41
ref|WP_004683070.1|  acetoin utilization protein [Brucella mel...    153   1e-41
ref|WP_032450054.1|  acetoin utilization protein [Brucella sp....    153   1e-41
ref|WP_004685460.1|  MULTISPECIES: acetoin utilization protein...    153   1e-41
ref|WP_026228729.1|  deacetylase [Burkholderia sp. JPY251]           153   2e-41
ref|WP_027230083.1|  acetoin utilization protein [Phyllobacter...    153   2e-41
ref|WP_011902355.1|  deacetylase [Polynucleobacter necessarius]      153   2e-41
ref|WP_020038841.1|  acetoin utilization protein [Salipiger mu...    153   2e-41
ref|WP_029718625.1|  deacetylase [Rubrivivax benzoatilyticus]        153   2e-41
gb|ENT11597.1|  hypothetical protein C983_00379 [Brucella sp. ...    153   2e-41
ref|WP_005969822.1|  MULTISPECIES: acetoin utilization protein...    153   2e-41
ref|WP_008235608.1|  acetoin utilization protein [Roseobacter ...    152   2e-41
gb|KFJ37298.1|  histone deacetylase domain protein [Neisseria ...    154   2e-41
ref|WP_003713513.1|  deacetylase [Neisseria lactamica]               154   2e-41
gb|EFG37396.1|  acetylspermidine deacetylase [Brucella sp. NVS...    153   2e-41
ref|WP_012589884.1|  acetoin utilization protein [Methylocella...    152   2e-41
ref|WP_021102551.1|  Acetylspermidine deacetylase [Thalassobac...    152   2e-41
ref|WP_008209588.1|  acetoin utilization protein [Roseobacter ...    153   2e-41
ref|WP_021031365.1|  lipase protein [Salinisphaera shabanensis]      152   2e-41
ref|WP_027022958.1|  acetoin utilization protein [Mesorhizobiu...    152   2e-41
ref|WP_009806547.1|  acetoin utilization protein [Oceanicola b...    152   2e-41
ref|WP_006641656.1|  acetoin utilization protein [Brucella pin...    153   2e-41
ref|WP_002967443.1|  MULTISPECIES: acetoin utilization protein...    153   3e-41
ref|WP_015815341.1|  deacetylase [Neisseria meningitidis]            154   3e-41
ref|WP_004690599.1|  acetoin utilization protein [Brucella suis]     153   3e-41
ref|WP_012113175.1|  acetoin utilization protein [Xanthobacter...    152   3e-41
ref|WP_028036209.1|  histone deacetylase [Candidatus Pelagibac...    152   3e-41
ref|WP_013449363.1|  deacetylase [Neisseria lactamica]               154   3e-41
ref|WP_015280720.1|  deacetylase [Thioflavicoccus mobilis]           152   3e-41
ref|WP_029167345.1|  histone deacetylase [alpha proteobacteriu...    152   3e-41
ref|WP_002227552.1|  deacetylase [Neisseria meningitidis]            154   3e-41
ref|WP_008128740.1|  deacetylase [Pseudoalteromonas sp. BSi20480]    152   3e-41
emb|CCA45250.1|  histone deacetylase 1 HD1 [Neisseria meningit...    154   3e-41
ref|WP_024600162.1|  deacetylase [Pseudoalteromonas haloplanktis]    152   3e-41
ref|WP_010362817.1|  deacetylase [Pseudoalteromonas citrea]          152   3e-41
ref|WP_008281227.1|  acetoin utilization protein [Roseovarius ...    152   3e-41
ref|WP_010607181.1|  deacetylase [Pseudoalteromonas flavipulchra]    152   3e-41
ref|WP_002234695.1|  deacetylase [Neisseria meningitidis]            153   4e-41
ref|WP_002229152.1|  histone deacetylase family protein [Neiss...    153   4e-41
ref|WP_013249736.1|  histone deacetylase [Candidatus Nitrospir...    152   4e-41
ref|WP_008136911.1|  deacetylase [Pseudoalteromonas sp. BSi20495]    152   4e-41
ref|WP_006933522.1|  acetoin utilization protein [Labrenzia ag...    152   4e-41
ref|WP_004179904.1|  Deacetylases, including yeast histone dea...    152   4e-41
ref|WP_023759112.1|  acetoin utilization protein [Mesorhizobiu...    152   4e-41
ref|WP_026059947.1|  acetoin utilization protein [Pseudaminoba...    152   4e-41
ref|WP_007586510.1|  deacetylase [Pseudoalteromonas sp. BSi20429]    152   4e-41
gb|EXL07125.1|  acetoin utilization protein [Ochrobactrum anth...    152   4e-41
ref|WP_029609300.1|  deacetylase [Neisseria lactamica]               153   4e-41
ref|WP_024590604.1|  MULTISPECIES: deacetylase [Pseudoalteromo...    152   4e-41
ref|WP_010553374.1|  deacetylase [Pseudoalteromonas arctica]         152   4e-41
ref|WP_008171068.1|  deacetylase [Pseudoalteromonas sp. BSi20652]    152   5e-41
gb|KDR37343.1|  deacetylase [Burkholderia grimmiae]                  152   5e-41
ref|WP_008872623.1|  hypothetical protein [Mesorhizobium metal...    152   5e-41
gb|KFF49175.1|  deacetylase [Gammaproteobacteria bacterium MFB...    152   5e-41
ref|WP_013270204.1|  acetoin utilization protein [Brevundimona...    151   5e-41
ref|WP_006204316.1|  acetoin utilization protein [Mesorhizobiu...    151   5e-41
ref|WP_009810379.1|  acetoin utilization protein [Roseobacter ...    151   5e-41
ref|WP_024597547.1|  deacetylase [Pseudoalteromonas haloplanktis]    151   6e-41
gb|AIK44578.1|  histone deacetylase domain protein [Ochrobactr...    152   6e-41
gb|KDR89631.1|  acetoin utilization protein [Agrobacterium tum...    151   6e-41
ref|WP_007376014.1|  MULTISPECIES: histone deacetylase superfa...    151   6e-41
ref|WP_031361037.1|  deacetylase [Burkholderia sordidicola]          151   6e-41
ref|WP_028354220.1|  deacetylase [Bordetella petrii]                 151   6e-41
ref|WP_009174738.1|  deacetylase [Neisseria sp. oral taxon 014]      153   6e-41
ref|WP_018304626.1|  hypothetical protein [Wenxinia marina]          151   6e-41
emb|CDX28841.1|  conserved hypothetical protein [Mesorhizobium...    153   7e-41
ref|WP_005607817.1|  histone deacetylase superfamily protein [...    151   7e-41
ref|WP_008935402.1|  MULTISPECIES: acetoin utilization protein...    151   7e-41
ref|WP_027058199.1|  acetoin utilization protein [Mesorhizobiu...    151   7e-41
ref|WP_023674116.1|  acetoin utilization protein [Mesorhizobiu...    151   8e-41
ref|WP_002975845.1|  acetoin utilization protein [Brucella abo...    151   8e-41
ref|WP_009210629.1|  acetoin utilization protein [Aurantimonas...    151   8e-41
ref|WP_018882631.1|  MULTISPECIES: hypothetical protein [Thioa...    151   9e-41
ref|WP_002968704.1|  MULTISPECIES: acetoin utilization protein...    151   9e-41
ref|WP_002241238.1|  deacetylase [Neisseria meningitidis]            152   9e-41
gb|EXL10182.1|  acetoin utilization protein [Aquamicrobium def...    151   9e-41
ref|WP_018239004.1|  acetoin utilization protein [Ensifer sp. ...    151   9e-41
ref|WP_007009834.1|  acetoin utilization protein [Nitratireduc...    151   9e-41
ref|WP_027164645.1|  acetoin utilization protein [Mesorhizobiu...    151   9e-41
ref|WP_008250322.1|  deacetylase [Limnobacter sp. MED105]            151   1e-40
ref|WP_014315825.1|  acetoin utilization protein [Brucella abo...    151   1e-40
ref|WP_018439088.1|  deacetylase [Burkholderia sp. JPY347]           150   1e-40
ref|WP_028791707.1|  acetoin utilization protein [Thalassospir...    150   1e-40
ref|WP_010105511.1|  deacetylase [Burkholderia oklahomensis]         150   1e-40
gb|EXI77625.1|  Histone deacetylase-like amidohydrolase [Candi...    150   1e-40
ref|WP_010374136.1|  deacetylase [Pseudoalteromonas piscicida]       150   1e-40
gb|EUA44530.1|  histone deacetylase domain protein [Mycobacter...    151   1e-40
emb|CDX46015.1|  conserved hypothetical protein [Mesorhizobium...    153   1e-40
ref|WP_021076751.1|  branched-chain amino acid transport syste...    150   1e-40
ref|WP_024326151.1|  deacetylase [Thioalkalivibrio sp. AKL19]        151   1e-40
emb|CDX55464.1|  conserved hypothetical protein [Mesorhizobium...    153   1e-40
gb|ETW12381.1|  histone deacetylase [Roseivivax sp. 22II-s10s]       150   1e-40
ref|WP_007151673.1|  deacetylase [Marinobacter algicola]             150   1e-40
ref|WP_002242394.1|  deacetylase [Neisseria meningitidis]            152   1e-40
ref|WP_008508219.1|  acetoin utilization protein [Brucella ino...    150   1e-40
ref|WP_025040038.1|  deacetylase [Nitrosospira briensis]             150   1e-40
ref|WP_012090814.1|  acetoin utilization protein [Ochrobactrum...    150   1e-40
ref|WP_024605483.1|  deacetylase [Pseudoalteromonas haloplanktis]    150   1e-40
gb|KEC81345.1|  histone deacetylase superfamily protein [Sinor...    150   1e-40
ref|WP_006309799.1|  acetoin utilization protein [Agrobacteriu...    150   1e-40
ref|WP_009456002.1|  histone deacetylase family protein [Alcal...    150   1e-40
ref|WP_003799163.1|  deacetylase [Alcaligenes faecalis]              150   1e-40
ref|WP_002253637.1|  histone deacetylase domain protein [Neiss...    152   1e-40
ref|WP_018866125.1|  MULTISPECIES: hypothetical protein [Thioa...    150   1e-40
ref|WP_002232115.1|  deacetylase [Neisseria meningitidis]            152   1e-40
gb|EGC50616.1|  histone deacetylase family protein [Neisseria ...    149   1e-40
ref|WP_002253859.1|  histone deacetylase domain protein [Neiss...    152   1e-40
gb|ERP88456.1|  acetoin utilization protein [Labrenzia sp. C1B10]    150   1e-40
ref|WP_027041448.1|  acetoin utilization protein [Mesorhizobiu...    150   2e-40
gb|KGD86066.1|  acetoin utilization protein [Rhizobium sp. YS-1r]    150   2e-40
ref|WP_031269678.1|  MULTISPECIES: acetoin utilization protein...    150   2e-40
ref|WP_002246033.1|  deacetylase [Neisseria meningitidis]            152   2e-40
ref|WP_019584085.1|  hypothetical protein [Thioalkalivibrio sp...    150   2e-40
ref|WP_002963587.1|  acetoin utilization protein [Brucella abo...    151   2e-40
ref|WP_002238854.1|  deacetylase [Neisseria meningitidis]            152   2e-40
ref|WP_002257121.1|  histone deacetylase domain protein [Neiss...    152   2e-40
ref|WP_027034214.1|  acetoin utilization protein [Mesorhizobiu...    150   2e-40
ref|WP_002248489.1|  histone deacetylase domain protein [Neiss...    152   2e-40
ref|WP_017218463.1|  deacetylase [Pseudoalteromonas sp. NJ631]       150   2e-40
ref|WP_002219657.1|  deacetylase [Neisseria meningitidis]            151   2e-40
ref|WP_028310310.1|  deacetylase [Derxia gummosa]                    150   2e-40
ref|WP_002222843.1|  deacetylase [Neisseria meningitidis]            151   2e-40
emb|CDX42114.1|  conserved hypothetical protein [Mesorhizobium...    150   2e-40
ref|WP_006330578.1|  hypothetical protein [Mesorhizobium sp. S...    150   2e-40
gb|KGW26025.1|  histone deacetylase domain protein [Burkholder...    150   2e-40
ref|WP_020010589.1|  MULTISPECIES: acetoin utilization protein...    150   2e-40
ref|WP_004688035.1|  acetoin utilization protein [Brucella neo...    150   2e-40
gb|KGE07705.1|  deacetylase [Burkholderia gladioli]                  150   2e-40
ref|WP_023649092.1|  histone deacetylase [Candidatus Pelagibac...    150   2e-40
ref|WP_028484855.1|  deacetylase [Thioalkalivibrio sp. ALE17]        150   2e-40
ref|WP_010971118.1|  acetoin utilization protein [Agrobacteriu...    150   2e-40
ref|WP_006025725.1|  deacetylase [Burkholderia thailandensis]        150   2e-40
ref|WP_004544116.1|  deacetylase [Burkholderia pseudomallei]         150   2e-40
ref|WP_002957812.1|  deacetylase [Pseudoalteromonas haloplanktis]    150   2e-40
ref|WP_002240364.1|  deacetylase [Neisseria meningitidis]            151   2e-40
ref|WP_024870301.1|  acetoin utilization protein [Pseudoxantho...    150   3e-40
ref|WP_028919149.1|  acetoin utilization protein [Pseudoxantho...    149   3e-40
emb|CDQ36180.1|  Histone deacetylase-like amidohydrolase [Virg...    150   3e-40
ref|WP_027262793.1|  acetoin utilization protein [Leisingera n...    150   3e-40
ref|WP_004283287.1|  deacetylase [Neisseria weaveri]                 150   3e-40
ref|WP_018389015.1|  MULTISPECIES: acetoin utilization protein...    150   3e-40
ref|WP_010981129.1|  deacetylase [Neisseria meningitidis]            151   3e-40
ref|WP_006992420.1|  histone deacetylase 14 [Glaciecola mesoph...    149   3e-40
ref|WP_013213116.1|  deacetylase [Ralstonia solanacearum]            149   3e-40
ref|WP_002244893.1|  histone deacetylase domain protein [Neiss...    150   3e-40
ref|WP_029016121.1|  histone deacetylase [alpha proteobacteriu...    149   3e-40
ref|WP_009465622.1|  acetoin utilization protein [Roseibium sp...    149   3e-40
emb|CDX18305.1|  conserved hypothetical protein [Mesorhizobium...    149   3e-40
ref|WP_033187531.1|  deacetylase [Pseudoalteromonas sp. PLSV]        149   3e-40
ref|WP_028475553.1|  deacetylase [Nevskia ramosa]                    149   3e-40
ref|WP_009345945.1|  deacetylase [Neisseria meningitidis]            151   3e-40
ref|WP_028303502.1|  deacetylase [Oceanospirillum maris]             149   4e-40
gb|KGC28762.1|  histone deacetylase domain protein [Burkholder...    149   4e-40
emb|CBX30025.1|  hypothetical protein N47_D28340 [uncultured D...    150   4e-40
ref|WP_004188957.1|  MULTISPECIES: deacetylase [pseudomallei g...    149   4e-40
ref|WP_026757305.1|  acetoin utilization protein [Sediminimona...    149   4e-40
gb|KGX07621.1|  histone deacetylase domain protein [Burkholder...    149   4e-40
gb|EFM04009.1|  histone deacetylase family [Neisseria meningit...    151   4e-40
ref|WP_004629176.1|  deacetylase, histone deacetylase/acetoin ...    149   4e-40
ref|WP_004533906.1|  deacetylase [Burkholderia pseudomallei]         149   4e-40
ref|WP_013697009.1|  MULTISPECIES: deacetylase [Burkholderia]        149   4e-40
ref|WP_014761383.1|  acetoin utilization protein [Sinorhizobiu...    149   4e-40
ref|WP_007042182.1|  deacetylase [Thiorhodococcus drewsii]           149   4e-40
ref|WP_018232894.1|  deacetylase [Thioalkalivibrio thiocyanode...    149   4e-40
ref|WP_013169191.1|  acetoin utilization protein [Starkeya nov...    149   4e-40
ref|WP_006109071.1|  hypothetical protein [Brucella abortus]         149   4e-40
gb|KGS55706.1|  histone deacetylase domain protein [Burkholder...    149   4e-40
ref|WP_009889864.1|  deacetylase [Burkholderia thailandensis]        149   4e-40
ref|WP_004522362.1|  deacetylase [Burkholderia pseudomallei]         149   4e-40
gb|EWH06475.1|  deacetylase [Pseudoalteromonas lipolytica SCSI...    149   4e-40
ref|WP_006106378.1|  hypothetical protein [Brucella abortus]         149   4e-40
gb|EXI75630.1|  Histone deacetylase-like amidohydrolase [Candi...    149   4e-40
ref|WP_004285540.1|  deacetylase [Neisseria weaveri]                 151   4e-40
ref|WP_029355589.1|  acetoin utilization protein [Mesorhizobiu...    149   5e-40
ref|WP_027537701.1|  acetoin utilization protein [Bradyrhizobi...    149   5e-40
emb|CBA07190.1|  histone deacetylase family protein [Neisseria...    150   5e-40
gb|EXJ14718.1|  Deacetylase [Thiorhodococcus sp. AK35]               149   5e-40
ref|WP_006017216.1|  acetoin utilization protein [Brucella ovis]     149   5e-40
ref|WP_029417937.1|  acetoin utilization protein [Brevundimona...    149   6e-40
ref|WP_018877598.1|  hypothetical protein [Thioalkalivibrio sp...    149   6e-40
ref|WP_002259615.1|  histone deacetylase domain protein [Neiss...    150   6e-40
gb|KGS09826.1|  histone deacetylase domain protein [Burkholder...    149   6e-40
ref|WP_031254972.1|  acetoin utilization protein [Mesorhizobiu...    149   6e-40
ref|WP_002237764.1|  deacetylase [Neisseria meningitidis]            150   6e-40
ref|WP_012221374.1|  deacetylase [Neisseria meningitidis]            150   6e-40
ref|WP_016670647.1|  histone deacetylase domain protein [Neiss...    150   6e-40
gb|ENR06419.1|  hypothetical protein C010_00425 [Brucella ovis...    149   6e-40
ref|WP_002230342.1|  histone deacetylase family protein [Neiss...    150   6e-40
ref|WP_018076356.1|  deacetylase [Thiobacillus denitrificans]        149   7e-40
ref|WP_005007730.1|  putative Deacetylase, histone deacetylase...    149   7e-40
dbj|BAO82837.1|  deacetylase, including yeast histone deacetyl...    149   7e-40
gb|EUA42297.1|  histone deacetylase domain protein [Mycobacter...    149   7e-40
ref|WP_029769637.1|  deacetylase [Neisseria meningitidis]            150   7e-40
gb|AHF04471.1|  deacetylase [Marichromatium purpuratum 984]          149   7e-40
ref|WP_002221334.1|  deacetylase [Neisseria meningitidis]            150   7e-40
gb|KGJ12373.1|  acetoin utilization protein [Paracoccus versutus]    149   7e-40
ref|WP_003268937.1|  deacetylase [Ralstonia solanacearum]            149   7e-40
ref|WP_008595369.1|  acetoin utilization protein [Nitratireduc...    149   7e-40
ref|WP_025456897.1|  deacetylase [Neisseria polysaccharea]           150   7e-40
ref|WP_003521079.1|  deacetylase [Agrobacterium tumefaciens]         149   7e-40
gb|ESZ19420.1|  acetoin utilization protein [Mesorhizobium sp....    149   7e-40
ref|WP_017201091.1|  deacetylase [Neisseria meningitidis]            150   7e-40
ref|WP_028371043.1|  deacetylase [Burkholderia sp. UYPR1.413]        148   8e-40
ref|WP_025457911.1|  deacetylase [Neisseria polysaccharea]           150   8e-40
ref|WP_008330744.1|  deacetylase [Maritimibacter alkaliphilus]       148   8e-40
ref|WP_011580075.1|  acetoin utilization protein [Chelativoran...    148   8e-40
ref|WP_008933093.1|  deacetylase [Ectothiorhodospira sp. PHS-1]      149   8e-40
ref|WP_003776571.1|  deacetylase [Neisseria macacae]                 149   8e-40
ref|WP_003921139.1|  histone deacetylase superfamily protein [...    149   9e-40
ref|WP_027053428.1|  acetoin utilization protein [Mesorhizobiu...    148   9e-40
ref|WP_014192029.1|  deacetylase [Burkholderia sp. YI23]             148   9e-40
ref|WP_011746744.1|  acetoin utilization protein [Paracoccus d...    149   9e-40
ref|WP_006470663.1|  histone deacetylase superfamily protein [...    148   9e-40
ref|WP_018421361.1|  deacetylase [Burkholderia sp. WSM4176]          148   9e-40
ref|WP_024349977.1|  acetoin utilization protein [Aurantimonas...    148   1e-39
ref|WP_008187007.1|  acetoin utilization protein [Rhodobactera...    148   1e-39
ref|WP_021586144.1|  acetoin utilization protein [Ochrobactrum...    148   1e-39
ref|WP_026044910.1|  deacetylase [Burkholderia pyrrocinia]           148   1e-39
ref|WP_003494204.1|  acetoin utilization protein [Agrobacteriu...    148   1e-39
ref|WP_006173792.1|  MULTISPECIES: hypothetical protein [Bruce...    148   1e-39
ref|WP_026199679.1|  deacetylase [Lamprocystis purpurea]             148   1e-39
ref|WP_009238643.1|  MULTISPECIES: deacetylase [Ralstonia]           148   1e-39
ref|WP_024926690.1|  MULTISPECIES: acetoin utilization protein...    148   1e-39
ref|WP_006466193.1|  acetoin utilization protein [Ochrobactrum...    148   1e-39
ref|WP_029000877.1|  deacetylase [Azohydromonas australica]          148   1e-39
ref|WP_024279963.1|  acetoin utilization protein [Xanthobacter...    148   1e-39
ref|WP_009364640.1|  acetoin utilization protein [Brucella sp....    148   1e-39
ref|WP_016913859.1|  hypothetical protein [Halomonas stevensii]      146   1e-39
ref|WP_019641596.1|  hypothetical protein [Thioalkalivibrio sp...    148   1e-39
emb|CCA85833.1|  putative enzyme, Histone deacetylase superfam...    148   1e-39
ref|WP_018330120.1|  acetoin utilization protein [Rhizobium gi...    148   1e-39
ref|WP_014617549.1|  deacetylase [Ralstonia solanacearum]            148   1e-39
gb|KDP72097.1|  acetoin utilization protein [Ensifer adhaerens]      148   1e-39
emb|CBA09794.1|  histone deacetylase family protein [Neisseria...    149   1e-39
ref|WP_008342364.1|  MULTISPECIES: deacetylase [Burkholderia]        148   1e-39
ref|WP_024580661.1|  acetoin utilization protein [Bradyrhizobi...    148   1e-39
gb|KAK46163.1|  deacetylase [Burkholderia sp. MP-1]                  148   1e-39
ref|WP_012435145.1|  MULTISPECIES: deacetylase [Betaproteobact...    147   2e-39
gb|ETY81388.1|  Deacetylase [Burkholderia caribensis MBA4]           147   2e-39
ref|WP_024973157.1|  deacetylase [Ralstonia pickettii]               147   2e-39
ref|WP_009177755.1|  acetoin utilization protein [Silicibacter...    147   2e-39
ref|WP_003765735.1|  deacetylase [Neisseria sicca]                   149   2e-39
ref|WP_017971000.1|  hypothetical protein [alpha proteobacteri...    147   2e-39
ref|WP_011489470.1|  deacetylase [Burkholderia xenovorans]           148   2e-39
gb|KAJ34602.1|  acetoin utilization protein [Agrobacterium tum...    147   2e-39
gb|KGW64620.1|  histone deacetylase domain protein [Burkholder...    147   2e-39
ref|WP_016345959.1|  putative histone deacetylase-family prote...    147   2e-39
ref|WP_011540236.1|  acetoin utilization protein [Ruegeria sp....    147   2e-39
ref|WP_031433821.1|  acetoin utilization protein [Methylomarin...    147   2e-39
ref|WP_015497463.1|  acetoin utilization protein [Octadecabact...    147   2e-39
gb|EEX90098.1|  histone deacetylase [Brucella ceti M13/05/1]         148   2e-39
ref|WP_007757489.1|  acetoin utilization protein [Rhizobium sp...    147   2e-39
ref|WP_002226591.1|  deacetylase [Neisseria meningitidis]            149   2e-39
ref|WP_009521839.1|  deacetylase [Ralstonia sp. PBA]                 147   2e-39
ref|WP_017943937.1|  hypothetical protein [alpha proteobacteri...    147   2e-39
ref|WP_024810383.1|  acetoin utilization protein [Oceanicola s...    147   2e-39
ref|WP_015259660.1|  Deacetylase, including histone deacetylas...    147   2e-39
ref|WP_020831504.1|  Deacetylase [Ralstonia solanacearum]            147   2e-39
ref|WP_026355386.1|  acetoin utilization protein [Pannonibacte...    147   2e-39
ref|WP_027198425.1|  deacetylase [Burkholderia sprentiae]            147   3e-39
ref|WP_011000871.1|  deacetylase [Ralstonia solanacearum]            147   3e-39
ref|WP_029557645.1|  acetoin utilization protein [Xanthobacter...    147   3e-39
ref|WP_007644107.1|  deacetylase [Cellvibrio sp. BR]                 147   3e-39
ref|WP_029207156.1|  histone deacetylase [alpha proteobacteriu...    147   3e-39
ref|WP_012400165.1|  deacetylase [Burkholderia phymatum]             147   3e-39
ref|WP_016687695.1|  deacetylase [Neisseria sicca]                   148   3e-39
gb|KDR40425.1|  deacetylase [Burkholderia glathei]                   147   3e-39
ref|WP_027288585.1|  acetoin utilization protein [Rhodovibrio ...    147   3e-39
ref|WP_026111253.1|  hypothetical protein [Pseudoalteromonas r...    144   3e-39
ref|WP_024092217.1|  acetoin utilization protein [Leisingera m...    147   3e-39
ref|WP_018264216.1|  acetoin utilization protein [Methylosinus...    147   3e-39
ref|WP_007180898.1|  deacetylase [Burkholderia sp. Ch1-1]            147   3e-39
ref|WP_019918239.1|  MULTISPECIES: hypothetical protein [Rhodo...    147   3e-39
emb|CDN91645.1|  Acetylspermidine deacetylase [Agrobacterium t...    147   3e-39
ref|WP_007576463.1|  deacetylase [Burkholderia terrae]               147   4e-39
ref|WP_006699885.1|  MULTISPECIES: acetoin utilization protein...    147   4e-39
ref|WP_026381164.1|  acetoin utilization protein [Afifella pfe...    147   4e-39
ref|WP_029205906.1|  histone deacetylase [alpha proteobacteriu...    147   4e-39
ref|WP_023494582.1|  histone deacetylase superfamily [Methylog...    147   4e-39
ref|WP_020564236.1|  hypothetical protein [Methylosarcina fibr...    147   4e-39
gb|KGB83288.1|  acetoin utilization protein [Rhodovulum sp. NI22]    147   4e-39
ref|WP_008032980.1|  acetoin utilization protein [Rhodobacter ...    147   4e-39
ref|WP_006406237.1|  deacetylase [Burkholderia multivorans]          146   4e-39
ref|WP_006400715.1|  deacetylase [Burkholderia multivorans]          146   4e-39
ref|WP_006413194.1|  deacetylase [Burkholderia multivorans]          146   5e-39
ref|WP_015501817.1|  acetoin utilization protein [Octadecabact...    146   5e-39
ref|WP_028716191.1|  acetoin utilization protein [Paracoccus s...    146   5e-39
ref|WP_024845363.1|  acetoin utilization protein [Paracoccus p...    146   5e-39
emb|CDM23912.1|  Deacetylases [Castellaniella defragrans 65Phen]     146   5e-39
ref|WP_023806741.1|  acetoin utilization protein [Mesorhizobiu...    146   5e-39
ref|WP_027507739.1|  acetoin utilization protein [Rhizobium su...    146   5e-39
gb|AAR37581.1|  histone deacetylase family protein [uncultured...    146   5e-39
dbj|GAK71840.1|  hypothetical protein RRU01S_20_01010 [Rhizobi...    146   5e-39
ref|WP_026618515.1|  acetoin utilization protein [Sinorhizobiu...    146   5e-39
ref|WP_031446929.1|  acetoin utilization protein [Caulobactera...    146   5e-39
ref|WP_026253761.1|  deacetylase [Oligella ureolytica]               146   5e-39
ref|WP_029250044.1|  deacetylase [Microbulbifer agarilyticus]        146   6e-39
gb|ADI18806.1|  deacetylases, including yeast histone deacetyl...    146   6e-39
gb|AIP31427.1|  histone deacetylase domain protein [Burkholder...    146   6e-39
ref|WP_007068786.1|  acetoin utilization protein [Fulvimarina ...    146   6e-39
ref|WP_003760864.1|  deacetylase [Neisseria sicca]                   147   6e-39
ref|WP_011453217.1|  acetoin utilization protein [Jannaschia s...    146   6e-39
gb|KFB10767.1|  Histone deacetylase superfamily protein [Nitra...    146   6e-39
ref|WP_028444861.1|  deacetylase [Chitinimonas koreensis]            146   6e-39
ref|WP_027529016.1|  acetoin utilization protein [Bradyrhizobi...    146   6e-39
ref|WP_013635598.1|  acetoin utilization protein [Agrobacteriu...    146   6e-39
ref|WP_020164731.1|  hypothetical protein [Methyloversatilis u...    146   7e-39
gb|KCV82379.1|  histone deacetylase family protein [Actibacter...    146   7e-39
ref|WP_023772932.1|  MULTISPECIES: acetoin utilization protein...    146   7e-39
ref|WP_028334493.1|  acetoin utilization protein [Bradyrhizobi...    146   7e-39
ref|WP_024878817.1|  MULTISPECIES: acetoin utilization protein...    146   7e-39
ref|WP_018270363.1|  acetoin utilization protein [Bradyrhizobi...    146   7e-39
ref|WP_024976258.1|  deacetylase [Ralstonia pickettii]               146   7e-39
ref|WP_003511750.1|  MULTISPECIES: acetoin utilization protein...    146   7e-39
ref|WP_009311080.1|  deacetylase [Neisseria sp. GT4A_CT1]            147   7e-39
ref|WP_008972088.1|  acetoin utilization protein [Bradyrhizobi...    146   7e-39
ref|WP_021195505.1|  deacetylase [Ralstonia sp. AU12-08]             146   8e-39
ref|WP_029168396.1|  histone deacetylase [alpha proteobacteriu...    146   8e-39
ref|WP_028339499.1|  acetoin utilization protein [Bradyrhizobi...    146   8e-39
ref|WP_028713322.1|  acetoin utilization protein [Paracoccus s...    145   8e-39
ref|WP_008390306.1|  acetoin utilization protein [Rhodovulum s...    146   8e-39
ref|WP_009830349.1|  acetoin utilization protein [Rhodobactera...    146   8e-39
ref|WP_029372416.1|  acetoin utilization protein [Paracoccus s...    145   8e-39
ref|WP_025282890.1|  MULTISPECIES: deacetylase [Ectothiorhodos...    146   9e-39
ref|WP_011800628.1|  deacetylase [Polaromonas naphthalenivorans]     146   9e-39
ref|WP_020044505.1|  hypothetical protein [alpha proteobacteri...    145   9e-39
ref|WP_009858194.1|  deacetylase [Rubrivivax benzoatilyticus]        145   1e-38
ref|WP_025603072.1|  deacetylase [Burkholderia sp. WSM2230]          145   1e-38
ref|WP_013148344.1|  deacetylase [Methylotenera versatilis]          145   1e-38
ref|WP_027795331.1|  deacetylase [Burkholderia acidipaludis]         145   1e-38
ref|WP_010561037.1|  deacetylase [Pseudoalteromonas spongiae]        145   1e-38
ref|WP_027526546.1|  acetoin utilization protein [Bradyrhizobi...    145   1e-38
emb|CDN46711.1|  Histone deacetylase family protein [Rhizobium...    145   1e-38
ref|WP_006050264.1|  MULTISPECIES: deacetylase [Burkholderia]        145   1e-38
ref|WP_027152344.1|  acetoin utilization protein [Mesorhizobiu...    145   1e-38
ref|WP_018139327.1|  MULTISPECIES: deacetylase [Thioalkalivibrio]    145   1e-38
ref|WP_029909682.1|  hypothetical protein [Hydrogenovibrio mar...    145   1e-38
ref|WP_011380890.1|  deacetylase [Nitrosospira multiformis]          145   1e-38
ref|WP_006225136.1|  deacetylase [Achromobacter piechaudii]          145   1e-38
ref|WP_027213526.1|  deacetylase [Burkholderia sp. WSM2232]          145   1e-38
ref|WP_028158054.1|  acetoin utilization protein [Bradyrhizobi...    145   1e-38
ref|WP_023747548.1|  MULTISPECIES: acetoin utilization protein...    145   1e-38
ref|WP_015318809.1|  acetoin utilization protein [Mesorhizobiu...    145   1e-38
ref|WP_014497195.1|  acetoin utilization protein [Bradyrhizobi...    145   1e-38
ref|WP_013340130.1|  deacetylase [Burkholderia sp. CCGE1003]         145   1e-38
ref|WP_023827473.1|  acetoin utilization protein [Mesorhizobiu...    145   1e-38
ref|WP_023830289.1|  acetoin utilization protein [Mesorhizobiu...    145   2e-38
ref|WP_029081381.1|  acetoin utilization protein [Bradyrhizobi...    145   2e-38
ref|WP_023702021.1|  acetoin utilization protein [Mesorhizobiu...    145   2e-38
ref|WP_028200070.1|  MULTISPECIES: deacetylase [Burkholderia]        145   2e-38
ref|WP_029455723.1|  histone deacetylase [Candidatus Pelagibac...    145   2e-38
ref|WP_028168307.1|  acetoin utilization protein [Bradyrhizobi...    145   2e-38
gb|AHK00608.1|  acetylspermidine deacetylase [Agrobacterium tu...    145   2e-38
gb|KEQ09217.1|  acetoin utilization protein [Rhizobium sp. R1-...    145   2e-38
ref|WP_007196473.1|  acetoin utilization protein [Hoeflea phot...    145   2e-38
ref|WP_011828845.1|  deacetylase [Methylibium petroleiphilum]        145   2e-38
ref|WP_023687140.1|  acetoin utilization protein [Mesorhizobiu...    145   2e-38
ref|WP_003740781.1|  deacetylase [Neisseria mucosa]                  146   2e-38
ref|WP_025140175.1|  deacetylase [Alcaligenes sp. DH1f]              145   2e-38
ref|WP_002243622.1|  deacetylase [Neisseria meningitidis]            146   2e-38
ref|WP_014581840.1|  deacetylase [Neisseria meningitidis]            146   2e-38
ref|WP_023685412.1|  MULTISPECIES: acetoin utilization protein...    145   2e-38
ref|WP_012433964.1|  deacetylase [Burkholderia phytofirmans]         145   2e-38
ref|WP_009838311.1|  deacetylase [Pseudoalteromonas tunicata]        145   2e-38
ref|WP_007662346.1|  acetoin utilization protein [Caulobacter ...    145   2e-38
ref|WP_029617146.1|  acetoin utilization protein [Rhizobium sp...    145   2e-38
ref|WP_027142344.1|  acetoin utilization protein [Mesorhizobiu...    145   2e-38
ref|WP_003614130.1|  acetoin utilization protein [Methylosinus...    145   2e-38
ref|WP_017998657.1|  acetoin utilization protein [Paracoccus s...    144   2e-38
ref|WP_023754097.1|  MULTISPECIES: acetoin utilization protein...    144   2e-38
ref|WP_031402653.1|  deacetylase [Burkholderia sp. MSh1]             144   2e-38
ref|WP_028739841.1|  acetoin utilization protein [Rhizobium mo...    144   2e-38
ref|WP_029207409.1|  histone deacetylase [alpha proteobacteriu...    144   2e-38
gb|KGB98505.1|  histone deacetylase domain protein [Burkholder...    144   3e-38
ref|WP_029308327.1|  deacetylase [Cupriavidus metallidurans]         144   3e-38
ref|WP_008921419.1|  deacetylase [Burkholderia sp. H160]             144   3e-38
ref|WP_012363354.1|  deacetylase [Burkholderia ambifaria]            144   3e-38
ref|WP_020182001.1|  hypothetical protein [Methylotenera sp. 1...    144   3e-38
ref|WP_029563015.1|  histone deacetylase [alpha proteobacteriu...    144   3e-38
ref|WP_027677032.1|  acetoin utilization protein [Agrobacteriu...    144   3e-38
ref|WP_027349153.1|  deacetylase [Halotalea alkalilenta]             145   3e-38
ref|WP_017460201.1|  hypothetical protein [Dyella ginsengisoli]      144   3e-38
ref|WP_029454095.1|  histone deacetylase [Candidatus Pelagibac...    144   3e-38
ref|WP_006750743.1|  deacetylase [Burkholderia ambifaria]            144   3e-38
ref|WP_005371312.1|  acetoin utilization protein [Methylomicro...    143   3e-38
ref|WP_015339026.1|  putative deacetylase [Rhizobium tropici]        144   3e-38
ref|WP_014897718.1|  deacetylase [Burkholderia cepacia]              144   3e-38
ref|WP_003503058.1|  acetoin utilization protein [Agrobacteriu...    144   3e-38
ref|WP_020704659.1|  hypothetical protein [Oxalobacteraceae ba...    144   3e-38
ref|WP_014188037.1|  acetoin utilization protein [Azospirillum...    144   3e-38
ref|WP_023692080.1|  MULTISPECIES: acetoin utilization protein...    144   3e-38
ref|WP_024314258.1|  acetoin utilization protein [Rhizobium sp...    144   3e-38
ref|WP_006486840.1|  deacetylase [Burkholderia cenocepacia]          144   3e-38
ref|WP_029564793.1|  histone deacetylase [alpha proteobacteriu...    144   3e-38
ref|WP_008132966.1|  acetoin utilization protein [Bradyrhizobi...    144   4e-38
ref|WP_006218218.1|  deacetylase [Achromobacter piechaudii]          145   4e-38
gb|KDB02573.1|  acetoin utilization protein [Defluviimonas sp....    144   4e-38
ref|WP_023834473.1|  acetoin utilization protein [Mesorhizobiu...    144   4e-38
ref|WP_006756802.1|  deacetylase [Burkholderia ambifaria]            144   4e-38
ref|WP_027783873.1|  deacetylase [Burkholderia cepacia]              144   4e-38
gb|KGY28681.1|  deacetylase [Achromobacter xylosoxidans]             144   4e-38
ref|WP_011770964.1|  deacetylase [Psychromonas ingrahamii]           144   4e-38
ref|WP_023709876.1|  MULTISPECIES: acetoin utilization protein...    144   4e-38
gb|KDR28638.1|  deacetylase [Burkholderia zhejiangensis]             144   4e-38
gb|KEA60028.1|  deacetylase [Burkholderia cenocepacia]               144   4e-38
gb|KFG69824.1|  acetoin utilization protein [Microvirga sp. BS...    144   4e-38
ref|WP_019270849.1|  deacetylase [Neisseria sicca]                   145   4e-38
emb|CDS52776.1|  Deacetylases, including yeast histone deacety...    144   4e-38
ref|WP_011544892.1|  deacetylase [Burkholderia cenocepacia]          144   4e-38
ref|WP_013215939.1|  histone deacetylase [Hyphomicrobium denit...    144   4e-38
ref|WP_024510347.1|  acetoin utilization protein [Bradyrhizobi...    144   4e-38
gb|AIO40453.1|  histone deacetylase domain protein [Burkholder...    144   4e-38
ref|WP_006476562.1|  deacetylase [Burkholderia cenocepacia]          144   4e-38
ref|WP_023475828.1|  Deacetylase [Burkholderia cenocepacia]          144   4e-38
ref|WP_017232007.1|  deacetylase [Pandoraea sp. B-6]                 144   4e-38
ref|WP_018902056.1|  acetoin utilization protein [Rhizobium sp...    144   4e-38
ref|WP_013392405.1|  deacetylase [Achromobacter xylosoxidans]        144   4e-38
ref|WP_003588155.1|  acetoin utilization protein [Rhizobium le...    144   5e-38
ref|WP_008544711.1|  histone deacetylase [Candidatus Pelagibac...    144   5e-38
ref|WP_031435781.1|  acetoin utilization protein [Methylobacte...    144   5e-38
ref|WP_012503402.1|  deacetylase [Neisseria gonorrhoeae]             145   5e-38
ref|WP_027150409.1|  acetoin utilization protein [Methylobacte...    144   5e-38
gb|KGD97152.1|  deacetylase [Achromobacter sp. RTa]                  144   5e-38
ref|WP_006890091.1|  acetoin utilization protein [Methylobacte...    144   5e-38
ref|WP_003675722.1|  deacetylase [Neisseria cinerea]                 145   5e-38
ref|WP_010356953.1|  deacetylase [Neisseria gonorrhoeae]             145   5e-38
ref|WP_024340267.1|  acetoin utilization protein [Bradyrhizobi...    144   5e-38
ref|WP_012565790.1|  acetoin utilization protein [Rhodospirill...    144   5e-38
ref|WP_015687787.1|  acetoin utilization protein [Bradyrhizobi...    144   6e-38
ref|WP_027677868.1|  deacetylase [Ralstonia sp. UNC404CL21Col]       144   6e-38
ref|WP_025034659.1|  acetoin utilization protein [Bradyrhizobi...    144   6e-38
ref|WP_029041969.1|  acetoin utilization protein [Cucumibacter...    144   6e-38
ref|WP_012824718.1|  deacetylase [Halothiobacillus neapolitanus]     144   6e-38
ref|WP_009764818.1|  acetoin utilization protein [Microvirga l...    144   6e-38
ref|WP_006410075.1|  deacetylase [Burkholderia multivorans]          143   6e-38
ref|WP_013589230.1|  MULTISPECIES: deacetylase [Burkholderia]        143   6e-38
ref|WP_006764855.1|  deacetylase [Burkholderia dolosa]               143   6e-38
ref|WP_023668434.1|  acetoin utilization protein [Mesorhizobiu...    143   6e-38
ref|WP_011909737.1|  acetoin utilization protein [Rhodobacter ...    143   6e-38
ref|WP_012970935.1|  deacetylase [Allochromatium vinosum]            143   7e-38
ref|WP_012975760.1|  acetoin utilization protein [Azospirillum...    143   7e-38
ref|WP_027570995.1|  acetoin utilization protein [Bradyrhizobi...    143   7e-38
ref|WP_028226813.1|  deacetylase [Burkholderia ferrariae]            143   7e-38
ref|WP_015003463.1|  deacetylase [Burkholderia phenoliruptrix]       143   7e-38
ref|WP_017927696.1|  hypothetical protein [Loktanella hongkong...    143   7e-38
ref|WP_015597441.1|  histone deacetylase [Hyphomicrobium denit...    143   7e-38
ref|WP_017926108.1|  deacetylase [Thioalkalivibrio sp. HL-Eb18]      143   7e-38
ref|WP_017970340.1|  hypothetical protein [alpha proteobacteri...    143   7e-38
ref|WP_015668429.1|  putative deacetylase [Bradyrhizobium olig...    143   8e-38
ref|WP_021157450.1|  MULTISPECIES: Deacetylase [Burkholderia c...    143   8e-38
gb|KFL51468.1|  deacetylase [Burkholderia pyrrocinia]                143   8e-38
ref|WP_011351344.1|  deacetylase [Burkholderia lata]                 143   8e-38
ref|WP_007632874.1|  acetoin utilization protein [Rhizobium sp...    143   8e-38
ref|WP_013964833.1|  deacetylase [Nitrosomonas sp. Is79A3]           143   8e-38
ref|WP_027804782.1|  deacetylase [Burkholderia bryophila]            143   8e-38
ref|WP_026640528.1|  deacetylase [Bordetella petrii]                 143   9e-38
emb|CCQ74148.1|  putative histone deacetylase [Magnetospira sp...    143   9e-38
gb|KDB06168.1|  Histone deacetylase domain containing protein ...    143   9e-38
ref|WP_026480160.1|  acetoin utilization protein [Ahrensia sp....    143   9e-38
ref|WP_011424264.1|  acetoin utilization protein [Rhizobium etli]    143   9e-38
ref|WP_027776429.1|  deacetylase [Burkholderia caledonica]           143   9e-38
ref|WP_011883840.1|  MULTISPECIES: deacetylase [Burkholderia]        143   9e-38
ref|WP_026382782.1|  deacetylase [Achromobacter xylosoxidans]        143   9e-38
ref|WP_027558318.1|  MULTISPECIES: acetoin utilization protein...    143   1e-37
ref|WP_018648645.1|  acetoin utilization protein [Bradyrhizobi...    143   1e-37
ref|WP_009758118.1|  acetoin utilization protein [Ahrensia sp....    143   1e-37
gb|KER71243.1|  deacetylase [Burkholderia cepacia]                   143   1e-37
ref|WP_031431526.1|  acetoin utilization protein [Methylomicro...    143   1e-37
ref|WP_010091754.1|  deacetylase [Burkholderia ubonensis]            143   1e-37
ref|WP_027554316.1|  acetoin utilization protein [Bradyrhizobi...    143   1e-37
ref|WP_026612926.1|  acetoin utilization protein [Ensifer sp. ...    143   1e-37
ref|WP_017774593.1|  deacetylase [Burkholderia kururiensis]          143   1e-37
ref|WP_007594645.1|  acetoin utilization protein [Bradyrhizobi...    143   1e-37
ref|WP_023517337.1|  deacetylase, histone deacetylase/acetoin ...    143   1e-37
ref|WP_018456262.1|  MULTISPECIES: acetoin utilization protein...    143   1e-37
ref|WP_008883522.1|  acetoin utilization protein [Citreicella ...    143   1e-37
ref|WP_004110006.1|  hypothetical protein [Rhizobium freirei]        143   1e-37
gb|EJZ32461.1|  hypothetical protein BCCGELA001_19480 [Bradyrh...    142   1e-37
ref|WP_016734609.1|  acetoin utilization protein [Rhizobium ph...    142   1e-37
ref|WP_019464319.1|  acetoin utilization protein [Dyella japon...    142   1e-37
ref|WP_026595698.1|  acetoin utilization protein [Methyloferul...    142   1e-37
ref|WP_020920558.1|  deacetylase protein [Rhizobium etli]            142   1e-37
ref|WP_027516569.1|  acetoin utilization protein [Bradyrhizobi...    142   1e-37
ref|WP_027804012.1|  deacetylase [Burkholderia sp. WSM3556]          142   2e-37
ref|WP_028148181.1|  acetoin utilization protein [Bradyrhizobi...    142   2e-37
ref|WP_007607412.1|  acetoin utilization protein [Bradyrhizobi...    142   2e-37
gb|AHG44313.1|  acetoin utilization protein [Rhizobium legumin...    142   2e-37
ref|WP_031552220.1|  acetoin utilization protein [Parvularcula...    142   2e-37
ref|WP_026224354.1|  deacetylase [Methyloversatilis sp. NVD]         142   2e-37
ref|WP_027546177.1|  acetoin utilization protein [Bradyrhizobi...    142   2e-37
gb|AIY43436.1|  Deacetylase [Collimonas arenae]                      142   2e-37
ref|WP_006611438.1|  acetoin utilization protein [Bradyrhizobi...    142   2e-37
ref|WP_024068179.1|  Deacetylase [Achromobacter xylosoxidans]        142   2e-37
ref|WP_008960177.1|  acetoin utilization protein [Bradyrhizobi...    142   2e-37
ref|WP_011235524.1|  deacetylase [Idiomarina loihiensis]             142   2e-37
gb|AHY52488.1|  hypothetical protein BJS_05950 [Bradyrhizobium...    142   2e-37
ref|WP_008758879.1|  acetoin utilization protein [Rhodobactera...    142   2e-37
ref|WP_016389992.1|  MULTISPECIES: Histone deacetylase superfa...    142   2e-37
ref|WP_018871912.1|  hypothetical protein [Thioalkalivibrio sp...    142   2e-37
ref|WP_006388273.1|  deacetylase [Achromobacter xylosoxidans]        142   2e-37
ref|WP_015421634.1|  histone deacetylase superfamily protein [...    142   2e-37
ref|WP_007793545.1|  acetoin utilization protein [Pelagibaca b...    142   2e-37
ref|WP_026293541.1|  acetoin utilization protein [Rudaea cellu...    142   2e-37
ref|WP_013896674.1|  acetoin utilization protein [Mesorhizobiu...    142   3e-37
ref|WP_007255964.1|  acetoin utilization protein [Oceanicola g...    142   3e-37
ref|WP_009027912.1|  acetoin utilization protein [Bradyrhizobi...    142   3e-37
ref|WP_025224300.1|  deacetylase [Methylophilaceae bacterium 11]     142   3e-37
gb|EGD04754.1|  histone deacetylase superfamily protein [Burkh...    142   3e-37
ref|WP_028180929.1|  acetoin utilization protein [Bradyrhizobi...    142   3e-37
ref|WP_018229311.1|  hypothetical protein [Methyloversatilis u...    142   3e-37
gb|KEO57951.1|  acetoin utilization protein [Thalassospira per...    142   3e-37
ref|WP_024300582.1|  MULTISPECIES: deacetylase [Rhodocyclaceae]      141   3e-37
ref|WP_033910275.1|  deacetylase [Neisseria gonorrhoeae]             143   3e-37
ref|WP_003584657.1|  acetoin utilization protein [Rhizobium le...    142   3e-37
ref|WP_012982753.1|  deacetylase [Thioalkalivibrio sp. K90mix]       141   3e-37
gb|ETX27986.1|  acetoin utilization protein [Roseivivax isopor...    142   3e-37
ref|WP_013742552.1|  deacetylase [Pusillimonas sp. T7-7]             141   4e-37
ref|WP_027157270.1|  acetoin utilization protein [Methylobacte...    142   4e-37
ref|WP_028144213.1|  acetoin utilization protein [Bradyrhizobi...    141   4e-37
emb|CBA28372.1|  hypothetical protein Csp_A06940 [Curvibacter ...    141   4e-37
ref|WP_023597140.1|  MULTISPECIES: deacetylase [Pandoraea]           141   4e-37
emb|CEG60858.1|  Histone deacetylase superfamily [Tatlockia mi...    141   4e-37
ref|WP_026202776.1|  acetoin utilization protein [Bradyrhizobi...    141   4e-37
ref|WP_023764506.1|  acetoin utilization protein [Mesorhizobiu...    141   4e-37
ref|WP_011925233.1|  acetoin utilization protein [Bradyrhizobi...    141   4e-37
ref|WP_024513593.1|  acetoin utilization protein [Bradyrhizobi...    141   4e-37
gb|EYD75205.1|  Acetylspermidine deacetylase, Deacetylase [Rub...    141   4e-37
gb|AIR50593.1|  deacetylase [Achromobacter xylosoxidans C54]         141   4e-37
ref|WP_027467618.1|  deacetylase [Deefgea rivuli]                    141   4e-37
ref|WP_011085438.1|  MULTISPECIES: acetoin utilization protein...    141   5e-37
ref|WP_006019110.1|  MULTISPECIES: hypothetical protein [Afipia]     141   5e-37
ref|WP_007817938.1|  acetoin utilization protein [Rhizobium sp...    141   5e-37
ref|WP_025249639.1|  deacetylase [Pandoraea pnomenusa]               141   5e-37
ref|WP_017523204.1|  hypothetical protein [Pusillimonas noerte...    141   5e-37
ref|WP_029143585.1|  deacetylase [Methyloversatilis universalis]     141   5e-37
gb|AHF82719.1|  acetoin utilization protein [Rhizobium legumin...    141   5e-37
ref|WP_003569905.1|  acetoin utilization protein [Rhizobium le...    141   5e-37
ref|WP_017959231.1|  acetoin utilization protein [Rhizobium le...    141   5e-37
ref|WP_019400614.1|  hypothetical protein [Chelatococcus sp. GW1]    141   5e-37
gb|EEZ43037.1|  histone deacetylase [Neisseria gonorrhoeae 35/02]    142   6e-37
ref|WP_025455770.1|  deacetylase [Neisseria gonorrhoeae]             142   6e-37
ref|WP_028135029.1|  acetoin utilization protein [Bradyrhizobi...    141   6e-37
ref|WP_010804332.1|  acetylspermidine deacetylase [Pandoraea s...    141   6e-37
gb|EEZ49514.1|  histone deacetylase [Neisseria gonorrhoeae PID18]    142   6e-37
ref|WP_018858970.1|  MULTISPECIES: acetoin utilization protein...    141   6e-37
ref|WP_028482613.1|  acetoin utilization protein [Nesiotobacte...    141   6e-37
ref|WP_002721554.1|  acetoin utilization protein [Rhodobacter ...    141   6e-37
ref|WP_027685762.1|  acetoin utilization protein [Rhizobium le...    141   6e-37
ref|WP_003704473.1|  deacetylase [Neisseria gonorrhoeae]             142   6e-37
gb|AII86000.1|  putative deacytelase, histone deacetylase supe...    141   6e-37
ref|WP_023808625.1|  acetoin utilization protein [Mesorhizobiu...    141   6e-37
ref|WP_023778678.1|  acetoin utilization protein [Mesorhizobiu...    140   7e-37
ref|WP_018689405.1|  hypothetical protein [Ahrensia kielensis]       140   7e-37
ref|WP_020157594.1|  acetoin utilization protein [Methylobacte...    141   7e-37
ref|WP_028747906.1|  acetoin utilization protein [Rhizobium me...    140   7e-37
ref|WP_020048725.1|  acetoin utilization protein [Rhizobium le...    140   8e-37
ref|WP_004272415.1|  acetoin utilization protein [Azospirillum...    140   8e-37
ref|WP_011338742.1|  acetoin utilization protein [Rhodobacter ...    140   8e-37
ref|WP_007530602.1|  acetoin utilization protein [Rhizobium me...    140   9e-37
ref|WP_026036721.1|  deacetylase [Limnohabitans sp. Rim47]           140   9e-37
emb|CCF18213.1|  putative deacetylase [Rhizobium sp.]                140   9e-37
ref|WP_028346793.1|  acetoin utilization protein [Bradyrhizobi...    140   9e-37
ref|WP_008529286.1|  acetoin utilization protein [Rhizobium sp...    140   9e-37
gb|EEH61478.1|  histone deacetylase [Neisseria gonorrhoeae 1291]     142   9e-37
gb|AHN97611.1|  histone deacetylase [uncultured bacterium 12AC...    140   1e-36
ref|WP_029475625.1|  hypothetical protein [Dehalococcoidia bac...    141   1e-36
ref|WP_027666641.1|  acetoin utilization protein [Rhizobium le...    140   1e-36
ref|WP_024576131.1|  MULTISPECIES: acetoin utilization protein...    140   1e-36
ref|WP_007635300.1|  histone deacetylase 14 [Glaciecola psychr...    140   1e-36
ref|WP_010359793.1|  deacetylase [Neisseria gonorrhoeae]             141   1e-36
ref|WP_003704850.1|  deacetylase [Neisseria gonorrhoeae]             141   1e-36
ref|WP_010951007.1|  deacetylase [Neisseria gonorrhoeae]             141   1e-36
ref|WP_027487168.1|  acetoin utilization protein [Rhizobium un...    140   1e-36
ref|WP_027493434.1|  acetoin utilization protein [Rhodanobacte...    140   1e-36
gb|KGJ68140.1|  hypothetical protein BJA5080_00962 [Bradyrhizo...    141   1e-36
ref|WP_016552982.1|  histone deacetylase superfamily protein [...    140   1e-36
ref|WP_028742754.1|  acetoin utilization protein [Rhizobium le...    140   1e-36
ref|WP_012756288.1|  acetoin utilization protein [Rhizobium le...    140   1e-36
ref|WP_008643671.1|  MULTISPECIES: deacetylase [Cupriavidus]         140   1e-36
ref|WP_003545922.1|  acetoin utilization protein [Rhizobium le...    140   1e-36
ref|WP_002683843.1|  deacetylase [Beggiatoa alba]                    140   1e-36
ref|WP_017993140.1|  acetoin utilization protein [Rhizobium le...    140   1e-36
ref|WP_011974698.1|  MULTISPECIES: acetoin utilization protein...    140   1e-36
ref|WP_012042674.1|  acetoin utilization protein [Bradyrhizobi...    140   1e-36
ref|WP_015238451.1|  histone deacetylase family protein [Candi...    140   2e-36
ref|WP_007816240.1|  acetoin utilization protein [Roseobacter ...    140   2e-36
ref|WP_007793196.1|  acetoin utilization protein [Rhizobium sp...    140   2e-36
ref|WP_018038655.1|  histone deacetylase [alpha proteobacteriu...    140   2e-36
ref|WP_014240273.1|  acetoin utilization protein [Azospirillum...    140   2e-36
gb|KGE04155.1|  Deacetylase [Haliea rubra DSM 19751]                 139   2e-36
ref|WP_029086658.1|  acetoin utilization protein [Brevundimona...    139   2e-36
ref|WP_008059899.1|  Histone deacetylase [Methyloversatilis un...    139   2e-36
ref|WP_011841896.1|  acetoin utilization protein [Rhodobacter ...    140   2e-36
ref|WP_015397099.1|  histone deacetylase-like protein [Candida...    139   2e-36
ref|WP_012482900.1|  acetoin utilization protein [Rhizobium etli]    139   2e-36
gb|KFN41503.1|  hypothetical protein N787_05975 [Arenimonas me...    139   3e-36
gb|EZQ08755.1|  acetoin utilization protein [Azospirillum bras...    139   3e-36
ref|WP_015389609.1|  deacetylase [Candidatus Kinetoplastibacte...    139   3e-36
ref|WP_029585188.1|  acetoin utilization protein [Bradyrhizobi...    139   3e-36
ref|WP_028840345.1|  acetoin utilization protein [Thermomonas ...    139   3e-36
gb|KGF67716.1|  acetoin utilization protein [Hoeflea sp. BAL378]     139   3e-36
ref|WP_007605458.1|  acetoin utilization protein [Rhizobium sp...    139   3e-36
ref|WP_018984448.1|  hypothetical protein [Salinimonas chungwh...    139   3e-36
ref|WP_029523990.1|  deacetylase [Polaromonas sp. Cr4-12]            139   3e-36
ref|WP_013419596.1|  acetoin utilization protein [Rhodomicrobi...    139   3e-36
gb|KGF30365.1|  deacetylase [Oligella urethralis DNF00040]           139   3e-36
ref|WP_028464444.1|  acetoin utilization protein [Nisaea denit...    139   3e-36
ref|WP_009563181.1|  Acetylspermidine deacetylase [Rhodobacter...    139   3e-36
ref|WP_026871618.1|  acetoin utilization protein [Inquilinus l...    139   4e-36
ref|WP_007827758.1|  deacetylase [Variovorax sp. CF313]              139   4e-36
ref|WP_007426581.1|  acetoin utilization protein [Oceaniovalib...    139   4e-36
ref|WP_026633705.1|  acetoin utilization protein [Dyella japon...    139   4e-36
ref|WP_028750626.1|  acetoin utilization protein [Rhizobium le...    139   4e-36
ref|WP_018863899.1|  MULTISPECIES: deacetylase [Thioalkalivibrio]    139   4e-36
gb|KFC66865.1|  Deacetylase, histone deacetylase/acetoin utili...    139   4e-36
ref|WP_025582350.1|  acetoin utilization protein [Rhizobium sp...    139   4e-36
ref|WP_007090866.1|  acetoin utilization protein [Thalassospir...    139   4e-36
ref|WP_024462420.1|  deacetylase [Marinimicrobium sp. LS-A18]        139   5e-36
ref|WP_010150547.1|  histone deacetylase [SAR324 cluster bacte...    139   5e-36
gb|KAK69394.1|  histone deacetylase family protein [Bordetella...    135   5e-36
ref|WP_026156800.1|  deacetylase [Oligella urethralis]               138   5e-36
ref|WP_015921486.1|  acetoin utilization protein [Rhodobacter ...    138   5e-36
ref|WP_014744481.1|  acetoin utilization protein [Tistrella mo...    139   5e-36
ref|WP_018007051.1|  deacetylase [Cupriavidus taiwanensis]           138   5e-36
ref|WP_018748236.1|  hypothetical protein [Chitiniphilus shina...    138   5e-36
ref|WP_014881461.1|  acetoin utilization protein [Phaeobacter ...    138   5e-36
emb|CDH45810.1|  Histone deacetylase superfamily [Candidatus C...    138   6e-36
ref|WP_017990478.1|  acetoin utilization protein [Rhizobium le...    138   6e-36
ref|WP_018607843.1|  hypothetical protein [Uliginosibacterium ...    138   6e-36
ref|WP_029045699.1|  deacetylase [Cupriavidus sp. amp6]              138   6e-36
ref|WP_028209083.1|  deacetylase [Burkholderia nodosa]               138   6e-36
ref|WP_022533901.1|  deacetylase [Ralstonia pickettii]               138   6e-36
ref|WP_027840339.1|  acetoin utilization protein [Mastigocoleu...    138   7e-36
ref|WP_023663874.1|  acetoin utilization protein [Rhodobacter ...    138   7e-36
ref|WP_027021531.1|  histone deacetylase [Conchiformibius stee...    139   7e-36
ref|WP_010812943.1|  MULTISPECIES: deacetylase [Burkholderiaceae]    138   7e-36
ref|WP_018312427.1|  deacetylase [Cupriavidus sp. UYPR2.512]         138   7e-36
ref|WP_017963072.1|  acetoin utilization protein [Rhizobium le...    138   7e-36
gb|KCZ73448.1|  deacetylase, histone deacetylase/acetoin utili...    139   7e-36
ref|WP_002714799.1|  hypothetical protein [Afipia clevelandensis]    138   7e-36
ref|WP_009735421.1|  acetoin utilization protein [Bradyrhizobi...    138   7e-36
gb|KDB52398.1|  histone deacetylase superfamily protein [Sphae...    138   7e-36
gb|EYS88497.1|  deacetylase [Cupriavidus sp. SK-4]                   138   7e-36
ref|WP_020948977.1|  histone deacetylase [Paracoccus aminophilus]    138   8e-36
ref|WP_028820713.1|  deacetylase [beta proteobacterium SCGC AA...    138   8e-36
ref|WP_013955860.1|  deacetylase [Cupriavidus necator]               138   8e-36
ref|WP_029915756.1|  acetoin utilization protein [Caulobacter ...    138   8e-36
gb|AIC26113.1|  deacetylase protein [Rhizobium etli bv. mimosa...    138   8e-36
ref|WP_026188150.1|  deacetylase [Methyloversatilis universalis]     138   8e-36
ref|WP_033473197.1|  deacetylase [Bordetella bronchiseptica]         135   8e-36
ref|WP_023397459.1|  putative deacetylase [Pseudoalteromonas l...    138   8e-36
ref|WP_007703698.1|  MULTISPECIES: acetoin utilization protein...    138   9e-36
ref|WP_027173774.1|  acetoin utilization protein [Methylobacte...    138   9e-36
ref|WP_012707080.1|  acetoin utilization protein [Sinorhizobiu...    138   9e-36
emb|CDO60529.1|  Acetylspermidine deacetylase; Deacetylases,in...    138   9e-36
ref|WP_032137276.1|  histone deacetylase superfamily protein [...    138   9e-36
ref|WP_019025565.1|  MULTISPECIES: deacetylase [Thioalkalivibrio]    138   9e-36
ref|WP_028215911.1|  deacetylase [Burkholderia oxyphila]             137   1e-35
ref|WP_012383949.1|  acetoin utilization protein [Beijerinckia...    139   1e-35
ref|WP_026224474.1|  deacetylase [Methyloversatilis sp. NVD]         137   1e-35
gb|KHD22381.1|  deacetylase [Burkholderia sacchari]                  137   1e-35
ref|WP_020558640.1|  hypothetical protein [Thiothrix flexilis]       137   1e-35
ref|WP_011370278.1|  histone deacetylase superfamily protein [...    137   1e-35
ref|WP_012330375.1|  acetoin utilization protein [Methylobacte...    137   1e-35
ref|WP_009812501.1|  acetoin utilization protein [Roseovarius ...    137   1e-35
ref|WP_020177647.1|  hypothetical protein [Methylopila sp. M107]     137   1e-35
ref|WP_032134013.1|  histone deacetylase superfamily protein [...    137   1e-35
ref|WP_027817375.1|  deacetylase [Burkholderia bannensis]            137   1e-35
ref|WP_031255757.1|  deacetylase [Curvibacter lanceolatus]           137   2e-35
gb|EGE58812.1|  putative deacetylase protein [Rhizobium etli C...    137   2e-35
ref|WP_018068384.1|  acetoin utilization protein [Rhizobium le...    137   2e-35
ref|WP_014876299.1|  acetoin utilization protein [Phaeobacter ...    137   2e-35
ref|WP_032827791.1|  histone deacetylase superfamily protein [...    137   2e-35
ref|WP_033181432.1|  acetoin utilization protein [Rhizobium le...    137   2e-35
ref|WP_018449324.1|  MULTISPECIES: acetoin utilization protein...    137   2e-35
ref|WP_028358013.1|  deacetylase [Brackiella oedipodis]              137   2e-35
ref|WP_027135946.1|  acetoin utilization protein [Geminicoccus...    137   2e-35
ref|WP_028916399.1|  acetoin utilization protein [Pseudoxantho...    137   2e-35
ref|WP_018496854.1|  acetoin utilization protein [Rhizobium le...    137   2e-35
ref|WP_009453258.1|  deacetylase [Leptothrix ochracea]               137   2e-35
ref|WP_014953818.1|  histone deacetylase [alpha proteobacteriu...    137   2e-35
ref|WP_015928556.1|  acetoin utilization protein [Methylobacte...    137   2e-35
ref|WP_003745671.1|  deacetylase [Neisseria mucosa]                  138   2e-35
ref|WP_018413780.1|  histone deacetylase [Candidatus Pelagibac...    137   2e-35
gb|KEC72811.1|  histone deacetylase superfamily protein [Rhizo...    137   2e-35
ref|WP_009798117.1|  acetoin utilization protein [Nitrobacter ...    137   2e-35
ref|WP_023871203.1|  MULTISPECIES: acetoin utilization protein...    137   2e-35
ref|WP_005859024.1|  acetoin utilization protein [Sagittula st...    137   2e-35
ref|WP_018245056.1|  acetoin utilization protein [Rhizobium le...    137   3e-35
ref|WP_019856973.1|  acetoin utilization protein [Mesorhizobiu...    137   3e-35
ref|WP_009959921.1|  histone deacetylase [Verrucomicrobium spi...    137   3e-35
ref|WP_003876064.1|  acetoin utilization protein [Mycobacteriu...    137   3e-35
ref|WP_028211703.1|  deacetylase [Burkholderia mimosarum]            136   3e-35
ref|WP_008944116.1|  acetoin utilization protein [Oceanibaculu...    136   3e-35
ref|WP_009977596.1|  MULTISPECIES: acetoin utilization protein...    136   3e-35
gb|EGK08404.1|  histone deacetylase [Kingella kingae ATCC 23330]     137   3e-35
ref|WP_033729991.1|  acetoin utilization protein [Mycobacteriu...    136   3e-35
ref|WP_022540218.1|  deacetylase [Ralstonia pickettii]               137   3e-35
ref|WP_011725404.1|  acetoin utilization protein [Mycobacteriu...    136   3e-35
ref|WP_010928904.1|  deacetylase [Bordetella parapertussis]          136   3e-35
ref|WP_008332953.1|  acetoin utilization protein [Maritimibact...    136   3e-35
ref|WP_002641916.1|  hypothetical protein [Simonsiella muelleri]     137   3e-35
ref|WP_023869482.1|  acetoin utilization protein [Mycobacteriu...    136   3e-35
ref|WP_011509361.1|  acetoin utilization protein [Nitrobacter ...    136   3e-35
ref|WP_003481571.1|  Histone deacetylase 1 Short=HD1 [Xanthomo...    136   3e-35
ref|WP_002716528.1|  hypothetical protein [Afipia felis]             136   3e-35
ref|WP_011390366.1|  acetoin utilization protein [Rhodospirill...    136   3e-35
ref|WP_006726710.1|  acetoin utilization protein [Agrobacteriu...    136   3e-35
ref|WP_027248381.1|  acetoin utilization protein [Phaeobacter ...    136   3e-35
ref|WP_010914873.1|  acetoin utilization protein [Mesorhizobiu...    136   3e-35
ref|WP_018262825.1|  acetoin utilization protein [Methylobacte...    136   4e-35
ref|WP_014414711.1|  acetoin utilization protein [Rhodospirill...    136   4e-35
ref|WP_010930109.1|  deacetylase [Bordetella pertussis]              136   4e-35
ref|WP_024080342.1|  putative histone deacetylase superfamily ...    137   4e-35
ref|WP_006997443.1|  histone deacetylase [Candidatus Pelagibac...    136   4e-35
ref|WP_029029486.1|  acetoin utilization protein [Salinarimona...    136   4e-35
ref|WP_021098425.1|  Deacetylase [Rubellimicrobium thermophilum]     136   4e-35
gb|KCV64000.1|  histone deacetylase family protein [Bordetella...    136   4e-35
ref|WP_011650715.1|  acetoin utilization protein [Rhizobium le...    136   5e-35
ref|WP_027279423.1|  acetoin utilization protein [Rhodopseudom...    136   5e-35
ref|WP_020721316.1|  hypothetical protein [Acidobacteriaceae b...    136   5e-35
ref|WP_018914018.1|  hypothetical protein [Thiomonas sp. FB-6]       136   5e-35
ref|WP_026608248.1|  acetoin utilization protein [Methylocapsa...    136   5e-35
ref|WP_022979283.1|  deacetylase [Ideonella sp. B508-1]              136   5e-35
ref|WP_027072994.1|  acetoin utilization protein [Luteimonas s...    136   5e-35
ref|WP_008164050.1|  deacetylase [Achromobacter arsenitoxydans]      135   5e-35
ref|WP_028879491.1|  acetoin utilization protein [Terasakiella...    136   5e-35
ref|WP_015915131.1|  acetoin utilization protein [Agrobacteriu...    136   5e-35
ref|WP_015039480.1|  histone deacetylase family protein [Borde...    135   6e-35
ref|WP_024006214.1|  deacetylase [Advenella kashmirensis]            135   6e-35
ref|WP_015390033.1|  acetylspermidine deacetylase [Kinetoplast...    135   6e-35
ref|WP_018939862.1|  deacetylase [Thioalkalivibrio sp. AKL11]        135   6e-35
ref|WP_028031917.1|  acetoin utilization protein [Catellibacte...    135   6e-35
emb|CEG08834.1|  Histone deacetylase-like amidohydrolase [Afip...    135   6e-35
ref|WP_024098796.1|  Deacetylase [Phaeobacter gallaeciensis]         135   7e-35
ref|WP_003821521.1|  MULTISPECIES: histone deacetylase family ...    135   7e-35
ref|WP_007737508.1|  deacetylase [Burkholderia sp. BT03]             135   7e-35
ref|WP_009340450.1|  acetoin utilization protein [Afipia sp. 1...    135   7e-35
ref|WP_010926822.1|  deacetylase [Bordetella bronchiseptica]         135   7e-35
ref|WP_003813342.1|  histone deacetylase family protein [Borde...    135   7e-35
ref|WP_019657356.1|  deacetylase [Variovorax paradoxus]              135   7e-35
emb|CAM76213.1|  histone deacetylase superfamily [Magnetospiri...    136   8e-35
ref|WP_005882067.1|  deacetylase [Oxalobacter formigenes]            135   8e-35
ref|WP_019732674.1|  acetoin utilization protein [Mycobacteriu...    135   8e-35
ref|WP_026304243.1|  acetoin utilization protein [Kaistia gran...    135   9e-35
ref|WP_008549498.1|  acetoin utilization protein [Pseudovibrio...    135   9e-35
ref|WP_028008754.1|  deacetylase [Sinobacter flavus]                 135   1e-34
gb|KCV32250.1|  histone deacetylase family protein [Bordetella...    136   1e-34
ref|WP_026610675.1|  acetoin utilization protein [Methylocaldu...    135   1e-34
ref|WP_029921145.1|  deacetylase [Nevskia soli]                      135   1e-34
ref|WP_021696328.1|  acetylspermidine deacetylase [Brevundimon...    135   1e-34
ref|WP_023852689.1|  histone deacetylase family protein [Borde...    136   1e-34
gb|KDD49456.1|  histone deacetylase family protein [Bordetella...    136   1e-34
ref|WP_015306122.1|  deacetylase, histone deacetylase/acetoin ...    135   1e-34
ref|WP_026142976.1|  MULTISPECIES: deacetylase [Thioalkalivibrio]    135   1e-34
gb|KDD85231.1|  histone deacetylase family protein [Bordetella...    136   1e-34
ref|WP_010568692.1|  histone deacetylase [Leptospira broomii]        135   1e-34
ref|WP_033467716.1|  deacetylase [Bordetella bronchiseptica]         135   1e-34
ref|WP_015238097.1|  histone deacetylase family protein [Kinet...    135   1e-34
gb|KAK74634.1|  histone deacetylase family protein [Bordetella...    136   1e-34
ref|WP_026175854.1|  acetoin utilization protein [Methylobacte...    135   1e-34
ref|WP_021692889.1|  acetylspermidine deacetylase [Loktanella ...    135   1e-34
gb|AHM03598.1|  Acetylspermidine deacetylase, Deacetylase [Ros...    135   1e-34
ref|WP_014284400.1|  acetoin utilization protein [Pseudovibrio...    135   1e-34
ref|WP_004519308.1|  deacetylase [Neisseria subflava]                135   1e-34
ref|WP_011300721.1|  acetoin utilization protein [Cupriavidus ...    135   1e-34
ref|WP_027578944.1|  acetoin utilization protein [Bradyrhizobi...    135   1e-34
ref|WP_023365394.1|  hypothetical protein [Spiribacter sp. UAH...    134   1e-34
ref|WP_011471619.1|  acetoin utilization protein [Rhodopseudom...    134   1e-34
gb|KEF41894.1|  histone deacetylase [Cyanobium sp. CACIAM 14]        135   1e-34
ref|WP_003791094.1|  histone deacetylase superfamily protein [...    136   1e-34
ref|WP_008035712.1|  acetoin utilization protein [Rhodobactera...    134   1e-34
ref|WP_003877650.1|  acetoin utilization protein [Mycobacteriu...    134   2e-34
ref|WP_027476445.1|  deacetylase [Curvibacter gracilis]              134   2e-34
ref|WP_005669057.1|  hypothetical protein [Massilia timonae]         134   2e-34
ref|WP_011313962.1|  acetoin utilization protein [Nitrobacter ...    134   2e-34
gb|KCV59527.1|  histone deacetylase family protein [Bordetella...    135   2e-34
ref|WP_022734533.1|  histone deacetylase [Candidatus Pelagibac...    134   2e-34
ref|WP_020169028.1|  histone deacetylase [Candidatus Pelagibac...    134   2e-34
gb|KDC16999.1|  histone deacetylase family protein [Bordetella...    134   2e-34
ref|WP_029462899.1|  deacetylase [Comamonadaceae bacterium H1]       134   2e-34
ref|WP_008899036.1|  deacetylase [Rheinheimera sp. A13L]             134   2e-34
gb|KGX68516.1|  histone deacetylase domain protein [Burkholder...    134   2e-34
ref|WP_014917818.1|  deacetylase [Burkholderia pseudomallei]         134   2e-34
ref|WP_020057750.1|  acetoin utilization protein [alpha proteo...    134   2e-34
ref|WP_029712382.1|  hypothetical protein [candidate division ...    134   2e-34
gb|ETX14967.1|  acetoin utilization protein [Roseivivax halodu...    134   2e-34
gb|KGC39282.1|  histone deacetylase domain protein [Burkholder...    134   2e-34
ref|WP_007080210.1|  acetoin utilization protein [Rhodanobacte...    134   2e-34
ref|WP_012641592.1|  histone deacetylase [Thermomicrobium roseum]    134   2e-34
ref|WP_013908501.1|  histone deacetylase [Thermodesulfatator i...    135   2e-34
ref|WP_014777150.1|  deacetylase [Thiocystis violascens]             134   2e-34
ref|WP_025916778.1|  deacetylase [Herminiimonas sp. CN]              134   2e-34
ref|WP_027242213.1|  acetoin utilization protein [Phaeobacter ...    134   3e-34
ref|WP_026279397.1|  MULTISPECIES: deacetylase [Thioalkalivibrio]    134   3e-34
ref|WP_023432204.1|  Acetylspermidine deacetylase [Lutibaculum...    134   3e-34
ref|WP_029918907.1|  deacetylase [Nevskia soli]                      134   3e-34
ref|WP_015119605.1|  deacetylase [Rivularia sp. PCC 7116]            134   3e-34
ref|WP_003053043.1|  deacetylase [Comamonas testosteroni]            134   3e-34
ref|WP_003079073.1|  deacetylase [Comamonas testosteroni]            134   3e-34
ref|WP_002708663.1|  deacetylase [Thiothrix nivea]                   134   3e-34
ref|WP_003069446.1|  deacetylase [Comamonas testosteroni]            134   3e-34
ref|WP_013819238.1|  acetoin utilization protein [Methylomonas...    134   3e-34
gb|KGG82386.1|  deacetylase [Comamonas testosteroni]                 134   3e-34
gb|AIJ48177.1|  deacetylase [Comamonas testosteroni TK102]           134   3e-34
ref|WP_018861493.1|  deacetylase [Thioalkalivibrio sp. ALJ3]         134   3e-34
ref|WP_015041736.1|  histone deacetylase family protein [Borde...    134   3e-34
ref|WP_011281727.1|  histone deacetylase [Candidatus Pelagibac...    134   3e-34
ref|WP_020186071.1|  hypothetical protein [Methylopila sp. 73B]      134   3e-34
ref|WP_016352722.1|  histone deacetylase-like amidohydrolase [...    133   4e-34
ref|WP_012352099.1|  deacetylase [Cupriavidus taiwanensis]           133   4e-34
ref|WP_029075766.1|  acetoin utilization protein [Kaistia adip...    133   4e-34
ref|WP_009516333.1|  deacetylase [Hydrogenophaga sp. PBC]            133   4e-34
ref|WP_013953070.1|  acetoin utilization protein [Cupriavidus ...    133   5e-34
gb|KGH30156.1|  deacetylase [Comamonas testosteroni]                 133   5e-34
ref|WP_014249478.1|  acetoin utilization protein [Azospirillum...    133   5e-34
gb|KGM39338.1|  deacetylase [Aquabacterium sp. NJ1]                  133   5e-34
ref|WP_012564028.1|  acetoin utilization protein [Oligotropha ...    133   5e-34
gb|KCV49528.1|  histone deacetylase family protein [Bordetella...    134   5e-34
gb|KHE91827.1|  histone deacetylase [Candidatus Scalindua brodae]    133   5e-34
ref|WP_012917230.1|  acetoin utilization protein [Xanthomonas ...    133   5e-34
ref|WP_015048485.1|  deacetylase [Simiduia agarivorans]              133   6e-34
ref|WP_009541088.1|  Acetylspermidine deacetylase [Caenispiril...    133   6e-34
ref|WP_018718718.1|  hypothetical protein [Arhodomonas aquaeolei]    133   6e-34
ref|WP_003678764.1|  deacetylase [Neisseria flavescens]              134   6e-34
ref|WP_028488260.1|  deacetylase [Thiothrix lacustris]               133   6e-34
ref|WP_003891503.1|  acetoin utilization protein [Mycobacteriu...    133   6e-34
ref|WP_009160614.1|  acetoin utilization protein [Thalassiobiu...    133   6e-34
ref|WP_027283268.1|  acetoin utilization protein [Rubritepida ...    133   6e-34
ref|WP_011491776.1|  deacetylase [Burkholderia xenovorans]           133   7e-34
gb|KGI77046.1|  acetoin utilization protein [Xanthomonadaceae ...    132   7e-34
ref|WP_015486925.1|  Deacetylase [Thalassolituus oleivorans]         133   7e-34
ref|WP_023948793.1|  deacetylase [Pelistega sp. HM-7]                132   8e-34
ref|WP_020924587.1|  Deacetylases, including yeast histone dea...    132   8e-34
ref|WP_022852536.1|  histone deacetylase [Thermodesulfatator a...    133   8e-34
gb|KGS04485.1|  histone deacetylase domain protein [Burkholder...    132   8e-34
ref|WP_028039945.1|  acetoin utilization protein [Caulobacter ...    132   8e-34
ref|WP_014876683.1|  acetoin utilization protein [Mycobacteriu...    133   9e-34
ref|WP_028602281.1|  deacetylase [Ottowia thiooxydans]               132   9e-34
ref|WP_019903695.1|  hypothetical protein [Methylobacterium sp...    132   9e-34
ref|WP_003685997.1|  deacetylase [Neisseria flavescens]              133   1e-33
ref|WP_006393631.1|  deacetylase [Achromobacter insuavis]            132   1e-33
ref|WP_012977220.1|  acetoin utilization protein [Azospirillum...    132   1e-33
ref|WP_028792584.1|  acetoin utilization protein [Thalassobacu...    132   1e-33
ref|WP_021132480.1|  histone deacetylase superfamily protein [...    132   1e-33
gb|EYS85957.1|  acetoin utilization protein [Cupriavidus sp. S...    132   1e-33
ref|WP_011312537.1|  deacetylase [Thiobacillus denitrificans]        132   1e-33
ref|WP_008433788.1|  acetoin utilization protein [Rhodanobacte...    132   1e-33
ref|WP_009550809.1|  deacetylase [Burkholderiales bacterium JO...    132   1e-33
ref|WP_027010912.1|  deacetylase [Comamonas sp. B-9]                 132   1e-33
ref|WP_010968890.1|  acetoin utilization protein [Sinorhizobiu...    132   1e-33
ref|WP_003535812.1|  acetoin utilization protein [Sinorhizobiu...    132   1e-33
ref|WP_015007273.1|  acetoin utilization protein [Sinorhizobiu...    132   1e-33
ref|WP_020084914.1|  hypothetical protein [Hyphomicrobium zava...    132   1e-33
ref|WP_004031225.1|  histone deacetylase [Methanobacterium for...    132   2e-33
gb|AHK15844.1|  deacetylase [Thalassolituus oleivorans R6-15]        132   2e-33
ref|WP_023849564.1|  acetoin utilization protein [Rhodobactera...    132   2e-33
ref|WP_029958803.1|  acetoin utilization protein [Ensifer sp. ...    132   2e-33
ref|WP_018947614.1|  hypothetical protein [Thioalkalivibrio sp...    132   2e-33
gb|KGF79871.1|  deacetylase [Massilia sp. JS1662]                    132   2e-33
gb|KFX72282.1|  histone deacetylase [alpha proteobacterium qin...    132   2e-33
ref|WP_012287343.1|  acetoin utilization protein [Caulobacter ...    131   2e-33
ref|WP_027172866.1|  acetoin utilization protein [Methylobacte...    132   2e-33
ref|WP_025899267.1|  acetoin utilization protein [Sneathiella ...    132   2e-33
ref|WP_012168945.1|  acetoin utilization protein [Azorhizobium...    132   2e-33
gb|KGD49686.1|  histone deacetylase domain protein [Burkholder...    131   2e-33
ref|WP_012521469.1|  acetoin utilization protein [Phenylobacte...    131   2e-33
ref|WP_027315165.1|  acetoin utilization protein [Microvirga f...    131   2e-33
ref|WP_007421469.1|  acetoin utilization protein [Acidiphilium...    131   2e-33
ref|WP_012455048.1|  acetoin utilization protein [Methylobacte...    132   2e-33
gb|KER80497.1|  acetoin utilization protein [Xanthomonas arbor...    131   2e-33
ref|WP_009373317.1|  histone deacetylase [alpha proteobacteriu...    131   3e-33
ref|WP_018880019.1|  MULTISPECIES: hypothetical protein [Thioa...    131   3e-33
ref|WP_011298704.1|  deacetylase [Cupriavidus pinatubonensis]        131   3e-33
gb|AIF97369.1|  deacetylase [Alteromonas sp. H17]                    131   3e-33
ref|WP_011872002.1|  acetoin utilization protein [Herminiimona...    131   3e-33
ref|WP_003782660.1|  histone deacetylase [Kingella denitrificans]    132   3e-33
ref|WP_026780983.1|  acetoin utilization protein [Polaromonas ...    131   3e-33
ref|WP_028492244.1|  deacetylase [Thioalkalivibrio sp. ALE19]        131   3e-33
ref|WP_026597842.1|  acetoin utilization protein [Methylocysti...    132   3e-33
ref|WP_018094426.1|  acetoin utilization protein [Sinorhizobiu...    131   3e-33
ref|WP_008216136.1|  acetoin utilization protein [Rhodanobacte...    131   3e-33
ref|WP_029051111.1|  acetoin utilization protein [Cupriavidus ...    131   3e-33
ref|WP_026597081.1|  acetoin utilization protein [Methylobacte...    131   3e-33
ref|WP_031404029.1|  deacetylase [Thiomonas sp. FB-Cd]               131   3e-33
ref|WP_012179957.1|  acetoin utilization protein [Dinoroseobac...    131   3e-33
ref|WP_006002953.1|  deacetylase [Glaciecola punicea]                131   4e-33
ref|WP_020092052.1|  acetoin utilization protein [Methylobacte...    131   4e-33
ref|WP_008062510.1|  deacetylase [Methyloversatilis universalis]     130   4e-33
ref|WP_022709976.1|  acetoin utilization protein [Pseudochroba...    131   4e-33
ref|WP_025256988.1|  deacetylase [Alteromonas sp. ALT199]            131   4e-33
ref|WP_011504681.1|  acetoin utilization protein [Rhodopseudom...    130   4e-33
ref|WP_013898063.1|  histone deacetylase [Methanosalsum zhilinae]    131   5e-33
gb|KGJ21716.1|  acetoin utilization protein [Paracoccus sp. 10...    130   5e-33
ref|WP_019022641.1|  hypothetical protein [Thioalkalivibrio sp...    130   5e-33
ref|WP_026176034.1|  acetoin utilization protein [Methylobacte...    130   5e-33
ref|WP_020056199.1|  hypothetical protein [alpha proteobacteri...    130   5e-33
dbj|BAO81179.1|  deacetylase, including yeast histone deacetyl...    130   5e-33
emb|CDO87950.1|  histone deacetylase [Mycobacterium triplex]         130   5e-33
ref|WP_014327572.1|  acetoin utilization protein [Sinorhizobiu...    130   5e-33
ref|WP_020649090.1|  hypothetical protein [Singularimonas vari...    130   5e-33
ref|WP_029113804.1|  acetoin utilization protein [Mycobacteriu...    130   5e-33
ref|WP_012516706.1|  deacetylase [Alteromonas macleodii]             130   6e-33
ref|WP_032094656.1|  MULTISPECIES: deacetylase [Alteromonas]         130   6e-33
ref|WP_019569428.1|  MULTISPECIES: hypothetical protein [Thioa...    130   6e-33
ref|WP_024015488.1|  Histone deacetylase/AcuC/AphA family prot...    130   6e-33
ref|WP_015065936.1|  Histone deacetylase/AcuC/AphA family prot...    130   6e-33
ref|WP_010581848.1|  acetoin utilization protein [Schlesneria ...    130   6e-33
ref|WP_014977951.1|  deacetylase [Alteromonas macleodii]             130   6e-33
ref|WP_010509504.1|  histone deacetylase [SAR324 cluster bacte...    130   6e-33
ref|WP_012109651.1|  acetoin utilization protein [Parvibaculum...    130   6e-33
ref|WP_006496535.1|  deacetylase [Burkholderia cenocepacia]          130   7e-33
ref|WP_014751058.1|  deacetylase [Advenella kashmirensis]            130   7e-33
ref|WP_029158741.1|  deacetylase [Comamonas testosteroni]            130   7e-33
ref|WP_028293555.1|  hypothetical protein [Oceanobacter kriegii]     130   7e-33
ref|WP_018869638.1|  hypothetical protein [Thioalkalivibrio sp...    130   7e-33
ref|WP_015396384.1|  deacetylase [Candidatus Kinetoplastibacte...    130   7e-33
gb|AIP36754.1|  histone deacetylase domain protein [Burkholder...    130   7e-33
ref|WP_013707001.1|  histone deacetylase [Desulfobacca acetoxi...    130   7e-33
ref|WP_006978820.1|  histone deacetylase [Chthoniobacter flavus]     130   7e-33
dbj|GAE57254.1|  histone deacetylase family protein [Xanthomon...    130   7e-33
ref|WP_014975334.1|  deacetylase [Alteromonas macleodii]             130   7e-33
ref|WP_007206103.1|  acetoin utilization protein [Loktanella v...    130   7e-33
ref|WP_016900762.1|  acetoin utilization protein [Xanthomonas ...    130   7e-33
ref|WP_006451493.1|  acetoin utilization protein [Xanthomonas ...    130   7e-33
ref|WP_024815824.1|  deacetylase [Acidovorax sp. JHL-3]              130   7e-33
gb|ADH42947.1|  deacetylase protein [uncultured SAR11 cluster ...    130   7e-33
ref|WP_014947830.1|  deacetylase [Alteromonas macleodii]             130   7e-33
ref|WP_024079514.1|  Histone deacetylase superfamily [Magnetos...    130   8e-33
ref|WP_029007583.1|  acetoin utilization protein [Azospirillum...    130   8e-33
ref|WP_026016234.1|  acetoin utilization protein [Methylocysti...    130   8e-33
ref|WP_005001530.1|  acetoin utilization protein [Nitrococcus ...    130   8e-33
ref|WP_029890812.1|  hypothetical protein [Polycyclovorans alg...    130   8e-33
gb|EYC51748.1|  acetoin utilization protein [Hylemonella graci...    130   8e-33
ref|WP_024938279.1|  acetoin utilization protein [Xanthomonas ...    130   8e-33
gb|KEZ76461.1|  deacetylase [Salinisphaera hydrothermalis C41B8]     129   9e-33
ref|WP_019955476.1|  acetoin utilization protein [Loktanella v...    130   9e-33
emb|CDI01149.1|  Histone deacetylase superfamily protein [Cand...    130   9e-33
ref|WP_028100077.1|  acetoin utilization protein [Dongia sp. U...    130   9e-33
gb|AAU43699.1|  acetoin utilization protein [uncultured archae...    130   1e-32
ref|WP_010412965.1|  histone deacetylase [Leptospira inadai]         130   1e-32
ref|WP_027082357.1|  acetoin utilization protein [Lysobacter s...    130   1e-32
ref|WP_014996884.1|  deacetylase [Alteromonas macleodii]             130   1e-32
ref|WP_027999701.1|  acetoin utilization protein [Sinorhizobiu...    130   1e-32
ref|WP_015197350.1|  histone deacetylase superfamily protein [...    130   1e-32
ref|WP_019644454.1|  hypothetical protein [Novispirillum iters...    130   1e-32
ref|WP_018046535.1|  hypothetical protein [Nitrospina sp. AB-6...    130   1e-32
gb|KGJ14709.1|  acetoin utilization protein [Paracoccus sp. 4681]    129   1e-32
gb|AHX14617.1|  acetoin utilization protein [Dyella jiangninge...    129   1e-32
ref|WP_023902941.1|  histone deacetylase family protein [Xanth...    129   1e-32
ref|WP_004558269.1|  MULTISPECIES: deacetylase, histone deacet...    130   1e-32
ref|WP_011662514.1|  acetoin utilization protein [Rhodopseudom...    129   1e-32
ref|WP_009097578.1|  histone deacetylase/AcuC/AphA family prot...    129   1e-32
ref|WP_008870277.1|  histone deacetylase [Desulfonatronospira ...    129   1e-32
gb|KFC69547.1|  Acetylspermidine deacetylase [Devosia sp. LC5]       129   1e-32
ref|WP_017504474.1|  acetoin utilization protein [alpha proteo...    129   1e-32
ref|WP_018037817.1|  hypothetical protein [alpha proteobacteri...    129   1e-32
ref|WP_033067096.1|  acetoin utilization protein [Thalassospir...    129   1e-32
ref|WP_019921795.1|  hypothetical protein [Duganella zoogloeoi...    129   1e-32
ref|WP_028997694.1|  deacetylase [Azohydromonas australica]          129   2e-32
ref|WP_018949302.1|  hypothetical protein [Thioalkalivibrio sp...    129   2e-32
ref|WP_019939477.1|  deacetylase [Bordetella sp. FB-8]               129   2e-32
gb|AHG63733.1|  histone deacetylase domain-containing protein ...    129   2e-32
ref|WP_013639561.1|  acetoin utilization protein [Acidiphilium...    129   2e-32
ref|WP_011443324.1|  acetoin utilization protein [Rhodopseudom...    129   2e-32
ref|WP_019560405.1|  deacetylase [Caldimonas manganoxidans]          129   2e-32
emb|CDS54106.1|  Deacetylases, including yeast histone deacety...    129   2e-32
gb|KGJ17175.1|  acetoin utilization protein [Paracoccus sp. 39...    129   2e-32
ref|WP_033081660.1|  deacetylase [Colwellia psychrerythraea]         129   2e-32
ref|WP_011942069.1|  acetoin utilization protein [Acidiphilium...    129   2e-32
ref|WP_028844486.1|  acetoin utilization protein [Thermodesulf...    129   2e-32
ref|WP_033158056.1|  acetoin utilization protein [Methylomonas...    129   2e-32
ref|WP_026779138.1|  deacetylase [Polaromonas sp. EUR3 1.2.1]        129   2e-32
gb|AAU82696.1|  acetoin utilization protein [uncultured archae...    129   2e-32
ref|WP_019015831.1|  hypothetical protein [Elioraea tepidiphila]     129   2e-32
ref|WP_021328704.1|  hypothetical protein [candidate division ...    129   2e-32
ref|WP_008325952.1|  deacetylase [Herbaspirillum sp. GW103]          129   2e-32
gb|KGK79631.1|  acetoin utilization protein [Thalassobacter st...    129   2e-32
ref|WP_024536960.1|  deacetylase [Comamonas badia]                   129   2e-32
gb|AAU84294.1|  acetoin utilization protein [uncultured archae...    129   2e-32
emb|CEJ49528.1|  Deacetylase [Xanthomonas citri pv. bilvae]          129   2e-32
ref|WP_012254317.1|  acetoin utilization protein [Methylobacte...    129   2e-32
ref|WP_026033251.1|  MULTISPECIES: acetoin utilization protein...    129   2e-32
ref|WP_019450729.1|  deacetylase [Cupriavidus sp. BIS7]              129   2e-32
ref|WP_029005034.1|  acetoin utilization protein [Azorhizobium...    129   2e-32
ref|WP_015108602.1|  deacetylase [Cyanobium gracile]                 129   3e-32
ref|WP_018937070.1|  hypothetical protein [Thioalkalivibrio sp...    129   3e-32
ref|WP_025917774.1|  deacetylase [Herminiimonas sp. CN]              129   3e-32
ref|WP_022729713.1|  acetoin utilization protein [Fodinicurvat...    129   3e-32
gb|EZQ05772.1|  acetoin utilization protein [Azospirillum bras...    129   3e-32
ref|WP_003794198.1|  hypothetical protein [Kingella oralis]          127   3e-32
ref|WP_029047136.1|  acetoin utilization protein [Cupriavidus ...    128   3e-32
gb|ETR76286.1|  acetoin utilization protein [Afipia sp. P52-10]      128   3e-32
ref|WP_015006395.1|  deacetylase [Cycloclasticus sp. P1]             128   3e-32
ref|WP_019141718.1|  hypothetical protein [Herbaspirillum mass...    128   4e-32
ref|WP_013786039.1|  deacetylase [Alteromonas sp. SN2]               129   4e-32
ref|WP_025736204.1|  acetoin utilization protein [Mycobacteriu...    128   4e-32
ref|WP_011813751.1|  acetoin utilization protein [Halorhodospi...    128   4e-32
ref|WP_006296779.1|  acetoin utilization protein [Hylemonella ...    128   4e-32
ref|WP_015403223.1|  deacetylase, histone deacetylase/acetoin ...    129   4e-32
ref|WP_007774299.1|  acetoin utilization protein [Mycobacteriu...    128   4e-32
ref|WP_014198452.1|  acetoin utilization protein [Azospirillum...    128   4e-32
ref|WP_029408194.1|  hypothetical protein [Thiomicrospira sp. ...    128   5e-32
ref|WP_013901851.1|  deacetylase [Ramlibacter tataouinensis]         128   5e-32
ref|WP_028364234.1|  acetoin utilization protein [Burkholderia...    128   5e-32
gb|KFL30753.1|  acetoin utilization protein [Devosia riboflavina]    128   5e-32
ref|WP_029640178.1|  acetoin utilization protein [alpha proteo...    128   5e-32
gb|KGJ05277.1|  acetoin utilization protein [Paracoccus sphaer...    127   6e-32
ref|WP_029914280.1|  histone deacetylase [Pelobacter seleniige...    128   7e-32
ref|WP_020481426.1|  hypothetical protein [Methylomonas sp. MK1]     127   7e-32
ref|WP_024901618.1|  deacetylase [Burkholderia andropogonis]         128   7e-32
ref|WP_012494599.1|  acetoin utilization protein [Rhodopseudom...    127   8e-32
ref|WP_017451317.1|  MULTISPECIES: deacetylase [Herbaspirillum]      127   8e-32
ref|WP_013948572.1|  histone deacetylase [Hyphomicrobium sp. MC1]    127   8e-32
ref|WP_031374143.1|  acetoin utilization protein [Lysobacter a...    127   8e-32
ref|WP_007809427.1|  acetoin utilization protein [Rhodanobacte...    127   8e-32
ref|WP_013500898.1|  acetoin utilization protein [Rhodopseudom...    127   8e-32
ref|WP_019997049.1|  acetoin utilization protein [Aureimonas u...    127   9e-32
ref|WP_027009075.1|  histone deacetylase [Conchiformibius kuhn...    128   9e-32
ref|WP_011156489.1|  acetoin utilization protein [Rhodopseudom...    127   9e-32
gb|ETW99713.1|  hypothetical protein ETSY1_14020 [Candidatus E...    127   1e-31
ref|WP_019428406.1|  deacetylase [Limnohabitans sp. Rim28]           127   1e-31
gb|ETZ28340.1|  histone deacetylase domain protein [Mycobacter...    127   1e-31
ref|WP_018633252.1|  hypothetical protein [Meganema perideroedes]    127   1e-31
ref|WP_029011381.1|  acetoin utilization protein [Azospirillum...    127   1e-31
ref|WP_026986186.1|  acetoin utilization protein [Fodinicurvat...    127   1e-31
ref|WP_027279651.1|  acetoin utilization protein [Roseomonas g...    127   1e-31
ref|WP_015112790.1|  histone deacetylase superfamily protein [...    127   1e-31
ref|WP_014711999.1|  acetoin utilization protein [Mycobacteriu...    127   1e-31
ref|WP_008258121.1|  MULTISPECIES: histone deacetylase superfa...    127   1e-31
ref|WP_014380459.1|  acetoin utilization protein [Mycobacteriu...    127   1e-31
ref|WP_014942454.1|  acetoin utilization protein [Mycobacteriu...    127   1e-31
ref|WP_014385246.1|  acetoin utilization protein [Mycobacteriu...    126   2e-31
gb|KFL27120.1|  acetoin utilization protein [Devosia sp. 17-2-...    127   2e-31
gb|KFN46518.1|  hypothetical protein N790_08550 [Arenimonas ma...    126   2e-31
ref|WP_027102848.1|  deacetylase [Comamonadaceae bacterium URH...    127   2e-31
ref|WP_007220780.1|  histone deacetylase [planctomycete KSU-1]       126   2e-31
ref|WP_018715905.1|  hypothetical protein [Brachymonas chironomi]    126   2e-31
dbj|GAK46120.1|  histone deacetylase superfamily protein [alph...    126   2e-31
ref|WP_031388735.1|  hypothetical protein [Desulfonatronum thi...    126   2e-31
gb|KCW44438.1|  hypothetical protein EUGRSUZ_L020602 [Eucalypt...    127   2e-31
gb|KGQ18911.1|  Histone deacetylase superfamily [Lysobacter do...    126   2e-31
gb|KBZ63729.1|  hypothetical protein K875_02441 [Mycobacterium...    126   2e-31
ref|WP_011321118.1|  hypothetical protein [Anabaena variabilis]      126   2e-31
ref|XP_010036773.1|  PREDICTED: histone deacetylase 5-like iso...    130   2e-31
ref|WP_027996898.1|  deacetylase [Simplicispira psychrophila]        126   2e-31
ref|WP_012640401.1|  acetoin utilization protein [Caulobacter ...    126   2e-31
ref|WP_024297489.1|  acetoin utilization protein [Methylosarci...    126   2e-31
emb|CDP50090.1|  Acetylspermidine deacetylase [Devosia sp. DBB...    126   2e-31
ref|XP_010036766.1|  PREDICTED: histone deacetylase 5-like iso...    129   2e-31
ref|WP_015951393.1|  acetoin utilization protein [Methylobacte...    126   2e-31
ref|WP_011036031.1|  acetoin utilization protein [Xanthomonas ...    126   2e-31
gb|AAU83123.1|  acetoin utilization protein [uncultured archae...    127   2e-31
ref|WP_005878287.1|  deacetylase [Oxalobacter formigenes]            126   2e-31
ref|WP_010995013.1|  hypothetical protein [Nostoc sp. PCC 7120]      126   3e-31
ref|WP_024329615.1|  deacetylase [Thioalkalivibrio sp. ALR17-21]     126   3e-31
ref|WP_026600972.1|  acetoin utilization protein [Methylomonas...    126   3e-31
ref|WP_005669018.1|  hypothetical protein [Massilia timonae]         125   4e-31
ref|WP_022846686.1|  acetoin utilization protein [Desulfurobac...    125   4e-31
gb|KFI05533.1|  deacetylase [Massilia sp. BSC265]                    125   4e-31
ref|WP_026354283.1|  deacetylase [Massilia niastensis]               125   4e-31
ref|WP_023854412.1|  deacetylase, histone deacetylase/acetoin ...    125   4e-31
ref|WP_007004943.1|  acetoin utilization protein [Roseomonas c...    125   4e-31
ref|WP_011260164.1|  acetoin utilization protein [Xanthomonas ...    125   4e-31
ref|WP_012844441.1|  histone deacetylase [Rhodothermus marinus]      126   4e-31
ref|WP_017876947.1|  deacetylase [Janthinobacterium sp. CG3]         125   4e-31
ref|WP_015128034.1|  histone deacetylase superfamily protein [...    125   5e-31
ref|WP_016548752.1|  histone deacetylase family protein [Lepto...    125   5e-31
ref|WP_013628295.1|  acetoin utilization protein [Planctomyces...    125   5e-31
gb|EYR65441.1|  acetoin utilization protein [Lysobacter capsic...    125   5e-31
ref|WP_007873374.1|  deacetylase [Polaromonas sp. CF318]             125   6e-31
ref|WP_014066564.1|  MULTISPECIES: histone deacetylase [Bacter...    125   6e-31
ref|WP_011189603.1|  histone deacetylase [Desulfotalea psychro...    125   6e-31
ref|WP_005877636.1|  acetoin utilization protein [Oxalobacter ...    125   6e-31
ref|WP_010102909.1|  deacetylase [Verminephrobacter aporrectod...    125   6e-31
ref|WP_011269987.1|  acetoin utilization protein [Xanthomonas ...    125   6e-31
gb|KEO50767.1|  hypothetical protein TP2_14155 [Thioclava paci...    125   6e-31
ref|WP_014506741.1|  acetoin utilization protein [Xanthomonas ...    125   6e-31
ref|WP_028249061.1|  deacetylase [Variovorax sp. URHB0020]           125   6e-31
gb|KDS76428.1|  histone deacetylase family protein [Bordetella...    124   6e-31
gb|EYC52016.1|  deacetylase [Hylemonella gracilis str. Niagara R]    125   7e-31
ref|WP_029357406.1|  acetoin utilization protein [Methylobacte...    125   7e-31
ref|WP_008891278.1|  acetoin utilization protein [Thalassospir...    125   7e-31
ref|WP_028842622.1|  acetoin utilization protein [Thermodesulf...    124   7e-31
ref|WP_022972069.1|  acetoin utilization protein [Xanthomonas ...    124   7e-31
ref|WP_007177191.1|  deacetylase [Burkholderia sp. Ch1-1]            125   7e-31
ref|WP_026437234.1|  deacetylase [Acidovorax sp. JHL-9]              125   7e-31
ref|WP_007563781.1|  acetoin utilization protein [Methylobacte...    125   8e-31
ref|WP_024001268.1|  histone deacetylase superfamily protein [...    125   8e-31
ref|WP_006296524.1|  deacetylase [Hylemonella gracilis]              125   8e-31
ref|WP_027353877.1|  histone deacetylase [Desulfosarcina sp. B...    125   9e-31
ref|WP_011957895.1|  histone deacetylase [Roseiflexus sp. RS-1]      125   9e-31
ref|WP_008481157.1|  histone deacetylase [Nitrolancetus hollan...    124   9e-31
ref|WP_020592638.1|  hypothetical protein [Kiloniella laminariae]    124   1e-30
ref|WP_011464813.1|  deacetylase [Albidiferax ferrireducens]         124   1e-30
ref|WP_024829732.1|  acetoin utilization protein [Methylobacte...    124   1e-30
ref|WP_015448698.1|  acetoin utilization protein [Rhodanobacte...    124   1e-30
ref|WP_022722111.1|  acetoin utilization protein [Rhodopseudom...    124   1e-30
ref|WP_008243449.1|  acetoin utilization protein [Sulfurovum s...    124   1e-30
ref|WP_027490097.1|  acetoin utilization protein [Rhodanobacte...    124   1e-30
ref|WP_012319706.1|  acetoin utilization protein [Methylobacte...    124   1e-30
ref|WP_007509295.1|  acetoin utilization protein [Rhodanobacte...    124   1e-30
ref|WP_010395733.1|  deacetylase [Janthinobacterium lividum]         124   1e-30
ref|WP_027477116.1|  deacetylase [Curvibacter gracilis]              124   1e-30
ref|WP_027484510.1|  acetoin utilization protein [Rhodanobacte...    124   1e-30
ref|WP_012405030.1|  acetoin utilization protein [Burkholderia...    124   1e-30
ref|WP_002811837.1|  histone deacetylase family protein [Xanth...    124   1e-30
ref|WP_026789473.1|  acetoin utilization protein [Pleomorphomo...    124   1e-30
ref|WP_017173003.1|  acetoin utilization protein [Xanthomonas ...    121   1e-30
ref|WP_011019423.1|  hypothetical protein [Methanopyrus kandleri]    125   1e-30
ref|WP_019574332.1|  deacetylase [Curvibacter lanceolatus]           124   1e-30
gb|ETY82980.1|  Acetylspermidine deacetylase [Burkholderia car...    124   2e-30
ref|WP_028571138.1|  histone deacetylase [Desulfonatronum lacu...    124   2e-30
ref|WP_007857668.1|  deacetylase [Acidovorax sp. CF316]              124   2e-30
ref|WP_029735697.1|  hypothetical protein [candidate division ...    124   2e-30
ref|WP_008515351.1|  deacetylase, histone deacetylase/acetoin ...    124   2e-30
ref|WP_029665749.1|  MULTISPECIES: hypothetical protein [Cales...    124   2e-30
ref|WP_017652517.1|  hypothetical protein [Microchaete sp. PCC...    124   2e-30
ref|WP_012080708.1|  acetoin utilization protein [Janthinobact...    124   2e-30
ref|WP_009634573.1|  deacetylase, histone deacetylase/acetoin ...    124   2e-30
gb|EWY36739.1|  acetoin utilization protein [Skermanella stibi...    124   2e-30
ref|XP_010037239.1|  PREDICTED: histone deacetylase 5 isoform ...    127   2e-30
ref|XP_010041328.1|  PREDICTED: histone deacetylase 5-like [Eu...    127   2e-30
ref|WP_011418060.1|  histone deacetylase family protein [Syntr...    124   2e-30
ref|WP_023378005.1|  histone deacetylase family protein [Smith...    124   2e-30
ref|WP_008115227.1|  deacetylase [Herbaspirillum sp. YR522]          123   2e-30
ref|XP_010037238.1|  PREDICTED: histone deacetylase 5 isoform ...    127   2e-30
ref|WP_013105061.1|  putative Histone deacetylase superfamily ...    123   2e-30
ref|XP_004346003.1|  hypothetical protein ACA1_184050 [Acantha...    125   2e-30
gb|EKD40515.1|  hypothetical protein ACD_75C00026G0007 [uncult...    123   2e-30
ref|WP_026433732.1|  deacetylase [Acidovorax oryzae]                 123   2e-30
ref|WP_029413017.1|  deacetylase [Acidovorax avenae]                 123   3e-30
ref|WP_013122506.1|  deacetylase [Thiomonas intermedia]              123   3e-30
ref|WP_018938334.1|  MULTISPECIES: hypothetical protein [Thioa...    123   3e-30
ref|WP_028736873.1|  acetoin utilization protein [Rhizobium se...    123   3e-30
ref|WP_007579398.1|  acetoin utilization protein [Burkholderia...    123   3e-30
ref|WP_009061794.1|  deacetylase [Methylacidiphilum fumariolicum]    123   3e-30
emb|CDG16042.1|  Histone deacetylase-like amidohydrolase [Xeno...    124   3e-30
ref|WP_018951877.1|  hypothetical protein [Thioalkalivibrio sp...    123   3e-30
ref|WP_018144758.1|  MULTISPECIES: hypothetical protein [Thioa...    123   3e-30
ref|WP_012748473.1|  deacetylase [Variovorax paradoxus]              123   3e-30
ref|WP_015015122.1|  deacetylase [Acidovorax sp. KKS102]             123   3e-30
ref|WP_024276190.1|  acetoin utilization protein [Hyphomicrobi...    123   3e-30
ref|WP_014007707.1|  deacetylase [Collimonas fungivorans]            124   3e-30
ref|WP_012347930.1|  deacetylase [Leptothrix cholodnii]              123   3e-30
ref|WP_027301404.1|  acetoin utilization protein [Rhodospirill...    123   3e-30
ref|WP_009621655.1|  putative acetylpolyamine aminohydrolase [...    124   3e-30
ref|WP_015904732.1|  histone deacetylase [Desulfobacterium aut...    123   3e-30
ref|WP_021008024.1|  putative deacetylase, histone deacetylase...    123   3e-30
ref|WP_012871402.1|  histone deacetylase [Sphaerobacter thermo...    123   4e-30
ref|XP_008346846.1|  PREDICTED: histone deacetylase 5-like [Ma...    121   4e-30
ref|WP_031771640.1|  acetoin utilization protein [Pseudomonas ...    123   4e-30
ref|WP_029757491.1|  deacetylase [Oxalobacteraceae bacterium J...    123   4e-30
ref|WP_011795278.1|  deacetylase [Acidovorax citrulli]               123   4e-30
ref|WP_014100482.1|  deacetylase [Candidatus Chloracidobacteri...    123   4e-30
ref|WP_019300550.1|  acetoin utilization protein [Xanthomonas ...    122   4e-30
ref|WP_019563420.1|  hypothetical protein [Thioalkalivibrio sp...    122   4e-30
ref|WP_031805829.1|  acetoin utilization protein [Pseudomonas ...    123   4e-30
ref|WP_012545634.1|  acetoin utilization protein [Thermodesulf...    122   4e-30
ref|WP_008688502.1|  histone deacetylase/AcuC/AphA family prot...    122   4e-30
ref|WP_019627599.1|  hypothetical protein [Thioalkalivibrio sp...    122   4e-30
ref|WP_008615654.1|  histone deacetylase superfamily protein [...    122   4e-30
ref|WP_018907376.1|  deacetylase [Variovorax paradoxus]              123   4e-30
ref|WP_011809851.1|  deacetylase [Verminephrobacter eiseniae]        122   5e-30
ref|WP_017840278.1|  acetoin utilization protein [Methylomicro...    122   5e-30
ref|WP_014954996.1|  histone deacetylase family protein [alpha...    122   5e-30
ref|WP_031628574.1|  acetoin utilization protein [Pseudomonas ...    124   5e-30
ref|WP_011484054.1|  deacetylase [Polaromonas sp. JS666]             122   5e-30
ref|WP_013638116.1|  acetoin utilization protein [Desulfurobac...    122   5e-30
ref|WP_019593574.1|  hypothetical protein [Thioalkalivibrio sp...    122   5e-30
ref|WP_023128281.1|  acetylpolyamine aminohydrolase [Pseudomon...    123   6e-30
ref|WP_024915454.1|  acetoin utilization protein [Pseudomonas ...    123   6e-30
ref|WP_015955520.1|  hypothetical protein [Cyanothece sp. PCC ...    122   6e-30
gb|ETX03275.1|  hypothetical protein ETSY1_00550 [Candidatus E...    122   6e-30
ref|WP_012444237.1|  acetoin utilization protein [Xanthomonas ...    122   6e-30
ref|WP_018048566.1|  hypothetical protein [Nitrospina sp. AB-6...    122   6e-30
ref|WP_031688676.1|  acetoin utilization protein [Pseudomonas ...    123   6e-30
gb|KGK57655.1|  acetoin utilization protein [Xanthomonas sp. N...    122   7e-30
ref|WP_023105997.1|  acetylpolyamine aminohydrolase [Pseudomon...    123   7e-30
ref|WP_011682089.1|  histone deacetylase [Candidatus Solibacte...    122   7e-30
ref|WP_007546966.1|  histone deacetylase 5 [Sulfurihydrogenibi...    119   7e-30
ref|WP_012933337.1|  histone deacetylase [Conexibacter woesei]       122   7e-30
ref|WP_011805969.1|  deacetylase [Acidovorax sp. JS42]               122   7e-30
ref|WP_024745661.1|  acetoin utilization protein [Xanthomonas ...    122   7e-30
ref|WP_015913716.1|  deacetylase [Acidovorax ebreus]                 122   7e-30
ref|WP_014502063.1|  acetoin utilization protein [Xanthomonas ...    122   7e-30
ref|WP_023436243.1|  acetoin utilization protein [Pseudomonas ...    123   7e-30
ref|WP_015202034.1|  histone deacetylase superfamily protein [...    122   7e-30
ref|WP_007732642.1|  acetoin utilization protein [Burkholderia...    122   7e-30
emb|CDW94580.1|  putative Histone deacetylase superfamily prot...    122   7e-30
ref|WP_009784637.1|  hypothetical protein [Lyngbya sp. PCC 8106]     122   7e-30
gb|KES23249.1|  acetoin utilization protein [Pseudomonas sp. AAC]    123   7e-30
ref|WP_015942273.1|  histone deacetylase [Chloroflexus aggregans]    122   8e-30
ref|WP_027704107.1|  acetoin utilization protein [Xanthomonas ...    122   8e-30
ref|WP_011409336.1|  acetoin utilization protein [Xanthomonas ...    122   8e-30
ref|WP_003105893.1|  acetoin utilization protein [Pseudomonas ...    123   8e-30
ref|WP_010505106.1|  histone deacetylase family protein [gamma...    122   8e-30
ref|WP_017148409.1|  acetoin utilization protein [Pseudomonas ...    123   8e-30
ref|WP_005918245.1|  acetoin utilization family protein [Xanth...    121   8e-30
ref|WP_020027775.1|  hypothetical protein [gamma proteobacteri...    122   8e-30
ref|WP_018176322.1|  hypothetical protein [Thioalkalivibrio sp...    122   8e-30
ref|WP_005433117.1|  histone deacetylase [Sutterella wadsworth...    122   8e-30
ref|WP_027015385.1|  deacetylase [Comamonas composti]                122   8e-30
ref|WP_020150973.1|  hypothetical protein [Verrucomicrobia bac...    122   9e-30
gb|KFB52134.1|  AGAP000532-PA-like protein [Anopheles sinensis]      127   9e-30
ref|WP_006511603.1|  deacetylase, histone deacetylase/acetoin ...    122   9e-30
ref|WP_005921104.1|  MULTISPECIES: histone deacetylase [Xantho...    122   9e-30
ref|WP_005925835.1|  acetoin utilization protein [Xanthomonas ...    122   9e-30
ref|WP_012074587.1|  acetoin utilization protein [Pseudomonas ...    123   9e-30
gb|KGT57207.1|  acetoin utilization protein [Xanthomonas axono...    121   9e-30
ref|WP_015649468.1|  MULTISPECIES: acetylpolyamine aminohydrol...    123   9e-30
ref|WP_020394702.1|  hypothetical protein [Thiothrix disciformis]    122   9e-30
ref|WP_010367461.1|  acetoin utilization protein [Xanthomonas ...    122   9e-30
ref|WP_014148184.1|  acetoin utilization protein [Methylomicro...    122   9e-30
ref|WP_003119301.1|  acetoin utilization protein [Pseudomonas ...    123   9e-30
ref|WP_003092720.1|  acetoin utilization protein [Pseudomonas ...    123   9e-30
ref|WP_003113816.1|  MULTISPECIES: acetoin utilization protein...    123   1e-29
ref|WP_003109799.1|  acetoin utilization protein [Pseudomonas ...    123   1e-29
ref|WP_009876956.1|  acetoin utilization protein [Pseudomonas ...    123   1e-29
gb|KGK65681.1|  acetoin utilization protein [Xanthomonas axono...    121   1e-29
ref|WP_006913991.1|  histone deacetylase [Salinisphaera shaban...    122   1e-29
ref|WP_004345616.1|  acetoin utilization protein [Pseudomonas ...    122   1e-29
ref|WP_023105068.1|  acetylpolyamine aminohydrolase [Pseudomon...    122   1e-29
ref|WP_033482692.1|  acetoin utilization protein [Xanthomonas ...    121   1e-29
ref|WP_023065068.1|  histone deacetylase domain protein [Lyngb...    122   1e-29
ref|WP_017157310.1|  acetoin utilization protein [Xanthomonas ...    121   1e-29
ref|WP_033481464.1|  acetoin utilization protein [Xanthomonas ...    121   1e-29
ref|WP_031638748.1|  acetoin utilization protein [Pseudomonas ...    122   1e-29
ref|WP_023099260.1|  acetylpolyamine aminohydrolase [Pseudomon...    122   1e-29
ref|WP_033837608.1|  acetoin utilization protein [Xanthomonas ...    121   1e-29
ref|WP_011050585.1|  MULTISPECIES: acetoin utilization protein...    121   1e-29
ref|WP_023125380.1|  acetylpolyamine aminohydrolase [Pseudomon...    122   1e-29
ref|WP_009313474.1|  acetoin utilization protein [Pseudomonas ...    122   1e-29
gb|KFZ44710.1|  histone deacetylase [Smithella sp. D17]              122   1e-29
ref|WP_007965241.1|  acetoin utilization protein [Xanthomonas ...    121   1e-29
ref|WP_024929032.1|  acetoin utilization protein [Pseudomonas ...    122   1e-29
ref|WP_033865739.1|  acetoin utilization protein [Pseudomonas ...    122   1e-29
ref|WP_023092545.1|  acetylpolyamine aminohydrolase [Pseudomon...    122   1e-29
ref|WP_019681640.1|  acetoin utilization protein [Pseudomonas ...    122   1e-29
ref|WP_023097276.1|  acetylpolyamine aminohydrolase [Pseudomon...    122   1e-29
gb|KHA79030.1|  deacetylase [Janthinobacterium lividum]              121   1e-29
ref|WP_007576486.1|  histone deacetylase [Patulibacter sp. I11]      122   1e-29
ref|WP_010340005.1|  acetoin utilization protein [Xanthomonas ...    121   1e-29
emb|CDW84653.1|  histone deacetylase family protein [Stylonych...    124   1e-29
gb|KFO66981.1|  histone deacetylase [Smithella sp. SCADC]            122   1e-29
ref|WP_017165215.1|  acetoin utilization protein [Xanthomonas ...    121   1e-29
gb|KDR41884.1|  acetoin utilization protein [Burkholderia glat...    121   1e-29
ref|WP_014102363.1|  acetoin utilization protein [Micavibrio a...    121   1e-29
ref|WP_007909035.1|  Histone deacetylase [Ktedonobacter racemi...    122   1e-29
ref|WP_024891295.1|  acetoin utilization protein [Luteimonas s...    121   1e-29
ref|WP_022558363.1|  putative histone deacetylase superfamily ...    121   1e-29
ref|WP_010881382.1|  acetoin utilization protein [Aquifex aeol...    121   1e-29
gb|EKD41915.1|  histone deacetylase family protein [uncultured...    121   1e-29
ref|WP_015139938.1|  deacetylase [Nostoc sp. PCC 7524]               121   1e-29
ref|WP_006713135.1|  acetylspermidine deacetylase [Herbaspiril...    121   1e-29
ref|WP_026105792.1|  acetoin utilization protein [Methylobacte...    121   1e-29
ref|WP_009407268.1|  histone deacetylase family protein [Pseud...    122   2e-29
gb|KCW48916.1|  hypothetical protein EUGRSUZ_K02530 [Eucalyptu...    124   2e-29
ref|WP_016917899.1|  hypothetical protein [Methylocystis parvus]     122   2e-29
ref|WP_003137874.1|  acetoin utilization protein [Pseudomonas ...    122   2e-29
ref|WP_010460097.1|  deacetylase [Acidovorax radicis]                121   2e-29
ref|WP_031685442.1|  acetoin utilization protein [Pseudomonas ...    122   2e-29
ref|WP_008906102.1|  deacetylase [Acidovorax sp. NO-1]               121   2e-29
ref|WP_020024487.1|  hypothetical protein [gamma proteobacteri...    121   2e-29
ref|WP_013540685.1|  deacetylase [Variovorax paradoxus]              121   2e-29
gb|EVT84626.1|  acetoin utilization protein [Pseudomonas aerug...    122   2e-29
ref|WP_014401881.1|  acetoin utilization protein [Frateuria au...    121   2e-29
ref|WP_026787457.1|  MULTISPECIES: hypothetical protein [Plank...    121   2e-29
ref|XP_007037563.1|  Histone deacetylase 5 isoform 3 [Theobrom...    124   2e-29
ref|WP_015245255.1|  acetoin utilization protein [Singulisphae...    121   2e-29
gb|ETX06924.1|  hypothetical protein ETSY2_14215 [Candidatus E...    121   2e-29
ref|XP_007037562.1|  Histone deacetylase 5 isoform 2 [Theobrom...    124   2e-29
ref|WP_018262505.1|  acetoin utilization protein [Methylobacte...    121   2e-29
ref|WP_020877773.1|  Histone deacetylase domain containing pro...    121   2e-29
ref|WP_029219136.1|  acetoin utilization protein [Xanthomonas ...    120   2e-29
ref|WP_002646288.1|  acetoin utilization protein [Planctomyces...    120   2e-29
ref|WP_017717995.1|  hypothetical protein [Oscillatoria sp. PC...    120   2e-29
ref|WP_012330943.1|  acetoin utilization protein [Methylobacte...    121   2e-29
ref|WP_007882159.1|  deacetylase [Herbaspirillum sp. CF444]          120   2e-29
gb|KGE53185.1|  acetoin utilization protein [Xanthomonas axono...    120   2e-29
ref|WP_010845332.1|  acetoin utilization protein [Xenorhabdus ...    121   3e-29
ref|WP_013519190.1|  deacetylase [Alicycliphilus denitrificans]      120   3e-29
ref|WP_008910304.1|  histone deacetylase family protein [Provi...    121   3e-29
ref|WP_026097672.1|  hypothetical protein [Geitlerinema sp. PC...    120   3e-29
ref|WP_027864814.1|  deacetylase [Massilia alkalitolerans]           120   3e-29
ref|WP_008177803.1|  hypothetical protein [Moorea producens]         120   3e-29
gb|AIQ90874.1|  Histone deacetylase superfamily protein [Methy...    120   3e-29
ref|XP_007037561.1|  Histone deacetylase 5 isoform 1 [Theobrom...    124   3e-29
ref|XP_003524633.1|  PREDICTED: histone deacetylase 5-like [Gl...    124   3e-29
gb|KCW48915.1|  hypothetical protein EUGRSUZ_K02530 [Eucalyptu...    124   3e-29
gb|KCW48913.1|  hypothetical protein EUGRSUZ_K02530 [Eucalyptu...    124   3e-29
ref|WP_019656062.1|  deacetylase [Variovorax paradoxus]              120   3e-29
ref|WP_024878837.1|  acetoin utilization protein [Methylosinus...    121   3e-29
gb|KCW48914.1|  hypothetical protein EUGRSUZ_K02530 [Eucalyptu...    124   3e-29
ref|WP_015181038.1|  deacetylase [Microcoleus sp. PCC 7113]          120   3e-29
ref|WP_028100419.1|  deacetylase [Duganella violaceinigra]           120   3e-29
ref|WP_015214091.1|  histone deacetylase superfamily [Anabaena...    120   4e-29
ref|WP_017314398.1|  hypothetical protein [Mastigocladopsis re...    120   4e-29
ref|WP_023788623.1|  histone deacetylase [Hyphomicrobium nitra...    120   4e-29
ref|WP_028580642.1|  histone deacetylase [Desulfobulbus japoni...    120   4e-29
ref|WP_005995142.1|  acetoin utilization protein [Xanthomonas ...    120   4e-29
ref|WP_007970928.1|  acetoin utilization family protein [Xanth...    120   4e-29
ref|WP_028076630.1|  histone deacetylase [Solirubrobacterales ...    120   4e-29
ref|WP_013218883.1|  histone deacetylase superfamily protein [...    120   4e-29
emb|CDL87015.1|  Histone deacetylase-like amidohydrolase [Xeno...    121   4e-29
ref|WP_027844671.1|  hypothetical protein [Mastigocoleus testa...    120   4e-29
ref|WP_012626257.1|  hypothetical protein [Cyanothece sp. PCC ...    120   4e-29
ref|WP_008576401.1|  MULTISPECIES: acetoin utilization protein...    120   4e-29
ref|WP_013811381.1|  MULTISPECIES: acetoin utilization protein...    120   5e-29
ref|WP_013055799.1|  histone deacetylase family protein [Bacil...    120   5e-29
ref|WP_018401180.1|  hypothetical protein [gamma proteobacteri...    120   5e-29
gb|KFC63058.1|  Deacetylase, histone deacetylase/acetoin utili...    120   5e-29
ref|WP_026797382.1|  hypothetical protein [Planktothrix prolif...    120   5e-29
ref|WP_013595374.1|  deacetylase [Acidovorax avenae]                 120   5e-29
ref|WP_012590343.1|  histone deacetylase [Methylocella silvest...    120   5e-29
ref|XP_010037237.1|  PREDICTED: histone deacetylase 5-like iso...    123   5e-29
ref|WP_009342502.1|  hypothetical protein [Raphidiopsis brookii]     119   5e-29
ref|WP_014089438.1|  acetoin utilization protein [Xanthomonas ...    119   6e-29
gb|KGT49573.1|  acetoin utilization protein [Xanthomonas axono...    119   6e-29
ref|XP_010037236.1|  PREDICTED: histone deacetylase 5-like iso...    123   6e-29
ref|WP_019895557.1|  hypothetical protein [Thiomicrospira halo...    120   6e-29
ref|WP_028080460.1|  deacetylase [Solimonas soli]                    120   6e-29
ref|WP_015823825.1|  acetoin utilization protein [Methylobacte...    120   6e-29
ref|XP_002280859.2|  PREDICTED: histone deacetylase 5-like [Vi...    122   6e-29
ref|WP_015206548.1|  deacetylase, histone deacetylase/acetoin ...    119   7e-29
ref|WP_028585142.1|  histone deacetylase [Desulfobulbus medite...    120   8e-29
gb|KGR41098.1|  acetoin utilization protein [Xanthomonas vasic...    119   8e-29
ref|WP_008704511.1|  histone deacetylase/AcuC/AphA family prot...    119   8e-29
ref|WP_026222814.1|  acetoin utilization protein [Methylocysti...    119   8e-29
dbj|BAO36842.1|  putative deacetylase [Serratia marcescens SM39]     120   9e-29
ref|WP_026793463.1|  MULTISPECIES: hypothetical protein [Plank...    119   9e-29
ref|WP_006276481.1|  hypothetical protein [Cylindrospermopsis ...    119   9e-29
ref|WP_004949846.1|  acetoin utilization protein [Serratia ply...    120   9e-29
ref|WP_014892455.1|  acetoin utilization protein [Methylocysti...    119   9e-29
ref|XP_003550702.1|  PREDICTED: histone deacetylase 5-like [Gl...    122   9e-29
ref|WP_026191135.1|  acetoin utilization protein [Methylosinus...    119   1e-28
gb|AHY05538.1|  acetoin utilization protein [Serratia plymuthica]    120   1e-28
ref|WP_012301415.1|  histone deacetylase superfamily protein [...    119   1e-28
gb|KFC11787.1|  Histone deacetylase domain containing protein ...    120   1e-28
ref|XP_008612259.1|  hypothetical protein SDRG_08167 [Saproleg...    121   1e-28
ref|WP_009851916.1|  histone deacetylase [beta proteobacterium...    119   1e-28
ref|WP_010381622.1|  acetoin utilization protein [Xanthomonas ...    119   1e-28
gb|AGW45507.1|  histone deacetylase [uncultured bacterium Lac36W]    115   1e-28
ref|WP_005881350.1|  acetoin utilization protein [Oxalobacter ...    119   1e-28
ref|WP_003770466.1|  deacetylase [Neisseria elongata]                119   1e-28
gb|KGA11813.1|  hypothetical protein GM46_2790 [actinobacteriu...    119   1e-28
ref|WP_002644687.1|  acetoin utilization protein [Planctomyces...    119   1e-28
ref|WP_009099549.1|  histone deacetylase [Halomonas sp. GFAJ-1]      119   1e-28
ref|WP_015419451.1|  MULTISPECIES: histone deacetylase superfa...    119   1e-28
ref|WP_008107365.1|  histone deacetylase [Methylophilales bact...    119   2e-28
ref|WP_012829146.1|  histone deacetylase [Haliangium ochraceum]      119   2e-28
ref|WP_006323450.1|  acetoin utilization protein [Serratia ply...    119   2e-28
ref|WP_012464740.1|  deacetylase [Methylacidiphilum infernorum]      118   2e-28
ref|WP_012123340.1|  histone deacetylase superfamily protein [...    119   2e-28
ref|WP_022099977.1|  histone deacetylase family protein [Prote...    118   2e-28
gb|EKD52505.1|  histone deacetylase family protein [uncultured...    118   2e-28
ref|WP_008811105.1|  histone deacetylase [Burkholderiales bact...    118   2e-28
ref|WP_013938397.1|  histone deacetylase [Myxococcus fulvus]         119   2e-28
ref|WP_002655022.1|  acetoin utilization protein [Blastopirell...    118   2e-28
gb|EXU78796.1|  deacetylase [Comamonas aquatica DA1877]              118   2e-28
ref|WP_008959930.1|  histone deacetylase [Halomonas sp. HAL1]        119   2e-28
ref|WP_009724941.1|  histone deacetylase [Halomonas sp. TD01]        119   2e-28
emb|CBA33065.1|  hypothetical protein Csp_B17170 [Curvibacter ...    118   2e-28
ref|WP_010919933.1|  acetoin utilization protein [Caulobacter ...    118   2e-28
ref|WP_026370124.1|  histone deacetylase [bacterium JKG1]            119   2e-28
ref|WP_007304300.1|  hypothetical protein [Crocosphaera watsonii]    118   2e-28
ref|WP_017341875.1|  acetoin utilization protein [Halorubrum s...    118   2e-28
ref|XP_004775450.1|  PREDICTED: histone deacetylase 10 isoform...    120   2e-28
gb|KDO30444.1|  hypothetical protein SPRG_04346 [Saprolegnia p...    119   2e-28
ref|WP_012165624.1|  hypothetical protein [Acaryochloris marina]     118   2e-28
ref|XP_008613834.1|  hypothetical protein SDRG_09664 [Saproleg...    119   2e-28
gb|KFB87193.1|  acetoin utilization protein [Serratia grimesii]      119   2e-28
ref|WP_023472941.1|  Histone deacetylase-like amidohydrolase [...    119   2e-28
ref|WP_008366571.1|  histone deacetylase superfamily protein [...    118   2e-28
emb|CDF83788.1|  Histone deacetylase-like amidohydrolase [Pseu...    119   3e-28
ref|WP_015376519.1|  histone deacetylase superfamily protein [...    119   3e-28
emb|CDG15248.1|  putative deacetylase [Serratia marcescens sub...    119   3e-28
ref|WP_013707185.1|  histone deacetylase [Desulfobacca acetoxi...    118   3e-28
emb|CAN69024.1|  hypothetical protein VITISV_041025 [Vitis vin...    116   3e-28
ref|WP_013826593.1|  histone deacetylase [Methanobacterium sp....    118   3e-28
ref|WP_015225893.1|  histone deacetylase superfamily protein [...    118   3e-28
ref|WP_016835969.1|  deacetylase [Herbaspirillum lusitanum]          117   3e-28
ref|XP_007510620.1|  histone deacetylase superfamily [Bathycoc...    119   3e-28
ref|WP_023866273.1|  acetoin utilization protein [Mycobacteriu...    117   3e-28
ref|WP_019398277.1|  acetoin utilization protein [Pseudoxantho...    117   3e-28
ref|WP_033631712.1|  acetoin utilization protein [Serratia nem...    118   3e-28
ref|WP_004599098.1|  histone deacetylase superfamily protein [...    118   3e-28
ref|WP_028688785.1|  acetoin utilization protein [Pseudomonas ...    118   3e-28
ref|WP_026912796.1|  histone deacetylase [Patulibacter minaton...    118   4e-28
ref|WP_008051126.1|  hypothetical protein [Arthrospira sp. PCC...    117   4e-28
ref|WP_012779183.1|  acetoin utilization protein [Methylobacte...    118   4e-28
ref|WP_032450695.1|  acetoin utilization protein [Brucella pin...    114   4e-28
ref|WP_007995377.1|  histone deacetylase superfamily protein [...    118   4e-28
ref|WP_017951988.1|  hypothetical protein [Nitrospina sp. SCGC...    117   4e-28
ref|XP_008374622.1|  PREDICTED: histone deacetylase 5-like iso...    120   4e-28
ref|XP_008374623.1|  PREDICTED: histone deacetylase 5-like iso...    120   4e-28
ref|WP_012204307.1|  MULTISPECIES: deacetylase [Delftia]             117   4e-28
ref|WP_022817374.1|  histone deacetylase [Candidatus Latesciba...    117   4e-28
ref|WP_020771501.1|  histone deacetylase family protein [Lepto...    117   4e-28
ref|XP_008374621.1|  PREDICTED: histone deacetylase 5-like iso...    120   4e-28
ref|WP_007831641.1|  deacetylase [Variovorax sp. CF313]              117   5e-28
ref|WP_029707238.1|  deacetylase [Rhodoferax saidenbachensis]        117   5e-28
ref|WP_024912104.1|  acetoin utilization protein [Serratia fon...    118   5e-28
ref|WP_011697803.1|  histone deacetylase [Syntrophobacter fuma...    117   5e-28
ref|WP_013182324.1|  histone deacetylase [Waddlia chondrophila]      117   5e-28
ref|XP_009338347.1|  PREDICTED: histone deacetylase 5 [Pyrus x...    120   5e-28
gb|KFF80628.1|  acetoin utilization protein [Serratia marcescens]    118   5e-28
ref|WP_014159919.1|  acetoin utilization protein [Pseudoxantho...    117   5e-28
ref|WP_021505266.1|  acetoin utilization protein [Serratia mar...    118   5e-28
ref|WP_006111497.1|  histone deacetylase superfamily protein [...    117   6e-28
dbj|GAK28717.1|  acetoin utilization protein [Serratia liquefa...    118   6e-28
ref|WP_019454943.1|  acetoin utilization protein [Serratia mar...    118   6e-28
ref|WP_033636961.1|  acetoin utilization protein [Serratia mar...    117   6e-28
ref|WP_033648541.1|  acetoin utilization protein [Serratia mar...    117   6e-28
ref|XP_008450330.1|  PREDICTED: histone deacetylase 15 isoform...    119   6e-28
gb|KGZ12016.1|  acetoin utilization protein [Serratia marcescens]    117   6e-28
gb|KGY44428.1|  acetoin utilization protein [Serratia marcescens]    117   6e-28
ref|WP_033652844.1|  acetoin utilization protein [Serratia mar...    117   6e-28
ref|WP_006616699.1|  hypothetical protein [Arthrospira platensis]    117   6e-28
ref|WP_007345758.1|  histone deacetylase superfamily protein [...    117   6e-28
ref|WP_033641755.1|  acetoin utilization protein [Serratia mar...    117   7e-28
ref|WP_015228292.1|  deacetylase [Dactylococcopsis salina]           117   7e-28
ref|WP_010682563.1|  histone deacetylase superfamily protein [...    116   7e-28
ref|XP_007210868.1|  hypothetical protein PRUPE_ppa003353mg [P...    119   7e-28
ref|WP_016449705.1|  hypothetical protein [Delftia acidovorans]      117   7e-28
ref|WP_008446255.1|  histone deacetylase domain-containing pro...    117   7e-28
ref|WP_009951914.1|  histone deacetylase superfamily protein [...    115   7e-28
ref|WP_022855316.1|  histone deacetylase [Thermodesulfobacteri...    117   7e-28
ref|WP_016543952.1|  histone deacetylase family protein [Lepto...    117   7e-28
ref|WP_033651377.1|  acetoin utilization protein [Serratia mar...    117   8e-28
ref|WP_029649837.1|  acetoin utilization protein [Methylocysti...    117   8e-28
ref|WP_012459887.1|  acetoin utilization protein [Sulfurihydro...    116   8e-28
ref|WP_026731922.1|  hypothetical protein [Fischerella sp. PCC...    116   8e-28
ref|XP_008393227.1|  PREDICTED: histone deacetylase 5-like [Ma...    120   8e-28
ref|WP_028841268.1|  histone deacetylase [Thermodesulfobacteri...    117   8e-28
ref|WP_008313277.1|  deacetylase, histone deacetylase/acetoin ...    116   8e-28
ref|WP_006624587.1|  MULTISPECIES: hypothetical protein [Arthr...    116   9e-28
ref|WP_004933203.1|  histone deacetylase superfamily protein [...    117   9e-28
ref|XP_008374620.1|  PREDICTED: histone deacetylase 5-like iso...    120   9e-28
ref|XP_008374619.1|  PREDICTED: histone deacetylase 5-like iso...    120   9e-28
ref|XP_008240023.1|  PREDICTED: histone deacetylase 5 [Prunus ...    120   9e-28
ref|WP_017891518.1|  acetoin utilization protein [Serratia sp....    117   9e-28
ref|WP_009664464.1|  deacetylase [Oxalobacteraceae bacterium I...    116   1e-27
ref|WP_033638805.1|  acetoin utilization protein [Serratia mar...    117   1e-27
ref|WP_016929203.1|  acetoin utilization protein [Serratia mar...    117   1e-27
ref|XP_009130142.1|  PREDICTED: histone deacetylase 5-like [Br...    117   1e-27
ref|WP_012410527.1|  hypothetical protein [Nostoc punctiforme]       116   1e-27
gb|KFB81602.1|  hypothetical protein IJ00_00695 [Calothrix sp....    116   1e-27
gb|KDO65744.1|  hypothetical protein CISIN_1g006415mg [Citrus ...    119   1e-27
ref|WP_008444328.1|  histone deacetylase superfamily protein [...    116   1e-27
gb|KDO65743.1|  hypothetical protein CISIN_1g006415mg [Citrus ...    119   1e-27
ref|XP_006477661.1|  PREDICTED: histone deacetylase 5-like iso...    119   1e-27
ref|XP_006477662.1|  PREDICTED: histone deacetylase 5-like iso...    119   1e-27
gb|EUA55169.1|  histone deacetylase domain protein [Mycobacter...    115   1e-27
ref|WP_008287966.1|  acetoin utilization protein [Hydrogenivir...    116   1e-27
ref|XP_006282097.1|  hypothetical protein CARUB_v10028344mg [C...    119   1e-27
ref|WP_003710468.1|  histone deacetylase family protein [Neiss...    115   1e-27
ref|WP_008594111.1|  histone deacetylase [Leptospira licerasiae]     116   1e-27
ref|WP_015195335.1|  histone deacetylase superfamily [Stanieri...    116   1e-27
gb|EYU23516.1|  hypothetical protein MIMGU_mgv1a021496mg [Mimu...    117   1e-27
gb|AIM20175.1|  histone deacetylase superfamily protein [Serra...    117   1e-27
ref|WP_026381745.1|  acetoin utilization protein [Afifella pfe...    117   1e-27
ref|WP_013190062.1|  hypothetical protein [Trichormus azollae]       116   1e-27
ref|WP_012513899.1|  acetoin utilization protein [Hydrogenobac...    116   1e-27
ref|WP_020200995.1|  deacetylase [Cupriavidus sp. WS]                116   1e-27
ref|WP_003599296.1|  acetoin utilization protein [Methylobacte...    115   1e-27
ref|WP_012005069.1|  acetoin utilization protein [Serratia pro...    117   1e-27
ref|WP_015823258.1|  acetoin utilization protein [Methylobacte...    115   1e-27
ref|WP_013537339.1|  acetoin utilization protein [Thermovibrio...    115   1e-27
ref|XP_008794183.1|  PREDICTED: histone deacetylase 5-like iso...    119   1e-27
gb|KFA93345.1|  histone deacetylase [Cystobacter violaceus Cb ...    116   1e-27
gb|AHY60235.1|  acetoin utilization protein [Stenotrophomonas ...    115   2e-27
ref|WP_013335995.1|  histone deacetylase [Vulcanisaeta distrib...    116   2e-27
ref|WP_005554467.1|  histone deacetylase [Natronococcus amylol...    116   2e-27
ref|XP_008450328.1|  PREDICTED: histone deacetylase 15 isoform...    118   2e-27
ref|WP_005797080.1|  deacetylase [Acidovorax delafieldii]            115   2e-27
gb|EPS65120.1|  hypothetical protein M569_09656 [Genlisea aurea]     119   2e-27
ref|XP_008791310.1|  PREDICTED: histone deacetylase 5-like [Ph...    119   2e-27
ref|XP_008450327.1|  PREDICTED: histone deacetylase 15 isoform...    118   2e-27
ref|WP_013605090.1|  histone deacetylase [Vulcanisaeta moutnov...    116   2e-27
ref|WP_013296361.1|  hypothetical protein [Methanothermobacter...    116   2e-27
gb|KAJ57140.1|  acetoin utilization protein [Actibacterium muc...    115   2e-27
ref|WP_015168674.1|  deacetylase [Synechococcus sp. PCC 7502]        115   2e-27
ref|WP_011555859.1|  histone deacetylase [Myxococcus xanthus]        116   2e-27
ref|WP_015175515.1|  histone deacetylase superfamily [Oscillat...    115   2e-27
ref|WP_002725819.1|  acetoin utilization protein [Phaeospirill...    115   2e-27
gb|KGO34719.1|  histone deacetylase [Desulfobulbus sp. Tol-SR]       115   2e-27
ref|WP_016862183.1|  hypothetical protein [Fischerella muscicola]    115   2e-27
ref|WP_006629281.1|  histone deacetylase superfamily protein [...    116   2e-27
ref|WP_021832038.1|  Deacetylases, including yeast histone dea...    115   2e-27
ref|XP_008794175.1|  PREDICTED: histone deacetylase 5-like iso...    119   2e-27
emb|CCB91684.1|  uncharacterized protein slr0245 [Waddlia chon...    115   2e-27
gb|KFE82273.1|  Acetylspermidine deacetylase [Sandaracinus amy...    116   2e-27
ref|XP_010456946.1|  PREDICTED: histone deacetylase 5-like [Ca...    119   2e-27
ref|WP_013534285.1|  acetoin utilization protein [Pseudoxantho...    115   2e-27
ref|WP_018290638.1|  hypothetical protein [Verrucomicrobium sp...    115   2e-27
ref|WP_027616359.1|  acetoin utilization protein [Pseudomonas ...    116   2e-27
ref|XP_004775449.1|  PREDICTED: histone deacetylase 10 isoform...    118   2e-27
gb|EGH71408.1|  putative acetylpolyamine aminohydrolase [Pseud...    114   2e-27
gb|KGK79240.1|  acetoin utilization protein [Thalassobacter st...    116   2e-27
ref|WP_023877686.1|  acetoin utilization protein [Mycobacteriu...    114   2e-27
ref|XP_006280162.1|  hypothetical protein CARUB_v10026060mg [C...    118   2e-27
ref|WP_008864769.1|  histone deacetylase [Parasutterella excre...    115   3e-27
ref|WP_021867519.1|  histone deacetylase family protein [Paras...    115   3e-27
emb|CCQ69898.1|  hypothetical protein CWATWH0402_1463 [Crocosp...    114   3e-27
ref|WP_025122118.1|  MULTISPECIES: acetoin utilization protein...    115   3e-27
gb|AIE72947.1|  Acetylspermidine deacetylase [Synechocystis sp...    115   3e-27
gb|AAS48345.1|  histone deacetylase 10 [Homo sapiens]                116   3e-27
ref|WP_011628086.1|  acetoin utilization protein [Alkalilimnic...    115   3e-27
ref|XP_006280161.1|  hypothetical protein CARUB_v10026060mg [C...    118   3e-27
gb|KGA10523.1|  putative deacetylase [actinobacterium acAcidi]       115   3e-27
gb|EAW73520.1|  histone deacetylase 10, isoform CRA_j [Homo sa...    116   3e-27
ref|WP_021179176.1|  Deacetylase [Serratia fonticola]                115   3e-27
gb|ERW02156.1|  acetylpolyamine aminohydrolase [Pseudomonas ae...    115   3e-27
ref|WP_011371206.1|  histone deacetylase superfamily protein [...    115   3e-27
ref|XP_009788039.1|  PREDICTED: histone deacetylase 5 [Nicotia...    118   3e-27
ref|XP_004818837.1|  PREDICTED: histone deacetylase 10 isoform...    118   3e-27
ref|XP_008450329.1|  PREDICTED: histone deacetylase 15 isoform...    117   3e-27
ref|XP_004172668.1|  PREDICTED: histone deacetylase 5-like [Cu...    115   3e-27
ref|XP_004775444.1|  PREDICTED: histone deacetylase 10 isoform...    118   3e-27
ref|XP_004775445.1|  PREDICTED: histone deacetylase 10 isoform...    118   3e-27
ref|WP_010481054.1|  hypothetical protein [Acaryochloris sp. C...    115   4e-27
ref|WP_017911143.1|  MULTISPECIES: acetoin utilization protein...    114   4e-27
ref|WP_014656437.1|  acetoin utilization protein [Providencia ...    115   4e-27
ref|WP_023175702.1|  histone deacetylase superfamily protein [...    115   4e-27
ref|WP_009556513.1|  deacetylase, histone deacetylase/acetoin ...    115   4e-27
ref|WP_003601174.1|  histone deacetylase [Methylobacterium ext...    115   4e-27
ref|WP_013909241.1|  histone deacetylase [Thermodesulfobacteri...    115   4e-27
ref|XP_004818836.1|  PREDICTED: histone deacetylase 10 isoform...    118   4e-27
ref|WP_022549755.1|  Histone deacetylase-like amidohydrolase [...    115   4e-27
ref|WP_028915967.1|  acetoin utilization protein [Pseudoxantho...    114   4e-27
gb|KGM38425.1|  histone deacetylase [Spirochaeta sp. JC202]          115   4e-27
emb|CDG88514.1|  Histone deacetylase-like amidohydrolase (HDAC...    115   4e-27
ref|WP_015078869.1|  histone deacetylase-like protein [Anabaen...    114   4e-27
ref|WP_006515433.1|  deacetylase, histone deacetylase/acetoin ...    115   4e-27
ref|XP_010443925.1|  PREDICTED: histone deacetylase 18-like [C...    118   4e-27
ref|WP_026719340.1|  hypothetical protein [Fischerella sp. PCC...    114   4e-27
ref|XP_009130144.1|  PREDICTED: histone deacetylase 5-like [Br...    117   4e-27
gb|EYU23514.1|  hypothetical protein MIMGU_mgv1a023963mg [Mimu...    115   4e-27
ref|WP_020705507.1|  deacetylase [Oxalobacteraceae bacterium A...    114   5e-27
ref|XP_004775447.1|  PREDICTED: histone deacetylase 10 isoform...    117   5e-27
ref|WP_022930264.1|  histone deacetylase [Patulibacter america...    115   5e-27
ref|WP_004407194.1|  acetoin utilization protein [Vibrio nigri...    115   5e-27
ref|WP_007313175.1|  hypothetical protein [Crocosphaera watsonii]    114   5e-27
ref|XP_008701088.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...    117   5e-27
ref|XP_009215839.1|  PREDICTED: histone deacetylase 10 isoform...    116   5e-27
ref|WP_024452634.1|  acetoin utilization protein [Mycobacteriu...    115   5e-27
ref|XP_010483771.1|  PREDICTED: histone deacetylase 5-like [Ca...    117   6e-27
ref|WP_004922079.1|  acetoin utilization protein [Providencia ...    115   6e-27
ref|WP_015498768.1|  histone deacetylase [Octadecabacter antar...    115   6e-27
gb|EFA83888.1|  hypothetical protein PPL_02958 [Polysphondyliu...    118   6e-27
ref|XP_004775448.1|  PREDICTED: histone deacetylase 10 isoform...    117   6e-27
ref|XP_010265267.1|  PREDICTED: histone deacetylase 15 isoform...    117   6e-27
gb|EJY88672.1|  Histone deacetylase family protein [Oxytricha ...    117   6e-27
ref|WP_027948019.1|  histone deacetylase [Halomonas anticarien...    115   6e-27
ref|WP_015319585.1|  deacetylase, histone deacetylase/acetoin ...    114   6e-27
ref|WP_027336116.1|  histone deacetylase [Halomonas sp. HL-48]       115   7e-27
ref|WP_012083265.1|  acetoin utilization protein [Sulfurovum s...    114   7e-27
ref|WP_014810581.1|  deacetylase, histone deacetylase/acetoin ...    114   7e-27
ref|WP_006563408.1|  histone deacetylase [Oscillochloris trich...    114   7e-27
ref|WP_008582798.1|  histone deacetylase superfamily protein [...    114   7e-27
ref|WP_017366162.1|  acetoin utilization protein [Methylococcu...    114   7e-27
ref|XP_010359543.1|  PREDICTED: histone deacetylase 10 isoform...    116   7e-27
ref|WP_022522968.1|  hypothetical protein [Halomonas sp. A3H3]       114   7e-27
ref|WP_028324561.1|  histone deacetylase [Desulfatirhabdium bu...    114   7e-27
ref|XP_008978904.1|  PREDICTED: histone deacetylase 10 isoform...    116   8e-27
ref|WP_016418727.1|  hypothetical protein [Halomonas anticarie...    115   8e-27
ref|XP_010501379.1|  PREDICTED: histone deacetylase 8-like [Ca...    113   8e-27
ref|XP_005110730.1|  PREDICTED: histone deacetylase 6-like [Ap...    117   8e-27
ref|XP_004958225.1|  PREDICTED: histone deacetylase 5-like [Se...    117   8e-27
ref|WP_027958663.1|  MULTISPECIES: histone deacetylase [Halomo...    114   8e-27
ref|XP_004775446.1|  PREDICTED: histone deacetylase 10 isoform...    117   9e-27
emb|CDG99138.1|  Histone deacetylase-like amidohydrolase (HDAC...    114   9e-27
ref|WP_024527262.1|  acetoin utilization protein [Serratia fon...    114   9e-27
ref|XP_006934262.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...    117   9e-27
ref|WP_017312211.1|  hypothetical protein [Fischerella sp. PCC...    114   9e-27
ref|WP_016949673.1|  hypothetical protein [Anabaena sp. PCC 7108]    114   1e-26
ref|WP_015442378.1|  putative deacetylase [Ilumatobacter cocci...    114   1e-26
ref|WP_012256249.1|  MULTISPECIES: histone deacetylase [Chloro...    114   1e-26
ref|XP_005566988.1|  PREDICTED: histone deacetylase 10 isoform...    116   1e-26
ref|WP_006649948.1|  histone deacetylase [Haloterrigena thermo...    114   1e-26
ref|WP_015783609.1|  hypothetical protein [Cyanothece sp. PCC ...    114   1e-26
ref|WP_021623802.1|  putative histone deacetylase-like amidohy...    114   1e-26
ref|WP_024485480.1|  acetoin utilization protein [Serratia fon...    114   1e-26
gb|KGM29733.1|  acetoin utilization protein [Photorhabdus lumi...    114   1e-26
ref|XP_010443923.1|  PREDICTED: histone deacetylase 5-like [Ca...    116   1e-26
ref|XP_009436945.1|  PREDICTED: histone deacetylase 10 isoform...    115   1e-26
ref|WP_013718925.1|  histone deacetylase [Methanosaeta concilii]     114   1e-26
ref|WP_021807993.1|  Deacetylase [Serratia fonticola]                114   1e-26
gb|KHD08506.1|  deacetylase [Candidatus Thiomargarita nelsonii]      113   1e-26
ref|XP_010483770.1|  PREDICTED: histone deacetylase 5-like [Ca...    116   1e-26
ref|XP_006440744.1|  hypothetical protein CICLE_v10019240mg [C...    116   1e-26
ref|WP_020825073.1|  acetoin utilization protein [Serratia liq...    114   1e-26
ref|WP_022607813.1|  Histone deacetylase-like amidohydrolase [...    114   1e-26
ref|WP_009287123.1|  Histone deacetylase superfamily [Halomona...    114   1e-26
ref|WP_013323910.1|  hypothetical protein [Cyanothece sp. PCC ...    113   1e-26
ref|WP_006529388.1|  deacetylase, histone deacetylase/acetoin ...    113   1e-26
ref|WP_019507148.1|  hypothetical protein [Pleurocapsa sp. PCC...    113   1e-26
ref|WP_032831148.1|  MULTISPECIES: acetoin utilization protein...    114   1e-26
ref|WP_014129783.1|  acetoin utilization protein [Pelagibacter...    113   1e-26
ref|NP_001105019.1|  probable histone deacetylase 19 [Zea mays]      116   1e-26
ref|WP_028487230.1|  histone deacetylase [Thiomicrospira chile...    114   1e-26
gb|EFX71695.1|  hypothetical protein DAPPUDRAFT_308757 [Daphni...    114   1e-26
ref|WP_012266725.1|  hypothetical protein [Microcystis aerugin...    113   1e-26
ref|WP_028065292.1|  histone deacetylase [Solirubrobacter soli]      113   1e-26
ref|XP_004508680.1|  PREDICTED: histone deacetylase 5-like [Ci...    116   1e-26
ref|WP_021835729.1|  hypothetical protein [Crocosphaera watsonii]    113   1e-26
ref|WP_006196266.1|  hypothetical protein [Nodularia spumigena]      113   1e-26
gb|ABY64526.1|  histone deacetylase 2 splice variant B [Tetrah...    114   1e-26
ref|XP_008453266.1|  PREDICTED: histone deacetylase 5 isoform ...    116   1e-26
ref|WP_006630995.1|  hypothetical protein [Microcoleus vaginatus]    113   1e-26
ref|WP_009044186.1|  acetoin utilization protein [Pseudomonas ...    114   1e-26
ref|WP_009020091.1|  histone deacetylase [Luminiphilus syltensis]    114   2e-26
ref|XP_008453265.1|  PREDICTED: histone deacetylase 5 isoform ...    116   2e-26
ref|WP_024749475.1|  acetoin utilization protein [Methylosinus...    113   2e-26
ref|WP_022589377.1|  Histone deacetylase-like amidohydrolase [...    114   2e-26
ref|WP_006674195.1|  histone deacetylase superfamily protein [...    114   2e-26
ref|WP_008848692.1|  histone deacetylase superfamily protein [...    113   2e-26
gb|KFL37185.1|  hypothetical protein N788_10890 [Arenimonas do...    113   2e-26
ref|WP_005575489.1|  acetoin utilization protein [Natronobacte...    113   2e-26
ref|WP_024461384.1|  histone deacetylase [Marinimicrobium sp. ...    114   2e-26
ref|WP_015141875.1|  deacetylase [Pleurocapsa minor]                 113   2e-26
ref|WP_019556573.1|  hypothetical protein [Thiomicrospira arct...    114   2e-26
ref|WP_006182677.1|  acetoin utilization protein [Natrinema pe...    113   2e-26
ref|XP_001862395.1|  histone deacetylase [Culex quinquefasciatus]    117   2e-26
gb|EFB15096.1|  hypothetical protein PANDA_005509 [Ailuropoda ...    116   2e-26
ref|WP_017744782.1|  hypothetical protein [Scytonema hofmanni]       113   2e-26
ref|XP_001995788.1|  GH17575 [Drosophila grimshawi]                  117   2e-26
ref|WP_008002125.1|  histone deacetylase superfamily protein [...    113   2e-26
ref|WP_033383955.1|  hypothetical protein [SAR324 cluster bact...    112   2e-26
gb|KEH32016.1|  histone deacetylase superfamily protein [Medic...    116   2e-26
ref|WP_015352050.1|  histone deacetylase [Myxococcus stipitatus]     113   2e-26
ref|WP_022612111.1|  Histone deacetylase-like amidohydrolase [...    114   2e-26
gb|KEH32017.1|  histone deacetylase superfamily protein [Medic...    116   2e-26
ref|WP_015723556.1|  histone deacetylase [Desulfobulbus propio...    113   2e-26
gb|KGM50813.1|  acetoin utilization protein [Lysobacter concre...    112   2e-26
ref|XP_002917311.1|  PREDICTED: histone deacetylase 10-like [A...    116   2e-26
gb|ACF78632.1|  unknown [Zea mays]                                   116   2e-26
ref|XP_010359541.1|  PREDICTED: histone deacetylase 10 isoform...    115   2e-26
emb|CDH25271.1|  Histone deacetylase-like amidohydrolase (HDAC...    113   2e-26
ref|WP_028769835.1|  acetoin utilization protein [Silanimonas ...    112   2e-26
ref|WP_015187482.1|  histone deacetylase superfamily [Gloeocap...    112   2e-26
ref|WP_025808650.1|  acetoin utilization protein [Pseudomonas ...    113   2e-26
ref|WP_019491134.1|  hypothetical protein [Calothrix sp. PCC 7...    112   2e-26
emb|CDH31470.1|  Histone deacetylase-like amidohydrolase (HDAC...    113   2e-26
ref|WP_012990452.1|  acetoin utilization protein [Xenorhabdus ...    113   2e-26
ref|WP_017521538.1|  hypothetical protein [Pseudomonas nitrore...    113   2e-26
ref|XP_009215833.1|  PREDICTED: histone deacetylase 10 isoform...    116   2e-26
ref|WP_026783213.1|  acetoin utilization protein [Pleomorphomo...    112   2e-26
ref|WP_002797168.1|  hypothetical protein [Microcystis aerugin...    112   2e-26
ref|XP_007036440.1|  Histone deacetylase 15 isoform 2 [Theobro...    114   2e-26
ref|WP_008421613.1|  histone deacetylase [Natronococcus jeotgali]    113   2e-26
ref|WP_011447958.1|  hypothetical protein [Methanospirillum hu...    113   2e-26
ref|WP_014436285.1|  putative deacetylase [Phycisphaera mikure...    112   2e-26
ref|XP_009394772.1|  PREDICTED: histone deacetylase 5-like iso...    115   2e-26
ref|XP_009394771.1|  PREDICTED: histone deacetylase 5-like iso...    115   2e-26
ref|XP_010359540.1|  PREDICTED: histone deacetylase 10 isoform...    115   2e-26
ref|WP_026307746.1|  hypothetical protein [candidate division ...    112   2e-26
ref|XP_006394541.1|  hypothetical protein EUTSA_v10003787mg [E...    115   2e-26
ref|XP_009215827.1|  PREDICTED: histone deacetylase 10 isoform...    116   2e-26
ref|XP_007094101.1|  PREDICTED: histone deacetylase 10 [Panthe...    115   2e-26
ref|WP_011695862.1|  histone deacetylase [Methanosaeta thermop...    113   2e-26
ref|XP_010359539.1|  PREDICTED: histone deacetylase 10 isoform...    115   3e-26
ref|XP_310554.5|  AGAP000532-PA [Anopheles gambiae str. PEST]        117   3e-26
ref|XP_005566986.1|  PREDICTED: histone deacetylase 10 isoform...    115   3e-26
ref|WP_015154672.1|  histone deacetylase superfamily protein [...    112   3e-26
ref|XP_003437019.1|  AGAP000532-PB [Anopheles gambiae str. PEST]     116   3e-26
ref|XP_007036441.1|  Histone deacetylase 15 isoform 3 [Theobro...    113   3e-26
ref|WP_031459646.1|  histone deacetylase [Chloroflexus sp. MS-G]     113   3e-26
ref|WP_013924078.1|  hypothetical protein [Parachlamydia acant...    112   3e-26
ref|XP_010359535.1|  PREDICTED: histone deacetylase 10 isoform...    115   3e-26
ref|XP_009111974.1|  PREDICTED: histone deacetylase 5-like iso...    115   3e-26
ref|XP_007036442.1|  Histone deacetylase 15 isoform 4 [Theobro...    113   3e-26
ref|XP_007036439.1|  Histone deacetylase 15 isoform 1 [Theobro...    115   3e-26
ref|XP_009111973.1|  PREDICTED: histone deacetylase 5-like iso...    115   3e-26
ref|WP_006928671.1|  histone deacetylase superfamily [Caldithr...    112   3e-26
ref|WP_018198965.1|  hypothetical protein [Candidatus Hydrogen...    112   3e-26
ref|XP_005566982.1|  PREDICTED: histone deacetylase 10 isoform...    115   3e-26
gb|ACG24223.1|  histone deacetylase 6 [Zea mays]                     115   3e-26
ref|XP_005566983.1|  PREDICTED: histone deacetylase 10 isoform...    115   3e-26
ref|XP_010359534.1|  PREDICTED: histone deacetylase 10 isoform...    115   3e-26
gb|ETN67676.1|  histone deacetylase [Anopheles darlingi]             116   3e-26
ref|XP_010488892.1|  PREDICTED: histone deacetylase 8 [Camelin...    113   3e-26
ref|WP_027080703.1|  acetoin utilization protein [Luteimonas m...    112   3e-26
ref|XP_009215829.1|  PREDICTED: histone deacetylase 10 isoform...    115   3e-26
ref|XP_002514660.1|  histone deacetylase hda1, putative [Ricin...    115   3e-26
ref|XP_009111972.1|  PREDICTED: histone deacetylase 5-like iso...    115   3e-26
ref|XP_005566980.1|  PREDICTED: histone deacetylase 10 isoform...    115   3e-26
ref|WP_010626065.1|  acetoin utilization protein [Halomonas sp...    113   3e-26
ref|WP_002640444.1|  histone deacetylase [Myxococcus sp. (cont...    112   3e-26
ref|WP_012910886.1|  acetoin utilization protein [Pirellula st...    112   3e-26
ref|XP_005823450.1|  hypothetical protein GUITHDRAFT_59248 [Gu...    112   3e-26
ref|XP_005566977.1|  PREDICTED: histone deacetylase 10 isoform...    115   3e-26
ref|XP_006657925.1|  PREDICTED: histone deacetylase 5-like [Or...    115   3e-26
ref|WP_007358180.1|  MULTISPECIES: hypothetical protein [Kampt...    112   3e-26
ref|WP_012941640.1|  acetoin utilization protein [Haloterrigen...    112   4e-26
ref|XP_010359536.1|  PREDICTED: histone deacetylase 10 isoform...    115   4e-26
ref|WP_023407680.1|  hypothetical protein [uncultured Desulfof...    113   4e-26
ref|XP_004138195.1|  PREDICTED: histone deacetylase 5-like [Cu...    115   4e-26
ref|XP_009215835.1|  PREDICTED: histone deacetylase 10 isoform...    115   4e-26
ref|WP_010324137.1|  acetoin utilization protein [Marinobacter...    112   4e-26
ref|XP_010359537.1|  PREDICTED: histone deacetylase 10 isoform...    115   4e-26
ref|XP_009595026.1|  PREDICTED: histone deacetylase 5 [Nicotia...    115   4e-26
emb|CDY16823.1|  BnaA09g05590D [Brassica napus]                      115   4e-26
ref|XP_009215830.1|  PREDICTED: histone deacetylase 10 isoform...    115   5e-26
ref|WP_012387798.1|  histone deacetylase [Leptospira biflexa]        112   5e-26
ref|XP_009215831.1|  PREDICTED: histone deacetylase 10 isoform...    115   5e-26
ref|XP_009215828.1|  PREDICTED: histone deacetylase 10 isoform...    115   5e-26
ref|WP_009603583.1|  deacetylase, histone deacetylase/acetoin ...    112   5e-26
ref|XP_003905791.1|  PREDICTED: histone deacetylase 10 isoform...    115   5e-26
gb|EHH20350.1|  hypothetical protein EGK_03191 [Macaca mulatta]      115   5e-26
ref|WP_015403348.1|  deacetylase, histone deacetylase/acetoin ...    112   5e-26
ref|WP_006340726.1|  hypothetical protein [Parachlamydia acant...    112   5e-26
ref|WP_003894785.1|  histone deacetylase-like amidohydrolase [...    112   5e-26
ref|WP_002770961.1|  hypothetical protein [Microcystis aerugin...    111   5e-26
ref|WP_004048735.1|  histone deacetylase superfamily protein [...    112   5e-26
gb|AIS12746.1|  acetoin utilization protein [Pseudomonas chlor...    112   5e-26
ref|XP_010265269.1|  PREDICTED: histone deacetylase 15 isoform...    113   5e-26
ref|XP_005566978.1|  PREDICTED: histone deacetylase 10 isoform...    115   6e-26
ref|WP_004822883.1|  hypothetical protein [Acinetobacter guill...    112   6e-26
gb|EHH65955.1|  hypothetical protein EGM_02833 [Macaca fascicu...    114   6e-26
ref|NP_200914.2|  histone deacetylase 5 [Arabidopsis thaliana]       114   6e-26
ref|XP_009045799.1|  hypothetical protein LOTGIDRAFT_137337 [L...    115   6e-26
ref|WP_022473717.1|  deacetylase histone deacetylase/acetoin u...    111   6e-26
ref|NP_001190583.1|  histone deacetylase 5 [Arabidopsis thaliana]    114   6e-26
gb|KFK94856.1|  acetoin utilization protein [Serratia sp. Ag1]       112   6e-26
ref|XP_001112171.1|  PREDICTED: histone deacetylase 10-like is...    114   6e-26
emb|CDO05804.1|  histone deacetylase superfamily protein [Myco...    112   6e-26
ref|WP_017305291.1|  hypothetical protein [Spirulina subsalsa]       111   6e-26
ref|XP_008978877.1|  PREDICTED: histone deacetylase 10 isoform...    114   6e-26
ref|XP_004999786.1|  PREDICTED: histone deacetylase 10 isoform...    113   6e-26
ref|WP_008197412.1|  hypothetical protein [Microcystis sp. T1-4]     111   6e-26
ref|WP_002792876.1|  hypothetical protein [Microcystis aerugin...    111   6e-26
ref|WP_002778332.1|  hypothetical protein [Microcystis aerugin...    111   6e-26
ref|WP_002800114.1|  hypothetical protein [Microcystis aerugin...    111   7e-26
ref|WP_013879306.1|  acetoin utilization protein [Halopiger xa...    112   7e-26
ref|WP_002789600.1|  hypothetical protein [Microcystis aerugin...    111   7e-26
ref|WP_004078310.1|  hypothetical protein [Methanoplanus limic...    112   7e-26
ref|XP_001112365.1|  PREDICTED: histone deacetylase 10-like is...    114   7e-26
ref|WP_012674463.1|  acetoin utilization protein [Sulfurihydro...    111   7e-26
ref|WP_029938711.1|  histone deacetylase [Thiomicrospira sp. M...    112   7e-26
ref|XP_008978879.1|  PREDICTED: histone deacetylase 10 isoform...    114   7e-26
ref|XP_010265268.1|  PREDICTED: histone deacetylase 15 isoform...    114   7e-26
ref|XP_002460972.1|  hypothetical protein SORBIDRAFT_02g038550...    114   7e-26
ref|XP_005566979.1|  PREDICTED: histone deacetylase 10 isoform...    114   7e-26
ref|WP_027247224.1|  acetoin utilization protein [Phaeobacter ...    112   7e-26
ref|WP_024270114.1|  deacetyase [Shinella zoogloeoides DD12]         112   7e-26
gb|AIC20483.1|  acetoin utilization protein [Pseudomonas chlor...    112   7e-26
ref|WP_007930880.1|  acetoin utilization protein [Pseudomonas ...    112   7e-26
ref|WP_015496354.1|  histone deacetylase [Octadecabacter arcti...    112   7e-26
ref|WP_002756065.1|  hypothetical protein [Microcystis aerugin...    111   8e-26
ref|WP_027401061.1|  hypothetical protein [Aphanizomenon flos-...    111   8e-26
ref|XP_003559993.1|  PREDICTED: histone deacetylase 5-like [Br...    114   8e-26
ref|XP_008978882.1|  PREDICTED: histone deacetylase 10 isoform...    114   8e-26
ref|XP_007974396.1|  PREDICTED: histone deacetylase 10 isoform...    114   8e-26
ref|WP_028949884.1|  acetoin utilization protein [Sulfurihydro...    111   8e-26
ref|XP_010265266.1|  PREDICTED: histone deacetylase 15 isoform...    114   8e-26
gb|KGE67604.1|  hypothetical protein K814_0112440 [Pseudomonas...    112   8e-26
gb|KEA65225.1|  Deacetylase [Marinobacterium sp. AK27]               112   8e-26
ref|WP_028090714.1|  hypothetical protein [Dolichospermum circ...    111   9e-26
gb|EYU16671.1|  deacetylase, histone deacetylase/acetoin utili...    112   9e-26
ref|XP_001781811.1|  class II RPD3 type histone deacetylase pr...    113   9e-26
ref|XP_010265262.1|  PREDICTED: histone deacetylase 15 isoform...    114   9e-26
ref|XP_009772785.1|  PREDICTED: histone deacetylase 5-like iso...    111   9e-26
ref|WP_011843437.1|  histone deacetylase [Methanoculleus maris...    111   9e-26
ref|XP_005625772.1|  PREDICTED: histone deacetylase 10 isoform...    113   9e-26
ref|WP_002738945.1|  histone deacetylase domain protein [Micro...    111   9e-26
ref|WP_002762171.1|  hypothetical protein [Microcystis aerugin...    111   9e-26
ref|WP_022600259.1|  Histone deacetylase-like amidohydrolase [...    112   9e-26
emb|CDF81559.1|  Histone deacetylase-like amidohydrolase [Pseu...    111   1e-25
ref|WP_024970772.1|  hypothetical protein [Microcystis aerugin...    110   1e-25
emb|CDX87200.1|  BnaC09g05150D [Brassica napus]                      114   1e-25
gb|KGM53928.1|  acetoin utilization protein [Lysobacter daejeo...    110   1e-25
ref|WP_028085517.1|  hypothetical protein [Dolichospermum circ...    110   1e-25
dbj|BAB10370.1|  unnamed protein product [Arabidopsis thaliana]      115   1e-25
ref|WP_012659358.1|  acetoin utilization protein [Halorubrum l...    111   1e-25
ref|XP_006735446.1|  PREDICTED: histone deacetylase 10 [Lepton...    114   1e-25
ref|WP_009049304.1|  acetoin utilization protein [Pseudomonas ...    111   1e-25
ref|XP_009772781.1|  PREDICTED: histone deacetylase 5-like iso...    111   1e-25
ref|WP_033370223.1|  hypothetical protein [Bacillus fordii]          111   1e-25
ref|WP_007113124.1|  histone deacetylase [Halomonas boliviensis]     111   1e-25
ref|XP_010458083.1|  PREDICTED: histone deacetylase 8-like [Ca...    111   1e-25
ref|XP_004166122.1|  PREDICTED: histone deacetylase 15-like [C...    112   1e-25
ref|XP_004610829.1|  PREDICTED: histone deacetylase 10 [Sorex ...    114   1e-25
dbj|BAC84464.1|  putative histone deacetylase [Oryza sativa Ja...    114   1e-25
ref|XP_007974398.1|  PREDICTED: histone deacetylase 10 isoform...    114   1e-25
ref|XP_010105365.1|  Histone deacetylase 15 [Morus notabilis]        113   1e-25
ref|NP_001060205.1|  Os07g0602200 [Oryza sativa Japonica Group]      114   1e-25
emb|CDW72549.1|  histone deacetylase hda1 [Stylonychia lemnae]       111   1e-25
ref|WP_010961709.1|  acetoin utilization protein [Methylococcu...    110   1e-25
gb|KFW90600.1|  Histone deacetylase 10 [Phalacrocorax carbo]         109   1e-25
ref|XP_010341644.1|  PREDICTED: histone deacetylase 10 isoform...    113   1e-25
gb|EEC82400.1|  hypothetical protein OsI_26768 [Oryza sativa I...    114   1e-25
ref|WP_002748714.1|  histone deacetylase domain protein [Micro...    110   1e-25
ref|WP_019029860.1|  deacetylase [Colwellia piezophila]              110   1e-25
ref|XP_004999785.1|  PREDICTED: histone deacetylase 10 isoform...    112   1e-25
ref|XP_002100654.1|  GE17180 [Drosophila yakuba]                     114   1e-25
ref|WP_028459059.1|  histone deacetylase [Chloroflexus sp. Y-3...    111   1e-25
gb|KAJ30717.1|  histone deacetylase [Sulfitobacter pontiacus 3...    111   1e-25
ref|WP_011629784.1|  histone deacetylase [Alkalilimnicola ehrl...    111   1e-25
ref|XP_001657988.1|  histone deacetylase [Aedes aegypti]             114   1e-25
ref|XP_010341643.1|  PREDICTED: histone deacetylase 10 isoform...    113   1e-25
ref|WP_011042487.1|  deacetylase [Colwellia psychrerythraea]         110   1e-25
ref|WP_029632486.1|  hypothetical protein [ [[Scytonema hofman...    110   1e-25
ref|WP_027335683.1|  histone deacetylase [Halomonas sp. HL-48]       111   1e-25
ref|WP_012594681.1|  hypothetical protein [Cyanothece sp. PCC ...    110   1e-25
ref|WP_016869291.1|  hypothetical protein [Fischerella muscicola]    110   1e-25
ref|XP_006108102.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...    113   1e-25
ref|WP_006826306.1|  histone deacetylase [Natrialba taiwanensis]     110   1e-25
ref|WP_018400570.1|  hypothetical protein [filamentous cyanoba...    110   1e-25
ref|XP_002866412.1|  hypothetical protein ARALYDRAFT_919345 [A...    113   2e-25
gb|AHE96085.1|  acetoin utilization protein [Thermocrinis ruber]     110   2e-25
ref|WP_015676922.1|  histone deacetylase family protein [Lepto...    110   2e-25
gb|KGG73683.1|  hypothetical protein DA73_16870 [Tolypothrix b...    110   2e-25
ref|XP_002967892.1|  hypothetical protein SELMODRAFT_169296 [S...    112   2e-25
ref|WP_023342946.1|  deacetylase [Klebsiella pneumoniae]             111   2e-25
ref|WP_015670769.1|  deacetylase, histone deacetylase/acetoin ...    111   2e-25
ref|WP_014450198.1|  histone deacetylase superfamily [Leptospi...    110   2e-25
ref|WP_011431732.1|  hypothetical protein [Synechococcus sp. J...    110   2e-25
ref|WP_023284815.1|  deacetylase [Klebsiella pneumoniae]             111   2e-25
gb|KFK27881.1|  hypothetical protein AALP_AA8G441500 [Arabis a...    113   2e-25
ref|XP_002964032.1|  hypothetical protein SELMODRAFT_166606 [S...    112   2e-25
gb|EAW73514.1|  histone deacetylase 10, isoform CRA_d [Homo sa...    113   2e-25
ref|XP_002044573.1|  GM20078 [Drosophila sechellia]                  113   2e-25
ref|WP_012138049.1|  histone deacetylase superfamily protein [...    110   2e-25
ref|WP_016704135.1|  acetoin utilization protein [Pseudomonas ...    110   2e-25
ref|XP_003317368.1|  PREDICTED: histone deacetylase 10 isoform...    113   2e-25
ref|XP_005653241.1|  PREDICTED: histone deacetylase 10 isoform...    113   2e-25
ref|XP_009436943.1|  PREDICTED: histone deacetylase 10 isoform...    113   2e-25
ref|XP_009436944.1|  PREDICTED: histone deacetylase 10 isoform...    113   2e-25
ref|WP_003846829.1|  histone deacetylase [Corynebacterium ammo...    110   2e-25
ref|XP_005653239.1|  PREDICTED: histone deacetylase 10 isoform...    113   2e-25
ref|XP_002112654.1|  hypothetical protein TRIADDRAFT_56890 [Tr...    111   2e-25
ref|WP_023497157.1|  putative deacetylase [uncultured archaeon...    109   2e-25
ref|XP_004063730.1|  PREDICTED: histone deacetylase 10 isoform...    113   2e-25
ref|XP_004301121.1|  PREDICTED: histone deacetylase 5-like [Fr...    112   2e-25
gb|AAH13700.1|  Hdac10 protein [Mus musculus]                        110   2e-25
ref|XP_515218.2|  PREDICTED: histone deacetylase 10 isoform X1...    113   2e-25
ref|WP_011308862.1|  histone deacetylase [Dehalococcoides mcca...    110   2e-25
ref|XP_004063729.1|  PREDICTED: histone deacetylase 10 isoform...    113   2e-25
ref|XP_003811076.1|  PREDICTED: histone deacetylase 10 isoform...    113   2e-25
ref|WP_007140950.1|  acetoin utilization protein [Halobiforma ...    110   2e-25
ref|XP_005653240.1|  PREDICTED: histone deacetylase 10 isoform...    113   2e-25
ref|WP_012675453.1|  acetoin utilization protein [Persephonell...    110   2e-25
ref|XP_008961642.1|  PREDICTED: histone deacetylase 10 isoform...    112   2e-25
ref|WP_014811923.1|  deacylase [Desulfomonile tiedjei]               110   2e-25
emb|CDH19810.1|  Histone deacetylase-like amidohydrolase (HDAC...    110   2e-25
ref|XP_007155240.1|  hypothetical protein PHAVU_003G185200g [P...    113   2e-25
ref|XP_003811075.1|  PREDICTED: histone deacetylase 10 isoform...    113   2e-25
ref|WP_029551964.1|  acetoin utilization protein [Thermocrinis...    110   2e-25
ref|XP_004409722.1|  PREDICTED: histone deacetylase 10 [Odoben...    113   2e-25
ref|WP_009828116.1|  histone deacetylase [Rhodobacteraceae bac...    110   2e-25
ref|WP_012121404.1|  histone deacetylase [Roseiflexus castenho...    110   3e-25
gb|KGB38359.1|  Histone deacetylase 6 [Schistosoma haematobium]      114   3e-25
ref|WP_015467096.1|  histone deacetylase/AcuC/AphA family prot...    110   3e-25
ref|WP_023965707.1|  acetoin utilization protein [Pseudomonas ...    110   3e-25
gb|AII59027.1|  histone deacetylase [Dehalococcoides mccartyi ...    110   3e-25
ref|XP_009215838.1|  PREDICTED: histone deacetylase 10 isoform...    112   3e-25
ref|WP_009577316.1|  histone deacetylase superfamily [gamma pr...    110   3e-25
ref|WP_025561437.1|  histone deacetylase [delta proteobacteriu...    110   3e-25
ref|XP_005566987.1|  PREDICTED: histone deacetylase 10 isoform...    112   3e-25
ref|WP_025985181.1|  acetoin utilization protein [Klebsiella p...    110   3e-25
ref|XP_004139132.1|  PREDICTED: histone deacetylase 15-like [C...    112   3e-25
ref|WP_022968246.1|  acetoin utilization protein [Arenimonas o...    109   3e-25
ref|XP_003397551.1|  PREDICTED: histone deacetylase 6-like [Bo...    114   3e-25
gb|AAK92206.1|AF407273_1  histone deacetylase 10 isoform beta ...    112   3e-25
ref|NP_001152758.1|  histone deacetylase 10 isoform 2 [Homo sa...    112   3e-25
ref|XP_003126824.1|  PREDICTED: histone deacetylase 10 isoform...    112   3e-25
ref|WP_014810177.1|  deacylase [Desulfomonile tiedjei]               110   3e-25
gb|EAW73515.1|  histone deacetylase 10, isoform CRA_e [Homo sa...    112   3e-25
ref|XP_002862598.1|  predicted protein [Arabidopsis lyrata sub...    112   3e-25
ref|WP_008939174.1|  histone deacetylase superfamily protein [...    110   3e-25
ref|XP_009215836.1|  PREDICTED: histone deacetylase 10 isoform...    112   3e-25
gb|KDO25434.1|  hypothetical protein SPRG_09376 [Saprolegnia p...    112   3e-25
ref|XP_010318852.1|  PREDICTED: histone deacetylase 5 [Solanum...    112   3e-25
ref|XP_001355195.2|  GA19406 [Drosophila pseudoobscura pseudoo...    113   3e-25
gb|AAK92205.1|AF407272_1  histone deacetylase 10 isoform alpha...    112   3e-25
gb|KDR24372.1|  Histone deacetylase 6 [Zootermopsis nevadensis]      113   3e-25
ref|NP_114408.3|  histone deacetylase 10 isoform 1 [Homo sapiens]    112   3e-25
ref|WP_026849917.1|  hypothetical protein [Gemmatimonas sp. AP64]    109   3e-25
gb|EMS62004.1|  hypothetical protein TRIUR3_22556 [Triticum ur...    112   3e-25
ref|WP_006015144.1|  histone deacetylase 5 [Glaciecola pallidula]    110   3e-25
ref|WP_016516938.1|  Histone deacetylase-like amidohydrolase [...    109   3e-25
ref|XP_008832953.1|  PREDICTED: histone deacetylase 10 [Nannos...    112   3e-25
ref|XP_001978099.1|  GG17876 [Drosophila erecta]                     113   3e-25
ref|XP_006345128.1|  PREDICTED: histone deacetylase 5-like [So...    112   4e-25
emb|CDP19097.1|  unnamed protein product [Coffea canephora]          112   4e-25
ref|WP_008005471.1|  histone deacetylase superfamily protein [...    109   4e-25
ref|WP_009455332.1|  MULTISPECIES: hypothetical protein [Fisch...    109   4e-25
ref|WP_032700622.1|  acetoin utilization protein [Raoultella p...    110   4e-25
ref|WP_032689057.1|  acetoin utilization protein [Raoultella o...    110   4e-25
ref|WP_004578955.1|  histone deacetylase superfamily protein [...    110   4e-25
ref|XP_003281532.1|  PREDICTED: histone deacetylase 10 [Nomasc...    112   4e-25
ref|WP_028319757.1|  histone deacetylase [Desulfobulbus elonga...    109   4e-25
emb|CDG84675.1|  histone deacetylase domain protein [Janthinob...    109   4e-25
ref|XP_005566985.1|  PREDICTED: histone deacetylase 10 isoform...    112   4e-25
dbj|GAL93398.1|  deacetylases, including yeast histone deacety...    109   4e-25
ref|XP_002022770.1|  GL14573 [Drosophila persimilis]                 113   4e-25
gb|AHF98512.1|  acetoin utilization protein [Halostagnicola la...    109   4e-25
ref|XP_002591582.1|  hypothetical protein BRAFLDRAFT_105116 [B...    109   4e-25
gb|KES23771.1|  acetoin utilization protein [Pseudomonas sp. AAC]    110   4e-25
ref|WP_033398686.1|  hypothetical protein [Desulfospira joerge...    109   4e-25
ref|WP_007739686.1|  histone deacetylase superfamily protein [...    109   4e-25
ref|WP_032421090.1|  acetoin utilization protein [Klebsiella p...    110   4e-25
ref|XP_001963843.1|  GF21044 [Drosophila ananassae]                  113   4e-25
gb|AHI30969.1|  histone deacetylase [Marinobacter sp. R9SW1]         110   4e-25
ref|WP_029522989.1|  acetoin utilization protein [Persephonell...    109   4e-25
ref|XP_007952955.1|  PREDICTED: histone deacetylase 10 [Orycte...    112   4e-25
ref|WP_011845068.1|  histone deacetylase [Methanoculleus maris...    109   4e-25
ref|WP_010936110.1|  histone deacetylase [Dehalococcoides mcca...    109   4e-25
gb|EFX83972.1|  putative histone deacetylase HDAC6 protein [Da...    113   4e-25
ref|WP_032696467.1|  acetoin utilization protein [Raoultella p...    109   4e-25
ref|WP_004051669.1|  histone deacetylase superfamily protein [...    109   4e-25
ref|XP_010341641.1|  PREDICTED: histone deacetylase 10 isoform...    112   4e-25
ref|XP_003932825.1|  PREDICTED: histone deacetylase 10 isoform...    112   4e-25
gb|KGZ17200.1|  acetoin utilization protein [Klebsiella pneumo...    109   5e-25
gb|AIR00714.1|  acetoin utilization protein [Pluralibacter ger...    109   5e-25
ref|WP_014992711.1|  histone deacetylase [Alcanivorax dieselolei]    109   5e-25
ref|WP_013683299.1|  hypothetical protein [Archaeoglobus venef...    109   5e-25
ref|XP_004380134.1|  PREDICTED: histone deacetylase 10 [Triche...    112   5e-25
ref|WP_009454546.1|  MULTISPECIES: histone deacetylase superfa...    109   5e-25
ref|WP_029520596.1|  acetoin utilization protein [Persephonell...    108   5e-25
ref|WP_007153031.1|  histone deacetylase [Marinobacter algicola]     109   5e-25
ref|XP_004532137.1|  PREDICTED: histone deacetylase-like amido...    109   5e-25
ref|WP_015921229.1|  histone deacetylase [Rhodobacter sphaeroi...    109   5e-25
ref|WP_007973005.1|  deacylase [Pseudomonas sp. GM33]                109   6e-25
ref|WP_016531822.1|  putative deacetylase [Klebsiella pneumoniae]    109   6e-25
ref|WP_006101836.1|  hypothetical protein [Coleofasciculus cht...    108   6e-25
ref|WP_003801208.1|  histone deacetylase [Alcaligenes faecalis]      109   6e-25
ref|WP_029014582.1|  acetoin utilization protein [Azospirillum...    108   6e-25
dbj|GAA52223.1|  histone deacetylase 6/10 [Clonorchis sinensis]      112   6e-25
ref|WP_029329151.1|  acetoin utilization protein [Lentibacillu...    109   6e-25
ref|WP_022639074.1|  acetoin utilization protein [Pseudomonas ...    109   6e-25
ref|WP_021099636.1|  Deacetylase [Thalassobacter arenae]             109   6e-25
ref|WP_006664961.1|  histone deacetylase [Natrialba aegyptia]        109   6e-25
ref|WP_007701964.1|  histone deacetylase [Halovivax asiaticus]       109   6e-25
ref|WP_026101999.1|  hypothetical protein [Geminocystis herdma...    108   6e-25
ref|WP_009614649.1|  putative acetylpolyamine aminohydrolase [...    109   6e-25
ref|WP_011338500.1|  histone deacetylase [Rhodobacter sphaeroi...    109   6e-25
ref|WP_014025581.1|  histone deacetylase superfamily protein [...    109   6e-25
ref|XP_007189304.1|  PREDICTED: histone deacetylase 10 isoform...    110   7e-25
ref|WP_012881609.1|  histone deacetylase [Dehalococcoides mcca...    109   7e-25
ref|WP_026244311.1|  acetoin utilization protein [Dasania marina]    109   7e-25
ref|WP_002780242.1|  hypothetical protein [Microcystis aerugin...    108   7e-25
ref|XP_002990598.1|  hypothetical protein SELMODRAFT_185423 [S...    109   7e-25
ref|XP_009592248.1|  PREDICTED: histone deacetylase 15 [Nicoti...    111   7e-25
ref|XP_007519490.1|  PREDICTED: histone deacetylase 10 [Erinac...    112   7e-25
gb|EYU29766.1|  hypothetical protein MIMGU_mgv1a005254mg [Mimu...    110   7e-25
gb|AIJ05050.1|  histone deacetylase [Methanocaldococcus sp. JH...    108   7e-25
ref|WP_011928777.1|  histone deacetylase [Dehalococcoides mcca...    108   7e-25
ref|XP_007189303.1|  PREDICTED: histone deacetylase 10 isoform...    111   7e-25
gb|EWH02255.1|  histone deacetylase [Halomonas sp. BC04]             109   7e-25
ref|WP_019956517.1|  histone deacetylase [Loktanella vestfolde...    109   7e-25
ref|WP_032436980.1|  acetoin utilization protein [Klebsiella p...    109   7e-25
ref|WP_011841682.1|  histone deacetylase [Rhodobacter sphaeroi...    109   8e-25
ref|WP_012238780.1|  histone deacetylase [Sorangium cellulosum]      109   8e-25
ref|WP_023322183.1|  deacetylase [Klebsiella pneumoniae]             109   8e-25
gb|KDE56341.1|  histone deacetylase [Methanoculleus sp. MH98A]       108   8e-25
ref|WP_020739317.1|  hypothetical protein [Sorangium cellulosum]     109   8e-25
gb|KFJ68124.1|  histone deacetylase domain protein [Bordetella...    108   8e-25
ref|WP_032729521.1|  acetoin utilization protein [Klebsiella p...    109   8e-25
ref|WP_009561715.1|  Deacetylase [Rhodobacter sp. AKP1]              109   8e-25
ref|WP_012542538.1|  MULTISPECIES: acetoin utilization protein...    109   8e-25
ref|WP_032739270.1|  acetoin utilization protein [Klebsiella p...    109   8e-25
ref|XP_009533248.1|  hypothetical protein PHYSODRAFT_261835 [P...    108   8e-25
ref|WP_012968768.1|  acetoin utilization protein [Klebsiella v...    108   8e-25
ref|WP_023339748.1|  deacetylase [Klebsiella pneumoniae]             108   8e-25
ref|WP_032712799.1|  acetoin utilization protein [Enterobacter...    108   8e-25
ref|WP_020294626.1|  histone deacetylase family protein [Pseud...    108   8e-25
gb|KFJ96489.1|  acetoin utilization protein [Klebsiella variic...    108   8e-25
ref|XP_005717232.1|  unnamed protein product [Chondrus crispus]      109   8e-25
ref|WP_029312228.1|  acetoin utilization protein [Acidiphilium...    108   9e-25
ref|WP_009484532.1|  histone deacetylase-like amidohydrolase [...    108   9e-25
gb|EWH01373.1|  histone deacetylase [Halomonas sp. BC04]             108   9e-25
ref|XP_010456940.1|  PREDICTED: histone deacetylase 5 [Camelin...    111   9e-25
ref|XP_004845392.1|  PREDICTED: histone deacetylase 10 isoform...    110   9e-25
ref|WP_012175390.1|  histone deacetylase superfamily protein [...    108   9e-25
ref|WP_007680442.1|  acetoin utilization protein [alpha proteo...    108   9e-25
ref|NP_001162760.1|  HDAC6, isoform D [Drosophila melanogaster]      112   9e-25
emb|CCM87547.1|  Deacetylases, including yeast histone deacety...    108   9e-25
ref|WP_032431588.1|  acetoin utilization protein [Klebsiella p...    108   9e-25
emb|CAJ71217.1|  similar to histone deacetylase [Candidatus Ku...    108   9e-25
ref|WP_024092469.1|  hypothetical protein [Leisingera methyloh...    108   9e-25
ref|XP_002615434.1|  hypothetical protein CLUG_04316 [Clavispo...    110   9e-25
gb|EDL04372.1|  histone deacetylase 10, isoform CRA_a [Mus mus...    108   1e-24
ref|XP_004642530.1|  PREDICTED: histone deacetylase 10 [Octodo...    111   1e-24
ref|WP_014863085.1|  acetoin utilization protein [Natrinema sp...    108   1e-24
ref|WP_032732647.1|  acetoin utilization protein [Klebsiella p...    108   1e-24
ref|WP_028321518.1|  histone deacetylase [Desulfobacterium ani...    108   1e-24
ref|WP_024075344.1|  acetoin utilization protein [Pseudomonas ...    108   1e-24
emb|CDK93442.1|  Deacetylases, including yeast histone deacety...    108   1e-24
ref|WP_023297172.1|  deacetylase [Klebsiella pneumoniae]             108   1e-24
ref|WP_016946862.1|  acetoin utilization protein [Klebsiella p...    108   1e-24
ref|WP_020323726.1|  putative histone deacetylase-like amidohy...    108   1e-24
ref|WP_026482738.1|  acetoin utilization protein [Alcaligenes ...    108   1e-24
ref|WP_032419701.1|  acetoin utilization protein [Klebsiella p...    108   1e-24
ref|WP_032414643.1|  acetoin utilization protein [Klebsiella p...    108   1e-24
ref|XP_005994305.1|  PREDICTED: histone deacetylase 10 isoform...    111   1e-24
ref|WP_032734918.1|  acetoin utilization protein [Klebsiella p...    108   1e-24
ref|WP_023287337.1|  deacetylase [Klebsiella pneumoniae]             108   1e-24
ref|XP_009518376.1|  hypothetical protein PHYSODRAFT_483861 [P...    108   1e-24
ref|XP_006561957.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...    112   1e-24
ref|WP_004178883.1|  acetoin utilization protein [Klebsiella p...    108   1e-24
ref|WP_008892800.1|  histone deacetylase [Haloterrigena salina]      108   1e-24
ref|XP_004301076.1|  PREDICTED: histone deacetylase 15-like [F...    110   1e-24
ref|WP_021221104.1|  acetoin utilization protein [Pseudomonas ...    108   1e-24
ref|NP_573017.2|  HDAC6, isoform A [Drosophila melanogaster]         112   1e-24
gb|AIE02169.1|  acetoin utilization protein [Klebsiella pneumo...    108   1e-24
ref|WP_032753820.1|  acetoin utilization protein [Klebsiella p...    108   1e-24
ref|WP_008805515.1|  acetoin utilization protein [Klebsiella s...    108   1e-24
ref|WP_021441365.1|  putative histone deacetylase-like amidohy...    108   1e-24
gb|ACN94199.1|  histone deacetylase 6 isoform A [Drosophila me...    112   1e-24
gb|ACN94119.1|  histone deacetylase 6 isoform A [Drosophila me...    112   1e-24
gb|ACN94087.1|  histone deacetylase 6 isoform A [Drosophila me...    112   1e-24
gb|AHM80871.1|  Acetoin utilization acuC protein [Klebsiella p...    108   1e-24
ref|WP_029602941.1|  acetoin utilization protein [Klebsiella p...    108   1e-24
ref|WP_032419271.1|  acetoin utilization protein [Klebsiella p...    108   1e-24
ref|WP_025861778.1|  acetoin utilization protein [Klebsiella p...    108   1e-24
ref|WP_020316355.1|  putative histone deacetylase-like amidohy...    108   1e-24
gb|AIK80618.1|  histone deacetylase-like amidohydrolase [Klebs...    108   1e-24
ref|WP_029884264.1|  acetoin utilization protein [Klebsiella p...    108   1e-24
ref|WP_032714026.1|  acetoin utilization protein [Enterobacter...    108   1e-24
ref|WP_004211620.1|  putative deacetylase [Klebsiella pneumoniae]    108   1e-24
ref|WP_004151809.1|  acetoin utilization protein [Klebsiella p...    108   1e-24
ref|NP_001245680.1|  HDAC6, isoform E [Drosophila melanogaster]      112   1e-24
gb|AFI26268.1|  HDAC6 [Drosophila melanogaster]                      112   1e-24
ref|WP_004228155.1|  Deacetylases, including yeast histone dea...    108   1e-24
ref|WP_023316537.1|  deacetylase [Klebsiella pneumoniae]             108   1e-24
ref|WP_023300805.1|  deacetylase [Klebsiella pneumoniae]             108   1e-24
ref|WP_015724216.1|  histone deacetylase [Desulfobulbus propio...    108   1e-24
ref|WP_032413206.1|  acetoin utilization protein [Klebsiella p...    108   1e-24
ref|WP_004893678.1|  putative deacetylase [Klebsiella pneumoniae]    108   1e-24
gb|ACN94103.1|  histone deacetylase 6 isoform A [Drosophila me...    112   1e-24
ref|WP_020802269.1|  putative histone deacetylase-like amidohy...    108   1e-24
ref|WP_011141275.1|  hypothetical protein [Gloeobacter violaceus]    108   1e-24
ref|NP_001245681.1|  HDAC6, isoform F [Drosophila melanogaster]      112   1e-24
gb|ACN94041.1|  histone deacetylase 6 isoform A [Drosophila me...    112   1e-24
ref|WP_032459144.1|  acetoin utilization protein [Klebsiella p...    108   1e-24
ref|WP_023312810.1|  deacetylase [Klebsiella pneumoniae]             108   1e-24
ref|WP_004176993.1|  acetoin utilization protein [Klebsiella p...    108   1e-24
ref|NP_001259569.1|  HDAC6, isoform G [Drosophila melanogaster]      112   1e-24
gb|EJK92068.1|  putative deacetylase [Klebsiella pneumoniae su...    108   1e-24
gb|AFI26267.1|  HDAC6 [Drosophila melanogaster]                      112   1e-24
gb|ACU45748.1|  AT13940p [Drosophila melanogaster]                   112   1e-24
ref|WP_023279222.1|  deacetylase [Klebsiella pneumoniae]             108   1e-24
ref|WP_020079408.1|  acetoin utilization protein [Enterobacter...    108   1e-24
ref|WP_013007235.1|  acetoin utilization protein AcuC [Deferri...    108   1e-24
gb|ACN94123.1|  histone deacetylase 6 isoform C [Drosophila me...    112   1e-24
gb|ACN94043.1|  histone deacetylase 6 isoform C [Drosophila me...    112   1e-24
gb|ACN94202.1|  histone deacetylase 6 isoform B [Drosophila me...    112   1e-24
gb|KGT68652.1|  putative histone deacetylase-like amidohydrola...    108   1e-24
ref|WP_032424672.1|  acetoin utilization protein [Klebsiella p...    108   1e-24
ref|NP_727842.1|  HDAC6, isoform B [Drosophila melanogaster]         112   1e-24
gb|ACN94122.1|  histone deacetylase 6 isoform B [Drosophila me...    112   1e-24
gb|ACN94106.1|  histone deacetylase 6 isoform B [Drosophila me...    112   1e-24
gb|EJY76626.1|  Putative histone deacetylase HDAC6 protein [Ox...    108   1e-24
ref|WP_009308089.1|  acetoin utilization protein [Klebsiella s...    108   1e-24
gb|ACN94042.1|  histone deacetylase 6 isoform B [Drosophila me...    112   1e-24
gb|ACN94203.1|  histone deacetylase 6 isoform C [Drosophila me...    112   1e-24
ref|WP_012068395.1|  acetoin utilization protein [Klebsiella p...    108   1e-24
ref|NP_727843.1|  HDAC6, isoform C [Drosophila melanogaster]         112   1e-24
gb|AFI26269.1|  HDAC6 [Drosophila melanogaster]                      112   1e-24
gb|KDP31342.1|  hypothetical protein JCGZ_11718 [Jatropha curcas]    110   1e-24
gb|ACN94090.1|  histone deacetylase 6 isoform B [Drosophila me...    112   1e-24
gb|KGL74133.1|  Histone deacetylase 10 [Tinamus guttatus]            106   1e-24
gb|ACN94091.1|  histone deacetylase 6 isoform C [Drosophila me...    112   1e-24
ref|WP_017161242.1|  acetoin utilization protein [Xanthomonas ...    106   1e-24
gb|ACN94107.1|  histone deacetylase 6 isoform C [Drosophila me...    112   1e-24
ref|WP_016873909.1|  hypothetical protein [Chlorogloeopsis fri...    107   1e-24
gb|ABY64525.1|  histone deacetylase 2 splice variant A [Tetrah...    110   1e-24
ref|XP_003382755.1|  PREDICTED: histone deacetylase 6-like [Am...    110   1e-24
ref|XP_002633897.1|  Hypothetical protein CBG19959 [Caenorhabd...    111   1e-24
ref|WP_023302211.1|  deacetylase [Klebsiella pneumoniae]             108   1e-24
gb|EJY86252.1|  Putative histone deacetylase HDAC6 protein [Ox...    108   1e-24
ref|WP_033092771.1|  deacetylase [Colwellia psychrerythraea]         108   1e-24
ref|WP_024098615.1|  Deacetylase [Phaeobacter gallaeciensis]         108   1e-24
ref|WP_032424335.1|  acetoin utilization protein [Klebsiella p...    108   1e-24
ref|WP_032875411.1|  acetoin utilization protein [Pseudomonas ...    108   2e-24
gb|AIU68940.1|  hypothetical protein TEU_00530 [Thermococcus s...    108   2e-24
emb|CBN78960.1|  conserved unknown protein [Ectocarpus silicul...    110   2e-24
ref|WP_032432750.1|  acetoin utilization protein [Klebsiella p...    108   2e-24
ref|XP_004845391.1|  PREDICTED: histone deacetylase 10 isoform...    110   2e-24
ref|XP_004885526.1|  PREDICTED: histone deacetylase 10 isoform...    110   2e-24
ref|WP_032716820.1|  acetoin utilization protein [Escherichia ...    108   2e-24
ref|WP_004859105.1|  acetoin utilization protein [Klebsiella o...    108   2e-24
ref|XP_006876475.1|  PREDICTED: histone deacetylase 10 [Chryso...    110   2e-24
emb|CDY06315.1|  BnaA09g48880D [Brassica napus]                      108   2e-24
ref|WP_015584959.1|  deacetylase [Raoultella ornithinolytica]        108   2e-24
ref|WP_006183664.1|  histone deacetylase superfamily protein [...    108   2e-24
ref|XP_003485837.1|  PREDICTED: histone deacetylase 6-like [Bo...    111   2e-24
ref|XP_004885525.1|  PREDICTED: histone deacetylase 10 isoform...    110   2e-24
ref|XP_010259827.1|  PREDICTED: histone deacetylase 5 [Nelumbo...    110   2e-24
gb|EGW01040.1|  Histone deacetylase 10 [Cricetulus griseus]          110   2e-24
ref|XP_008808614.1|  PREDICTED: histone deacetylase 15-like [P...    108   2e-24
ref|WP_014867660.1|  histone deacetylase [Methanoculleus bourg...    107   2e-24
ref|WP_005788258.1|  acetoin utilization protein [Pseudomonas ...    108   2e-24
ref|WP_007110412.1|  histone deacetylase superfamily protein [...    107   2e-24
ref|XP_010031758.1|  PREDICTED: histone deacetylase 15 isoform...    110   2e-24
ref|WP_019092249.1|  acetoin utilization protein [Gluconacetob...    108   2e-24
ref|WP_024125960.1|  histone deacetylase family protein [Therm...    107   2e-24
ref|XP_010031770.1|  PREDICTED: histone deacetylase 15 isoform...    110   2e-24
ref|WP_019704883.1|  acetoin utilization protein [Klebsiella p...    108   2e-24
emb|CDR33772.1|  Histone deacetylase superfamily protein [Crib...    107   2e-24
gb|KFO09854.1|  Histone deacetylase 10 [Balearica pavonina gib...    107   2e-24
ref|XP_010031777.1|  PREDICTED: histone deacetylase 15 isoform...    109   2e-24
ref|WP_032435543.1|  acetoin utilization protein [Klebsiella p...    107   2e-24
ref|WP_015834763.1|  acetoin utilization protein [Photorhabdus...    107   2e-24
ref|XP_003461634.2|  PREDICTED: histone deacetylase 10 isoform...    110   2e-24
ref|WP_015479634.1|  putative acetylpolyamine aminohydrolase [...    107   2e-24
ref|WP_010508738.1|  acetoin utilization protein [Gluconacetob...    107   2e-24
ref|WP_024808417.1|  histone deacetylase [Verrucomicrobia bact...    107   2e-24
emb|CCI49551.1|  unnamed protein product [Albugo candida]            108   2e-24
ref|WP_008456836.1|  histone deacetylase superfamily protein [...    107   2e-24
gb|KFP23705.1|  Histone deacetylase 10 [Colius striatus]             105   2e-24
ref|WP_016500687.1|  putative deacetylase [Pseudomonas putida]       107   2e-24
ref|WP_018603991.1|  MULTISPECIES: histone deacetylase family ...    107   2e-24
ref|XP_003865908.1|  Hda1 hypothetical proteinistone deacetyla...    110   2e-24
ref|XP_008531335.1|  PREDICTED: histone deacetylase 10 isoform...    110   2e-24
ref|XP_005606855.1|  PREDICTED: histone deacetylase 10 [Equus ...    110   2e-24
ref|XP_002889695.1|  hypothetical protein ARALYDRAFT_470906 [A...    107   3e-24
ref|WP_022927664.1|  histone deacetylase [Patulibacter america...    107   3e-24
ref|WP_010876818.1|  hypothetical protein [Methanothermobacter...    107   3e-24
ref|WP_027262026.1|  acetoin utilization protein [Leisingera n...    107   3e-24
ref|WP_008008846.1|  histone deacetylase [Haloterrigena limicola]    107   3e-24
ref|WP_013194942.1|  histone deacetylase [Methanohalobium eves...    107   3e-24
ref|XP_007502812.1|  PREDICTED: histone deacetylase 10 isoform...    110   3e-24
ref|WP_023279758.1|  deacetylase [Klebsiella pneumoniae]             107   3e-24
ref|XP_007502810.1|  PREDICTED: histone deacetylase 10 isoform...    110   3e-24
emb|CCD59123.1|  histone deacetylase,putative [Schistosoma man...    110   3e-24
ref|WP_010877642.1|  hypothetical protein [Archaeoglobus fulgi...    107   3e-24
ref|WP_023651902.1|  histone deacetylase [Dehalococcoides mcca...    107   3e-24
ref|XP_007502811.1|  PREDICTED: histone deacetylase 10 isoform...    110   3e-24
ref|XP_002968712.1|  hypothetical protein SELMODRAFT_170187 [S...    107   3e-24
ref|XP_007210256.1|  hypothetical protein PRUPE_ppa003397mg [P...    109   3e-24
ref|WP_006165425.1|  histone deacetylase [Natrialba chahannaoe...    107   3e-24
ref|XP_007502813.1|  PREDICTED: histone deacetylase 10 isoform...    109   3e-24
ref|XP_007126839.1|  PREDICTED: histone deacetylase 10 [Physet...    109   3e-24
ref|XP_007502814.1|  PREDICTED: histone deacetylase 10 isoform...    109   3e-24
ref|WP_010480090.1|  hypothetical protein [Thermococcus zilligii]    107   3e-24
ref|XP_006016576.1|  PREDICTED: histone deacetylase 10 isoform...    109   3e-24
ref|XP_005830966.1|  hypothetical protein GUITHDRAFT_157988 [G...    107   3e-24
ref|WP_017320358.1|  hypothetical protein [cyanobacterium PCC ...    106   3e-24
ref|XP_005625770.1|  PREDICTED: histone deacetylase 10 isoform...    109   3e-24
ref|XP_006266271.1|  PREDICTED: histone deacetylase 10 [Alliga...    109   3e-24
ref|WP_007259216.1|  histone deacetylase [Natronolimnobius inn...    107   3e-24
ref|WP_008516894.1|  histone deacetylase superfamily [Dethioba...    107   4e-24
ref|WP_003457348.1|  Deacetylase [Pseudomonas pseudoalcaligenes]     107   4e-24
ref|WP_005431954.1|  histone deacetylase [Sutterella wadsworth...    107   4e-24
ref|XP_005625771.1|  PREDICTED: histone deacetylase 10 isoform...    109   4e-24
ref|WP_026295599.1|  histone deacetylase [Methylophilus methyl...    107   4e-24
gb|KFN39875.1|  hypothetical protein KN63_01245 [Smithella sp....    107   4e-24
ref|WP_014890206.1|  histone deacetylase [Methylocystis sp. SC2]     107   4e-24
ref|XP_006016575.1|  PREDICTED: histone deacetylase 10 isoform...    109   4e-24
ref|WP_008273746.1|  hypothetical protein [Cyanothece sp. CCY0...    106   4e-24
ref|WP_012979913.1|  hypothetical protein [Methanocaldococcus ...    107   4e-24
ref|WP_029648229.1|  acetoin utilization protein [Methylocysti...    107   4e-24
ref|WP_017168201.1|  acetoin utilization protein [Xanthomonas ...    104   4e-24
ref|XP_004845390.1|  PREDICTED: histone deacetylase 10 isoform...    109   4e-24
ref|XP_005878070.1|  PREDICTED: histone deacetylase 6 isoform ...    110   4e-24
ref|XP_005878066.1|  PREDICTED: histone deacetylase 6 isoform ...    110   4e-24
ref|XP_001017986.1|  Histone deacetylase family protein [Tetra...    110   4e-24
gb|ACN94063.1|  histone deacetylase 6 isoform A [Drosophila me...    110   4e-24
ref|WP_015680970.1|  histone deacetylase family protein [Lepto...    106   4e-24
gb|ACN94067.1|  histone deacetylase 6 isoform C [Drosophila me...    110   4e-24
dbj|BAM70335.1|  acetylpolyamine aminohydolase [Methanothermob...    106   4e-24
ref|XP_004885524.1|  PREDICTED: histone deacetylase 10 isoform...    109   4e-24
ref|XP_004845389.1|  PREDICTED: histone deacetylase 10 isoform...    109   4e-24
ref|WP_012682410.1|  histone deacetylase family protein [Gemma...    106   4e-24
ref|XP_004885523.1|  PREDICTED: histone deacetylase 10 isoform...    109   5e-24
gb|EWS61582.1|  Histone deacetylase-like amidohydrolase [Methy...    104   5e-24
gb|KEH32090.1|  histone deacetylase superfamily protein [Medic...    108   5e-24
ref|XP_006854480.1|  hypothetical protein AMTR_s00175p00021990...    109   5e-24
ref|XP_007441277.1|  PREDICTED: histone deacetylase 10 isoform...    109   5e-24
gb|ACN94066.1|  histone deacetylase 6 isoform B [Drosophila me...    110   5e-24
ref|XP_002546102.1|  histone deacetylase HDA1 [Candida tropica...    109   5e-24
gb|ELK33921.1|  Histone deacetylase 6 [Myotis davidii]               110   5e-24
ref|WP_026575713.1|  acetoin utilization protein [Bacillus sp....    107   5e-24
ref|XP_006758932.1|  PREDICTED: histone deacetylase 6 [Myotis ...    110   5e-24
ref|XP_007397084.1|  hypothetical protein PHACADRAFT_196818 [P...    109   5e-24
ref|XP_007189298.1|  PREDICTED: histone deacetylase 10 isoform...    109   5e-24
emb|CCE41516.1|  hypothetical protein CPAR2_800680 [Candida pa...    109   5e-24
ref|XP_005354418.1|  PREDICTED: histone deacetylase 10 [Microt...    109   5e-24
gb|KFO85838.1|  Histone deacetylase 10 [Buceros rhinoceros sil...    106   5e-24
gb|ERE86431.1|  histone deacetylase 10-like protein [Cricetulu...    109   5e-24
ref|XP_005974413.1|  PREDICTED: type-2 histone deacetylase 2-l...    105   5e-24
ref|WP_022814437.1|  hypothetical protein [Poribacteria bacter...    106   6e-24
ref|WP_015704670.1|  acetoin utilization protein [Enterobacter...    106   6e-24
ref|XP_005379609.1|  PREDICTED: histone deacetylase 10 isoform...    109   6e-24
ref|XP_003690319.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...    110   6e-24
ref|XP_010270353.1|  PREDICTED: histone deacetylase 14 isoform...    107   6e-24
ref|WP_008060378.1|  deacylase [Pseudomonas sp. GM78]                106   6e-24
ref|XP_007648353.1|  PREDICTED: histone deacetylase 10 isoform...    109   6e-24
gb|AAH64018.1|  Histone deacetylase 10 [Mus musculus]                108   6e-24
ref|XP_005379608.1|  PREDICTED: histone deacetylase 10 isoform...    109   6e-24
ref|WP_019514337.1|  hypothetical protein [Mycobacterium neoau...    106   6e-24
ref|XP_006097235.1|  PREDICTED: histone deacetylase 6 [Myotis ...    110   6e-24
ref|XP_002164574.2|  PREDICTED: histone deacetylase 6-like [Hy...    107   6e-24
ref|XP_002009552.1|  GI15174 [Drosophila mojavensis]                 109   6e-24
ref|WP_033422872.1|  histone deacetylase [Thiomicrospira halop...    106   7e-24
ref|WP_021779780.1|  deacetylases, including yeast histone dea...    106   7e-24
ref|WP_027594737.1|  acetoin utilization protein [Pseudomonas ...    106   7e-24
ref|XP_006607835.1|  PREDICTED: histone deacetylase 6-like iso...    109   7e-24
ref|WP_027608938.1|  acetoin utilization protein [Pseudomonas ...    106   7e-24
ref|XP_006607834.1|  PREDICTED: histone deacetylase 6-like iso...    109   7e-24
gb|KDO21546.1|  hypothetical protein SPRG_13356 [Saprolegnia p...    108   7e-24
ref|XP_008244027.1|  PREDICTED: histone deacetylase 15 [Prunus...    108   7e-24
ref|WP_028063574.1|  acetoin utilization protein [Solirubrobac...    106   7e-24
ref|WP_010114855.1|  acetoin utilization protein [Burkholderia...    106   7e-24
gb|KEH32089.1|  histone deacetylase superfamily protein [Medic...    108   7e-24
ref|WP_018707991.1|  hypothetical protein [Bacillus fordii]          106   7e-24
ref|WP_020302766.1|  histone deacetylase family protein [Pseud...    106   8e-24
emb|CDQ53588.1|  unnamed protein product [Klebsiella pneumoniae]     106   8e-24
ref|XP_004007727.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...    108   8e-24
gb|EHB03489.1|  Histone deacetylase 10 [Heterocephalus glaber]       108   8e-24
ref|XP_007189297.1|  PREDICTED: histone deacetylase 10 isoform...    108   8e-24
ref|XP_010443924.1|  PREDICTED: histone deacetylase 5-like [Ca...    108   8e-24
ref|XP_007189302.1|  PREDICTED: histone deacetylase 10 isoform...    108   8e-24
emb|CDY77068.1|  Acetylspermidine deacetylase ; Deacetylases, ...    105   8e-24
ref|WP_029733860.1|  hypothetical protein [Deferrisoma camini]       105   8e-24
ref|WP_010102943.1|  acetoin utilization protein [Burkholderia...    106   8e-24
ref|WP_010871339.1|  hypothetical protein [Synechocystis sp. P...    105   8e-24
ref|XP_007189299.1|  PREDICTED: histone deacetylase 10 isoform...    108   8e-24
ref|XP_008880007.1|  hypothetical protein H310_14055 [Aphanomy...    107   8e-24
ref|WP_009019132.1|  histone deacetylase [Luminiphilus syltensis]    106   8e-24
ref|XP_008205621.1|  PREDICTED: histone deacetylase 6 [Nasonia...    109   8e-24
ref|XP_002511973.1|  histone deacetylase hda1, putative [Ricin...    108   8e-24
gb|ERS84209.1|  histone deacetylase [Halomonas sp. PBN3]             106   8e-24
gb|ETE70969.1|  Histone deacetylase 6 [Ophiophagus hannah]           109   8e-24
ref|WP_008541994.1|  histone deacetylase [Sutterella parvirubra]     105   8e-24
ref|XP_007189296.1|  PREDICTED: histone deacetylase 10 isoform...    108   9e-24
ref|WP_004420744.1|  Deacetylase [Pseudomonas pseudoalcaligenes]     106   9e-24
ref|WP_014432136.1|  histone deacetylase [Caldilinea aerophila]      105   9e-24
ref|XP_007189295.1|  PREDICTED: histone deacetylase 10 isoform...    108   9e-24
ref|WP_023288712.1|  MULTISPECIES: deacetylase [Klebsiella]          106   9e-24
ref|WP_012033188.1|  deacetylases [Pelotomaculum thermopropion...    106   9e-24
ref|WP_031218447.1|  acetoin utilization protein [Halomonas sp...    106   9e-24
ref|WP_014123156.1|  hypothetical protein [Thermococcus sp. AM4]     105   9e-24
ref|WP_015367827.1|  Deacetylases, including yeast histone dea...    106   9e-24
ref|WP_032455666.1|  acetoin utilization protein [Klebsiella s...    106   9e-24
ref|WP_023319896.1|  deacetylase [Klebsiella pneumoniae]             106   9e-24
ref|WP_017900835.1|  acetoin utilization protein [Klebsiella p...    106   9e-24
ref|XP_005981171.1|  PREDICTED: histone deacetylase 10 [Pantho...    108   9e-24
ref|NP_563817.1|  histone deacetylase 8 [Arabidopsis thaliana]       106   9e-24
ref|XP_005927925.1|  PREDICTED: histone deacetylase 10-like [H...    108   1e-23
ref|XP_008156434.1|  PREDICTED: histone deacetylase 6 [Eptesic...    109   1e-23
ref|XP_003509615.2|  PREDICTED: histone deacetylase 10 isoform...    108   1e-23
gb|KEH32091.1|  histone deacetylase superfamily protein [Medic...    108   1e-23
ref|WP_004202448.1|  putative deacetylase [Klebsiella pneumoniae]    106   1e-23
ref|WP_026439328.1|  acetoin utilization protein [Acidocella f...    105   1e-23
emb|CDQ13112.1|  Histone deacetylase-like amidohydrolase [Kleb...    105   1e-23
ref|WP_014338327.1|  acetoin utilization protein [Pseudomonas ...    105   1e-23
ref|WP_020673327.1|  hypothetical protein [Amycolatopsis nigre...    105   1e-23
ref|XP_007189301.1|  PREDICTED: histone deacetylase 10 isoform...    108   1e-23
ref|XP_008531334.1|  PREDICTED: histone deacetylase 10 isoform...    108   1e-23
gb|AHW64602.1|  Histone deacetylase-like amidohydrolase [Coryn...    105   1e-23
gb|KFK43155.1|  hypothetical protein AALP_AA1G087000 [Arabis a...    106   1e-23
ref|WP_019958747.1|  hypothetical protein [Vitreoscilla sterco...    105   1e-23
ref|XP_005728236.1|  PREDICTED: histone deacetylase 10-like is...    108   1e-23
ref|XP_007189300.1|  PREDICTED: histone deacetylase 10 isoform...    108   1e-23
gb|KFC07936.1|  Histone deacetylase domain containing protein ...    105   1e-23
ref|XP_004508570.1|  PREDICTED: histone deacetylase 15-like [C...    107   1e-23
ref|WP_030471959.1|  histone deacetylase [Lechevalieria aeroco...    105   1e-23
gb|EXX66036.1|  Hda1p [Rhizophagus irregularis DAOM 197198w]         107   1e-23
ref|WP_002974992.1|  histone deacetylase family protein [Lepto...    105   1e-23
ref|XP_009502215.1|  PREDICTED: histone deacetylase 10 [Phalac...    108   1e-23
ref|XP_009118374.1|  PREDICTED: histone deacetylase 8 [Brassic...    105   1e-23
ref|WP_015133591.1|  histone deacetylase superfamily protein [...    105   1e-23
gb|AAF22892.1|AC006932_9  T27G7.14 [Arabidopsis thaliana]            106   1e-23
ref|XP_006157645.1|  PREDICTED: histone deacetylase 10 isoform...    108   1e-23
ref|XP_006520599.1|  PREDICTED: histone deacetylase 10 isoform...    108   1e-23
ref|XP_005728235.1|  PREDICTED: histone deacetylase 10-like is...    108   1e-23
ref|XP_006520598.1|  PREDICTED: histone deacetylase 10 isoform...    108   1e-23
ref|XP_005335088.1|  PREDICTED: histone deacetylase 10 [Ictido...    108   1e-23
emb|CBN78959.1|  histone deactylase of possible bacterial orig...    109   1e-23
ref|NP_001142413.1|  hypothetical protein [Zea mays]                 105   1e-23
ref|XP_006520602.1|  PREDICTED: histone deacetylase 10 isoform...    108   1e-23
emb|CDY22682.1|  BnaC08g43160D [Brassica napus]                      105   1e-23
ref|XP_007159852.1|  hypothetical protein PHAVU_002G273200g [P...    105   1e-23
gb|KGM89736.1|  Deacetylase [Roseovarius mucosus DSM 17069]          103   1e-23
ref|WP_029147510.1|  histone deacetylase [Methylophilus sp. 5]       105   1e-23
emb|CCA17150.1|  histone deacetylase putative [Albugo laibachi...    105   1e-23
ref|WP_012572272.1|  hypothetical protein [Thermococcus onnuri...    105   1e-23
ref|WP_011249089.1|  hypothetical protein [Thermococcus kodaka...    105   1e-23
ref|XP_003707583.1|  PREDICTED: histone deacetylase 6-like [Me...    108   1e-23
ref|WP_013732998.1|  histone deacetylase [Verrucosispora maris]      105   1e-23
ref|XP_002305854.2|  hypothetical protein POPTR_0004s09180g [P...    108   1e-23
ref|WP_011146589.1|  acetoin utilization protein [Photorhabdus...    105   1e-23
ref|WP_011907438.1|  histone deacetylase [Rhodobacter sphaeroi...    105   1e-23
ref|XP_004832599.1|  conserved hypothetical protein [Babesia e...    108   1e-23
ref|XP_006520606.1|  PREDICTED: histone deacetylase 10 isoform...    107   1e-23
gb|EZP39683.1|  Histone deacetylase domain-containing protein ...    104   1e-23
ref|XP_006520604.1|  PREDICTED: histone deacetylase 10 isoform...    107   2e-23
ref|XP_005066948.1|  PREDICTED: histone deacetylase 10 [Mesocr...    108   2e-23
ref|XP_006157644.1|  PREDICTED: histone deacetylase 10 isoform...    107   2e-23
gb|EMC82052.1|  Histone deacetylase 10 [Columba livia]               103   2e-23
ref|WP_016474834.1|  hypothetical protein [Sutterella wadswort...    105   2e-23
ref|XP_007235164.1|  PREDICTED: histone deacetylase 10-like [A...    107   2e-23
ref|XP_004279656.1|  PREDICTED: histone deacetylase 10 [Orcinu...    107   2e-23
ref|WP_027817698.1|  acetoin utilization protein [Burkholderia...    105   2e-23
ref|NP_954668.2|  histone deacetylase 10 [Mus musculus]              107   2e-23
ref|XP_006520600.1|  PREDICTED: histone deacetylase 10 isoform...    107   2e-23
ref|WP_022947406.1|  histone deacetylase [Methylohalobius crim...    105   2e-23
ref|WP_021995425.1|  putative uncharacterized protein [Suttere...    105   2e-23
ref|XP_003783462.1|  PREDICTED: histone deacetylase 10 [Otolem...    107   2e-23
ref|XP_004563915.1|  PREDICTED: histone deacetylase 10-like [M...    107   2e-23
gb|KGM56657.1|  acetoin utilization protein [Lysobacter arseni...    104   2e-23
gb|EPS67516.1|  hypothetical protein M569_07259 [Genlisea aurea]     105   2e-23
ref|XP_008109464.1|  PREDICTED: histone deacetylase 10 [Anolis...    107   2e-23
ref|XP_010206121.1|  PREDICTED: histone deacetylase 10 [Colius...    105   2e-23
ref|XP_010298692.1|  PREDICTED: histone deacetylase 10 [Balear...    107   2e-23
ref|WP_012964019.1|  acetoin utilization protein [Hydrogenobac...    104   2e-23
ref|WP_031359596.1|  acetoin utilization protein [Burkholderia...    105   2e-23
ref|XP_007507737.1|  PREDICTED: histone deacetylase 6 isoform ...    108   2e-23
ref|WP_008160749.1|  histone deacetylase [Natronorubrum sulfid...    105   2e-23
gb|KGD61800.1|  histone deacetylase superfamily protein [Alcan...    105   2e-23
ref|WP_009573200.1|  acetoin utilization protein [Celeribacter...    105   2e-23
ref|WP_016697926.1|  hypothetical protein [Actinoalloteichus s...    105   2e-23
ref|WP_023264941.1|  hypothetical protein [Cupriavidus sp. HPC...    103   2e-23
ref|XP_007507740.1|  PREDICTED: histone deacetylase 6 isoform ...    108   2e-23
gb|EXG81583.1|  deacetylase, histone deacetylase/acetoin utili...    105   2e-23
ref|WP_015094759.1|  histone deacetylase [Pseudomonas sp. UW4]       105   2e-23
ref|WP_009807892.1|  histone deacetylase [Roseobacter sp. MED193]    105   2e-23
ref|WP_012992389.1|  acetoin utilization protein [Thermocrinis...    104   2e-23
ref|WP_009814059.1|  histone deacetylase [Roseovarius nubinhib...    105   2e-23
ref|WP_005372402.1|  deacetylase, histone deacetylase/acetoin ...    105   2e-23
ref|WP_011429480.1|  hypothetical protein [Synechococcus sp. J...    104   2e-23
ref|XP_007507741.1|  PREDICTED: histone deacetylase 6 isoform ...    108   2e-23
ref|XP_006305019.1|  hypothetical protein CARUB_v10009385mg [C...    105   2e-23
ref|WP_025808728.1|  acetoin utilization protein [Pseudomonas ...    105   2e-23
gb|EXX66035.1|  Hda1p [Rhizophagus irregularis DAOM 197198w]         106   2e-23
gb|KER67986.1|  acetoin utilization protein [Burkholderia cepa...    105   2e-23
ref|XP_009302028.1|  PREDICTED: histone deacetylase 6 isoform ...    108   2e-23
gb|KCW51841.1|  hypothetical protein EUGRSUZ_J01293 [Eucalyptu...    105   2e-23
ref|XP_007453951.1|  PREDICTED: histone deacetylase 10 [Lipote...    107   2e-23
ref|WP_005264776.1|  histone deacetylase [Rhodococcus opacus]        105   2e-23
ref|XP_008293470.1|  PREDICTED: histone deacetylase 6 [Stegast...    108   2e-23
ref|XP_006341636.1|  PREDICTED: histone deacetylase 15-like is...    106   2e-23
ref|WP_014586124.1|  histone deacetylase [Methanosaeta harundi...    104   2e-23
ref|WP_025130023.1|  acetoin utilization protein [Pseudomonas ...    105   2e-23
ref|XP_004197432.1|  Piso0_004685 [Millerozyma farinosa CBS 7064]    107   2e-23
ref|XP_004650461.1|  PREDICTED: histone deacetylase 10 isoform...    107   2e-23
ref|XP_003557557.1|  PREDICTED: histone deacetylase 15-like is...    107   3e-23
gb|ETS30805.1|  deacetylase, histone deacetylase/acetoin utili...    104   3e-23
ref|WP_012308378.1|  hypothetical protein [Synechococcus sp. P...    104   3e-23
ref|WP_011352369.1|  acetoin utilization protein [Burkholderia...    104   3e-23
ref|XP_008876908.1|  hypothetical protein H310_11856 [Aphanomy...    107   3e-23
gb|KFZ62388.1|  Histone deacetylase 10 [Caprimulgus carolinensis]    102   3e-23
ref|WP_009286729.1|  Histone deacetylase superfamily [Halomona...    104   3e-23
ref|WP_015858049.1|  hypothetical protein [Thermococcus gammat...    104   3e-23
ref|XP_008316122.1|  PREDICTED: histone deacetylase 6 [Cynoglo...    107   3e-23
gb|KFP96444.1|  Histone deacetylase 10 [Haliaeetus albicilla]        104   3e-23
gb|KFV93851.1|  Histone deacetylase 10 [Eurypyga helias]             102   3e-23
ref|WP_012082112.1|  acetoin utilization protein [Nitratirupto...    104   3e-23
gb|ERG85803.1|  histone deacetylase 6 [Ascaris suum]                 107   3e-23
ref|WP_031431781.1|  hypothetical protein [Methylomicrobium ag...    103   3e-23
ref|XP_004650460.1|  PREDICTED: histone deacetylase 10 isoform...    107   3e-23
gb|ELU00516.1|  hypothetical protein CAPTEDRAFT_43373 [Capitel...    104   3e-23
gb|KDB02363.1|  histone deacetylase [Defluviimonas sp. 20V17]        104   3e-23
gb|KFP00232.1|  Histone deacetylase 10 [Calypte anna]                104   3e-23
ref|XP_003444063.2|  PREDICTED: histone deacetylase 10-like is...    107   3e-23
ref|XP_009302026.1|  PREDICTED: histone deacetylase 6 isoform ...    107   3e-23
gb|KER67691.1|  acetoin utilization protein [Burkholderia cepa...    104   3e-23
ref|XP_010228344.1|  PREDICTED: histone deacetylase 15-like is...    106   3e-23
ref|XP_007422273.1|  PREDICTED: histone deacetylase 6 [Python ...    107   3e-23
ref|WP_018408895.1|  histone deacetylase [Methylocystis rosea]       104   3e-23
ref|WP_025772445.1|  hypothetical protein [Thioalkalivibrio sp...    104   3e-23
ref|WP_006158401.1|  Deacetylase, histone deacetylase family p...    102   3e-23
ref|WP_011061643.1|  acetoin utilization protein [Pseudomonas ...    104   3e-23
ref|WP_026020252.1|  acetoin utilization protein [Pseudomonas ...    104   3e-23
ref|WP_017509080.1|  hypothetical protein [beta proteobacteriu...    104   3e-23
ref|NP_200915.2|  histone deacetylase 18 [Arabidopsis thaliana]      107   3e-23
ref|XP_006066386.1|  PREDICTED: histone deacetylase 10 isoform...    107   3e-23
ref|WP_005045531.1|  HdaI-type histone deacetylase [Halococcus...    104   3e-23
ref|WP_006078194.1|  HdaI-type histone deacetylase [Halococcus...    104   3e-23
ref|XP_006066387.1|  PREDICTED: histone deacetylase 10 isoform...    107   3e-23
ref|XP_010228346.1|  PREDICTED: histone deacetylase 15-like is...    106   3e-23
ref|XP_008654338.1|  PREDICTED: uncharacterized protein LOC100...    104   3e-23
ref|WP_023992836.1|  putative protein MTH_1194 [Methanobacteri...    104   3e-23
gb|KFR11165.1|  Histone deacetylase 10 [Opisthocomus hoazin]         104   3e-23
gb|KFW83214.1|  Histone deacetylase 10 [Manacus vitellinus]          104   3e-23
ref|XP_008310469.1|  PREDICTED: histone deacetylase 10 isoform...    107   3e-23
ref|WP_015635864.1|  histone deacetylase-like amidohydrolase H...    104   3e-23
ref|WP_009722138.1|  histone deacetylase [Halomonas sp. TD01]        104   3e-23
ref|XP_010228343.1|  PREDICTED: histone deacetylase 15-like is...    106   3e-23
ref|XP_010228347.1|  PREDICTED: histone deacetylase 15-like is...    106   4e-23
ref|WP_025064318.1|  acetoin utilization protein [Sulfitobacte...    104   4e-23
ref|XP_004085908.1|  PREDICTED: histone deacetylase 6-like [Or...    102   4e-23
ref|XP_006376754.1|  hypothetical protein POPTR_0012s05730g [P...    104   4e-23
ref|XP_010032446.1|  PREDICTED: histone deacetylase 14 [Eucaly...    104   4e-23
gb|EPY19637.1|  histone deacetylase [Angomonas deanei]               103   4e-23
ref|WP_006336748.1|  Histone deacetylase-like amidohydrolase [...    104   4e-23
ref|XP_010228342.1|  PREDICTED: histone deacetylase 15-like is...    106   4e-23
gb|KFP41387.1|  Histone deacetylase 10 [Chlamydotis undulata m...    104   4e-23
emb|CDJ04732.1|  histone deacetylase 6 [Echinococcus multilocu...    107   4e-23
gb|KFQ60447.1|  Histone deacetylase 10 [Pelecanus crispus]           104   4e-23
ref|XP_010228349.1|  PREDICTED: histone deacetylase 15-like is...    106   4e-23
ref|XP_002064165.1|  GK20022 [Drosophila willistoni]                 107   4e-23
ref|XP_005174308.1|  PREDICTED: histone deacetylase 10 isoform...    107   4e-23
gb|KGK40499.1|  hypothetical protein JL09_g295 [Pichia kudriav...    107   4e-23
gb|ESA23492.1|  hypothetical protein GLOINDRAFT_106023 [Rhizop...    106   4e-23
ref|XP_004438107.1|  PREDICTED: histone deacetylase 10 [Cerato...    106   4e-23
ref|WP_014896799.1|  acetoin utilization protein [Burkholderia...    104   4e-23
ref|WP_008494181.1|  acetoin utilization protein [Acidocella s...    103   4e-23
ref|XP_009782419.1|  PREDICTED: histone deacetylase 15 [Nicoti...    106   4e-23
gb|KEA58212.1|  acetoin utilization protein [Burkholderia ceno...    104   4e-23
ref|XP_006212656.1|  PREDICTED: histone deacetylase 10 [Vicugn...    106   4e-23
ref|XP_007658118.1|  PREDICTED: histone deacetylase 6 [Ornitho...    107   4e-23
ref|NP_956069.1|  histone deacetylase 10 [Danio rerio]               106   4e-23
ref|WP_014718495.1|  acetoin utilization protein [Pseudomonas ...    103   5e-23
ref|XP_002274270.2|  PREDICTED: histone deacetylase 15-like [V...    106   5e-23
ref|XP_002668933.1|  histone deacetylase [Naegleria gruberi st...    107   5e-23
gb|AIB42115.1|  acetoin utilization protein [Pseudomonas sp. W...    103   5e-23
ref|XP_009413868.1|  PREDICTED: histone deacetylase 15-like is...    106   5e-23
ref|WP_028098482.1|  acetoin utilization protein [Dongia sp. U...    103   5e-23
ref|WP_027603472.1|  acetoin utilization protein [Pseudomonas ...    103   5e-23
ref|WP_004267261.1|  acetoin utilization protein [Natrialba ma...    103   5e-23
emb|CBI15417.3|  unnamed protein product [Vitis vinifera]            106   5e-23
ref|WP_029017757.1|  acetoin utilization protein [actinobacter...    103   5e-23
ref|WP_019817066.1|  histone deacetylase family protein [Pseud...    103   5e-23
ref|WP_025046016.1|  acetoin utilization protein [Sulfitobacte...    103   5e-23
ref|WP_022608704.1|  deacetylase [Rubidibacter lacunae]              103   5e-23
ref|XP_001527542.1|  histone deacetylase HDA1 [Lodderomyces el...    107   5e-23
ref|WP_015173726.1|  histone deacetylase superfamily protein [...    103   5e-23
ref|XP_004529653.1|  PREDICTED: histone deacetylase 6-like iso...    107   5e-23
ref|XP_009413871.1|  PREDICTED: histone deacetylase 15-like is...    106   5e-23
ref|WP_024810098.1|  acetoin utilization protein [Oceanicola s...    103   5e-23
ref|WP_008959739.1|  histone deacetylase [Halomonas sp. HAL1]        103   5e-23
ref|XP_004529654.1|  PREDICTED: histone deacetylase 6-like iso...    107   5e-23
ref|WP_021160393.1|  Histone deacetylase 6 [Burkholderia vietn...    103   5e-23
ref|WP_012036052.1|  acetoin utilization protein [Methanocella...    103   5e-23
ref|XP_006341635.1|  PREDICTED: histone deacetylase 15-like is...    105   5e-23
ref|WP_025714909.1|  acetoin utilization protein [Klebsiella s...    103   6e-23
gb|ELW49014.1|  Plexin-B2 [Tupaia chinensis]                         107   6e-23
ref|XP_006782567.1|  PREDICTED: histone deacetylase 10-like is...    106   6e-23
ref|XP_001647545.1|  predicted protein [Nematostella vectensis]      103   6e-23
ref|XP_010143638.1|  PREDICTED: histone deacetylase 10 [Bucero...    105   6e-23
gb|ELR50426.1|  Histone deacetylase 10 [Bos mutus]                   106   6e-23
ref|XP_005822076.1|  hypothetical protein GUITHDRAFT_160215 [G...    103   6e-23
ref|WP_006432397.1|  histone deacetylase [Natrinema versiforme]      103   6e-23
gb|KFV46606.1|  Histone deacetylase 10 [Gavia stellata]              103   6e-23
ref|WP_032903045.1|  acetoin utilization protein [Pseudomonas ...    103   6e-23
ref|WP_020773821.1|  histone deacetylase family protein [Lepto...    103   6e-23
gb|KGA09806.1|  hypothetical protein GM45_0170 [actinobacteriu...    103   6e-23
ref|WP_023809007.1|  histone deacetylase [Mesorhizobium sp. L2...    103   6e-23
gb|EKC35286.1|  Histone deacetylase 6 [Crassostrea gigas]            106   6e-23
ref|XP_006976202.1|  PREDICTED: histone deacetylase 10 [Peromy...    106   6e-23
gb|KFP54391.1|  Histone deacetylase 10 [Cathartes aura]              103   6e-23
ref|XP_006341634.1|  PREDICTED: histone deacetylase 15-like is...    105   6e-23
ref|XP_006376752.1|  hypothetical protein POPTR_0012s05730g [P...    104   6e-23
ref|WP_024930968.1|  histone deacetylase [Methylophilus sp. OH31]    103   7e-23
gb|AHL23317.1|  Deacetylase, histone deacetylase-like and acet...    103   7e-23
gb|KDE54988.1|  histone deacetylase [Methanoculleus sp. MH98A]       103   7e-23
ref|XP_458424.2|  DEHA2C16918p [Debaryomyces hansenii CBS767]        106   7e-23
ref|XP_005207569.1|  PREDICTED: histone deacetylase 10 isoform...    105   7e-23
ref|XP_009844867.1|  hypothetical protein, variant [Aphanomyce...    103   7e-23
ref|WP_011241877.1|  acetoin utilization protein [Ruegeria pom...    103   7e-23
ref|XP_005184100.1|  PREDICTED: histone deacetylase 6-like iso...    106   7e-23
ref|XP_005207571.1|  PREDICTED: histone deacetylase 10 isoform...    105   7e-23
ref|XP_008102145.1|  PREDICTED: histone deacetylase 6 [Anolis ...    106   7e-23
gb|EMG48891.1|  Histone deacetylase HDA1 [Candida maltosa Xu316]     105   7e-23
ref|XP_005903968.1|  PREDICTED: histone deacetylase 10 [Bos mu...    105   7e-23
gb|KFP66127.1|  Histone deacetylase 10 [Cariama cristata]            103   8e-23
ref|WP_024809636.1|  acetoin utilization protein [Oceanicola s...    103   8e-23
ref|XP_005184097.1|  PREDICTED: histone deacetylase 6-like iso...    106   8e-23
ref|WP_017356472.1|  acetoin utilization protein [Stenotrophom...    102   8e-23
gb|AII85746.1|  histone deacetylase-like amidohydrolase HdaH [...    103   8e-23
ref|WP_020951140.1|  histone deacetylase [Paracoccus aminophilus]    103   8e-23
ref|XP_006607836.1|  PREDICTED: histone deacetylase 6-like iso...    106   8e-23
ref|WP_022520058.1|  Histone deacetylase superfamily protein [...    103   8e-23
ref|XP_005184098.1|  PREDICTED: histone deacetylase 6-like iso...    106   8e-23
ref|XP_006684285.1|  hypothetical protein CANTEDRAFT_118275 [C...    105   8e-23
ref|XP_005207570.1|  PREDICTED: histone deacetylase 10 isoform...    105   8e-23
ref|WP_010529965.1|  histone deacetylase [Lentibacillus jeotgali]    103   8e-23
ref|WP_021324292.1|  histone deacetylase family protein [Photo...    103   8e-23
ref|XP_005184099.1|  PREDICTED: histone deacetylase 6-like iso...    106   8e-23
ref|WP_015100855.1|  hypothetical protein [Saccharothrix espan...    105   8e-23
ref|XP_006633251.1|  PREDICTED: histone deacetylase 10-like [L...    104   8e-23
ref|NP_001068928.1|  histone deacetylase 10 [Bos taurus]             105   8e-23
ref|WP_027967267.1|  acetoin utilization protein [Halomonas ha...    103   8e-23
emb|CDJ04733.1|  histone deacetylase 6 [Echinococcus multilocu...    100   9e-23
ref|XP_002982757.1|  hypothetical protein SELMODRAFT_179763 [S...    103   9e-23
ref|WP_013886579.1|  acetoin utilization protein AcuC [Flexist...    103   9e-23
gb|EMP38534.1|  Histone deacetylase 10 [Chelonia mydas]              104   9e-23
ref|WP_014789244.1|  hypothetical protein [Thermococcus sp. CL1]     103   9e-23
ref|WP_008876991.1|  Histone deacetylase-like amidohydrolase [...    103   9e-23
ref|WP_027794528.1|  acetoin utilization protein [Burkholderia...    103   9e-23
ref|XP_010094452.1|  hypothetical protein L484_001083 [Morus n...    102   9e-23
emb|CEA13293.1|  putative protein MTH_1194 [Methanobacterium f...    103   9e-23
ref|XP_006376753.1|  hypothetical protein POPTR_0012s05730g [P...    105   9e-23
ref|WP_027810327.1|  acetoin utilization protein [Burkholderia...    103   9e-23
gb|ELU01419.1|  hypothetical protein CAPTEDRAFT_126869 [Capite...    105   9e-23
ref|XP_004612981.1|  PREDICTED: histone deacetylase 6 [Sorex a...    106   9e-23
ref|XP_008878309.1|  hypothetical protein, variant 6 [Aphanomy...    104   9e-23
gb|EDN66325.1|  Histone deacetylase domain [Beggiatoa sp. PS]        100   9e-23
gb|AHG02885.1|  acetoin utilization protein [Halobacterium sp....    103   9e-23
gb|KEZ02814.1|  acetoin utilization protein [Burkholderia sp. ...    103   9e-23
ref|WP_008954119.1|  acetoin utilization protein [Pseudogulben...    103   1e-22
ref|WP_002996726.1|  histone deacetylase family protein [Lepto...    102   1e-22
ref|XP_001450336.1|  hypothetical protein [Paramecium tetraure...    105   1e-22
ref|XP_010117534.1|  PREDICTED: histone deacetylase 10-like [C...    103   1e-22
ref|XP_009170313.1|  hypothetical protein T265_06715 [Opisthor...    106   1e-22
ref|WP_027814577.1|  acetoin utilization protein [Burkholderia...    103   1e-22
ref|WP_010628237.1|  histone deacetylase [Halomonas sp. KM-1]        103   1e-22
ref|WP_012617299.1|  histone deacetylase [Methanosphaerula pal...    102   1e-22
ref|WP_006410237.1|  acetoin utilization protein [Burkholderia...    103   1e-22
gb|AIS31787.1|  histone deacetylase family protein [Methanobac...    102   1e-22
ref|XP_004347039.1|  histone deacetylase [Capsaspora owczarzak...    106   1e-22
ref|XP_010270352.1|  PREDICTED: histone deacetylase 14 isoform...    103   1e-22
ref|XP_002831342.1|  PREDICTED: histone deacetylase 10 [Pongo ...    105   1e-22
gb|KFV64953.1|  Histone deacetylase 10 [Picoides pubescens]          102   1e-22
ref|WP_027809637.1|  acetoin utilization protein [Burkholderia...    103   1e-22
ref|WP_008227805.1|  histone deacetylase [Roseobacter sp. GAI101]    103   1e-22
ref|WP_023393546.1|  histone deacetylase superfamily protein [...    102   1e-22
ref|XP_009136431.1|  PREDICTED: histone deacetylase 5-like [Br...    105   1e-22
gb|KGB06738.1|  histone deacetylase domain protein [Enterobact...    103   1e-22
ref|XP_007380856.1|  histone deacetylase clr3 [Punctularia str...    105   1e-22
gb|KFU93968.1|  Histone deacetylase 10 [Chaetura pelagica]           102   1e-22
gb|AIO32646.1|  histone deacetylase domain protein [Burkholder...    102   1e-22
sp|Q70I53.3|HDAH_ALCSD  RecName: Full=Histone deacetylase-like...    102   1e-22
gb|AHM02015.1|  acetoin utilization protein [uncultured miscel...    102   1e-22
gb|ELK07516.1|  Histone deacetylase 10 [Pteropus alecto]             105   1e-22
ref|XP_003682794.1|  hypothetical protein TDEL_0G02160 [Torula...    105   1e-22
gb|KFQ82011.1|  Histone deacetylase 10 [Phoenicopterus ruber r...    102   1e-22
gb|KFZ65998.1|  Histone deacetylase 10 [Podiceps cristatus]          102   1e-22
ref|WP_007438570.1|  acetoin utilization protein [Acetobactera...    102   1e-22
ref|WP_014013385.1|  hypothetical protein [Thermococcus sp. 4557]    102   1e-22
ref|XP_008430990.1|  PREDICTED: histone deacetylase 10 isoform...    105   1e-22
ref|XP_001646141.1|  hypothetical protein Kpol_1039p32 [Vander...    105   1e-22
ref|WP_009120086.1|  histone deacetylase [Neisseria shayeganii]      102   1e-22
ref|XP_002947645.1|  hypothetical protein VOLCADRAFT_120505 [V...    105   1e-22
ref|XP_010226287.1|  PREDICTED: histone deacetylase 10 [Tinamu...    105   1e-22
ref|XP_009549035.1|  hypothetical protein HETIRDRAFT_324562 [H...    105   1e-22
ref|XP_006122683.1|  PREDICTED: histone deacetylase 10 isoform...    104   1e-22
gb|EWM27914.1|  histone deacetylase superfamily protein [Nanno...    102   1e-22
pdb|1ZZ0|A  Chain A, Crystal Structure Of A Hdac-Like Protein ...    102   1e-22
gb|EGD03861.1|  histone deacetylase superfamily protein [Burkh...    102   1e-22
gb|EHJ75870.1|  putative histone deacetylase 7A [Danaus plexip...    105   1e-22
pdb|2VCG|A  Chain A, Crystal Structure Of A Hdac-like Protein ...    102   1e-22
ref|WP_006065111.1|  histone deacetylase [Natronorubrum bangense]    102   1e-22
ref|WP_029042429.1|  acetoin utilization protein [Cucumibacter...    102   1e-22
ref|XP_007864501.1|  histone deacetylase complex protein [Gloe...    105   1e-22
ref|WP_023475592.1|  Histone deacetylase 6 [Burkholderia cenoc...    102   1e-22
ref|XP_004075765.1|  PREDICTED: histone deacetylase 10-like [O...    104   1e-22
ref|XP_002106992.1|  HDAC6 [Drosophila simulans]                     105   2e-22
gb|AAK55655.1|  histone deacetylase HDA1 [Candida albicans]          105   2e-22
ref|XP_007546781.1|  PREDICTED: histone deacetylase 10 [Poecil...    105   2e-22
gb|EWH01992.1|  histone deacetylase [Halomonas sp. BC04]             102   2e-22
ref|XP_007048426.1|  Histone deacetylase 14 isoform 2 [Theobro...    102   2e-22
emb|CAG08631.1|  unnamed protein product [Tetraodon nigroviridis]    102   2e-22
gb|KFV05971.1|  Histone deacetylase 10 [Tauraco erythrolophus]       102   2e-22
ref|WP_019883789.1|  MULTISPECIES: hypothetical protein [Methy...    102   2e-22
ref|WP_009545130.1|  MULTISPECIES: hypothetical protein [Cyano...    102   2e-22
gb|KFV03625.1|  Histone deacetylase 10 [Pterocles gutturalis]        102   2e-22
ref|WP_004040720.1|  histone deacetylase [Methanofollis limina...    102   2e-22
ref|XP_002587576.1|  hypothetical protein BRAFLDRAFT_95716 [Br...    105   2e-22
ref|XP_002866413.1|  hypothetical protein ARALYDRAFT_919346 [A...    105   2e-22
ref|XP_006213513.1|  PREDICTED: histone deacetylase 6 [Vicugna...    105   2e-22
gb|EUB57988.1|  Histone deacetylase 6 [Echinococcus granulosus]      105   2e-22
emb|CDY02173.1|  BnaA03g39940D [Brassica napus]                      104   2e-22
ref|WP_032427359.1|  acetoin utilization protein [Klebsiella p...    102   2e-22
ref|WP_029934002.1|  histone deacetylase [Thiomicrospira pelop...    102   2e-22
gb|KFV46281.1|  Histone deacetylase 10 [Tyto alba]                   100   2e-22
gb|EGI62119.1|  Histone deacetylase 6 [Acromyrmex echinatior]        105   2e-22
ref|XP_004589760.1|  PREDICTED: gamma-tubulin complex componen...    106   2e-22
ref|XP_006917911.1|  PREDICTED: histone deacetylase 10 [Pterop...    105   2e-22
ref|WP_013532992.1|  MULTISPECIES: histone deacetylase [Mesorh...    102   2e-22
ref|WP_012328707.1|  acetoin utilization protein [Burkholderia...    102   2e-22
gb|ABG43093.1|  histone deacetylase HDAC4 [Triticum aestivum]        102   2e-22
emb|CDX18467.1|  Histone deacetylase-like amidohydrolase [Meso...    102   2e-22
ref|WP_017326125.1|  hypothetical protein [Synechococcus sp. P...    102   2e-22
ref|XP_009844866.1|  hypothetical protein H257_17686 [Aphanomy...    103   2e-22
ref|WP_009765923.1|  histone deacetylase [Sporosarcina newyork...    102   2e-22
gb|AAL16299.1|AF428369_1  At1g08460/T27G7_7 [Arabidopsis thali...    102   2e-22
gb|EPY84858.1|  histone deacetylase 10 [Camelus ferus]               105   2e-22
ref|XP_006122682.1|  PREDICTED: histone deacetylase 10 isoform...    104   2e-22
emb|CDX23897.1|  Histone deacetylase-like amidohydrolase [Meso...    102   2e-22
emb|CDQ76250.1|  unnamed protein product [Oncorhynchus mykiss]       104   2e-22
ref|WP_030007660.1|  hypothetical protein [Synechococcus sp. N...    101   2e-22
ref|XP_006888173.1|  PREDICTED: histone deacetylase 10 [Elepha...    105   2e-22
ref|WP_028200053.1|  acetoin utilization protein [Burkholderia...    102   2e-22
ref|XP_006122681.1|  PREDICTED: histone deacetylase 10 isoform...    104   2e-22
ref|WP_012753364.1|  acetoin utilization protein [Methylobacte...    101   2e-22
ref|WP_007670063.1|  histone deacetylase [Caulobacter sp. AP07]      102   2e-22
ref|WP_020775760.1|  histone deacetylase family protein [Lepto...    101   2e-22
ref|WP_023777097.1|  histone deacetylase [Mesorhizobium sp. LN...    102   2e-22
gb|EFB29238.1|  hypothetical protein PANDA_006175 [Ailuropoda ...    105   2e-22
ref|WP_020445184.1|  deacetylase, histone deacetylase/acetoin ...    102   2e-22
ref|XP_001772074.1|  class II RPD3 type histone deacetylase pr...    103   2e-22
ref|XP_008188784.1|  PREDICTED: histone deacetylase 6 [Acyrtho...    104   2e-22
gb|EMS61946.1|  Histone deacetylase 15 [Triticum urartu]             104   2e-22
ref|WP_012187714.1|  histone deacetylase superfamily protein [...    102   3e-22
ref|WP_012724185.1|  acetoin utilization protein [Pseudomonas ...    102   3e-22
ref|WP_027784696.1|  acetoin utilization protein [Burkholderia...    102   3e-22
ref|XP_008171105.1|  PREDICTED: histone deacetylase 10 isoform...    104   3e-22
ref|XP_008153700.1|  PREDICTED: histone deacetylase 10 [Eptesi...    104   3e-22
ref|XP_006922811.1|  PREDICTED: histone deacetylase 6 isoform ...    105   3e-22
ref|WP_012898836.1|  acetoin utilization protein [Methanocella...    101   3e-22
ref|WP_004593718.1|  histone deacetylase [Methanocaldococcus v...    101   3e-22
ref|XP_002911602.1|  histone deacetylase clr3 [Coprinopsis cin...    104   3e-22
ref|XP_001699864.1|  histone deacetylase [Chlamydomonas reinha...    102   3e-22
gb|EGO01316.1|  hypothetical protein SERLA73DRAFT_72261 [Serpu...    104   3e-22
ref|WP_015324284.1|  deacetylase, histone deacetylase/acetoin ...    104   3e-22
ref|XP_007317128.1|  hypothetical protein SERLADRAFT_436772 [S...    104   3e-22
ref|WP_003191270.1|  acetoin utilization protein [Pseudomonas ...    102   3e-22
ref|WP_018717937.1|  hypothetical protein [Arhodomonas aquaeolei]    102   3e-22
gb|KGB99673.1|  histone deacetylase domain protein [Burkholder...    102   3e-22
gb|EIE78040.1|  hypothetical protein RO3G_02744 [Rhizopus dele...    103   3e-22
ref|XP_002917832.1|  PREDICTED: histone deacetylase 6-like [Ai...    105   3e-22
ref|XP_009385435.1|  PREDICTED: histone deacetylase 14 [Musa a...    102   3e-22
ref|XP_003062528.1|  histone deacetylase [Micromonas pusilla C...    101   3e-22
gb|KFQ95252.1|  Histone deacetylase 10 [Nipponia nippon]             101   3e-22
ref|WP_030103496.1|  acetoin utilization protein [Burkholderia...    101   3e-22
ref|WP_015178700.1|  histone deacetylase superfamily [Oscillat...    101   3e-22
ref|XP_003578822.1|  PREDICTED: histone deacetylase 14 [Brachy...    102   3e-22
ref|WP_015150036.1|  deacetylase [Oscillatoria acuminata]            101   3e-22
ref|XP_004587979.1|  PREDICTED: histone deacetylase 6 [Ochoton...    105   3e-22
ref|XP_008491300.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...    103   3e-22
ref|WP_024546793.1|  hypothetical protein [Synechococcus sp. N...    101   3e-22
ref|WP_021042001.1|  putative deacetylase [halophilic archaeon...    101   3e-22
emb|CDP04660.1|  unnamed protein product [Coffea canephora]          102   3e-22
ref|XP_007056931.1|  PREDICTED: histone deacetylase 10 [Chelon...    103   3e-22
ref|XP_004396896.1|  PREDICTED: histone deacetylase 6 [Odobenu...    104   3e-22
ref|XP_006269100.1|  PREDICTED: histone deacetylase 6 [Alligat...    104   3e-22
ref|XP_006032119.1|  PREDICTED: histone deacetylase 6 [Alligat...    104   3e-22
ref|XP_003645631.1|  hypothetical protein Ecym_3324 [Eremothec...    103   3e-22
ref|WP_031399295.1|  acetoin utilization protein [Burkholderia...    101   4e-22
gb|KGU20082.1|  histone deacetylase 6/10 [Candida albicans P34...    104   4e-22
gb|KGQ81544.1|  histone deacetylase 6/10 [Candida albicans P94...    104   4e-22
ref|XP_007450942.1|  PREDICTED: histone deacetylase 6 [Lipotes...    104   4e-22
ref|WP_004784707.1|  histone deacetylase [Leptospira meyeri]         101   4e-22
gb|EIF48091.1|  histone deacetylase hda1 [Dekkera bruxellensis...    103   4e-22
ref|XP_009915653.1|  PREDICTED: histone deacetylase 10 [Haliae...    103   4e-22
ref|WP_013257413.1|  histone deacetylase superfamily protein [...    101   4e-22
ref|XP_009933509.1|  PREDICTED: histone deacetylase 10 [Opisth...    103   4e-22
gb|EFN70093.1|  Histone deacetylase 6 [Camponotus floridanus]        104   4e-22
ref|WP_011657169.1|  acetoin utilization protein [Burkholderia...    101   4e-22
ref|XP_001383345.2|  hypothetical protein PICST_71431 [Scheffe...    104   4e-22
ref|WP_011549604.1|  acetoin utilization protein [Burkholderia...    101   4e-22
gb|KGR07024.1|  histone deacetylase 6/10 [Candida albicans P37...    104   4e-22
ref|XP_718366.1|  likely class II histone deacetylase subunit ...    104   4e-22
gb|EST04726.1|  hypothetical protein PSEUBRA_SCAF8g02105 [Pseu...    103   4e-22
ref|XP_009479508.1|  PREDICTED: histone deacetylase 10 [Peleca...    103   4e-22
gb|KHC67175.1|  histone deacetylase 6/10 [Candida albicans P78...    104   4e-22
gb|KGR04447.1|  histone deacetylase 6/10 [Candida albicans P78...    104   4e-22
ref|XP_008924838.1|  PREDICTED: histone deacetylase 10 [Manacu...    103   4e-22
ref|WP_019856725.1|  histone deacetylase [Mesorhizobium loti]        101   4e-22
ref|WP_009374781.1|  acetoin utilization protein [Halogranum s...    101   4e-22
gb|KFW72729.1|  Histone deacetylase 10 [Pygoscelis adeliae]          101   4e-22
ref|XP_009816955.1|  PREDICTED: histone deacetylase 10 [Gavia ...    103   4e-22
ref|XP_004435130.1|  PREDICTED: histone deacetylase 6 [Ceratot...    104   4e-22
ref|XP_008878307.1|  hypothetical protein, variant 4 [Aphanomy...    103   5e-22
ref|WP_012492677.1|  acetoin utilization protein [Burkholderia...    101   5e-22
gb|EFZ12265.1|  hypothetical protein SINV_07643 [Solenopsis in...    104   5e-22
ref|XP_008171111.1|  PREDICTED: histone deacetylase 10 isoform...    103   5e-22
ref|WP_006883040.1|  histone deacetylase superfamily protein [...    100   5e-22
ref|WP_012965169.1|  hypothetical protein [Ferroglobus placidus]     101   5e-22
ref|XP_002307035.2|  hypothetical protein POPTR_0005s06520g [P...    101   5e-22
ref|XP_006997585.1|  PREDICTED: histone deacetylase 6 [Peromys...    104   5e-22
gb|KHC71168.1|  histone deacetylase 6/10 [Candida albicans SC5...    103   5e-22
gb|KHC30006.1|  histone deacetylase 6/10 [Candida albicans P76...    103   5e-22
gb|KHC29579.1|  histone deacetylase 6/10 [Candida albicans P76...    103   5e-22
gb|KGU23503.1|  histone deacetylase 6/10 [Candida albicans P75...    103   5e-22
gb|KGT64501.1|  histone deacetylase 6/10 [Candida albicans 12C]      103   5e-22
gb|KGL92153.1|  Histone deacetylase 10 [Charadrius vociferus]        100   5e-22
ref|WP_006488011.1|  acetoin utilization protein [Burkholderia...    101   5e-22
ref|WP_020198748.1|  hypothetical protein [Sulfolobales archae...    100   5e-22
gb|KGQ83940.1|  histone deacetylase 6/10 [Candida albicans GC75]     103   5e-22
gb|EEQ43318.1|  histone deacetylase HDA1 [Candida albicans WO-1]     103   5e-22
ref|WP_013896919.1|  histone deacetylase [Mesorhizobium opport...    101   5e-22
gb|AIO49322.1|  histone deacetylase domain protein [Burkholder...    101   5e-22
gb|KFL53144.1|  acetoin utilization protein [Burkholderia pyrr...    101   5e-22
ref|WP_011613519.1|  hypothetical protein [Trichodesmium eryth...    100   5e-22
ref|WP_019935120.1|  histone deacetylase [Oceanimonas smirnovii]     101   5e-22
ref|XP_005807514.1|  PREDICTED: histone deacetylase 10-like [X...    103   5e-22
gb|AID28513.1|  histone deacetylase-like amidohydrolase [Mesor...    100   5e-22
ref|WP_023764728.1|  histone deacetylase [Mesorhizobium sp. LN...    100   5e-22
ref|XP_008878310.1|  hypothetical protein, variant 1 [Aphanomy...    103   5e-22
gb|KHC30833.1|  histone deacetylase 6/10 [Candida albicans Ca6]      103   5e-22
gb|KGR01680.1|  histone deacetylase 6/10 [Candida albicans P57...    103   5e-22
ref|XP_004961939.1|  PREDICTED: histone deacetylase 8-like [Se...    101   6e-22
ref|WP_010902051.1|  acetoin utilization protein [Halobacteriu...    100   6e-22
ref|WP_027041181.1|  acetoin utilization protein [Mesorhizobiu...    100   6e-22
ref|WP_016747671.1|  acetoin utilization protein [Sphingomonas...    100   6e-22
gb|KDR75830.1|  hypothetical protein GALMADRAFT_97752 [Galerin...    103   6e-22
gb|ESA96695.1|  putative histone deacetylase-like amidohydrola...    100   6e-22
gb|EYF03070.1|  histone deacetylase family protein [Chondromyc...    100   6e-22
ref|XP_007974399.1|  PREDICTED: histone deacetylase 10 isoform...    103   6e-22
ref|WP_018918110.1|  histone deacetylase [Halomonas zhanjiange...    100   6e-22
ref|WP_024357769.1|  acetoin utilization protein [Leucobacter ...    100   6e-22
gb|AIA75061.1|  acetoin utilization protein [Halomonas campani...    100   6e-22
ref|WP_027787151.1|  acetoin utilization protein [Burkholderia...    100   6e-22
dbj|BAD88603.1|  deacetylase [Enterobacter aerogenes]                100   6e-22
ref|XP_006179735.1|  PREDICTED: histone deacetylase 10 [Camelu...    103   6e-22
ref|XP_005338713.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...    103   6e-22
ref|WP_022065418.1|  histone deacetylase family protein [Klebs...    100   6e-22
dbj|BAP73830.1|  histone deacetylase HDA1 [Kluyveromyces marxi...    103   6e-22
ref|XP_001030816.2|  Histone deacetylase family protein [Tetra...    100   6e-22
ref|WP_002892815.1|  putative deacetylase [Klebsiella pneumoniae]    100   6e-22
gb|KCW50912.1|  hypothetical protein EUGRSUZ_J00560 [Eucalyptu...    100   6e-22
ref|XP_009837146.1|  hypothetical protein, variant [Aphanomyce...    102   6e-22
dbj|BAO42443.1|  histone deacetylase HDA1 [Kluyveromyces marxi...    103   6e-22
gb|EDL33937.1|  histone deacetylase 6 [Mus musculus]                 103   6e-22
gb|AAH41105.1|  Hdac6 protein [Mus musculus]                         103   6e-22
ref|WP_007236318.1|  histone deacetylase [marine gamma proteob...    100   7e-22
ref|XP_004920407.1|  PREDICTED: histone deacetylase 6 isoform ...    103   7e-22
dbj|BAE32376.1|  unnamed protein product [Mus musculus]              103   7e-22
ref|XP_008171087.1|  PREDICTED: histone deacetylase 10 isoform...    103   7e-22
ref|WP_031292574.1|  hypothetical protein [Leptolyngbya sp. He...    100   7e-22
ref|XP_009636438.1|  PREDICTED: histone deacetylase 10 [Egrett...    103   7e-22
ref|XP_008555902.1|  PREDICTED: histone deacetylase 6 [Micropl...    103   7e-22
ref|WP_032897250.1|  acetoin utilization protein [Pseudomonas ...    100   7e-22
ref|XP_004670159.1|  PREDICTED: histone deacetylase 6 [Jaculus...    103   7e-22
ref|XP_002189697.2|  PREDICTED: histone deacetylase 10-like [T...    102   7e-22
ref|WP_018788564.1|  histone deacetylase [Micromonospora sp. C...    100   7e-22
gb|AHI29485.1|  histone deacetylase [Marinobacter sp. A3d10]         100   7e-22
ref|WP_014399221.1|  histone deacetylase [Corallococcus corall...    100   8e-22
gb|AHG90356.1|  Histone deacetylase domain protein [Gemmatimon...    100   8e-22
ref|WP_007690032.1|  histone deacetylase superfamily protein [...    100   8e-22
ref|NP_034543.3|  histone deacetylase 6 [Mus musculus]               103   8e-22
ref|WP_010202119.1|  histone deacetylase [Salinibacterium sp. ...    100   8e-22
ref|WP_013289226.1|  histone deacetylase [Micromonospora auran...    100   8e-22
ref|WP_006166017.1|  histone deacetylase [Natrialba chahannaoe...    100   8e-22
ref|WP_008528210.1|  acetoin utilization protein [Halorhabdus ...    100   8e-22
gb|EYU23736.1|  hypothetical protein MIMGU_mgv1a006979mg [Mimu...    100   8e-22
gb|EYU23517.1|  hypothetical protein MIMGU_mgv1a019729mg [Mimu...    100   8e-22
ref|XP_007529499.1|  PREDICTED: histone deacetylase 6 [Erinace...    103   8e-22
ref|WP_015319035.1|  histone deacetylase [Mesorhizobium austra...    100   8e-22
ref|XP_008878313.1|  hypothetical protein H310_12858 [Aphanomy...    103   8e-22
ref|XP_004920403.1|  PREDICTED: histone deacetylase 6 isoform ...    103   8e-22
gb|EGT50492.1|  hypothetical protein CAEBREN_16084 [Caenorhabd...    103   8e-22
emb|CDY23088.1|  BnaC07g30990D [Brassica napus]                      102   8e-22
ref|XP_010318596.1|  PREDICTED: histone deacetylase 15 isoform...    102   8e-22
gb|ESX02093.1|  Histone deacetylase HDA1 [Ogataea parapolymorp...    103   8e-22
ref|WP_007351373.1|  histone deacetylase [Marinobacter sp. ELB17]    100   8e-22
gb|EGT40151.1|  hypothetical protein CAEBREN_23214 [Caenorhabd...    103   8e-22
ref|WP_023782316.1|  histone deacetylase [Mesorhizobium sp. LN...    100   9e-22
ref|XP_010090829.1|  hypothetical protein L484_020688 [Morus n...    101   9e-22
gb|KGB78311.1|  histone deacetylase clr3 [Cryptococcus gattii ...    103   9e-22
ref|WP_015126091.1|  deacetylase [Synechococcus sp. PCC 6312]        100   9e-22
dbj|BAF62919.1|  putative histone deacetylase family protein [...    100   9e-22
gb|EMT15178.1|  Histone deacetylase 15 [Aegilops tauschii]           102   9e-22
ref|XP_005146176.1|  PREDICTED: histone deacetylase 10 [Melops...    102   9e-22
gb|ESA36849.1|  histone deacetylase superfamily protein [Lepto...    100   9e-22
ref|WP_011830240.1|  acetoin utilization protein [Methylibium ...    100   9e-22
ref|XP_008604281.1|  hypothetical protein SDRG_00577 [Saproleg...    102   9e-22
gb|KGM07154.1|  Acetylspermidine deacetylase [Methylophaga thi...    100   9e-22
ref|XP_004920405.1|  PREDICTED: histone deacetylase 6 isoform ...    103   9e-22
gb|EWS59236.1|  Histone deacetylase-like amidohydrolase [Methy...    100   9e-22
ref|XP_003967671.1|  PREDICTED: histone deacetylase 10-like [T...    102   9e-22
ref|XP_002441176.1|  hypothetical protein SORBIDRAFT_09g021720...    100   9e-22
ref|XP_003677619.1|  hypothetical protein NCAS_0G03800 [Naumov...    102   1e-21
ref|XP_007364431.1|  histone deacetylase complex protein [Dich...    102   1e-21
ref|XP_007766397.1|  histone deacetylase clr3 [Coniophora pute...    102   1e-21
ref|XP_004920404.1|  PREDICTED: histone deacetylase 6 isoform ...    103   1e-21
ref|XP_010031560.1|  PREDICTED: histone deacetylase 8 [Eucalyp...    100   1e-21
ref|XP_007546789.1|  PREDICTED: histone deacetylase 10-like [P...    102   1e-21
gb|KFQ70803.1|  Histone deacetylase 10 [Phaethon lepturus]           100   1e-21
emb|CCG37809.1|  histone deacetylase domain protein [Xanthomon...  99.8    1e-21
emb|CEG80599.1|  hypothetical protein RMATCC62417_14901 [Rhizo...    101   1e-21
ref|XP_004030374.1|  hypothetical protein IMG5_162410 [Ichthyo...    102   1e-21
gb|KFV99759.1|  Histone deacetylase 10 [Fulmarus glacialis]          100   1e-21
emb|CDS16992.1|  histone deacetylase 6 [Echinococcus granulosus]   97.8    1e-21
ref|WP_008205927.1|  histone deacetylase [Roseobacter sp. SK20...    100   1e-21
dbj|BAE28372.1|  unnamed protein product [Mus musculus]              103   1e-21
gb|KFQ38465.1|  Histone deacetylase 10 [Mesitornis unicolor]       97.1    1e-21
ref|XP_004920402.1|  PREDICTED: histone deacetylase 6 isoform ...    103   1e-21
ref|XP_002990330.1|  hypothetical protein SELMODRAFT_131541 [S...    102   1e-21
ref|XP_005039315.1|  PREDICTED: histone deacetylase 10 [Ficedu...    102   1e-21
ref|XP_009700647.1|  PREDICTED: histone deacetylase 10 [Cariam...    102   1e-21
gb|ACD50314.1|  histone deacetylase RPD3/HDA1 class II [Hordeu...    102   1e-21
ref|XP_004282060.1|  PREDICTED: histone deacetylase 6 [Orcinus...    103   1e-21
ref|WP_023771177.1|  MULTISPECIES: histone deacetylase [Mesorh...    100   1e-21
ref|XP_007123890.1|  PREDICTED: histone deacetylase 6 isoform ...    103   1e-21
ref|NP_001058957.1|  Os07g0164100 [Oryza sativa Japonica Group]      102   1e-21
ref|WP_006182455.1|  acetoin utilization protein [Natrinema pe...    100   1e-21
ref|XP_005839275.1|  hypothetical protein GUITHDRAFT_65370 [Gu...  99.8    1e-21
ref|XP_004920398.1|  PREDICTED: histone deacetylase 6 isoform ...    103   1e-21
ref|XP_007085036.1|  PREDICTED: histone deacetylase 6 [Panther...    103   1e-21
ref|XP_010151627.1|  PREDICTED: histone deacetylase 10 [Eurypy...    102   1e-21
ref|WP_019182425.1|  acetoin utilization protein [Stenotrophom...  99.8    1e-21
ref|XP_002501595.1|  histone deacetylase [Micromonas sp. RCC299]     102   1e-21
ref|WP_019630359.1|  hypothetical protein [Actinomadura atrame...    100   1e-21
ref|WP_002538767.1|  Deacetylase [Grimontia sp. AK16]                100   1e-21
gb|KFA01606.1|  acetoin utilization protein [Xanthomonas vasic...  98.6    1e-21
ref|XP_004321463.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...    103   1e-21
emb|CDJ92412.1|  Histone deacetylase superfamily domain contai...    101   1e-21
ref|XP_009895651.1|  PREDICTED: histone deacetylase 10 [Picoid...    102   1e-21
ref|XP_003770848.1|  PREDICTED: histone deacetylase 10 [Sarcop...    102   1e-21
ref|WP_027036157.1|  acetoin utilization protein [Mesorhizobiu...    100   1e-21
ref|WP_023808834.1|  histone deacetylase [Mesorhizobium sp. L2...    100   1e-21
ref|XP_002979356.1|  hypothetical protein SELMODRAFT_110614 [S...    102   1e-21
ref|XP_006364494.1|  PREDICTED: histone deacetylase 14-like [S...    100   1e-21
ref|WP_010171357.1|  acetoin utilization protein [Pseudomonas ...    100   1e-21
ref|WP_005412302.1|  acetoin utilization family protein [Steno...  99.8    1e-21
ref|WP_030091162.1|  acetoin utilization protein [Sphingomonas...    100   1e-21
ref|XP_006837132.1|  hypothetical protein AMTR_s00110p00134320...    102   1e-21
ref|WP_012049438.1|  acetoin utilization protein [Sphingomonas...    100   1e-21
gb|KGA98648.1|  acetoin utilization protein [Bacillus alcaloph...    100   1e-21
ref|XP_007974394.1|  PREDICTED: histone deacetylase 10 isoform...    102   1e-21
gb|KFQ46554.1|  Histone deacetylase 10 [Nestor notabilis]          99.8    1e-21
gb|KEZ95988.1|  acetoin utilization protein [Xanthomonas vasic...  98.6    1e-21
ref|WP_011048242.1|  histone deacetylase [Ruegeria pomeroyi]         100   1e-21
ref|WP_029995058.1|  acetoin utilization protein [Sphingomonas...    100   1e-21
ref|WP_022696384.1|  acetoin utilization protein [Maricaulis s...  99.8    1e-21
ref|WP_005408143.1|  acetoin utilization protein [Stenotrophom...  99.8    1e-21
ref|XP_010001703.1|  PREDICTED: histone deacetylase 10 [Chaetu...    102   1e-21
ref|WP_030069562.1|  acetoin utilization protein [Halomonas al...  99.8    1e-21
ref|XP_009989722.1|  PREDICTED: histone deacetylase 10 [Taurac...    102   1e-21
dbj|BAC79741.1|  putative histone deacetylase [Oryza sativa Ja...    102   1e-21
ref|WP_006752039.1|  acetoin utilization protein [Burkholderia...  99.8    1e-21
ref|XP_010312921.1|  PREDICTED: histone deacetylase 14 isoform...  99.8    1e-21
ref|XP_004755094.1|  PREDICTED: histone deacetylase 6 isoform ...    102   1e-21
ref|XP_002867177.1|  hypothetical protein ARALYDRAFT_913072 [A...    100   1e-21
ref|WP_026756505.1|  acetoin utilization protein [Sediminimona...  99.8    1e-21
ref|XP_003201995.1|  PREDICTED: histone deacetylase 10-like [M...    101   1e-21
emb|CDK29439.1|  unnamed protein product [Kuraishia capsulata ...    102   1e-21
ref|XP_007974397.1|  PREDICTED: histone deacetylase 10 isoform...    102   1e-21
ref|XP_010170468.1|  PREDICTED: histone deacetylase 10 [Caprim...    102   2e-21
ref|WP_020983845.1|  histone deacetylase family protein [Lepto...  99.4    2e-21
ref|XP_004755092.1|  PREDICTED: histone deacetylase 6 isoform ...    102   2e-21
ref|XP_004755089.1|  PREDICTED: histone deacetylase 6 isoform ...    102   2e-21
ref|XP_002776878.1|  histone deacetylase hda1, putative [Perki...    102   2e-21
ref|WP_031278906.1|  hypothetical protein [Candidatus Microthr...  99.8    2e-21
ref|WP_027033991.1|  acetoin utilization protein [Mesorhizobiu...  99.8    2e-21
gb|EOB00350.1|  Histone deacetylase 10 [Anas platyrhynchos]          102   2e-21
ref|XP_004755088.1|  PREDICTED: histone deacetylase 6 isoform ...    102   2e-21
ref|WP_029725231.1|  hypothetical protein [Desulfotignum balti...  99.4    2e-21
ref|XP_007123893.1|  PREDICTED: histone deacetylase 6 isoform ...    102   2e-21
ref|XP_004755093.1|  PREDICTED: histone deacetylase 6 isoform ...    102   2e-21
ref|XP_004817799.1|  PREDICTED: histone deacetylase 6 isoform ...    102   2e-21
gb|EEC68966.1|  hypothetical protein OsI_37706 [Oryza sativa I...    100   2e-21
ref|XP_010076221.1|  PREDICTED: histone deacetylase 10 [Pteroc...    102   2e-21
ref|XP_004755087.1|  PREDICTED: histone deacetylase 6 isoform ...    102   2e-21
ref|XP_002494455.1|  ZYRO0A01870p [Zygosaccharomyces rouxii CB...    102   2e-21
ref|XP_004000574.1|  PREDICTED: histone deacetylase 6 isoform ...    102   2e-21
emb|CCM62263.1|  conserved hypothetical protein [Candidatus Mi...  99.8    2e-21
ref|WP_006408383.1|  acetoin utilization protein [Burkholderia...  99.8    2e-21
ref|XP_004288101.1|  PREDICTED: histone deacetylase 14-like [F...    100   2e-21
ref|XP_004817797.1|  PREDICTED: histone deacetylase 6 isoform ...    102   2e-21
ref|XP_004817798.1|  PREDICTED: histone deacetylase 6 isoform ...    102   2e-21
ref|XP_006943776.1|  PREDICTED: histone deacetylase 6 isoform ...    102   2e-21
ref|XP_009837147.1|  hypothetical protein H257_11812 [Aphanomy...    102   2e-21
ref|WP_003472716.1|  histone deacetylase [Xanthomonas transluc...  97.8    2e-21
ref|NP_001066322.1|  Os12g0182700 [Oryza sativa Japonica Group]      100   2e-21
ref|XP_010318595.1|  PREDICTED: histone deacetylase 15 isoform...    101   2e-21
gb|KGU97451.1|  histone deacetylase-like amidohydrolase [Burkh...  99.8    2e-21
gb|AAM93215.1|AF527614_1  histone deacetylase HDA110 isoform 4...  99.8    2e-21
emb|CDJ90815.1|  Histone deacetylase superfamily domain contai...    102   2e-21
gb|EFN88230.1|  Histone deacetylase 6 [Harpegnathos saltator]        102   2e-21
ref|WP_008267305.1|  acetoin utilization protein [Stenotrophom...  99.4    2e-21
ref|XP_005020908.1|  PREDICTED: histone deacetylase 10 isoform...    101   2e-21
ref|WP_023516059.1|  histone deacetylase-like amidohydrolase H...  99.4    2e-21
ref|WP_016974770.1|  acetoin utilization protein [Pseudomonas ...  99.4    2e-21
gb|EPS65757.1|  hypothetical protein M569_09020 [Genlisea aurea]   99.4    2e-21
ref|XP_004817796.1|  PREDICTED: histone deacetylase 6 isoform ...    102   2e-21
ref|XP_004235741.1|  PREDICTED: histone deacetylase 15 isoform...    101   2e-21
ref|WP_021203189.1|  acetoin utilization protein [Stenotrophom...  99.0    2e-21
emb|CDW53649.1|  histone deacetylase family protein [Trichuris...    100   2e-21
ref|WP_027005238.1|  hypothetical protein [Conexibacter woesei]    99.4    2e-21
ref|WP_013194190.1|  histone deacetylase superfamily protein [...    100   2e-21
gb|EGW06104.1|  Histone deacetylase 6 [Cricetulus griseus]           101   2e-21
ref|XP_005020909.1|  PREDICTED: histone deacetylase 10 isoform...    101   2e-21
ref|WP_007111569.1|  histone deacetylase [Halomonas boliviensis]   99.4    2e-21
ref|XP_005020907.1|  PREDICTED: histone deacetylase 10 isoform...    101   2e-21
gb|ADI22476.1|  deacetylases, including yeast histone deacetyl...  99.4    2e-21
gb|EMT21577.1|  hypothetical protein F775_04394 [Aegilops taus...    101   2e-21
ref|WP_019661122.1|  acetoin utilization protein [Stenotrophom...  99.0    2e-21
ref|WP_023431993.1|  Deacetylase [Lutibaculum baratangense]        99.4    2e-21
ref|XP_006902973.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...    102   2e-21
ref|XP_009626344.1|  PREDICTED: histone deacetylase 14 isoform...  99.8    2e-21
gb|EAR83153.3|  histone deacetylasehistone-like deacetylase fa...    100   2e-21
ref|WP_027055921.1|  acetoin utilization protein [Mesorhizobiu...  99.4    2e-21
ref|XP_009626345.1|  PREDICTED: histone deacetylase 14 isoform...  99.4    2e-21
ref|XP_003630282.1|  Histone deacetylase [Medicago truncatula]     99.8    2e-21
ref|WP_012479199.1|  acetoin utilization protein [Stenotrophom...  99.0    3e-21
ref|WP_015164005.1|  histone deacetylase superfamily protein [...  98.6    3e-21
ref|XP_005759765.1|  hypothetical protein EMIHUDRAFT_426194 [E...  99.0    3e-21
ref|XP_009461218.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...    101   3e-21
ref|XP_005510546.1|  PREDICTED: histone deacetylase 10 [Columb...    101   3e-21
ref|XP_008393285.1|  PREDICTED: histone deacetylase 15-like [M...    100   3e-21
emb|CCH43643.1|  histone deacetylase 6/10 [Wickerhamomyces cif...    101   3e-21
dbj|GAC93093.1|  Rpd3 histone deacetylase complex [Pseudozyma ...    101   3e-21
ref|XP_010447237.1|  PREDICTED: histone deacetylase 14-like [C...  99.8    3e-21
dbj|GAK65368.1|  histone deacetylase clr3 [Pseudozyma antarctica]    101   3e-21
ref|XP_007374013.1|  histone deacetylase HDA1 [Spathaspora pas...    102   3e-21
ref|WP_007756162.1|  histone deacetylase [Rhizobium sp. CF080]     99.0    3e-21
ref|WP_031383614.1|  acetoin utilization protein [Halomonas zi...  99.0    3e-21
ref|WP_006760968.1|  acetoin utilization protein [Burkholderia...  99.0    3e-21
gb|KEZ78141.1|  histone deacetylase superfamily protein [Salin...  99.0    3e-21
ref|WP_019394248.1|  hypothetical protein [Bacillus endophyticus]  99.0    3e-21
ref|XP_008840778.1|  PREDICTED: histone deacetylase 6 isoform ...    102   3e-21
ref|WP_021050184.1|  putative deacetylase [Haloquadratum walsbyi]  98.6    3e-21
ref|XP_005411337.1|  PREDICTED: histone deacetylase 6 isoform ...    102   3e-21
ref|XP_004228472.1|  PREDICTED: histone deacetylase 14 isoform...  99.8    3e-21
ref|XP_005411341.1|  PREDICTED: histone deacetylase 6 isoform ...    102   3e-21
ref|XP_004690067.1|  PREDICTED: histone deacetylase 6 [Condylu...    102   3e-21
gb|KEJ95511.1|  acetoin utilization protein [Sulfitobacter sp....  99.0    3e-21
ref|XP_007636621.1|  PREDICTED: histone deacetylase 6 [Cricetu...    102   3e-21
gb|EZA54635.1|  Histone deacetylase [Cerapachys biroi]               102   3e-21
ref|XP_008270809.1|  PREDICTED: histone deacetylase 6 isoform ...    102   3e-21
ref|WP_011056413.1|  hypothetical protein [Thermosynechococcus...  97.8    3e-21
ref|XP_003525125.1|  PREDICTED: histone deacetylase 14 [Glycin...  99.4    3e-21
ref|XP_003462634.1|  PREDICTED: histone deacetylase 6 isoform ...    102   3e-21
ref|WP_011570720.1|  acetoin utilization protein [Haloquadratu...  98.6    3e-21
ref|XP_003505149.1|  PREDICTED: histone deacetylase 6 [Cricetu...    102   3e-21
ref|XP_002932227.1|  PREDICTED: histone deacetylase 10-like [X...    101   4e-21
ref|WP_015301953.1|  deacetylase, histone deacetylase/acetoin ...  98.6    4e-21
gb|KFO65816.1|  Histone deacetylase 10 [Corvus brachyrhynchos]     98.6    4e-21
ref|XP_008064508.1|  PREDICTED: histone deacetylase 6 [Tarsius...    102   4e-21
ref|XP_007956107.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...    101   4e-21
gb|ERE63742.1|  histone deacetylase 6-like protein [Cricetulus...    102   4e-21
ref|XP_008840774.1|  PREDICTED: histone deacetylase 6 isoform ...    101   4e-21
ref|WP_006653635.1|  histone deacetylase [Natrialba hulunbeire...  98.6    4e-21
gb|KGG51732.1|  hypothetical protein DI09_28p130 [Microsporidi...  99.8    4e-21
ref|WP_013749310.1|  hypothetical protein [Pyrococcus sp. NA2]     98.6    4e-21
gb|KFM80510.1|  Histone deacetylase 6 [Stegodyphus mimosarum]        101   4e-21
ref|WP_006653026.1|  histone deacetylase [Natrialba hulunbeire...  98.6    4e-21
ref|WP_009825949.1|  histone deacetylase [Sulfitobacter sp. NA...  98.6    4e-21
ref|WP_027058424.1|  acetoin utilization protein [Mesorhizobiu...  98.6    4e-21
ref|XP_003192629.1|  histone deacetylase clr3 [Cryptococcus ga...    101   4e-21
ref|XP_004377008.1|  PREDICTED: histone deacetylase 6 [Trichec...    101   4e-21
ref|XP_008270807.1|  PREDICTED: histone deacetylase 6 isoform ...    101   4e-21
gb|ETS59633.1|  hypothetical protein PaG_06557 [Pseudozyma aph...    101   4e-21
ref|XP_008270808.1|  PREDICTED: histone deacetylase 6 isoform ...    101   4e-21
ref|WP_016414809.1|  histone deacetylase [Halomonas anticarien...  98.6    4e-21
ref|XP_009836181.1|  hypothetical protein, variant 1 [Aphanomy...    100   4e-21
gb|KDO27844.1|  hypothetical protein SPRG_07117 [Saprolegnia p...    100   4e-21
ref|WP_005415351.1|  acetoin utilization family protein [Steno...  98.2    4e-21
ref|XP_009836180.1|  hypothetical protein H257_11045 [Aphanomy...    100   4e-21
ref|XP_008840777.1|  PREDICTED: histone deacetylase 6 isoform ...    101   4e-21
ref|XP_009836182.1|  hypothetical protein, variant 2 [Aphanomy...    100   4e-21
ref|XP_006876753.1|  PREDICTED: histone deacetylase 6 [Chrysoc...    101   4e-21
ref|XP_009405322.1|  PREDICTED: histone deacetylase 8 [Musa ac...  98.6    4e-21
ref|XP_007015689.1|  Histone deacetylase 8 isoform 4 [Theobrom...  98.2    5e-21
ref|XP_001889846.1|  histone deacetylase complex protein [Lacc...    100   5e-21
ref|NP_500788.1|  Protein HDA-6, isoform a [Caenorhabditis ele...    101   5e-21
ref|XP_007015692.1|  Histone deacetylase 8 isoform 7 [Theobrom...  98.2    5e-21
ref|XP_005519570.1|  PREDICTED: histone deacetylase 10 [Pseudo...    100   5e-21
ref|XP_001758783.1|  class II RPD3 type histone deacetylase pr...    100   5e-21
ref|WP_002762641.1|  histone deacetylase family protein [Lepto...  98.2    5e-21
ref|WP_014290534.1|  histone deacetylase [Oceanimonas sp. GK1]     98.2    5e-21
ref|WP_016756920.1|  histone deacetylase [Leptospira santarosai]   98.2    5e-21
dbj|GAC72165.1|  histone deacetylase complex, catalytic compon...    100   5e-21
ref|XP_007015688.1|  Histone deacetylase 8 isoform 3 [Theobrom...  98.2    5e-21
ref|XP_009085284.1|  PREDICTED: histone deacetylase 10 [Serinu...    100   5e-21
ref|WP_004484192.1|  histone deacetylase family protein [Lepto...  97.8    5e-21
ref|XP_003284138.1|  hypothetical protein DICPUDRAFT_147871 [D...    101   5e-21
ref|WP_005851264.1|  histone deacetylase [Sulfitobacter sp. EE...  98.2    5e-21
ref|XP_009684713.1|  PREDICTED: histone deacetylase 10 [Struth...    100   5e-21
ref|WP_032129908.1|  acetoin utilization protein [Stenotrophom...  97.8    5e-21
ref|XP_007015691.1|  Histone deacetylase 8 isoform 6 [Theobrom...  98.2    5e-21
ref|WP_012784118.1|  histone deacetylase superfamily [Acidimic...  98.2    5e-21
ref|NP_001055667.1|  Os05g0440100 [Oryza sativa Japonica Group]    98.6    5e-21
gb|EDK39781.2|  hypothetical protein PGUG_03879 [Meyerozyma gu...    101   5e-21
ref|XP_569378.1|  histone deacetylase clr3 [Cryptococcus neofo...    100   5e-21
ref|XP_009437330.1|  PREDICTED: histone deacetylase 6 [Pan tro...    101   5e-21
ref|XP_006657472.1|  PREDICTED: histone deacetylase 15-like is...  99.8    5e-21
ref|XP_004955535.1|  PREDICTED: histone deacetylase 15-like is...    100   5e-21
emb|CDH48472.1|  histone deacetylase [Lichtheimia corymbifera ...    100   5e-21
ref|WP_020784100.1|  histone deacetylase family protein [Lepto...  97.8    5e-21
ref|NP_001266603.1|  histone deacetylase 10 [Zea mays]             98.6    5e-21
gb|AAD09835.2|  histone deacetylase mHDA2 [Mus musculus]             101   5e-21
gb|EDL83809.1|  histone deacetylase 6 [Rattus norvegicus]            101   5e-21
gb|AFR97768.1|  histone deacetylase 6/10 [Cryptococcus neoform...    100   5e-21
emb|CAF88355.1|  unnamed protein product [Tetraodon nigroviridis]    101   6e-21
ref|XP_004955536.1|  PREDICTED: histone deacetylase 15-like is...    100   6e-21
ref|XP_008338725.1|  PREDICTED: histone deacetylase 14 isoform...  99.0    6e-21
ref|XP_005852771.1|  histone deacetylase superfamily protein [...  98.6    6e-21
ref|WP_033476765.1|  deacetylase [Bordetella pertussis]            93.6    6e-21
ref|WP_019338104.1|  acetoin utilization protein [Stenotrophom...  97.8    6e-21
ref|WP_009725730.1|  acetylspermidine deacetylase [Methylophag...  97.8    6e-21
ref|XP_008673398.1|  PREDICTED: histone deacetylase 10 isoform...  99.0    6e-21
ref|XP_228753.4|  PREDICTED: histone deacetylase 6 [Rattus nor...    101   6e-21
ref|XP_009881988.1|  PREDICTED: histone deacetylase 10 [Charad...    100   6e-21
ref|XP_007211505.1|  hypothetical protein PRUPE_ppa007939mg [P...  97.8    6e-21
ref|WP_006087758.1|  histone deacetylase [Natronorubrum tibete...  97.8    6e-21
ref|XP_010359388.1|  PREDICTED: histone deacetylase 6 [Rhinopi...    101   6e-21
ref|XP_004503929.1|  PREDICTED: histone deacetylase 14-like is...  99.0    6e-21
ref|XP_003418046.1|  PREDICTED: histone deacetylase 6-like [Lo...    101   6e-21
ref|XP_004713270.1|  PREDICTED: histone deacetylase 6 [Echinop...    101   6e-21
ref|XP_004955537.1|  PREDICTED: histone deacetylase 15-like is...    100   6e-21
ref|WP_008183463.1|  histone deacetylase [Rhodobacteraceae bac...  98.2    6e-21
ref|WP_010481827.1|  acetoin utilization protein [ [Pseudomona...  97.8    6e-21
ref|WP_005393559.1|  histone deacetylase [Corynebacterium gluc...  98.2    7e-21
ref|XP_004465093.1|  PREDICTED: histone deacetylase 6 [Dasypus...    100   7e-21
ref|WP_002621857.1|  histone deacetylase family protein [Lepto...  97.8    7e-21
ref|WP_013430608.1|  histone deacetylase [Caldicellulosiruptor...  98.6    7e-21
gb|KFO72845.1|  Histone deacetylase 10 [Cuculus canorus]           97.8    7e-21
ref|WP_004501961.1|  histone deacetylase family protein [Lepto...  97.4    7e-21
ref|XP_005614184.1|  PREDICTED: histone deacetylase 6 isoform ...    100   7e-21
gb|AAM93213.1|AF527612_1  histone deacetylase HDA110 isoform 2...  99.4    7e-21
ref|XP_007889134.1|  PREDICTED: histone deacetylase 10 isoform...    100   7e-21
ref|WP_014042025.1|  histone deacetylase [Caldicellulosiruptor...  98.6    7e-21
ref|WP_014036040.1|  acetoin utilization protein [Stenotrophom...  97.4    7e-21
ref|XP_005614186.1|  PREDICTED: histone deacetylase 6 isoform ...    100   7e-21
ref|XP_002900512.1|  histone deacetylase, putative [Phytophtho...  97.8    7e-21
ref|XP_007015690.1|  Histone deacetylase 8 isoform 5 [Theobrom...  97.8    7e-21
ref|XP_001493915.3|  PREDICTED: histone deacetylase 6 isoform ...    100   7e-21
ref|XP_007889135.1|  PREDICTED: histone deacetylase 10 isoform...    100   7e-21
tpg|DAA59648.1|  TPA: hypothetical protein ZEAMMB73_114812 [Ze...  99.4    7e-21
ref|NP_500787.1|  Protein HDA-6, isoform b [Caenorhabditis ele...    100   7e-21
ref|WP_004464244.1|  MULTISPECIES: histone deacetylase [Leptos...  97.4    7e-21
ref|XP_009330292.1|  PREDICTED: histone deacetylase 10 [Pygosc...    100   7e-21
ref|XP_006657469.1|  PREDICTED: histone deacetylase 15-like is...    100   7e-21
ref|XP_002421780.1|  histone deacetylase, putative [Candida du...    100   7e-21
ref|WP_015922494.1|  hdac6 protein [Thermomicrobium roseum]        97.8    7e-21
gb|KFO22665.1|  Histone deacetylase 6 [Fukomys damarensis]           100   7e-21
ref|NP_001122780.1|  Protein HDA-6, isoform c [Caenorhabditis ...    100   7e-21
ref|XP_003568360.1|  PREDICTED: histone deacetylase 8 [Brachyp...  97.8    8e-21
ref|WP_033830394.1|  acetoin utilization protein [Stenotrophom...  97.4    8e-21
ref|XP_007015687.1|  Histone deacetylase 8 isoform 2 [Theobrom...  98.2    8e-21
ref|WP_015907546.1|  histone deacetylase [Caldicellulosiruptor...  98.6    8e-21
ref|XP_009777307.1|  PREDICTED: histone deacetylase 14 isoform...  98.6    8e-21
emb|CDS16991.1|  histone deacetylase 6 [Echinococcus granulosus]     100   8e-21
ref|WP_032722705.1|  acetoin utilization protein [Salinispora ...  97.8    8e-21
ref|XP_009285055.1|  PREDICTED: histone deacetylase 10 [Apteno...    100   8e-21
gb|EGU11373.1|  Histone deacetylase clr3 [Rhodotorula glutinis...    100   8e-21
ref|XP_008567166.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...    100   8e-21
ref|XP_005614177.1|  PREDICTED: histone deacetylase 6 isoform ...    100   8e-21
ref|WP_013413479.1|  hypothetical protein [Methanothermus ferv...  97.4    8e-21
emb|CEF99066.1|  Ankyrin repeat [Ostreococcus tauri]                 100   8e-21
ref|WP_025877923.1|  MULTISPECIES: acetoin utilization protein...  97.4    8e-21
ref|XP_005614176.1|  PREDICTED: histone deacetylase 6 isoform ...    100   8e-21
ref|XP_007180366.1|  PREDICTED: histone deacetylase 6 [Balaeno...    100   8e-21
gb|EMS18419.1|  histone deacetylase 6/10 [Rhodosporidium torul...    100   9e-21
gb|EPB81785.1|  hypothetical protein HMPREF1544_11499 [Mucor c...  97.8    9e-21
ref|WP_007980028.1|  acetoin utilization protein [Haladaptatus...  97.4    9e-21
gb|KAJ56181.1|  acetoin utilization protein [Actibacterium muc...  97.8    9e-21
ref|XP_002180279.1|  predicted protein [Phaeodactylum tricornu...    100   9e-21
ref|XP_008957540.1|  PREDICTED: histone deacetylase 6 isoform ...    100   9e-21
gb|EJY83099.1|  hypothetical protein OXYTRI_19281 [Oxytricha t...  97.8    9e-21
ref|NP_567921.1|  histone deacetylase 14 [Arabidopsis thaliana]    98.2    9e-21
ref|WP_015220220.1|  histone deacetylase superfamily protein [...  97.4    9e-21
ref|WP_014704017.1|  histone deacetylase [Methylophaga sp. JAM7]   97.4    9e-21
emb|CDH08489.1|  probable Histone deacetylase HDA1 [Zygosaccha...    100   9e-21
ref|WP_010870039.1|  hypothetical protein [Methanocaldococcus ...  97.4    9e-21
ref|XP_003360363.2|  PREDICTED: histone deacetylase 6 isoform ...    100   9e-21
ref|WP_008387244.1|  deacetylase [Halosarcina pallida]             97.4    9e-21
ref|WP_029067671.1|  acetoin utilization protein [Klebsiella p...  97.1    9e-21
ref|WP_004457863.1|  histone deacetylase [Leptospira santarosai]   97.1    9e-21
gb|KFP73552.1|  Histone deacetylase 10 [Acanthisitta chloris]      97.4    9e-21
ref|XP_008957537.1|  PREDICTED: histone deacetylase 6 isoform ...    100   1e-20
ref|XP_005704234.1|  histone deacetylase [Galdieria sulphuraria]   97.4    1e-20
ref|WP_006186934.1|  histone deacetylase superfamily protein [...  97.4    1e-20
ref|XP_004064156.1|  PREDICTED: histone deacetylase 6 isoform ...    100   1e-20
ref|WP_004503955.1|  histone deacetylase family protein [Lepto...  97.1    1e-20
ref|XP_010312891.1|  PREDICTED: histone deacetylase 14 isoform...  97.4    1e-20
ref|WP_021055669.1|  putative deacetylase [Haloquadratum walsbyi]  97.4    1e-20
ref|WP_004500255.1|  histone deacetylase family protein [Lepto...  97.1    1e-20
ref|XP_005700866.1|  PREDICTED: histone deacetylase 6 [Capra h...    100   1e-20
ref|XP_004022155.1|  PREDICTED: histone deacetylase 6 [Ovis ar...    100   1e-20
ref|WP_020782496.1|  histone deacetylase family protein [Lepto...  97.1    1e-20
ref|XP_008808492.1|  PREDICTED: histone deacetylase 14 [Phoeni...  98.2    1e-20
ref|XP_009961211.1|  PREDICTED: histone deacetylase 10 [Tyto a...  99.8    1e-20
ref|XP_008486584.1|  PREDICTED: histone deacetylase 4-like [Di...  97.8    1e-20
ref|WP_004495434.1|  histone deacetylase family protein [Lepto...  97.1    1e-20
gb|KFQ21605.1|  Histone deacetylase 10 [Merops nubicus]            94.4    1e-20
ref|XP_454328.1|  hypothetical protein [Kluyveromyces lactis N...  99.8    1e-20
ref|XP_009195797.1|  PREDICTED: histone deacetylase 6 isoform ...    100   1e-20
ref|XP_007989808.1|  PREDICTED: histone deacetylase 6 isoform ...    100   1e-20
ref|XP_005593547.1|  PREDICTED: histone deacetylase 6 isoform ...    100   1e-20
ref|XP_005593554.1|  PREDICTED: histone deacetylase 6 isoform ...    100   1e-20
ref|XP_002491196.1|  Putative catalytic subunit of a class II ...    100   1e-20
ref|XP_007989811.1|  PREDICTED: histone deacetylase 6 isoform ...    100   1e-20
ref|XP_003917728.1|  PREDICTED: histone deacetylase 6 isoform ...    100   1e-20
ref|XP_009570494.1|  PREDICTED: histone deacetylase 10 [Fulmar...  99.8    1e-20
ref|NP_001092430.1|  histone deacetylase 6 [Bos taurus]              100   1e-20
gb|AFK45229.1|  unknown [Lotus japonicus]                          97.8    1e-20
gb|KFC25084.1|  acetoin utilization protein [Sulfitobacter sp....  97.4    1e-20
ref|XP_005593548.1|  PREDICTED: histone deacetylase 6 isoform ...    100   1e-20
ref|XP_010295764.1|  PREDICTED: histone deacetylase 10 [Phaeth...  99.8    1e-20
ref|XP_005673657.1|  PREDICTED: histone deacetylase 6 isoform ...    100   1e-20
ref|WP_005388558.1|  histone deacetylase [Corynebacterium gluc...  97.4    1e-20
emb|CDO76009.1|  hypothetical protein BN946_scf184665.g1 [Tram...  99.8    1e-20
gb|KDR16176.1|  Histone deacetylase 4 [Zootermopsis nevadensis]      100   1e-20
ref|XP_001101533.2|  PREDICTED: histone deacetylase 6-like iso...    100   1e-20
ref|XP_005085180.1|  PREDICTED: histone deacetylase 6 [Mesocri...    100   1e-20
ref|XP_004064155.1|  PREDICTED: histone deacetylase 6 isoform ...    100   1e-20
ref|XP_003807271.1|  PREDICTED: histone deacetylase 6 isoform ...    100   1e-20
ref|XP_001101619.1|  PREDICTED: histone deacetylase 6-like iso...    100   1e-20
ref|XP_005956992.1|  PREDICTED: histone deacetylase 6 [Panthol...    100   1e-20
ref|XP_005887732.1|  PREDICTED: histone deacetylase 6 [Bos mutus]    100   1e-20
ref|WP_015789986.1|  acetoin utilization protein [Halorhabdus ...  97.1    1e-20
gb|EJY66545.1|  hypothetical protein OXYTRI_13167 [Oxytricha t...  97.8    1e-20
ref|XP_001484498.1|  hypothetical protein PGUG_03879 [Meyerozy...    100   1e-20
tpg|DAA59649.1|  TPA: hypothetical protein ZEAMMB73_114812 [Ze...  98.6    1e-20
ref|XP_009122119.1|  PREDICTED: histone deacetylase 14 [Brassi...  97.8    1e-20
ref|XP_004503930.1|  PREDICTED: histone deacetylase 14-like is...  97.1    1e-20
ref|XP_008227633.1|  PREDICTED: histone deacetylase 14 [Prunus...  97.8    1e-20
ref|XP_006171993.1|  PREDICTED: histone deacetylase 6 isoform ...    100   1e-20
ref|XP_007015686.1|  Histone deacetylase 8 isoform 1 [Theobrom...  97.8    1e-20
ref|WP_006110537.1|  histone deacetylase [Natrialba asiatica]      97.1    1e-20
ref|WP_004144562.1|  acetoin utilization protein [Stenotrophom...  96.7    1e-20
ref|XP_005614185.1|  PREDICTED: histone deacetylase 6 isoform ...    100   1e-20
ref|XP_007989812.1|  PREDICTED: histone deacetylase 6 isoform ...    100   1e-20
ref|XP_003917726.1|  PREDICTED: histone deacetylase 6 isoform ...    100   1e-20
ref|XP_003108801.1|  CRE-HDA-6 protein [Caenorhabditis remanei]    98.6    1e-20
gb|AHF80720.1|  acetylpolyamine aminohydrolase [Thermococcus s...  97.1    1e-20
ref|XP_005593549.1|  PREDICTED: histone deacetylase 6 isoform ...    100   1e-20
ref|XP_007989810.1|  PREDICTED: histone deacetylase 6 isoform ...    100   1e-20
ref|XP_007989809.1|  PREDICTED: histone deacetylase 6 isoform ...    100   1e-20
ref|XP_006171997.1|  PREDICTED: histone deacetylase 6 isoform ...    100   1e-20
gb|AEO21835.1|  propanil hydrolase [Sphingomonas sp. Y57]          97.1    1e-20
gb|ELR62301.1|  Histone deacetylase 6 [Bos mutus]                    100   1e-20
gb|ETK71338.1|  hypothetical protein L915_21408 [Phytophthora ...  97.1    1e-20
gb|ELV09218.1|  Histone deacetylase 6 [Tupaia chinensis]             100   1e-20
ref|WP_004504835.1|  histone deacetylase family protein [Lepto...  96.7    1e-20
ref|NP_001181125.1|  histone deacetylase 6 [Macaca mulatta]          100   1e-20
ref|XP_002174972.1|  histone deacetylase clr3 [Schizosaccharom...  99.4    1e-20
ref|XP_005228175.1|  PREDICTED: histone deacetylase 6 isoform ...    100   1e-20
ref|WP_030478399.1|  histone deacetylase [Lentzea albidocapill...  96.7    2e-20
ref|XP_003958877.1|  hypothetical protein KAFR_0H03320 [Kazach...  99.4    2e-20
ref|WP_002727800.1|  MULTISPECIES: histone deacetylase family ...  96.7    2e-20
gb|EIE86938.1|  hypothetical protein RO3G_11649 [Rhizopus dele...  99.4    2e-20
ref|WP_011670642.1|  histone deacetylase [Leptospira borgpeter...  96.7    2e-20
ref|WP_004486076.1|  histone deacetylase family protein [Lepto...  96.7    2e-20
ref|WP_004478937.1|  histone deacetylase family protein [Lepto...  96.7    2e-20
ref|XP_003671084.2|  hypothetical protein NDAI_0G00650 [Naumov...  99.4    2e-20
ref|WP_026288915.1|  acetoin utilization protein [Thioalkalivi...  97.1    2e-20
ref|WP_016561399.1|  histone deacetylase family protein [Lepto...  96.7    2e-20
ref|WP_002751681.1|  histone deacetylase family protein [Lepto...  96.7    2e-20
ref|XP_797761.3|  PREDICTED: histone deacetylase 4-like [Stron...  99.8    2e-20
ref|XP_010008936.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  99.0    2e-20
ref|NP_001105095.1|  histone deacetylase [Zea mays]                99.0    2e-20
ref|WP_013143569.1|  histone deacetylase [Staphylothermus hell...  96.7    2e-20
ref|WP_032959020.1|  acetoin utilization protein [Stenotrophom...  96.3    2e-20
ref|XP_004633630.1|  PREDICTED: histone deacetylase 6 [Octodon...  99.8    2e-20
ref|XP_005244063.1|  PREDICTED: histone deacetylase 10 [Falco ...  99.0    2e-20
dbj|BAG58680.1|  unnamed protein product [Homo sapiens]            96.3    2e-20
ref|XP_005481984.1|  PREDICTED: histone deacetylase 10 [Zonotr...  99.0    2e-20
ref|WP_002735490.1|  histone deacetylase family protein [Lepto...  96.3    2e-20
ref|WP_014645990.1|  acetoin utilization protein [Stenotrophom...  96.3    2e-20
ref|WP_007256750.1|  histone deacetylase [Oceanicola granulosus]   96.7    2e-20
ref|XP_006285468.1|  hypothetical protein CARUB_v10006887mg [C...  97.4    2e-20
ref|WP_018707427.1|  hypothetical protein [Bacillus fordii]        96.7    2e-20
gb|KDO29072.1|  hypothetical protein SPRG_06127 [Saprolegnia p...    100   2e-20
ref|WP_028955170.1|  acetoin utilization protein [Sulfitobacte...  96.7    2e-20
emb|CEG67414.1|  hypothetical protein RMATCC62417_03848 [Rhizo...  99.0    2e-20
ref|WP_025702284.1|  acetoin utilization protein [Paenibacillu...  96.7    2e-20
gb|EGT57967.1|  hypothetical protein CAEBREN_13830 [Caenorhabd...  99.4    2e-20
ref|XP_005438728.1|  PREDICTED: histone deacetylase 10 [Falco ...  99.0    2e-20
ref|NP_983880.2|  ADL216Cp [Ashbya gossypii ATCC 10895]            99.0    2e-20
ref|XP_855362.2|  PREDICTED: histone deacetylase 6 isoform X6 ...  99.8    2e-20
ref|XP_005641382.1|  PREDICTED: histone deacetylase 6 isoform ...  99.8    2e-20
ref|XP_008785785.1|  PREDICTED: histone deacetylase 8 [Phoenix...  96.7    2e-20
ref|XP_005641385.1|  PREDICTED: histone deacetylase 6 isoform ...  99.8    2e-20
ref|XP_002990908.1|  hypothetical protein SELMODRAFT_161290 [S...  95.9    2e-20
ref|WP_013258716.1|  histone deacetylase superfamily protein [...  96.3    2e-20
ref|WP_027966949.1|  acetoin utilization protein [Halomonas ha...  96.7    2e-20
gb|KGF22004.1|  acetoin utilization protein [Corynebacterium t...  96.7    2e-20
ref|WP_001141965.1|  histone deacetylase [Leptospira interrogans]  94.0    2e-20
ref|XP_006663891.1|  PREDICTED: histone deacetylase 14-like [O...  97.4    2e-20
ref|XP_005352863.1|  PREDICTED: histone deacetylase 6 isoform ...  99.8    2e-20
ref|WP_009627691.1|  histone deacetylase superfamily [Pseudana...  96.3    2e-20
gb|KGM34314.1|  acetoin utilization protein [Inquilinus limosu...  96.3    2e-20
ref|XP_003148434.1|  histone deacetylase 7A [Loa loa]              98.6    2e-20
gb|ETN67811.1|  histone deacetylase [Anopheles darlingi]           99.4    2e-20
ref|XP_002431644.1|  histone deacetylase hda2, putative [Pedic...  99.4    2e-20
ref|NP_001257279.1|  Protein HDA-4, isoform b [Caenorhabditis ...  99.0    2e-20
ref|WP_011501698.1|  histone deacetylase [Rhodopseudomonas pal...  96.3    2e-20
gb|ETM31266.1|  hypothetical protein L914_21140 [Phytophthora ...  96.3    2e-20
ref|XP_004894827.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  99.4    2e-20
ref|XP_004977200.1|  PREDICTED: histone deacetylase 14-like is...  97.1    2e-20
ref|XP_008274351.1|  PREDICTED: histone deacetylase 10 [Stegas...  98.6    3e-20
ref|XP_005352861.1|  PREDICTED: histone deacetylase 6 isoform ...  99.4    3e-20
ref|XP_005272621.1|  PREDICTED: histone deacetylase 6 isoform ...  99.4    3e-20
ref|XP_005352860.1|  PREDICTED: histone deacetylase 6 isoform ...  99.4    3e-20
ref|WP_007205862.1|  histone deacetylase [Loktanella vestfolde...  96.3    3e-20
gb|ADE76452.1|  unknown [Picea sitchensis]                         96.3    3e-20
gb|EMD37432.1|  hypothetical protein CERSUDRAFT_83190 [Ceripor...  98.6    3e-20
ref|XP_005352859.1|  PREDICTED: histone deacetylase 6 isoform ...  99.4    3e-20
dbj|BAA74924.2|  KIAA0901 protein [Homo sapiens]                   99.4    3e-20
gb|ACJ84689.1|  unknown [Medicago truncatula]                      96.3    3e-20
ref|NP_001257278.1|  Protein HDA-4, isoform a [Caenorhabditis ...  99.0    3e-20
gb|KGA94552.1|  Acetylspermidine deacetylase [Leptospirillum f...  95.9    3e-20
ref|XP_010432559.1|  PREDICTED: histone deacetylase 14 isoform...  96.3    3e-20
ref|WP_029228198.1|  histone deacetylase [Caldicellulosiruptor...  97.1    3e-20
ref|WP_013905214.1|  hypothetical protein [Pyrococcus yayanosii]   95.9    3e-20
ref|WP_013467586.1|  hypothetical protein [Thermococcus baroph...  95.9    3e-20
ref|XP_006180233.1|  PREDICTED: histone deacetylase 6 [Camelus...  99.4    3e-20
ref|XP_008915193.1|  hypothetical protein PPTG_18708 [Phytopht...  96.3    3e-20
ref|WP_017713646.1|  hypothetical protein [Prochlorothrix holl...  95.9    3e-20
gb|ETP28901.1|  hypothetical protein F442_21866 [Phytophthora ...  96.3    3e-20
gb|EDZ40093.1|  Probable histone deacetylase family protein [L...  95.9    3e-20
gb|AGO11570.1|  AaceriADL216Cp [Saccharomycetaceae sp. 'Ashbya...  98.6    3e-20
ref|WP_013432339.1|  histone deacetylase [Caldicellulosiruptor...  96.7    3e-20
ref|XP_005352862.1|  PREDICTED: histone deacetylase 6 isoform ...  99.4    3e-20
gb|EGA73404.1|  Hda1p [Saccharomyces cerevisiae AWRI796]           98.2    3e-20
gb|KFD48677.1|  hypothetical protein M513_10461 [Trichuris suis]   99.0    3e-20
ref|XP_002044572.1|  GM19975 [Drosophila sechellia]                97.4    3e-20
ref|XP_008374726.1|  PREDICTED: histone deacetylase 15-like is...  97.8    3e-20
gb|EYB99542.1|  hypothetical protein Y032_0121g1000 [Ancylosto...  99.0    3e-20
emb|CDR43474.1|  CYFA0S12e00892g1_1 [Cyberlindnera fabianii]       98.6    3e-20
ref|XP_003799739.1|  PREDICTED: histone deacetylase 6 [Otolemu...  99.0    3e-20
ref|XP_008374725.1|  PREDICTED: histone deacetylase 15-like is...  97.8    3e-20
gb|AAF36540.1|  GR AF-1 specific histone deacetylase [Homo sap...  99.0    3e-20
gb|EKC34968.1|  Histone deacetylase 4 [Crassostrea gigas]          98.6    3e-20
ref|WP_010210383.1|  MULTISPECIES: acetoin utilization protein...  95.9    3e-20
gb|KFV79322.1|  Histone deacetylase 4 [Struthio camelus austra...  99.0    3e-20
dbj|BAK01741.1|  predicted protein [Hordeum vulgare subsp. vul...  96.7    3e-20
gb|AAH13737.1|  HDAC6 protein [Homo sapiens]                       99.0    3e-20
dbj|BAG64088.1|  unnamed protein product [Homo sapiens]            99.0    3e-20
gb|EYB99541.1|  hypothetical protein Y032_0121g1000 [Ancylosto...  98.6    3e-20
ref|XP_007974395.1|  PREDICTED: histone deacetylase 10 isoform...  98.6    3e-20
ref|WP_027957412.1|  MULTISPECIES: acetoin utilization protein...  95.9    3e-20
ref|XP_010393844.1|  PREDICTED: histone deacetylase 10 isoform...  98.2    3e-20
emb|CDX68980.1|  BnaC01g04730D [Brassica napus]                    96.7    3e-20
gb|AAI66352.1|  LOC100158627 protein [Xenopus (Silurana) tropi...  97.8    3e-20
gb|AAD29048.1|AF132609_1  histone deacetylase 6 [Homo sapiens]     99.0    3e-20
ref|XP_758249.1|  hypothetical protein UM02102.1 [Ustilago may...  98.6    3e-20
ref|WP_002112906.1|  histone deacetylase family protein [Lepto...  95.5    3e-20
ref|XP_010173624.1|  PREDICTED: histone deacetylase 9-like [Ca...  95.9    3e-20
gb|EPY84552.1|  histone deacetylase 6-like protein [Camelus fe...  99.0    3e-20
emb|CDX75356.1|  BnaA01g03460D [Brassica napus]                    96.3    3e-20
gb|EKC22071.1|  Histone deacetylase 10 [Crassostrea gigas]         94.0    4e-20
ref|XP_010393842.1|  PREDICTED: histone deacetylase 10 isoform...  98.2    4e-20
ref|NP_006035.2|  histone deacetylase 6 [Homo sapiens]             99.0    4e-20
gb|AAH69243.1|  HDAC6 protein [Homo sapiens]                       99.0    4e-20
emb|CAB70878.2|  hypothetical protein [Homo sapiens]               99.0    4e-20
gb|EXF25802.1|  acetoin utilization protein [Nesterenkonia sp....  95.9    4e-20
ref|XP_007914843.1|  putative histone deacetylase protein [Tog...  98.2    4e-20
ref|XP_006655362.1|  PREDICTED: histone deacetylase 8-like [Or...  95.9    4e-20
gb|KGB38358.1|  Histone deacetylase 6 [Schistosoma haematobium]    99.0    4e-20
ref|WP_025050451.1|  acetoin utilization protein [Sulfitobacte...  95.9    4e-20
ref|XP_008640813.1|  PREDICTED: histone deacetylase 10 [Corvus...  97.8    4e-20
ref|XP_010432557.1|  PREDICTED: histone deacetylase 14 isoform...  96.7    4e-20
emb|CCK71615.1|  hypothetical protein KNAG_0H02010 [Kazachstan...  98.2    4e-20
ref|NP_014377.1|  Hda1p [Saccharomyces cerevisiae S288c]           98.2    4e-20
ref|XP_009554698.1|  PREDICTED: histone deacetylase 10 [Cuculu...  97.8    4e-20
gb|EDZ69626.1|  YNL021Wp-like protein [Saccharomyces cerevisia...  98.2    4e-20
ref|NP_001080486.1|  histone deacetylase 6 [Xenopus laevis]        99.0    4e-20
gb|EGA85014.1|  Hda1p [Saccharomyces cerevisiae VL3]               98.2    4e-20
gb|EGA77063.1|  Hda1p [Saccharomyces cerevisiae Vin13]             98.2    4e-20
ref|XP_006045750.1|  PREDICTED: histone deacetylase 6 isoform ...  98.2    4e-20
ref|XP_004977199.1|  PREDICTED: histone deacetylase 14-like is...  96.7    4e-20
ref|XP_002456590.1|  hypothetical protein SORBIDRAFT_03g038950...  96.3    4e-20
gb|EHN04898.1|  Hda1p [Saccharomyces cerevisiae x Saccharomyce...  98.2    4e-20
ref|XP_009777314.1|  PREDICTED: histone deacetylase 14 isoform...  95.5    4e-20
ref|XP_010393845.1|  PREDICTED: histone deacetylase 10 isoform...  97.8    4e-20
ref|NP_001089352.1|  histone deacetylase 10 [Xenopus laevis]       98.2    4e-20
gb|EDV12289.1|  histone deacetylase [Saccharomyces cerevisiae ...  98.2    4e-20
dbj|BAG50935.1|  unnamed protein product [Homo sapiens]            98.2    4e-20
gb|EHB09441.1|  Histone deacetylase 6 [Heterocephalus glaber]      99.0    4e-20
ref|WP_023503194.1|  putative deacetylase [uncultured archaeon...  95.5    4e-20
ref|WP_005537261.1|  acetoin utilization protein/histone deace...  95.5    4e-20
gb|KFQ70710.1|  Histone deacetylase 4 [Phaethon lepturus]          97.4    4e-20
ref|XP_010393843.1|  PREDICTED: histone deacetylase 10 isoform...  97.8    4e-20
emb|CDO98466.1|  unnamed protein product [Coffea canephora]        97.8    5e-20
ref|WP_010868269.1|  hypothetical protein [Pyrococcus abyssi]      95.5    5e-20
ref|XP_005986349.1|  PREDICTED: histone deacetylase 7 isoform ...  98.6    5e-20
ref|XP_005986348.1|  PREDICTED: histone deacetylase 7 isoform ...  98.6    5e-20
ref|XP_008509924.1|  PREDICTED: histone deacetylase 6 isoform ...  95.1    5e-20
gb|KDA53488.1|  hypothetical protein EG19_04575 [bacterium MP-01]  95.1    5e-20
ref|WP_002984044.1|  histone deacetylase family protein [Lepto...  95.1    5e-20
dbj|BAG53817.1|  unnamed protein product [Homo sapiens]            98.2    5e-20
ref|XP_008112124.1|  PREDICTED: histone deacetylase 4 isoform ...  98.6    5e-20
ref|XP_002555483.1|  KLTH0G10340p [Lachancea thermotolerans CB...  97.8    5e-20
gb|EAW50745.1|  histone deacetylase 6, isoform CRA_b [Homo sap...  98.2    5e-20
ref|WP_031296210.1|  deacetylase [Pseudogulbenkiania ferrooxid...  90.5    5e-20
ref|XP_007721816.1|  histone deacetylase 6/10 [Capronia corona...  98.2    5e-20
ref|WP_021688456.1|  hypothetical protein [Novosphingobium tar...  95.5    5e-20
ref|XP_003106798.1|  CRE-HDA-4 protein [Caenorhabditis remanei]    98.2    5e-20
ref|XP_003374822.1|  putative histone deacetylase 4 [Trichinel...  98.2    5e-20
ref|WP_004515365.1|  acetoin utilization protein [Haloarcula v...  95.1    5e-20
ref|XP_004084833.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  98.2    5e-20
ref|WP_031503848.1|  histone deacetylase [Thermotoga hypogea]      95.1    5e-20
ref|WP_001141966.1|  histone deacetylase [Leptospira interrogans]  95.1    5e-20
ref|XP_008441062.1|  PREDICTED: histone deacetylase 14 isoform...  96.3    5e-20
dbj|BAC42833.1|  putative histone deacetylase [Arabidopsis tha...  97.1    5e-20
gb|EHH30703.1|  Histone deacetylase 6 [Macaca mulatta]             98.6    5e-20
ref|XP_008112127.1|  PREDICTED: histone deacetylase 4 isoform ...  98.2    5e-20
ref|XP_008112134.1|  PREDICTED: histone deacetylase 4 isoform ...  98.2    6e-20
ref|WP_030524702.1|  acetoin utilization protein [Nocardia rha...  95.1    6e-20
gb|AAT47772.1|  GH10588p [Drosophila melanogaster]                 97.4    6e-20
ref|XP_008509921.1|  PREDICTED: histone deacetylase 6 isoform ...  95.1    6e-20
ref|WP_018681067.1|  hypothetical protein [Actinokineospora en...  95.1    6e-20
emb|CAF98204.1|  unnamed protein product [Tetraodon nigroviridis]  98.2    6e-20
ref|XP_006045749.1|  PREDICTED: histone deacetylase 6 isoform ...  97.8    6e-20
ref|XP_008112092.1|  PREDICTED: histone deacetylase 4 isoform ...  98.2    6e-20
emb|CCF52212.1|  related to HDA1-histone deacetylase A [Ustila...  97.8    6e-20
ref|XP_008509923.1|  PREDICTED: histone deacetylase 6 isoform ...  95.1    6e-20
ref|XP_008248630.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar...  98.2    6e-20
ref|XP_005421002.1|  PREDICTED: histone deacetylase 10 [Geospi...  97.4    6e-20
ref|XP_008112118.1|  PREDICTED: histone deacetylase 4 isoform ...  98.2    6e-20
ref|WP_015408426.1|  HdaI-type histone deacetylase [Natronomon...  95.1    6e-20
gb|EJT41666.1|  HDA1-like protein [Saccharomyces kudriavzevii ...  97.8    6e-20
dbj|BAG51263.1|  unnamed protein product [Homo sapiens]            97.8    6e-20
ref|WP_001141967.1|  histone deacetylase [Leptospira interrogans]  94.7    6e-20
ref|WP_001141958.1|  histone deacetylase [Leptospira interrogans]  94.7    6e-20
ref|XP_003057180.1|  histone deacetylase [Micromonas pusilla C...  95.1    6e-20
ref|NP_566612.1|  histone deacetylase 15 [Arabidopsis thaliana]    97.1    6e-20
ref|WP_001141968.1|  histone deacetylase [Leptospira interrogans]  94.7    6e-20
ref|WP_010679754.1|  histone deacetylase family protein [Lepto...  94.7    6e-20
ref|XP_008046280.1|  PREDICTED: histone deacetylase 10 [Tarsiu...  97.4    6e-20
ref|WP_030427482.1|  histone deacetylase [Allokutzneria albata]    95.1    6e-20
ref|XP_004832131.1|  histone deacetylase, putative [Babesia equi]  98.2    7e-20
gb|AIQ12489.1|  acetoin utilization protein [Paenibacillus durus]  95.1    7e-20
gb|EJD76727.1|  histone deacetylase 4 [Loa loa]                    97.8    7e-20
ref|XP_007533695.1|  PREDICTED: histone deacetylase 9 isoform ...  98.2    7e-20
ref|XP_008569659.1|  PREDICTED: histone deacetylase 6 isoform ...  98.2    7e-20
ref|XP_002883138.1|  hypothetical protein ARALYDRAFT_479356 [A...  97.1    7e-20
ref|XP_001453090.1|  hypothetical protein [Paramecium tetraure...  97.4    7e-20
ref|WP_020198391.1|  histone deacetylase [Leptospira interrogans]  94.7    7e-20
gb|EFN75801.1|  Histone deacetylase 4 [Harpegnathos saltator]      97.8    7e-20
ref|XP_002898371.1|  histone deacetylase, putative [Phytophtho...  95.1    7e-20
ref|XP_003743834.1|  PREDICTED: histone deacetylase 4-like [Me...  97.8    7e-20
ref|XP_008193521.1|  PREDICTED: histone deacetylase 6 [Triboli...  97.8    7e-20
ref|WP_011378329.1|  hypothetical protein [Synechococcus elong...  94.7    7e-20
ref|XP_007150031.1|  hypothetical protein PHAVU_005G120200g [P...  95.1    7e-20
ref|XP_002267516.1|  PREDICTED: histone deacetylase 14 [Vitis ...  95.9    7e-20
ref|XP_002840741.1|  hypothetical protein [Tuber melanosporum ...  95.9    7e-20
ref|WP_013302881.1|  histone deacetylase [Ignisphaera aggregans]   94.7    7e-20
ref|XP_008569662.1|  PREDICTED: histone deacetylase 6 isoform ...  97.8    7e-20
gb|AFW81787.1|  hypothetical protein ZEAMMB73_628415 [Zea mays]    95.1    7e-20
ref|WP_022643840.1|  hypothetical protein [Pseudomonas sp. CMA...  95.1    8e-20
ref|WP_031228668.1|  histone deacetylase [Streptomyces niveus]     94.7    8e-20
emb|CBQ72644.1|  related to HDA1-histone deacetylase A [Sporis...  97.4    8e-20
dbj|BAG52988.1|  unnamed protein product [Homo sapiens]            97.8    8e-20
ref|WP_019528998.1|  hypothetical protein [Dasania marina]         95.1    8e-20
gb|EAW73511.1|  histone deacetylase 10, isoform CRA_a [Homo sa...  97.1    8e-20
gb|EFA11522.1|  hypothetical protein TcasGA2_TC014236 [Triboli...  97.4    8e-20
ref|WP_022540822.1|  histone deacetylase [Aeropyrum camini]        94.7    8e-20
gb|EAW73519.1|  histone deacetylase 10, isoform CRA_i [Homo sa...  97.1    8e-20
ref|WP_021621224.1|  putative histone deacetylase-like amidohy...  94.7    8e-20
gb|KGF16548.1|  acetoin utilization protein [Corynebacterium f...  94.7    8e-20
ref|NP_850609.2|  histone deacetylase 15 [Arabidopsis thaliana]    96.7    8e-20
ref|XP_006297354.1|  hypothetical protein CARUB_v10013374mg [C...  96.7    8e-20
ref|WP_006965008.1|  hypothetical protein [Desulfotignum phosp...  97.4    9e-20
ref|XP_001766598.1|  class II RPD3 type histone deacetylase pr...  95.5    9e-20
ref|XP_004637408.1|  PREDICTED: histone deacetylase 4 [Octodon...  97.8    9e-20
ref|WP_001141969.1|  histone deacetylase [Leptospira interrogans]  94.4    9e-20
emb|CCI44928.1|  unnamed protein product [Albugo candida]          97.4    9e-20
ref|WP_020678310.1|  hypothetical protein [Geopsychrobacter el...  94.4    9e-20
gb|EST33028.1|  histone deacetylase [Streptomyces niveus NCIMB...  94.7    9e-20
ref|XP_009346854.1|  PREDICTED: histone deacetylase 15-like [P...  96.7    9e-20
ref|WP_033436793.1|  histone deacetylase [Saccharothrix sp. NR...  94.7    9e-20
ref|WP_001141963.1|  histone deacetylase [Leptospira interrogans]  94.4    9e-20
ref|WP_006056309.1|  acetoin utilization protein [Halogeometri...  94.4    9e-20
ref|XP_009008751.1|  hypothetical protein HELRODRAFT_105206 [H...  94.7    9e-20
ref|XP_002643599.1|  C. briggsae CBR-HDA-4 protein [Caenorhabd...  97.4    9e-20
ref|XP_447854.1|  hypothetical protein [Candida glabrata CBS 138]  97.1    9e-20
ref|XP_003596882.1|  Histone deacetylase [Medicago truncatula]     94.7    9e-20
ref|XP_006412355.1|  hypothetical protein EUTSA_v10025266mg [E...  95.1    1e-19
ref|WP_029018077.1|  acetoin utilization protein [actinobacter...  94.7    1e-19
dbj|BAG64143.1|  unnamed protein product [Homo sapiens]            97.8    1e-19
gb|ELU01509.1|  hypothetical protein CAPTEDRAFT_173494 [Capite...  94.7    1e-19
ref|XP_010188734.1|  PREDICTED: histone deacetylase 4 [Mesitor...  95.9    1e-19
ref|XP_006854632.1|  hypothetical protein AMTR_s00030p00182140...  94.7    1e-19
ref|XP_002286754.1|  predicted protein [Thalassiosira pseudona...  93.2    1e-19
ref|XP_814618.1|  histone deacetylase [Trypanosoma cruzi strai...  96.7    1e-19
ref|XP_004911974.1|  PREDICTED: histone deacetylase 7 isoform ...  97.4    1e-19
ref|WP_026300312.1|  histone deacetylase [Halomonas lutea]         94.4    1e-19
ref|XP_006485755.1|  PREDICTED: histone deacetylase 15-like is...  96.7    1e-19
ref|XP_009082448.1|  PREDICTED: histone deacetylase 10 [Acanth...  96.7    1e-19
ref|XP_004333528.1|  histone deacetylase domain containing pro...  97.4    1e-19
ref|XP_002100445.1|  GE16165 [Drosophila yakuba]                   97.4    1e-19
ref|XP_008526062.1|  PREDICTED: histone deacetylase 4 [Equus p...  97.4    1e-19
ref|XP_004911972.1|  PREDICTED: histone deacetylase 7 isoform ...  97.4    1e-19
ref|XP_008905056.1|  hypothetical protein PPTG_11482 [Phytopht...  94.7    1e-19
gb|EPS72412.1|  histone deacetylase superfamily [Genlisea aurea]   94.7    1e-19
ref|NP_001259509.1|  HDAC4, isoform I [Drosophila melanogaster]    97.4    1e-19
ref|XP_002935701.2|  PREDICTED: histone deacetylase 7 isoform ...  97.4    1e-19
ref|XP_005430162.1|  PREDICTED: histone deacetylase 7 [Geospiz...  96.7    1e-19
ref|WP_021040449.1|  putative deacetylase [Halonotius sp. J07HN4]  94.4    1e-19
gb|KGM49177.1|  acetoin utilization protein [Oceanicola sp. 22...  94.4    1e-19
ref|XP_001978293.1|  GG19512 [Drosophila erecta]                   97.4    1e-19
ref|WP_013908610.1|  histone deacetylase superfamily [Thermode...  94.0    1e-19
ref|XP_003474428.2|  PREDICTED: histone deacetylase 4 isoform ...  97.4    1e-19
ref|XP_007155138.1|  hypothetical protein PHAVU_003G176700g [P...  96.3    1e-19
ref|XP_004911973.1|  PREDICTED: histone deacetylase 7 isoform ...  97.1    1e-19
ref|WP_009805532.1|  histone deacetylase [Oceanicola batsensis]    94.4    1e-19
emb|CDY24487.1|  BnaC05g34670D [Brassica napus]                    96.3    1e-19
ref|XP_005748065.1|  PREDICTED: histone deacetylase 6-like [Pu...  97.4    1e-19
pdb|2VQO|A  Chain A, Structure Of Hdac4 Catalytic Domain With ...  94.7    1e-19
ref|XP_006485756.1|  PREDICTED: histone deacetylase 15-like is...  96.3    1e-19
ref|WP_020986809.1|  histone deacetylase family protein [Lepto...  94.0    1e-19
ref|WP_016655204.1|  hypothetical protein [Acinetobacter rudis]    94.4    1e-19
ref|XP_002025300.1|  GL13309 [Drosophila persimilis]               97.4    1e-19
ref|XP_004487453.1|  PREDICTED: histone deacetylase 8-like [Ci...  94.4    1e-19
ref|WP_013403581.1|  histone deacetylase [Caldicellulosiruptor...  95.1    1e-19
ref|XP_003717862.1|  histone deacetylase HDA1 [Magnaporthe ory...  96.7    1e-19
pdb|2VQQ|A  Chain A, Structure Of Hdac4 Catalytic Domain (A Do...  94.7    1e-19
ref|WP_014706047.1|  histone deacetylase [Methylophaga sp. JAM1]   94.0    1e-19
ref|XP_002042910.1|  GM11498 [Drosophila sechellia]                97.1    1e-19
ref|XP_005533414.1|  PREDICTED: histone deacetylase 6 [Pseudop...  96.7    1e-19
ref|WP_014867323.1|  histone deacetylase [Methanoculleus bourg...  94.0    1e-19
ref|XP_004568222.1|  PREDICTED: histone deacetylase 6-like iso...  97.1    1e-19
ref|XP_002139783.1|  histone deacetylase [Cryptosporidium muri...  97.1    1e-19
ref|XP_001644590.1|  hypothetical protein Kpol_1003p37 [Vander...  94.0    1e-19
ref|XP_004092626.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  97.1    1e-19
ref|WP_011011947.1|  hypothetical protein [Pyrococcus furiosus]    94.0    1e-19
ref|NP_001014736.2|  HDAC4, isoform E [Drosophila melanogaster]    97.1    1e-19
gb|AAN15142.1|  histone deacetylase dHDAC4 isoform a [Drosophi...  97.1    1e-19
ref|XP_002523875.1|  Histone deacetylase, putative [Ricinus co...  94.4    1e-19
ref|XP_005931185.1|  PREDICTED: histone deacetylase 6-like iso...  97.1    1e-19
ref|XP_002904392.1|  histone deacetylase, putative [Phytophtho...  96.7    2e-19
ref|NP_001259507.1|  HDAC4, isoform G [Drosophila melanogaster]    97.1    2e-19
ref|XP_001355273.2|  GA14617 [Drosophila pseudoobscura pseudoo...  97.1    2e-19
ref|XP_005646444.1|  Arginase/deacetylase [Coccomyxa subellips...  94.4    2e-19
gb|AGD79326.1|  RE18386p1 [Drosophila melanogaster]                97.1    2e-19
ref|WP_001141962.1|  histone deacetylase [Leptospira interrogans]  93.6    2e-19
gb|ABV82197.1|  GH08881p [Drosophila melanogaster]                 97.1    2e-19
ref|XP_008987545.1|  PREDICTED: histone deacetylase 6 [Callith...  97.1    2e-19
ref|NP_727682.1|  HDAC4, isoform B [Drosophila melanogaster]       97.1    2e-19
ref|WP_004425131.1|  histone deacetylase [Leptospira noguchii]     93.6    2e-19
gb|AHM04261.1|  Deacetylase [Roseibacterium elongatum DSM 19469]   94.0    2e-19
ref|WP_011208570.1|  histone deacetylase [Nocardia farcinica]      94.0    2e-19
ref|NP_572868.3|  HDAC4, isoform D [Drosophila melanogaster]       97.1    2e-19
gb|AAN15143.1|  histone deacetylase dHDAC4 isoform b [Drosophi...  97.1    2e-19
ref|XP_006440921.1|  hypothetical protein CICLE_v10019370mg [C...  95.9    2e-19
ref|WP_002103385.1|  histone deacetylase family protein [Lepto...  93.6    2e-19
ref|NP_001245651.1|  HDAC4, isoform F [Drosophila melanogaster]    97.1    2e-19
gb|KGE24798.1|  histone deacetylase [Leptospira interrogans se...  93.6    2e-19
ref|WP_015105160.1|  putative deacetylase [Saccharothrix espan...  94.0    2e-19
ref|XP_009556543.1|  PREDICTED: histone deacetylase 4 [Cuculus...  95.9    2e-19
ref|WP_001141961.1|  histone deacetylase [Leptospira interrogans]  93.6    2e-19
emb|CDQ04603.1|  Protein BM-HDA-4, isoform b [Brugia malayi]       96.7    2e-19
ref|XP_003939595.1|  PREDICTED: histone deacetylase 6 isoform ...  97.1    2e-19
ref|XP_005462525.1|  PREDICTED: histone deacetylase 6-like iso...  97.1    2e-19
ref|WP_012939705.1|  hypothetical protein [Archaeoglobus profu...  93.6    2e-19
ref|WP_027134270.1|  acetoin utilization protein [Geminicoccus...  94.0    2e-19
ref|XP_009181744.1|  PREDICTED: histone deacetylase 4 isoform ...  95.9    2e-19
ref|WP_017851292.1|  histone deacetylase [Leptospira interrogans]  93.6    2e-19
ref|XP_010348502.1|  PREDICTED: histone deacetylase 6 isoform ...  97.1    2e-19
emb|CDW73889.1|  histone deacetylase family protein [Stylonych...  94.7    2e-19
gb|KFB42575.1|  histone deacetylase [Anopheles sinensis]           97.1    2e-19
ref|XP_006152037.1|  PREDICTED: histone deacetylase 4 [Tupaia ...  96.7    2e-19
ref|WP_001141960.1|  histone deacetylase [Leptospira interrogans]  93.6    2e-19
ref|XP_006636697.1|  PREDICTED: histone deacetylase 4-like [Le...  96.7    2e-19
gb|ELK14388.1|  Histone deacetylase 4 [Pteropus alecto]            94.7    2e-19
ref|WP_013290781.1|  histone deacetylase [Caldicellulosiruptor...  94.7    2e-19
emb|CCA19742.1|  histone deacetylase putative [Albugo laibachi...  96.7    2e-19
ref|XP_005411237.1|  PREDICTED: histone deacetylase 4 isoform ...  96.7    2e-19
ref|XP_007328549.1|  hypothetical protein AGABI1DRAFT_127061 [...  95.5    2e-19
ref|XP_010295563.1|  PREDICTED: histone deacetylase 4 [Phaetho...  95.9    2e-19
ref|WP_013377371.1|  histone deacetylase [Stigmatella aurantiaca]  93.6    2e-19
ref|XP_006440922.1|  hypothetical protein CICLE_v10019370mg [C...  95.9    2e-19
ref|XP_003684925.1|  hypothetical protein TPHA_0C03390 [Tetrap...  96.3    2e-19
gb|KFK29969.1|  hypothetical protein AALP_AA7G200700 [Arabis a...  94.4    2e-19
ref|XP_006600779.1|  PREDICTED: histone deacetylase 15-like is...  95.1    2e-19
ref|XP_005462524.1|  PREDICTED: histone deacetylase 6-like iso...  96.7    2e-19
ref|XP_967425.2|  PREDICTED: histone deacetylase 7 [Tribolium ...  96.3    2e-19
ref|XP_007655477.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  94.0    2e-19
ref|WP_008416407.1|  acetoin utilization protein [Halalkalicoc...  93.6    2e-19
ref|XP_008863976.1|  hypothetical protein H310_02297 [Aphanomy...  93.6    2e-19
ref|WP_021061942.1|  putative deacetylase [Halonotius sp. J07HN6]  93.6    2e-19
emb|CDQ85820.1|  unnamed protein product [Oncorhynchus mykiss]     95.1    2e-19
ref|XP_004676801.1|  PREDICTED: histone deacetylase 9 isoform ...  96.7    2e-19
pdb|4CBT|A  Chain A, Design, Synthesis, And Biological Evaluat...  94.0    2e-19
pdb|2VQW|G  Chain G, Structure Of Inhibitor-Free Hdac4 Catalyt...  94.0    2e-19
ref|WP_004023626.1|  histone deacetylase [Gordonia terrae]         93.6    2e-19
gb|EHH60864.1|  Histone deacetylase 6 [Macaca fascicularis]        96.7    2e-19
emb|CCJ31234.1|  unnamed protein product [Pneumocystis jirovecii]  95.9    2e-19
ref|XP_004676802.1|  PREDICTED: histone deacetylase 9 isoform ...  96.7    2e-19
emb|CDX92243.1|  BnaA05g21640D [Brassica napus]                    95.5    2e-19
ref|XP_006803803.1|  PREDICTED: histone deacetylase 6-like [Ne...  96.3    2e-19
ref|WP_028634156.1|  acetoin utilization protein [Pseudomonas ...  93.6    2e-19
ref|XP_010186535.1|  PREDICTED: histone deacetylase 10-like [M...  95.9    2e-19
ref|XP_001419561.1|  predicted protein [Ostreococcus lucimarin...  95.9    2e-19
pdb|2VQJ|A  Chain A, Structure Of Hdac4 Catalytic Domain Bound...  94.0    2e-19
ref|XP_006741219.1|  PREDICTED: histone deacetylase 4-like [Le...  95.9    2e-19
gb|EAY98204.1|  hypothetical protein OsI_20117 [Oryza sativa I...  94.0    2e-19
ref|XP_007438163.1|  PREDICTED: histone deacetylase 4-like [Py...  96.3    2e-19
ref|XP_009145883.1|  PREDICTED: histone deacetylase 15 isoform...  95.1    2e-19
ref|WP_012284642.1|  histone deacetylase [Caulobacter sp. K31]     93.6    2e-19
ref|XP_006461150.1|  hypothetical protein AGABI2DRAFT_118070 [...  95.9    2e-19
gb|EFA04105.1|  hypothetical protein TcasGA2_TC014342 [Triboli...  96.3    3e-19
ref|WP_011839478.1|  histone deacetylase [Staphylothermus mari...  93.2    3e-19
ref|XP_009669340.1|  PREDICTED: histone deacetylase 4 isoform ...  96.3    3e-19
ref|XP_006738464.1|  PREDICTED: histone deacetylase 6 [Leptony...  96.3    3e-19
ref|XP_006481541.1|  PREDICTED: histone deacetylase 8-like iso...  93.2    3e-19
gb|ETK87446.1|  hypothetical protein L915_08119 [Phytophthora ...  94.0    3e-19
gb|KGL75096.1|  Histone deacetylase 4 [Tinamus guttatus]           96.3    3e-19
ref|XP_009145885.1|  PREDICTED: histone deacetylase 15 isoform...  95.1    3e-19
ref|XP_010487777.1|  PREDICTED: histone deacetylase 15-like [C...  95.1    3e-19
ref|WP_004267076.1|  histone deacetylase [Natrialba magadii]       93.6    3e-19
ref|XP_007245939.1|  PREDICTED: histone deacetylase 6-like [As...  96.3    3e-19
ref|XP_007554237.1|  PREDICTED: histone deacetylase 7-like [Po...  96.3    3e-19
ref|XP_009233112.1|  PREDICTED: histone deacetylase 6 [Pongo a...  96.3    3e-19
ref|XP_003739405.1|  PREDICTED: histone deacetylase 6-like [Me...  96.3    3e-19
ref|XP_010137865.1|  PREDICTED: histone deacetylase 9-like [Bu...  94.4    3e-19
ref|XP_010506955.1|  PREDICTED: histone deacetylase 15-like [C...  95.1    3e-19
ref|XP_009669341.1|  PREDICTED: histone deacetylase 4 isoform ...  96.3    3e-19
ref|WP_011244278.1|  hypothetical protein [Synechococcus elong...  92.8    3e-19
ref|XP_009824413.1|  hypothetical protein H257_02456 [Aphanomy...  93.2    3e-19
ref|WP_033190870.1|  histone deacetylase [Fervidobacterium isl...  92.8    3e-19
gb|EJU04046.1|  histone deacetylase complex protein [Dacryopin...  95.5    3e-19
ref|XP_010465954.1|  PREDICTED: histone deacetylase 15 [Cameli...  95.1    3e-19
gb|KFW64858.1|  Histone deacetylase 4 [Pygoscelis adeliae]         96.3    3e-19
dbj|BAD32295.1|  mKIAA0744 protein [Mus musculus]                  95.1    3e-19
gb|KFQ12259.1|  Histone deacetylase 10 [Leptosomus discolor]       89.7    3e-19
ref|XP_006580689.1|  PREDICTED: histone deacetylase 15-like [G...  94.0    3e-19
ref|XP_504372.1|  YALI0E24893p [Yarrowia lipolytica CLIB122]       95.5    3e-19
ref|WP_011454134.1|  histone deacetylase [Jannaschia sp. CCS1]     93.2    3e-19
ref|WP_013164832.1|  histone deacetylase [Desulfurivibrio alka...  92.8    3e-19
ref|XP_006481542.1|  PREDICTED: histone deacetylase 8-like iso...  92.8    3e-19
gb|KDQ28087.1|  hypothetical protein PLEOSDRAFT_1041421 [Pleur...  95.9    3e-19
gb|KFP12507.1|  Histone deacetylase 4 [Egretta garzetta]           95.9    3e-19
ref|XP_807406.1|  histone deacetylase [Trypanosoma cruzi strai...  95.5    3e-19
ref|WP_017792714.1|  histone deacetylase [Leucobacter salsicius]   93.2    3e-19
ref|XP_006481540.1|  PREDICTED: histone deacetylase 8-like iso...  93.2    3e-19
ref|WP_012647279.1|  histone deacetylase superfamily protein [...  92.8    3e-19
ref|XP_008762833.1|  PREDICTED: histone deacetylase 9 isoform ...  95.9    3e-19
ref|XP_002183066.1|  predicted protein [Phaeodactylum tricornu...  92.4    3e-19
gb|ESS63103.1|  histone deacetylase [Trypanosoma cruzi Dm28c]      95.1    3e-19
ref|XP_008086287.1|  Arginase/deacetylase [Glarea lozoyensis A...  95.5    3e-19
ref|XP_006600776.1|  PREDICTED: histone deacetylase 15-like is...  94.7    3e-19
ref|XP_006008601.1|  PREDICTED: histone deacetylase 6 [Latimer...  95.9    3e-19
ref|WP_016914899.1|  histone deacetylase [Halomonas stevensii]     93.2    3e-19
ref|XP_004386559.1|  PREDICTED: histone deacetylase 4 [Trichec...  95.9    4e-19
ref|XP_002057375.1|  GJ17051 [Drosophila virilis]                  95.9    4e-19
gb|KFO74183.1|  Histone deacetylase 4 [Cuculus canorus]            95.1    4e-19
ref|XP_005759484.1|  hypothetical protein EMIHUDRAFT_448459 [E...  92.8    4e-19
ref|XP_008338726.1|  PREDICTED: histone deacetylase 14 isoform...  93.6    4e-19
ref|WP_018828667.1|  hypothetical protein [Salinispora pacifica]   93.2    4e-19
ref|XP_005635986.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  95.9    4e-19
gb|KDP20091.1|  hypothetical protein JCGZ_05860 [Jatropha curcas]  95.1    4e-19
gb|EKG06645.1|  histone deacetylase, putative [Trypanosoma cruzi]  95.5    4e-19
gb|EPY49563.1|  histone deacetylase Clr3 [Schizosaccharomyces ...  95.1    4e-19
gb|KGE88561.1|  histone deacetylase [Saprospiraceae bacterium ...  92.4    4e-19
ref|XP_003724721.1|  PREDICTED: histone deacetylase 6-like [St...  95.9    4e-19
dbj|BAL56653.1|  histone deacetylase superfamily protein [uncu...  92.4    4e-19
ref|WP_013411808.1|  histone deacetylase [Caldicellulosiruptor...  93.6    4e-19
ref|XP_008729671.1|  hypothetical protein G647_07132 [Cladophi...  95.5    4e-19
ref|XP_008250243.1|  PREDICTED: PRKCA-binding protein [Oryctol...  95.5    4e-19
dbj|BAJ52889.1|  histone deacetylase 9 delta 7 [Rattus norvegi...  95.5    4e-19
ref|XP_005509285.1|  PREDICTED: histone deacetylase 4 isoform ...  95.9    4e-19
ref|XP_003966612.1|  PREDICTED: histone deacetylase 4-like [Ta...  95.9    4e-19
gb|KDQ21359.1|  hypothetical protein BOTBODRAFT_25795 [Botryob...  95.1    4e-19
ref|XP_007904062.1|  PREDICTED: histone deacetylase 4 isoform ...  95.9    4e-19
ref|XP_005509284.1|  PREDICTED: histone deacetylase 4 isoform ...  95.9    4e-19
ref|XP_005509286.1|  PREDICTED: histone deacetylase 4 isoform ...  95.9    4e-19
ref|XP_008034325.1|  histone deacetylase complex protein [Tram...  95.1    4e-19
ref|XP_004410503.1|  PREDICTED: histone deacetylase 4 [Odobenu...  95.9    4e-19
gb|EGI63924.1|  Histone deacetylase 4 [Acromyrmex echinatior]      95.5    4e-19
ref|XP_009025268.1|  hypothetical protein HELRODRAFT_95510 [He...  95.5    4e-19
ref|XP_004179035.1|  hypothetical protein TBLA_0B06950 [Tetrap...  95.5    4e-19
ref|WP_031384495.1|  histone deacetylase [Halomonas zincidurans]   92.8    4e-19
ref|WP_007291418.1|  histone deacetylase [delta proteobacteriu...  92.8    4e-19
ref|XP_007502816.1|  PREDICTED: histone deacetylase 10 isoform...  94.7    4e-19
ref|XP_001609345.1|  histone deacetylase [Babesia bovis T2Bo]      95.9    4e-19
gb|ETE70912.1|  Histone deacetylase 10 [Ophiophagus hannah]        94.4    4e-19
ref|XP_010155830.1|  PREDICTED: histone deacetylase 9-like [Eu...  93.6    4e-19
ref|XP_005995993.1|  PREDICTED: histone deacetylase 4 [Latimer...  95.5    4e-19
ref|XP_001991747.1|  GH11896 [Drosophila grimshawi]                95.9    4e-19
gb|ETE70668.1|  Histone deacetylase 9 [Ophiophagus hannah]         92.0    5e-19
ref|XP_003380638.1|  histone deacetylase family protein [Trich...  95.5    5e-19
ref|NP_001186974.1|  histone deacetylase 9 [Rattus norvegicus]     95.5    5e-19
gb|ETL94029.1|  hypothetical protein L917_07935 [Phytophthora ...  93.2    5e-19
emb|CDY42846.1|  BnaAnng06710D [Brassica napus]                    94.4    5e-19
ref|XP_006515326.1|  PREDICTED: histone deacetylase 9 isoform ...  95.5    5e-19
ref|XP_010359111.1|  PREDICTED: histone deacetylase 4 isoform ...  95.5    5e-19
gb|ENN79580.1|  hypothetical protein YQE_04042 [Dendroctonus p...  95.1    5e-19
ref|WP_006024074.1|  histone deacetylase [Burkholderia thailan...  92.8    5e-19
ref|XP_004700672.1|  PREDICTED: histone deacetylase 10 [Echino...  95.1    5e-19
ref|XP_008762838.1|  PREDICTED: histone deacetylase 9 isoform ...  95.5    5e-19
ref|WP_025175877.1|  histone deacetylase [Leptospira kirschneri]   92.0    5e-19
ref|WP_004769059.1|  histone deacetylase family protein [Lepto...  92.0    5e-19
ref|XP_008323193.1|  PREDICTED: histone deacetylase 4 [Cynoglo...  95.5    5e-19
ref|XP_002516301.1|  Histone deacetylase, putative [Ricinus co...  93.2    5e-19
ref|WP_015601181.1|  histone deacetylase-like amidohydrolase [...  92.4    5e-19
ref|XP_006515334.1|  PREDICTED: histone deacetylase 9 isoform ...  95.5    5e-19
ref|WP_025177111.1|  histone deacetylase [Leptospira kirschneri]   92.0    5e-19
ref|WP_025179233.1|  histone deacetylase [Leptospira kirschneri]   92.0    5e-19
gb|ESL08464.1|  histone deacetylase [Trypanosoma rangeli SC58]     94.7    5e-19
ref|XP_010345558.1|  PREDICTED: histone deacetylase 4 isoform ...  95.5    5e-19
ref|XP_009691392.1|  uncharacterized protein TOT_030000917 [Th...  95.5    5e-19
gb|EJO70205.1|  histone deacetylase family protein [Leptospira...  92.4    5e-19
ref|WP_004762338.1|  histone deacetylase family protein [Lepto...  92.0    5e-19
gb|ETP45353.1|  hypothetical protein F442_08233 [Phytophthora ...  92.8    5e-19
ref|WP_025183530.1|  histone deacetylase [Leptospira kirschneri]   92.0    5e-19
ref|XP_003875456.1|  putative histone deacetylase [Leishmania ...  94.7    5e-19
gb|EKP05399.1|  histone deacetylase family protein [Leptospira...  92.4    5e-19
ref|XP_009494958.1|  hypothetical protein H696_02785 [Fonticul...  95.5    6e-19
ref|XP_007310481.1|  histone deacetylase complex protein [Ster...  94.7    6e-19
ref|XP_006832294.1|  PREDICTED: histone deacetylase 9 isoform ...  95.5    6e-19
ref|XP_002128142.1|  PREDICTED: histone deacetylase 9 [Ciona i...  95.5    6e-19
ref|WP_029992537.1|  acetoin utilization protein [Sphingomonas...  92.4    6e-19
ref|XP_004427858.1|  PREDICTED: histone deacetylase 4 [Ceratot...  95.5    6e-19
gb|EMS64603.1|  hypothetical protein TRIUR3_22712 [Triticum ur...  92.0    6e-19
ref|XP_010345559.1|  PREDICTED: histone deacetylase 4 isoform ...  95.1    6e-19
gb|ETI47510.1|  hypothetical protein F443_08290 [Phytophthora ...  92.8    6e-19
gb|EFX85913.1|  hypothetical protein DAPPUDRAFT_98501 [Daphnia...  94.7    6e-19
ref|XP_009442959.1|  PREDICTED: histone deacetylase 4 isoform ...  95.1    6e-19
ref|XP_010359112.1|  PREDICTED: histone deacetylase 4 isoform ...  95.1    6e-19
ref|XP_008963891.1|  PREDICTED: histone deacetylase 4 isoform ...  95.1    6e-19
ref|XP_005964435.1|  PREDICTED: histone deacetylase 9 isoform ...  95.1    6e-19
ref|WP_012873515.1|  Histone deacetylase [Sphaerobacter thermo...  92.4    6e-19
ref|XP_006432170.1|  hypothetical protein CICLE_v10001184mg [C...  92.8    6e-19
ref|WP_006402227.1|  acetoin utilization protein [Burkholderia...  92.4    6e-19
ref|XP_006912031.1|  PREDICTED: histone deacetylase 9 isoform ...  95.1    6e-19
ref|XP_007843575.1|  histone deacetylase clr3 [Moniliophthora ...  94.4    7e-19
gb|ETO76228.1|  hypothetical protein F444_08351 [Phytophthora ...  92.8    7e-19
ref|XP_006832295.1|  PREDICTED: histone deacetylase 9 isoform ...  95.1    7e-19
ref|XP_010115812.1|  PREDICTED: histone deacetylase 9-like [Ch...  94.0    7e-19
ref|XP_005609303.1|  PREDICTED: histone deacetylase 9 isoform ...  95.1    7e-19
ref|XP_004377485.1|  PREDICTED: histone deacetylase 9 isoform ...  95.1    7e-19
ref|XP_006912032.1|  PREDICTED: histone deacetylase 9 isoform ...  95.1    7e-19
ref|WP_012213182.1|  acetoin utilization protein [Burkholderia...  92.4    7e-19
ref|XP_005532889.1|  PREDICTED: histone deacetylase 7 [Pseudop...  95.1    7e-19
ref|XP_004743437.1|  PREDICTED: histone deacetylase 9 isoform ...  95.1    7e-19
ref|WP_012050527.1|  acetoin utilization protein [Sphingomonas...  92.4    7e-19
pdb|4CBY|A  Chain A, Design, Synthesis, And Biological Evaluat...  92.4    7e-19
ref|XP_004163043.1|  PREDICTED: histone deacetylase 14-like [C...  93.2    7e-19
ref|XP_008934517.1|  PREDICTED: histone deacetylase 10 [Merops...  94.0    7e-19
ref|XP_004263508.1|  PREDICTED: histone deacetylase 9 isoform ...  95.1    7e-19
ref|WP_008291268.1|  histone deacetylase [Methylophaga thiooxy...  91.7    7e-19
ref|XP_004263507.1|  PREDICTED: histone deacetylase 9 isoform ...  95.1    7e-19
ref|XP_004148663.1|  PREDICTED: histone deacetylase 14-like [C...  93.2    7e-19
ref|XP_004818830.1|  PREDICTED: histone deacetylase 10 isoform...  94.7    7e-19
gb|AAM63340.1|  histone deacetylase, putative [Arabidopsis tha...  94.0    8e-19
ref|XP_006995519.1|  PREDICTED: histone deacetylase 4 [Peromys...  94.4    8e-19
ref|WP_023663811.1|  histone deacetylase [Rhodobacter sp. CACI...  92.0    8e-19
ref|XP_009040655.1|  hypothetical protein AURANDRAFT_3079 [Aur...  91.7    8e-19
ref|XP_007264065.1|  histone deacetylase clr3 [Fomitiporia med...  94.4    8e-19
ref|XP_008998030.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  94.7    8e-19
ref|NP_001030172.1|  histone deacetylase 10 [Rattus norvegicus]    94.0    8e-19
ref|XP_007007504.1|  hypothetical protein TREMEDRAFT_34982 [Tr...  94.4    8e-19
ref|XP_006760569.1|  PREDICTED: histone deacetylase 4 isoform ...  94.7    8e-19
ref|XP_006211779.1|  PREDICTED: histone deacetylase 9 isoform ...  94.7    8e-19
gb|EPQ11502.1|  Histone deacetylase 9 [Myotis brandtii]            94.7    8e-19
ref|XP_006211778.1|  PREDICTED: histone deacetylase 9 isoform ...  94.7    8e-19
gb|KFE62990.1|  Acetylspermidine deacetylase [Hyalangium minutum]  91.7    8e-19
ref|XP_002954155.1|  hypothetical protein VOLCADRAFT_106247 [V...  94.7    8e-19
ref|XP_005857777.1|  PREDICTED: histone deacetylase 4 isoform ...  94.7    8e-19
ref|WP_004444413.1|  histone deacetylase family protein [Lepto...  91.7    8e-19
ref|XP_006083050.1|  PREDICTED: histone deacetylase 4 [Myotis ...  94.7    8e-19
gb|EFB14770.1|  hypothetical protein PANDA_003385 [Ailuropoda ...  94.7    9e-19
ref|XP_006432171.1|  hypothetical protein CICLE_v10001184mg [C...  92.8    9e-19
ref|XP_004419002.1|  PREDICTED: histone deacetylase 9 isoform ...  94.7    9e-19
emb|CDS03167.1|  hypothetical protein LRAMOSA00569 [Absidia id...  94.0    9e-19
ref|WP_023504332.1|  putative deacetylase [uncultured archaeon...  91.7    9e-19
ref|WP_002188630.1|  histone deacetylase family protein [Lepto...  91.7    9e-19
ref|XP_008407566.1|  PREDICTED: histone deacetylase 7-like [Po...  94.7    9e-19
ref|XP_002071647.1|  GK25029 [Drosophila willistoni]               94.7    9e-19
ref|XP_004419003.1|  PREDICTED: histone deacetylase 9 isoform ...  94.7    1e-18
ref|XP_003382716.1|  PREDICTED: histone deacetylase 4-like [Am...  94.4    1e-18
ref|XP_006406594.1|  hypothetical protein EUTSA_v10020421mg [E...  93.6    1e-18
ref|WP_014041404.1|  acetoin utilization protein [Haloarcula h...  91.7    1e-18
ref|XP_005628657.1|  PREDICTED: histone deacetylase 9 isoform ...  94.7    1e-18
ref|XP_005198083.1|  PREDICTED: histone deacetylase 9 isoform ...  94.7    1e-18
ref|XP_003207165.1|  PREDICTED: histone deacetylase 9-like [Me...  94.7    1e-18
ref|XP_006671914.1|  histone deacetylase [Cordyceps militaris ...  94.0    1e-18
ref|XP_005816310.1|  PREDICTED: histone deacetylase 6-like [Xi...  94.4    1e-18
gb|EPQ02407.1|  Histone deacetylase 4 [Myotis brandtii]            94.7    1e-18
gb|EYU36034.1|  hypothetical protein MIMGU_mgv1a008061mg [Mimu...  92.0    1e-18
ref|XP_003540263.1|  PREDICTED: histone deacetylase 8-like iso...  91.7    1e-18
ref|XP_006909997.1|  PREDICTED: histone deacetylase 4 [Pteropu...  94.4    1e-18
ref|XP_005964437.1|  PREDICTED: histone deacetylase 9 isoform ...  94.4    1e-18
gb|EMT04688.1|  hypothetical protein F775_03495 [Aegilops taus...  92.0    1e-18
ref|XP_005198084.1|  PREDICTED: histone deacetylase 9 isoform ...  94.4    1e-18
ref|XP_007760353.1|  histone deacetylase 6/10 [Cladophialophor...  94.4    1e-18
tpg|DAA30776.1|  TPA: histone deacetylase 9-like [Bos taurus]      94.7    1e-18
gb|ETN74228.1|  histone deacetylase family protein [Necator am...  91.3    1e-18
ref|XP_005198076.1|  PREDICTED: histone deacetylase 9 isoform ...  94.4    1e-18
ref|XP_003214282.1|  PREDICTED: histone deacetylase 7-like [Me...  94.4    1e-18
ref|XP_006242280.1|  PREDICTED: histone deacetylase 10 isoform...  94.0    1e-18
ref|WP_008307674.1|  acetoin utilization protein/histone deace...  91.3    1e-18
ref|XP_005198077.1|  PREDICTED: histone deacetylase 9 isoform ...  94.4    1e-18
ref|XP_006242282.1|  PREDICTED: histone deacetylase 10 isoform...  93.6    1e-18
ref|XP_001655442.1|  histone deacetylase [Aedes aegypti]           94.4    1e-18
ref|WP_010885357.1|  hypothetical protein [Pyrococcus horikoshii]  91.3    1e-18
emb|CAD21239.1|  related to histone deacetylase A [Neurospora ...  94.0    1e-18
gb|EGT37079.1|  hypothetical protein CAEBREN_01541 [Caenorhabd...  93.2    1e-18
ref|WP_020765643.1|  histone deacetylase family protein [Lepto...  91.3    1e-18
ref|XP_005198079.1|  PREDICTED: histone deacetylase 9 isoform ...  94.4    1e-18
ref|XP_956974.2|  hypothetical protein NCU01525 [Neurospora cr...  94.0    1e-18
ref|XP_007804800.1|  hypothetical protein EPUS_01873 [Endocarp...  94.0    1e-18
gb|EWM27025.1|  histone deacetylase [Nannochloropsis gaditana]     94.4    1e-18
emb|CDL16769.1|  Deacetylases, including yeast histone deacety...  90.5    1e-18
gb|EPX75078.1|  histone deacetylase Clr3 [Schizosaccharomyces ...  93.6    1e-18
ref|XP_005005749.1|  PREDICTED: histone deacetylase 4 isoform ...  94.4    1e-18
gb|EFN68742.1|  Histone deacetylase 4 [Camponotus floridanus]      94.4    1e-18
gb|EUC66932.1|  histone deacetylase [Rhizoctonia solani AG-3 R...  93.2    1e-18
ref|WP_008230580.1|  histone deacetylase [Roseobacter sp. CCS2]    91.3    1e-18
ref|XP_004082033.1|  PREDICTED: histone deacetylase 4-like [Or...  94.4    1e-18
ref|XP_008146597.1|  PREDICTED: histone deacetylase 9 isoform ...  94.4    1e-18
ref|XP_006242281.1|  PREDICTED: histone deacetylase 10 isoform...  93.6    1e-18
ref|XP_005945566.1|  PREDICTED: histone deacetylase 4-like iso...  94.4    1e-18
ref|WP_002610784.1|  histone deacetylase/AcuC/AphA family prot...  93.2    1e-18
ref|XP_002596886.1|  hypothetical protein BRAFLDRAFT_103129 [B...  94.0    1e-18
gb|KFQ05784.1|  Histone deacetylase 4 [Haliaeetus albicilla]       94.0    1e-18
ref|XP_005646795.1|  hypothetical protein COCSUDRAFT_66525 [Co...  94.0    1e-18
gb|EAA27738.3|  histone deacetylase hda1 [Neurospora crassa OR...  94.0    1e-18
ref|WP_018808299.1|  hypothetical protein [Salinispora arenicola]  91.3    1e-18
ref|XP_008146590.1|  PREDICTED: histone deacetylase 9 isoform ...  94.0    1e-18
ref|XP_010221605.1|  PREDICTED: histone deacetylase 5-like [Ti...  91.3    1e-18
ref|XP_007205347.1|  hypothetical protein PRUPE_ppa007108mg [P...  91.7    1e-18
ref|XP_005945565.1|  PREDICTED: histone deacetylase 4-like iso...  94.0    1e-18
ref|XP_005752957.1|  PREDICTED: histone deacetylase 4-like iso...  94.0    1e-18
ref|XP_009181743.1|  PREDICTED: histone deacetylase 4 isoform ...  93.2    1e-18
ref|XP_005463142.1|  PREDICTED: histone deacetylase 4-like iso...  94.0    1e-18
emb|CDL59397.1|  Deacetylases, including yeast histone deacety...  90.5    1e-18
ref|XP_005668835.1|  PREDICTED: histone deacetylase 5 [Sus scr...  93.6    2e-18
ref|XP_006066836.1|  PREDICTED: histone deacetylase 4 isoform ...  94.0    2e-18
ref|WP_028671736.1|  histone deacetylase [Saccharospirillum im...  91.3    2e-18
ref|WP_032451762.1|  acetoin utilization protein [Klebsiella p...  90.5    2e-18
ref|XP_007944238.1|  PREDICTED: histone deacetylase 9 isoform ...  94.0    2e-18
ref|WP_014234753.1|  histone deacetylase [Vibrio sp. EJY3]         91.3    2e-18
ref|XP_004920406.1|  PREDICTED: histone deacetylase 6 isoform ...  94.4    2e-18
dbj|GAK09125.1|  deacetylase [Geomicrobium sp. JCM 19038]          90.9    2e-18
ref|XP_007944232.1|  PREDICTED: histone deacetylase 9 isoform ...  94.0    2e-18
ref|XP_007667044.1|  PREDICTED: histone deacetylase 4 isoform ...  94.0    2e-18
gb|AFW81805.1|  hypothetical protein ZEAMMB73_483858 [Zea mays]    93.2    2e-18
dbj|BAL56853.1|  histone deacetylase superfamily protein [uncu...  90.5    2e-18
ref|WP_025991353.1|  hypothetical protein [Burkholderia pseudo...  87.8    2e-18
ref|XP_002313479.1|  histone deacetylase family protein [Popul...  91.3    2e-18
ref|XP_005801316.1|  PREDICTED: histone deacetylase 4-like [Xi...  94.0    2e-18
ref|XP_005752956.1|  PREDICTED: histone deacetylase 4-like iso...  94.0    2e-18
ref|XP_003699345.1|  PREDICTED: histone deacetylase 4-like [Me...  94.0    2e-18
ref|XP_009898402.1|  PREDICTED: histone deacetylase 9 isoform ...  94.0    2e-18
ref|YP_007993001.1|  unnamed protein product [Klebsiella pneum...  93.2    2e-18
ref|XP_009898403.1|  PREDICTED: histone deacetylase 9 isoform ...  94.0    2e-18
ref|WP_014126906.1|  acetylpolyamine aminohydrolase [Thermopro...  90.9    2e-18
ref|XP_010263005.1|  PREDICTED: histone deacetylase 8 [Nelumbo...  91.3    2e-18
ref|WP_014346423.1|  acetylpolyamine aminohydrolase [Pyrobacul...  90.9    2e-18
ref|XP_005945564.1|  PREDICTED: histone deacetylase 4-like iso...  94.0    2e-18
ref|XP_005945563.1|  PREDICTED: histone deacetylase 4-like iso...  94.0    2e-18
ref|XP_005752955.1|  PREDICTED: histone deacetylase 4-like iso...  94.0    2e-18
ref|XP_004702891.1|  PREDICTED: histone deacetylase 9 [Echinop...  93.6    2e-18
ref|XP_009851950.1|  hypothetical protein NEUTE1DRAFT_147039 [...  93.6    2e-18
gb|EEW42327.1|  transporter, major facilitator family protein ...  93.2    2e-18
ref|XP_008463635.1|  PREDICTED: histone deacetylase 8 [Cucumis...  91.3    2e-18
gb|EMS59835.1|  hypothetical protein TRIUR3_12332 [Triticum ur...  90.9    2e-18
ref|WP_011900818.1|  acetylpolyamine aminohydrolase [Pyrobacul...  90.9    2e-18
gb|EHB08744.1|  Histone deacetylase 4 [Heterocephalus glaber]      94.0    2e-18
ref|XP_005463141.1|  PREDICTED: histone deacetylase 4-like iso...  94.0    2e-18
ref|XP_005377402.1|  PREDICTED: histone deacetylase 9 isoform ...  94.0    2e-18
gb|EGT51521.1|  hypothetical protein CAEBREN_05118 [Caenorhabd...  92.4    2e-18
ref|XP_005377403.1|  PREDICTED: histone deacetylase 9 isoform ...  94.0    2e-18
ref|XP_005377404.1|  PREDICTED: histone deacetylase 9 isoform ...  94.0    2e-18
ref|XP_004893621.1|  PREDICTED: histone deacetylase 4 [Heteroc...  94.0    2e-18
ref|XP_006729552.1|  PREDICTED: histone deacetylase 9 isoform ...  93.6    2e-18
ref|XP_009929660.1|  PREDICTED: histone deacetylase 9 isoform ...  93.6    2e-18
gb|KFQ56108.1|  Histone deacetylase 4 [Nestor notabilis]           93.6    2e-18
gb|EJT49913.1|  histone deacetylase clr3 [Trichosporon asahii ...  93.2    2e-18
gb|KFO25099.1|  Histone deacetylase 9 [Fukomys damarensis]         93.6    2e-18
ref|WP_015724951.1|  histone deacetylase superfamily protein [...  90.5    2e-18
ref|XP_006417687.1|  hypothetical protein EUTSA_v10007924mg [E...  90.9    2e-18
ref|XP_003005704.1|  histone deacetylase clr3 [Verticillium al...  90.9    2e-18
ref|XP_008327281.1|  PREDICTED: histone deacetylase 4-like [Cy...  93.6    2e-18
ref|XP_002162824.2|  PREDICTED: histone deacetylase 4-like [Hy...  91.7    2e-18
ref|XP_007420614.1|  PREDICTED: histone deacetylase 9-like [Py...  91.7    2e-18
ref|XP_006520601.1|  PREDICTED: histone deacetylase 10 isoform...  93.2    2e-18
gb|EKC98996.1|  histone deacetylase clr3 [Trichosporon asahii ...  93.2    2e-18
gb|KFK29968.1|  hypothetical protein AALP_AA7G200700 [Arabis a...  91.7    2e-18
ref|XP_006729551.1|  PREDICTED: histone deacetylase 9 isoform ...  93.6    2e-18
ref|XP_008051087.1|  PREDICTED: histone deacetylase 4 isoform ...  93.6    2e-18
ref|XP_004575251.1|  PREDICTED: histone deacetylase 4-like iso...  93.6    2e-18
ref|XP_641762.1|  histone deacetylase family protein [Dictyost...  94.0    2e-18
ref|XP_005463140.1|  PREDICTED: histone deacetylase 4-like iso...  93.6    2e-18
ref|XP_004575250.1|  PREDICTED: histone deacetylase 4-like iso...  93.6    2e-18
ref|XP_004575248.1|  PREDICTED: histone deacetylase 4-like iso...  93.6    2e-18
ref|XP_005463138.1|  PREDICTED: histone deacetylase 4-like iso...  93.6    2e-18
ref|XP_005235690.1|  PREDICTED: histone deacetylase 9 isoform ...  93.6    2e-18
ref|XP_005445157.1|  PREDICTED: histone deacetylase 9 isoform ...  93.6    2e-18
ref|XP_008476467.1|  PREDICTED: histone deacetylase 6-like [Di...  92.8    2e-18
ref|WP_019878554.1|  hypothetical protein [Succinispira mobilis]   91.7    2e-18
ref|WP_007189364.1|  acetoin utilization protein [Haloarcula c...  90.5    2e-18
gb|KDP32483.1|  hypothetical protein JCGZ_13408 [Jatropha curcas]  90.9    2e-18
ref|XP_008051088.1|  PREDICTED: histone deacetylase 4 isoform ...  93.2    2e-18
ref|WP_004958955.1|  acetoin utilization protein [Haloarcula s...  90.5    2e-18
ref|XP_005411233.1|  PREDICTED: histone deacetylase 4 isoform ...  93.6    2e-18
ref|WP_007292378.1|  histone deacetylase [delta proteobacteriu...  90.5    2e-18
ref|XP_007740894.1|  histone deacetylase 6/10 [Cladophialophor...  93.2    2e-18
ref|XP_006856677.1|  hypothetical protein AMTR_s00054p00095350...  90.5    2e-18
gb|EAY56724.1|  probable histone deacetylase family protein [L...  89.7    2e-18
ref|XP_007244453.1|  PREDICTED: histone deacetylase 4-like [As...  93.2    3e-18
gb|ERL86900.1|  hypothetical protein D910_04303 [Dendroctonus ...  92.8    3e-18
ref|XP_005535929.1|  similar to acetylpolyamine aminohydolase ...  91.3    3e-18
ref|XP_415986.4|  PREDICTED: histone deacetylase 10 [Gallus ga...  92.8    3e-18
dbj|BAE27070.1|  unnamed protein product [Mus musculus]            92.0    3e-18
ref|WP_013775855.1|  deacetylase [Acidianus hospitalis]            90.1    3e-18
ref|XP_763640.1|  histone deacetylase [Theileria parva strain ...  92.8    3e-18
gb|KFP77986.1|  Histone deacetylase 10 [Apaloderma vittatum]       87.0    3e-18
gb|KGN66560.1|  hypothetical protein Csa_1G629170 [Cucumis sat...  90.1    3e-18
ref|XP_004139506.1|  PREDICTED: histone deacetylase 8-like [Cu...  90.5    3e-18
gb|EHB14700.1|  Histone deacetylase 9 [Heterocephalus glaber]      93.2    3e-18
ref|XP_004839640.1|  PREDICTED: histone deacetylase 9 isoform ...  93.2    3e-18
gb|KFP30388.1|  Histone deacetylase 9 [Colius striatus]            93.2    3e-18
ref|XP_005233133.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  93.2    3e-18
ref|XP_005480903.1|  PREDICTED: histone deacetylase 9 isoform ...  93.2    3e-18
ref|WP_011048885.1|  histone deacetylase [Ruegeria pomeroyi]       90.5    3e-18
gb|EGV98579.1|  Histone deacetylase 4 [Cricetulus griseus]         93.2    3e-18
ref|XP_008613229.1|  hypothetical protein SDRG_09094 [Saproleg...  93.6    3e-18
ref|WP_002180525.1|  histone deacetylase family protein [Lepto...  90.1    3e-18
ref|WP_011876166.1|  histone deacetylase [Burkholderia vietnam...  90.5    3e-18
gb|AIO75501.1|  histone deacetylase domain protein [Burkholder...  90.5    3e-18
ref|XP_007574513.1|  PREDICTED: histone deacetylase 4 isoform ...  93.2    3e-18
gb|EPQ64582.1|  hypothetical protein BGT96224_5289 [Blumeria g...  90.9    3e-18
ref|XP_005518914.1|  PREDICTED: histone deacetylase 9 isoform ...  93.2    3e-18
gb|KGB97817.1|  histone deacetylase domain protein [Burkholder...  90.5    3e-18
ref|XP_008400568.1|  PREDICTED: histone deacetylase 6 [Poecili...  93.2    3e-18
ref|WP_011762136.1|  acetylpolyamine aminohydrolase [Pyrobacul...  90.1    3e-18
ref|XP_009460372.1|  PREDICTED: histone deacetylase 9 isoform ...  93.2    3e-18
ref|XP_010359113.1|  PREDICTED: histone deacetylase 4 isoform ...  93.2    3e-18
ref|XP_009993252.1|  PREDICTED: histone deacetylase 9 isoform ...  93.2    3e-18
ref|XP_004903360.1|  PREDICTED: histone deacetylase 9 isoform ...  93.2    3e-18
ref|XP_641298.1|  FYVE-type zinc finger-containing protein [Di...  93.2    3e-18
ref|XP_004159105.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  90.5    3e-18
ref|XP_007574511.1|  PREDICTED: histone deacetylase 4 isoform ...  93.2    3e-18
gb|EMT31322.1|  hypothetical protein F775_27113 [Aegilops taus...  92.4    3e-18
gb|EMC81633.1|  Histone deacetylase 9 [Columba livia]              93.2    3e-18
ref|XP_010196831.1|  PREDICTED: histone deacetylase 9 isoform ...  93.2    3e-18
ref|WP_010157731.1|  histone deacetylase [Leucobacter chromiir...  90.5    3e-18
ref|NP_595104.1|  histone deacetylase (class II) Clr3 [Schizos...  92.4    3e-18
ref|XP_007733613.1|  histone deacetylase 6/10 [Capronia epimyc...  92.8    3e-18
ref|XP_009993254.1|  PREDICTED: histone deacetylase 9 isoform ...  93.2    3e-18
ref|XP_009460373.1|  PREDICTED: histone deacetylase 9 isoform ...  93.2    3e-18
ref|XP_007505478.1|  PREDICTED: histone deacetylase 9 isoform ...  92.8    3e-18
gb|KFQ94671.1|  Histone deacetylase 9 [Nipponia nippon]            92.8    3e-18
ref|XP_004291676.1|  PREDICTED: histone deacetylase 8-like [Fr...  90.5    3e-18
ref|XP_008053077.1|  PREDICTED: histone deacetylase 9 isoform ...  92.8    3e-18
gb|EMP33741.1|  Histone deacetylase 5 [Chelonia mydas]             93.2    3e-18
ref|XP_008053078.1|  PREDICTED: histone deacetylase 9 isoform ...  92.8    3e-18
ref|NP_001026152.2|  histone deacetylase 9 [Gallus gallus]         92.8    4e-18
ref|XP_009272680.1|  PREDICTED: histone deacetylase 7 isoform ...  92.8    4e-18
ref|XP_006245503.1|  PREDICTED: histone deacetylase 4 isoform ...  93.2    4e-18
ref|XP_007965051.1|  PREDICTED: histone deacetylase 4 isoform ...  92.8    4e-18
gb|KFU87605.1|  Histone deacetylase 9 [Chaetura pelagica]          92.8    4e-18
ref|XP_001567864.1|  putative histone deacetylase [Leishmania ...  92.0    4e-18
ref|XP_006529372.1|  PREDICTED: histone deacetylase 4 isoform ...  92.8    4e-18
ref|WP_008169546.1|  histone deacetylase [Marinobacter mangano...  90.1    4e-18
ref|XP_005510994.1|  PREDICTED: histone deacetylase 9 isoform ...  92.8    4e-18
ref|XP_008230191.1|  PREDICTED: histone deacetylase 8 [Prunus ...  90.1    4e-18
ref|XP_007542297.1|  PREDICTED: histone deacetylase 6 [Poecili...  92.8    4e-18
ref|XP_005510995.1|  PREDICTED: histone deacetylase 9 isoform ...  92.8    4e-18
ref|XP_006771168.1|  PREDICTED: histone deacetylase 10 [Myotis...  92.4    4e-18
ref|WP_013332634.1|  histone deacetylase [Halomonas elongata]      90.1    4e-18
emb|CDP06851.1|  unnamed protein product [Coffea canephora]        89.7    4e-18
ref|XP_006245504.1|  PREDICTED: histone deacetylase 4 isoform ...  92.8    4e-18
ref|XP_005480904.1|  PREDICTED: histone deacetylase 9 isoform ...  92.8    4e-18
ref|XP_009272679.1|  PREDICTED: histone deacetylase 7 isoform ...  92.8    4e-18
ref|XP_008963892.1|  PREDICTED: histone deacetylase 4 isoform ...  92.8    4e-18
ref|WP_015052410.1|  histone deacetylase superfamily [Methanol...  89.7    4e-18
ref|WP_021057687.1|  putative deacetylase [Haloquadratum sp. J...  89.7    4e-18
ref|XP_008628179.1|  PREDICTED: histone deacetylase 9 isoform ...  92.8    4e-18
ref|WP_007922914.1|  Histone deacetylase [Ktedonobacter racemi...  90.1    4e-18
gb|KFM01221.1|  Histone deacetylase 4 [Aptenodytes forsteri]       92.8    4e-18
ref|NP_001026573.1|  histone deacetylase 7 [Gallus gallus]         92.8    4e-18
ref|XP_009993253.1|  PREDICTED: histone deacetylase 9 isoform ...  92.8    4e-18
ref|XP_001934032.1|  histone deacetylase 4 [Pyrenophora tritic...  92.4    4e-18
ref|XP_003813136.1|  PREDICTED: histone deacetylase 4 isoform ...  92.8    4e-18
ref|XP_007965059.1|  PREDICTED: histone deacetylase 4 isoform ...  92.8    4e-18
gb|AAD29046.1|AF132607_1  histone deacetylase 4 [Homo sapiens]     92.8    4e-18
ref|NP_006028.2|  histone deacetylase 4 [Homo sapiens]             92.8    4e-18
ref|XP_003936809.1|  PREDICTED: histone deacetylase 4 isoform ...  92.8    4e-18
ref|XP_004033491.1|  PREDICTED: histone deacetylase 4 [Gorilla...  92.8    4e-18
ref|XP_010359110.1|  PREDICTED: histone deacetylase 4 isoform ...  92.8    4e-18
gb|EMS56138.1|  hypothetical protein TRIUR3_18154 [Triticum ur...  90.5    4e-18
ref|XP_005361735.1|  PREDICTED: histone deacetylase 4 isoform ...  92.8    4e-18
ref|XP_007965054.1|  PREDICTED: histone deacetylase 4 isoform ...  92.8    4e-18
ref|XP_010207418.1|  PREDICTED: histone deacetylase 5-like [Co...  90.5    4e-18
emb|CDI53179.1|  related to HDA1-histone deacetylase A [Melano...  92.4    4e-18
gb|EAW93704.1|  histone deacetylase 9, isoform CRA_d [Homo sap...  92.4    4e-18
ref|WP_012808090.1|  acetoin utilization protein [Halomicrobiu...  89.7    4e-18
gb|KEQ78941.1|  histone deacetylase HdaA [Aureobasidium pullul...  92.4    4e-18
gb|ETO23663.1|  hypothetical protein RFI_13517 [Reticulomyxa f...  92.8    4e-18
gb|ERH13363.1|  putative deacetylase [halophilic archaeon J07H...  89.7    4e-18
ref|XP_003788531.1|  PREDICTED: histone deacetylase 9 [Otolemu...  92.8    4e-18
ref|XP_009442958.1|  PREDICTED: histone deacetylase 4 isoform ...  92.8    4e-18
ref|WP_006417240.1|  acetoin utilization protein [Burkholderia...  90.1    4e-18
ref|XP_009450996.1|  PREDICTED: histone deacetylase 9 isoform ...  92.8    5e-18
ref|XP_006529367.1|  PREDICTED: histone deacetylase 4 isoform ...  92.8    5e-18
ref|XP_009450991.1|  PREDICTED: histone deacetylase 9 isoform ...  92.4    5e-18
gb|KGR93559.1|  histone deacetylase-like amidohydrolase [Burkh...  89.7    5e-18
gb|ELW61672.1|  Histone deacetylase 9 [Tupaia chinensis]           92.8    5e-18
ref|XP_007062064.1|  PREDICTED: histone deacetylase 5 [Cheloni...  92.0    5e-18
ref|XP_009450990.1|  PREDICTED: histone deacetylase 9 isoform ...  92.8    5e-18
ref|XP_007069566.1|  PREDICTED: histone deacetylase 9 isoform ...  92.8    5e-18
ref|XP_005152921.1|  PREDICTED: histone deacetylase 9 isoform ...  92.4    5e-18
ref|XP_009451001.1|  PREDICTED: histone deacetylase 9 isoform ...  92.4    5e-18
ref|XP_009804419.1|  PREDICTED: histone deacetylase 8 isoform ...  89.7    5e-18
ref|XP_007965058.1|  PREDICTED: histone deacetylase 4 isoform ...  92.4    5e-18
ref|XP_010019979.1|  PREDICTED: histone deacetylase 4 [Nestor ...  92.4    5e-18
gb|EMP27930.1|  Histone deacetylase 7 [Chelonia mydas]             92.4    5e-18
ref|WP_026268704.1|  acetoin utilization protein [Micromonospo...  89.7    5e-18
ref|XP_003666818.1|  histone deacetylase A-like protein [Mycel...  92.0    5e-18
ref|XP_009450985.1|  PREDICTED: histone deacetylase 9 isoform ...  92.4    5e-18
gb|KGW19070.1|  histone deacetylase domain protein [Burkholder...  89.7    5e-18
ref|XP_009450994.1|  PREDICTED: histone deacetylase 9 isoform ...  92.4    5e-18
ref|WP_019255822.1|  acetoin utilization protein [Burkholderia...  89.4    5e-18
ref|XP_006529370.1|  PREDICTED: histone deacetylase 4 isoform ...  92.4    5e-18
ref|WP_027961423.1|  acetoin utilization protein [Halomonas ha...  89.7    5e-18
gb|KDN45498.1|  hypothetical protein RSAG8_04822 [Rhizoctonia ...  92.0    5e-18
ref|XP_005574859.1|  PREDICTED: histone deacetylase 4 [Macaca ...  92.4    5e-18
ref|XP_009450997.1|  PREDICTED: histone deacetylase 9 isoform ...  92.4    5e-18
ref|XP_010281728.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  92.4    5e-18
ref|WP_019503101.1|  hypothetical protein [Pseudanabaena sp. P...  89.4    5e-18
ref|XP_003508340.1|  PREDICTED: histone deacetylase 4 isoform ...  92.4    5e-18
ref|XP_001418630.1|  predicted protein [Ostreococcus lucimarin...  90.9    5e-18
ref|XP_009491004.1|  PREDICTED: histone deacetylase 7 [Pelecan...  92.4    5e-18
ref|WP_011224138.1|  acetoin utilization protein [Haloarcula m...  89.4    5e-18
emb|CCA72749.1|  related to HDA1-histone deacetylase A [Pirifo...  92.0    5e-18
ref|XP_009450987.1|  PREDICTED: histone deacetylase 9 isoform ...  92.4    5e-18
ref|XP_009450992.1|  PREDICTED: histone deacetylase 9 isoform ...  92.4    5e-18
ref|XP_009450989.1|  PREDICTED: histone deacetylase 9 isoform ...  92.4    5e-18
gb|KFV84353.1|  Histone deacetylase 9 [Struthio camelus austra...  92.4    5e-18
ref|XP_009554470.1|  PREDICTED: histone deacetylase 7 [Cuculus...  92.4    5e-18
ref|XP_002922520.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  92.4    5e-18
ref|XP_004536130.1|  PREDICTED: histone deacetylase 4-like iso...  92.4    5e-18
ref|XP_005152922.1|  PREDICTED: histone deacetylase 9 isoform ...  92.4    5e-18
ref|XP_009450986.1|  PREDICTED: histone deacetylase 9 isoform ...  92.4    5e-18
gb|EKG19671.1|  Histone deacetylase superfamily [Macrophomina ...  92.4    5e-18
ref|XP_006821757.1|  PREDICTED: uncharacterized protein LOC102...  92.8    5e-18
ref|WP_011822008.1|  histone deacetylase [Hyperthermus butylicus]  89.7    5e-18
ref|XP_007069567.1|  PREDICTED: histone deacetylase 9 isoform ...  92.4    5e-18
ref|XP_009679089.1|  PREDICTED: histone deacetylase 9 isoform ...  92.4    5e-18
gb|EGX47416.1|  hypothetical protein AOL_s00083g509 [Arthrobot...  92.0    6e-18
ref|XP_009679091.1|  PREDICTED: histone deacetylase 9 isoform ...  92.4    6e-18
ref|XP_005139661.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  92.4    6e-18
gb|AFQ01097.1|  histone deacetylase 4 [Glossina morsitans mors...  92.4    6e-18
ref|XP_001591174.1|  hypothetical protein SS1G_07799 [Scleroti...  92.0    6e-18
ref|XP_006465060.1|  PREDICTED: histone deacetylase 14-like is...  90.5    6e-18
ref|XP_009679086.1|  PREDICTED: histone deacetylase 9 isoform ...  92.4    6e-18
ref|XP_004536125.1|  PREDICTED: histone deacetylase 4-like iso...  92.4    6e-18
emb|CDW84780.1|  histone deacetylase family protein [Stylonych...  89.4    6e-18
ref|NP_741051.1|  Protein HDA-5 [Caenorhabditis elegans]           91.3    6e-18
ref|XP_008185951.1|  PREDICTED: histone deacetylase 4 isoform ...  92.4    6e-18
ref|XP_005312413.1|  PREDICTED: histone deacetylase 7 isoform ...  92.0    6e-18
ref|XP_004536129.1|  PREDICTED: histone deacetylase 4-like iso...  92.4    6e-18
emb|CCU80714.1|  histone deacetylase hda1 [Blumeria graminis f...  91.7    6e-18
ref|XP_009679090.1|  PREDICTED: histone deacetylase 9 isoform ...  92.4    6e-18
ref|WP_014961936.1|  histone deacetylase family protein [Lepto...  89.4    6e-18
ref|XP_009679088.1|  PREDICTED: histone deacetylase 9 isoform ...  92.4    6e-18
ref|WP_027287462.1|  acetylpolyamine aminohydrolase [Rhodovibr...  89.4    6e-18
ref|XP_004536128.1|  PREDICTED: histone deacetylase 4-like iso...  92.4    6e-18
ref|XP_005015198.1|  PREDICTED: histone deacetylase 9 isoform ...  92.4    6e-18
ref|NP_445901.1|  histone deacetylase 4 [Rattus norvegicus]        92.4    6e-18
ref|XP_008597855.1|  histone deacetylase [Beauveria bassiana A...  92.0    6e-18
ref|XP_009881482.1|  PREDICTED: histone deacetylase 7 [Charadr...  92.0    6e-18
ref|XP_005015199.1|  PREDICTED: histone deacetylase 9 isoform ...  92.4    6e-18
ref|XP_004045188.1|  PREDICTED: histone deacetylase 9 isoform ...  92.4    6e-18
gb|AIA31151.1|  histone deacetylase [Leptospirillum ferriphilu...  89.0    6e-18
ref|XP_006621398.1|  PREDICTED: histone deacetylase 5-like iso...  92.0    6e-18
ref|XP_003938731.1|  PREDICTED: histone deacetylase 9 isoform ...  92.4    6e-18
ref|XP_005312414.1|  PREDICTED: histone deacetylase 7 isoform ...  92.0    6e-18
ref|XP_006621397.1|  PREDICTED: histone deacetylase 5-like iso...  92.0    6e-18
ref|XP_008185948.1|  PREDICTED: histone deacetylase 4 isoform ...  92.0    6e-18
ref|XP_004069331.1|  PREDICTED: histone deacetylase 7-like [Or...  92.0    6e-18
ref|WP_011402267.1|  acetoin utilization protein [Burkholderia...  89.4    6e-18
gb|KEQ60820.1|  histone deacetylase clr3 [Aureobasidium melano...  91.7    7e-18
ref|XP_008160873.1|  PREDICTED: histone deacetylase 5 isoform ...  92.0    7e-18
ref|XP_006570516.1|  PREDICTED: histone deacetylase 5 isoform ...  92.0    7e-18
ref|XP_001945475.2|  PREDICTED: histone deacetylase 4 isoform ...  92.0    7e-18
gb|KGQ09057.1|  Histone deacetylase clr3 [Beauveria bassiana D...  91.7    7e-18
ref|XP_006570515.1|  PREDICTED: histone deacetylase 5 isoform ...  92.0    7e-18
ref|XP_006621392.1|  PREDICTED: histone deacetylase 5-like iso...  92.0    7e-18
ref|XP_003962963.1|  PREDICTED: histone deacetylase 6-like [Ta...  92.0    7e-18
ref|XP_009644308.1|  PREDICTED: histone deacetylase 7 [Egretta...  92.0    7e-18
gb|EYB92276.1|  hypothetical protein Y032_0196g1545 [Ancylosto...  91.7    7e-18
ref|XP_008185942.1|  PREDICTED: histone deacetylase 4 isoform ...  92.0    7e-18
ref|WP_009890596.1|  acetoin utilization protein [Burkholderia...  89.4    7e-18
ref|XP_004602293.1|  PREDICTED: histone deacetylase 9 isoform ...  92.0    7e-18
gb|EMT62397.1|  Histone deacetylase clr3 [Fusarium oxysporum f...  91.7    7e-18
ref|WP_025058505.1|  acetoin utilization protein [Sulfitobacte...  89.4    7e-18
ref|XP_008185947.1|  PREDICTED: histone deacetylase 4 isoform ...  92.0    7e-18
ref|XP_008185946.1|  PREDICTED: histone deacetylase 4 isoform ...  92.0    7e-18
ref|XP_006570507.1|  PREDICTED: histone deacetylase 5 isoform ...  92.0    7e-18
ref|XP_008185949.1|  PREDICTED: histone deacetylase 4 isoform ...  92.0    7e-18
ref|XP_009673657.1|  PREDICTED: histone deacetylase 7 isoform ...  92.0    7e-18
ref|XP_391882.3|  PREDICTED: histone deacetylase 5 isoform X11...  92.0    7e-18
ref|XP_007980131.1|  PREDICTED: histone deacetylase 9 isoform ...  92.0    7e-18
ref|XP_006621390.1|  PREDICTED: histone deacetylase 5-like iso...  92.0    7e-18
ref|XP_006570508.1|  PREDICTED: histone deacetylase 5 isoform ...  92.0    7e-18
ref|WP_011343211.1|  histone deacetylase [Carboxydothermus hyd...  90.1    7e-18
ref|XP_006621391.1|  PREDICTED: histone deacetylase 5-like iso...  92.0    7e-18
ref|XP_006621393.1|  PREDICTED: histone deacetylase 5-like iso...  92.0    7e-18
ref|XP_008259719.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  92.0    7e-18
ref|XP_003489740.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  92.0    7e-18
ref|XP_003693215.1|  PREDICTED: histone deacetylase 4-like [Ap...  92.0    7e-18
ref|XP_003825075.1|  PREDICTED: histone deacetylase 9 isoform ...  92.0    7e-18
gb|KFP21847.1|  Histone deacetylase 7 [Egretta garzetta]           92.0    7e-18
dbj|BAE33147.1|  unnamed protein product [Mus musculus]            92.0    7e-18
ref|XP_004045189.1|  PREDICTED: histone deacetylase 9 isoform ...  92.0    7e-18
ref|XP_006570509.1|  PREDICTED: histone deacetylase 5 isoform ...  92.0    7e-18
ref|NP_848510.1|  histone deacetylase 9 isoform 4 [Homo sapiens]   92.0    7e-18
ref|XP_009804418.1|  PREDICTED: histone deacetylase 8 isoform ...  89.7    7e-18
gb|EWG52663.1|  histone deacetylase 6/10 [Fusarium verticillio...  91.7    7e-18
ref|XP_003252666.1|  PREDICTED: histone deacetylase 9 isoform ...  92.0    7e-18
ref|XP_007667032.1|  PREDICTED: histone deacetylase 4 isoform ...  92.0    7e-18
ref|XP_001104451.2|  PREDICTED: histone deacetylase 9-like iso...  92.0    7e-18
ref|XP_007980140.1|  PREDICTED: histone deacetylase 9 isoform ...  92.0    8e-18
ref|XP_001151044.2|  PREDICTED: histone deacetylase 9 isoform ...  92.0    8e-18
ref|XP_001103866.2|  PREDICTED: histone deacetylase 9-like iso...  92.0    8e-18
ref|XP_005991333.1|  PREDICTED: histone deacetylase 9 isoform ...  92.0    8e-18
ref|NP_997108.1|  histone deacetylase 4 [Mus musculus]             92.0    8e-18
ref|WP_015161988.1|  deacetylase, histone deacetylase/acetoin ...  88.6    8e-18
gb|EYB92277.1|  hypothetical protein Y032_0196g1545 [Ancylosto...  91.7    8e-18
gb|EAW57958.1|  histone deacetylase 7A, isoform CRA_g [Homo sa...  89.7    8e-18
ref|XP_009844838.1|  hypothetical protein, variant [Aphanomyce...  91.3    8e-18
emb|CCW65457.1|  unnamed protein product [Phytomonas sp. isola...  91.3    8e-18
ref|XP_009648071.1|  histone deacetylase clr3 [Verticillium da...  91.7    8e-18
ref|XP_009673654.1|  PREDICTED: histone deacetylase 7 isoform ...  92.0    8e-18
ref|XP_005436176.1|  PREDICTED: histone deacetylase 7 [Falco c...  91.7    8e-18
ref|XP_010118791.1|  PREDICTED: histone deacetylase 7 [Chlamyd...  91.7    8e-18
gb|EFX72406.1|  histone deacetylase HDAC4 protein-like protein...  92.0    8e-18
ref|XP_007707245.1|  hypothetical protein COCCADRAFT_82967 [Bi...  91.7    8e-18
gb|KFH65404.1|  histone deacetylase 4/5 [Mortierella verticill...  92.0    8e-18
ref|XP_009844839.1|  hypothetical protein H257_17669 [Aphanomy...  91.7    8e-18
gb|EMD87492.1|  hypothetical protein COCHEDRAFT_1145200 [Bipol...  91.7    8e-18
ref|XP_005550089.1|  PREDICTED: histone deacetylase 9 isoform ...  91.7    8e-18
ref|WP_011993959.1|  histone deacetylase [Fervidobacterium nod...  88.6    9e-18
gb|KFP01779.1|  Histone deacetylase 4 [Calypte anna]               91.7    9e-18
pdb|3C0Y|A  Chain A, Crystal Structure Of Catalytic Domain Of ...  89.7    9e-18
ref|WP_033428646.1|  histone deacetylase [Saccharothrix syringae]  89.0    9e-18
ref|XP_005550085.1|  PREDICTED: histone deacetylase 9 isoform ...  91.7    9e-18
ref|WP_016140206.1|  hypothetical protein [Acinetobacter pittii]   89.0    9e-18
gb|EWY84947.1|  histone deacetylase 6/10 [Fusarium oxysporum F...  91.3    9e-18
gb|EXM05969.1|  histone deacetylase 6/10 [Fusarium oxysporum f...  91.3    9e-18
ref|WP_012186984.1|  histone deacetylase superfamily protein [...  89.0    9e-18
ref|XP_009462554.1|  PREDICTED: histone deacetylase 7 [Nipponi...  91.7    9e-18
emb|CEG77575.1|  hypothetical protein RMATCC62417_12296 [Rhizo...  89.4    9e-18
ref|NP_001034447.2|  histone deacetylase 4 [Danio rerio]           91.7    9e-18
gb|EXA37523.1|  histone deacetylase 6/10 [Fusarium oxysporum f...  91.3    9e-18
ref|XP_009215834.1|  PREDICTED: histone deacetylase 10 isoform...  91.3    9e-18
ref|XP_005515473.1|  PREDICTED: histone deacetylase 7 isoform ...  91.7    9e-18
emb|CDS03599.1|  hypothetical protein LRAMOSA01001 [Absidia id...  90.9    9e-18
ref|XP_005515475.1|  PREDICTED: histone deacetylase 7 isoform ...  91.7    9e-18
ref|WP_015285873.1|  deacetylase, histone deacetylase/acetoin ...  89.0    9e-18
ref|XP_008684588.1|  PREDICTED: histone deacetylase 9 [Ursus m...  91.7    9e-18
ref|XP_007572268.1|  PREDICTED: histone deacetylase 4-like [Po...  91.7    9e-18
gb|AHI65381.1|  histone deacetylase-like amidohydrolase [Burkh...  89.0    9e-18
ref|XP_006760567.1|  PREDICTED: histone deacetylase 4 isoform ...  91.7    9e-18
ref|XP_006760568.1|  PREDICTED: histone deacetylase 4 isoform ...  91.7    1e-17
ref|XP_008285553.1|  PREDICTED: histone deacetylase 4-like [St...  91.7    1e-17
ref|XP_007256448.1|  PREDICTED: histone deacetylase 4 [Astyana...  91.7    1e-17
ref|WP_011325645.1|  acetoin utilization protein [Burkholderia...  88.6    1e-17
ref|WP_009904948.1|  acetoin utilization protein [Burkholderia...  89.0    1e-17
ref|XP_007704863.1|  hypothetical protein COCSADRAFT_41143 [Bi...  91.3    1e-17
gb|EWZ35394.1|  histone deacetylase 6/10 [Fusarium oxysporum F...  90.9    1e-17
gb|ETO85879.1|  hypothetical protein F444_00507 [Phytophthora ...  91.3    1e-17
ref|WP_006827019.1|  histone deacetylase [Natrialba taiwanensis]   89.0    1e-17
dbj|BAG54670.1|  unnamed protein product [Homo sapiens]            89.7    1e-17
ref|XP_005021622.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  91.7    1e-17
ref|XP_004743790.1|  PREDICTED: histone deacetylase 4 isoform ...  91.7    1e-17
ref|XP_005181281.1|  PREDICTED: histone deacetylase 4-like iso...  91.7    1e-17
ref|WP_006457355.1|  Histone deacetylase family, putative [Syn...  88.6    1e-17
ref|XP_005181283.1|  PREDICTED: histone deacetylase 4-like iso...  91.7    1e-17
gb|KGS19718.1|  histone deacetylase domain protein [Burkholder...  89.0    1e-17
ref|XP_004868474.1|  PREDICTED: histone deacetylase 4 isoform ...  91.7    1e-17
ref|WP_028051694.1|  histone deacetylase [Carboxydothermus fer...  89.7    1e-17
gb|ETP26902.1|  hypothetical protein F441_00508 [Phytophthora ...  91.3    1e-17
gb|AHN52085.1|  hdac4 [Paralichthys olivaceus]                     91.7    1e-17
gb|EFA78298.1|  FYVE-type zinc finger-containing protein [Poly...  91.7    1e-17
ref|XP_005659035.1|  PREDICTED: histone deacetylase 10-like [S...  90.1    1e-17
gb|ETM03295.1|  hypothetical protein L917_00460 [Phytophthora ...  91.3    1e-17
gb|KGU73021.1|  histone deacetylase domain protein [Burkholder...  88.6    1e-17
ref|WP_018256704.1|  acetoin utilization protein [Halomicrobiu...  88.6    1e-17
emb|CCT73422.1|  related to histone deacetylase A [Fusarium fu...  91.3    1e-17
ref|XP_004917941.1|  PREDICTED: histone deacetylase 4 isoform ...  91.7    1e-17
ref|WP_011203997.1|  acetoin utilization protein [Burkholderia...  88.6    1e-17
gb|KDE04664.1|  hypothetical protein MVLG_04888 [Microbotryum ...  91.7    1e-17
ref|XP_004917939.1|  PREDICTED: histone deacetylase 4 isoform ...  91.7    1e-17
emb|CCG80536.1|  Histone deacetylase clr3 [Taphrina deformans ...  90.9    1e-17
ref|XP_002932071.2|  PREDICTED: histone deacetylase 4 isoform ...  91.7    1e-17
emb|CDR33237.1|  Histone deacetylase superfamily protein [Crib...  88.6    1e-17
ref|XP_010072083.1|  PREDICTED: histone deacetylase 4-like [Pt...  89.0    1e-17
gb|ENH74153.1|  Histone deacetylase clr3 [Fusarium oxysporum f...  91.3    1e-17
ref|XP_001605910.2|  PREDICTED: histone deacetylase 5 [Nasonia...  91.3    1e-17
gb|KFQ98283.1|  Histone deacetylase 4 [Opisthocomus hoazin]        91.3    1e-17
ref|XP_007667033.1|  PREDICTED: histone deacetylase 4 isoform ...  91.7    1e-17
ref|XP_009215832.1|  PREDICTED: histone deacetylase 10 isoform...  90.9    1e-17
ref|WP_015805198.1|  histone deacetylase superfamily [Actinosy...  88.6    1e-17
gb|AAZ32522.1|  deacetylase [uncultured euryarchaeote Alv-FOS4]    88.6    1e-17
gb|ABB92849.1|  histone deacetylase 4 [Danio rerio]                91.3    1e-17
ref|XP_008479420.1|  PREDICTED: histone deacetylase 6-like [Di...  90.9    1e-17
ref|NP_496910.1|  Protein HDA-10 [Caenorhabditis elegans]          90.1    1e-17
ref|XP_003775206.1|  PREDICTED: histone deacetylase 6 [Sarcoph...  91.3    1e-17
gb|KFQ93899.1|  Histone deacetylase 4 [Nipponia nippon]            91.3    1e-17
gb|EGT48447.1|  hypothetical protein CAEBREN_17707 [Caenorhabd...  90.1    1e-17
gb|KGU65796.1|  histone deacetylase domain protein [Burkholder...  88.6    1e-17
gb|EWY84943.1|  histone deacetylase 6/10 [Fusarium oxysporum F...  90.9    1e-17
ref|XP_009485327.1|  PREDICTED: histone deacetylase 4-like [Pe...  89.0    1e-17
gb|EXM05966.1|  histone deacetylase 6/10 [Fusarium oxysporum f...  90.9    1e-17
dbj|BAB01118.1|  unnamed protein product [Arabidopsis thaliana]    90.5    1e-17
ref|XP_010204953.1|  PREDICTED: histone deacetylase 4-like [Co...  89.0    1e-17
gb|EHH20664.1|  hypothetical protein EGK_03566 [Macaca mulatta]    89.7    1e-17
gb|EXM24984.1|  histone deacetylase 6/10 [Fusarium oxysporum f...  90.9    1e-17
ref|XP_007904060.1|  PREDICTED: histone deacetylase 4 isoform ...  91.3    1e-17
gb|EHH66221.1|  hypothetical protein EGM_03164 [Macaca fascicu...  89.7    1e-17
ref|XP_005812270.1|  PREDICTED: histone deacetylase 4-like [Xi...  91.3    1e-17
ref|XP_007904061.1|  PREDICTED: histone deacetylase 4 isoform ...  91.3    1e-17
ref|WP_024900549.1|  acetoin utilization protein [Burkholderia...  88.6    1e-17
ref|XP_005172586.1|  PREDICTED: histone deacetylase 4 isoform ...  91.3    1e-17
gb|KGX32241.1|  histone deacetylase domain protein [Burkholder...  88.6    1e-17
ref|WP_004527232.1|  acetoin utilization protein [Burkholderia...  88.6    1e-17
ref|WP_028580684.1|  histone deacetylase [Desulfobulbus japoni...  88.2    1e-17
gb|KGU98923.1|  histone deacetylase domain protein [Burkholder...  88.6    1e-17
ref|WP_004266736.1|  acetoin utilization protein [Burkholderia...  88.6    1e-17
gb|EWZ35390.1|  histone deacetylase 6/10 [Fusarium oxysporum F...  90.9    1e-17
gb|KGU77165.1|  histone deacetylase domain protein [Burkholder...  88.6    1e-17
ref|WP_004554310.1|  acetoin utilization protein [Burkholderia...  88.6    1e-17
gb|EXA37519.1|  histone deacetylase 6/10 [Fusarium oxysporum f...  90.9    1e-17
ref|XP_007667039.1|  PREDICTED: histone deacetylase 4 isoform ...  91.3    1e-17
ref|XP_004743793.1|  PREDICTED: histone deacetylase 4 isoform ...  91.3    1e-17
ref|XP_006127520.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  91.3    1e-17
ref|WP_027832017.1|  histone deacetylase [Marinobacter sp. HL-58]  88.6    1e-17
ref|XP_009966133.1|  PREDICTED: histone deacetylase 4 [Tyto alba]  87.8    1e-17
ref|XP_009303231.1|  PREDICTED: histone deacetylase 4 isoform ...  91.3    1e-17
gb|EGU85150.1|  hypothetical protein FOXB_04328 [Fusarium oxys...  90.9    1e-17
gb|KGS40576.1|  histone deacetylase domain protein [Burkholder...  88.6    1e-17
ref|XP_002631306.1|  Hypothetical protein CBG03124 [Caenorhabd...  90.9    1e-17
ref|XP_003398679.1|  PREDICTED: histone deacetylase 4-like [Bo...  91.3    1e-17
gb|KGR94506.1|  histone deacetylase domain protein [Burkholder...  88.6    1e-17
ref|XP_007873923.1|  hypothetical protein PNEG_01946 [Pneumocy...  90.9    1e-17
gb|KGW59614.1|  histone deacetylase domain protein [Burkholder...  88.6    1e-17
ref|WP_017298196.1|  hypothetical protein [Nodosilinea nodulosa]   88.2    1e-17
ref|XP_002318567.2|  hypothetical protein POPTR_0012s05730g [P...  90.5    1e-17
emb|CCW72062.1|  unnamed protein product [Phytomonas sp. isola...  90.5    1e-17
gb|AIS89048.1|  histone deacetylase-like amidohydrolase [Burkh...  88.6    1e-17
ref|WP_013765323.1|  histone deacetylase superfamily protein [...  88.2    1e-17
ref|XP_009569131.1|  PREDICTED: histone deacetylase 9 isoform ...  91.3    1e-17
ref|XP_005495574.1|  PREDICTED: histone deacetylase 4 [Zonotri...  91.3    1e-17
gb|EGW09518.1|  Histone deacetylase 7 [Cricetulus griseus]         89.4    1e-17
ref|XP_002631513.1|  C. briggsae CBR-HDA-6 protein [Caenorhabd...  90.1    1e-17
gb|KGV36867.1|  histone deacetylase domain protein [Burkholder...  88.6    1e-17
ref|WP_004539691.1|  acetoin utilization protein [Burkholderia...  88.6    1e-17
ref|XP_007684563.1|  hypothetical protein COCMIDRAFT_85978 [Bi...  90.9    1e-17
emb|CDU28724.1|  histone deacetylase family protein [Burkholde...  88.6    1e-17
ref|XP_005411231.1|  PREDICTED: histone deacetylase 4 isoform ...  91.3    1e-17
ref|XP_008762832.1|  PREDICTED: histone deacetylase 9 isoform ...  90.9    1e-17
gb|KGD07677.1|  histone deacetylase domain protein [Burkholder...  88.6    1e-17
gb|ELR46883.1|  Histone deacetylase 9 [Bos mutus]                  90.9    1e-17
gb|KEQ98865.1|  hypothetical protein AUEXF2481DRAFT_94577 [Aur...  90.5    2e-17
ref|XP_008688752.1|  PREDICTED: histone deacetylase 4 [Ursus m...  90.9    2e-17
ref|XP_009669343.1|  PREDICTED: histone deacetylase 4 isoform ...  90.9    2e-17
ref|WP_018804130.1|  hypothetical protein [Salinispora arenicola]  88.6    2e-17
ref|XP_003081007.1|  histone deacetylase family protein (ISS) ...  88.6    2e-17
ref|XP_007879335.1|  hypothetical protein PFL1_03625 [Pseudozy...  90.9    2e-17
ref|WP_011851783.1|  acetoin utilization protein [Burkholderia...  88.6    2e-17
ref|WP_004192901.1|  MULTISPECIES: acetoin utilization protein...  88.6    2e-17
gb|KEF52978.1|  histone deacetylase 6/10 [Exophiala aquamarina...  90.9    2e-17
gb|KFU94959.1|  Histone deacetylase 4 [Chaetura pelagica]          90.9    2e-17
emb|CAP37644.2|  Protein CBR-HDA-6 [Caenorhabditis briggsae]       89.7    2e-17
ref|WP_010865483.1|  hypothetical protein [Aeropyrum pernix]       88.2    2e-17
ref|WP_004203830.1|  acetoin utilization protein [Burkholderia...  88.6    2e-17
ref|WP_011321888.1|  acetoin utilization protein [Natronomonas...  88.2    2e-17
emb|CAB38805.1|  putative protein [Arabidopsis thaliana]           88.2    2e-17
emb|CDX82341.1|  BnaA03g34800D [Brassica napus]                    89.4    2e-17
ref|XP_005439523.1|  PREDICTED: histone deacetylase 5 [Falco c...  90.5    2e-17
ref|XP_005628648.1|  PREDICTED: histone deacetylase 9 isoform ...  90.9    2e-17
ref|WP_018588685.1|  hypothetical protein [Salinispora arenicola]  88.6    2e-17
gb|KGX36828.1|  histone deacetylase domain protein [Burkholder...  88.2    2e-17
ref|XP_005964436.1|  PREDICTED: histone deacetylase 9 isoform ...  90.9    2e-17
ref|XP_005628656.1|  PREDICTED: histone deacetylase 9 isoform ...  90.9    2e-17
ref|XP_005872372.1|  PREDICTED: histone deacetylase 9 isoform ...  90.9    2e-17
ref|XP_005628655.1|  PREDICTED: histone deacetylase 9 isoform ...  90.9    2e-17
ref|WP_028674220.1|  acetoin utilization protein [Salinispora ...  88.6    2e-17
ref|XP_008762834.1|  PREDICTED: histone deacetylase 9 isoform ...  90.9    2e-17
ref|XP_005679060.1|  PREDICTED: histone deacetylase 9 isoform ...  90.9    2e-17
ref|WP_011205002.1|  acetoin utilization protein [Burkholderia...  88.6    2e-17
ref|XP_008424070.1|  PREDICTED: histone deacetylase 4-like [Po...  90.9    2e-17
ref|WP_014576836.1|  histone deacetylase [Marinobacter adhaerens]  88.2    2e-17
gb|KFH67298.1|  hypothetical protein MVEG_06033 [Mortierella v...  90.9    2e-17
ref|XP_005198073.1|  PREDICTED: histone deacetylase 9 isoform ...  90.9    2e-17
ref|XP_001625421.1|  predicted protein [Nematostella vectensis]    88.2    2e-17
ref|XP_008278570.1|  PREDICTED: histone deacetylase 4-like [St...  90.9    2e-17
ref|XP_005429983.1|  PREDICTED: histone deacetylase 4 [Geospiz...  90.9    2e-17
ref|XP_005198075.1|  PREDICTED: histone deacetylase 9 isoform ...  90.9    2e-17
ref|XP_004701934.1|  PREDICTED: histone deacetylase 4 [Echinop...  90.9    2e-17
gb|EYB92275.1|  hypothetical protein Y032_0196g1545 [Ancylosto...  90.9    2e-17
ref|XP_009074595.1|  PREDICTED: histone deacetylase 4 [Acanthi...  87.8    2e-17
ref|XP_001683153.1|  putative histone deacetylase [Leishmania ...  90.1    2e-17
gb|ERG80865.1|  histone deacetylase 4 [Ascaris suum]               90.5    2e-17
ref|XP_006515324.1|  PREDICTED: histone deacetylase 9 isoform ...  90.9    2e-17
ref|XP_008513251.1|  PREDICTED: histone deacetylase 9 isoform ...  90.9    2e-17
ref|XP_003449166.1|  PREDICTED: histone deacetylase 7-like iso...  90.9    2e-17
gb|AAX26194.2|  SJCHGC03352 protein [Schistosoma japonicum]        85.9    2e-17
ref|XP_005931558.1|  PREDICTED: histone deacetylase 7-like [Ha...  90.9    2e-17
ref|XP_005628647.1|  PREDICTED: histone deacetylase 9 isoform ...  90.9    2e-17
ref|XP_005628650.1|  PREDICTED: histone deacetylase 9 isoform ...  90.9    2e-17
ref|XP_005628646.1|  PREDICTED: histone deacetylase 9 isoform ...  90.9    2e-17
ref|XP_004575008.1|  PREDICTED: histone deacetylase 7-like iso...  90.9    2e-17
gb|EYB92274.1|  hypothetical protein Y032_0196g1545 [Ancylosto...  90.9    2e-17
ref|XP_002915414.1|  PREDICTED: histone deacetylase 9-like [Ai...  90.9    2e-17
ref|XP_005454144.1|  PREDICTED: histone deacetylase 7-like iso...  90.9    2e-17
ref|XP_006515325.1|  PREDICTED: histone deacetylase 9 isoform ...  90.9    2e-17
ref|XP_005628652.1|  PREDICTED: histone deacetylase 9 isoform ...  90.9    2e-17
ref|XP_005730905.1|  PREDICTED: histone deacetylase 7-like [Pu...  90.9    2e-17
gb|EYB92273.1|  hypothetical protein Y032_0196g1545 [Ancylosto...  90.9    2e-17
ref|XP_005628651.1|  PREDICTED: histone deacetylase 9 isoform ...  90.9    2e-17
ref|XP_005628649.1|  PREDICTED: histone deacetylase 9 isoform ...  90.9    2e-17
ref|XP_006085114.1|  PREDICTED: histone deacetylase 9 isoform ...  90.9    2e-17
ref|WP_008101225.1|  histone deacetylase [Verrucomicrobiae bac...  87.4    2e-17
ref|XP_008878282.1|  hypothetical protein, variant [Aphanomyce...  90.1    2e-17
ref|WP_013046631.1|  histone deacetylase [Candidatus Puniceisp...  88.2    2e-17
ref|XP_005846820.1|  hypothetical protein CHLNCDRAFT_24556 [Ch...  88.2    2e-17
ref|XP_009950290.1|  PREDICTED: histone deacetylase 10-like [L...  89.7    2e-17
ref|XP_006515335.1|  PREDICTED: histone deacetylase 9 isoform ...  90.5    2e-17
ref|WP_004590857.1|  acetoin utilization protein/histone deace...  87.8    2e-17
ref|XP_006515332.1|  PREDICTED: histone deacetylase 9 isoform ...  90.5    2e-17
gb|ELU40937.1|  histone deacetylase complex protein [Rhizocton...  90.5    2e-17
ref|XP_005377401.1|  PREDICTED: histone deacetylase 9 isoform ...  90.5    2e-17
gb|KDO58245.1|  hypothetical protein CISIN_1g048339mg [Citrus ...  88.2    2e-17
gb|EAW57954.1|  histone deacetylase 7A, isoform CRA_c [Homo sa...  89.4    2e-17
ref|XP_005198080.1|  PREDICTED: histone deacetylase 9 isoform ...  90.5    2e-17
ref|XP_007339220.1|  hypothetical protein AURDEDRAFT_82103 [Au...  90.1    2e-17
gb|KDP39409.1|  hypothetical protein JCGZ_03691 [Jatropha curcas]  89.0    2e-17
ref|XP_002954936.1|  hypothetical protein VOLCADRAFT_118904 [V...  90.5    2e-17
ref|XP_005679059.1|  PREDICTED: histone deacetylase 9 isoform ...  90.5    2e-17
gb|ERE85920.1|  histone deacetylase 4-like protein [Cricetulus...  90.5    2e-17
ref|XP_009369823.1|  PREDICTED: histone deacetylase 8-like [Py...  88.2    2e-17
ref|XP_006515333.1|  PREDICTED: histone deacetylase 9 isoform ...  90.5    2e-17
ref|XP_008941818.1|  PREDICTED: histone deacetylase 4-like [Me...  87.0    2e-17
ref|NP_001258315.1|  histone deacetylase 9 isoform 1 [Mus musc...  90.5    2e-17
ref|XP_009632988.1|  PREDICTED: histone deacetylase 4 [Egretta...  90.5    2e-17
ref|XP_005908803.1|  PREDICTED: histone deacetylase 9 isoform ...  90.5    2e-17
ref|XP_010132829.1|  PREDICTED: histone deacetylase 4 [Buceros...  90.5    2e-17
ref|XP_009919393.1|  PREDICTED: histone deacetylase 4 [Haliaee...  90.5    2e-17
gb|AIN98295.1|  histone deacetylase, putative [Leishmania pana...  89.7    2e-17
ref|XP_005628654.1|  PREDICTED: histone deacetylase 9 isoform ...  90.5    2e-17
ref|XP_006832788.1|  PREDICTED: histone deacetylase 5 [Chrysoc...  90.5    2e-17
ref|XP_004575009.1|  PREDICTED: histone deacetylase 7-like iso...  90.5    2e-17
ref|XP_009669342.1|  PREDICTED: histone deacetylase 4 isoform ...  90.5    2e-17
ref|XP_007293387.1|  hypothetical protein MBM_05498 [Marssonin...  90.1    2e-17
gb|KFM68134.1|  hypothetical protein X975_27199 [Stegodyphus m...  90.5    2e-17
ref|XP_008051756.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  90.5    3e-17
ref|XP_006957046.1|  hypothetical protein WALSEDRAFT_59725 [Wa...  90.1    3e-17
ref|XP_008878283.1|  hypothetical protein H310_12849 [Aphanomy...  90.1    3e-17
ref|XP_003056785.1|  histone deacetylase [Micromonas pusilla C...  90.1    3e-17
gb|ELK32649.1|  Histone deacetylase 4 [Myotis davidii]             90.5    3e-17
ref|XP_006793750.1|  PREDICTED: histone deacetylase 4-like iso...  90.5    3e-17
ref|XP_004559276.1|  PREDICTED: histone deacetylase 4-like iso...  90.5    3e-17
ref|XP_009898754.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  90.5    3e-17
emb|CDS25446.1|  histone deacetylase 6 [Hymenolepis microstoma]    90.1    3e-17
ref|XP_009982127.1|  PREDICTED: histone deacetylase 4 [Tauraco...  90.5    3e-17
gb|KFV67361.1|  Histone deacetylase 4 [Picoides pubescens]         90.5    3e-17
ref|XP_010003008.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  90.5    3e-17
ref|WP_020042874.1|  hypothetical protein [Salipiger mucosus]      88.2    3e-17
gb|AAI15263.1|  Hdac6 protein [Danio rerio]                        90.1    3e-17
ref|XP_009294820.1|  PREDICTED: histone deacetylase 7 [Danio r...  89.7    3e-17
ref|XP_006897912.1|  PREDICTED: histone deacetylase 5 [Elephan...  90.5    3e-17
ref|XP_005048972.1|  PREDICTED: histone deacetylase 4 isoform ...  90.5    3e-17
gb|EDL92000.1|  histone deacetylase 4 (predicted), isoform CRA...  90.1    3e-17
ref|XP_004559275.1|  PREDICTED: histone deacetylase 4-like iso...  90.1    3e-17
ref|XP_001225634.1|  hypothetical protein CHGG_07978 [Chaetomi...  90.1    3e-17
ref|XP_005048969.1|  PREDICTED: histone deacetylase 4 isoform ...  90.5    3e-17
ref|WP_024083580.1|  deacetylase [Sulfolobus acidocaldarius]       87.4    3e-17
gb|ERS94967.1|  hypothetical protein HMPREF1624_08679 [Sporoth...  89.7    3e-17
gb|AAH06453.2|  HDAC7 protein [Homo sapiens]                       89.4    3e-17
ref|XP_005082250.1|  PREDICTED: histone deacetylase 4 isoform ...  90.1    3e-17
gb|EDL91998.1|  histone deacetylase 4 (predicted), isoform CRA...  90.1    3e-17
ref|XP_006793749.1|  PREDICTED: histone deacetylase 4-like iso...  90.1    3e-17
ref|XP_005944178.1|  PREDICTED: histone deacetylase 4-like [Ha...  90.1    3e-17
ref|XP_004559274.1|  PREDICTED: histone deacetylase 4-like iso...  90.1    3e-17
gb|ELK14159.1|  Histone deacetylase 5 [Pteropus alecto]            90.1    3e-17
gb|EUN32264.1|  hypothetical protein COCVIDRAFT_85585 [Bipolar...  90.1    3e-17
ref|XP_005650534.1|  Arginase/deacetylase [Coccomyxa subellips...  90.1    3e-17
ref|XP_009829079.1|  hypothetical protein H257_05798 [Aphanomy...  90.5    3e-17
ref|XP_007965053.1|  PREDICTED: histone deacetylase 4 isoform ...  90.1    3e-17
gb|KFP64906.1|  Histone deacetylase 4 [Cariama cristata]           90.1    3e-17
gb|EYC41102.1|  hypothetical protein Y032_0582g290 [Ancylostom...  89.0    3e-17
ref|WP_025055673.1|  acetoin utilization protein [Sulfitobacte...  87.4    3e-17
ref|XP_006529379.1|  PREDICTED: histone deacetylase 4 isoform ...  90.1    3e-17
ref|XP_001549548.1|  hypothetical protein BC1G_11969 [Botryoti...  89.7    3e-17
ref|WP_010980410.1|  deacetylase [Sulfolobus tokodaii]             87.0    3e-17
ref|XP_005015197.1|  PREDICTED: histone deacetylase 9 isoform ...  90.1    3e-17
ref|XP_008827349.1|  PREDICTED: histone deacetylase 4 isoform ...  90.1    3e-17
gb|AHA85936.1|  histone deacetylase [Arachis hypogaea]             89.4    3e-17
gb|ETP65276.1|  acetoin utilization protein [Burkholderia dolo...  87.4    3e-17
gb|EYC41101.1|  hypothetical protein Y032_0582g290 [Ancylostom...  89.0    3e-17
ref|XP_009808780.1|  PREDICTED: histone deacetylase 4-like [Ga...  86.3    3e-17
gb|EGT40791.1|  hypothetical protein CAEBREN_15499 [Caenorhabd...  89.0    3e-17
ref|WP_006026141.1|  acetoin utilization protein [Burkholderia...  87.4    3e-17
gb|KGL88770.1|  Histone deacetylase 9 [Charadrius vociferus]       90.1    3e-17
ref|XP_004453279.1|  PREDICTED: histone deacetylase 10 [Dasypu...  89.4    3e-17
ref|XP_005003670.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  90.1    3e-17
ref|XP_666892.1|  hypothetical protein [Cryptosporidium homini...  90.1    3e-17
ref|XP_005532750.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  90.1    3e-17
ref|XP_008830923.1|  PREDICTED: histone deacetylase 9 isoform ...  90.1    3e-17
dbj|BAE43272.1|  unnamed protein product [Mus musculus]            89.7    3e-17
gb|AAS07402.1|  unknown [Homo sapiens]                             84.7    3e-17
ref|XP_006785340.1|  PREDICTED: histone deacetylase 7-like [Ne...  90.1    3e-17
gb|AAS07401.1|  unknown [Homo sapiens]                             84.7    3e-17
emb|CCD47374.1|  hypothetical protein BofuT4_P005330.1 [Botryo...  89.7    3e-17
ref|WP_028845697.1|  hypothetical protein [Thermodesulfatator ...  87.0    3e-17
ref|XP_006245500.1|  PREDICTED: histone deacetylase 4 isoform ...  90.1    4e-17
ref|XP_005024825.1|  PREDICTED: histone deacetylase 4 isoform ...  90.1    4e-17
gb|EMR83697.1|  putative histone deacetylase protein [Botryoti...  89.7    4e-17
ref|XP_009698249.1|  PREDICTED: histone deacetylase 4 [Cariama...  89.7    4e-17
ref|XP_009869205.1|  PREDICTED: histone deacetylase 4 [Apalode...  90.1    4e-17
ref|XP_008918619.1|  PREDICTED: histone deacetylase 9 isoform ...  90.1    4e-17
ref|XP_003285624.1|  hypothetical protein DICPUDRAFT_149504 [D...  90.1    4e-17
ref|XP_009953617.1|  PREDICTED: histone deacetylase 4 [Leptoso...  90.1    4e-17
gb|EDL40017.1|  histone deacetylase 4, isoform CRA_a [Mus musc...  89.7    4e-17
ref|XP_005048973.1|  PREDICTED: histone deacetylase 4 isoform ...  90.1    4e-17
ref|XP_007953409.1|  PREDICTED: histone deacetylase 5 isoform ...  90.1    4e-17
gb|KGS49140.1|  histone deacetylase domain protein [Burkholder...  87.4    4e-17
ref|XP_004186156.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  89.4    4e-17
ref|XP_006267363.1|  PREDICTED: histone deacetylase 4-like [Al...  90.1    4e-17
gb|KFZ59899.1|  Histone deacetylase 4 [Podiceps cristatus]         89.7    4e-17
ref|XP_002190608.2|  PREDICTED: histone deacetylase 4 [Taeniop...  90.1    4e-17
ref|WP_015052411.1|  histone deacetylase superfamily [Methanol...  89.4    4e-17
ref|XP_005048971.1|  PREDICTED: histone deacetylase 4 isoform ...  90.1    4e-17
ref|XP_008638928.1|  PREDICTED: histone deacetylase 4 [Corvus ...  90.1    4e-17
ref|XP_009319044.1|  PREDICTED: histone deacetylase 4 [Pygosce...  90.1    4e-17
ref|XP_009280205.1|  PREDICTED: histone deacetylase 4 [Aptenod...  90.1    4e-17
ref|XP_009887369.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  90.1    4e-17
gb|ETN69059.1|  histone deacetylase family protein [Necator am...  89.7    4e-17
dbj|BAD66831.1|  KIAA0600 splice variant 1 [Homo sapiens]          89.4    4e-17
ref|XP_007953407.1|  PREDICTED: histone deacetylase 5 isoform ...  89.7    4e-17
ref|XP_009942983.1|  PREDICTED: histone deacetylase 4 [Opistho...  89.7    4e-17
ref|WP_015601389.1|  histone deacetylase-like amidohydrolase [...  87.4    4e-17
gb|KFW86802.1|  Histone deacetylase 4 [Manacus vitellinus]         89.7    4e-17
ref|XP_006935832.1|  PREDICTED: histone deacetylase 4 [Felis c...  90.1    4e-17
ref|XP_008765501.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    4e-17
ref|XP_009495831.1|  hypothetical protein H696_03693 [Fonticul...  87.8    4e-17
ref|XP_005509287.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    4e-17
ref|XP_005024822.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    4e-17
ref|XP_008836381.1|  PREDICTED: histone deacetylase 5 isoform ...  89.7    4e-17
ref|XP_002162568.2|  PREDICTED: histone deacetylase 6-like [Hy...  87.0    4e-17
gb|KFV04897.1|  Histone deacetylase 4 [Tauraco erythrolophus]      89.7    4e-17
ref|XP_009532012.1|  hypothetical protein PHYSODRAFT_562727 [P...  90.1    4e-17
ref|XP_006529371.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    4e-17
ref|XP_006245502.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    4e-17
ref|XP_005361736.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    4e-17
ref|XP_010209778.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  89.7    4e-17
gb|ERE85919.1|  histone deacetylase 4-like protein [Cricetulus...  89.7    4e-17
ref|XP_005024823.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    4e-17
gb|KGL86844.1|  Histone deacetylase 4 [Charadrius vociferus]       89.7    4e-17
ref|XP_008836377.1|  PREDICTED: histone deacetylase 5 isoform ...  89.7    4e-17
ref|XP_625509.1|  histone deacetylase [Cryptosporidium parvum ...  89.7    4e-17
ref|XP_008548453.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    4e-17
ref|XP_008548435.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    4e-17
ref|XP_008765500.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    4e-17
ref|NP_989644.1|  histone deacetylase 4 [Gallus gallus]            89.7    4e-17
ref|XP_009086454.1|  PREDICTED: histone deacetylase 4 [Serinus...  89.7    4e-17
ref|XP_003207402.1|  PREDICTED: histone deacetylase 4-like [Me...  89.7    4e-17
ref|XP_006020011.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  89.7    4e-17
ref|XP_006940473.1|  PREDICTED: histone deacetylase 5 isoform ...  89.7    4e-17
ref|XP_006910166.1|  PREDICTED: histone deacetylase 5 isoform ...  89.7    4e-17
gb|EOA97572.1|  Histone deacetylase 4 [Anas platyrhynchos]         89.7    4e-17
ref|XP_006910165.1|  PREDICTED: histone deacetylase 5 isoform ...  89.7    4e-17
ref|XP_006910164.1|  PREDICTED: histone deacetylase 5 isoform ...  89.7    4e-17
ref|XP_005024826.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    4e-17
ref|XP_008929197.1|  PREDICTED: histone deacetylase 4 [Manacus...  89.7    4e-17
ref|XP_008493225.1|  PREDICTED: histone deacetylase 4 [Calypte...  89.7    4e-17
ref|XP_005241345.1|  PREDICTED: histone deacetylase 4 [Falco p...  89.7    4e-17
ref|XP_005024824.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    4e-17
ref|XP_006910168.1|  PREDICTED: histone deacetylase 5 isoform ...  89.7    4e-17
ref|XP_006910167.1|  PREDICTED: histone deacetylase 5 isoform ...  89.7    4e-17
ref|WP_029978514.1|  hypothetical protein [Pseudomonas sp. PH1b]   87.0    4e-17
ref|XP_009459362.1|  PREDICTED: histone deacetylase 4 [Nipponi...  89.7    4e-17
ref|XP_003858679.1|  histone deacetylase, putative [Leishmania...  89.0    4e-17
ref|WP_021720582.1|  histone deacetylase family protein [Phasc...  88.2    4e-17
gb|KDQ57529.1|  hypothetical protein JAAARDRAFT_686851 [Jaapia...  89.4    4e-17
ref|XP_008572595.1|  PREDICTED: histone deacetylase 5 isoform ...  89.7    4e-17
ref|XP_006529373.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    4e-17
ref|XP_006138399.1|  PREDICTED: histone deacetylase 9 [Pelodis...  89.7    4e-17
gb|EDL91999.1|  histone deacetylase 4 (predicted), isoform CRA...  89.7    4e-17
emb|CEG64615.1|  hypothetical protein RMATCC62417_01555 [Rhizo...  89.4    4e-17
ref|XP_006970671.1|  PREDICTED: histone deacetylase 5 isoform ...  89.7    4e-17
gb|ABM67397.1|  HDAC9 [Hylobates klossii]                          84.3    4e-17
ref|XP_005751182.1|  PREDICTED: histone deacetylase 4-like [Pu...  89.7    4e-17
ref|XP_005450501.1|  PREDICTED: histone deacetylase 4-like iso...  89.7    5e-17
ref|XP_006245505.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    5e-17
ref|XP_004923895.1|  PREDICTED: histone deacetylase 6-like [Bo...  89.7    5e-17
ref|XP_003772175.1|  PREDICTED: histone deacetylase 9 [Sarcoph...  89.7    5e-17
ref|XP_010406222.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    5e-17
ref|XP_006529366.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    5e-17
ref|XP_006529365.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    5e-17
ref|XP_005450500.1|  PREDICTED: histone deacetylase 4-like iso...  89.7    5e-17
ref|XP_009269131.1|  Histone deacetylase clr3 [Wallemia ichthy...  89.4    5e-17
ref|XP_004451642.1|  PREDICTED: histone deacetylase 5 isoform ...  89.7    5e-17
ref|XP_008169672.1|  PREDICTED: histone deacetylase 9 isoform ...  89.7    5e-17
ref|XP_008548478.1|  PREDICTED: histone deacetylase 4 isoform ...  89.4    5e-17
ref|XP_008548461.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    5e-17
ref|XP_008548444.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    5e-17
ref|XP_007085145.1|  PREDICTED: histone deacetylase 4 [Panther...  89.4    5e-17
ref|XP_004707561.1|  PREDICTED: histone deacetylase 5 [Echinop...  89.7    5e-17
ref|XP_009871454.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  86.3    5e-17
ref|XP_010148528.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  89.4    5e-17
ref|XP_006529375.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    5e-17
ref|WP_023843863.1|  deacetylase, histone deacetylase/acetoin ...  86.7    5e-17
ref|XP_008548421.1|  PREDICTED: histone deacetylase 4 isoform ...  89.4    5e-17
gb|ELV11238.1|  Histone deacetylase 5 [Tupaia chinensis]           89.7    5e-17
ref|XP_008628180.1|  PREDICTED: histone deacetylase 9 isoform ...  89.4    5e-17
ref|XP_008548470.1|  PREDICTED: histone deacetylase 4 isoform ...  89.4    5e-17
ref|XP_004241339.1|  PREDICTED: histone deacetylase 8 [Solanum...  87.0    5e-17
ref|XP_007184899.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    5e-17
ref|XP_007184898.1|  PREDICTED: histone deacetylase 4 isoform ...  89.7    5e-17
ref|XP_008548429.1|  PREDICTED: histone deacetylase 4 isoform ...  89.4    5e-17
ref|XP_004868475.1|  PREDICTED: histone deacetylase 4 isoform ...  89.4    5e-17
emb|CDP93901.1|  Protein BM-HDA-6 [Brugia malayi]                  88.6    5e-17
ref|XP_006529369.1|  PREDICTED: histone deacetylase 4 isoform ...  89.4    5e-17
ref|XP_004451641.1|  PREDICTED: histone deacetylase 5 isoform ...  89.4    5e-17
ref|XP_006529368.1|  PREDICTED: histone deacetylase 4 isoform ...  89.4    5e-17
ref|WP_015286271.1|  deacetylase, histone deacetylase/acetoin ...  86.7    5e-17
gb|EDL40018.1|  histone deacetylase 4, isoform CRA_b [Mus musc...  89.4    6e-17
ref|WP_027233598.1|  acetoin utilization protein [Phaeobacter ...  86.7    6e-17
ref|XP_007647109.1|  PREDICTED: histone deacetylase 4 isoform ...  89.4    6e-17
ref|XP_010406226.1|  PREDICTED: histone deacetylase 4 isoform ...  89.4    6e-17
ref|XP_006529378.1|  PREDICTED: histone deacetylase 4 isoform ...  89.4    6e-17
ref|XP_006529374.1|  PREDICTED: histone deacetylase 4 isoform ...  89.4    6e-17
ref|XP_008629183.1|  PREDICTED: histone deacetylase 7 [Corvus ...  89.0    6e-17
ref|XP_010406223.1|  PREDICTED: histone deacetylase 4 isoform ...  89.4    6e-17
ref|XP_006940477.1|  PREDICTED: histone deacetylase 5 isoform ...  89.4    6e-17
ref|XP_010406224.1|  PREDICTED: histone deacetylase 4 isoform ...  89.4    6e-17
gb|KFV67080.1|  Histone deacetylase 9 [Picoides pubescens]         89.4    6e-17
ref|XP_004597509.1|  PREDICTED: histone deacetylase 4 [Ochoton...  89.4    6e-17
ref|XP_006970674.1|  PREDICTED: histone deacetylase 5 isoform ...  89.4    6e-17
ref|XP_008023815.1|  hypothetical protein SETTUDRAFT_160266 [S...  89.0    6e-17
ref|WP_028318665.1|  histone deacetylase [Desulfobulbus elonga...  86.3    6e-17
ref|XP_008572596.1|  PREDICTED: histone deacetylase 5 isoform ...  89.4    6e-17
ref|XP_010406228.1|  PREDICTED: histone deacetylase 4 isoform ...  89.4    6e-17
ref|XP_010406227.1|  PREDICTED: histone deacetylase 4 isoform ...  89.4    6e-17
ref|XP_010406225.1|  PREDICTED: histone deacetylase 4 isoform ...  89.4    6e-17
ref|XP_005610857.1|  PREDICTED: histone deacetylase 4 [Equus c...  89.4    6e-17
emb|CDQ63453.1|  unnamed protein product [Oncorhynchus mykiss]     89.0    6e-17
gb|EHJ64741.1|  putative histone deacetylase hda2 [Danaus plex...  89.4    6e-17
ref|XP_006167474.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  89.4    6e-17
ref|XP_008572594.1|  PREDICTED: histone deacetylase 5 isoform ...  89.4    6e-17
ref|XP_004451640.1|  PREDICTED: histone deacetylase 5 isoform ...  89.4    6e-17
ref|XP_005339705.1|  PREDICTED: histone deacetylase 4 [Ictidom...  89.4    6e-17
ref|XP_004360866.1|  histone deacetylase family protein [Dicty...  89.4    6e-17
ref|XP_006940476.1|  PREDICTED: histone deacetylase 5 isoform ...  89.4    6e-17
dbj|BAB15759.1|  FLJ00062 protein [Homo sapiens]                   88.2    6e-17
ref|XP_006940475.1|  PREDICTED: histone deacetylase 5 isoform ...  89.4    6e-17
ref|XP_008836379.1|  PREDICTED: histone deacetylase 5 isoform ...  89.4    6e-17
ref|XP_008836378.1|  PREDICTED: histone deacetylase 5 isoform ...  89.4    6e-17
ref|XP_003786331.1|  PREDICTED: histone deacetylase 5 [Otolemu...  89.4    6e-17
ref|XP_006970673.1|  PREDICTED: histone deacetylase 5 isoform ...  89.4    6e-17
ref|XP_003997024.1|  PREDICTED: histone deacetylase 5 isoform ...  89.4    6e-17
ref|XP_010406229.1|  PREDICTED: histone deacetylase 4 isoform ...  89.4    6e-17
ref|XP_008269790.1|  PREDICTED: histone deacetylase 5 isoform ...  89.4    6e-17
ref|XP_006970670.1|  PREDICTED: histone deacetylase 5 isoform ...  89.4    6e-17
ref|XP_004451636.1|  PREDICTED: histone deacetylase 5 isoform ...  89.4    6e-17
emb|CCV00038.1|  unnamed protein product [Malassezia sympodial...  88.6    6e-17
ref|XP_008587623.1|  PREDICTED: histone deacetylase 9-like [Ga...  87.0    6e-17
ref|XP_010406230.1|  PREDICTED: histone deacetylase 4 isoform ...  89.4    6e-17
ref|XP_010406232.1|  PREDICTED: histone deacetylase 4 isoform ...  89.4    7e-17
ref|XP_006940474.1|  PREDICTED: histone deacetylase 5 isoform ...  89.4    7e-17
ref|XP_006636255.1|  PREDICTED: histone deacetylase 9-like [Le...  89.0    7e-17
ref|XP_007505479.1|  PREDICTED: histone deacetylase 9 isoform ...  89.0    7e-17
gb|KFO18536.1|  Histone deacetylase 4 [Fukomys damarensis]         89.4    7e-17
emb|CAP37105.2|  Protein CBR-HDAC-6 [Caenorhabditis briggsae]      89.0    7e-17
ref|XP_006970672.1|  PREDICTED: histone deacetylase 5 isoform ...  89.0    7e-17
ref|XP_006779106.1|  PREDICTED: histone deacetylase 9 isoform ...  89.0    7e-17
gb|ESZ92003.1|  hypothetical protein SBOR_7618 [Sclerotinia bo...  88.6    7e-17
emb|CAF98995.1|  unnamed protein product [Tetraodon nigroviridis]  89.0    7e-17
ref|XP_008250495.1|  PREDICTED: histone deacetylase 4 [Oryctol...  89.0    7e-17
ref|XP_006424116.1|  hypothetical protein CICLE_v10028632mg [C...  86.7    7e-17
ref|XP_003417973.1|  PREDICTED: histone deacetylase 4-like [Lo...  89.0    7e-17
gb|EAW93706.1|  histone deacetylase 9, isoform CRA_f [Homo sap...  89.0    7e-17
ref|XP_004597375.1|  PREDICTED: histone deacetylase 5 [Ochoton...  89.0    7e-17
ref|XP_007897890.1|  PREDICTED: histone deacetylase 9 [Callorh...  89.0    8e-17
ref|XP_007505477.1|  PREDICTED: histone deacetylase 9 isoform ...  89.0    8e-17
ref|XP_007505474.1|  PREDICTED: histone deacetylase 9 isoform ...  89.0    8e-17
ref|XP_002751569.3|  PREDICTED: histone deacetylase 9 isoform ...  89.0    8e-17
dbj|GAA94237.1|  hypothetical protein E5Q_00886 [Mixia osmunda...  88.6    8e-17
ref|XP_010389009.1|  PREDICTED: histone deacetylase 7 [Corvus ...  87.8    8e-17
ref|XP_007505473.1|  PREDICTED: histone deacetylase 9 isoform ...  89.0    8e-17
ref|XP_004451639.1|  PREDICTED: histone deacetylase 5 isoform ...  89.0    8e-17
gb|KCW44444.1|  hypothetical protein EUGRSUZ_L020641 [Eucalypt...  84.0    8e-17
ref|XP_004451638.1|  PREDICTED: histone deacetylase 5 isoform ...  89.0    8e-17
gb|EDL04373.1|  histone deacetylase 10, isoform CRA_b [Mus mus...  87.8    8e-17
ref|XP_595731.4|  PREDICTED: histone deacetylase 4 [Bos taurus]    89.0    8e-17
ref|XP_007505483.1|  PREDICTED: histone deacetylase 9 isoform ...  89.0    8e-17
ref|XP_002719479.1|  PREDICTED: histone deacetylase 5 isoform ...  89.0    8e-17
gb|KFP01156.1|  Histone deacetylase 9 [Calypte anna]               89.0    8e-17
ref|XP_004772622.1|  PREDICTED: histone deacetylase 5 isoform ...  89.0    8e-17
ref|XP_003345552.1|  hypothetical protein SMAC_06205 [Sordaria...  88.2    8e-17
ref|XP_004772621.1|  PREDICTED: histone deacetylase 5 isoform ...  89.0    8e-17
ref|XP_004772628.1|  PREDICTED: histone deacetylase 5 isoform ...  89.0    8e-17
ref|XP_004772623.1|  PREDICTED: histone deacetylase 5 isoform ...  89.0    8e-17
ref|XP_010341642.1|  PREDICTED: histone deacetylase 10 isoform...  88.2    8e-17
ref|XP_005857776.1|  PREDICTED: histone deacetylase 4 isoform ...  89.0    8e-17
ref|XP_006682136.1|  hypothetical protein BATDEDRAFT_14326 [Ba...  84.7    8e-17
ref|XP_003302166.1|  hypothetical protein PTT_13889 [Pyrenopho...  88.6    8e-17
ref|XP_007505683.1|  PREDICTED: histone deacetylase 4-like [Mo...  84.7    8e-17
dbj|GAA94236.1|  hypothetical protein E5Q_00885 [Mixia osmunda...  88.6    8e-17
ref|XP_002427051.1|  histone deacetylase 7A, putative [Pedicul...  89.0    8e-17
ref|XP_002291034.1|  histone deacetylase [Thalassiosira pseudo...  88.6    9e-17
ref|XP_004743788.1|  PREDICTED: histone deacetylase 4 isoform ...  89.0    9e-17
ref|XP_002935586.2|  PREDICTED: histone deacetylase 5 [Xenopus...  89.0    9e-17
ref|XP_007980137.1|  PREDICTED: histone deacetylase 9 isoform ...  89.0    9e-17
ref|XP_007980149.1|  PREDICTED: histone deacetylase 9 isoform ...  89.0    9e-17
gb|AAC18040.1|  antigen NY-CO-9 [Homo sapiens]                     88.6    9e-17
ref|XP_004374367.1|  PREDICTED: histone deacetylase 5 [Trichec...  89.0    9e-17
emb|CDR98086.1|  histone deacetylase, putative [Babesia bigemina]  89.0    9e-17
ref|XP_007980130.1|  PREDICTED: histone deacetylase 9 isoform ...  89.0    9e-17
ref|WP_009158196.1|  histone deacetylase [Thalassiobium sp. R2...  86.3    9e-17
ref|XP_004868473.1|  PREDICTED: histone deacetylase 4 isoform ...  89.0    9e-17
ref|XP_006532324.1|  PREDICTED: histone deacetylase 5 isoform ...  89.0    9e-17
ref|XP_004772626.1|  PREDICTED: histone deacetylase 5 isoform ...  89.0    9e-17
gb|EPE07668.1|  histone deacetylase [Ophiostoma piceae UAMH 11...  88.6    9e-17
ref|XP_008572598.1|  PREDICTED: histone deacetylase 5 isoform ...  89.0    9e-17
ref|XP_004451637.1|  PREDICTED: histone deacetylase 5 isoform ...  89.0    9e-17
ref|XP_007980141.1|  PREDICTED: histone deacetylase 9 isoform ...  88.6    9e-17
dbj|BAH13789.1|  unnamed protein product [Homo sapiens]            88.2    9e-17
emb|CCE27396.1|  related to histone deacetylase A [Claviceps p...  88.6    9e-17
ref|XP_008572597.1|  PREDICTED: histone deacetylase 5 isoform ...  89.0    9e-17
ref|XP_009450988.1|  PREDICTED: histone deacetylase 9 isoform ...  88.6    9e-17
ref|XP_008269791.1|  PREDICTED: histone deacetylase 5 isoform ...  88.6    9e-17
ref|XP_008974225.1|  PREDICTED: histone deacetylase 5 isoform ...  88.6    9e-17
gb|ACA04842.1|  histone deacetylase superfamily protein [Picea...  84.0    9e-17
ref|NP_478056.1|  histone deacetylase 9 isoform 1 [Homo sapiens]   88.6    1e-16
ref|XP_007941688.1|  PREDICTED: histone deacetylase 4-like [Or...  88.6    1e-16
ref|XP_008974231.1|  PREDICTED: histone deacetylase 5 isoform ...  88.6    1e-16
ref|XP_008161634.1|  PREDICTED: histone deacetylase 4 isoform ...  88.6    1e-16
ref|XP_003962145.1|  PREDICTED: histone deacetylase 4-like [Ta...  88.6    1e-16
ref|XP_006532318.1|  PREDICTED: histone deacetylase 5 isoform ...  88.6    1e-16
ref|XP_004772627.1|  PREDICTED: histone deacetylase 5 isoform ...  88.6    1e-16
ref|XP_006715865.1|  PREDICTED: histone deacetylase 9 isoform ...  88.6    1e-16
ref|WP_015404820.1|  deacetylase, histone deacetylase/acetoin ...  85.5    1e-16
ref|XP_006532323.1|  PREDICTED: histone deacetylase 5 isoform ...  88.6    1e-16
dbj|BAC65607.2|  mKIAA0600 protein [Mus musculus]                  88.6    1e-16
ref|XP_008430992.1|  PREDICTED: histone deacetylase 10 isoform...  87.8    1e-16
ref|XP_006361095.1|  PREDICTED: histone deacetylase 8-like [So...  86.3    1e-16
gb|AAO27363.1|  histone deacetylase 9 [Homo sapiens]               88.6    1e-16
ref|XP_006721692.1|  PREDICTED: histone deacetylase 5 isoform ...  88.6    1e-16
ref|NP_001271177.1|  histone deacetylase 5 isoform 3 [Mus musc...  88.6    1e-16
ref|XP_007505475.1|  PREDICTED: histone deacetylase 9 isoform ...  88.6    1e-16
ref|WP_029170501.1|  MULTISPECIES: histone deacetylase [unclas...  85.5    1e-16
ref|XP_008161631.1|  PREDICTED: histone deacetylase 4 isoform ...  88.6    1e-16
ref|WP_021166925.1|  histone deacetylase superfamily [Sporomus...  87.0    1e-16
ref|XP_006532316.1|  PREDICTED: histone deacetylase 5 isoform ...  88.6    1e-16
ref|XP_008161632.1|  PREDICTED: histone deacetylase 4 isoform ...  88.6    1e-16
ref|XP_010393846.1|  PREDICTED: histone deacetylase 10 isoform...  87.8    1e-16
ref|XP_004772624.1|  PREDICTED: histone deacetylase 5 isoform ...  88.6    1e-16
ref|XP_009877863.1|  PREDICTED: histone deacetylase 9 isoform ...  88.6    1e-16
ref|XP_008692119.1|  PREDICTED: histone deacetylase 5 [Ursus m...  88.6    1e-16
gb|ERG89610.1|  putative deacetylase [halophilic archaeon J07HX5]  85.5    1e-16
ref|XP_006532322.1|  PREDICTED: histone deacetylase 5 isoform ...  88.6    1e-16
sp|Q9Z2V6.2|HDAC5_MOUSE  RecName: Full=Histone deacetylase 5; ...  88.6    1e-16
ref|XP_004743789.1|  PREDICTED: histone deacetylase 4 isoform ...  88.6    1e-16
gb|KFP77559.1|  Histone deacetylase 9 [Acanthisitta chloris]       88.2    1e-16
gb|EHH17464.1|  hypothetical protein EGK_13878 [Macaca mulatta]    88.6    1e-16
ref|XP_003173894.1|  histone deacetylase clr3 [Arthroderma gyp...  88.2    1e-16
ref|NP_001271178.1|  histone deacetylase 5 isoform 4 [Mus musc...  88.6    1e-16
dbj|BAE33201.1|  unnamed protein product [Mus musculus]            88.6    1e-16
ref|XP_004772625.1|  PREDICTED: histone deacetylase 5 isoform ...  88.6    1e-16
ref|XP_004743794.1|  PREDICTED: histone deacetylase 4 isoform ...  88.6    1e-16
gb|AAF31418.1|AF207748_1  histone deacetylase 5 [Mus musculus]     88.6    1e-16
ref|NP_001271179.1|  histone deacetylase 5 isoform 5 [Mus musc...  88.6    1e-16
ref|XP_006532319.1|  PREDICTED: histone deacetylase 5 isoform ...  88.6    1e-16
emb|CCM03597.1|  predicted protein [Fibroporia radiculosa]         87.8    1e-16
ref|XP_001964156.1|  GF21406 [Drosophila ananassae]                88.6    1e-16
gb|EDL34099.1|  histone deacetylase 5, isoform CRA_b [Mus musc...  88.6    1e-16
ref|XP_008998028.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  88.6    1e-16
ref|XP_008114639.1|  PREDICTED: histone deacetylase 7 isoform ...  88.2    1e-16
ref|XP_005445156.1|  PREDICTED: histone deacetylase 9 isoform ...  88.6    1e-16
gb|AAI11736.1|  HDAC9 protein [Homo sapiens]                       88.6    1e-16
ref|XP_006532321.1|  PREDICTED: histone deacetylase 5 isoform ...  88.6    1e-16
ref|XP_007980142.1|  PREDICTED: histone deacetylase 9 isoform ...  88.6    1e-16
ref|XP_005235689.1|  PREDICTED: histone deacetylase 9 isoform ...  88.6    1e-16
ref|XP_004667891.1|  PREDICTED: histone deacetylase 4 [Jaculus...  88.6    1e-16
ref|WP_009989642.1|  deacetylase [Sulfolobus solfataricus]         85.5    1e-16
ref|WP_012309318.1|  histone deacetylase superfamily protein [...  85.5    1e-16
ref|XP_003235345.1|  histone deacetylase [Trichophyton rubrum ...  88.2    1e-16
ref|NP_848512.1|  histone deacetylase 9 isoform 5 [Homo sapiens]   88.6    1e-16
ref|XP_005550087.1|  PREDICTED: histone deacetylase 9 isoform ...  88.6    1e-16
ref|XP_010347643.1|  PREDICTED: histone deacetylase 9 isoform ...  88.6    1e-16
ref|XP_009929659.1|  PREDICTED: histone deacetylase 9 isoform ...  88.6    1e-16
ref|WP_024762765.1|  hypothetical protein [Pseudomonas nitrore...  85.9    1e-16
ref|XP_007980139.1|  PREDICTED: histone deacetylase 9 isoform ...  88.6    1e-16
ref|XP_004743792.1|  PREDICTED: histone deacetylase 4 isoform ...  88.6    1e-16
ref|XP_005550086.1|  PREDICTED: histone deacetylase 9 isoform ...  88.6    1e-16
ref|XP_009265820.1|  Histone deacetylase clr3 [Wallemia ichthy...  87.8    1e-16
ref|XP_003069716.1|  histone deacetylase clr3, putative [Cocci...  88.2    1e-16
ref|XP_008114638.1|  PREDICTED: histone deacetylase 7 isoform ...  88.2    1e-16
ref|XP_001463453.1|  putative histone deacetylase [Leishmania ...  87.8    1e-16
ref|XP_008976958.1|  PREDICTED: histone deacetylase 9 isoform ...  88.6    1e-16
ref|XP_007980133.1|  PREDICTED: histone deacetylase 9 isoform ...  88.6    1e-16
ref|XP_007980132.1|  PREDICTED: histone deacetylase 9 isoform ...  88.6    1e-16
ref|WP_017517743.1|  hypothetical protein [Pseudomonas nitrore...  85.9    1e-16
ref|XP_003252663.1|  PREDICTED: histone deacetylase 9 isoform ...  88.2    1e-16
gb|KGL73024.1|  Histone deacetylase 9 [Tinamus guttatus]           88.2    1e-16
ref|XP_008147500.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    1e-16
ref|WP_014052721.1|  acetoin utilization protein [halophilic a...  85.5    1e-16
gb|EGD99561.1|  histone deacetylase HdaA [Trichophyton tonsura...  88.2    1e-16
gb|EAS31193.2|  histone deacetylase clr3 [Coccidioides immitis...  88.2    1e-16
ref|XP_006154545.1|  PREDICTED: histone deacetylase 9-like [Tu...  88.6    1e-16
ref|XP_009220367.1|  histone deacetylase HDA1 [Gaeumannomyces ...  87.8    1e-16
ref|XP_008249686.1|  PREDICTED: histone deacetylase 10 isoform...  87.4    1e-16
ref|XP_008161626.1|  PREDICTED: histone deacetylase 4 isoform ...  88.2    1e-16
ref|WP_004970448.1|  HdaI-type histone deacetylase [Haloferax ...  85.5    1e-16
gb|EZF30710.1|  hypothetical protein H101_05656 [Trichophyton ...  87.8    1e-16
ref|XP_007060862.1|  PREDICTED: histone deacetylase 4 [Cheloni...  88.2    1e-16
ref|XP_009033232.1|  hypothetical protein AURANDRAFT_13109 [Au...  85.5    1e-16
ref|XP_005863885.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    1e-16
ref|XP_008411328.1|  PREDICTED: histone deacetylase 7 [Poecili...  88.2    1e-16
ref|XP_004743791.1|  PREDICTED: histone deacetylase 4 isoform ...  88.2    1e-16
ref|XP_007531892.1|  PREDICTED: histone deacetylase 5 [Erinace...  88.2    1e-16
ref|WP_009910934.1|  histone deacetylase family protein [Burkh...  84.7    1e-16
ref|NP_034542.3|  histone deacetylase 5 isoform 2 [Mus musculus]   88.2    1e-16
gb|EDL34098.1|  histone deacetylase 5, isoform CRA_a [Mus musc...  88.2    1e-16
ref|XP_009871824.1|  PREDICTED: histone deacetylase 10 [Apalod...  87.4    1e-16
ref|XP_010196830.1|  PREDICTED: histone deacetylase 9 isoform ...  88.2    1e-16
ref|XP_008147502.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    1e-16
ref|XP_007980134.1|  PREDICTED: histone deacetylase 9 isoform ...  88.2    1e-16
ref|XP_005041081.1|  PREDICTED: histone deacetylase 9 isoform ...  88.2    1e-16
ref|XP_008518794.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    1e-16
gb|EZA55439.1|  Histone deacetylase [Cerapachys biroi]             88.2    1e-16
ref|XP_004620705.1|  PREDICTED: histone deacetylase 4 [Sorex a...  88.2    1e-16
gb|EPQ06243.1|  Histone deacetylase 5 [Myotis brandtii]            88.2    1e-16
ref|XP_005411232.1|  PREDICTED: histone deacetylase 4 isoform ...  88.2    1e-16
ref|WP_006665346.1|  histone deacetylase [Natrialba aegyptia]      85.9    1e-16
ref|XP_005863884.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    1e-16
ref|WP_007274869.1|  HdaI-type histone deacetylase [Haloferax ...  85.1    1e-16
ref|WP_007414069.1|  histone deacetylase superfamily [Pedospha...  85.1    1e-16
ref|XP_005205099.1|  PREDICTED: histone deacetylase 4 isoform ...  88.2    1e-16
ref|XP_004003498.1|  PREDICTED: histone deacetylase 4 [Ovis ar...  88.2    1e-16
ref|XP_006092342.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    1e-16
ref|XP_005863887.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    1e-16
ref|XP_005836322.1|  hypothetical protein GUITHDRAFT_68111 [Gu...  85.1    1e-16
ref|WP_020446197.1|  histone deacetylase superfamily protein [...  85.5    1e-16
gb|AAK66822.1|  histone deacetylase 9a [Homo sapiens]              87.8    2e-16
gb|EDL36870.1|  mCG145563 [Mus musculus]                           85.9    2e-16
ref|XP_004407330.1|  PREDICTED: histone deacetylase 5 [Odobenu...  88.2    2e-16
ref|XP_008147501.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    2e-16
ref|XP_007643221.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    2e-16
ref|XP_006866852.1|  PREDICTED: histone deacetylase 4 [Chrysoc...  88.2    2e-16
ref|NP_001071164.1|  histone deacetylase 5 isoform 1 [Mus musc...  88.2    2e-16
emb|CAF93554.1|  unnamed protein product [Tetraodon nigroviridis]  87.8    2e-16
gb|EDL34100.1|  histone deacetylase 5, isoform CRA_c [Mus musc...  88.2    2e-16
ref|XP_009430321.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    2e-16
ref|XP_009430319.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    2e-16
ref|XP_009430320.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    2e-16
ref|XP_009430318.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    2e-16
ref|XP_009249950.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  88.2    2e-16
ref|XP_009430317.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    2e-16
ref|XP_005256964.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    2e-16
ref|XP_008010660.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    2e-16
ref|XP_005256962.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    2e-16
ref|XP_511542.3|  PREDICTED: histone deacetylase 5 isoform X2 ...  88.2    2e-16
ref|NP_005465.2|  histone deacetylase 5 isoform 1 [Homo sapiens]   88.2    2e-16
ref|XP_009430315.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    2e-16
ref|NP_001015053.1|  histone deacetylase 5 isoform 3 [Homo sap...  88.2    2e-16
ref|WP_006492160.1|  Histone deacetylase superfamily [Mesotoga...  85.1    2e-16
ref|XP_007643220.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    2e-16
ref|XP_005807711.1|  PREDICTED: histone deacetylase 7-like [Xi...  87.8    2e-16
ref|XP_005070147.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    2e-16
ref|XP_010217288.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  88.2    2e-16
gb|KFP89688.1|  Histone deacetylase 4 [Apaloderma vittatum]        88.2    2e-16
ref|XP_009625584.1|  PREDICTED: histone deacetylase 8 isoform ...  85.1    2e-16
ref|XP_006738853.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    2e-16
ref|XP_006738854.1|  PREDICTED: histone deacetylase 5 isoform ...  88.2    2e-16
ref|XP_008161629.1|  PREDICTED: histone deacetylase 4 isoform ...  88.2    2e-16
ref|XP_009070131.1|  PREDICTED: histone deacetylase 9 isoform ...  87.8    2e-16
ref|XP_008344371.1|  PREDICTED: histone deacetylase 8 [Malus d...  85.9    2e-16
ref|XP_008161630.1|  PREDICTED: histone deacetylase 4 isoform ...  88.2    2e-16
ref|XP_005299960.1|  PREDICTED: histone deacetylase 4 isoform ...  88.2    2e-16
ref|WP_014730364.1|  histone deacetylase [Mesotoga prima]          85.1    2e-16
ref|XP_006629419.1|  PREDICTED: histone deacetylase 7-like [Le...  87.8    2e-16
ref|XP_005369187.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_002919807.1|  PREDICTED: histone deacetylase 5-like [Ai...  88.2    2e-16
ref|XP_006092341.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_005863886.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_009084274.1|  PREDICTED: histone deacetylase 9 [Serinus...  87.8    2e-16
ref|XP_005518913.1|  PREDICTED: histone deacetylase 9 isoform ...  87.8    2e-16
ref|XP_005299962.1|  PREDICTED: histone deacetylase 4 isoform ...  87.8    2e-16
ref|WP_011277875.1|  deacetylase [Sulfolobus acidocaldarius]       85.1    2e-16
ref|XP_008402302.1|  PREDICTED: histone deacetylase 4 [Poecili...  87.8    2e-16
ref|WP_030699616.1|  histone deacetylase [Streptomyces griseus]    85.5    2e-16
gb|EPY77101.1|  hypothetical protein CB1_001320008 [Camelus fe...  85.5    2e-16
ref|XP_010352250.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
gb|EMC82819.1|  Histone deacetylase 4 [Columba livia]              87.8    2e-16
ref|XP_005070146.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
emb|CAF88863.1|  unnamed protein product [Tetraodon nigroviridis]  84.0    2e-16
emb|CDY52901.1|  BnaCnng23800D [Brassica napus]                    86.7    2e-16
ref|WP_024430094.1|  acetoin utilization protein [Burkholderia...  85.5    2e-16
ref|XP_006271609.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|WP_024562811.1|  histone deacetylase [candidate division W...  84.7    2e-16
ref|XP_006017921.1|  PREDICTED: histone deacetylase 5 [Alligat...  87.8    2e-16
ref|XP_008518800.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_005418594.1|  PREDICTED: histone deacetylase 9 isoform ...  87.8    2e-16
emb|CDQ81948.1|  unnamed protein product [Oncorhynchus mykiss]     85.1    2e-16
gb|EGE07161.1|  histone deacetylase hda1 [Trichophyton equinum...  87.4    2e-16
ref|XP_010191013.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  87.4    2e-16
gb|EKD34928.1|  hypothetical protein ACD_75C02122G0002 [uncult...  84.3    2e-16
ref|XP_006271610.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_006776920.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
gb|ETE71587.1|  Histone deacetylase 7 [Ophiophagus hannah]         87.8    2e-16
ref|XP_005328842.1|  PREDICTED: histone deacetylase 9 isoform ...  87.8    2e-16
ref|XP_004655351.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_005070145.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_005070144.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_010010032.1|  PREDICTED: histone deacetylase 7 [Nestor ...  87.8    2e-16
gb|EHH55297.1|  hypothetical protein EGM_04468 [Macaca fascicu...  87.8    2e-16
ref|XP_008827351.1|  PREDICTED: histone deacetylase 4 isoform ...  87.8    2e-16
ref|XP_008518798.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
gb|KFD46842.1|  hypothetical protein M513_12288 [Trichuris suis]   87.4    2e-16
ref|XP_005907741.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_005220884.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_005907740.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_005220882.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_005411234.1|  PREDICTED: histone deacetylase 4 isoform ...  87.8    2e-16
ref|XP_004013026.1|  PREDICTED: LOW QUALITY PROTEIN: histone d...  87.8    2e-16
ref|XP_007180283.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_006776919.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_002289714.1|  histone deacetylase 1 HDAC Hda1p [Thalass...  87.0    2e-16
emb|CDW86211.1|  histone deacetylase [Stylonychia lemnae]          87.4    2e-16
ref|XP_008111751.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_008111750.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_004655350.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_007128016.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_007180279.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|WP_010100712.1|  histone deacetylase [Burkholderia oklahom...  85.1    2e-16
ref|XP_005220883.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_008518795.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_005597404.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_005693975.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|NP_001033114.2|  histone deacetylase 5 [Bos taurus]            87.8    2e-16
ref|XP_005693974.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_004621050.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_004621049.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_005082251.1|  PREDICTED: histone deacetylase 4 isoform ...  87.8    2e-16
ref|XP_005220885.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_004432603.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_008518797.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_001490721.2|  PREDICTED: histone deacetylase 5 isoformX...  87.8    2e-16
ref|XP_006060632.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_005624467.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_004432602.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_006060631.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_005624466.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_005220881.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_005983731.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_005983730.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_006060633.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_009189036.1|  PREDICTED: histone deacetylase 5 [Papio a...  87.8    2e-16
ref|XP_548064.3|  PREDICTED: histone deacetylase 5 isoformX1 [...  87.8    2e-16
ref|WP_009577338.1|  Histone deacetylase family protein [Xanth...  83.6    2e-16
ref|WP_020252319.1|  MULTISPECIES: hypothetical protein [uncla...  84.7    2e-16
ref|XP_010352243.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_006060630.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
gb|KFO64464.1|  Histone deacetylase 4 [Corvus brachyrhynchos]      87.4    2e-16
ref|XP_005411236.1|  PREDICTED: histone deacetylase 4 isoform ...  87.8    2e-16
gb|EHH25040.1|  hypothetical protein EGK_08794 [Macaca mulatta]    87.8    2e-16
ref|NP_001245027.1|  histone deacetylase 5 [Macaca mulatta]        87.8    2e-16
ref|XP_008010657.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_002371371.1|  histone deacetylase [Toxoplasma gondii ME49]  87.8    2e-16
ref|XP_010352249.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_008010656.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_007180281.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|WP_009766421.1|  histone deacetylase [Sporosarcina newyork...  85.1    2e-16
gb|EGW08173.1|  Histone deacetylase 5 [Cricetulus griseus]         87.4    2e-16
ref|XP_005328843.1|  PREDICTED: histone deacetylase 9 isoform ...  87.4    2e-16
ref|XP_010352246.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16
ref|XP_007455158.1|  PREDICTED: histone deacetylase 5 isoform ...  87.8    2e-16

ALIGNMENTS
>gb|AIA76113.1| deacetylase [Halomonas campaniensis]
Length=313

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 120/181 (66%), Gaps = 1/181 (1%)

Query  16   THPDCENHKLA-QHPERPERLRAVINRLVETGMTQDMKVKLAEELSDDVLIHVHPSKYVE  74
            THPDC  H +  +HPE P+RL A+  RL   G+ Q      A+E  D+ L  VHP++++ 
Sbjct  7    THPDCALHHMGPEHPESPQRLEAIRARLSLAGLLQQTMQADAKEACDEALARVHPTRHLN  66

Query  75   TINRSEPTISTVRLDPDTYMSPGSLRAAKLAAGACVAAVSDILQEKTDRAFCAIRPPGHH  134
             + +  P    V LD DT M+P SL+AA++AAGA +  V  + + + D  FCA+RPPGHH
Sbjct  67   ALEKCLPKEGIVTLDSDTMMNPDSLKAARVAAGAVIRGVDQVFKRQADNVFCAVRPPGHH  126

Query  135  AEVAAAMGFCIFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVDIFKNRPEVLVCSSF  194
            AE A AMGFC +NNIA+ A  A A     R+AI+DFDVH CNGT+DIFKN PEVLVC+SF
Sbjct  127  AEAADAMGFCFYNNIAVGAAHAKAKYGAKRIAILDFDVHQCNGTIDIFKNDPEVLVCTSF  186

Query  195  Q  195
            Q
Sbjct  187  Q  187


>ref|WP_007114266.1| deacetylase [Halomonas boliviensis]
 gb|EHJ91777.1| hypothetical protein KUC_3334 [Halomonas boliviensis LC1]
Length=313

 Score =   193 bits (491),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 122/181 (67%), Gaps = 1/181 (1%)

Query  16   THPDCENHKLA-QHPERPERLRAVINRLVETGMTQDMKVKLAEELSDDVLIHVHPSKYVE  74
            THPDC  H +  +HPE P+RL A+  RL   G+ Q      A+E  ++ L  VHP +++ 
Sbjct  7    THPDCSLHHMGPEHPESPQRLEAIRARLSLAGLLQQTMQADAKEACEEALARVHPLRHLR  66

Query  75   TINRSEPTISTVRLDPDTYMSPGSLRAAKLAAGACVAAVSDILQEKTDRAFCAIRPPGHH  134
            ++++  PT   V LD DT M+P SL+AA++AAGA +  V  + + + D  FCA+RPPGHH
Sbjct  67   SLDKCLPTEGIVTLDSDTMMNPDSLKAARVAAGAVIRGVDQVFKRQADNVFCAVRPPGHH  126

Query  135  AEVAAAMGFCIFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVDIFKNRPEVLVCSSF  194
            AE + AMGFC +NNIA+ A  A A     R+AI+DFDVH CNGT+DIFKN PEVL+C+SF
Sbjct  127  AEASDAMGFCFYNNIAVGAAHARAKYGAKRIAILDFDVHQCNGTIDIFKNDPEVLICTSF  186

Query  195  Q  195
            Q
Sbjct  187  Q  187


>gb|KEA64810.1| Acetylspermidine deacetylase [Marinobacterium sp. AK27]
Length=307

 Score =   192 bits (489),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 121/183 (66%), Gaps = 1/183 (1%)

Query  14   LYTHPDCENHKL-AQHPERPERLRAVINRLVETGMTQDMKVKLAEELSDDVLIHVHPSKY  72
            L +H DCE H++ A HPE PERLRA+  +L  +GM + + + +A   S   L   HP  Y
Sbjct  5    LISHVDCELHQMSAGHPESPERLRAIHRQLELSGMLERLDLLVASPASRAQLELAHPDHY  64

Query  73   VETINRSEPTISTVRLDPDTYMSPGSLRAAKLAAGACVAAVSDILQEKTDRAFCAIRPPG  132
            ++ I    P       DPDT ++P SLRAA LAAGA V  V  +L    D  FCA+RPPG
Sbjct  65   IDAICDLHPERGLSYADPDTALNPHSLRAADLAAGAVVQGVDRVLDGLADNVFCAVRPPG  124

Query  133  HHAEVAAAMGFCIFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVDIFKNRPEVLVCS  192
            HHAE  AAMGFC+FNN+A  A  AL  P + RVA++DFDVHH NGTVDIFK+RP+VLVCS
Sbjct  125  HHAEHDAAMGFCLFNNVATGAGWALQRPGVKRVAVLDFDVHHGNGTVDIFKDRPDVLVCS  184

Query  193  SFQ  195
            SFQ
Sbjct  185  SFQ  187


>ref|WP_009724395.1| deacetylase [Halomonas sp. TD01]
 gb|EGP18679.1| histone deacetylase superfamily protein [Halomonas sp. TD01]
Length=313

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 120/181 (66%), Gaps = 1/181 (1%)

Query  16   THPDCENHKLA-QHPERPERLRAVINRLVETGMTQDMKVKLAEELSDDVLIHVHPSKYVE  74
            THPDC  H +  +HPE P+RL A+  RL   G+ Q      A+E  ++ L  VHP++++ 
Sbjct  7    THPDCALHHMGPEHPESPQRLEAIRARLSLAGLLQQTMQADAKEACNEALARVHPTRHLN  66

Query  75   TINRSEPTISTVRLDPDTYMSPGSLRAAKLAAGACVAAVSDILQEKTDRAFCAIRPPGHH  134
             + +  P    V LD DT M+P SL+AA++AAGA +  V  + + + D  FCA+RPPGHH
Sbjct  67   ALEKCLPKEGIVTLDSDTMMNPDSLKAARVAAGAVIRGVDQVFKRQADNVFCAVRPPGHH  126

Query  135  AEVAAAMGFCIFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVDIFKNRPEVLVCSSF  194
            AE A AMGFC +NNIA+ A  A A     R+AI+DFDVH CNGT+DIFKN PEVLVC+SF
Sbjct  127  AEAADAMGFCFYNNIAVGAAHAKAKYGARRIAILDFDVHQCNGTIDIFKNDPEVLVCTSF  186

Query  195  Q  195
            Q
Sbjct  187  Q  187


>ref|WP_007462293.1| histone deacetylase superfamily [Photobacterium sp. AK15]
 gb|ELR67633.1| histone deacetylase superfamily [Photobacterium sp. AK15]
Length=307

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 119/181 (66%), Gaps = 1/181 (1%)

Query  16   THPDCENHKLA-QHPERPERLRAVINRLVETGMTQDMKVKLAEELSDDVLIHVHPSKYVE  74
            TH D   H +  QHPE PERL A+ + L  T +   +    AE  +++ L  VHP+ Y+ 
Sbjct  7    THGDYLLHSMGEQHPECPERLGAITSYLASTELGNQVTWLSAESATNEQLERVHPADYIR  66

Query  75   TINRSEPTISTVRLDPDTYMSPGSLRAAKLAAGACVAAVSDILQEKTDRAFCAIRPPGHH  134
             ++  +P    V  DPDT ++P ++ AA+LAAGA   A   +L  K   AFCA+RPPGHH
Sbjct  67   RLDSMQPQRGLVYADPDTALNPHTMHAARLAAGAVTMATELVLSGKISNAFCAVRPPGHH  126

Query  135  AEVAAAMGFCIFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVDIFKNRPEVLVCSSF  194
            AE   AMGFC FNNIA+  E AL H +I RVAI+DFDVHHCNGTVD FK+RPEVLVCS+F
Sbjct  127  AEHNTAMGFCFFNNIAVGVEQALTHYEIERVAILDFDVHHCNGTVDAFKDRPEVLVCSTF  186

Query  195  Q  195
            Q
Sbjct  187  Q  187


>ref|WP_008957937.1| deacetylase [Halomonas sp. HAL1]
 gb|EHA15621.1| histone deacetylase superfamily protein [Halomonas sp. HAL1]
 gb|KFC11348.1| Histone deacetylase domain containing protein [Halomonas sp. 
KO116]
Length=313

 Score =   191 bits (485),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 120/181 (66%), Gaps = 1/181 (1%)

Query  16   THPDCENHKLA-QHPERPERLRAVINRLVETGMTQDMKVKLAEELSDDVLIHVHPSKYVE  74
            THPDC  H +  +HPE P+RL A+  RL   G+ Q      A+E  ++ L  VHP +++ 
Sbjct  7    THPDCSLHHMGPEHPESPQRLEAIRARLSLAGLLQQTMQADAKEACEEALARVHPLRHLR  66

Query  75   TINRSEPTISTVRLDPDTYMSPGSLRAAKLAAGACVAAVSDILQEKTDRAFCAIRPPGHH  134
             + +  P+   V LD DT M+P SL+AA++AAGA +  V  + + + D  FCA+RPPGHH
Sbjct  67   ALEKCLPSEGIVTLDSDTMMNPNSLKAARVAAGAVIRGVDQVFKRQADNVFCAVRPPGHH  126

Query  135  AEVAAAMGFCIFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVDIFKNRPEVLVCSSF  194
            AE + AMGFC +NNIA+ A  A A     R+AI+DFDVH CNGT+DIFKN PEVL+C+SF
Sbjct  127  AEASDAMGFCFYNNIAVGAAHARAKYGAKRIAILDFDVHQCNGTIDIFKNDPEVLICTSF  186

Query  195  Q  195
            Q
Sbjct  187  Q  187


>ref|WP_008042647.1| Deacetylase, including yeast histone deacetylase and acetoin 
utilization protein [Reinekea blandensis]
 gb|EAR10275.1| Deacetylase, including yeast histone deacetylase and acetoin 
utilization protein [Reinekea sp. MED297]
Length=308

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 125/187 (67%), Gaps = 2/187 (1%)

Query  10   KPMYLYTHPDCENHKLAQ-HPERPERLRAVINRLVETGMTQDMKVKLAEELSDDVLIHVH  68
            K  ++Y H  CE H + + HPE P R   +  RL+E+G+ + +    A + +   ++ VH
Sbjct  3    KTAFIY-HEHCELHDMGEDHPESPRRTEIIRERLIESGLMEQLLPLKAFQATKSQILRVH  61

Query  69   PSKYVETINRSEPTISTVRLDPDTYMSPGSLRAAKLAAGACVAAVSDILQEKTDRAFCAI  128
             S YV+ ++R  P    ++ DPDT M P +  A+ LAAGA + AV  I+    +RAFCA+
Sbjct  62   HSTYVDQLDRINPKYGLIQADPDTLMGPYTYEASYLAAGAGIQAVDGIMNGAFNRAFCAV  121

Query  129  RPPGHHAEVAAAMGFCIFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVDIFKNRPEV  188
            RPPGHHAE    MGFC FNNIA+AAE AL H  ++RVAI+DFDVH CNGT+++++NRPEV
Sbjct  122  RPPGHHAEPNVTMGFCFFNNIAVAAEHALKHHKLSRVAIIDFDVHQCNGTIEMYENRPEV  181

Query  189  LVCSSFQ  195
            ++C+SFQ
Sbjct  182  MICTSFQ  188


>ref|WP_009287865.1| MULTISPECIES: Histone deacetylase superfamily [Halomonas]
 gb|ELY20998.1| Histone deacetylase superfamily [Halomonas titanicae BH1]
Length=313

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 120/181 (66%), Gaps = 1/181 (1%)

Query  16   THPDCENHKLA-QHPERPERLRAVINRLVETGMTQDMKVKLAEELSDDVLIHVHPSKYVE  74
            THPDC  H +  +HPE P+RL A+  RL   G+ Q      A+   ++ L  VHP +++ 
Sbjct  7    THPDCSLHHMGPEHPESPQRLEAIRARLSLVGLLQQTMQADAKAACEESLARVHPLRHLR  66

Query  75   TINRSEPTISTVRLDPDTYMSPGSLRAAKLAAGACVAAVSDILQEKTDRAFCAIRPPGHH  134
            ++ +  PT   V LD DT M+P SL+AA++AAGA +  V  + + + D  FCA+RPPGHH
Sbjct  67   SLEKCLPTEGIVTLDSDTMMNPDSLQAARVAAGAVIRGVDQVFKRQADNVFCAVRPPGHH  126

Query  135  AEVAAAMGFCIFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVDIFKNRPEVLVCSSF  194
            AE + AMGFC +NNIA+ A  A A     R+AI+DFDVH CNGT+DIFKN PE+L+C+SF
Sbjct  127  AEASDAMGFCFYNNIAVGAAHARAKYGAKRIAILDFDVHQCNGTIDIFKNDPEILICTSF  186

Query  195  Q  195
            Q
Sbjct  187  Q  187


>ref|WP_022523452.1| hypothetical protein [Halomonas sp. A3H3]
 emb|CDG55249.1| conserved hypothetical protein [Halomonas sp. A3H3]
Length=313

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 120/181 (66%), Gaps = 1/181 (1%)

Query  16   THPDCENHKLA-QHPERPERLRAVINRLVETGMTQDMKVKLAEELSDDVLIHVHPSKYVE  74
            THPDC  H +  +HPE P+RL A+  RL   G+ Q      A+   ++ L  VHP +++ 
Sbjct  7    THPDCSLHHMGPEHPESPQRLEAIRARLSLVGLLQQTMQADAKAACEESLARVHPLRHLR  66

Query  75   TINRSEPTISTVRLDPDTYMSPGSLRAAKLAAGACVAAVSDILQEKTDRAFCAIRPPGHH  134
            ++ +  PT   V LD DT M+P SL+AA++AAGA +  V  + + + D  FCA+RPPGHH
Sbjct  67   SLEKCLPTEGLVTLDSDTMMNPDSLQAARVAAGAVIRGVDQVFKRQADNVFCAVRPPGHH  126

Query  135  AEVAAAMGFCIFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVDIFKNRPEVLVCSSF  194
            AE + AMGFC +NNIA+ A  A A     R+AI+DFDVH CNGT+DIFKN PE+L+C+SF
Sbjct  127  AEASDAMGFCFYNNIAVGAAHARAKYGAKRIAILDFDVHQCNGTIDIFKNDPEILICTSF  186

Query  195  Q  195
            Q
Sbjct  187  Q  187


>ref|WP_011398575.1| deacetylase [Hahella chejuensis]
 ref|YP_435935.1| deacetylase [Hahella chejuensis KCTC 2396]
 gb|ABC31510.1| Deacetylases, including yeast histone deacetylase and acetoin 
utilization protein [Hahella chejuensis KCTC 2396]
Length=307

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 123/183 (67%), Gaps = 1/183 (1%)

Query  14   LYTHPDCENHKLAQ-HPERPERLRAVINRLVETGMTQDMKVKLAEELSDDVLIHVHPSKY  72
            L+ H DC  H + + HPE P RL+A+++RL   G+ Q++ +   +E   D +I VHPS+Y
Sbjct  5    LFYHKDCTLHDMGEGHPESPMRLQAIMDRLEHAGILQEVDLVEPQETDRDKIIRVHPSRY  64

Query  73   VETINRSEPTISTVRLDPDTYMSPGSLRAAKLAAGACVAAVSDILQEKTDRAFCAIRPPG  132
            VE +    P    + +DPDT +   SLRAA LAAG+ V A + +L  + + AFCA+RPPG
Sbjct  65   VEQLENLNPDKGRIMVDPDTALMRHSLRAAYLAAGSAVEAANMVLSGQANTAFCAVRPPG  124

Query  133  HHAEVAAAMGFCIFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVDIFKNRPEVLVCS  192
            HHAE + +MGFC FNNIA+AA  A+    + R+AIVDFDVH  NGTVDIF++ P VL CS
Sbjct  125  HHAERSKSMGFCFFNNIAIAARHAMDFHGLERIAIVDFDVHQGNGTVDIFQDDPRVLFCS  184

Query  193  SFQ  195
            SF+
Sbjct  185  SFE  187



________________________________________________________________________________________________________________________

BLAST fait sur SWISSPROT

 Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q8RX28.1|HDA5_ARATH  RecName: Full=Histone deacetylase 5 [A...    114   5e-28
sp|Q969S8.1|HDA10_HUMAN  RecName: Full=Histone deacetylase 10;...    112   3e-27
sp|O27262.1|Y1194_METTH  RecName: Full=Uncharacterized protein...    107   2e-26
sp|O30107.1|Y130_ARCFU  RecName: Full=Uncharacterized protein ...    107   3e-26
sp|P72702.1|Y245_SYNY3  RecName: Full=Uncharacterized protein ...    105   7e-26
sp|Q94EJ2.1|HDA8_ARATH  RecName: Full=Histone deacetylase 8 [A...    106   8e-26
sp|Q6P3E7.2|HDA10_MOUSE  RecName: Full=Histone deacetylase 10;...    107   1e-25
sp|Q8LRK8.1|HDA18_ARATH  RecName: Full=Histone deacetylase 18 ...    107   3e-25
sp|Q70I53.3|HDAH_ALCSD  RecName: Full=Histone deacetylase-like...    102   1e-24
sp|Q5A960.1|HDA1_CANAL  RecName: Full=Histone deacetylase HDA1...    104   4e-24
sp|Q9Z2V5.3|HDAC6_MOUSE  RecName: Full=Histone deacetylase 6; ...    103   7e-24
sp|Q20296.2|HDA6_CAEEL  RecName: Full=Histone deacetylase 6 [C...    100   6e-23
sp|Q941D6.1|HDA14_ARATH  RecName: Full=Histone deacetylase 14 ...  98.2    8e-23
sp|Q57955.1|Y535_METJA  RecName: Full=Uncharacterized protein ...  97.4    8e-23
sp|O17323.3|HDA4_CAEEL  RecName: Full=Histone deacetylase 4; A...  99.0    2e-22
sp|Q9UBN7.2|HDAC6_HUMAN  RecName: Full=Histone deacetylase 6; ...  99.0    3e-22
sp|P53973.1|HDA1_YEAST  RecName: Full=Histone deacetylase HDA1...  98.2    3e-22
sp|Q8GXJ1.2|HDA15_ARATH  RecName: Full=Histone deacetylase 15 ...  97.1    6e-22
sp|Q613L4.1|HDA4_CAEBR  RecName: Full=Histone deacetylase 4 [C...  97.4    8e-22
sp|Q569C4.1|HDA10_RAT  RecName: Full=Histone deacetylase 10; S...  94.0    7e-21
sp|Q54X15.1|HDA21_DICDI  RecName: Full=Type-2 histone deacetyl...  94.0    2e-20
sp|Q54VQ7.1|HDA22_DICDI  RecName: Full=Type-2 histone deacetyl...  93.2    3e-20
sp|P56523.1|CLR3_SCHPO  RecName: Full=Histone deacetylase clr3...  92.4    3e-20
sp|P56524.3|HDAC4_HUMAN  RecName: Full=Histone deacetylase 4; ...  92.8    4e-20
sp|Q99P99.2|HDAC4_RAT  RecName: Full=Histone deacetylase 4; Sh...  92.4    5e-20
sp|Q6NZM9.1|HDAC4_MOUSE  RecName: Full=Histone deacetylase 4; ...  92.0    7e-20
sp|P83038.1|HDAC4_CHICK  RecName: Full=Histone deacetylase 4; ...  89.7    4e-19
sp|Q9UKV0.2|HDAC9_HUMAN  RecName: Full=Histone deacetylase 9; ...  88.6    9e-19
sp|Q9Z2V6.2|HDAC5_MOUSE  RecName: Full=Histone deacetylase 5; ...  88.6    1e-18
sp|Q9UQL6.2|HDAC5_HUMAN  RecName: Full=Histone deacetylase 5; ...  88.2    1e-18
sp|Q80ZH1.1|HDAC5_CRIGR  RecName: Full=Histone deacetylase 5; ...  87.4    2e-18
sp|Q5R902.1|HDAC5_PONAB  RecName: Full=Histone deacetylase 5; ...  85.9    8e-18
sp|Q8C2B3.2|HDAC7_MOUSE  RecName: Full=Histone deacetylase 7; ...  85.1    1e-17
sp|Q8WUI4.2|HDAC7_HUMAN  RecName: Full=Histone deacetylase 7; ...  83.6    4e-17
sp|Q02959.1|HOS3_YEAST  RecName: Full=Histone deacetylase HOS3...  77.0    5e-15
sp|Q48935.1|APHA_MYCRA  RecName: Full=Acetylpolyamine aminohyd...  73.9    2e-14
sp|O59702.1|CLR6_SCHPO  RecName: Full=Histone deacetylase clr6...  74.3    2e-14
sp|Q91695.1|HDA1A_XENLA  RecName: Full=Probable histone deacet...  72.0    1e-13
sp|P56517.1|HDAC1_CHICK  RecName: Full=Histone deacetylase 1; ...  71.2    3e-13
sp|O42227.1|HDA1B_XENLA  RecName: Full=Probable histone deacet...  70.5    5e-13
sp|Q13547.1|HDAC1_HUMAN  RecName: Full=Histone deacetylase 1; ...  70.1    7e-13
sp|Q32PJ8.1|HDAC1_BOVIN  RecName: Full=Histone deacetylase 1; ...  70.1    8e-13
sp|Q4QQW4.1|HDAC1_RAT  RecName: Full=Histone deacetylase 1; Sh...  69.7    8e-13
sp|O09106.1|HDAC1_MOUSE  RecName: Full=Histone deacetylase 1; ...  69.7    8e-13
sp|Q92769.2|HDAC2_HUMAN  RecName: Full=Histone deacetylase 2; ...  69.7    1e-12
sp|P70288.1|HDAC2_MOUSE  RecName: Full=Histone deacetylase 2; ...  69.3    1e-12
sp|P56519.1|HDAC2_CHICK  RecName: Full=Histone deacetylase 2; ...  69.3    1e-12
sp|Q94517.2|HDAC1_DROME  RecName: Full=Histone deacetylase Rpd...  68.9    2e-12
sp|P32561.1|RPD3_YEAST  RecName: Full=Histone deacetylase RPD3...  65.9    1e-11
sp|P56518.1|HDAC1_STRPU  RecName: Full=Histone deacetylase 1; ...  65.1    3e-11
sp|O88895.1|HDAC3_MOUSE  RecName: Full=Histone deacetylase 3; ...  61.6    3e-10
sp|Q55FN5.1|HDA11_DICDI  RecName: Full=Type-1 histone deacetyl...  62.0    3e-10
sp|O15379.2|HDAC3_HUMAN  RecName: Full=Histone deacetylase 3; ...  61.6    4e-10
sp|Q6P6W3.1|HDAC3_RAT  RecName: Full=Histone deacetylase 3; Sh...  61.6    4e-10
sp|Q5RB76.1|HDAC3_PONAB  RecName: Full=Histone deacetylase 3; ...  61.6    4e-10
sp|Q4SFA0.1|HDAC3_TETNG  RecName: Full=Histone deacetylase 3; ...  61.6    4e-10
sp|Q803C3.1|HDAC3_DANRE  RecName: Full=Histone deacetylase 3; ...  61.6    4e-10
sp|Q6GFX3.1|ACUC_STAAR  RecName: Full=Acetoin utilization prot...  60.8    6e-10
sp|P56520.1|HDAC3_CHICK  RecName: Full=Histone deacetylase 3; ...  60.5    1e-09
sp|O13298.1|PHD1_SCHPO  RecName: Full=Histone deacetylase phd1...  60.5    1e-09
sp|Q8NW34.1|ACUC_STAAW  RecName: Full=Acetoin utilization prot...  59.7    1e-09
sp|Q28DV3.1|HDAC3_XENTR  RecName: Full=Histone deacetylase 3; ...  59.7    2e-09
sp|Q5HF39.1|ACUC_STAAC  RecName: Full=Acetoin utilization prot...  59.3    2e-09
sp|Q6IRL9.2|HDAC3_XENLA  RecName: Full=Histone deacetylase 3; ...  58.9    3e-09
sp|P53096.1|HOS2_YEAST  RecName: Full=Probable histone deacety...  58.2    6e-09
sp|Q09440.1|HDA2_CAEEL  RecName: Full=Putative histone deacety...  57.8    7e-09
sp|O17695.1|HDA1_CAEEL  RecName: Full=Histone deacetylase 1 [C...  57.4    1e-08
sp|P56521.1|HDA19_MAIZE  RecName: Full=Probable histone deacet...  57.0    1e-08
sp|O22446.2|HDA19_ARATH  RecName: Full=Histone deacetylase 19;...  56.6    2e-08
sp|Q3JUN4.1|APHA_BURP1  RecName: Full=Acetylpolyamine aminohyd...  55.8    3e-08
sp|B1H369.1|HDAC8_XENTR  RecName: Full=Histone deacetylase 8; ...  55.8    3e-08
sp|P64376.1|ACUC_STAAN  RecName: Full=Acetoin utilization prot...  55.8    3e-08
sp|Q55BW2.1|HDA12_DICDI  RecName: Full=Histone deacetylase B; ...  55.5    4e-08
sp|P28606.2|Y1628_SYNP2  RecName: Full=Uncharacterized protein...  54.7    7e-08
sp|Q56195.1|ACUC_STAXY  RecName: Full=Acetoin utilization prot...  53.9    1e-07
sp|Q6GPA7.1|HDAC8_XENLA  RecName: Full=Histone deacetylase 8; ...  52.8    3e-07
sp|Q8H0W2.1|HDA9_ARATH  RecName: Full=Histone deacetylase 9 [A...  51.2    1e-06
sp|Q9FML2.1|HDA6_ARATH  RecName: Full=Histone deacetylase 6 [A...  48.9    8e-06
sp|Q944K3.2|HDA2_ARATH  RecName: Full=Histone deacetylase 2 [A...  47.8    2e-05
sp|Q9GKU5.2|HDA11_MACFA  RecName: Full=Histone deacetylase 11;...  47.8    2e-05
sp|Q96DB2.1|HDA11_HUMAN  RecName: Full=Histone deacetylase 11;...  47.4    2e-05
sp|Q91WA3.1|HDA11_MOUSE  RecName: Full=Histone deacetylase 11;...  47.4    2e-05
sp|P39067.1|ACUC_BACSU  RecName: Full=Acetoin utilization prot...  46.2    5e-05
sp|Q7SXM0.1|HDAC8_DANRE  RecName: Full=Histone deacetylase 8; ...  45.8    7e-05
sp|Q0VCB2.1|HDAC8_BOVIN  RecName: Full=Histone deacetylase 8; ...  43.9    3e-04
sp|B1WC68.1|HDAC8_RAT  RecName: Full=Histone deacetylase 8; Sh...  42.7    8e-04
sp|Q8VH37.2|HDAC8_MOUSE  RecName: Full=Histone deacetylase 8; ...  42.7    8e-04
sp|Q12214.1|HOS1_YEAST  RecName: Full=Histone deacetylase HOS1...  42.7    0.001
sp|Q9BY41.2|HDAC8_HUMAN  RecName: Full=Histone deacetylase 8; ...  41.6    0.002
sp|Q9S9X4.1|FBL8_ARATH  RecName: Full=Putative F-box/LRR-repea...  33.5    1.1  
sp|Q9C626.1|FB37_ARATH  RecName: Full=F-box protein At1g47056 ...  33.1    1.2  
sp|Q7Q323.2|FEN1_ANOGA  RecName: Full=Flap endonuclease 1; Sho...  31.2    5.5  
sp|Q178M1.1|FEN1_AEDAE  RecName: Full=Flap endonuclease 1; Sho...  30.8    6.2  
sp|O45293.1|GALT8_CAEEL  RecName: Full=Probable N-acetylgalact...  30.4    9.3  
sp|Q9HJ26.1|DNLI_THEAC  RecName: Full=DNA ligase; AltName: Ful...  30.4    9.9  

ALIGNMENTS
>sp|Q8RX28.1|HDA5_ARATH RecName: Full=Histone deacetylase 5 [Arabidopsis thaliana]
Length=660

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 101/194 (52%), Gaps = 22/194 (11%)

Query  18   PDCENHKLAQHPERPERLRAVINRLVETGMTQDMKVKLAEELSDDVLIHVHPSKYVETIN  77
            PD E+H     PE P+R+R +  +L   G++Q   V  + +  D  L  VH   +V  + 
Sbjct  41   PDGEDH-----PECPDRIRVIWEKLQLAGVSQRCVVLGSSKAEDKHLQLVHTKDHVNLVK  95

Query  78   RSEPTISTVRLD----------PDTYMSPGSLRAAKLAAGACVAAVSDILQEKTDRAFCA  127
                +IST + D             Y++ GS  AA LAAG+ V     + + + D  F  
Sbjct  96   ----SISTKQKDYRRNRIASQLNSIYLNGGSSEAAYLAAGSVVKLAEKVAEGELDCGFAI  151

Query  128  IRPPGHHAEVAAAMGFCIFNNIALAAETAL-AHPD--INRVAIVDFDVHHCNGTVDIFKN  184
            +RPPGHHAE   AMGFC+FNN+A+AA   L   PD  + ++ IVD+DVHH NGT  +F  
Sbjct  152  VRPPGHHAEADEAMGFCLFNNVAVAASFLLNERPDLGVKKILIVDWDVHHGNGTQKMFWK  211

Query  185  RPEVLVCSSFQENY  198
             P VL  S  +  Y
Sbjct  212  DPRVLFFSVHRHEY  225


>sp|Q969S8.1|HDA10_HUMAN RecName: Full=Histone deacetylase 10; Short=HD10 [Homo sapiens]
Length=669

 Score =   112 bits (281),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 67/185 (36%), Positives = 98/185 (53%), Gaps = 14/185 (8%)

Query  14   LYTHPDCENHKLAQHPERPERLRAVINRLVETGMTQDMKVKLAEELSDDVLIHVHPSKYV  73
            L+  P+CE        ERPERL A ++RL + G+ Q      A E S++ L  VH  +YV
Sbjct  17   LWDDPECE-------IERPERLTAALDRLRQRGLEQRCLRLSAREASEEELGLVHSPEYV  69

Query  74   ------ETINRSEPTISTVRLDPDTYMSPGSLRAAKLAAGACVAAVSDILQEKTDRAFCA  127
                  + + + E    + + D   Y  P +   A+LAAGA +  V  +L          
Sbjct  70   SLVRETQVLGKEELQALSGQFDA-IYFHPSTFHCARLAAGAGLQLVDAVLTGAVQNGLAL  128

Query  128  IRPPGHHAEVAAAMGFCIFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVDIFKNRPE  187
            +RPPGHH + AAA GFC+FNN+A+AA  A     ++R+ +VD+DVHH  G   +F++ P 
Sbjct  129  VRPPGHHGQRAAANGFCVFNNVAIAAAHAKQKHGLHRILVVDWDVHHGQGIQYLFEDDPS  188

Query  188  VLVCS  192
            VL  S
Sbjct  189  VLYFS  193


>sp|O27262.1|Y1194_METTH RecName: Full=Uncharacterized protein MTH_1194 [Methanothermobacter 
thermautotrophicus str. Delta H]
Length=331

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 97/178 (54%), Gaps = 7/178 (4%)

Query  19   DCENHKLAQHPERPERLRAVINRLVETGMTQDMKVKLAEELSDDVLIHVHPSKYVETINR  78
            D  NH+   H E   R RA++ R +E+       V+      DD+L+ VH S +VE +  
Sbjct  10   DLHNHE--GHVENSGRTRAIL-RAIESSDLSPRFVEPGMAGIDDILM-VHSSTHVEYLEV  65

Query  79   SEPTISTVRLDPDTYMSPGSLRAAKLAAGACVAAVSDILQEKTDRAFCAIRPPGHHAEVA  138
                     LD DTYM+P S   A+L+AG  + A  + L++    ++   RPPGHHA   
Sbjct  66   FAGR-GGGWLDYDTYMTPESFSVARLSAGGAMLAAEEALRDGW--SYSLGRPPGHHATYD  122

Query  139  AAMGFCIFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVDIFKNRPEVLVCSSFQE  196
             +MGFCIFNNIA+A E A  +  ++R  ++DFDVHH NGT  IF    +V+  S  Q+
Sbjct  123  RSMGFCIFNNIAIAIEHARRNLGVSRPLVLDFDVHHGNGTSSIFYRDRDVMYISIHQD  180


>sp|O30107.1|Y130_ARCFU RecName: Full=Uncharacterized protein AF_0130 [Archaeoglobus 
fulgidus DSM 4304]
Length=359

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 90/171 (53%), Gaps = 7/171 (4%)

Query  28   HPERPERLRAVINRLVETGMTQDMKVKLAEELS---DDVLIHVHPSKYVETINRSEPTIS  84
            HPER ERL   +++L E G+ +  ++ L E      +DVL  VH  +YV  +        
Sbjct  20   HPERRERLAYTMDQLREEGIFESERIVLLEPFKASLEDVL-EVHTEEYVRFLEMESKKGG  78

Query  85   TVRLDPDTYMSPGSLRAAKLAAGACVAAVSDILQEKTDRAFCAIRPPGHHAEVAAAMGFC  144
             +  D DT +  G    A LAAG  + A   +L ++ + AF  IRPPGHHA+     GFC
Sbjct  79   II--DFDTNIPVGVFDRALLAAGGAIRAAQAVLNKECENAFAMIRPPGHHAKPYIGAGFC  136

Query  145  IFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVDIFKNRPEVLVCSSFQ  195
              NN+A+  +  L      R+AI+D+D HH +GT +IF N   VL  S+ Q
Sbjct  137  YLNNMAIMVKWLLKQ-GFERIAILDWDAHHGDGTQEIFYNDDRVLFISTHQ  186


>sp|P72702.1|Y245_SYNY3 RecName: Full=Uncharacterized protein slr0245 [Synechocystis 
sp. PCC 6803 substr. Kazusa]
Length=304

 Score =   105 bits (263),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 89/171 (52%), Gaps = 5/171 (3%)

Query  28   HPERPERLRAVINRLVETGMTQDMKVKLAEELS---DDVLIHVHPSKYVETINRSEPTIS  84
            HPE P RL A+   L +      +  +    ++   D  ++  H  +Y+  + +    + 
Sbjct  19   HPECPARLTAIATALRKMPGANYLHWQKPSPVTWNLDPYILRCHSQEYLNKLAKLA-ELG  77

Query  85   TVRLDPDTYMSPGSLRAAKLAAGACVAAVSDILQEKTDRAFCAIRPPGHHAEVAAAMGFC  144
               LD DT +SP S   A+LA  A +  V  +L ++ +  F   RPPGHHA     MGFC
Sbjct  78   GGSLDADTPVSPQSYDVARLAVRAWLDGVDHVLNQR-EAVFVLARPPGHHAIRNTGMGFC  136

Query  145  IFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVDIFKNRPEVLVCSSFQ  195
            + NN+A+AA  AL  P + RVAI+D+DVHH NGT  +  + P +  CS  Q
Sbjct  137  LLNNVAIAAHYALTRPGVERVAILDWDVHHGNGTEALVDHNPRIFYCSLHQ  187


>sp|Q94EJ2.1|HDA8_ARATH RecName: Full=Histone deacetylase 8 [Arabidopsis thaliana]
Length=377

 Score =   106 bits (264),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 90/168 (54%), Gaps = 0/168 (0%)

Query  25   LAQHPERPERLRAVINRLVETGMTQDMKVKLAEELSDDVLIHVHPSKYVETINRSEPTIS  84
            L +HPE  +R+R +++ L    +   +            L+  H S+Y+E +  ++ +  
Sbjct  36   LEKHPENADRVRNMLSILRRGPIAPHVNWFTGLPAIVSELLMFHTSEYIEKLVEADKSGE  95

Query  85   TVRLDPDTYMSPGSLRAAKLAAGACVAAVSDILQEKTDRAFCAIRPPGHHAEVAAAMGFC  144
               +   T+MSPGS  AA LAAG  ++A+  IL      A+  +RPPGHH++   A G+C
Sbjct  96   RCEIAAGTFMSPGSWEAALLAAGTTLSAMQHILDCHGKIAYALVRPPGHHSQPTQADGYC  155

Query  145  IFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVDIFKNRPEVLVCS  192
              NN ALA + AL     +RVA++D DVH+ NGT + F    +VL  S
Sbjct  156  FLNNAALAVKLALNSGSCSRVAVIDIDVHYGNGTAEGFYTSDKVLTVS  203


>sp|Q6P3E7.2|HDA10_MOUSE RecName: Full=Histone deacetylase 10; Short=HD10 [Mus musculus]
Length=666

 Score =   107 bits (268),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 66/185 (36%), Positives = 96/185 (52%), Gaps = 14/185 (8%)

Query  14   LYTHPDCENHKLAQHPERPERLRAVINRLVETGMTQDMKVKLAEELSDDVLIHVHPSKYV  73
            L+  P+CE        E PERL A ++ L + G+ +      A E S++ L  VH  +Y+
Sbjct  17   LWDDPECE-------IECPERLTAALDGLRQRGLEERCLCLSACEASEEELGLVHSPEYI  69

Query  74   ETINRSEPTISTVRLDP------DTYMSPGSLRAAKLAAGACVAAVSDILQEKTDRAFCA  127
              + +++ T+    L          Y  P +   A+LAAGA +  V  +L          
Sbjct  70   ALVQKTQ-TLDKEELHALSKQYNAVYFHPDTFHCARLAAGAALQLVDAVLTGAVHNGLAL  128

Query  128  IRPPGHHAEVAAAMGFCIFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVDIFKNRPE  187
            +RPPGHH++ AAA GFC+FNN+ALAA+ A     + R+ IVD+DVHH  G   IF + P 
Sbjct  129  VRPPGHHSQRAAANGFCVFNNVALAAKHAKQKYGLQRILIVDWDVHHGQGIQYIFNDDPS  188

Query  188  VLVCS  192
            VL  S
Sbjct  189  VLYFS  193


>sp|Q8LRK8.1|HDA18_ARATH RecName: Full=Histone deacetylase 18 [Arabidopsis thaliana]
Length=682

 Score =   107 bits (266),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 66/182 (36%), Positives = 97/182 (53%), Gaps = 17/182 (9%)

Query  30   ERPERLRAVINRLVETGMTQDMKVKLAEELSDDVLIHVHPSKYVETINRSEPTISTVRLD  89
            E P+R+R +  +L   G+TQ   V    +  D  L  VH  K+V  +     +IST + D
Sbjct  81   ECPDRIRVIWEKLQLAGVTQRCVVLGGSKAEDKHLKLVHTKKHVNLVK----SISTKKKD  136

Query  90   P----------DTYMSPGSLRAAKLAAGACVAAVSDILQEKTDRAFCAIRPPGHHAEVAA  139
                         Y++ GS  AA LAAG+ V     + + + D  F  +RPPGHHAE   
Sbjct  137  SRRNKIASQLDSIYLNGGSSEAAYLAAGSVVKVAEKVAEGELDCGFAIVRPPGHHAESDE  196

Query  140  AMGFCIFNNIALAAETAL-AHPDIN--RVAIVDFDVHHCNGTVDIFKNRPEVLVCSSFQE  196
            AMGFC+FNN+A+AA   L   PD++  ++ IVD+D+HH NGT  +F     VL+ S  + 
Sbjct  197  AMGFCLFNNVAVAASFLLNERPDLDVKKILIVDWDIHHGNGTQKMFWKDSRVLIFSVHRH  256

Query  197  NY  198
            ++
Sbjct  257  DH  258


>sp|Q70I53.3|HDAH_ALCSD RecName: Full=Histone deacetylase-like amidohydrolase; Short=HDAC-like 
amidohydrolase; Short=HDAH [Alcaligenaceae bacterium 
FB188]
Length=369

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 90/176 (51%), Gaps = 7/176 (4%)

Query  22   NHKLAQHPERPERLRAVINRLVETGMTQDMKVKLAEELSDDVLIHVHPSKYVETINRSE-  80
            +H LA HP+   R   ++     +G  + +    A   +D  ++  H + ++E + R   
Sbjct  34   SHHLA-HPDTKRRFHELV---CASGQIEHLTPIAAVAATDADILRAHSAAHLENMKRVSN  89

Query  81   -PTISTVRLDPDTYMSPGSLRAAKLAAGACVAAVSDILQEKTDRAFCAIRPPGHHAEVAA  139
             PT      D  T M  G L  A+L+AG  V     +   +    +  + PPGHHA   A
Sbjct  90   LPTGGDTG-DGITMMGNGGLEIARLSAGGAVELTRRVATGELSAGYALVNPPGHHAPHNA  148

Query  140  AMGFCIFNNIALAAETALAHPDINRVAIVDFDVHHCNGTVDIFKNRPEVLVCSSFQ  195
            AMGFCIFNN ++AA  A A   + RVAI+D+DVHH NGT DI+ N P VL  S  Q
Sbjct  149  AMGFCIFNNTSVAAGYARAVLGMERVAILDWDVHHGNGTQDIWWNDPSVLTISLHQ  204


>sp|Q5A960.1|HDA1_CANAL RecName: Full=Histone deacetylase HDA1 [Candida albicans SC5314]
Length=833

 Score =   104 bits (259),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 62/186 (33%), Positives = 101/186 (54%), Gaps = 23/186 (12%)

Query  28   HPERPERLRAVINRLVETGMTQD-------------MKVKLAEELSDDVLIHVHPSKYVE  74
            HPE P R+  +  +LVE G+  D             +K+ + E  S+++L  VH   +++
Sbjct  144  HPEDPRRIYRIYKKLVEAGIVLDPSLAGINEIGPFMLKIPIREATSEEIL-QVHSEDHLK  202

Query  75   TINRSEPTISTVRLDPDT------YMSPGSLRAAKLAAGACVAAVSDILQEKTDRAFCAI  128
             I  +E  +S  +L  +T      Y++  S  +AKL+ G  + A   +++ +   +   +
Sbjct  203  FIQSTE-DMSRDQLLKETETGDSIYVNNDSYLSAKLSCGGTIEACKAVIEGRVKNSLAIV  261

Query  129  RPPGHHAEVAAAMGFCIFNNIALAAETALA-HPD-INRVAIVDFDVHHCNGTVDIFKNRP  186
            RPPGHHAE     GFC+F+N+A+AA+  L  +P+ + R+ IVD+D+HH NGT   F N P
Sbjct  262  RPPGHHAEPNTPAGFCLFSNVAVAAKNMLKNYPESVRRIVIVDWDIHHGNGTQKAFYNDP  321

Query  187  EVLVCS  192
             VL  S