TO32D 4693180

From Metagenes
Revision as of 12:40, 26 March 2015 by Annotathon (talk | contribs) (AutoExport)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : 32D_scaffold7_1
Annotathon code: TO32D_4693180
Sample :
  • GPS :23,383333N 37,2525E
  •  : SharmElSheikh-Jeddah station 32 DCM -
  • (-DCMm, 26°C, 0.2-1.6 microns)
Authors
Team : BioCell2014
Username : yokemilo
Annotated on : 2015-01-28 09:46:32
  • Logerot Yoann
  • Micoud Kevin

Synopsis

  • Taxonomy: Alphaproteobacteria (NCBI info)
    Rank: class - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 28211
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order:
    Bacteria; Proteobacteria; Alphaproteobacteria;

Genomic Sequence

>32D_scaffold7_1 TO32D_4693180 Genomic DNA
TGAGTCATATCTGCAGTAACAACATTACCTGCAATAATAGTTTTTTTTGGATATTTTTTTCTTACTTCTGAAACAAAATTACTAAAATTTTCTGAATAAC
CATTTGCAACATCAATACAGATAAATTTAAATTTTGGATATTTTTTTAAAATTGAATTTAACCTATTGTAACTGTCTTTACTTGTACCGCAACTAAGAGC
AATTGAATCAAAGAAAATATTTTTATTGTAAATAGTTCCTATTTGATTAATGTCATGCTGTTTTGTTAAAGCAGTCATTAGTTTGTGAGAACTTAGTTTT
TTTGCAACATCTATTTCACCAACACCATCCATATTAGAGGCTATTATTGGAATTCCTTTCCATGATGATCTTGAGTGTTTAAAAGTATATTTTCTATTCA
AATCAACATCTTTCCTACTTTTTAAAGTACTTCTCTTTGGTCTAAAAAGGACATCTGAGTAGTCAAGTTTAATTTCTTCTTCGATTCTCATAAATACATT
CGCATATTTGTATTAAATAATTTAGAAATTAAAACAAATATAAATTGTTATCTATGAACTTAAATACGTTAATAAATGCAAATAAAAGAAAGTTTGATAT
TAAATTTAAAAAACTTTTAAAAAATAAGCTAGACAAATCAAGTTTATCAAATGCAATCTTTTATGGCTCTATGAATGGAGGAAAAAGAATAAGGCCATTT
TTAGTAATGGAGTCTGCAAAAATAGCAAAAATTTCATCAAATGATGCCTTTATCATAGCCTCATGTATTGAATGTATACATTCGTACTCCTTAATTCACG
ATGATTTACCATCAATGGATGATGATGATTACAGAAGAGGTAAATTAAGTACTCATAAAAAATTTAATGAAGCTACTGCAATTTTAGCAGGAGATGCTTT
ACATGATTTAGCATTTGAATTGATCTCAGGAAATCTTAAAAATAAAAATGTTATTTCTAGATTAAATTTAATAAATTATCTTTCTTTGTGTATTGGACAT
AAAGGATTAGCTCTTGGTCAAGCTTTAGATTTAGAATATGAAAATAAAAAGTTATCTAAAAATAAAATTTTAGATATGTATTCTAGAAAAACTGGCAAGT
TATTTGAATTCTCTTTTTCTGCACCTTTTATATTAAAAGATAAAAGTAAAATAGAAAT

Translation

[533 - 1156/1158]   direct strand
>TO32D_4693180 Translation [533-1156   direct strand]
NKYKLLSMNLNTLINANKRKFDIKFKKLLKNKLDKSSLSNAIFYGSMNGGKRIRPFLVMESAKIAKISSNDAFIIASCIECIHSYSLIHDDLPSMDDDDY
RRGKLSTHKKFNEATAILAGDALHDLAFELISGNLKNKNVISRLNLINYLSLCIGHKGLALGQALDLEYENKKLSKNKILDMYSRKTGKLFEFSFSAPFI
LKDKSKIE

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

A partir de la séquence récupérée, nous avons procédé à la recherche d'ORF et avons trouvé un ORF qui s'est avéré être satisfaisant de part les analyses effectuées par la suite. En effet, en réalisant le Blastp nous avons trouvés des résultats convaincants, de grands scores et de faibles e-values (que ce soit sur les bases de données NR ou SP).

Nous avions 5000 résultats sur NR avec des e-value entre 2e-56 et 6e-24.


Sur SP, nous trouvons tout de même 97 résultats selon une gamme de e-value entre 1e-39 et 8.4, avec une valeur seuil à 5e-04. Dès lors que nous savons qu'en dessous de 1e-10 comme e-value une séquence est fiable, nous pouvons dire que toutes les séquences provenant de NR sont correctes. Les scores ainsi trouvés sont eux aussi assez convaincants, avec comme plus grand score 192 chez les alphaprotéobactéries, et une moyenne de 140 pour toutes les protéobactéries. Grâce au Blastp, on a pu établir 1 tableau de fonctions pour NR et un pour SP. La fonction la plus représenté est une polyprélyl synthetase qui est responsable de la synthèse d'isoprénoïdes (Terpénoïdes). On parlera donc aussi de Terpenoid Synthase qui est un enzyme qui intervient dans le métabolisme de nombreuses bactéries et qui possède la fonction qui nous intéresse le plus.


Sur le rapport taxonomique, nous avons pu observer que les séquences les plus homologues à l'ORF faisaient bien partis des protéobactéries, et en particulier des alphaprotéobactéries. De ce fait, nous choisissions les alphaprotéobactéries comme groupe d'étude et le reste des protéobactéries comme groupe extérieur. Nous voyons aussi un différentiel de e-value et scores assez remarquable entre ces 2 groupes, une différence de l'ordre de -17 pour les e-value et de 46 pour le score.

Pour faire l'alignement multiple, nous avons sélectionné 20 séquences du groupe d'étude et 14 du groupe extérieur ainsi que l'ORF. Nous observons un pourcentage de conservations de 26% (91 positions sur 341), et une conservation plus grande pour les séquences des alphaprotéobactéries, ce qui nous réconforte dans notre choix des 2 groupes.


De cet alignement multiple, nous avons pu construire l'arbre phylogénétique PhyML. De cet arbre, nous voyons bien la distinction entre les 2 groupes, 2 branches bien distinctes sont crées par enracinement au mid-point. Note ORF se situe bien au sein des alphaprotéobactéries, notre groupe d'étude. Le reste des protéobactéries sont tous sur la 2ème branche de l'arbre. La séparation de ces branches est caractérisée par un événement spéciation (entre les alphaproteobacteries et les autres proteobacteries).


Quant aux domaines protéiques, lors de la recherche de ceux-ci via INTERPRO, nous observons 3 IPR différents. Parmi ces 3 IPR, on retrouve un domaine qui correspond à la fonction de Terpenoid synthase.

L'ORF est complet en 5' et incomplet en 3', il manque environ 25 acides aminés à la fin de la séquence, par rapport à toutes les autres séquences sélectionnées.

ORF finding

PROTOCOLE:


a) SMS ORFinder / sens direct / cadres 1, 2 & 3 / min 60 AA / initiation 'any codon' / code génétique 'standard'


b) SMS ORFinder / sens indirect / cadres 1, 2 & 3 / min 60 AA / initiation 'any codon' / code génétique 'standard'



ANALYSE DES RÉSULTATS:


  _______________________________________________________________________________________________________________________

        |    Taille     |  Taille  |  Brin   | position  |  position  |  ORF complet  |  ORF complet  | nombre de hits   |

        | (nucléotides) |   (aa)   |         | de début  |   de fin   |     en 5'     |     en 3'     |blast NR EV<1E-10 |

  ______|_______________|__________|_________|___________|____________|_______________|_______________|__________________|

        |               |          |         |           |            |               |               |                  |

  ORF 1 |      624      |    208   | direct  |    533    |     1156   |      oui      |      non      |      5000        |

  ______|_______________|__________|_________|___________|____________|_______________|_______________|__________________|

        |               |          |         |           |            |               |               |                  |

  ORF 2 |      510      |    170   | indirect|    647    |     1156   |      oui      |      non      |      1244        |

  ______|_______________|__________|_________|___________|____________|_______________|_______________|__________________|



En faisant la recherche d'ORF de la séquence sélectionnée avec l'outil ORFinder, sur les brins direct et indirect en suivant les 3 cadres de lecture possible par brin, nous observons au total 2 ORFs, les 2 se trouvent sur le cadre de lecture n°2 mais l'un se situe sur le brin direct, et l'autre sur le brin indirect.


Après analyse de ces 2 ORFs avec l’intermédiaire de Blastp, nous avons sélectionné le premier ORF (brin direct) car il présente beaucoup plus de résultats avec des E-values convaincants (5000 par rapport à 1244), c'est-à-dire en dessous de 1e-10, et c'est l'ORF présentant le plus de nucléotides (624 par rapport à 510), c'est donc le plus long. Il a donc un total de 208 acides aminés.


Néanmoins, l'ORF sélectionné est incomplet en 3', mais complet en 5' car il commence au 533ème nucléotide, il est donc précédé d'un codon stop. Il ne commence pas par une méthionine car lors de la recherche d'ORF, nous avons sélectionné le paramètre "any codon", ce qui veut dire que l'ORF peut commencer par n'importe quel codon. La première méthionine (le codon d'initiation) se trouve de la position 554 à 557.


Suite à l'analyse de l'alignement multiple, nous pouvons voir que l'ORF débute approximativement au même endroit que les autres séquences sélectionnées (à quelques acides aminés près), le codon d'initiation se situant à la position 8 de la séquence protéique de l'ORF.

RÉSULTATS BRUTS:


a) sens direct

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 533 to base 1156.
AACAAATATAAATTGTTATCTATGAACTTAAATACGTTAATAAATGCAAATAAAAGAAAG
TTTGATATTAAATTTAAAAAACTTTTAAAAAATAAGCTAGACAAATCAAGTTTATCAAAT
GCAATCTTTTATGGCTCTATGAATGGAGGAAAAAGAATAAGGCCATTTTTAGTAATGGAG
TCTGCAAAAATAGCAAAAATTTCATCAAATGATGCCTTTATCATAGCCTCATGTATTGAA
TGTATACATTCGTACTCCTTAATTCACGATGATTTACCATCAATGGATGATGATGATTAC
AGAAGAGGTAAATTAAGTACTCATAAAAAATTTAATGAAGCTACTGCAATTTTAGCAGGA
GATGCTTTACATGATTTAGCATTTGAATTGATCTCAGGAAATCTTAAAAATAAAAATGTT
ATTTCTAGATTAAATTTAATAAATTATCTTTCTTTGTGTATTGGACATAAAGGATTAGCT
CTTGGTCAAGCTTTAGATTTAGAATATGAAAATAAAAAGTTATCTAAAAATAAAATTTTA
GATATGTATTCTAGAAAAACTGGCAAGTTATTTGAATTCTCTTTTTCTGCACCTTTTATA
TTAAAAGATAAAAGTAAAATAGAA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
NKYKLLSMNLNTLINANKRKFDIKFKKLLKNKLDKSSLSNAIFYGSMNGGKRIRPFLVME
SAKIAKISSNDAFIIASCIECIHSYSLIHDDLPSMDDDDYRRGKLSTHKKFNEATAILAG
DALHDLAFELISGNLKNKNVISRLNLINYLSLCIGHKGLALGQALDLEYENKKLSKNKIL
DMYSRKTGKLFEFSFSAPFILKDKSKIE

No ORFs were found in reading frame 3.




b) sens indirect 

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 647 to base 1156.
TACAAATATGCGAATGTATTTATGAGAATCGAAGAAGAAATTAAACTTGACTACTCAGAT
GTCCTTTTTAGACCAAAGAGAAGTACTTTAAAAAGTAGGAAAGATGTTGATTTGAATAGA
AAATATACTTTTAAACACTCAAGATCATCATGGAAAGGAATTCCAATAATAGCCTCTAAT
ATGGATGGTGTTGGTGAAATAGATGTTGCAAAAAAACTAAGTTCTCACAAACTAATGACT
GCTTTAACAAAACAGCATGACATTAATCAAATAGGAACTATTTACAATAAAAATATTTTC
TTTGATTCAATTGCTCTTAGTTGCGGTACAAGTAAAGACAGTTACAATAGGTTAAATTCA
ATTTTAAAAAAATATCCAAAATTTAAATTTATCTGTATTGATGTTGCAAATGGTTATTCA
GAAAATTTTAGTAATTTTGTTTCAGAAGTAAGAAAAAAATATCCAAAAAAAACTATTATT
GCAGGTAATGTTGTTACTGCAGATATGACT

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
YKYANVFMRIEEEIKLDYSDVLFRPKRSTLKSRKDVDLNRKYTFKHSRSSWKGIPIIASN
MDGVGEIDVAKKLSSHKLMTALTKQHDINQIGTIYNKNIFFDSIALSCGTSKDSYNRLNS
ILKKYPKFKFICIDVANGYSENFSNFVSEVRKKYPKKTIIAGNVVTADMT

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOLE:


Phylogeny.fr / Multiple Alignement : Muscle / ALignement curation : Gblocks / Construction of phylogenic tree : PhyML / Run workflow : step by step / Alignement in Clustgal format



ANALYSE DES RÉSULTATS:



Afin de faire l'alignement multiple, nous avons sélectionné 20 séquences du groupe d'étude (alphaprotéobactéries), 14 du groupe extérieur (2 delta, 3 epsilon, 4 béta et 5 gammaprotéobactéries) ainsi que notre ORF.

Selon MUSCLE, nous observons 26 acides aminés totalement conservés sur toutes les séquences (*), 19 positions où les acides aminés ont subi une substitution, engendrant une faible perte de conservation au sein de quelques séquences (:), et 8 positions où cette substitution est plus grande, provoquant une perte de conservation un peu plus importante (.). Au total, nous avons donc 53 positions conservées.

Avec Gblocks, nous pouvons voir que l'alignement est assez convaincant, en effet nous avons 91 positions totalement conservées sur 341 au sein de toutes les séquences, soit 26% (or nous savons que le taux minimum requis pour faire un arbre convaincant est de 80 positions, et ce, avec les paramètres prédéfinis en cours de Gblocks). Nous pouvons définir ces positions, se trouvant sur 4 endroits différents : de 59 à 68 ; de 105 à 155 ; de 178 à 194 ; de 220 à 232. De plus, les séquences issues de cet alignement font toutes approximativement la même longueur, à une vingtaine d'acides aminés près situés en début de séquences. Elles se terminent toutes (excepté l'ORF et "Bac_Pro_Alp_1") en  position 341.

Toutes ces caractéristiques démontrent une similarité avec l'ORF plus importante au niveau de quelques séquences, s'avérant faire partie des protéobactéries, et plus précisément des alphaprotéobactéries.


Nous observons au sein de Gblocks, 4 INDELS principaux (Insertion-Délétion) dont 3 se trouvant au début des séquences. En effet, de la position 40 à 42, nous observons une insertion de 3 acides aminés "GTC" pour la séquence "Bac_Pro_Gam_5", ensuite nous avons un INDEL de la position 45 à 49 et une autre de la position 89 à 93.

Le dernier INDEL est une délétion et concerne l'ORF étudié, elle se situe en fin de séquence, de la position 236 à 307, c'est à dire une délétion de 71 acides aminés, par rapport aux autres séquences.


L'ORF ainsi étudié débute en position 13, par une Asparagine ("N"), et commence approximativement au même endroit par rapport aux autres séquences homologues, à 4-5 acides aminés près. En effet, les autres séquences commencent pour la plupart entre les positions 14 et 19.

A l'extrémité 3' de l'ORF (c'est-à-dire où il est incomplet), le dernier acide aminé se trouve à la position 315. Nous avons donc une différence de 26 acides aminés avec les autres séquences (qui se finissent en position 341).


RÉSULTATS BRUTS:


CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


B.P.Del_2       ---------------------MMSKLSHYKELVDNFINE---LA------QIKRFPPIFQ
B.P.Eps_3       -----------------------------MQNFENFLLN---HL-----PASKSIHPTYE
B.P.Eps_1       -----------------MNNPNLSFYYNECERFESFLNH---HH-----LHLESFHPYLE
B.P.Eps_2       -----------------MNSPNLSFYCNECERFESFLKN---HH-----LHLEDFHPYLE
B.P.Del_1       ---------------MENEAFLKAYLQDRQKIIEEALEH---YL-----SGEDNIPADIY
B.P.Alp_17      ------------------MLNFNVQLNDTASIVEIALKE---ML-------QKQGNDLMS
B.P.Alp_19      ------------------MLNFNVQLNDTASIVEIALKD---ML-------QKQGNDLMS
B.P.Alp_18      --------------------MFDAALTQAAQRVAAHFDH---VL-------AQLDDLPLT
B.P.Alp_4       -------------MTGTSPSDFAKRLDKTADDTEALLGR---LLSDDILPDEIARPKRLM
B.P.Alp_7       ------------------MHEFTTLLAEHAHTVEKRLDT---LLSDQVQTGEIARPETLI
B.P.Alp_9       ----------------MSQTPFQARLSEAADLTEARLAD---CL-AGAHGSVAGAPARLL
B.P.Alp_8       --------------MVASSEAFDIRLKTNAQEIEALLDA---LLSDDTREDEIARPESLR
B.P.Alp_10      --------------MDANRDTFETRLKNNAREIEALLDA---LLLPNALSDEIARPETLR
B.P.Alp_5       -------------MTNDDEMAFEMALIRRAAAVEVMLRR---LLDDRPLSGEIARPDRLM
B.P.Alp_6       -------------MNETTTPPFEIKLAVSAEMVEDTLRR---LLDTRPLEGEVARPQRLL
B.P.Alp_2       ----------------MGREMLEKSIESTAEQLHAIMDE---LL----PEPSGLIEDQLF
B.P.Alp_16      -----------MELVQAGSDVLAEAIGRVQAEIDSLFDA---LL-----PVPQDTSARLV
B.P.Alp_14      ------MSGMIGGETASAGALVKARSAEVAAAIDRAFDH---LL-----SVPDDPRARLY
B.P.Alp_15      --------------MVQPSLSLKPALDAIGKAIDQRFDR---LL-----AVPDDPRARLY
B.P.Alp_13      ----------------------------AALELEETLDV---LL-----PFEEGAEAPLA
B.P.Alp_11      -----------------MSIDLSKAMAETGAQVERVLDR---VL-----PKPQPGEPPLA
B.P.Alp_12      --------------MPSLPKTLTAAMADTVEQVETAIDI---LL-----PRSSMAEAKLY
B.P.Gam_5       -------------------MNAEIYLKEYQTRINHFLSNGTCLL-----PAENKQPAELH
B.P.Bet_1       MNESMIAEPSTPLNEGKPALDFSVWMQERLARTEDALSR---WV-------GINAPAGLG
B.P.Bet_4       ----------------MQANDLELWQQKAQAQTELALER---VL-----PANHAVPNTLH
B.P.Bet_2       ----------------MSGNHFAAWMESVQHRTEAALGA---IL-----PEASIAPQRLH
B.P.Bet_3       ------------MNTDSKLPSFSEWTAQIQQRTEVALAG---VL-----PDAAIAPHRLH
B.P.Gam_3       --------------------MMQQTLTSFQQRNNQQLNL---WL-----DQLPYQEQPLI
B.P.Gam_4       -------------------MDLLTLMTTRHQRVDAALIG---LL-----DQLPSDNASLT
B.P.Gam_1       -------------------MNIKQFTAEVRSAVDNRLNQ---LI------ESHIASSSLK
B.P.Gam_2       --------------MSEQTLDATRFLDSCRDRVDAELDR---CI------DRKAASERLQ
B.P.Alp_3       ------------------MLDTEKKILKVAKDVDIFLKK---FL------KRKTQKSKLY
B.P.Alp_20      ------------------MSGFQNKIRQIAKDTDKYLYQ---YF------KKQDAKSYLL
B.P.Alp_1       -----------------MNKRINKEIKIHRSRFDKYYKK---LL------KSNLPKDDLS
T.o.ORF_nu      ------------NKYKLLSMNLNTLINANKRKFDIKFKK---LL------KNKLDKSSLS
                                                                            

B.P.Del_2       EALFYTPKSGGKRIRAMLVMCA-ADMFG-----ADETKSLHIASAIELMHAYSLIHDDLP
B.P.Eps_3       EAVQKMLIAGGKRFRPALLLGV-VNAYNP----LMIGGAYHAAYAIELLHTYSLIHDDLP
B.P.Eps_1       KAFFEMVLNGGKRFRPKLFLAVLCALVGKKDYSNQQTEYFKIALSIECLHTYSLIHDDLP
B.P.Eps_2       KAFFEMVLNGGKRFRPKLFLAVLCSLVGKKDYLNQQTEYFKIALSIECLHTYSLIHDDLP
B.P.Del_1       KAVRYSVFNGGKRLRPILCLAA-AEAVS-----GDLGPAIPVACALELIHSYSLIHDDLP
B.P.Alp_17      APIRHAVLNGGKRLRAFLVIHS-CNIFE-----VQKDTAIQAAIAIECLHAYSLVHDDLP
B.P.Alp_19      APIRHAVLNGGKRLRAFLVIHS-CNIFE-----VQKDTAIQAAIAIECLHAYSLVHDDLP
B.P.Alp_18      QAMAHATD-GGKRLRGFLVLET-ARLHG-----IGAEVAIWPATAIEALHAYSLVHDDLP
B.P.Alp_4       DAMRYSSLNGGKRLRPFLVVES-AAVFG-----VSREAALLVGAALECIHCYSLIHDDLP
B.P.Alp_7       KAMRYGVLNGGKRLRPFLVMQS-AALFD-----IPAEHSLDIACALECVHCYSLIHDDLP
B.P.Alp_9       AAMRHGALGGGKRLRPFLVIES-ARLFG-----ADLQAAIGAATALECIHCYSLVHDDLP
B.P.Alp_8       AAMHYAVLNGGKRLRPFLVVES-ALLLG-----GDKEAALRVGAALECIHCYSLVHDDLP
B.P.Alp_10      GAMHYAVLNGGKRLRPFLVVES-AALLG-----GDAQAALRIGAALECVHCYSLVHDDLP
B.P.Alp_5       AAMRHGVLNGGKRLRPFLVMES-AALFS-----ADGEAALRVAAALECVHCYSLIHDDLP
B.P.Alp_6       DAMRHGVLNGGKRLRPFLVLET-ASLFD-----AQGEAALRVAAALECVHCYSLVHDDLP
B.P.Alp_2       KALRYVALSPGKRIRPYLVVAT-SNAFG-----VSLDCALKTAVAIEFIHAYSLVHDDLP
B.P.Alp_16      EAMRYAAIGGGKRVRPLLVVST-ASLFG-----VARNAALRAGAAIEAIHVYSLIHDDLP
B.P.Alp_14      EAMRHAAIGGGKRLRPLLVQAT-SDLFH-----LSRESALRVGLAIECIHVYSLVHDDLP
B.P.Alp_15      EAMRHSVIGGGKRMRPLLVVAA-CDIFQ-----VNREQALRVALAIECIHRYSLIHDDLP
B.P.Alp_13      TAMRYATMGGGKRLRGFLVLEG-ARSFG-----VARASALRVAAAIEMLHAYSLVHDDLP
B.P.Alp_11      EAIRYASLGGGKRLRPFLVVSS-ARLFG-----VAESCALRVGAAVEMIHCYSLVHDDLP
B.P.Alp_12      EAMRYGCLGGGKRLRPFLVMES-ARLFG-----VSPACALRVAAAVEFVHCYSLIHDDLP
B.P.Gam_5       KAMRYAVLNGGKRIRAALVYAT-GEALG-----ADFDVLDHIGSAIEMIHAFSLIHDDLP
B.P.Bet_1       EAMRYAVLDGGKRLRPLLVWAA-AEAVG-----GLAAATLRAGCAVELIHAYSLVHDDMP
B.P.Bet_4       EAMRYATLGGGKRLRPLLVLAA-SELGE-----ADFTAVEQAMAAIEMVHVYSLVHDDMP
B.P.Bet_2       EAMRYAVLGGGKRVRPLLVHAA-GEIAG-----ADPERLDRIACAVELIHAYSLVHDDLP
B.P.Bet_3       EAMRYAVLGGGKRVRPLLAHAA-GALAG-----AAAEDLDRIACAVELIHAYSLVHDDLP
B.P.Gam_3       QAMKYGLLLGGKRVRPFLVYIT-GQMLG-----CKPEDLDTPAAAIECIHAYSLIHDDLP
B.P.Gam_4       EAMRYGVLLGGKRMRPFLVYAT-GEMFG-----TPLSCLDVPAAAIECIHAYSLIHDDLP
B.P.Gam_1       EAMAYGVLLGGKRIRPYLTMAV-AELCG-----AETNDALDAACAVELIHAYSLIHDDLP
B.P.Gam_2       EAMRYSVLGGGKRIRPALCLAA-AKAVG-----GSFESALVPACAVELIHAYSLIHDDLP
B.P.Alp_3       EAIKYGLFSGGKKFRSYLIVNT-GNIFN-----LNYRDLITVAAAVECMHSYSLIHDDLP
B.P.Alp_20      KPMKYGLFSGGKGFRSKIIFDT-GKIFN-----IDYNLLKALSAAVECVHSYSLIHDDLP
B.P.Alp_1       KIMLYGTLNGGKRIRPFLISIF-SQLAA-----LPNYKYYRISAAVECIHSYSLIHDDLP
T.o.ORF_nu      NAIFYGSMNGGKRIRPFLVMES-AKIAK-----ISSNDAFIIASCIECIHSYSLIHDDLP
                  .       ** .*  :                          .:* :* :**:***:*

B.P.Del_2       VMDNDDFRRGKPANHKVYGEDLALLVGDGLNTYTFNVIA---DAPIDDARKVKIVKWLSN
B.P.Eps_3       AMDNSPLRRGEPTLHVLFDEVTAILAGDALNTYAFEVLS---NAPFSDFTRVELIRELAT
B.P.Eps_1       CMDNAALRRNHPTLHAKYDETTAVLIGDALNTYSFELLS---NSLLESHIIVELIKILSA
B.P.Eps_2       CMDNAALRRNHPTLHAKYDETTAVLIGDALNTYSFELLS---NALLESRIIVELVKILSA
B.P.Del_1       AMDNDDFRRGKPTCHKVFGEDIAILAGDALLTEAFVLLSRAEKVRLSAERHLAVIQEIAQ
B.P.Alp_17      CMDDDELRRGKPTVHVKWDEATATLTGDALQALAFELIA--SLPNTDAIRIVELLKKLAK
B.P.Alp_19      CMDDDELRRGKPTVHVKWDEATATLTGDALQALAFELIA--SLPNTDAIRIVELLKKLAK
B.P.Alp_18      CMDDDDLRRGLPTVHRKWDEATAVLAGDALQALAFELVT-APEVG-SGDLRAKLARTLAV
B.P.Alp_4       AMDNSDLRRGRPTLHKKTDDATAILAGDGLLTLAFDIIT-RDEIHRDANVRLLLTRALAR
B.P.Alp_7       AMDNDTLRRGKPTVHRAFDEATAILAGNALLTFAFEIIA-HKASTLPFDTRIKLVTALAQ
B.P.Alp_9       SMDDDDLRRGKPTVHRAYDEATAILAGDGLLTLAFGLVA--GEEGLSPKARVALVALLAR
B.P.Alp_8       AMDDDKLRRGKPTAHIAFDEATAILAGDSLLTYAFDIIA-ADETRLPEQSKVALILALAR
B.P.Alp_10      AMDDDDIRRGKPTVHVKFDEATAILAGDSLLTYAFDIVA-APETALPDTSKASLVLALAR
B.P.Alp_5       AMDDDDLRRGQPTVHKAFDEATAILAGDALLTLAFDIIA-GEATALPAERRAALVLALAR
B.P.Alp_6       AMDDDDLRRGQPTVHRAFDEATAILAGDSLLTYAFDIIA-DDATLLSAEKRLALTLRLAR
B.P.Alp_2       AMDNDDFRRGQPSCHKKFDEATAILTGDALLTLAFEMLA-HESTHPDPGVRTELISKIAV
B.P.Alp_16      CMDNDDLRHGKPTVHRAFDEATAVLAGDALHALAFEILA-EDATSEDPFTRSELILTLGQ
B.P.Alp_14      AMDNDDMRRGKATVHKAFDEATAILAGDCLHDLAFQILS-DEETHPDPFVRIELVRALAL
B.P.Alp_15      CMDNDDMRHGKPTVHKAFDEATAVLAGDCLHDLAFGILA-DPATHEDPAVRLELVTELAI
B.P.Alp_13      AMDNDDLRRGKPTVHKAFGEATAILAGDALQAQAFAVLA-DEDTHSDAAVRVELVRRLAI
B.P.Alp_11      AMDNDDLRRGKPTTHKAYDEATAILAGDALLTQAFEVLA-DAETHADPKVRIALVTALAR
B.P.Alp_12      AMDDASLRRGRPTVHRQFDEATAILAGDALLTAAFEVMT-DPETHEDPRVRCALVSALAK
B.P.Gam_5       ALDNDDLRRGKPSCHKAFSEATAILAGDALQTLAFETIASLDKNKIAVEIEIEMIRLLAR
B.P.Bet_1       CMDNDTMRRGKPTVHVQFGEASALLAGDALQALAFELLL-PEDDGIPCSMQAKLCRLLGA
B.P.Bet_4       AMDNDSLRRGKPTCHVQYDEATALLVGDALQTLAFDVLS--RPANLPAARQLKMVAVLAK
B.P.Bet_2       CMDDDVLRRGKPTVHVEYDEATALLVGDALQALAFQTIA-EGRVNDVPAVQLEMVALLGR
B.P.Bet_3       CMDDDVLRRGKPTVHVEFDEATALLAGDALQTLAFQVLA-ERPLGTDPANQLAMLNQLAI
B.P.Gam_3       AMDDDELRRGQPTCHIKFDEATAILTGDALQTLAFTIIADGQLSPAAEAQRINMIKALAH
B.P.Gam_4       AMDNDALRRGKPTCHIAYGDDIAILAGDALQTLAFSALAEQPMPTVTLSSRLRMISELAT
B.P.Gam_1       AMDDDELRRGHPTCHIKFGEATAVLAGDALQTLAFEVLSTNLETKLSSQRRIAMIQHLAS
B.P.Gam_2       AMDDDELRRGRPTTHIAFDEATAILAGDALQALAFEMLS--QSSTLDTEARLAMIRELAA
B.P.Alp_3       SMDNDDFRRGKPSVHKAFGESTAILAGNSLLTLAFEILT-SDNMKSRSKSKSDLVYALAS
B.P.Alp_20      SMDDDDIRRGKPSTHKKFGESTAILSGNSLLTLAFEILS-DKKLKLKNKIKTELIYSLSI
B.P.Alp_1       CMDNDDFRRGKLSVHRKFGEAQAILAGDSLHDIAFEFIA-NQKTHNDPMIRIKLVYLLSS
T.o.ORF_nu      SMDDDDYRRGKLSTHKKFNEATAILAGDALHDLAFELIS-GNLKNKNVISRLNLINYLSL
                 :*:   *..  : *   .:  * * *: *   :*  :               :   :. 

B.P.Del_2       NAGIGGMVVGQVVDVLSSR--DRLKGHSHKKLVNFIHKHKTAKLIQASVVCGAIC-GNPD
B.P.Eps_3       NGGLNGMVLGQAIDCYFEN--RVLSI---DDVKI-LHTNKTAKLIAASLKMGAIIVGE--
B.P.Eps_1       NGGIKGMVLGQALDCYFEN--TPLNL---EQLTF-LHEHKTAKLISASLMMGLVASGVKD
B.P.Eps_2       NGGIKGMILGQALDCYFEN--TPLNL---EQLTF-LHEHKTAKLISASLMMGLVASGIKN
B.P.Del_1       AAGICGMVGGQALDVLSGK--FAPDE---NTLRE-IHRRKTGALIVAAVKSGAII-SNAG
B.P.Alp_17      ASGMQGMVLGQAQDIQAEK--SEVNL-NINDITS-LQQNKTGALIEWSAISGAIL----S
B.P.Alp_19      ASGMQGMVLGQAQDIQAEK--SEVNL-NINDITS-LQQNKTGALIEWSAISGAIL----S
B.P.Alp_18      AAGAQGMVLGQTLDIAAET--APEPL-SLDAITA-LQQGKTGALIAWAALAG----PRMA
B.P.Alp_4       CAGIGGMVGGQILDLAGEG--RFGGN-EPIDVAR-IQQMKTGALLRYGCIAGAIL-GRAS
B.P.Alp_7       SAGIGGMVGGQMLDLEAEK--KPQES---TNIIT-LQRMKTAALISFACQAGAII-GNAS
B.P.Alp_9       DAGAAGMVGGQVLDLAAEN--AVLSE---DEIAR-MQAMKTGALIAFACEAGAIV-ADAG
B.P.Alp_8       SAGLGGMAGGQTLDLAAEK--TTPDE---RGIVT-LQAMKTGALIRFACEAGAMI-AGAS
B.P.Alp_10      AAGLGGMAGGQALDLAAEK--QAPDE---AGIIR-LQAMKTGALIRFACEAGAIL-AGSP
B.P.Alp_5       AAGAGGMVGGQKLDLEAEQ--VRPDE---AGIIK-LQAMKTGALIRFACEAGAIL-AGAQ
B.P.Alp_6       AAGIGGMAGGQALDLAAEG--ETLAE---EEILR-LQAMKTGALIRYACEAGAII-GSGN
B.P.Alp_2       ASGYRGMVGGQMMDLLAQH--NTLEF---SEVVR-LQRMKTGALFAISCEAGAIL-GKAS
B.P.Alp_16      ASGMNGMAGGQMMDMVADE--EGITY-DLPAITR-LQQLKTGALLAAAVEMGAIL-GKVP
B.P.Alp_14      ASGPAGMAGGQMMDLEAEH--ARFDL---ATVTR-LQNLKTGALIAFCVDAAAIM-ARIP
B.P.Alp_15      HSGPAGMAGGQMMDMVAGD--VAYDL---AGITR-LQQLKTGALIQWCLEAGAIM-GRAS
B.P.Alp_13      AAGPRGMCGGQMLDMLAEDGSEPATE---ASIGR-LQLLKTGKLIEFAAEAGAIL-GKAA
B.P.Alp_11      ASGAAGMVGGQALDMQAEQ--TPLTE--IGAITR-LQRLKTGALFEFSCEAGAIL-GKVE
B.P.Alp_12      ASGPRGMVGGQMLDLIAET--QALDI---GAITR-LQRMKTGELIAFAATAGAIL-GRAS
B.P.Gam_5       AIGSLGMAGGEELDIEMKD--KDVSL---NELEN-TYKLKTGYLLTASILLGALAANCHD
B.P.Bet_1       AAGSQGMAGGQAIDLASVG--KQLSE---AQLRE-MHRLKTGALLLGSVLMGAACNAQTD
B.P.Bet_4       AAGSLGMAGGQAIDLANVG--KAMNQ---AELEQ-MHGLKTGALIRAAVMLGALCCPNLN
B.P.Bet_2       ASGSRGMAGGQAIDLGAVG--KQLTR---EELEF-MHIHKTGALIRASVLLGAQSGAPLA
B.P.Bet_3       ASGSRGMAGGQAIDLASVG--KRLGR---EELEF-MHIHKTGALIRAAVLLGARAGGTLG
B.P.Gam_3       SSGASGMCVGQALDLGAEN--RQVSL---EEMEE-IHRKKTGALIDCAVKLGALAAGEKG
B.P.Gam_4       ASGALGMCAGQALDLAAEG--KSVAL---DALET-IHRHKTGALIRAAVRLGAYSAGEQA
B.P.Gam_1       ASGAKGMCFGQALDLDATG--RAIDE---LELEK-IHRHKTGALIRASAALGVLAGNDES
B.P.Gam_2       ASGHRGMVGGQAIDLESVG--RTLTL---AQLET-MHRHKTGALIEASVRMGALVSPELD
B.P.Alp_3       ASGYTGIAGGQFLDLRFEK--MKVKK---DLIIN-MQNKKTGELISFCSESAAILSGK--
B.P.Alp_20      CSGYSGMAGGQYLDLNFEH--KKVNK---LQLIE-MQNKKTGKLFSFCCSSSAII-KEKK
B.P.Alp_1       TLGAKGLAGGQYLDLKFEN--KKINK---NKILK-MYNLKTAALFCFCCMAPFIM-TKKN
T.o.ORF_nu      CIGHKGLALGQALDLEYEN--KKLSK---NKILD-MYSRKTGKLFEFSFSAPFIL-----
                  *  *:  *:  *                 :       **. *:               

B.P.Del_2       DVQLDRLAKYGLYAGVAFQIIDDYLDVVGDEEKLGKK-KVDEINNTLTYPKVYGLKRSYD
B.P.Eps_3       EKLAETLYDFGIKLGLLFQIQDDILDVTQSSQEAGKLTNNDE--NKNSFVTILGLDEAFL
B.P.Eps_1       EELFKWLQAFGLKMGLCFQVLDDIIDVTQDEEESGKTTHLDSA--KNSFVNLLGLEEASG
B.P.Eps_2       EELLKWLQDFGLKMGLCFQVLDDIIDVTQDEEESGKTTHLDSA--KNSFVNLLGLKKASD
B.P.Del_1       KDKIQALAEYGINVGLAFQIADDILNVEGDRELMGKETGSDAARGKLTYPSLMGLDVAKE
B.P.Alp_17      NHDDRKLLDYAKSIGLAFQIQDDILDIEGDAVLAGKRLQKDVSAGKATFVSLLGIENAKL
B.P.Alp_19      NHDDRNLLDYAKSIGLAFQIQDDILDIEGDAVLAGKRLQKDVSAGKATFVSLLGIENAKL
B.P.Alp_18      GADTAPLAAYAKALGLAFQIADDILDVTGDTATVGKATGKDASAGKATFVSHLGLDGAKR
B.P.Alp_4       QKEYQALDDYGRALGEAFQIADDLLDVEGDAAALGKPAGADAALGKTTFVTQLGIEGAKQ
B.P.Alp_7       KEFTEKLAAFGTYLGLAFQLTDDLLDVTAKSEILGKTVGKDKTAHKATFVRLYGIEETQK
B.P.Alp_9       AAERARLRRFGEIVGLAFQLADDLLDETADAAVLGKAAGKDRERGKKTLPALHGIDWTRA
B.P.Alp_8       SDDRKRLRAFGEKIGLAFQLADDLLDVKSDAATMGKATGKDVGRGKGTLVSLRGIGWAEA
B.P.Alp_10      QDDRQRLRAFGEKIGLAFQLADDILDLTSDAATMGKATGKDAARGKGTLVALHGMEWAET
B.P.Alp_5       SDDLERLAEFGSAIGLAFQLADDLLDLTADAEQMGKATGKDAAAGKGTLVALHGADWARK
B.P.Alp_6       DADRERLGEFGAAIGLAFQLADDLLDLTASSEAMGKATGKDAAAGKATLASLHGIDWTRA
B.P.Alp_2       KNLRNALRAYANNIGIAFQITDDLLDAEGTREETGKSVGKDKSQGKATLVSCIGIEKARE
B.P.Alp_16      PPGRAHLRAYARDIGLAFQIADDLLDVEGDAEKAGKALRKDAGQGKQTFVTLLGAERARE
B.P.Alp_14      VDARTGLHGYARDIGLAFQIADDLLDVEGDATVAGKALGKDAAAGKETFVSLLGVDRARA
B.P.Alp_15      EASRKSLRGYARDLGLAFQIADDLLDVEGESAKTGKAVQKDAAAGKATFVSLMGVERART
B.P.Alp_13      PLQRHALCAYGRDLGAAFQIADDVLDATATAEETGKRTGKDEQAGKATLVGLLGLERARA
B.P.Alp_11      DSRRGALQAYAHDMGLAFQIADDLLDVRGRAEEIGKTPGKDQAAGKATFVSILGLERAES
B.P.Alp_12      PPQFHALQAYAHDLGLAFQIADDLLDVEGTEAETGKSVGRDKPAGKATFVSILGLERARD
B.P.Gam_5       KNILNNLQKFGDYIGLAFQIHDDIIGIESDTQTLGKHQGSDQERNKPTYPTLIGMRKAKQ
B.P.Bet_1       ARALAALTDYGQALGVAFQVVDDILDVVADSATLGKTAGKDAANDKPTFVSLLGLEAARA
B.P.Bet_4       DDDMVRLDGYAKKLGLAFQVIDDVLDCEADTATLGKTAGKDADNDKPTYVKLMGLADARS
B.P.Bet_2       PDALARLDRYGKLVGLLFQVVDDILDAQADTATLGKTAGKDADRNKPTYVTLLGLSEART
B.P.Bet_3       ADEHARLDHYAKVVGLLFQVVDDLLDAEADTATLGKTAGKDADNDKPTYVSLLGLVDARR
B.P.Gam_3       IEVLPHLERYSKAIGLAFQVQDDILDIISDTETLGKPQGSDQGLNKSTYPSLLGLEGAIE
B.P.Gam_4       EPVLAELDRYANAIGLAFQVQDDILDIVGDTEVIGKRQGADIALGKSTYPALLGLEGARE
B.P.Gam_1       QQYLDHFCDFASWIGLAYQVYDDILDVVGNTEVMGKPQGSDEAHHKATYVALLGLDGASE
B.P.Gam_2       EPALDALTAFARSLGLAFQVQDDLLDIEGATEVIGKPQGSDAARAKPTYPALLGQEGARR
B.P.Alp_3       EKERSFLKKIGLDIGLLFQVTDDLLDIFGDSKKIGKPTRRDNQKGKATIIRNLGVNKTIE
B.P.Alp_20      LSMKRDLSQIGLQIGLLYQISDDLIDVRGNSNKAGKPTKRDVKRGKATLVNLLGYNNLLE
B.P.Alp_1       NKDLQFAKEYGNVFGIIFQIIDDYLDEFENFKKIGKTPGKDRKQGKSTILLHMKKKEVIP
T.o.ORF_nu      ------------------------------------------------------------
                                                                            

B.P.Del_2       IAQKLKDMAILQI-KDI-----KGSKEL-IDIAKLIVERDR
B.P.Eps_3       EAESLANTLLKEI-DGF---DEKLKSELSKLLVHYINRHKN
B.P.Eps_1       YAQTLKTEVLDDL-NLLKPAYPLLQENL-NALLNTLFKGKT
B.P.Eps_2       YAQTLKTEVLNDL-NLLKPAYPLLQENL-NALLNTLFKGKT
B.P.Del_1       KLAKHIDAAEVSL-SEF---DERARP-L-LLIARYVMERKS
B.P.Alp_17      RAKELIEEAIDAL-SDY---GDKAEP-M-RQVAKFIIERKM
B.P.Alp_19      RAKELIEEAIDAL-SDY---GDKAEP-M-RQVAKFIIERKM
B.P.Alp_18      RANELMQSACDAL-SVY---GGDADT-L-RDAARFVVARKN
B.P.Alp_4       RVRDLLARADSAV-SIF---GERAAV-L-QAAARFVAERKS
B.P.Alp_7       KRDELIAKAEVLL-HPF---GAKAKP-L-QQAARFSATRKN
B.P.Alp_9       RLDRLVAEAEAEL-APF---GDKGGV-L-IEAARFVANRTS
B.P.Alp_8       ELRRHVEDARKLL-APY---GDAAAT-L-AATAHFVAARKS
B.P.Alp_10      ELRRHVADAEALL-APY---GVRAST-L-IAAAHFIADRKS
B.P.Alp_5       QLDGLVGQAHALL-EPY---GEKAAL-L-KAAAIFVATRNS
B.P.Alp_6       QLRGLVAQARDIL-APY---GEEAEG-L-RQAALFVAERQN
B.P.Alp_2       HALVLAKQAIEHL-NIF---DGKANL-L-KELAYFIVERNK
B.P.Alp_16      QARALVDQAVLRL-ASY---GSEADV-L-RALARYIVERDH
B.P.Alp_14      QAHMLVDQAKAHL-HGY---GAEADL-L-RAIADYIVERDR
B.P.Alp_15      QANMLIDQAIAHL-SAF---GPEADL-L-RAIARFAVERDR
B.P.Alp_13      QAERLAAQAQQHL-DSL---GERADL-L-RMLADYTIARRS
B.P.Alp_11      QARMLVDQACRHL-DVF---GDRADA-L-RAVAHFVVERKA
B.P.Alp_12      QAGRLADQATRHL-EIF---EGRASM-L-QAVARFVVDRRS
B.P.Gam_5       KENEIFNKALKHL-NKT---GIPVNK-L-EAIARYVVNRNF
B.P.Bet_1       HAEQLRQQAHAAL-TRS---GLADTQAL-GALADMVVQRTH
B.P.Bet_4       YAETLVADAVSLL-VPF---GGKAAR-L-RGLAEFVTARKN
B.P.Bet_2       LADVLLADARDAI-TSF---GAAATR-L-DELASFIVHRRF
B.P.Bet_3       LAEEMLDEARASL-RPF---GARALR-L-EQLADYIVHRAF
B.P.Gam_3       KAHTLLQEALQAL-EAI---PYNTQL-L-EEFARYVIERKN
B.P.Gam_4       KAHLLYQEAMDAL-ARVAAHSFDTTA-L-QALAGYIIERDK
B.P.Gam_1       KLLSLHQQALLSL-NKI---PYNTQK-L-ETFSEILLKRDH
B.P.Gam_2       HLSDLLSDAHESL-RAF---GPEADP-L-RAMADFVVARTH
B.P.Alp_3       FSYELADGISERLKNRY---GTRADS-L-IDSVYFLLRRDH
B.P.Alp_20      FTYSLKNKLVNKI-KKY---GTKSRD-L-LESLEYIIHREV
B.P.Alp_1       YCQSLANQFIKRN-KKY---FIKWNI-L-EDLLVNITQV--
T.o.ORF_nu      -------KDKSKI-E--------------------------
                                                         
                                           















=========================================

GBLOCKS

=========================================



Gblocks 0.91b Results
Processed file: input.fasta
Number of sequences: 35
Alignment assumed to be: Protein
New number of positions: 91 (selected positions are underlined in blue)
                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Del_2    ---------------------MMSKLSHYKELVDNFINE---LA------QIKRFPPIFQ
Bac_Pro_Eps_3    -----------------------------MQNFENFLLN---HL-----PASKSIHPTYE
Bac_Pro_Eps_1    -----------------MNNPNLSFYYNECERFESFLNH---HH-----LHLESFHPYLE
Bac_Pro_Eps_2    -----------------MNSPNLSFYCNECERFESFLKN---HH-----LHLEDFHPYLE
Bac_Pro_Del_1    ---------------MENEAFLKAYLQDRQKIIEEALEH---YL-----SGEDNIPADIY
Bac_Pro_Alp_17   ------------------MLNFNVQLNDTASIVEIALKE---ML-------QKQGNDLMS
Bac_Pro_Alp_19   ------------------MLNFNVQLNDTASIVEIALKD---ML-------QKQGNDLMS
Bac_Pro_Alp_18   --------------------MFDAALTQAAQRVAAHFDH---VL-------AQLDDLPLT
Bac_Pro_Alp_4    -------------MTGTSPSDFAKRLDKTADDTEALLGR---LLSDDILPDEIARPKRLM
Bac_Pro_Alp_7    ------------------MHEFTTLLAEHAHTVEKRLDT---LLSDQVQTGEIARPETLI
Bac_Pro_Alp_9    ----------------MSQTPFQARLSEAADLTEARLAD---CL-AGAHGSVAGAPARLL
Bac_Pro_Alp_8    --------------MVASSEAFDIRLKTNAQEIEALLDA---LLSDDTREDEIARPESLR
Bac_Pro_Alp_10   --------------MDANRDTFETRLKNNAREIEALLDA---LLLPNALSDEIARPETLR
Bac_Pro_Alp_5    -------------MTNDDEMAFEMALIRRAAAVEVMLRR---LLDDRPLSGEIARPDRLM
Bac_Pro_Alp_6    -------------MNETTTPPFEIKLAVSAEMVEDTLRR---LLDTRPLEGEVARPQRLL
Bac_Pro_Alp_2    ----------------MGREMLEKSIESTAEQLHAIMDE---LL----PEPSGLIEDQLF
Bac_Pro_Alp_16   -----------MELVQAGSDVLAEAIGRVQAEIDSLFDA---LL-----PVPQDTSARLV
Bac_Pro_Alp_14   ------MSGMIGGETASAGALVKARSAEVAAAIDRAFDH---LL-----SVPDDPRARLY
Bac_Pro_Alp_15   --------------MVQPSLSLKPALDAIGKAIDQRFDR---LL-----AVPDDPRARLY
Bac_Pro_Alp_13   ----------------------------AALELEETLDV---LL-----PFEEGAEAPLA
Bac_Pro_Alp_11   -----------------MSIDLSKAMAETGAQVERVLDR---VL-----PKPQPGEPPLA
Bac_Pro_Alp_12   --------------MPSLPKTLTAAMADTVEQVETAIDI---LL-----PRSSMAEAKLY
Bac_Pro_Gam_5    -------------------MNAEIYLKEYQTRINHFLSNGTCLL-----PAENKQPAELH
Bac_Pro_Bet_1    MNESMIAEPSTPLNEGKPALDFSVWMQERLARTEDALSR---WV-------GINAPAGLG
Bac_Pro_Bet_4    ----------------MQANDLELWQQKAQAQTELALER---VL-----PANHAVPNTLH
Bac_Pro_Bet_2    ----------------MSGNHFAAWMESVQHRTEAALGA---IL-----PEASIAPQRLH
Bac_Pro_Bet_3    ------------MNTDSKLPSFSEWTAQIQQRTEVALAG---VL-----PDAAIAPHRLH
Bac_Pro_Gam_3    --------------------MMQQTLTSFQQRNNQQLNL---WL-----DQLPYQEQPLI
Bac_Pro_Gam_4    -------------------MDLLTLMTTRHQRVDAALIG---LL-----DQLPSDNASLT
Bac_Pro_Gam_1    -------------------MNIKQFTAEVRSAVDNRLNQ---LI------ESHIASSSLK
Bac_Pro_Gam_2    --------------MSEQTLDATRFLDSCRDRVDAELDR---CI------DRKAASERLQ
Bac_Pro_Alp_3    ------------------MLDTEKKILKVAKDVDIFLKK---FL------KRKTQKSKLY
Bac_Pro_Alp_20   ------------------MSGFQNKIRQIAKDTDKYLYQ---YF------KKQDAKSYLL
Bac_Pro_Alp_1    -----------------MNKRINKEIKIHRSRFDKYYKK---LL------KSNLPKDDLS
Translation_of   ------------NKYKLLSMNLNTLINANKRKFDIKFKK---LL------KNKLDKSSLS
                                                                           ##


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Del_2    EALFYTPKSGGKRIRAMLVMCA-ADMFG-----ADETKSLHIASAIELMHAYSLIHDDLP
Bac_Pro_Eps_3    EAVQKMLIAGGKRFRPALLLGV-VNAYNP----LMIGGAYHAAYAIELLHTYSLIHDDLP
Bac_Pro_Eps_1    KAFFEMVLNGGKRFRPKLFLAVLCALVGKKDYSNQQTEYFKIALSIECLHTYSLIHDDLP
Bac_Pro_Eps_2    KAFFEMVLNGGKRFRPKLFLAVLCSLVGKKDYLNQQTEYFKIALSIECLHTYSLIHDDLP
Bac_Pro_Del_1    KAVRYSVFNGGKRLRPILCLAA-AEAVS-----GDLGPAIPVACALELIHSYSLIHDDLP
Bac_Pro_Alp_17   APIRHAVLNGGKRLRAFLVIHS-CNIFE-----VQKDTAIQAAIAIECLHAYSLVHDDLP
Bac_Pro_Alp_19   APIRHAVLNGGKRLRAFLVIHS-CNIFE-----VQKDTAIQAAIAIECLHAYSLVHDDLP
Bac_Pro_Alp_18   QAMAHATD-GGKRLRGFLVLET-ARLHG-----IGAEVAIWPATAIEALHAYSLVHDDLP
Bac_Pro_Alp_4    DAMRYSSLNGGKRLRPFLVVES-AAVFG-----VSREAALLVGAALECIHCYSLIHDDLP
Bac_Pro_Alp_7    KAMRYGVLNGGKRLRPFLVMQS-AALFD-----IPAEHSLDIACALECVHCYSLIHDDLP
Bac_Pro_Alp_9    AAMRHGALGGGKRLRPFLVIES-ARLFG-----ADLQAAIGAATALECIHCYSLVHDDLP
Bac_Pro_Alp_8    AAMHYAVLNGGKRLRPFLVVES-ALLLG-----GDKEAALRVGAALECIHCYSLVHDDLP
Bac_Pro_Alp_10   GAMHYAVLNGGKRLRPFLVVES-AALLG-----GDAQAALRIGAALECVHCYSLVHDDLP
Bac_Pro_Alp_5    AAMRHGVLNGGKRLRPFLVMES-AALFS-----ADGEAALRVAAALECVHCYSLIHDDLP
Bac_Pro_Alp_6    DAMRHGVLNGGKRLRPFLVLET-ASLFD-----AQGEAALRVAAALECVHCYSLVHDDLP
Bac_Pro_Alp_2    KALRYVALSPGKRIRPYLVVAT-SNAFG-----VSLDCALKTAVAIEFIHAYSLVHDDLP
Bac_Pro_Alp_16   EAMRYAAIGGGKRVRPLLVVST-ASLFG-----VARNAALRAGAAIEAIHVYSLIHDDLP
Bac_Pro_Alp_14   EAMRHAAIGGGKRLRPLLVQAT-SDLFH-----LSRESALRVGLAIECIHVYSLVHDDLP
Bac_Pro_Alp_15   EAMRHSVIGGGKRMRPLLVVAA-CDIFQ-----VNREQALRVALAIECIHRYSLIHDDLP
Bac_Pro_Alp_13   TAMRYATMGGGKRLRGFLVLEG-ARSFG-----VARASALRVAAAIEMLHAYSLVHDDLP
Bac_Pro_Alp_11   EAIRYASLGGGKRLRPFLVVSS-ARLFG-----VAESCALRVGAAVEMIHCYSLVHDDLP
Bac_Pro_Alp_12   EAMRYGCLGGGKRLRPFLVMES-ARLFG-----VSPACALRVAAAVEFVHCYSLIHDDLP
Bac_Pro_Gam_5    KAMRYAVLNGGKRIRAALVYAT-GEALG-----ADFDVLDHIGSAIEMIHAFSLIHDDLP
Bac_Pro_Bet_1    EAMRYAVLDGGKRLRPLLVWAA-AEAVG-----GLAAATLRAGCAVELIHAYSLVHDDMP
Bac_Pro_Bet_4    EAMRYATLGGGKRLRPLLVLAA-SELGE-----ADFTAVEQAMAAIEMVHVYSLVHDDMP
Bac_Pro_Bet_2    EAMRYAVLGGGKRVRPLLVHAA-GEIAG-----ADPERLDRIACAVELIHAYSLVHDDLP
Bac_Pro_Bet_3    EAMRYAVLGGGKRVRPLLAHAA-GALAG-----AAAEDLDRIACAVELIHAYSLVHDDLP
Bac_Pro_Gam_3    QAMKYGLLLGGKRVRPFLVYIT-GQMLG-----CKPEDLDTPAAAIECIHAYSLIHDDLP
Bac_Pro_Gam_4    EAMRYGVLLGGKRMRPFLVYAT-GEMFG-----TPLSCLDVPAAAIECIHAYSLIHDDLP
Bac_Pro_Gam_1    EAMAYGVLLGGKRIRPYLTMAV-AELCG-----AETNDALDAACAVELIHAYSLIHDDLP
Bac_Pro_Gam_2    EAMRYSVLGGGKRIRPALCLAA-AKAVG-----GSFESALVPACAVELIHAYSLIHDDLP
Bac_Pro_Alp_3    EAIKYGLFSGGKKFRSYLIVNT-GNIFN-----LNYRDLITVAAAVECMHSYSLIHDDLP
Bac_Pro_Alp_20   KPMKYGLFSGGKGFRSKIIFDT-GKIFN-----IDYNLLKALSAAVECVHSYSLIHDDLP
Bac_Pro_Alp_1    KIMLYGTLNGGKRIRPFLISIF-SQLAA-----LPNYKYYRISAAVECIHSYSLIHDDLP
Translation_of   NAIFYGSMNGGKRIRPFLVMES-AKIAK-----ISSNDAFIIASCIECIHSYSLIHDDLP
                 ########                                    ################


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Del_2    VMDNDDFRRGKPANHKVYGEDLALLVGDGLNTYTFNVIA---DAPIDDARKVKIVKWLSN
Bac_Pro_Eps_3    AMDNSPLRRGEPTLHVLFDEVTAILAGDALNTYAFEVLS---NAPFSDFTRVELIRELAT
Bac_Pro_Eps_1    CMDNAALRRNHPTLHAKYDETTAVLIGDALNTYSFELLS---NSLLESHIIVELIKILSA
Bac_Pro_Eps_2    CMDNAALRRNHPTLHAKYDETTAVLIGDALNTYSFELLS---NALLESRIIVELVKILSA
Bac_Pro_Del_1    AMDNDDFRRGKPTCHKVFGEDIAILAGDALLTEAFVLLSRAEKVRLSAERHLAVIQEIAQ
Bac_Pro_Alp_17   CMDDDELRRGKPTVHVKWDEATATLTGDALQALAFELIA--SLPNTDAIRIVELLKKLAK
Bac_Pro_Alp_19   CMDDDELRRGKPTVHVKWDEATATLTGDALQALAFELIA--SLPNTDAIRIVELLKKLAK
Bac_Pro_Alp_18   CMDDDDLRRGLPTVHRKWDEATAVLAGDALQALAFELVT-APEVG-SGDLRAKLARTLAV
Bac_Pro_Alp_4    AMDNSDLRRGRPTLHKKTDDATAILAGDGLLTLAFDIIT-RDEIHRDANVRLLLTRALAR
Bac_Pro_Alp_7    AMDNDTLRRGKPTVHRAFDEATAILAGNALLTFAFEIIA-HKASTLPFDTRIKLVTALAQ
Bac_Pro_Alp_9    SMDDDDLRRGKPTVHRAYDEATAILAGDGLLTLAFGLVA--GEEGLSPKARVALVALLAR
Bac_Pro_Alp_8    AMDDDKLRRGKPTAHIAFDEATAILAGDSLLTYAFDIIA-ADETRLPEQSKVALILALAR
Bac_Pro_Alp_10   AMDDDDIRRGKPTVHVKFDEATAILAGDSLLTYAFDIVA-APETALPDTSKASLVLALAR
Bac_Pro_Alp_5    AMDDDDLRRGQPTVHKAFDEATAILAGDALLTLAFDIIA-GEATALPAERRAALVLALAR
Bac_Pro_Alp_6    AMDDDDLRRGQPTVHRAFDEATAILAGDSLLTYAFDIIA-DDATLLSAEKRLALTLRLAR
Bac_Pro_Alp_2    AMDNDDFRRGQPSCHKKFDEATAILTGDALLTLAFEMLA-HESTHPDPGVRTELISKIAV
Bac_Pro_Alp_16   CMDNDDLRHGKPTVHRAFDEATAVLAGDALHALAFEILA-EDATSEDPFTRSELILTLGQ
Bac_Pro_Alp_14   AMDNDDMRRGKATVHKAFDEATAILAGDCLHDLAFQILS-DEETHPDPFVRIELVRALAL
Bac_Pro_Alp_15   CMDNDDMRHGKPTVHKAFDEATAVLAGDCLHDLAFGILA-DPATHEDPAVRLELVTELAI
Bac_Pro_Alp_13   AMDNDDLRRGKPTVHKAFGEATAILAGDALQAQAFAVLA-DEDTHSDAAVRVELVRRLAI
Bac_Pro_Alp_11   AMDNDDLRRGKPTTHKAYDEATAILAGDALLTQAFEVLA-DAETHADPKVRIALVTALAR
Bac_Pro_Alp_12   AMDDASLRRGRPTVHRQFDEATAILAGDALLTAAFEVMT-DPETHEDPRVRCALVSALAK
Bac_Pro_Gam_5    ALDNDDLRRGKPSCHKAFSEATAILAGDALQTLAFETIASLDKNKIAVEIEIEMIRLLAR
Bac_Pro_Bet_1    CMDNDTMRRGKPTVHVQFGEASALLAGDALQALAFELLL-PEDDGIPCSMQAKLCRLLGA
Bac_Pro_Bet_4    AMDNDSLRRGKPTCHVQYDEATALLVGDALQTLAFDVLS--RPANLPAARQLKMVAVLAK
Bac_Pro_Bet_2    CMDDDVLRRGKPTVHVEYDEATALLVGDALQALAFQTIA-EGRVNDVPAVQLEMVALLGR
Bac_Pro_Bet_3    CMDDDVLRRGKPTVHVEFDEATALLAGDALQTLAFQVLA-ERPLGTDPANQLAMLNQLAI
Bac_Pro_Gam_3    AMDDDELRRGQPTCHIKFDEATAILTGDALQTLAFTIIADGQLSPAAEAQRINMIKALAH
Bac_Pro_Gam_4    AMDNDALRRGKPTCHIAYGDDIAILAGDALQTLAFSALAEQPMPTVTLSSRLRMISELAT
Bac_Pro_Gam_1    AMDDDELRRGHPTCHIKFGEATAVLAGDALQTLAFEVLSTNLETKLSSQRRIAMIQHLAS
Bac_Pro_Gam_2    AMDDDELRRGRPTTHIAFDEATAILAGDALQALAFEMLS--QSSTLDTEARLAMIRELAA
Bac_Pro_Alp_3    SMDNDDFRRGKPSVHKAFGESTAILAGNSLLTLAFEILT-SDNMKSRSKSKSDLVYALAS
Bac_Pro_Alp_20   SMDDDDIRRGKPSTHKKFGESTAILSGNSLLTLAFEILS-DKKLKLKNKIKTELIYSLSI
Bac_Pro_Alp_1    CMDNDDFRRGKLSVHRKFGEAQAILAGDSLHDIAFEFIA-NQKTHNDPMIRIKLVYLLSS
Translation_of   SMDDDDYRRGKLSTHKKFNEATAILAGDALHDLAFELIS-GNLKNKNVISRLNLINYLSL
                 ###################################                      ###


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Del_2    NAGIGGMVVGQVVDVLSSR--DRLKGHSHKKLVNFIHKHKTAKLIQASVVCGAIC-GNPD
Bac_Pro_Eps_3    NGGLNGMVLGQAIDCYFEN--RVLSI---DDVKI-LHTNKTAKLIAASLKMGAIIVGE--
Bac_Pro_Eps_1    NGGIKGMVLGQALDCYFEN--TPLNL---EQLTF-LHEHKTAKLISASLMMGLVASGVKD
Bac_Pro_Eps_2    NGGIKGMILGQALDCYFEN--TPLNL---EQLTF-LHEHKTAKLISASLMMGLVASGIKN
Bac_Pro_Del_1    AAGICGMVGGQALDVLSGK--FAPDE---NTLRE-IHRRKTGALIVAAVKSGAII-SNAG
Bac_Pro_Alp_17   ASGMQGMVLGQAQDIQAEK--SEVNL-NINDITS-LQQNKTGALIEWSAISGAIL----S
Bac_Pro_Alp_19   ASGMQGMVLGQAQDIQAEK--SEVNL-NINDITS-LQQNKTGALIEWSAISGAIL----S
Bac_Pro_Alp_18   AAGAQGMVLGQTLDIAAET--APEPL-SLDAITA-LQQGKTGALIAWAALAG----PRMA
Bac_Pro_Alp_4    CAGIGGMVGGQILDLAGEG--RFGGN-EPIDVAR-IQQMKTGALLRYGCIAGAIL-GRAS
Bac_Pro_Alp_7    SAGIGGMVGGQMLDLEAEK--KPQES---TNIIT-LQRMKTAALISFACQAGAII-GNAS
Bac_Pro_Alp_9    DAGAAGMVGGQVLDLAAEN--AVLSE---DEIAR-MQAMKTGALIAFACEAGAIV-ADAG
Bac_Pro_Alp_8    SAGLGGMAGGQTLDLAAEK--TTPDE---RGIVT-LQAMKTGALIRFACEAGAMI-AGAS
Bac_Pro_Alp_10   AAGLGGMAGGQALDLAAEK--QAPDE---AGIIR-LQAMKTGALIRFACEAGAIL-AGSP
Bac_Pro_Alp_5    AAGAGGMVGGQKLDLEAEQ--VRPDE---AGIIK-LQAMKTGALIRFACEAGAIL-AGAQ
Bac_Pro_Alp_6    AAGIGGMAGGQALDLAAEG--ETLAE---EEILR-LQAMKTGALIRYACEAGAII-GSGN
Bac_Pro_Alp_2    ASGYRGMVGGQMMDLLAQH--NTLEF---SEVVR-LQRMKTGALFAISCEAGAIL-GKAS
Bac_Pro_Alp_16   ASGMNGMAGGQMMDMVADE--EGITY-DLPAITR-LQQLKTGALLAAAVEMGAIL-GKVP
Bac_Pro_Alp_14   ASGPAGMAGGQMMDLEAEH--ARFDL---ATVTR-LQNLKTGALIAFCVDAAAIM-ARIP
Bac_Pro_Alp_15   HSGPAGMAGGQMMDMVAGD--VAYDL---AGITR-LQQLKTGALIQWCLEAGAIM-GRAS
Bac_Pro_Alp_13   AAGPRGMCGGQMLDMLAEDGSEPATE---ASIGR-LQLLKTGKLIEFAAEAGAIL-GKAA
Bac_Pro_Alp_11   ASGAAGMVGGQALDMQAEQ--TPLTE--IGAITR-LQRLKTGALFEFSCEAGAIL-GKVE
Bac_Pro_Alp_12   ASGPRGMVGGQMLDLIAET--QALDI---GAITR-LQRMKTGELIAFAATAGAIL-GRAS
Bac_Pro_Gam_5    AIGSLGMAGGEELDIEMKD--KDVSL---NELEN-TYKLKTGYLLTASILLGALAANCHD
Bac_Pro_Bet_1    AAGSQGMAGGQAIDLASVG--KQLSE---AQLRE-MHRLKTGALLLGSVLMGAACNAQTD
Bac_Pro_Bet_4    AAGSLGMAGGQAIDLANVG--KAMNQ---AELEQ-MHGLKTGALIRAAVMLGALCCPNLN
Bac_Pro_Bet_2    ASGSRGMAGGQAIDLGAVG--KQLTR---EELEF-MHIHKTGALIRASVLLGAQSGAPLA
Bac_Pro_Bet_3    ASGSRGMAGGQAIDLASVG--KRLGR---EELEF-MHIHKTGALIRAAVLLGARAGGTLG
Bac_Pro_Gam_3    SSGASGMCVGQALDLGAEN--RQVSL---EEMEE-IHRKKTGALIDCAVKLGALAAGEKG
Bac_Pro_Gam_4    ASGALGMCAGQALDLAAEG--KSVAL---DALET-IHRHKTGALIRAAVRLGAYSAGEQA
Bac_Pro_Gam_1    ASGAKGMCFGQALDLDATG--RAIDE---LELEK-IHRHKTGALIRASAALGVLAGNDES
Bac_Pro_Gam_2    ASGHRGMVGGQAIDLESVG--RTLTL---AQLET-MHRHKTGALIEASVRMGALVSPELD
Bac_Pro_Alp_3    ASGYTGIAGGQFLDLRFEK--MKVKK---DLIIN-MQNKKTGELISFCSESAAILSGK--
Bac_Pro_Alp_20   CSGYSGMAGGQYLDLNFEH--KKVNK---LQLIE-MQNKKTGKLFSFCCSSSAII-KEKK
Bac_Pro_Alp_1    TLGAKGLAGGQYLDLKFEN--KKINK---NKILK-MYNLKTAALFCFCCMAPFIM-TKKN
Translation_of   CIGHKGLALGQALDLEYEN--KKLSK---NKILD-MYSRKTGKLFEFSFSAPFIL-----
                 ##############                         #############        


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Del_2    DVQLDRLAKYGLYAGVAFQIIDDYLDVVGDEEKLGKK-KVDEINNTLTYPKVYGLKRSYD
Bac_Pro_Eps_3    EKLAETLYDFGIKLGLLFQIQDDILDVTQSSQEAGKLTNNDE--NKNSFVTILGLDEAFL
Bac_Pro_Eps_1    EELFKWLQAFGLKMGLCFQVLDDIIDVTQDEEESGKTTHLDSA--KNSFVNLLGLEEASG
Bac_Pro_Eps_2    EELLKWLQDFGLKMGLCFQVLDDIIDVTQDEEESGKTTHLDSA--KNSFVNLLGLKKASD
Bac_Pro_Del_1    KDKIQALAEYGINVGLAFQIADDILNVEGDRELMGKETGSDAARGKLTYPSLMGLDVAKE
Bac_Pro_Alp_17   NHDDRKLLDYAKSIGLAFQIQDDILDIEGDAVLAGKRLQKDVSAGKATFVSLLGIENAKL
Bac_Pro_Alp_19   NHDDRNLLDYAKSIGLAFQIQDDILDIEGDAVLAGKRLQKDVSAGKATFVSLLGIENAKL
Bac_Pro_Alp_18   GADTAPLAAYAKALGLAFQIADDILDVTGDTATVGKATGKDASAGKATFVSHLGLDGAKR
Bac_Pro_Alp_4    QKEYQALDDYGRALGEAFQIADDLLDVEGDAAALGKPAGADAALGKTTFVTQLGIEGAKQ
Bac_Pro_Alp_7    KEFTEKLAAFGTYLGLAFQLTDDLLDVTAKSEILGKTVGKDKTAHKATFVRLYGIEETQK
Bac_Pro_Alp_9    AAERARLRRFGEIVGLAFQLADDLLDETADAAVLGKAAGKDRERGKKTLPALHGIDWTRA
Bac_Pro_Alp_8    SDDRKRLRAFGEKIGLAFQLADDLLDVKSDAATMGKATGKDVGRGKGTLVSLRGIGWAEA
Bac_Pro_Alp_10   QDDRQRLRAFGEKIGLAFQLADDILDLTSDAATMGKATGKDAARGKGTLVALHGMEWAET
Bac_Pro_Alp_5    SDDLERLAEFGSAIGLAFQLADDLLDLTADAEQMGKATGKDAAAGKGTLVALHGADWARK
Bac_Pro_Alp_6    DADRERLGEFGAAIGLAFQLADDLLDLTASSEAMGKATGKDAAAGKATLASLHGIDWTRA
Bac_Pro_Alp_2    KNLRNALRAYANNIGIAFQITDDLLDAEGTREETGKSVGKDKSQGKATLVSCIGIEKARE
Bac_Pro_Alp_16   PPGRAHLRAYARDIGLAFQIADDLLDVEGDAEKAGKALRKDAGQGKQTFVTLLGAERARE
Bac_Pro_Alp_14   VDARTGLHGYARDIGLAFQIADDLLDVEGDATVAGKALGKDAAAGKETFVSLLGVDRARA
Bac_Pro_Alp_15   EASRKSLRGYARDLGLAFQIADDLLDVEGESAKTGKAVQKDAAAGKATFVSLMGVERART
Bac_Pro_Alp_13   PLQRHALCAYGRDLGAAFQIADDVLDATATAEETGKRTGKDEQAGKATLVGLLGLERARA
Bac_Pro_Alp_11   DSRRGALQAYAHDMGLAFQIADDLLDVRGRAEEIGKTPGKDQAAGKATFVSILGLERAES
Bac_Pro_Alp_12   PPQFHALQAYAHDLGLAFQIADDLLDVEGTEAETGKSVGRDKPAGKATFVSILGLERARD
Bac_Pro_Gam_5    KNILNNLQKFGDYIGLAFQIHDDIIGIESDTQTLGKHQGSDQERNKPTYPTLIGMRKAKQ
Bac_Pro_Bet_1    ARALAALTDYGQALGVAFQVVDDILDVVADSATLGKTAGKDAANDKPTFVSLLGLEAARA
Bac_Pro_Bet_4    DDDMVRLDGYAKKLGLAFQVIDDVLDCEADTATLGKTAGKDADNDKPTYVKLMGLADARS
Bac_Pro_Bet_2    PDALARLDRYGKLVGLLFQVVDDILDAQADTATLGKTAGKDADRNKPTYVTLLGLSEART
Bac_Pro_Bet_3    ADEHARLDHYAKVVGLLFQVVDDLLDAEADTATLGKTAGKDADNDKPTYVSLLGLVDARR
Bac_Pro_Gam_3    IEVLPHLERYSKAIGLAFQVQDDILDIISDTETLGKPQGSDQGLNKSTYPSLLGLEGAIE
Bac_Pro_Gam_4    EPVLAELDRYANAIGLAFQVQDDILDIVGDTEVIGKRQGADIALGKSTYPALLGLEGARE
Bac_Pro_Gam_1    QQYLDHFCDFASWIGLAYQVYDDILDVVGNTEVMGKPQGSDEAHHKATYVALLGLDGASE
Bac_Pro_Gam_2    EPALDALTAFARSLGLAFQVQDDLLDIEGATEVIGKPQGSDAARAKPTYPALLGQEGARR
Bac_Pro_Alp_3    EKERSFLKKIGLDIGLLFQVTDDLLDIFGDSKKIGKPTRRDNQKGKATIIRNLGVNKTIE
Bac_Pro_Alp_20   LSMKRDLSQIGLQIGLLYQISDDLIDVRGNSNKAGKPTKRDVKRGKATLVNLLGYNNLLE
Bac_Pro_Alp_1    NKDLQFAKEYGNVFGIIFQIIDDYLDEFENFKKIGKTPGKDRKQGKSTILLHMKKKEVIP
Translation_of   ------------------------------------------------------------
                                                                             


                        310       320       330       340
                 =========+=========+=========+=========+=
Bac_Pro_Del_2    IAQKLKDMAILQI-KDI-----KGSKEL-IDIAKLIVERDR
Bac_Pro_Eps_3    EAESLANTLLKEI-DGF---DEKLKSELSKLLVHYINRHKN
Bac_Pro_Eps_1    YAQTLKTEVLDDL-NLLKPAYPLLQENL-NALLNTLFKGKT
Bac_Pro_Eps_2    YAQTLKTEVLNDL-NLLKPAYPLLQENL-NALLNTLFKGKT
Bac_Pro_Del_1    KLAKHIDAAEVSL-SEF---DERARP-L-LLIARYVMERKS
Bac_Pro_Alp_17   RAKELIEEAIDAL-SDY---GDKAEP-M-RQVAKFIIERKM
Bac_Pro_Alp_19   RAKELIEEAIDAL-SDY---GDKAEP-M-RQVAKFIIERKM
Bac_Pro_Alp_18   RANELMQSACDAL-SVY---GGDADT-L-RDAARFVVARKN
Bac_Pro_Alp_4    RVRDLLARADSAV-SIF---GERAAV-L-QAAARFVAERKS
Bac_Pro_Alp_7    KRDELIAKAEVLL-HPF---GAKAKP-L-QQAARFSATRKN
Bac_Pro_Alp_9    RLDRLVAEAEAEL-APF---GDKGGV-L-IEAARFVANRTS
Bac_Pro_Alp_8    ELRRHVEDARKLL-APY---GDAAAT-L-AATAHFVAARKS
Bac_Pro_Alp_10   ELRRHVADAEALL-APY---GVRAST-L-IAAAHFIADRKS
Bac_Pro_Alp_5    QLDGLVGQAHALL-EPY---GEKAAL-L-KAAAIFVATRNS
Bac_Pro_Alp_6    QLRGLVAQARDIL-APY---GEEAEG-L-RQAALFVAERQN
Bac_Pro_Alp_2    HALVLAKQAIEHL-NIF---DGKANL-L-KELAYFIVERNK
Bac_Pro_Alp_16   QARALVDQAVLRL-ASY---GSEADV-L-RALARYIVERDH
Bac_Pro_Alp_14   QAHMLVDQAKAHL-HGY---GAEADL-L-RAIADYIVERDR
Bac_Pro_Alp_15   QANMLIDQAIAHL-SAF---GPEADL-L-RAIARFAVERDR
Bac_Pro_Alp_13   QAERLAAQAQQHL-DSL---GERADL-L-RMLADYTIARRS
Bac_Pro_Alp_11   QARMLVDQACRHL-DVF---GDRADA-L-RAVAHFVVERKA
Bac_Pro_Alp_12   QAGRLADQATRHL-EIF---EGRASM-L-QAVARFVVDRRS
Bac_Pro_Gam_5    KENEIFNKALKHL-NKT---GIPVNK-L-EAIARYVVNRNF
Bac_Pro_Bet_1    HAEQLRQQAHAAL-TRS---GLADTQAL-GALADMVVQRTH
Bac_Pro_Bet_4    YAETLVADAVSLL-VPF---GGKAAR-L-RGLAEFVTARKN
Bac_Pro_Bet_2    LADVLLADARDAI-TSF---GAAATR-L-DELASFIVHRRF
Bac_Pro_Bet_3    LAEEMLDEARASL-RPF---GARALR-L-EQLADYIVHRAF
Bac_Pro_Gam_3    KAHTLLQEALQAL-EAI---PYNTQL-L-EEFARYVIERKN
Bac_Pro_Gam_4    KAHLLYQEAMDAL-ARVAAHSFDTTA-L-QALAGYIIERDK
Bac_Pro_Gam_1    KLLSLHQQALLSL-NKI---PYNTQK-L-ETFSEILLKRDH
Bac_Pro_Gam_2    HLSDLLSDAHESL-RAF---GPEADP-L-RAMADFVVARTH
Bac_Pro_Alp_3    FSYELADGISERLKNRY---GTRADS-L-IDSVYFLLRRDH
Bac_Pro_Alp_20   FTYSLKNKLVNKI-KKY---GTKSRD-L-LESLEYIIHREV
Bac_Pro_Alp_1    YCQSLANQFIKRN-KKY---FIKWNI-L-EDLLVNITQV--
Translation_of   -------KDKSKI-E--------------------------
                                                          






Parameters used
Minimum Number Of Sequences For A Conserved Position: 18
Minimum Number Of Sequences For A Flanking Position: 30
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes

Flank positions of the 4 selected block(s)
Flanks: [59  68]  [105  155]  [178  194]  [220  232]  

New number of positions in input.fasta-gb:  91  (26% of the original 341 positions)

Protein Domains

PROTOCOLE:


EBI "interpro" ; paramètres par défaut ; export : TSV



ANALYSE DES RÉSULTATS:



  _________________________________________________________________________________________________________________________________________________________________

|  Code Interpro  |    Banque   |  position  |  position  |  E-value  |  Intitulé banque d'origine |   Intitulé Interpro                                          | 
|   (IPRxxxxxx)   |  d'origine  |  de début  |   de fin   |           |  (premier sur la ligne)    |   (en fin de ligne)                                          |
|_________________|_____________|____________|____________|___________|____________________________|______________________________________________________________|
|                 |             |            |            |           |                            |                                                              |
|   IPR008949     | SUPERFAMILY |     23     |     203    |  2.88E-49 |   SSF48576                 |   Terpenoid synthase                                         |
|_________________|_____________|____________|____________|___________|____________________________|______________________________________________________________|
|                 |             |            |            |           |                            |                                                              |
|   IPR008949     | Gene3D      |     8      |     206    |  2.8E-53  |   G3DSA:1.10.600.10        |   Terpenoid synthase                                         |
|_________________|_____________|____________|____________|___________|____________________________|______________________________________________________________|
|                 |             |            |            |           |                            |                                                              |
|   IPR017446     | PANTHER     |     8      |     201    |  4.9E-45  |   PTHR12001                |   Polyprenyl synthetase-related                              |
|_________________|_____________|____________|____________|___________|____________________________|______________________________________________________________|
|                 |             |            |            |           |                            |                                                              |
|   IPR000092     |  ProSite    |            |            |           |                            |                                                              |
|                 |   Patterns  |     87     |     103    |           |   PS00723 Polyprenyl       |   Polyprenyl synthetase	GO:0008299                         |
|                 |             |            |            |           |  synthases signature 1.    |                                                              |
|                 |             |            |            |           |                            |                                                              |
|_________________|_____________|____________|____________|___________|____________________________|______________________________________________________________|
|                 |             |            |            |           |                            |                                                              |
|   IPR000092     | Pfam        |      40    |     201    |  1.5E-41  |  PF00348   Polyprenyl      |   Polyprenyl synthetase	GO:0008299                         |
|                 |             |            |            |           |     synthetase             |                                                              |
|_________________|_____________|____________|____________|___________|____________________________|______________________________________________________________|



Lors de la recherche de domaines protéiques sur l'ORF sélectionné, nous observons au total 6 domaines conservés, dont une qui n'a pas de code interpro (qui n'est donc pas recensé dans le tableau). C'est pourquoi nous avons 5 domaines conservés dans le tableau.

Dans ces 5 domaines conservés, il y en a 2 avec le même code interpro (IPR008949), 2 autres avec eux-aussi un même code interpro (IPR000092) et enfin un autre avec son code interpro unique (IPR017446).

Pour le code interpro IPR008949, nous avons 2 domaines conservés provenant de 2 banques d'origine différentes (SUPERFAMILY et Gene3D), pour le code interpro IPR000092 aussi (ProSitePatterns et Pfam), enfin pour le code interpro IPR017446, le domaines conservés provient de PANTHER. Nous avons donc au total 5 banques d'origine différentes.


En ce qui concerne la sélection des domaines, tout d'abord nous avons éliminé le domaine conservé qui ne contient pas de code interpro, car celui-ci n'est pas encore répertorié dans INTERPRO.

Ensuite, au sujet des domaines conservés restants, nous observons que 4 d'entre eux font tous pratiquement toute la longueur de l'ORF, or les domaines ne doivent pas se chevaucher ou se superposer, il nous faut donc choisir un seul domaine parmi les restants. Notre choix s'est fait en fonction de la E-value des séquences, de la longueur de la séquence. Nous voyons que les e-value se situent entre 2.8e-53 et 1.5e-41 (ce sont de bonnes e-values), la meilleure e-value est de 2.8e-53, ce qui correspond au domaine conservé n°2 dans le tableau, au code interpro IPR008949. Si maintenant nous nous penchons sur la longueur des domaines conservés, nous voyons qu'ils varient entre 16 et 198 nucléotides, et le domaine conservé qui correspond à la meilleure e-value fait 198 nucléotides. En raison de ces 2 paramètres, notre choix s'est donc porté sur ce domaine conservé, qui a donc comme fonction : Terpenoid synthase.

La terpenoid synthase est une enzyme permettant de synthétiser les différents terpènes, grâce à une cascade de réactions dans le métabolisme cellulaire des plantes et des bactéries.


Nous observons grâce à INTERPRO 2 fonctions différentes : Terpenoid synthase et Polyprenyl synthetase. Ces 2 fonctions sont liées du fait que la prolyprenyl synthetase est une classe d'enzyme responsable de la synthèse des isoprenoids, qui sont aussi des terpénoids.

Nous retrouvons aussi la fonction de prolyprenyl synthetase au sein du Blastp réalisé plus tôt, avec des e-values assez faibles (un minimum de 1e-41). La fonction terpenoid synthase se trouve à une e-value de 1e-26.

Ceci dit, les fonctions les plus retrouvées au Blastp ne sont pas identifiées ici (geranyl transferase, diphosphate synthase, pyrophosphate synthase).

RÉSULTATS BRUTS:


Submitted	c63167efac442a01f6968f08ec691002	208	SUPERFAMILY	SSF48576		23	203	2.88E-49	T	04-11-2014	IPR008949	Terpenoid synthase		
Submitted	c63167efac442a01f6968f08ec691002	208	Gene3D	G3DSA:1.10.600.10		8	206	2.8E-53	T	04-11-2014	IPR008949	Terpenoid synthase		
Submitted	c63167efac442a01f6968f08ec691002	208	PANTHER	PTHR12001		8	201	4.9E-45	T	04-11-2014	IPR017446	Polyprenyl synthetase-related		
Submitted	c63167efac442a01f6968f08ec691002	208	ProSitePatterns	PS00723	Polyprenyl synthases signature 1.	87	103	-	T	04-11-2014	IPR000092	Polyprenyl synthetase	GO:0008299	
Submitted	c63167efac442a01f6968f08ec691002	208	PANTHER	PTHR12001:SF23		8	201	4.9E-45	T	04-11-2014
Submitted	c63167efac442a01f6968f08ec691002	208	Pfam	PF00348	Polyprenyl synthetase	40	201	1.5E-41	T	04-11-2014	IPR000092	Polyprenyl synthetase	GO:0008299	

Phylogeny

PROTOCOLE:


a) Phylogeny.fr / méthode PhyML / groupe extérieur : toutes les protéobactéries sauf alpha-protéobactéries / paramètres par défaut


b) Phylogeny.fr / méthode Neighbor / groupe extérieur : toutes les protéobactéries sauf alpha-protéobactéries / paramètres par défaut



ANALYSE DES RÉSULTATS:  



L'exploitation de l'alignement multiple précédent nous permet d'obtenir l'arbre phylogénétique ci-dessous.


L'arbre PhyML obtenu est assez convaincant, en effet nous pouvons voir que les 2 branches principales de l'arbre séparent, comme convenu, le groupe d'étude (alphaprotéobactéries) du groupe extérieur (toutes les autres protéobactéries). De plus, l'ORF est bien compris au sein de la branche où se trouvent toutes les alphaprotéobactéries, il en est entouré.

Nous observons ainsi que la séquence la plus homologue à l'ORF est celle de la première alphaprotéobactérie sélectionnée ("Bac_Pro_Alp_1"). Les alphaprotéobactéries les moins similaires à l'ORF sont les 17, 18 et 19.

Le ré-enracinement de arbre a été fait avec le point central (mid-point rooting).

Nous observons ainsi 2 événements de spéciations, la première étant entre les séquences du groupe d'étude (issues de la branche "B") et du groupe extérieur (branche "A), et la seconde au sein de groupe extérieur même, entre "Bac_Pro_Gam_2" et les betaproteobacteries (à la branche "C").


Passons maintenant à l'arbre Neighbor.

Dans cet arbre, nous observons que les 2 branches principales ("a" et "b") séparent les 2 groupes, mais pas de manière catégorique. En effet, nous observons d'une part (au sein de la branche "a") 4 séquences du groupe extérieur, et d'autre part (au sein de la branche "b") toutes les autres séquences en plus de l'ORF, y compris donc le reste des séquences du groupe extérieur (issues de la branche "b2"). Mais ces séquences-ci (branche "b2") sont bien isolées de toutes les séquences du groupe d'étude ainsi que l'ORF. Du fait que quelques séquences du groupe extérieur ("b2") se retrouvent dans la même branche ("b") que les séquences du groupe d'étude, cet arbre est moins convaincant que le premier mais reste néanmoins bien structuré car les séquences des 2 groupes (extérieur et étude) sont bien distinguées. On ne retrouve pas d'espèces du groupe extérieur compris dans les espèces constituant le groupe d'étude même, et inversement. La branche "b1" représentant une branche monophylétique pour les alphaproteobactéries, qui sont les espèces choisies pour le groupe d'étude.

Nous retrouvons la même première alphaprotéobactérie ("Bac_Pro_Alp_1") comme étant la séquence la plus homologue la l'ORF. Au sein des 2 arbres nous observons que l'ORF, en plus d'avoir une forte homologie avec la même séquence, est entouré d'alphaprotéobactéries, ce qui nous convaincs qu'il fait bien partie du groupe des alphaproteobacteries.

Le ré-enracinement de arbre a été fait avec le point central (mid-point rooting).


RÉSULTATS BRUTS:


a) PhyML selon MUSCLE


                                                                                                           +-B.P.Eps_1
                                                                  +----------------------------------------+
                                                                  |                                        +--B.P.Eps_2
                             +------------------------------------+
              +--------------+                                    +------------------------B.P.Eps_3
              |              |
              |              +---------------------------------------------------------B.P.Del_2
              |
              |                              +-------------------------B.P.Bet_1
              |                              |
              |               +--------------+     +-------------------B.P.Bet_4
              |               |              |     |
              |            C  |              +-----+
           +--+        +------+                    |            +----------B.P.Bet_2
           |  |        |      |                    +------------+
           |  |        |      |                                 +----------B.P.Bet_3
           |  |        |      |
           |  |    +---+      +-------------------B.P.Gam_2
           |  |    |   |
     A     |  |    |   |                      +--------------------B.P.Gam_3
 +---------+  |    |   |           +----------+
 |         |  +----+   +-----------+          +-----------------B.P.Gam_4
 |         |       |               |
 |         |       |               +---------------------------B.P.Gam_1
 |         |       |
 |         |       +---------------------------------------B.P.Gam_5
 |         |
 |         +----------------------------------------B.P.Del_1
 |
 |                                             +B.P.Alp_17
 |                    +------------------------+
 |                    |                        +B.P.Alp_19
 |    +---------------+
 |    |               +--------------------------B.P.Alp_18
 |    |
 |    |         +----------------------B.P.Alp_4
 |    |         |
 |    |         |
 |    |   +-----+      +-------------------------B.P.Alp_7
 |    |   |     |      |
 +----+   |     |      |         +--------B.P.Alp_5
   B  |   |     +------+    +----+
      |   |            |    |    +-------------B.P.Alp_6
      |   |            |    |
      |   |            +----+          +-------B.P.Alp_8
      |   |                 | +--------+
      |   |                 +-+        +-----B.P.Alp_10
      |   |                   |
      +---+                   +--------------------------B.P.Alp_9
          |
          |                                                       +------------B.P.Alp_3
          |                                    +------------------+
          |                                    |                  +---------------------------------B.P.Alp_20
          |  +---------------------------------+
          |  |                                 |                                 +----------------------------B.P.Alp_1
          |  |                                 +---------------------------------+
          |  |                                                                   +----------------------------T.o.ORF_nu
          |  |
          |  |         +-----------------------------B.P.Alp_2
          +--+         |
             |     +---+
             |     |   |  +-------------B.P.Alp_12
             |     |   +--+
             |     |      |  +-----------B.P.Alp_11
             +-----+      +--+
                   |         +---------------------B.P.Alp_13
                   |
                   |         +------------------B.P.Alp_16
                   +---------+
                             |     +------------B.P.Alp_14
                             +-----+
                                   +------------B.P.Alp_15
























b) ProtDist/FastDist + Neighbor selon MUSCLE



     +----------------------------------------Bac_Pro_Del_1
     |
   a |                                                                                           +--Bac_Pro_Eps_2
 +---+                                              +--------------------------------------------+
 |   |                                              |                                            +Bac_Pro_Eps_1
 |   |                          +-------------------+
 |   |                          |                   +------------------------------Bac_Pro_Eps_3
 |   +--------------------------+
 |                              +---------------------------------------------------------------Bac_Pro_Del_2
 |
 |                                                     +--------------------------------------------Translation_of_ORF_n
 |                                      +--------------+
 |                                      |              |
 |                                      |              +---------------------------------------Bac_Pro_Alp_1
 |               +----------------------+
 |               |                      |             +---------------------------------Bac_Pro_Alp_20
 |             +-+                      +-------------+
 |             | |                                    +-------------------Bac_Pro_Alp_3
 |             | |
 |           +-+ +-----------------------------------Bac_Pro_Alp_2
 |           | |
 |           | +--------------------------Bac_Pro_Alp_11
 |           |
 |         +-+       +-------------------------------Bac_Pro_Alp_12
 |         | |       |
 |         | |       |    +-------------------------Bac_Pro_Alp_7
 |         | +-------+    |
 |         |         |    |     +-----------Bac_Pro_Alp_5
 |         |         |    |     |
 |         |         |    |    ++    +------------Bac_Pro_Alp_6
 |         |         +----+    ||    |
 |         |              |    |+----+     +---------Bac_Pro_Alp_10
 |         |              |+---+     +-----+
 |     b1  |              ||   |           +-----------Bac_Pro_Alp_8
 |   +-----+              ||   |
 |   |     |              ++   +-------------------Bac_Pro_Alp_9
 |   |     |               |
 |   |     |               |
 |   |     |               +--------------------------------------Bac_Pro_Alp_4
 |   |     |
 |   |     |                            +--------------------Bac_Pro_Alp_15
 |   |     |               +------------+
 |   |     |  +------------+            +-------------Bac_Pro_Alp_14
 |   |     |  |            |
 |   |     |  |            +-------------------------Bac_Pro_Alp_16
 |   |     +--+
 |   |        |   +---------------------------Bac_Pro_Alp_13
 |   |        |   |
 +---+        +---+                    +---------------------------Bac_Pro_Alp_18
   b |            |                    |
     |            +--------------------+                               +Bac_Pro_Alp_19
     |                                 +-------------------------------+
     |                                                                 +Bac_Pro_Alp_17
     |
     |      +----------------------Bac_Pro_Gam_2
     |      |
     |  +---+       +-----------------------Bac_Pro_Gam_4
     |  |   |       |
     |  |   +-------+ +------------------------Bac_Pro_Gam_1
     |  |           | |
     |  |           +-+
     |  |             +-----------------------Bac_Pro_Gam_3
     +--+
      b2|             +----------------------Bac_Pro_Bet_4
        |             |
        |  +----------+          +---Bac_Pro_Bet_3
        |  |          |     +----+
        |  |          +-----+    +----------Bac_Pro_Bet_2
        +--+                |
           |                +-----------------------------Bac_Pro_Bet_1
           |
           +--------------------------------------Bac_Pro_Gam_5

Taxonomy report

PROTOCOLE:


BLASTp contre NR, paramètres par défaut au NCBI sauf "Number of descriptions_5000", puis outil local "tax_report2"



ANALYSE DES RÉSULTATS:




Groupe d'étude : Alpha-protéobactéries


>Bac_Pro_Alp_1 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_2e-56  Bacteria;Proteobacteria;Alphaproteobacteria; gi|516678772|ref|WP_018037340.1| hypothetical protein [alpha proteobacterium SCGC AB-629-F11]

>Bac_Pro_Alp_2 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_3e-37  Bacteria;Proteobacteria;Alphaproteobacteria;Rickettsiales;Holosporaceae; gi|665991591|gb|AIF81352.1| geranyltranstransferase [endosymbiont of Acanthamoeba sp. UWC8]

>Bac_Pro_Alp_3 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_8e-46  Bacteria;Proteobacteria;Alphaproteobacteria; gi|516596700|ref|WP_017971727.1| hypothetical protein [alpha proteobacterium SCGC AAA280-B11]

>Bac_Pro_Alp_4 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_3e-39  Bacteria;Proteobacteria;Alphaproteobacteria;Rhizobiales;Phyllobacteriaceae;Mesorhizobium; gi|517267103|ref|WP_018455921.1| geranylgeranyl pyrophosphate synthase [Bradyrhizobium sp. WSM4349]

>Bac_Pro_Alp_5 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_3e-28  Bacteria;Proteobacteria;Alphaproteobacteria;Rhizobiales;Phyllobacteriaceae;Mesorhizobium; gi|505128241|ref|WP_015315343.1| farnesyl-diphosphate synthase [Mesorhizobium australicum]

>Bac_Pro_Alp_6 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_1e-25  Bacteria;Proteobacteria;Alphaproteobacteria;Rhizobiales;Phyllobacteriaceae;Nitratireductor; gi|497058042|ref|WP_009450830.1| farnesyl-diphosphate synthase [Nitratireductor indicus]

>Bac_Pro_Alp_7 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_3e-42  Bacteria;Proteobacteria;Alphaproteobacteria;Rhizobiales;Bartonellaceae;Bartonella; gi|490996065|ref|WP_004857792.1| farnesyl-diphosphate synthase [Bartonella taylorii]

>Bac_Pro_Alp_8 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_1e-37  Bacteria;Proteobacteria;Alphaproteobacteria;Rhizobiales;Rhizobiaceae;Rhizobium/Agrobacterium group;Rhizobium; gi|655331793|ref|WP_028740001.1| farnesyl-diphosphate synthase [Rhizobium mongolense]

>Bac_Pro_Alp_9 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_2e-33  Bacteria;Proteobacteria;Alphaproteobacteria;Rhizobiales;Aurantimonadaceae;Aurantimonas; gi|496502519|ref|WP_009210802.1| farnesyl-diphosphate synthase [Aurantimonas manganoxydans]

>Bac_Pro_Alp_10 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_3e-25  Bacteria;Proteobacteria;Alphaproteobacteria;Rhizobiales;Rhizobiaceae;Rhizobium/Agrobacterium group;Rhizobium; gi|657771514|ref|WP_029531871.1| farnesyl-diphosphate synthase [Rhizobium phaseoli]

>Bac_Pro_Alp_11 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_8e-44  Bacteria;Proteobacteria;Alphaproteobacteria;Rhodospirillales;Rhodospirillaceae;Inquilinus; gi|699011637|gb|KGM31584.1| farnesyl-diphosphate synthase [Inquilinus limosus MP06]

>Bac_Pro_Alp_12 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_6e-42  Bacteria;Proteobacteria;Alphaproteobacteria;Rhodospirillales;Rhodospirillaceae;Azospirillum; gi|490394806|ref|WP_004272414.1| farnesyl-diphosphate synthase [Nitrospirillum amazonense]

>Bac_Pro_Alp_13 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_7e-40  Bacteria;Proteobacteria;Alphaproteobacteria;Rhodospirillales;Acetobacteraceae;unclassified Acetobacteraceae; gi|494678627|ref|WP_007435962.1| polyprenyl synthetase, partial [Acetobacteraceae bacterium AT-5844]

>Bac_Pro_Alp_14 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_3e-42  Bacteria;Proteobacteria;Alphaproteobacteria;Sphingomonadales;Sphingomonadaceae;Sphingobium; gi|517881500|ref|WP_019051708.1| farnesyl-diphosphate synthase [Sphingobium xenophagum]

>Bac_Pro_Alp_15 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_3e-40  Bacteria;Proteobacteria;Alphaproteobacteria;Sphingomonadales;Sphingomonadaceae;Sandarakinorhabdus; gi|516264819|ref|WP_017668782.1| hypothetical protein [Sandarakinorhabdus sp. AAP62]

>Bac_Pro_Alp_16 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_9e-37  Bacteria;Proteobacteria;Alphaproteobacteria;Sphingomonadales;Erythrobacteraceae;Porphyrobacter; gi|653236200|ref|WP_027441921.1| farnesyl-diphosphate synthase [Porphyrobacter cryptus]

>Bac_Pro_Alp_17 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_8e-41  Bacteria;Proteobacteria;Alphaproteobacteria;Rhodobacterales; gi|495310966|ref|WP_008035714.1| farnesyl-diphosphate synthase [Rhodobacterales bacterium HTCC2255]

>Bac_Pro_Alp_18 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_2e-27  Bacteria;Proteobacteria;Alphaproteobacteria;Rhodobacterales;Rhodobacteraceae;Sulfitobacter; gi|640614713|ref|WP_025042775.1| farnesyl-diphosphate synthase [Sulfitobacter sp. MM-124]

>Bac_Pro_Alp_19 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_2e-40  Bacteria;Proteobacteria;Alphaproteobacteria; gi|518901873|ref|WP_020057748.1| farnesyl-diphosphate synthase [alpha proteobacterium SCGC AAA076-C03]

>Bac_Pro_Alp_20 [Bacteria Proteobacteria Alphaproteobacteria]  E-value_3e-34  Bacteria;Proteobacteria;Alphaproteobacteria; gi|656260148|ref|WP_029206320.1| geranyl transferase [alpha proteobacterium SCGC AAA288-G21]








Groupe extérieur : Toutes les protéobactéries hormis les alpha-protéobactéries


>Bac_Pro_Gam_1 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_7e-45  Bacteria;Proteobacteria;Gammaproteobacteria;Alteromonadales;Idiomarinaceae;Idiomarina; gi|494013985|ref|WP_006956361.1| geranyltranstransferase [Idiomarina baltica]

>Bac_Pro_Gam_2 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_4e-43  Bacteria;Proteobacteria;Gammaproteobacteria;Alteromonadales;Alteromonadaceae;Marinobacter; gi|496223176|ref|WP_008937211.1| geranyltranstransferase [Marinobacter santoriniensis]

>Bac_Pro_Gam_3 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_1e-41  Bacteria;Proteobacteria;Gammaproteobacteria;Vibrionales;Vibrionaceae;Vibrio; gi|543995411|ref|WP_021034136.1| geranyltranstransferase [Vibrio alginolyticus]

>Bac_Pro_Gam_4 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_4e-36  Bacteria;Proteobacteria;Gammaproteobacteria;Enterobacteriales;Enterobacteriaceae;Tatumella; gi|658473985|ref|WP_029686923.1| geranyl transferase [Tatumella saanichensis]

>Bac_Pro_Gam_5 [Bacteria Proteobacteria Gammaproteobacteria]  E-value_4e-34  Bacteria;Proteobacteria;Gammaproteobacteria;Legionellales;Legionellaceae;Fluoribacter; gi|498340087|ref|WP_010654243.1| farnesyl-diphosphate synthase [Fluoribacter dumoffii]

>Bac_Pro_Del_1 [Bacteria Proteobacteria Deltaproteobacteria]  E-value_2e-29  Bacteria;Proteobacteria;Deltaproteobacteria;Syntrophobacterales;Syntrophaceae;Smithella; gi|676547841|gb|KFO66513.1| hypothetical protein ER57_16905 [Smithella sp. SCADC]

>Bac_Pro_Del_2 [Bacteria Proteobacteria Deltaproteobacteria]  E-value_3e-24  Bacteria;Proteobacteria;Deltaproteobacteria;Desulfurellales;Desulfurellaceae;Hippea; gi|503446537|ref|WP_013681198.1| farnesyltranstransferase [Hippea maritima]

>Bac_Pro_Bet_1 [Bacteria Proteobacteria Betaproteobacteria]  E-value_5e-32  Bacteria;Proteobacteria;Betaproteobacteria;Burkholderiales;Comamonadaceae;Comamonas; gi|489159509|ref|WP_003069162.1| polyprenyl synthetase [Comamonas testosteroni]

>Bac_Pro_Bet_2 [Bacteria Proteobacteria Betaproteobacteria]  E-value_4e-34  Bacteria;Proteobacteria;Betaproteobacteria;Rhodocyclales;Rhodocyclaceae;Azoarcus; gi|517820691|ref|WP_018990899.1| geranyltranstransferase [Azoarcus toluclasticus]

>Bac_Pro_Bet_3 [Bacteria Proteobacteria Betaproteobacteria]  E-value_4e-33  Bacteria;Proteobacteria;Betaproteobacteria;Rhodocyclales;Rhodocyclaceae;Thauera; gi|490439064|ref|WP_004310077.1| MULTISPECIES: geranyltranstransferase [Thauera]

>Bac_Pro_Bet_4 [Bacteria Proteobacteria Betaproteobacteria]  E-value_2e-30  Bacteria;Proteobacteria;Betaproteobacteria;Neisseriales;Neisseriaceae;Neisseria; gi|496406438|ref|WP_009115302.1| geranyltranstransferase [Neisseria wadsworthii]

>Bac_Pro_Eps_1 [Bacteria Proteobacteria Epsilonproteobacteria]  E-value_3e-29  Bacteria;Proteobacteria;Epsilonproteobacteria;Campylobacterales;Helicobacteraceae;Helicobacter; gi|446987050|ref|WP_001064306.1| geranyltranstransferase [Helicobacter pylori]

>Bac_Pro_Eps_2 [Bacteria Proteobacteria Epsilonproteobacteria]  E-value_7e-28  Bacteria;Proteobacteria;Epsilonproteobacteria;Campylobacterales;Helicobacteraceae;Helicobacter; gi|447010659|ref|WP_001087915.1| geranyltranstransferase [Helicobacter pylori]

>Bac_Pro_Eps_3 [Bacteria Proteobacteria Epsilonproteobacteria]  E-value_2e-25  Bacteria;Proteobacteria;Epsilonproteobacteria;Campylobacterales;Helicobacteraceae;Sulfurimonas; gi|499691238|ref|WP_011371972.1| geranyltranstransferase [Sulfurimonas denitrificans]





_______________________________________________________________________________________________________________

|                       |                   |                          |                  |                     |  |                       |                   |                          |                  |                     |

| phylum                | classe            | Ordre                    | gamme de e-value | nombre de résultats |

|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

| [Bacteria]            | [Proteobacteria]  | [Alphaproteobacteria]    |  2e-56 - 3e-24   |        636          |

|                       |                   |__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|                       |                   | [Gammaproteobacteria]    |  7e-45 - 5e-24   |        1100         |

|                       |                   |__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|                       |                   | [Deltaproteobacteria]    |  3e-40 - 5e-24   |         56          |

|                       |                   |__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|                       |                   | [Betaproteobacteria]     |   1e-38 - 4e-24  |          306        |

|                       |                   |__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|                       |                   | [Epsilonproteobacteria]  |   4e-32 - 5e-24  |         256         |

|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|                       | [Firmicutes]      |                          |  7e-40 - 6e-24   |        1324         |

|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|                       | [Fusobacteria]    |                          |  5e-33 - 7e-28   |        60           |

|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|                       | [Cyanobacteria]   |                          |  4e-32 - 4e-24   |        165          |

|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|                       | [Spirochaetes]    |                          |  2e-31 - 6e-26   |        60           |

|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|                       | [Verrucomicrobia] |                          |  8e-34 - 4e-29   |        10           |

|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|                       | [Thermotogae]     |                          |  2e-33 - 8-e26   |        9            |

|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|                       | [Nitrospirae]     |                          |  1e-30 - 5e-24   |        9            |

|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|                       | [Acidobacteria]   |                          |  4e-30 - 8e-27   |        15           |

|_______________________|___________________|__________________________|__________________|_____________________|

|                       |                   |                          |                  |                     |

|                       | [Aquificae]       |                          |  3e-29 - 1e-24   |        10           |

|_______________________|___________________|__________________________|__________________|_____________________|







Etant donné que notre Blastp selon la base de donnée NR donne des résultats de faible e-value, jusqu'au dernier, nous avons donc sélectionné les 5000 séquences du Blastp pour faire le rapport taxonomique (la valeur seuil de e-value étant 6e-24).

Nous observons ainsi pratiquement que des bactéries (4893 sur 5000), très peu d'Archaea (5 sur 5000) et peu d'Eukaryotes (102 sur 5000), les protéobactéries présentent les meilleurs résultats car elles possèdent les plus faibles e-values et les meilleurs scores (2e-56 et 192 pour alphaprotéobactérie ; 7e-45 et 162 pour gammaprotéobactérie). Les 3 autres protéobactéries démontrent également de bons résultats (3e-40 et 149 pour deltaprotéobactérie ; 1e-38 et 145 pour betaprotéobactérie ; 4e-32 et 128 pour epsilonprotéobactérie). Nous observons aussi que le nombre de résultats pour les protéobactéries est élevé, et donc convaincant (un total de 2354, soit pratiquement la moitié du nombre total de séquences trouvées). Nous avons quelques eucaryotes, mais un nombre très peu élevé, non significatif.


Les alphaprotéobactéries nous paraissent donc comme être le groupe présentant le plus d'homologues (selon les e-values, les scores, et le nombre de résultats au vu des précédentes analyses). De ce fait, nous pouvons le définir comme le groupe d'étude, qui est le groupe présentant le plus de similarités avec l'ORF choisi.


Une fois le groupe d'étude choisi, il nous a fallu identifier le groupe extérieur, qui est le groupe représentant un ensemble d'espèces possédant le même ancêtre commun que le groupe d'étude et dont les e-values et scores sont moins significatifs que le groupe d'étude (e-value plus grande et score plus faible). En vue des résultats trouvés et de l'arbre de la vie, nous définissons toutes les autres protéobactéries (gamma, delta, beta, epsilonprotéobactéries) comme étant le groupe extérieur. Comme vu précédemment, ces espèces présentent aussi de bonnes e-value, de bons scores.


Nous observons que les 2 groupes présentent un différentiel de e-values et de scores. En prenant les meilleures e-values (2e-56 et 7e-45) et les meilleurs scores (192 et 162) et des 2 groupes, nous avons, entre ces 2 groupes, un différentiel de l'ordre de -11 pour les e-values et un différentiel de 30 pour les scores. Ce résultat significatif nous conforte donc dans notre choix du groupe extérieur, mettant en évidence le groupe d'étude.

RÉSULTATS BRUTS:

Lineage report

.LUCA
. Bacteria
. .Proteobacteria
. . Alphaproteobacteria
. . .alpha proteobacterium SCGC AB-629-F11........ 192  2e-56  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [alpha proteobacteri...   
. . .alpha proteobacterium HIMB5.................. 169  1e-47  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [alpha proteobact...   
. . .Candidatus Pelagibacter ubique............... 162  6e-45  11 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyl transferase [Candidatus Pelagibac...   
. . .Candidatus Pelagibacter sp. HTCC7211......... 158  1e-43  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Candidatus Pelag...   
. . .Candidatus Pelagibacter sp. IMCC9063......... 155  2e-42  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Candidatus Pelag...   
. . .Candidatus Pelagibacter ubique HTCC1002...... 149  3e-40  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Candidatus Pelag...   
. . .Candidatus Pelagibacter ubique HTCC1062...... 149  5e-40  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Candidatus Pelag...   
. . .alpha proteobacterium HIMB114................ 147  4e-39  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [alpha proteobact...   
. . .Candidatus Pelagibacter ubique HIMB083....... 145  1e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranylgeranyl pyrophosphate synthase [Ca...   
. . .alpha proteobacterium HIMB59................. 129  2e-32  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: polyprenyl synthetase [alpha proteobacter...   
. . .endosymbiont of Acanthamoeba sp. UWC8........ 142  3e-37  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [endosymbiont of Acant...   
. . .Candidatus Midichloria mitochondrii.......... 140  1e-36  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Candidatus Midic...   
. . .Rickettsiales bacterium Ac37b................ 134  2e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: Farnesyl diphosphate synthase [Rickettsiales b...   
. . .Wolbachia endosymbiont of Cimex lectularius.. 132  8e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: farnesyl diphosphate synthase [Wolbachia endo...   
. . .Ehrlichia ruminantium........................ 130  3e-33  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Ehrlichia rumina...   
. . .Ehrlichia ruminantium str. Welgevonden....... 130  5e-33  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Ehrlichia rumina...   
. . .Ehrlichia canis.............................. 127  8e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Ehrlichia canis]      
. . .Wolbachia endosymbiont of Brugia malayi...... 125  6e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Wolbachia endosy...   
. . .Wolbachia.................................... 123  2e-30  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: MULTISPECIES: geranyltranstransferase [Wo...   
. . .Ehrlichia chaffeensis........................ 121  7e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Ehrlichia chaffe...   
. . .Wolbachia endosymbiont of Muscidifurax unirapto 121  9e-30  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Wolbachia endosy...   
. . .Anaplasma centrale........................... 121  2e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Anaplasma centrale]   
. . .Wolbachia endosymbiont of Drosophila simulans 120  1e-29  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: Geranylgeranyl pyrophosphate synthase [Wo...   
. . .Wolbachia endosymbiont of Drosophila simulans w 119  4e-29  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: Geranyltranstransferase [Wolbachia endosy...   
. . .Candidatus Paracaedibacter symbiosus......... 119  7e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: hypothetical protein [Candidatus Paracaed...   
. . .Ehrlichia muris.............................. 119  8e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Ehrlichia muris]      
. . .Anaplasma marginale.......................... 119  1e-28  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyl transferase [Anaplasma marginale]      
. . .Ehrlichia sp. HF............................. 119  1e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: polyprenyl synthetase family protein [Ehrlichi...   
. . .Wolbachia pipientis.......................... 118  1e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Wolbachia pipien...   
. . .Wolbachia endosymbiont of Culex quinquefasciatu 118  1e-28  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: MULTISPECIES: geranyltranstransferase [Wo...   
. . .Wolbachia endosymbiont of Nasonia vitripennis 118  1e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Wolbachia endosy...   
. . .Wolbachia endosymbiont of Diaphorina citri... 118  1e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Wolbachia endosy...   
. . .Anaplasma marginale str. St. Maries.......... 118  2e-28  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Anaplasma margin...   
. . .Wolbachia endosymbiont of Drosophila melanogast 116  1e-27  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Wolbachia endosy...   
. . .Wolbachia endosymbiont of Glossina morsitans mo 115  5e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Wolbachia endosymbion...   
. . .Anaplasma phagocytophilum str. Norway variant2 108  8e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyl transferase [Anaplasma phagocytophilum...   
. . .Anaplasma phagocytophilum str. MRK........... 107  1e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyl transferase [Anaplasma phagocytophilum...   
. . .Anaplasma phagocytophilum.................... 107  2e-24  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Anaplasma phagoc...   
. . .Anaplasma phagocytophilum HZ2................ 107  2e-24  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Anaplasma phagoc...   
. . .Anaplasma phagocytophilum str. CRT35......... 106  3e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyl transferase [Anaplasma phagocytophilum...   
. . .Anaplasma phagocytophilum CRT38.............. 106  5e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rickettsiales: geranyltranstransferase [Anaplasma phagoc...   
. . .alpha proteobacterium SCGC AAA280-B11........ 164  8e-46  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [alpha proteobacteri...   
. . .alpha proteobacterium SCGC AB-629-G21........ 163  2e-45  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [alpha proteobacteri...   
. . .alpha proteobacterium SCGC AAA240-E13........ 162  7e-45  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: geranyl transferase [alpha proteobacteriu...   
. . .alpha proteobacterium SCGC AAA028-D10........ 160  2e-44  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: geranyl transferase [alpha proteobacteriu...   
. . .Phyllobacterium sp. YR531.................... 159  7e-44  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Phyllobact...   
. . .Phyllobacterium sp. UNC302MFCol5.2........... 129  1e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Phyllobact...   
. . .Bradyrhizobium sp. WSM4349................... 147  3e-39  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Me...   
. . .Aminobacter sp. J41.......................... 145  1e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Aminobacte...   
. . .Phyllobacteriaceae bacterium AMV1............ 138  9e-36  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase (farnesyl-diphosp...   
. . .Chelativorans sp. J32........................ 132  2e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Chelativor...   
. . .Aquamicrobium defluvii....................... 130  7e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Aquamicrobium d...   
. . .Aliihoeflea sp. 2WW.......................... 129  2e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Aliihoefle...   
. . .Mesorhizobium loti........................... 124  2e-30  10 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium sp. LNHC252B00................. 123  4e-30  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium sp. WSM3224.................... 121  2e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Hoeflea sp. 108.............................. 121  2e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Hoeflea sp...   
. . .Mesorhizobium................................ 121  3e-29  11 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . .Nitratireductor aquibiodomus................. 120  3e-29  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Nitratired...   
. . .Hoeflea phototrophica........................ 120  4e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Ho...   
. . .Nitratireductor aquibiodomus RA22............ 119  9e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Nitratired...   
. . .Mesorhizobium sp. LNHC220B00................. 119  1e-28  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium sp. LSJC280B00................. 119  1e-28  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium sp. LNHC229A00................. 119  1e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . .Mesorhizobium sp. L103C119B0................. 119  1e-28  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium sp. LNJC380A00................. 119  1e-28  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Nitratireductor basaltis..................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Geranylgeranyl pyrophosphate synthase [Nitrati...   
. . .Mesorhizobium sp. LNHC232B00................. 119  1e-28  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium sp. URHC0008................... 119  2e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium sp. LSHC412B00................. 118  2e-28  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizobium s...   
. . .Mesorhizobium sp. LNJC399B00................. 118  3e-28  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . .Mesorhizobium australicum.................... 118  3e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium sp. LSJC277A00................. 118  3e-28  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium sp. LNJC403B00................. 118  3e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . .Mesorhizobium sp. LSJC268A00................. 118  3e-28  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . .Mesorhizobium sp. SOD10...................... 117  5e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Mesorhizobium sp. SO...   
. . .Mesorhizobium ciceri......................... 117  5e-28  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium sp. ORS3324.................... 117  7e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Mesorhizobium sp. OR...   
. . .Mesorhizobium loti WSM1293................... 117  8e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Nitratireductor pacificus.................... 117  8e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Nitratired...   
. . .Mesorhizobium ciceri biovar biserrulae WSM1271 116  9e-28  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium metallidurans STM 4661......... 116  1e-27  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Mesorhizobium sp...   
. . .Mesorhizobium sp. LSHC440B00................. 116  1e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . .Mesorhizobium sp. LNJC395A00................. 116  1e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . .Mesorhizobium sp. LSJC269B00................. 116  1e-27  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . .Mesorhizobium sp. LSHC420B00................. 116  2e-27  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Parvibaculum lavamentivorans................. 115  2e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Parvibacul...   
. . .Mesorhizobium plurifarium.................... 115  3e-27  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Mesorhizobium plurif...   
. . .Mesorhizobium sp. L2C067A000................. 115  3e-27  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium sp. LNHC221B00................. 115  3e-27  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium sp. L103C131B0................. 115  4e-27  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium opportunistum.................. 115  5e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium sp. L103C105A0................. 115  5e-27  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium loti NZP2037................... 115  6e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: putative farnesyl diphosphate synthase [Mesor...   
. . .Mesorhizobium sp. LNJC374B00................. 114  5e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . .Mesorhizobium sp. WSM3626.................... 114  6e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium amorphae....................... 114  7e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium loti MAFF303099................ 114  1e-26  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium sp. L2C084A000................. 114  1e-26  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium loti R7A....................... 114  1e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: PROBABLE FARNESYL-DIPHOSPHATE SYNTHASE PROTEI...   
. . .Mesorhizobium huakuii 7653R.................. 113  2e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Mesorhizobium huakuii...   
. . .Mesorhizobium sp. URHA0056................... 112  4e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium metallidurans.................. 112  4e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Mesorhizobium me...   
. . .Nitratireductor indicus...................... 111  1e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Nitratired...   
. . .Chelativorans sp. BNC1....................... 111  1e-25  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Chelativor...   
. . .Mesorhizobium sp. ORS3359.................... 110  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Mesorhizobium sp. OR...   
. . .Mesorhizobium sp. L48C026A00................. 110  3e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Pseudaminobacter salicylatoxidans............ 108  6e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Pseudamino...   
. . .Mesorhizobium sp. LSJC264A00................. 108  2e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizobium s...   
. . .Mesorhizobium sp. LSHC422A00................. 108  2e-24  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . .Mesorhizobium sp. L2C085B000................. 107  2e-24  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizobium s...   
. . .Mesorhizobium sp. L2C089B000................. 107  3e-24  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium sp. LSJC265A00................. 107  3e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium sp. LSHC426A00................. 107  3e-24  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizobium s...   
. . .Mesorhizobium sp. LSJC255A00................. 107  3e-24  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium sp. L2C066B000................. 107  4e-24  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizobium s...   
. . .Mesorhizobium sp. L103C120A0................. 107  4e-24  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . .Mesorhizobium sp. L2C054A000................. 107  4e-24  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium sp. LNJC391B00................. 107  4e-24  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Mesorhizobium sp. LNJC405B00................. 107  4e-24  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Mesorhizob...   
. . .Bartonella taylorii.......................... 155  3e-42  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Bartonella...   
. . .Hyphomicrobium nitrativorans................. 153  1e-41  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: polyprenyl synthetase [Hyphomicrobium nit...   
. . .Ochrobactrum sp. CDB2........................ 151  9e-41  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: polyprenyl synthetase [Ochrobactrum sp. C...   
. . .Bartonella bacilliformis Ver097.............. 151  1e-40  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein H710_00328 [Bartonella ba...   
. . .Ochrobactrum rhizosphaerae................... 151  1e-40  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Ochrobactr...   
. . .Bartonella vinsonii.......................... 151  1e-40  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Bartonella...   
. . .Bartonella bacilliformis..................... 150  1e-40  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Bartonella...   
. . .Bartonella koehlerae C-29.................... 149  4e-40  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein O9A_00132 [Bartonella koe...   
. . .Bartonella vinsonii subsp. arupensis Pm136co. 149  5e-40  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Bartonella...   
. . .Bartonella australis......................... 148  1e-39  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Bartonella austr...   
. . .Bartonella vinsonii subsp. berkhoffii str. Winn 148  2e-39  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Bartonella vinso...   
. . .Bartonella bacilliformis Peru-18............. 147  2e-39  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein X470_00037 [Bartonella ba...   
. . .Bartonella rattaustraliani................... 147  3e-39  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Bartonella...   
. . .Bartonella sp. DB5-6......................... 147  3e-39  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Bartonella...   
. . .Bartonella alsatica.......................... 147  4e-39  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Bartonella...   
. . .Bartonella bovis............................. 147  4e-39  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Bartonella bovis]     
. . .Bartonella rochalimae ATCC BAA-1498.......... 147  4e-39  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Bartonella rochalima...   
. . .Bradyrhizobium sp. YR681..................... 147  5e-39  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bradyrhizobium sp. URHA0013.................. 146  6e-39  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bradyrhizobium japonicum..................... 146  7e-39  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bradyrhizobium sp. CCGE-LA001................ 146  1e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Bradyrhizobium sp. CC...   
. . .Bartonella quintana.......................... 146  1e-38  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Bartonella...   
. . .Bartonella sp. 1-1C.......................... 145  1e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Bartonella sp. 1-1C]      
. . .Bartonella bovis 91-4........................ 145  1e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Bartonella bovis]     
. . .Bradyrhizobium sp. DOA9...................... 145  1e-38  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Xanthobacteraceae............................ 145  1e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: geranylgeranyl pyrophosphat...   
. . .Bartonella birtlesii......................... 145  1e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Bartonella...   
. . .Bradyrhizobium japonicum USDA 6.............. 145  2e-38  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bradyrhizobium japonicum SEMIA 5079.......... 145  2e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Bradyrhizobium japoni...   
. . .Bartonella henselae.......................... 145  2e-38  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Bartonella...   
. . .Bartonella henselae JK 42.................... 145  2e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein Q653_00545 [Bartonella he...   
. . .Bradyrhizobium japonicum WSM2793............. 145  2e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bradyrhizobium elkanii....................... 145  2e-38  7 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bradyrhizobium sp. STM 3843.................. 145  3e-38  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bradyrhizobium sp. Ai1a-2.................... 145  3e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bartonella quintana str. Toulouse............ 144  4e-38  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Bartonella...   
. . .Bradyrhizobium sp. WSM1743................... 144  5e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bartonella doshiae........................... 144  6e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Bartonella...   
. . .Bartonella sp. AR 15-3....................... 144  6e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Bartonella sp. AR 15-3]   
. . .Bradyrhizobium sp. th.b2..................... 144  6e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bartonella melophagi......................... 144  6e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Bartonella...   
. . .Bradyrhizobium sp. S23321.................... 144  6e-38  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Rhodopseudomonas palustris................... 144  8e-38  8 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Agromonas oligotrophica...................... 143  1e-37  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: putative geranyltranstransferase [Bradyrh...   
. . .Bradyrhizobium sp. ORS 285................... 143  1e-37  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Rhodopseudomonas sp. B29..................... 143  1e-37  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Bartonella clarridgeiae...................... 143  1e-37  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Bartonella...   
. . .Rhizobium mongolense......................... 143  1e-37  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Rhizobium ...   
. . .Rhodopseudomonas palustris HaA2.............. 143  1e-37  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Bradyrhizobium sp. STM 3809.................. 142  2e-37  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bradyrhizobium sp. ORS 375................... 142  2e-37  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bradyrhizobium sp. ORS 278................... 142  2e-37  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bradyrhizobium sp. DFCI-1.................... 142  2e-37  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl diphosphate synthase [Bradyrhizo...   
. . .Bartonella rattimassiliensis................. 142  2e-37  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Bartonella...   
. . .Bartonella clarridgeiae 73................... 141  4e-37  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Bartonella...   
. . .Bradyrhizobium sp. BTAi1..................... 141  6e-37  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bartonella schoenbuchensis................... 141  7e-37  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Bartonella schoenbuc...   
. . .Bradyrhizobium sp. Ec3.3..................... 141  7e-37  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Rhodopseudomonas palustris BisB5............. 141  1e-36  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Rhizobium sp. YS-1r.......................... 140  9e-37  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Rhizobium sp. Y...   
. . .Bradyrhizobium sp. WSM1253................... 140  2e-36  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bradyrhizobiaceae bacterium SG-6C............ 139  5e-36  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Rhodomicrobium sp. JA643..................... 138  6e-36  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Rhodomi...   
. . .Rhodomicrobium vannielii..................... 138  7e-36  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Bradyrhizobium sp. WSM1417................... 138  1e-35  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bradyrhizobium sp. WSM471.................... 138  1e-35  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bradyrhizobium............................... 138  1e-35  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: geranylgeranyl pyrophosphat...   
. . .Beijerinckiaceae bacterium SOP9.............. 137  2e-35  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: polyprenyl synthetase [Methyloferula stel...   
. . .Afipia sp. Bat1.............................. 137  3e-35  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Afipia ...   
. . .Afipia clevelandensis........................ 136  4e-35  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Afipia clevelandensis]   
. . .Bartonella washoensis........................ 136  4e-35  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Bartonella...   
. . .Bartonella tribocorum........................ 136  5e-35  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Bartonella...   
. . .Bradyrhizobium sp. Cp5.3..................... 136  5e-35  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bradyrhizobium sp. ARR65..................... 136  5e-35  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bradyrhizobium sp. WSM2254................... 136  6e-35  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bradyrhizobium sp. OHSU_III.................. 136  6e-35  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bradyrhizobium diazoefficiens USDA 110....... 135  7e-35  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: geranylgeranyl pyrophosphat...   
. . .Starkeya novella............................. 135  7e-35  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [St...   
. . .Azorhizobium doebereinerae................... 135  7e-35  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Az...   
. . .Methylocella silvestris...................... 135  8e-35  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: polyprenyl synthetase [Methylocella silve...   
. . .Ochrobactrum anthropi........................ 135  1e-34  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Ochrobactr...   
. . .Bartonella washoensis 085-0475............... 135  2e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Bartonella...   
. . .Bradyrhizobium sp. WSM3983................... 135  2e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Bradyrhizobium sp. Tv2a-2.................... 134  2e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Ochrobactrum anthropi ATCC 49188............. 134  2e-34  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Ochrobactr...   
. . .Oligotropha carboxidovorans.................. 134  3e-34  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Ol...   
. . .Bartonella grahamii.......................... 134  3e-34  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Bartonella...   
. . .Nitrobacter hamburgensis..................... 134  3e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Ni...   
. . .Oligotropha carboxidovorans OM4.............. 134  3e-34  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Ol...   
. . .Aurantimonas coralicida...................... 134  4e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Aurantimon...   
. . .Brucella inopinata........................... 133  6e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Brucella i...   
. . .Rhodopseudomonas palustris TIE-1............. 133  7e-34  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Rhodopseudomonas palustris CGA009............ 133  7e-34  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Ochrobactrum sp. UNC390CL2Tsu3S39............ 133  8e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Ochrobactr...   
. . .Brucella..................................... 133  8e-34  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . .Afipia....................................... 133  9e-34  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: geranylgeranyl pyrophosphat...   
. . .Afipia felis................................. 133  1e-33  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Afipia felis]            
. . .Xanthobacter autotrophicus................... 132  1e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Xa...   
. . .Brucella melitensis.......................... 132  1e-33  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Brucella m...   
. . .Brucella melitensis bv. 1 str. 16M........... 132  1e-33  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . .Brucella ovis................................ 132  1e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Brucella o...   
. . .Pelagibacterium halotolerans................. 132  1e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Pelagibact...   
. . .Brucella sp. BO2............................. 132  1e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Brucella s...   
. . .Methylocapsa acidiphila...................... 132  1e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Me...   
. . .Brucella sp. 83/13........................... 132  1e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . .Aurantimonas manganoxydans................... 132  2e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Aurantimon...   
. . .Brucella abortus............................. 132  2e-33  10 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Brucella abortus]        
. . .Brucella suis................................ 132  2e-33  9 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Brucella s...   
. . .Afipia sp. 1NLS2............................. 132  2e-33  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Af...   
. . .Rhizobium sp. JGI 0001005-L20................ 131  3e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Rhizobium ...   
. . .Ochrobactrum................................. 131  3e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: polyprenyl synthetase [Ochr...   
. . .Bradyrhizobium sp. URHA0002.................. 131  4e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Pseudochrobactrum sp. AO18b.................. 131  4e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Pseudochro...   
. . .Hyphomicrobium sp. 802....................... 131  4e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Hy...   
. . .Rhodopseudomonas palustris BisA53............ 131  4e-33  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Ochrobactrum intermedium..................... 131  5e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Ochrobactr...   
. . .Rhodopseudomonas palustris BisB18............ 130  6e-33  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Hyphomicrobium sp. MC1....................... 130  6e-33  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Hy...   
. . .Brucella suis ATCC 23445..................... 130  7e-33  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Brucella s...   
. . .Azorhizobium caulinodans..................... 130  9e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Az...   
. . .Beijerinckia indica.......................... 130  1e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: polyprenyl synthetase [Beijerinckia indica]    
. . .Bradyrhizobium sp. URHD0069.................. 130  1e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Br...   
. . .Brucella sp. BO1............................. 129  2e-32  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Brucella inopinata BO1]    
. . .Methylobacterium nodulans.................... 129  4e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Me...   
. . .Brucella sp. NF 2653......................... 128  4e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Brucella sp. NF 2653]      
. . .Brucella abortus S19......................... 128  4e-32  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Brucella a...   
. . .Nitrobacter sp. Nb-311A...................... 128  5e-32  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Ni...   
. . .Nitrobacter winogradskyi..................... 128  7e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Ni...   
. . .Rhizobium sp................................. 127  1e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Putative Geranyltranstransferase (Farnesyl-di...   
. . .Hyphomicrobium denitrificans................. 126  2e-31  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Hy...   
. . .Cucumibacter marinus......................... 126  2e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Cu...   
. . .Bartonella tamiae............................ 126  3e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Bartonella...   
. . .Kaistia granuli.............................. 125  5e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Kaistia granuli]         
. . .Hyphomicrobium denitrificans ATCC 51888...... 125  5e-31  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Hy...   
. . .Hyphomicrobium zavarzinii.................... 124  1e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Hyphomicrobium zava...   
. . .Rhizobium sp. CF080.......................... 124  2e-30  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Kaistia adipata.............................. 123  4e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Ka...   
. . .Rhizobium mesoamericanum..................... 122  7e-30  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Rhizobium sullae............................. 120  6e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Rhizobium ...   
. . .Rhizobium giardinii.......................... 120  7e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Rhizobium giardinii]     
. . .Sinorhizobium meliloti....................... 119  1e-28  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Sinorhizob...   
. . .Rhizobium sp. 2MFCol3.1...................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Terasakiella pusilla......................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Terasakiel...   
. . .Methylocystis sp. SC2........................ 119  3e-28  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: polyprenyl synthetase [Methylocystis sp. ...   
. . .Candidatus Liberibacter americanus........... 117  3e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase protein [Candidat...   
. . .Rhizobium sp. MGL06.......................... 117  4e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Rhizobium ...   
. . .Meganema perideroedes........................ 117  4e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Meganema perideroedes]   
. . .Rhizobium sp. R1-200B2....................... 117  8e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Rhizobium sp. R...   
. . .Methylocystis parvus......................... 116  1e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: polyprenyl synthetase [Methylocystis parvus]   
. . .Candidatus Liberibacter solanacearum......... 115  2e-27  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Candidatus Liber...   
. . .Rhizobium grahamii........................... 115  3e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Rhizobium grahamii]   
. . .Agrobacterium albertimagni................... 115  4e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Ag...   
. . .Sinorhizobium................................ 114  5e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: geranylgeranyl pyrophosphat...   
. . .Sinorhizobium medicae........................ 114  9e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Sinorhizob...   
. . .Agrobacterium tumefaciens.................... 114  1e-26  5 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Ag...   
. . .Methylosinus sp. LW4......................... 114  1e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Me...   
. . .Methylosinus sp. LW3......................... 114  1e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Me...   
. . .Methylocystis sp. LW5........................ 113  2e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Me...   
. . .Rhizobium mesoamericanum STM3625............. 113  2e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Rhizobium ...   
. . .Methylocystis rosea.......................... 112  3e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Me...   
. . .Agrobacterium tumefaciens GW4................ 112  3e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Agrobacterium t...   
. . .Agrobacterium radiobacter DSM 30147.......... 112  3e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Ag...   
. . .Agrobacterium sp. Cherry 2E-2-2.............. 112  4e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Agrobacterium tu...   
. . .Rhizobium leguminosarum bv. phaseoli CCGM1... 112  5e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase [Rhizobium leguminosar...   
. . .Candidatus Liberibacter asiaticus str. Ishi1. 112  5e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase protein [Candidatus L...   
. . .Candidatus Liberibacter asiaticus............ 112  5e-26  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase protein [Candidat...   
. . .Agrobacterium larrymoorei.................... 112  6e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Agrobacter...   
. . .Rhizobium leguminosarum...................... 112  6e-26  18 hits Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Rhizobium ...   
. . .Microvirga flocculans........................ 111  8e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Mi...   
. . .Pleomorphomonas oryzae....................... 111  9e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Pleomorphomonas ory...   
. . .Amorphus coralli............................. 110  1e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Amorphus coralli]        
. . .Microvirga sp. BSC39......................... 110  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Microvi...   
. . .Rhizobium etli............................... 110  2e-25  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Rhizobium phaseoli........................... 110  3e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Rhizobium ...   
. . .Sinorhizobium arboris........................ 110  3e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Sinorhizob...   
. . .Methylobacterium sp. 88A..................... 110  4e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Me...   
. . .Methylobacterium sp. 10...................... 109  4e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Me...   
. . .Bosea sp. 117................................ 109  4e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Bo...   
. . .Methylobacterium............................. 109  4e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: geranylgeranyl pyrophosphat...   
. . .Rhizobium leguminosarum bv. viciae WSM1455... 109  5e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Rhizobium etli CNPAF512...................... 109  8e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranyltranstransferase protein [Rhizobium etl...   
. . .Rhizobium leguminosarum bv. trifolii WSM1325. 108  8e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Agrobacterium................................ 108  9e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . .Chelatococcus sp. GW1........................ 108  1e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Chelatococcus sp. GW1]   
. . .Devosia sp. 17-2-E-8......................... 108  1e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein JP74_19140 [Devosia sp. 1...   
. . .Martelella sp. AD-3.......................... 108  1e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Martelella...   
. . .Rhizobium gallicum........................... 108  1e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Rhizobium etli CFN 42........................ 108  1e-24  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Aurantimonas ureilytica...................... 108  2e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: hypothetical protein [Aureimonas ureilytica]   
. . .Xanthobacter sp. 91.......................... 108  2e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Xa...   
. . .Xanthobacter sp. 126......................... 107  2e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Xa...   
. . .Agrobacterium sp. ATCC 31749................. 107  2e-24  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Ag...   
. . .Rhizobium leguminosarum bv. viciae 3841...... 107  3e-24  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Methylosinus trichosporium................... 107  3e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: polyprenyl synthetase [Methylosinus trich...   
. . .Rhizobium etli bv. mimosae str. IE4771....... 107  3e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: polyprenyl synthetase protein [Rhizobium etli ...   
. . .Rhizobium sp. CCGE 510....................... 107  3e-24  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Agrobacterium tumefaciens F2................. 107  4e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Ag...   
. . .Methylocystis sp. SB2........................ 107  4e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Me...   
. . .Methylobacterium radiotolerans JCM 2831...... 107  4e-24  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: MULTISPECIES: geranylgeranyl pyrophosphat...   
. . .Rhizobium leguminosarum bv. trifolii WSM2297. 107  4e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Methylobacterium sp. EUR3 AL-11.............. 107  5e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Me...   
. . .Rhizobium undicola........................... 106  4e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Rhizobium ...   
. . .Methylobacterium oryzae CBMB20............... 106  4e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: Polyprenyl synthetase [Methylobacterium oryzae...   
. . .Methylobacterium sp. GXF4.................... 106  5e-24  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Me...   
. . .Rhizobium etli bv. mimosae str. Mim1......... 106  5e-24  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: polyprenyl synthetase protein [Rhizobium ...   
. . .Methylobacterium sp. 285MFTsu5.1............. 106  5e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: geranylgeranyl pyrophosphate synthase [Me...   
. . .Rhizobium sp. JGI 0001019-L19................ 106  6e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhizobiales: farnesyl-diphosphate synthase [Rhizobium ...   
. . .Inquilinus limosus MP06...................... 159  8e-44  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Inquilinus limo...   
. . .Inquilinus limosus........................... 142  2e-37  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Inquilinus...   
. . .Azospirillum amazonense...................... 154  6e-42  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Azospirill...   
. . .Phaeospirillum fulvum........................ 150  2e-40  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: geranylgeranyl pyrophosphate synthase [Ph...   
. . .Fodinicurvata fenggangensis.................. 149  6e-40  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Fodinicurv...   
. . .Phaeospirillum molischianum.................. 149  8e-40  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Phaeospiri...   
. . .Nisaea salexigens............................ 148  1e-39  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Thalassoba...   
. . .Nisaea denitrificans......................... 147  2e-39  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Nisaea den...   
. . .Rhodospirillum centenum...................... 146  6e-39  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Rhodospiri...   
. . .Azospirillum lipoferum....................... 146  7e-39  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Azospirill...   
. . .Rhodovibrio salinarum........................ 145  9e-39  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Rhodovibri...   
. . .Azospirillum lipoferum 4B.................... 145  1e-38  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Azospirill...   
. . .Rhodospirillum rubrum........................ 145  2e-38  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Rhodospiri...   
. . .Rhodospirillum photometricum................. 145  3e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Rhodospiri...   
. . .Azospirillum brasilense...................... 144  3e-38  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Azospirill...   
. . .Rhodospirillum rubrum ATCC 11170............. 144  4e-38  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Rhodospiri...   
. . .Fodinicurvata sediminis...................... 144  6e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Fodinicurv...   
. . .Candidatus Endolissoclinum faulkneri L5...... 140  9e-37  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: geranyltranstransferase [Candidatus Endolissoc...   
. . .Novospirillum itersonii...................... 139  2e-36  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: hypothetical protein [Novispirillum iters...   
. . .Azospirillum halopraeferens.................. 139  5e-36  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Azospirill...   
. . .Dongia sp. URHE0060.......................... 136  4e-35  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Dongia sp....   
. . .Azospirillum sp. CAG:239..................... 135  1e-34  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: geranyltranstransferase [Azospirillum sp....   
. . .Skermanella stibiiresistens SB22............. 133  5e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Skermanella sti...   
. . .Oceanibaculum indicum........................ 133  6e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Oceanibacu...   
. . .Azospirillum irakense........................ 132  2e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Azospirill...   
. . .Candidatus Endolissoclinum faulkneri......... 129  1e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: polyprenyl synthetase family protein [Can...   
. . .Azospirillum sp. CAG:260..................... 128  4e-32  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: geranyltranstransferase [Azospirillum sp....   
. . .Thalassospira lucentensis.................... 124  1e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Thalassosp...   
. . .Thalassospira sp. NP3b2...................... 123  4e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Thalassosp...   
. . .Thalassospira profundimaris.................. 122  4e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Thalassosp...   
. . .Thalassospira xiamenensis.................... 122  5e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Thalassosp...   
. . .Caenispirillum salinarum..................... 122  1e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: Octaprenyl-diphosphate synthase [Caenispi...   
. . .Magnetospirillum sp. SO-1.................... 111  7e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: geranylgeranyl pyrophosphate synthase [Ma...   
. . .Magnetospirillum magneticum.................. 107  4e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Magnetospi...   
. . .Acetobacteraceae bacterium AT-5844........... 148  7e-40  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: polyprenyl synthetase [Acetobacteraceae b...   
. . .Roseomonas cervicalis........................ 144  3e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Roseomonas...   
. . .Acidiphilium sp. CAG:727..................... 133  6e-34  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: polyprenyl synthetase [Acidiphilium sp. C...   
. . .Gluconacetobacter diazotrophicus............. 132  2e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Gluconacet...   
. . .Gluconacetobacter medellensis................ 131  3e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Gluconacet...   
. . .Acidocella facilis........................... 131  4e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Acidocella...   
. . .Acidocella sp. MX-AZ02....................... 131  4e-33  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Acidocella...   
. . .Gluconacetobacter europaeus.................. 130  6e-33  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Gluconacet...   
. . .Gluconacetobacter rhaeticus AF1.............. 130  7e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Gluconacetobact...   
. . .Asaia prunellae.............................. 129  2e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Asaia prun...   
. . .Gluconacetobacter sp. SXCC-1................. 129  4e-32  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Gluconacet...   
. . .Gluconacetobacter xylinus E25................ 129  4e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: Polyprenyl synthetase [Gluconacetobacter xylin...   
. . .Gluconacetobacter hansenii................... 128  5e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Gluconacet...   
. . .Rubritepida flocculans....................... 127  6e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Rubritepid...   
. . .Commensalibacter sp. MX-MONARCH01............ 127  8e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: geranylgeranyl pyrophosphate synthase [Commens...   
. . .Asaia sp. SF2.1.............................. 127  9e-32  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Asaia sp. ...   
. . .Acetobacter sp. CAG:977...................... 127  2e-31  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: geranyltranstransferase [Acetobacter sp. ...   
. . .Acetobacter sp. CAG:267...................... 126  4e-31  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: geranylgeranyl pyrophosphate synthase [Ac...   
. . .Rhodospirillales bacterium URHD0088.......... 125  5e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Rhodospiri...   
. . .Commensalibacter intestini................... 125  6e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Commensali...   
. . .Acetobacter nitrogenifigens.................. 124  1e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Acetobacte...   
. . .Asaia astilbes............................... 124  2e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Asaia asti...   
. . .Granulibacter bethesdensis CGDNIH4........... 124  3e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: Dimethylallyltransferase [Granulibacter bethes...   
. . .Granulibacter bethesdensis................... 123  4e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Granulibac...   
. . .Granulibacter bethesdensis CGDNIH3........... 123  4e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: Dimethylallyltransferase [Granulibacter bethes...   
. . .Roseomonas gilardii.......................... 122  7e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Roseomonas...   
. . .Kozakia baliensis............................ 122  1e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Kozakia ba...   
. . .Roseomonas................................... 121  2e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . .Acidiphilium................................. 120  3e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . .Acetobacter malorum.......................... 120  5e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: Octaprenyl-diphosphate synthase [Acetobacter m...   
. . .Acetobacter okinawensis...................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Acetobacte...   
. . .Acetobacter aceti............................ 119  2e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Acetobacte...   
. . .Acidiphilium angustum........................ 118  3e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Acidiphili...   
. . .Acetobacter aceti 1023....................... 118  3e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Acetobacter ace...   
. . .Acetobacter pasteurianus..................... 118  3e-28  5 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Acetobacte...   
. . .Acetobacter pasteurianus 386B................ 117  5e-28  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: geranyltranstransferase [Acetobacter past...   
. . .Acetobacter pomorum.......................... 117  7e-28  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: Octaprenyl-diphosphate synthase [Acetobacter p...   
. . .Acetobacter pomorum DM001.................... 117  8e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Acetobacte...   
. . .Acetobacter pasteurianus NBRC 101655......... 116  1e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: geranylgeranyl pyrophosphate synthase [Ac...   
. . .Acetobacter pasteurianus IFO 3283-01......... 116  1e-27  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Acetobacte...   
. . .Acetobacter pasteurianus subsp. pasteurianus LM 115  3e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Acetobacte...   
. . .Gluconacetobacter oboediens.................. 115  4e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Gluconacet...   
. . .Saccharibacter sp. AM169..................... 114  7e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: Dimethylallyltransferase [Saccharibacter sp. ...   
. . .Saccharibacter floricola..................... 112  3e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Sacchariba...   
. . .Gluconobacter oxydans DSM 3504............... 112  3e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: geranyltranstransferase IspA [Gluconobacter ox...   
. . .Elioraea tepidiphila......................... 112  3e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Elioraea t...   
. . .Gluconobacter oxydans........................ 112  3e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Gluconobac...   
. . .Acetobacter papayae.......................... 110  3e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: farnesyl-diphosphate synthase [Acetobacte...   
. . .Acidomonas methanolica NBRC 104435........... 108  1e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodospirillales: geranylgeranyl pyrophosphate synthase [Acidom...   
. . .Sphingobium xenophagum....................... 155  3e-42  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingobiu...   
. . .Sphingobium sp. SYK-6........................ 142  1e-37  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingobiu...   
. . .Sphingobium ummariense....................... 137  3e-35  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingobiu...   
. . .Sphingobium sp. DS20......................... 134  3e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingobiu...   
. . .Sphingobium sp. AP49......................... 132  2e-33  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingobiu...   
. . .Sphingobium japonicum........................ 130  5e-33  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: Octaprenyl-diphosphate synthase / Dimethy...   
. . .Sphingobium sp. DC-2......................... 130  6e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingobiu...   
. . .Sphingobium quisquiliarum P25................ 129  1e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingobium qui...   
. . .Sphingobium chlorophenolicum................. 129  1e-32  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: Geranyltranstransferase [Sphingobium chlorophe...   
. . .Sphingobium quisquiliarum.................... 129  2e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingobiu...   
. . .Sphingobium chlorophenolicum L-1............. 129  2e-32  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingobiu...   
. . .Sphingobium sp. KK22......................... 129  3e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingobiu...   
. . .Sphingobium yanoikuyae....................... 129  3e-32  5 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: Geranylgeranyl pyrophosphate synthase precurso...   
. . .Sphingobium yanoikuyae ATCC 51230............ 129  3e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: hypothetical protein [Sphingobium yanoiku...   
. . .Sphingobium sp. HDIP04....................... 127  5e-32  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingobiu...   
. . .Sphingobium chinhatense...................... 127  9e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingobiu...   
. . .Sphingobium sp. Ant17........................ 127  1e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingobium sp....   
. . .Sphingobium japonicum UT26S.................. 127  1e-31  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingobiu...   
. . .Sphingobium sp. ba1.......................... 126  2e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: geranyltranstransferase [Sphingobium sp. ba1]       
. . .Sphingobium indicum.......................... 125  2e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: geranyltranstransferase [Sphingobium indi...   
. . .Sphingobium herbicidovorans NBRC 16415....... 125  6e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: Farnesyl-diphosphate synthase [Sphingobium her...   
. . .Sphingobium sp. C100......................... 124  1e-30  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingobiu...   
. . .Sphingobium sp. YL23......................... 124  2e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingobiu...   
. . .Sandarakinorhabdus sp. AAP62................. 149  3e-40  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: hypothetical protein [Sandarakinorhabdus ...   
. . .Zymomonas mobilis............................ 147  3e-39  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Zymomonas ...   
. . .Zymomonas mobilis subsp. mobilis ZM4......... 147  3e-39  5 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: Chain A, Crystal Structure Of A Fpp/gfpp Synthase ...   
. . .Zymomonas mobilis subsp. mobilis NCIMB 11163. 146  7e-39  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Zymomonas ...   
. . .Sphingomonas sp. URHD0057.................... 145  2e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingomon...   
. . .Zymomonas mobilis subsp. pomaceae ATCC 29192. 141  4e-37  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Zymomonas ...   
. . .Sphingomonas sp. Mn802worker................. 139  3e-36  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingomon...   
. . .Blastomonas sp. CACIA14H2.................... 139  3e-36  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Blastomona...   
. . .Novosphingobium sp. B-7...................... 137  2e-35  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Novosphing...   
. . .Sandarakinorhabdus limnophila................ 135  9e-35  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sandarakin...   
. . .Sphingomonas sp. ATCC 31555.................. 135  1e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingomon...   
. . .Sphingomonas sp. SKA58....................... 135  1e-34  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingomon...   
. . .Novosphingobium aromaticivorans.............. 135  2e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Novosphing...   
. . .Novosphingobium lindaniclasticum LE124....... 134  2e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Novosphingobium...   
. . .Novosphingobium lindaniclasticum............. 134  2e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Novosphing...   
. . .Sphingomonas elodea.......................... 132  2e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingomon...   
. . .Novosphingobium acidiphilum.................. 131  3e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Novosphing...   
. . .Sphingomonas sp. LH128....................... 131  3e-33  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingomon...   
. . .Novosphingobium resinovorum.................. 131  4e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: Geranyltranstransferase [Novosphingobium resin...   
. . .Sphingomonas sanxanigenens DSM 19645......... 130  6e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: hypothetical protein NX02_22505 [Sphingomonas ...   
. . .Novosphingobium sp. AP12..................... 130  8e-33  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Novosphing...   
. . .Novosphingobium sp. Rr 2-17.................. 128  6e-32  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Novosphing...   
. . .Sphingomonas sp. PAMC 26605.................. 127  1e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingomon...   
. . .Sphingomonas sp. PAMC 26621.................. 124  2e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingomon...   
. . .Sphingomonas sp. PAMC 26617.................. 124  2e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingomon...   
. . .Sphingomonas sp. S17......................... 122  6e-30  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingomon...   
. . .Sphingomonas astaxanthinifaciens............. 122  1e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingomon...   
. . .Sphingomonas sp. UNC305MFCol5.2.............. 121  2e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingomon...   
. . .Novosphingobium sp. PP1Y..................... 121  2e-29  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Novosphing...   
. . .Novosphingobium pentaromativorans............ 121  2e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Novosphing...   
. . .Sphingomonas sp. STIS6.2..................... 121  2e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingomon...   
. . .Sphingomonas phyllosphaerae.................. 121  2e-29  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingomon...   
. . .Sphingomonas sp. FUKUSWIS1................... 120  3e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingomon...   
. . .Sphingomonas sp. JGI 0001002-C18............. 120  3e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingomon...   
. . .Sphingomonas sp. KC8......................... 119  6e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingomon...   
. . .Novosphingobium nitrogenifigens.............. 118  2e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Novosphing...   
. . .Sphingomonas sp. PR090111-T3T-6A............. 115  2e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingomon...   
. . .Citromicrobium bathyomarinum................. 115  2e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Citromicro...   
. . .Blastomonas sp. AAP53........................ 115  3e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Blastomona...   
. . .Sphingomonas taxi............................ 114  9e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingomonas taxi]   
. . .Sphingomonas sp. RIT328...................... 114  1e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: Polyprenyl synthetase family protein [Sphingom...   
. . .Sphingomonas melonis......................... 113  1e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingomon...   
. . .Sphingomonas-like bacterium B12.............. 111  8e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingomon...   
. . .Sphingopyxis baekryungensis.................. 110  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Sphingopyx...   
. . .Novosphingobium tardaugens................... 108  1e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: geranyltranstransferase [Novosphingobium ...   
. . .Porphyrobacter cryptus....................... 140  9e-37  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Porphyroba...   
. . .Erythrobacter litoralis...................... 139  5e-36  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Erythrobac...   
. . .Porphyrobacter sp. AAP82..................... 117  4e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Porphyroba...   
. . .Erythrobacter sp. SD-21...................... 111  6e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Erythrobac...   
. . .Erythrobacter sp. JL475...................... 108  8e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sphingomonadales: farnesyl-diphosphate synthase [Erythrobacter s...   
. . .Rhodobacterales bacterium HTCC2255........... 151  8e-41  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Rhodobacte...   
. . .Sulfitobacter sp. H3......................... 147  2e-39  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Sulfitobacter s...   
. . .Sulfitobacter sp. 20_GPM-1509m............... 146  5e-39  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Sulfitobac...   
. . .Ahrensia kielensis........................... 144  2e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Ahrensia k...   
. . .Roseobacter denitrificans.................... 144  5e-38  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Roseobacte...   
. . .Roseobacter denitrificans OCh 114............ 143  9e-38  6 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: Chain A, Crystal Structure Of A Farnesyl Diphospha...   
. . .Roseovarius mucosus DSM 17069................ 142  1e-37  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: Geranylgeranyl pyrophosphate synthase [Roseova...   
. . .Paracoccus sp. TRP........................... 142  2e-37  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Paracoccus...   
. . .Rhodobacteraceae bacterium KLH11............. 142  2e-37  4 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Rhodobacte...   
. . .Thalassobacter arenae........................ 141  4e-37  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: Octaprenyl-diphosphate synthase / Dimethy...   
. . .Roseovarius sp. 217.......................... 141  6e-37  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Roseovariu...   
. . .Paracoccus halophilus........................ 140  7e-37  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Paracoccus halo...   
. . .Roseovarius sp. TM1035....................... 138  4e-36  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Roseovariu...   
. . .Hyphomonas sp. BH-BN04-4..................... 138  7e-36  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Hyphomonas sp. ...   
. . .Robiginitomaculum antarcticum................ 137  1e-35  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: hypothetical protein [Robiginitomaculum a...   
. . .Hyphomonas oceanitis SCH89................... 137  2e-35  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: geranyltranstransferase [Hyphomonas oceanitis ...   
. . .Rhodovulum sp. PH10.......................... 135  2e-34  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Thalassobacter stenotrophicus................ 134  2e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Thalassobacter ...   
. . .Nesiotobacter exalbescens.................... 134  4e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Nesiotobac...   
. . .Roseivivax isoporae LMG 25204................ 132  7e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Roseivivax isop...   
. . .Rhodobacter capsulatus....................... 131  2e-33  6 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Rhodobacte...   
. . .Ahrensia sp. 13_GOM-1096m.................... 131  3e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Ahrensia s...   
. . .Labrenzia.................................... 130  5e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . .Rhodobacter capsulatus SB 1003............... 130  5e-33  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Rhodobacte...   
. . .Labrenzia aggregata.......................... 130  8e-33  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Labrenzia ...   
. . .Pseudorhodobacter ferrugineus................ 128  3e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Pseudorhod...   
. . .Catellibacterium nectariphilum............... 128  3e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Catellibac...   
. . .Pseudovibrio sp. JE062....................... 127  7e-32  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Pseudovibr...   
. . .Pannonibacter phragmitetus................... 127  8e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: hypothetical protein [Pannonibacter phrag...   
. . .Ahrensia sp. R2A130.......................... 127  2e-31  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Ahrensia s...   
. . .Pseudovibrio sp. FO-BEG1..................... 127  2e-31  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Pseudovibr...   
. . .Labrenzia alexandrii......................... 126  2e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Labrenzia ...   
. . .Leisingera nanhaiensis....................... 126  2e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Leisingera...   
. . .Sulfitobacter sp. CB2047..................... 126  2e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Sulfitobacter s...   
. . .Sulfitobacter pontiacus 3SOLIMAR09........... 126  3e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Sulfitobacter p...   
. . .Sulfitobacter sp. NAS-14.1................... 126  3e-31  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Sulfitobac...   
. . .Sulfitobacter sp. EE-36...................... 126  3e-31  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Sulfitobac...   
. . .Roseobacter sp. GAI101....................... 122  1e-29  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Roseobacte...   
. . .Paracoccus zeaxanthinifaciens................ 120  3e-29  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Paracoccus...   
. . .Citreicella sp. 357.......................... 120  3e-29  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Citreicell...   
. . .Maricaulis maris............................. 120  5e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Maricaulis...   
. . .Paracoccus aminophilus....................... 119  6e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: geranyltranstransferase [Paracoccus amino...   
. . .Roseobacter litoralis........................ 119  1e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Roseobacte...   
. . .Rubellimicrobium thermophilum................ 118  3e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: Geranylgeranyl pyrophosphate synthase [Ru...   
. . .Donghicola xiamenensis....................... 117  3e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Donghicola...   
. . .Ruegeria pomeroyi............................ 117  4e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Ruegeria p...   
. . .Paracoccus denitrificans..................... 117  6e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Paracoccus...   
. . .Leisingera daeponensis....................... 117  6e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Phaeobacte...   
. . .Paracoccus pantotrophus...................... 116  9e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Paracoccus...   
. . .Sulfitobacter sp. NB-77...................... 116  9e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Sulfitobac...   
. . .Ruegeria conchae............................. 116  1e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Ruegeria s...   
. . .Sulfitobacter sp. MM-124..................... 115  2e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Sulfitobac...   
. . .Jannaschia sp. CCS1.......................... 115  2e-27  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Jannaschia...   
. . .Paracoccus sp. N5............................ 115  3e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Paracoccus...   
. . .Ruegeria lacuscaerulensis.................... 115  4e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Ruegeria l...   
. . .Henriciella marina........................... 114  5e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Henriciell...   
. . .Rhodobacteraceae bacterium HTCC2083.......... 114  9e-27  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Rhodobacte...   
. . .Paracoccus yeei.............................. 114  9e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Paracoccus...   
. . .Pelagibaca bermudensis....................... 113  1e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Pelagibaca...   
. . .Rhodobacter sphaeroides...................... 113  1e-26  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Rhodobacte...   
. . .Hellea balneolensis.......................... 113  1e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Hellea bal...   
. . .Sulfitobacter sp. NB-68...................... 113  1e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Sulfitobac...   
. . .Hyphomonas polymorpha PS728.................. 113  2e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: geranyltranstransferase [Hyphomonas polymorpha...   
. . .Candidatus Planktomarina temperata RCA23..... 113  2e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: geranyltranstransferase IspA [Candidatus Plank...   
. . .Roseibacterium elongatum DSM 19469........... 112  2e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: Octaprenyl-diphosphate synthase / Dimethylally...   
. . .Hyphomonas hirschiana VP5.................... 112  2e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: geranyltranstransferase [Hyphomonas hirschiana...   
. . .Hyphomonas neptunium......................... 112  2e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Hyphomonas...   
. . .Dinoroseobacter shibae....................... 112  3e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Dinoroseob...   
. . .Silicibacter sp. TrichCH4B................... 112  4e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Silicibact...   
. . .Ruegeria mobilis............................. 112  4e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Ruegeria m...   
. . .Rhodobacter sp. CACIA14H1.................... 112  4e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Rhodobacte...   
. . .Oceanicaulis sp. HTCC2633.................... 112  6e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Oceanicaul...   
. . .Thioclava dalianensis........................ 111  6e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Thioclava sp. D...   
. . .Roseovarius nubinhibens...................... 111  8e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Roseovariu...   
. . .Sulfitobacter donghicola..................... 111  8e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Sulfitobac...   
. . .Oceanicola nanhaiensis....................... 111  8e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Oceanicola...   
. . .Octadecabacter antarcticus................... 110  1e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: geranyltranstransferase IspA [Octadecabac...   
. . .Oceanicola sp. HL-35......................... 110  1e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Oceanicola...   
. . .Ponticaulis koreensis........................ 110  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Ponticauli...   
. . .Citreicella sp. SE45......................... 110  2e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Citreicell...   
. . .Labrenzia sp. DG1229......................... 110  2e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Labrenzia ...   
. . .Haematobacter massiliensis................... 109  3e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Haematobacter m...   
. . .Roseobacter sp. SK209-2-6.................... 109  4e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Roseobacte...   
. . .Sediminimonas qiaohouensis................... 109  4e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Sediminimo...   
. . .Roseobacter sp. AzwK-3b...................... 109  5e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Roseobacte...   
. . .Phaeobacter arcticus......................... 108  7e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Phaeobacte...   
. . .Hirschia baltica............................. 108  7e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Hirschia b...   
. . .Roseivivax halodurans JCM 10272.............. 108  8e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Roseivivax halo...   
. . .Rhodobacteraceae bacterium HIMB11............ 108  9e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: geranylgeranyl pyrophosphate synthase [Rh...   
. . .Maricaulis sp. JL2009........................ 108  1e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Maricaulis...   
. . .Paracoccus sp. 4681.......................... 107  2e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Paracoccus sp. ...   
. . .Ruegeria sp. TM1040.......................... 107  2e-24  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Ruegeria s...   
. . .Hirschia maritima............................ 107  3e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Hirschia m...   
. . .Paracoccus sp. 10990......................... 107  4e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Paracoccus sp. ...   
. . .Sulfitobacter guttiformis.................... 106  4e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Sulfitobac...   
. . .Loktanella vestfoldensis..................... 106  5e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Loktanella...   
. . .Hyphomonas adhaerens MHS-3................... 106  5e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: geranyltranstransferase [Hyphomonas adhaerens ...   
. . .Celeribacter baekdonensis.................... 106  5e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Celeribact...   
. . .Rhodobacter sphaeroides 2.4.1................ 106  5e-24  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Rhodobacterales: farnesyl-diphosphate synthase [Rhodobacte...   
. . .alpha proteobacterium SCGC AAA076-C03........ 150  2e-40  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: farnesyl-diphosphate synthase [alpha prot...   
. . .Micavibrio aeruginosavorus................... 150  2e-40  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria: Octaprenyl-diphosphate synthase / Dimethy...   
. . .Micavibrio aeruginosavorus ARL-13............ 150  2e-40  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria: farnesyl-diphosphate synthase [Micavibrio...   
. . .Kiloniella laminariae........................ 146  8e-39  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Kiloniellales: hypothetical protein [Kiloniella laminariae]   
. . .Candidatus Puniceispirillum marinum.......... 143  1e-37  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: dimethylallyltransferase [Candidatus Puni...   
. . .SAR 116 cluster alpha proteobacterium HIMB100 127  9e-32  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria: geranylgeranyl pyrophosphate synthase [SA...   
. . .alpha proteobacterium SCGC AAA028-C07........ 140  1e-36  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: geranyl transferase [alpha proteobacteriu...   
. . .alpha proteobacterium SCGC AAA158-B04........ 140  1e-36  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [alpha proteobacteri...   
. . .Parvularcula sp. JLT2013..................... 137  2e-35  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Parvularculales: farnesyl-diphosphate synthase [Parvularcu...   
. . .Parvularcula bermudensis..................... 129  1e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Parvularculales: geranyltranstransferase (farnesyl-diphosp...   
. . .alpha proteobacterium SCGC AAA280-P20........ 137  2e-35  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [alpha proteobacteri...   
. . .alpha proteobacterium SCGC AAA027-J10........ 135  6e-35  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [alpha proteobacteri...   
. . .alpha proteobacterium BAL199................. 135  1e-34  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria: farnesyl-diphosphate synthase [alpha prot...   
. . .Woodsholea maritima.......................... 134  2e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: hypothetical protein [Woodsholea maritima]     
. . .Brevundimonas aveniformis.................... 133  7e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: farnesyl-diphosphate synthase [Brevundimo...   
. . .Asticcacaulis benevestitus................... 127  9e-32  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: farnesyl-diphosphate synthase [Asticcacau...   
. . .Asticcacaulis benevestitus DSM 16100......... 127  1e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: farnesyl-diphosphate synthase [Asticcacau...   
. . .Asticcacaulis sp. YBE204..................... 126  2e-31  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: farnesyl-diphosphate synthase [Asticcacau...   
. . .Asticcacaulis sp. AC466...................... 124  1e-30  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: farnesyl-diphosphate synthase [Asticcacau...   
. . .Asticcacaulis excentricus.................... 123  4e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: farnesyl-diphosphate synthase [Asticcacau...   
. . .Brevundimonas sp. EAKA....................... 120  4e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: farnesyl-diphosphate synthase [Brevundimonas s...   
. . .Brevundimonas sp. BAL3....................... 120  4e-29  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: farnesyl-diphosphate synthase [Brevundimo...   
. . .Asticcacaulis biprosthecium.................. 119  7e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: farnesyl-diphosphate synthase [Asticcacau...   
. . .Caulobacter sp. URHA0033..................... 117  7e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: farnesyl-diphosphate synthase [Caulobacte...   
. . .Brevundimonas bacteroides.................... 116  1e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: farnesyl-diphosphate synthase [Brevundimo...   
. . .Caulobacter segnis........................... 115  2e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: farnesyl-diphosphate synthase [Caulobacte...   
. . .Caulobacter vibrioides....................... 115  3e-27  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: farnesyl-diphosphate synthase [Caulobacte...   
. . .Caulobacter sp. K31.......................... 114  5e-27  3 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: farnesyl-diphosphate synthase [Caulobacte...   
. . .Caulobacter crescentus OR37.................. 114  9e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: farnesyl-diphosphate synthase [Caulobacte...   
. . .Caulobacter sp. AP07......................... 113  2e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: farnesyl-diphosphate synthase [Caulobacte...   
. . .Caulobacter sp. UNC358MFTsu5.1............... 112  3e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: farnesyl-diphosphate synthase [Caulobacte...   
. . .Brevundimonas subvibrioides.................. 111  8e-26  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: farnesyl-diphosphate synthase [Brevundimo...   
. . .Brevundimonas naejangsanensis................ 111  8e-26  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: farnesyl-diphosphate synthase [Brevundimo...   
. . .Brevundimonas abyssalis...................... 111  1e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: octaprenyl-diphosphate synthase / dimethy...   
. . .Brevundimonas diminuta....................... 110  2e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: polyprenyl synthetase [Brevundimonas dimi...   
. . .Brevundimonas diminuta ATCC 11568............ 110  3e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: farnesyl-diphosphate synthase [Brevundimo...   
. . .Asticcacaulis sp. AC402...................... 109  4e-25  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria:Caulobacterales: farnesyl-diphosphate synthase [Asticcacau...   
. . .alpha proteobacterium SCGC AAA288-G21........ 134  3e-34  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: geranyl transferase [alpha proteobacteriu...   
. . .alpha proteobacterium LLX12A................. 128  3e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: farnesyl-diphosphate synthase [alpha prot...   
. . .Kordiimonas gwangyangensis................... 128  4e-32  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Kordiimonadales: hypothetical protein [Kordiimonas gwangya...   
. . .alpha proteobacterium SCGC AAA027-C06........ 122  5e-31  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [alpha proteobacteri...   
. . .alpha proteobacterium Mf 1.05b.01............ 122  4e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: farnesyl-diphosphate synthase [alpha prot...   
. . .alpha proteobacterium L41A................... 122  7e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: farnesyl-diphosphate synthase [alpha prot...   
. . .alpha proteobacterium Q-1.................... 122  8e-30  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: farnesyl diphosphate synthase [alpha proteoba...   
. . .alpha proteobacterium MA2.................... 121  1e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: polyprenyl synthetase [alpha proteobacterium ...   
. . .alpha proteobacterium IMCC14465.............. 121  2e-29  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria: farnesyl-diphosphate synthase [alpha prot...   
. . .alpha proteobacterium SCGC AAA536-G10........ 121  2e-29  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [alpha proteobacteri...   
. . .alpha proteobacterium SCGC AAA536-K22........ 117  6e-28  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: farnesyl-diphosphate synthase [alpha prot...   
. . .Polymorphum gilvum........................... 116  1e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: farnesyl-diphosphate synthase [Polymorphu...   
. . .alpha proteobacterium SCGC AAA015-N04........ 116  1e-27  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [alpha proteobacteri...   
. . .alpha proteobacterium RS24................... 115  3e-27  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria: Rhomboid-related membrane protein [alpha ...   
. . .alpha proteobacterium JLT2015................ 114  9e-27  2 hits  Bacteria:Proteobacteria:Alphaproteobacteria: Octaprenyl-diphosphate synthase [alpha pr...   
. . .alpha proteobacterium SCGC AAA298-K06........ 108  6e-25  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria: hypothetical protein [alpha proteobacteri...   
. . .Sneathiella glossodoripedis.................. 107  3e-24  1 hit   Bacteria:Proteobacteria:Alphaproteobacteria:Sneathiellales: farnesyl-diphosphate synthase [Sneathiell...   
. . Idiomarina baltica............................ 162  7e-45  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Idiomarina baltica]   
. . Idiomarina xiamenensis........................ 148  1e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Idiomarina xiame...   
. . Idiomarina sp. A28L........................... 136  5e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Idiomarina sp. A...   
. . Idiomarina loihiensis......................... 127  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Idiomarina loihi...   
. . Idiomarina sp. MCCC 1A10513................... 120  2e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Idiomarina sp. MCCC 1A10513]   
. . Idiomarina salinarum.......................... 152  3e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Idiomarina salinarum]          
. . Pseudidiomarina sediminum..................... 113  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Idiomarina sediminum]     
. . Marinobacter santoriniensis................... 157  4e-43  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Marinobacter san...   
. . Aestuariibacter salexigens.................... 157  6e-43  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Aestuariibacter sale...   
. . Psychromonas hadalis.......................... 156  7e-43  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Psychromonas had...   
. . Psychromonas ossibalaenae..................... 150  1e-40  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Psychromonas ossiba...   
. . Psychromonas sp. SP041........................ 149  4e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Psychromonas sp. SP041]   
. . Marinobacter sp. HL-58........................ 149  5e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Marinobacter sp. HL-58]   
. . Psychromonas arctica.......................... 148  1e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Psychromonas arctica]     
. . Marinobacter adhaerens........................ 147  2e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: farnesyl-diphosphate synthase [Marinobact...   
. . Glaciecola lipolytica......................... 147  2e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: farnesyl diphosphate synthase [Glaciecola...   
. . Marinobacter manganoxydans.................... 147  4e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: farnesyl-diphosphate synthase [Marinobact...   
. . Shewanella fidelis............................ 146  4e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Shewanella fidelis]       
. . Shewanella sp. HN-41.......................... 145  1e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Shewanella sp. H...   
. . Shewanella loihica............................ 145  1e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Shewanella loihica]   
. . Shewanella sp. 38A_GOM-205m................... 145  2e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Shewanella sp. 38A_G...   
. . Shewanella haliotis........................... 144  2e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Shewanella haliotis]      
. . Shewanella woodyi............................. 144  2e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Shewanella woodyi]    
. . Shewanella algae.............................. 144  3e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Shewanella algae]         
. . Glaciecola psychrophila....................... 144  5e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: farnesyl diphosphate synthase [Glaciecola...   
. . Shewanella putrefaciens....................... 144  6e-38  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Shewanella putrefaci...   
. . Shewanella putrefaciens 200................... 143  6e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Shewanella putre...   
. . Shewanella putrefaciens CN-32................. 143  6e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Shewanella putre...   
. . Shewanella baltica............................ 143  1e-37  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Shewanella baltica]   
. . Shewanella baltica OS185...................... 143  1e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Shewanella baltica]   
. . Shewanella sp. W3-18-1........................ 143  1e-37  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Shewanella sp. W...   
. . Marinobacter lipolyticus...................... 143  1e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Marinobacter lip...   
. . Psychromonas sp. CNPT3........................ 142  1e-37  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Psychromonas sp....   
. . Shewanella sp. YQH10.......................... 142  2e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Shewanella sp. YQH10]          
. . Shewanella baltica BA175...................... 142  2e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Shewanella baltica]   
. . Glaciecola punicea............................ 142  3e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Glaciecola punicea]   
. . Shewanella waksmanii.......................... 141  5e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Shewanella waksmanii]     
. . Shewanella frigidimarina...................... 141  6e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Shewanella frigi...   
. . Shewanella amazonensis........................ 141  6e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Shewanella amazo...   
. . Shewanella halifaxensis....................... 140  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Shewanella halif...   
. . Shewanella piezotolerans...................... 140  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: Polyprenyl synthetase [Shewanella piezoto...   
. . Shewanella denitrificans...................... 140  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Shewanella denit...   
. . Catenovulum agarivorans DS-2.................. 139  3e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: Octaprenyl-diphosphate synthase [Catenovulum a...   
. . Shewanella oneidensis......................... 139  4e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Shewanella oneid...   
. . Shewanella pealeana........................... 139  4e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Shewanella peale...   
. . Shewanella colwelliana........................ 139  4e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Shewanella colwelliana]   
. . Marinobacter algicola......................... 139  4e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: farnesyl-diphosphate synthase [Marinobact...   
. . Pseudoalteromonas haloplanktis................ 139  5e-36  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Pseudoalteromona...   
. . Pseudoalteromonas sp. NJ631................... 139  5e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Pseudoalteromona...   
. . Shewanella benthica........................... 138  5e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Shewanella benth...   
. . Shewanella violacea........................... 138  5e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Shewanella viola...   
. . Marinobacter salarius......................... 138  7e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: farnesyl-diphosphate synthase [Marinobacter sp...   
. . Pseudoalteromonas piscicida................... 138  7e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Pseudoalteromona...   
. . Ferrimonas balearica.......................... 137  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Ferrimonas balea...   
. . Ferrimonas senticii........................... 137  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Ferrimonas senticii]      
. . Teredinibacter turnerae....................... 135  9e-35  6 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: farnesyl-diphosphate synthase [Terediniba...   
. . Teredinibacter turnerae T7901................. 135  1e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: farnesyl-diphosphate synthase [Terediniba...   
. . Marinobacter nanhaiticus...................... 134  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Marinobacter nan...   
. . Aliagarivorans taiwanensis.................... 132  9e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Aliagarivorans taiwa...   
. . Pseudoalteromonas ruthenica................... 132  1e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Pseudoalteromona...   
. . Catenovulum agarivorans....................... 132  1e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Catenovulum agarivo...   
. . Glaciecola pallidula.......................... 131  3e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: farnesyl diphosphate synthase [Glaciecola...   
. . Salinimonas chungwhensis...................... 130  4e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Salinimonas chungwh...   
. . Aliagarivorans marinus........................ 130  5e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Aliagarivorans marinus]   
. . Marinobacterium sp. AK27...................... 129  2e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: Octaprenyl diphosphate synthase [Marinobacteri...   
. . Marinobacter sp. ELB17........................ 129  3e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: farnesyl-diphosphate synthase [Marinobact...   
. . Algicola sagamiensis.......................... 128  5e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Algicola sagamiensis]    
. . Glaciecola nitratireducens.................... 128  6e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Glaciecola nitra...   
. . Pseudoalteromonas spongiae.................... 127  7e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Pseudoalteromona...   
. . Pseudoalteromonas haloplanktis ANT/505........ 127  7e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Pseudoalteromona...   
. . Haliea salexigens............................. 127  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Haliea salexigens]        
. . Psychromonas ingrahamii....................... 127  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Psychromonas ing...   
. . Agarivorans albus............................. 127  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: octaprenyl-diphosphate synthase [Agarivor...   
. . Marinobacter sp. AK21......................... 126  3e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: Octaprenyl-diphosphate synthase [Marinobacter ...   
. . Microbulbifer agarilyticus.................... 125  6e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: farnesyl-diphosphate synthase [Microbulbi...   
. . Psychromonas aquimarina....................... 124  1e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Psychromonas aquimar...   
. . Thalassotalea sp. ND16A....................... 124  2e-30  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Thalassotalea sp. ND...   
. . Pseudoalteromonas citrea...................... 122  1e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Pseudoalteromona...   
. . Pseudoalteromonas luteoviolacea............... 120  3e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: Octaprenyl-diphosphate synthase [Pseudoal...   
. . Colwellia psychrerythraea..................... 120  4e-29  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Colwellia psychreryt...   
. . Alishewanella aestuarii....................... 119  8e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Alishewanella ae...   
. . Marinobacter sp. EN3.......................... 119  1e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: farnesyl-diphosphate synthase [Marinobact...   
. . Marinobacterium jannaschii.................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Marinobacterium jann...   
. . Marinobacter.................................. 119  1e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . Pseudoalteromonas............................. 119  1e-28  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: MULTISPECIES: geranyltranstransferase [Ps...   
. . Marinobacter aquaeolei VT8.................... 118  2e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . Pseudoalteromonas sp. BSi20652................ 118  2e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Pseudoalteromona...   
. . Pseudoalteromonas agarivorans................. 117  3e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Pseudoalteromona...   
. . Pseudoalteromonas sp. NW 4327................. 117  4e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Pseudoalteromona...   
. . Pseudoalteromonas sp. TB51.................... 117  4e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Pseudoalteromonas sp...   
. . Pseudoalteromonas rubra....................... 117  5e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Pseudoalteromona...   
. . Glaciecola arctica............................ 117  5e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: farnesyl diphosphate synthase [Glaciecola...   
. . Colwellia psychrerythraea 34H................. 117  6e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Colwellia psychr...   
. . Shewanella sp. MR-7........................... 117  7e-28  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Shewanella sp. M...   
. . Shewanella marina............................. 116  1e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Shewanella marina]        
. . Pseudoalteromonas arctica..................... 116  1e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Pseudoalteromona...   
. . Colwellia piezophila.......................... 116  1e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Colwellia piezop...   
. . Glaciecola polaris............................ 115  2e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: farnesyl diphosphate synthase [Glaciecola...   
. . Marinobacter sp. ES-1......................... 115  3e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: farnesyl-diphosphate synthase [Marinobact...   
. . Pseudoalteromonas lipolytica SCSIO 04301...... 115  3e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Pseudoalteromonas lipolyt...   
. . Marinobacter daepoensis....................... 115  3e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Marinobacter daepoen...   
. . Pseudoalteromonas sp. SM9913.................. 115  4e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: MULTISPECIES: geranyltranstransferase [Ps...   
. . Marinimicrobium sp. LS-A18.................... 114  6e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Marinimicrobium sp. ...   
. . Pseudoalteromonas sp. S3431................... 114  7e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Pseudoalteromonas sp...   
. . Marinimicrobium agarilyticum.................. 114  7e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Marinimicrobium agar...   
. . Shewanella sp. MR-4........................... 114  8e-27  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Shewanella sp. M...   
. . Shewanella decolorationis..................... 114  8e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: polyprenyl synthetase [Shewanella decolor...   
. . Shewanella sp. ANA-3.......................... 114  8e-27  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Shewanella sp. A...   
. . Pseudoalteromonas sp. ND6B.................... 114  9e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Pseudoalteromonas sp...   
. . Glaciecola agarilytica........................ 113  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Glaciecola agari...   
. . Pseudoalteromonas tunicata.................... 113  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Pseudoalteromona...   
. . Pseudoalteromonas sp. BSi20495................ 113  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: MULTISPECIES: geranyltranstransferase [Ps...   
. . Glaciecola chathamensis....................... 113  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Glaciecola chath...   
. . Pseudoalteromonas sp. BSi20311................ 113  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: MULTISPECIES: geranyltranstransferase [Ps...   
. . Pseudoalteromonas undina...................... 113  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Pseudoalteromona...   
. . Ferrimonas kyonanensis........................ 112  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Ferrimonas kyonanensis]   
. . Glaciecola mesophila.......................... 112  3e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: farnesyl diphosphate synthase [Glaciecola...   
. . Saccharophagus degradans...................... 112  3e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: farnesyl-diphosphate synthase [Saccharoph...   
. . Microbulbifer variabilis...................... 112  3e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Microbulbifer varia...   
. . Pseudoalteromonas sp. SCSIO_11900............. 112  4e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Pseudoalteromonas sp. SCS...   
. . Marinobacterium stanieri...................... 112  4e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: farnesyl-diphosphate synthase [Marinobact...   
. . Pseudoalteromonas flavipulchra................ 111  7e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Pseudoalteromona...   
. . Ferrimonas futtsuensis........................ 111  7e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyl transferase [Ferrimonas futtsuensis]   
. . Pseudoalteromonas luteoviolacea 2ta16......... 111  8e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranylgeranyl pyrophosphate synthase [Ps...   
. . Pseudoalteromonas marina...................... 111  8e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Pseudoalteromona...   
. . Alteromonadales............................... 110  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: MULTISPECIES: geranyltranstransferase [Al...   
. . Pseudoalteromonas atlantica................... 110  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Pseudoalteromona...   
. . Glaciecola sp. 4H-3-7+YE-5.................... 110  1e-25  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Glaciecola sp. 4...   
. . Gilvimarinus chinensis........................ 109  4e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Gilvimarinus chinen...   
. . Marinobacterium rhizophilum................... 108  7e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: hypothetical protein [Marinobacterium rhi...   
. . Alteromonas sp. SN2........................... 107  2e-24  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Alteromonas sp. ...   
. . Alteromonas macleodii......................... 107  3e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Alteromonas macl...   
. . Alteromonas................................... 106  4e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: MULTISPECIES: geranyl transferase [Altero...   
. . Moritella dasanensis.......................... 106  5e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Alteromonadales: geranyltranstransferase [Moritella dasane...   
. . Vibrio alginolyticus.......................... 153  1e-41  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio alginolyt...   
. . Vibrio alginolyticus 12G01.................... 152  2e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio alginolyt...   
. . Vibrio alginolyticus 40B...................... 152  2e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio alginolyt...   
. . Vibrio owensii JCM 18905...................... 152  2e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: octaprenyl diphosphate synthase [Vibrio sp. J...   
. . Vibrio........................................ 152  3e-41  7 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: MULTISPECIES: geranyltranstransferase [Vi...   
. . Vibrio sp. EJY3............................... 152  3e-41  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: MULTISPECIES: geranyltranstransferase [Vi...   
. . Vibrio parahaemolyticus....................... 152  5e-41  69 hits Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyl transferase [Vibrio parahaemolyti...   
. . Aliivibrio logei.............................. 152  5e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Aliivibrio logei]     
. . Vibrio fluvialis.............................. 151  8e-41  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Octaprenyl-diphosphate synthase [Vibrio f...   
. . Vibrio fluvialis PG41......................... 151  9e-41  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Octaprenyl-diphosphate synthase [Vibrio f...   
. . Vibrio sp. JCM 19053.......................... 151  1e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: octaprenyl diphosphate synthase [Vibrio sp. J...   
. . Vibrio sp. 712i1.............................. 150  1e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio sp. 712i1]     
. . Aliivibrio salmonicida........................ 150  1e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Aliivibrio salmo...   
. . Vibrio ordalii................................ 150  1e-40  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio ordalii]       
. . Vibrio ezurae................................. 150  1e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: farnesyl diphosphate synthase [Vibrio ezu...   
. . Tatumella morbirosei.......................... 150  2e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Tatumella morbirosei]          
. . Vibrio halioticoli............................ 150  2e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: farnesyl diphosphate synthase [Vibrio hal...   
. . Vibrio furnissii.............................. 150  2e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio furnissii]     
. . Pseudomonas flectens.......................... 150  2e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Phaseolibacter flect...   
. . Thiothrix disciformis......................... 149  4e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: hypothetical protein [Thiothrix disciformis]   
. . Rheinheimera sp. A13L......................... 149  4e-40  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: geranyltranstransferase [Rheinheimera sp....   
. . Vibrio sp. F6................................. 149  5e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio genomosp....   
. . Vibrio ponticus............................... 149  6e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: octaprenyl diphosphate synthase [Vibrio ponti...   
. . Vibrio genomosp. F10.......................... 148  8e-40  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio genomosp....   
. . Vibrio anguillarum 775........................ 148  9e-40  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: MULTISPECIES: geranyltranstransferase [Vi...   
. . Vibrio vulnificus............................. 148  1e-39  11 hits Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio vulnificus]    
. . Vibrio sp. JCM 19052.......................... 148  1e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: octaprenyl-diphosphate synthase [Vibrio sp. J...   
. . Vibrio vulnificus BAA87....................... 148  1e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyl transferase [Vibrio vulnificus]        
. . Vibrio vulnificus YJ016....................... 148  1e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio vulnificus]    
. . Vibrio fortis................................. 148  1e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyl transferase [Vibrio fortis]            
. . Vibrio harveyi 1DA3........................... 148  1e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: MULTISPECIES: geranyltranstransferase [Vi...   
. . Vibrio vulnificus CMCP6....................... 148  1e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio vulnificus]    
. . Vibrio rotiferianus........................... 148  1e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio rotiferia...   
. . Vibrio cyclitrophicus......................... 148  1e-39  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio cyclitrop...   
. . Vibrio cyclitrophicus FF75.................... 147  2e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio cyclitrop...   
. . Photobacterium leiognathi..................... 147  2e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Photobacterium l...   
. . Vibrio crassostreae........................... 147  2e-39  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio crassostr...   
. . Aliivibrio wodanis............................ 147  3e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Aliivibrio wodanis]       
. . Photobacterium leiognathi lrivu.4.1........... 147  3e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Photobacterium l...   
. . Vibrio splendidus............................. 147  3e-39  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio splendidus]    
. . Vibrio breoganii.............................. 147  3e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: hypothetical protein [Vibrio breoganii]        
. . Neptunomonas japonica......................... 147  3e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: geranyl transferase [Neptunomonas japonica]    
. . Vibrio cholerae HENC-01....................... 147  4e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: MULTISPECIES: geranyltranstransferase [Vi...   
. . Vibrio orientalis............................. 147  4e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio orientalis]    
. . Candidatus Photodesmus blepharus.............. 147  4e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: farnesyl diphosphate synthase [Candidatus Phot...   
. . Candidatus Regiella insecticola............... 147  5e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Candidatus Regie...   
. . Vibrio ichthyoenteri.......................... 146  4e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio ichthyoen...   
. . Vibrio sp. MED222............................. 146  5e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio sp. MED222]    
. . Escherichia hermannii......................... 146  5e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia herm...   
. . Vibrio tasmaniensis........................... 146  5e-39  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio tasmanien...   
. . Vibrio splendidus LGP32....................... 146  6e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: MULTISPECIES: geranyltranstransferase [Vi...   
. . Vibrio navarrensis............................ 146  6e-39  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyl transferase [Vibrio navarrensis]            
. . Vibrio splendidus 12B01....................... 146  6e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio splendidus]    
. . Photobacterium sp. AK15....................... 146  7e-39  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Octaprenyl-diphosphate synthase [Photobac...   
. . Alkalilimnicola ehrlichii..................... 146  7e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: farnesyl-diphosphate synthase [Alkalilimn...   
. . Aliivibrio fischeri........................... 146  7e-39  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Aliivibrio fisch...   
. . Vibrio tubiashii.............................. 145  9e-39  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio tubiashii]     
. . Wigglesworthia glossinidia.................... 145  1e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Wigglesworthia g...   
. . Vibrio sp. C7................................. 145  1e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: octaprenyl-diphosphate synthase synthetase [V...   
. . Vibrio gazogenes.............................. 145  1e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio gazogenes]     
. . Klebsiella sp. YR343.......................... 145  1e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Pantoea sp. YR343]    
. . Vibrio fischeri SR5........................... 145  1e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Aliivibrio fisch...   
. . Candidatus Regiella insecticola R5.15......... 145  2e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Candidatus Regie...   
. . Aeromonas hydrophila 4AK4..................... 145  2e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: ispA product [Aeromonas hydrophila 4AK4]            
. . Vibrio fischeri ES114......................... 145  2e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Aliivibrio fisch...   
. . Thalassolituus oleivorans..................... 145  2e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: farnesyl-diphosphate synthase [Thalassoli...   
. . Vibrio rumoiensis............................. 145  2e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio rumoiensis]    
. . Pantoea sp. AS-PWVM4.......................... 145  2e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Octaprenyl-diphosphate synthase [Pantoea ...   
. . Enterobacter sp. GM01......................... 145  2e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Pantoea sp. GM01]     
. . Photobacterium damselae....................... 144  3e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Photobacterium d...   
. . Vibrio sp. PPCK-2014.......................... 144  3e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyl transferase [Vibrio sp. PPCK-2014]          
. . Vibrio cholerae............................... 144  3e-38  32 hits Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio cholerae]      
. . Vibrio sp. RC341.............................. 144  3e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio sp. RC341]     
. . Tatumella sp. UCD-D_suzukii................... 144  3e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Tatumella sp. UCD-D_...   
. . Aeromonas sp. AE235........................... 144  4e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyl transferase [Aeromonas sp. AE235]      
. . Tatumella ptyseos............................. 144  4e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Tatumella ptyseos]        
. . Vibrio coralliilyticus........................ 144  4e-38  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyl transferase [Vibrio coralliilyticus]        
. . Photobacterium sp. SKA34...................... 144  4e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Photobacterium s...   
. . Vibrio cholerae O395.......................... 144  5e-38  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio cholerae]      
. . Vibrio proteolyticus.......................... 144  5e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: farnesyl diphosphate synthase [Vibrio pro...   
. . Rheinheimera perlucida........................ 144  5e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Rheinheimera perluc...   
. . Vibrio cholerae 1587.......................... 144  5e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio cholerae]      
. . Vibrio azureus................................ 144  5e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: farnesyl diphosphate synthase [Vibrio azu...   
. . Vibrio cholerae TM 11079-80................... 144  5e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio cholerae]      
. . Vibrio coralliilyticus ATCC BAA-450........... 144  6e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio coralliil...   
. . Enterobacteriaceae bacterium HS............... 144  6e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Polyprenyl synthetase [Sodalis sp. HS1]             
. . Vibrio brasiliensis........................... 143  6e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio brasilien...   
. . Cedecea neteri................................ 143  7e-38  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Cedecea neteri]                
. . Enterobacter sp. Ag1.......................... 143  7e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Enterobacter sp....   
. . Vibrio cholerae MZO-3......................... 143  8e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio cholerae]      
. . Candidatus Sodalis pierantonius............... 143  8e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Geranyltranstransferase (farnesyldiphosphate s...   
. . Vibrio mimicus................................ 143  9e-38  6 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio mimicus]       
. . Vibrio parahaemolyticus 16.................... 143  9e-38  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio sp. 16]        
. . Vibrio cholerae HE45.......................... 143  9e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio cholerae]      
. . Aeromonas media WS............................ 143  9e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyltranstransferase [Aeromonas media WS]        
. . Pantoea sp. At-9b............................. 143  9e-38  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Pantoea sp. At-9b]    
. . Vibrio mimicus MB451.......................... 143  9e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio mimicus]       
. . Vibrio mimicus CAIM 1883...................... 143  9e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio mimicus]       
. . Vibrio mimicus CAIM 602....................... 143  9e-38  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: octaprenyl-diphosphate synthase [Vibrio m...   
. . Vibrio mimicus VM603.......................... 143  1e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio mimicus]       
. . Vibrio cholerae 623-39........................ 143  1e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio cholerae]      
. . Vibrio mimicus VM573.......................... 143  1e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio mimicus]       
. . Vibrio cholerae LMA3984-4..................... 143  1e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: MULTISPECIES: geranyltranstransferase [Vi...   
. . Vibrio variabilis............................. 143  1e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: dimethylallyltransferase [Vibrio variabilis]       
. . Vibrio sp. RC586.............................. 143  1e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio sp. RC586]     
. . Francisella sp. FSC1006....................... 143  1e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: octaprenyl-diphosphate synthase [Francisella s...   
. . Vibrio cholerae AM-19226...................... 143  1e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio cholerae]      
. . Aeromonas salmonicida......................... 143  1e-37  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyltranstransferase [Aeromonas salmon...   
. . Vibrio cholerae HE-16......................... 143  1e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio cholerae]      
. . Vibrio cholerae 12129(1)...................... 143  1e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio cholerae]      
. . Erwinia toletana.............................. 143  1e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Erwinia toletana]         
. . Marinomonas sp. MED121........................ 143  2e-37  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: Chain A, Crystal Structure Of A Putative Farnesyl-...   
. . Vibrio sinaloensis............................ 142  1e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio sinaloensis]   
. . Vibrio cholerae O1 biovar El Tor str. N16961.. 142  1e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio cholerae]      
. . Photobacterium angustum....................... 142  1e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Photobacterium a...   
. . Photorhabdus temperata........................ 142  2e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Photorhabdus tem...   
. . Photobacterium phosphoreum ANT220............. 142  2e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Photobacterium phosp...   
. . Vibrio litoralis.............................. 142  2e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyl transferase [Vibrio litoralis]         
. . Photorhabdus temperata subsp. khanii NC19..... 142  2e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranylgeranyl pyrophosphate synthase [Photorh...   
. . Photobacterium profundum...................... 142  2e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Photobacterium p...   
. . Vibrio scophthalmi............................ 142  2e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio scophthalmi]   
. . Proteus mirabilis............................. 142  2e-37  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Proteus mirabilis]    
. . Photorhabdus temperata subsp. temperata Meg1.. 142  3e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranylgeranyl pyrophosphate synthase [Photorh...   
. . Photorhabdus asymbiotica...................... 142  4e-37  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Photorhabdus asy...   
. . Nitrincola lacisaponensis..................... 141  6e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: Octaprenyl diphosphate synthase [Nitrincola la...   
. . Proteus mirabilis HI4320...................... 141  6e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Proteus mirabilis]    
. . Proteus mirabilis BB2000...................... 141  8e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Proteus mirabilis]    
. . Thioploca ingrica............................. 140  8e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: polyprenyl synthetase [Thioploca ingrica]          
. . Francisella tularensis........................ 140  8e-37  11 hits Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: Octaprenyl-diphosphate synthase / Dimethy...   
. . Thiobacillus prosperus........................ 140  8e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: geranyltranstransferase [Thiobacillus prosperus]    
. . Aeromonas salmonicida subsp. salmonicida A449. 140  8e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyltranstransferase [Aeromonas salmon...   
. . Aeromonas enteropelogenes..................... 140  9e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyl transferase [Aeromonas enteropelo...   
. . Aeromonas veronii............................. 140  9e-37  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyltranstransferase [Aeromonas veronii]    
. . Oleispira antarctica RB-8..................... 140  9e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: Geranyltranstransferase (Farnesyl-diphosphate...   
. . Haemophilus ducreyi........................... 140  9e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus ducr...   
. . gamma proteobacterium HIMB30.................. 140  9e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: geranyltranstransferase [gamma proteobact...   
. . Sodalis glossinidius.......................... 140  9e-37  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Sodalis glossini...   
. . Vibrio sp. N418............................... 140  9e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio sp. N418]      
. . Aeromonas veronii B565........................ 140  9e-37  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyltranstransferase [Aeromonas veronii]    
. . Aeromonas veronii AER39....................... 140  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyltranstransferase [Aeromonas veronii]    
. . Aeromonas hydrophila.......................... 140  1e-36  11 hits Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyl transferase [Aeromonas hydrophila]     
. . Vibrio shilonii............................... 140  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio shilonii]      
. . Pseudomonas azotifigens....................... 140  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas azotifig...   
. . Pantoea sp. SC-1.............................. 140  1e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Pantoea sp. Sc1]      
. . Erwinia tracheiphila.......................... 140  1e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Erwinia tracheip...   
. . Photorhabdus temperata J3..................... 140  1e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Photorhabdus tem...   
. . Hafnia alvei ATCC 13337....................... 140  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: polyprenyl synthetase [Hafnia alvei ATCC 13337]     
. . Vibrio sp. ER1A............................... 140  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyl transferase [Vibrio sp. ER1A]               
. . Hafnia alvei.................................. 140  2e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Hafnia alvei]             
. . Aeromonas sp. 159............................. 140  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyltranstransferase [Aeromonas sp. 159]    
. . Grimontia hollisae............................ 140  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Grimontia hollisae]   
. . Rheinheimera nanhaiensis...................... 139  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: geranyltranstransferase [Rheinheimera nan...   
. . Candidatus Baumannia cicadellinicola.......... 139  2e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: Octaprenyl diphosphate synthase / Dimethylally...   
. . Pantoea agglomerans Eh318..................... 139  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Pantoea agglomerans E...   
. . Fangia hongkongensis.......................... 139  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: hypothetical protein [Fangia hongkongensis]    
. . Erwinia amylovora............................. 139  2e-36  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Erwinia amylovora]    
. . Pantoea....................................... 139  2e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Pa...   
. . Serratia odorifera............................ 139  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Serratia odorifera]   
. . Photobacterium profundum SS9.................. 139  2e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Photobacterium p...   
. . Thiorhodospira sibirica....................... 139  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: farnesyl-diphosphate synthase [Thiorhodos...   
. . endosymbiont of Riftia pachyptila............. 139  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: farnesyl-diphosphate synthase [endosymbio...   
. . Erwinia amylovora Ea644....................... 139  2e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Erwinia amylovora]    
. . Aeromonas hydrophila AD9...................... 139  3e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyl transferase [Aeromonas hydrophila AD9]      
. . Pantoea agglomerans........................... 139  3e-36  7 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Polyprenyl synthetase [Pantoea agglomerans]         
. . Enterovibrio calviensis....................... 139  3e-36  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyl transferase [Enterovibrio calvien...   
. . Erwinia sp. Ejp617............................ 139  3e-36  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Erwinia sp. Ejp617]   
. . Photobacterium halotolerans................... 139  3e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyl transferase [Photobacterium halot...   
. . Tatumella saanichensis........................ 139  4e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Tatumella saanichensis]   
. . Erwinia pyrifoliae............................ 139  4e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Erwinia pyrifoliae]   
. . Serratia symbiotica........................... 139  4e-36  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Serratia symbiot...   
. . Pantoea rwandensis............................ 139  4e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Pantoea rwandensis]            
. . Lamprocystis purpurea......................... 139  4e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Lamprocystis purpurea]   
. . Pantoea sp. IMH............................... 139  5e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Pantoea sp. IMH]          
. . Aeromonas hydrophila subsp. hydrophila ATCC 796 139  5e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyltranstransferase [Aeromonas hydrop...   
. . endosymbiont of Tevnia jerichonana............ 138  5e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: farnesyl-diphosphate synthase [endosymbio...   
. . Candidatus Photodesmus katoptron.............. 138  5e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Candidatus Photo...   
. . Erwinia mallotivora........................... 138  6e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Erwinia mallotivora]           
. . Photorhabdus luminescens...................... 138  7e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Photorhabdus luminescens]      
. . Erwinia tasmaniensis.......................... 138  7e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Erwinia tasmanie...   
. . Vibrio nigripulchritudo....................... 138  8e-36  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio nigripulc...   
. . Xenorhabdus bovienii str. puntauvense......... 138  8e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase (=farnesyldiphosphate...   
. . Morganella morganii........................... 138  8e-36  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Morganella morga...   
. . Morganella morganii subsp. morganii KT........ 138  9e-36  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Octaprenyl-diphosphate synthase [Morganel...   
. . Xenorhabdus bovienii str. feltiae France...... 138  9e-36  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase (=farnesyldiphosphate...   
. . Arsenophonus endosymbiont of Nilaparvata lugens 138  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Arsenophonus endosym...   
. . Brenneria sp. EniD312......................... 138  1e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Brenneria sp. En...   
. . Xenorhabdus bovienii str. oregonense.......... 138  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase (=farnesyldiphosphate...   
. . Enterovibrio norvegicus....................... 137  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Enterovibrio nor...   
. . Xenorhabdus bovienii str. kraussei Becker Under 137  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase (=farnesyldiphosphate...   
. . Xenorhabdus bovienii str. kraussei Quebec..... 137  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase (=farnesyldiphosphate...   
. . Candidatus Blochmannia chromaiodes............ 137  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Farnesyl diphosphate synthase [Candidatus...   
. . Vibrio nigripulchritudo BLFn1................. 137  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio nigripulc...   
. . Pantoea ananatis.............................. 137  1e-35  6 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Pantoea ananatis]         
. . Vibrio nigripulchritudo SOn1.................. 137  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio nigripulc...   
. . Xenorhabdus bovienii str. Intermedium......... 137  1e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase (=farnesyldiphosphate...   
. . Pantoea ananatis AJ13355...................... 137  2e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Pantoea ananatis]     
. . Buchnera aphidicola........................... 137  2e-35  6 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl-diphosphate synthase [Buchnera a...   
. . Pantoea sp. aB................................ 137  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Pa...   
. . Pantoea ananatis LMG 20103.................... 137  2e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Pantoea ananatis]     
. . Pantoea vagans................................ 137  2e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Pantoea vagans]                
. . Xenorhabdus bovienii.......................... 137  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Xenorhabdus bovi...   
. . Thioalkalivibrio sulfidiphilus................ 137  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: farnesyl-diphosphate synthase [Thioalkali...   
. . Candidatus Blochmannia pennsylvanicus......... 137  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Candidatus Bloch...   
. . Yersinia bercovieri........................... 137  2e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Yersinia bercovi...   
. . Photorhabdus luminescens subsp. laumondii TTO1 137  2e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Photorhabdus lum...   
. . Baumannia cicadellinicola str. Hc (Homalodisca  137  2e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: geranyltranstransferase [Candidatus Bauma...   
. . Plesiomonas shigelloides...................... 137  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: polyprenyl synthetase [Plesiomonas shigel...   
. . Serratia symbiotica SCt-VLC................... 137  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Farnesyl diphosphate synthase [Serratia symbi...   
. . Photorhabdus luminescens BA1.................. 137  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranylgeranyl pyrophosphate synthase [Photorh...   
. . Vibrio nigripulchritudo SFn118................ 136  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio nigripulc...   
. . Escherichia coli.............................. 136  3e-35  134 hitsBacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia coli]     
. . Mannheimia varigena USDA-ARS-USMARC-1261...... 136  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Farnesyl-diphosphate synthase [Mannheimia vari...   
. . Pantoea dispersa.............................. 136  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Pantoea dispersa]     
. . Amphritea japonica............................ 136  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: geranyl transferase [Amphritea japonica]       
. . Escherichia coli KTE107....................... 136  3e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Vibrio nigripulchritudo AM115................. 136  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio nigripulc...   
. . Hafnia alvei ATCC 51873....................... 136  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Hafnia alvei]         
. . Yersinia mollaretii........................... 136  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Yersinia mollare...   
. . Yersinia ruckeri.............................. 136  4e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Yersinia ruckeri]          
. . Erwinia piriflorinigrans...................... 136  4e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Erwinia piriflor...   
. . Yersinia ruckeri ATCC 29473................... 136  4e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Yersinia ruckeri]     
. . Thioalkalivibrio sp. ALJ17.................... 136  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: farnesyl-diphosphate synthase [Thioalkali...   
. . Haemophilus influenzae........................ 136  5e-35  20 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus infl...   
. . Salinivibrio socompensis...................... 136  5e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyl transferase [Salinivibrio socompe...   
. . Haemophilus paraphrohaemolyticus.............. 136  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus para...   
. . Enterovibrio sp. AK16......................... 136  5e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Octaprenyl-diphosphate synthase [Grimonti...   
. . Pantoea sp. 3.5.1............................. 136  5e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Pantoea sp. 3.5.2]        
. . Enterobacteriaceae bacterium 9_2_54FAA........ 136  5e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Enterobacteriace...   
. . Pantoea stewartii subsp. indologenes.......... 135  6e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Pantoea stewartii subsp. ...   
. . Pasteurella multocida......................... 135  7e-35  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Pasteurella mult...   
. . Serratia symbiotica str. Tucson............... 135  7e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Serratia symbiot...   
. . Serratia sp. ATCC 39006....................... 135  7e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Geranyltranstransferase [Serratia sp. ATC...   
. . Pasteurella multocida subsp. multocida str. HN0 135  8e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Pasteurella mult...   
. . Xenorhabdus doucetiae......................... 135  9e-35  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Geranyltranstransferase [Xenorhabdus doucetiae]    
. . Arsenophonus nasoniae......................... 135  9e-35  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Arsenophonus nasoniae]    
. . Mannheimia varigena USDA-ARS-USMARC-1296...... 135  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Farnesyl-diphosphate synthase [Mannheimia vari...   
. . Francisella sp. TX077308...................... 135  1e-34  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: Octaprenyl-diphosphate synthase / Dimethy...   
. . Mannheimia varigena USDA-ARS-USMARC-1312...... 135  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Farnesyl-diphosphate synthase [Mannheimia vari...   
. . Mannheimia varigena USDA-ARS-USMARC-1388...... 135  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Farnesyl-diphosphate synthase [Mannheimia vari...   
. . Succinimonas amylolytica...................... 135  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyl transferase [Succinimonas amyloly...   
. . Erwinia billingiae............................ 135  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Erwinia billingiae]   
. . Enterobacteriaceae bacterium LSJC7............ 135  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Enterobacteriace...   
. . Xenorhabdus szentirmaii DSM 16338............. 135  1e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Geranyltranstransferase [Xenorhabdus szentirm...   
. . Xenorhabdus nematophila....................... 135  1e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Farnesyl diphosphate synthase [Xenorhabdu...   
. . Lonsdalea quercina............................ 135  2e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Lonsdalea quercina]       
. . Xenorhabdus nematophila ATCC 19061............ 135  2e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Xenorhabdus nema...   
. . Pasteurella multocida subsp. gallicida str. Ana 134  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Pasteurella mult...   
. . Pasteurella multocida subsp. multocida str. Pm7 134  2e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Pasteurella mult...   
. . Rheinheimera baltica.......................... 134  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: geranyl transferase [Rheinheimera baltica]     
. . Haemophilus sp. CCUG 13788.................... 134  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus sput...   
. . Dickeya solani................................ 134  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Geranyltranstransferase [Dickeya solani]       
. . Haemophilus influenzae R2846.................. 134  2e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus infl...   
. . Haemophilus influenzae 6P18H1................. 134  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus infl...   
. . Haemophilus influenzae R2866.................. 134  2e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus infl...   
. . Marinomonas sp. D104.......................... 134  2e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: farnesyl-diphosphate synthase [Marinomona...   
. . Actinobacillus succinogenes................... 134  2e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Actinobacillus s...   
. . Xenorhabdus poinarii G6....................... 134  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Geranyltranstransferase [Xenorhabdus poinarii...   
. . Pantoea stewartii............................. 134  3e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Pantoea stewartii]    
. . Haemophilus sp. FF7........................... 134  4e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyl transferase [Haemophilus sp. FF7]      
. . Fluoribacter dumoffii......................... 134  4e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: farnesyl-diphosphate synthase [Fluoribact...   
. . Pasteurella dagmatis ATCC 43325............... 134  5e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: polyprenyl synthetase [Pasteurella dagmatis AT...   
. . Pasteurella pneumotropica..................... 133  4e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Pasteurella pneu...   
. . Pasteurella dagmatis.......................... 133  5e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyl transferase [Pasteurella dagmatis]     
. . Haemophilus parainfluenzae.................... 133  5e-34  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus para...   
. . Pantoea sp. A4................................ 133  5e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Pantoea sp. A4]       
. . Succinatimonas hippei......................... 133  5e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyltranstransferase [Succinatimonas h...   
. . Thioalkalivibrio.............................. 133  5e-34  11 hits Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . Bermanella marisrubri......................... 133  5e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: farnesyl-diphosphate synthase [Bermanella...   
. . Haemophilus haemolyticus...................... 133  6e-34  6 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus haem...   
. . Xenorhabdus cabanillasii JM26................. 133  6e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Geranyltranstransferase [Xenorhabdus cabanill...   
. . Candidatus Hamiltonella defensa............... 133  6e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Candidatus Hamil...   
. . Actinobacillus minor.......................... 133  7e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Actinobacillus m...   
. . Actinobacillus minor NM305.................... 133  7e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Actinobacillus m...   
. . Polaromonas sp. CF318......................... 133  9e-34  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: polyprenyl synthetase [Polaromonas sp. CF...   
. . Nitrosococcus watsonii........................ 132  8e-34  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: farnesyl-diphosphate synthase [Nitrosococ...   
. . Actinobacillus capsulatus..................... 132  1e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Actinobacillus c...   
. . Actinobacillus suis........................... 132  1e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Actinobacillus s...   
. . Vibrio owensii JCM 18904...................... 132  1e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: LOW QUALITY PROTEIN: octaprenyl diphosphate s...   
. . Mannheimia granulomatis....................... 132  1e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyl transferase [Mannheimia granuloma...   
. . Francisella tularensis subsp. mediasiatica FSC1 132  1e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: geranyl diphosphate synthase/farnesyl dip...   
. . Buchnera aphidicola str. APS (Acyrthosiphon pis 132  1e-33  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl-diphosphate synthase [Buchnera a...   
. . Succinivibrio dextrinosolvens................. 132  1e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyl transferase [Succinivibrio dextri...   
. . Halothiobacillus neapolitanus................. 132  1e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: polyprenyl synthetase [Halothiobacillus n...   
. . Francisella philomiragia...................... 132  1e-33  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: geranyltranstransferase [Francisella phil...   
. . Francisella philomiragia subsp. philomiragia AT 132  2e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: geranyltranstransferase [Francisella phil...   
. . Pseudomonas caeni............................. 132  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Buchnera aphidicola str. JF99 (Acyrthosiphon pi 132  2e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Buchnera aphidic...   
. . Rickettsiella grylli.......................... 132  2e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: geranyltranstransferase (Farnesyl-diphosp...   
. . Mannheimia haemolytica serotype A1/A6 str. PKL1 132  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Mannheimia haemolytic...   
. . Buchnera aphidicola str. JF98 (Acyrthosiphon pi 132  2e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl-diphosphate synthase [Buchnera a...   
. . Methyloglobulus morosus....................... 131  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: farnesyl diphosphate synthase IspA [Methy...   
. . Candidatus Schmidhempelia bombi............... 131  2e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Orbales: geranyl transferase [Candidatus Schmidhem...   
. . Francisella novicida.......................... 131  3e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: geranyltranstransferase [Francisella novi...   
. . Francisella tularensis subsp. tularensis SCHU S 131  3e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: geranyltranstransferase [Francisella tula...   
. . Mannheimia haemolytica........................ 131  3e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Mannheimia haemo...   
. . Citrobacter youngae........................... 131  3e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Citrobacter youn...   
. . Actinobacillus ureae.......................... 131  3e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Actinobacillus u...   
. . Bibersteinia trehalosi........................ 131  4e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Farnesyl diphosphate synthase [Biberstein...   
. . Bibersteinia trehalosi USDA-ARS-USMARC-190.... 131  4e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Farnesyl diphosphate synthase [Bibersteinia tr...   
. . Francisella sp. W12-1067...................... 130  4e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: octaprenyl diphosphate synthase [Francisella s...   
. . Mannheimia haemolytica USDA-ARS-USMARC-183.... 130  7e-33  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Mannheimia haemo...   
. . Haemophilus parasuis.......................... 130  8e-33  9 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyl transferase [Haemophilus parasuis]          
. . Thiomicrospira sp. Milos-T2................... 130  9e-33  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: geranyl transferase [Thiomicrospira sp. M...   
. . Francisella tularensis subsp. holarctica LVS.. 129  1e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: geranyltranstransferase [Francisella tula...   
. . Methylomonas sp. LW13......................... 129  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: geranyl transferase [Methylomonas sp. LW13]    
. . Bibersteinia trehalosi USDA-ARS-USMARC-188.... 129  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Farnesyl diphosphate synthase [Bibersteinia tr...   
. . Haemophilus parasuis HPS11.................... 129  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyl transferase [Haemophilus parasuis HPS11]    
. . Haemophilus parasuis H465..................... 129  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus para...   
. . Salinivibrio costicola........................ 129  1e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Salinivibrio cos...   
. . Candidatus Contendobacter odensis Run_B_J11... 129  2e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: geranyltranstransferase (=farnesyldiphosphate...   
. . Haemophilus parasuis MN-H..................... 129  2e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus para...   
. . Haemophilus parasuis ZJ0906................... 129  2e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus para...   
. . gamma proteobacterium HdN1.................... 129  2e-32  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria: farnesyl-diphosphate synthase [gamma prot...   
. . Haemophilus parasuis SW114.................... 129  2e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus para...   
. . Haemophilus parasuis 84-15995................. 129  2e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus para...   
. . Haemophilus parasuis SH0165................... 129  2e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus para...   
. . secondary endosymbiont of Ctenarytaina eucalypt 129  2e-32  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [secondary endosy...   
. . Pseudoxanthomonas spadix...................... 129  2e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Pseudoxant...   
. . Buchnera aphidicola str. USDA (Myzus persicae) 129  2e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Ispa [Buchnera aphidicola str. USDA (Myzus per...   
. . Rhodanobacter sp. OR444....................... 129  3e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: geranyl transferase [Rhodanobacter sp. OR...   
. . Necropsobacter rosorum........................ 128  3e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyl transferase [Necropsobacter rosorum]   
. . Thioalkalivibrio sp. AKL11.................... 128  3e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: farnesyl-diphosphate synthase [Thioalkali...   
. . Methylobacter luteus.......................... 128  3e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: geranyl transferase [Methylobacter luteus]     
. . Rhodanobacter spathiphylli.................... 128  3e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Rhodanobac...   
. . uncultured SAR86 cluster bacterium SAR86A..... 128  4e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: geranylgeranyl pyrophosphate ligase, ic [SAR86...   
. . Actinobacillus pleuropneumoniae............... 128  5e-32  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Actinobacillus p...   
. . Gallibacterium anatis......................... 128  5e-32  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Gallibacterium a...   
. . Rhodanobacter fulvus.......................... 128  5e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Rhodanobac...   
. . Methylomonas sp. MK1.......................... 127  6e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: farnesyl-diphosphate synthase [Methylomon...   
. . Actinobacillus pleuropneumoniae serovar 2 str.  127  7e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Actinobacillus p...   
. . Pantoea ananatis LMG 5342..................... 127  8e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Pantoea ananatis]     
. . Nitrosococcus halophilus...................... 127  8e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: farnesyl-diphosphate synthase [Nitrosococ...   
. . Vibrio parahaemolyticus Peru-466.............. 127  8e-32  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio parahaemo...   
. . Vibrio parahaemolyticus BB22OP................ 127  9e-32  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: Dimethylallyltransferase [Vibrio parahaem...   
. . Methylomonas sp. 11b.......................... 127  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: geranyl transferase [Methylomonas sp. 11b]     
. . gamma proteobacterium HIMB55.................. 127  1e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: farnesyl-diphosphate synthase [gamma prot...   
. . Vibrio parahaemolyticus 10329................. 127  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio parahaemo...   
. . Aggregatibacter actinomycetemcomitans......... 127  1e-31  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Aggregatibacter ...   
. . Vibrio parahaemolyticus UCM-V493.............. 127  1e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyl transferase [Vibrio parahaemolyti...   
. . Vibrio parahaemolyticus RIMD 2210633.......... 126  2e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio parahaemo...   
. . Methylomonas methanica........................ 126  2e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: farnesyl-diphosphate synthase [Methylomon...   
. . Candidatus Competibacter denitrificans Run_A_D1 126  2e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: geranyltranstransferase (=farnesyldiphosphate...   
. . Actinobacillus pleuropneumoniae serovar 5b str. 126  2e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Actinobacillus p...   
. . Aggregatibacter actinomycetemcomitans serotype  126  2e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Aggregatibacter ...   
. . Anaerobiospirillum succiniciproducens......... 126  2e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: hypothetical protein [Anaerobiospirillum ...   
. . Gallibacterium anatis UMN179.................. 126  3e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Gallibacterium a...   
. . Haemophilus parasuis ST4-2.................... 126  3e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyl transferase [Haemophilus parasuis ST4-2]    
. . Aggregatibacter actinomycetemcomitans D7S-1... 125  4e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Aggregatibacter ...   
. . Aggregatibacter actinomycetemcomitans D11S-1.. 125  4e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Aggregatibacter ...   
. . Aggregatibacter actinomycetemcomitans D17P-2.. 125  4e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Aggregatibacter ...   
. . Aggregatibacter actinomycetemcomitans serotype  125  4e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Aggregatibacter ...   
. . Acidithiobacillus caldus...................... 125  5e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: farnesyl-diphosphate synthase [Acidithiob...   
. . Vibrio parahaemolyticus O1:K33 str. CDC_K4557. 125  5e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio parahaemo...   
. . Dyella japonica............................... 125  5e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: geranyl transferase [Dyella japonica]          
. . Nitrosococcus oceani.......................... 125  5e-31  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: farnesyl-diphosphate synthase [Nitrosococ...   
. . Rhodanobacter thiooxydans..................... 125  6e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Rhodanobac...   
. . Dyella jiangningensis......................... 125  8e-31  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: geranyl transferase [Dyella jiangningensis]         
. . Alcanivorax sp. 97CO-5........................ 124  1e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: farnesyl-diphosphate synthase [Alcanivorax sp....   
. . Alcanivorax borkumensis....................... 124  1e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: farnesyl-diphosphate synthase [Alcanivora...   
. . Aggregatibacter actinomycetemcomitans RhAA1... 124  1e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Aggregatibacter ...   
. . Legionella lansingensis....................... 124  1e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: geranyl transferase [Legionella lansingen...   
. . Hahella chejuensis............................ 124  1e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: farnesyl-diphosphate synthase [Hahella ch...   
. . Methylovulum miyakonense...................... 124  1e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: farnesyl-diphosphate synthase [Methylovul...   
. . Legionella oakridgensis RV-2-2007............. 124  1e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: farnesyl-diphosphate synthase [Legionella oakr...   
. . Stenotrophomonas maltophilia.................. 124  2e-30  18 hits Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Stenotroph...   
. . Methylocaldum szegediense..................... 124  2e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Methylococcales: geranyl transferase [Methylocaldum szeged...   
. . Legionella pneumophila........................ 124  2e-30  14 hits Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: geranyl transferase [Legionella pneumophila]   
. . Vibrio caribbenthicus......................... 124  2e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio sp. N384]      
. . Actinobacillus pleuropneumoniae serovar 7 str.  124  2e-30  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Actinobacillus p...   
. . Candidatus Gilliamella apicola................ 123  2e-30  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria: Octaprenyl-diphosphate synthase / Dimethylally...   
. . Aggregatibacter aphrophilus................... 123  2e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Aggregatibacter ...   
. . Salinisphaera shabanensis..................... 123  2e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Salinisphaerales: farnesyl-diphosphate synthase [Salinispha...   
. . Piscirickettsia salmonis...................... 123  2e-30  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: polyprenyl synthetase family protein [Pisciric...   
. . Piscirickettsia salmonis LF-89................ 123  2e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: polyprenyl synthetase family protein [Pis...   
. . Stenotrophomonas maltophilia RA8.............. 123  3e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: geranyltranstransferase [Stenotrophomonas...   
. . Stenotrophomonas maltophilia R551-3........... 123  3e-30  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Stenotroph...   
. . gamma proteobacterium IMCC3088................ 123  3e-30  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: Octaprenyl-diphosphate synthase [gamma pr...   
. . Aggregatibacter aphrophilus ATCC 33389........ 123  3e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: IspA protein [Aggregatibacter aphrophilus ATCC...   
. . Oceanimonas sp. GK1........................... 123  4e-30  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyltranstransferase [Oceanimonas sp. ...   
. . Alcanivorax sp. 19-m-6........................ 122  5e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: geranylgeranyl pyrophosphate synthetase [Alcan...   
. . Stenotrophomonas maltophilia AU12-09.......... 122  6e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: octaprenyl-diphosphate synthase [Stenotro...   
. . Leucothrix mucor.............................. 122  6e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: geranyl transferase [Leucothrix mucor]         
. . Gallaecimonas xiamenensis..................... 122  6e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: geranyltranstransferase [Gallaecimonas xi...   
. . Alcanivorax jadensis T9....................... 122  6e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: geranylgeranyl pyrophosphate synthetase [Alcan...   
. . Succinatimonas sp. CAG:777.................... 122  8e-30  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyltranstransferase [Succinatimonas s...   
. . Thioalkalivibrio sp. ARh3..................... 122  8e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: farnesyl-diphosphate synthase [Thioalkali...   
. . Ruminobacter sp. RM87......................... 122  9e-30  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyl transferase [Ruminobacter sp. RM87]    
. . Thioalkalimicrobium aerophilum AL3............ 122  1e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: geranyltranstransferase [Thioalkalimicrobium a...   
. . Buttiauxella agrestis ATCC 33320.............. 122  1e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: polyprenyl synthetase [Buttiauxella agrestis A...   
. . Aggregatibacter sp. oral taxon 458............ 122  1e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: putative geranyltranstransferase [Aggrega...   
. . Aggregatibacter segnis........................ 121  1e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Aggregatibacter ...   
. . Stenotrophomonas maltophilia SKK35............ 121  1e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: geranyltranstransferase [Stenotrophomonas mal...   
. . Vibrio campbellii............................. 121  1e-29  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio campbellii]    
. . Legionella fairfieldensis..................... 121  1e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: geranyl transferase [Legionella fairfield...   
. . Cedecea davisae............................... 121  1e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: polyprenyl synthetase [Cedecea davisae]        
. . Rhodanobacter................................. 121  2e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . Rhodanobacter sp. 2APBS1...................... 121  2e-29  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . Thiorhodovibrio sp. 970....................... 121  2e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: farnesyl-diphosphate synthase [Thiorhodov...   
. . Enterobacter cloacae complex.................. 121  2e-29  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyl transferase [Entero...   
. . Leminorella grimontii......................... 121  2e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Leminorella grimontii]    
. . Vibrio campbellii CAIM 519.................... 121  2e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio campbellii]    
. . Enterobacter asburiae......................... 121  2e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Enterobacter asb...   
. . Enterobacter cloacae ISC8..................... 120  2e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Geranyltranstransferase (farnesyldiphosphate ...   
. . Vibrio kanaloae............................... 120  2e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: geranyltranstransferase [Vibrio kanaloae]      
. . Stenotrophomonas maltophilia M30.............. 120  3e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: geranyl transferase [Stenotrophomonas mal...   
. . Stenotrophomonas maltophilia D457............. 120  3e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Stenotroph...   
. . Escherichia blattae........................... 120  3e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Shimwellia blattae]   
. . Stenotrophomonas maltophilia EPM1............. 120  3e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: Octaprenyl-diphosphate synthase / Dimethy...   
. . Xanthomonadaceae.............................. 120  3e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . Thioalkalivibrio sp. K90mix................... 120  3e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . Stenotrophomonas maltophilia MF89............. 120  3e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Stenotroph...   
. . Stenotrophomonas maltophilia K279a............ 120  3e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Stenotroph...   
. . Budvicia aquatica............................. 120  4e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Budvicia aquatica]        
. . Spiribacter salinus........................... 120  4e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: farnesyl-diphosphate synthase [Spiribacte...   
. . Frateuria aurantia............................ 120  4e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: geranyltranstransferase [Frateuria aurantia]   
. . Erwinia tracheiphila PSU-1.................... 120  4e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: putative geranylgeranyl diphosphate synth...   
. . Enterobacter cloacae EcWSU1................... 120  4e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [En...   
. . Dyella ginsengisoli........................... 120  4e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Dyella gin...   
. . Haemophilus aegyptius......................... 120  4e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus aegy...   
. . Xylella fastidiosa............................ 120  5e-29  9 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Xylella fa...   
. . Yokenella regensburgei........................ 120  5e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Yokenella regens...   
. . Stenotrophomonas maltophilia 5BA-I-2.......... 119  6e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Stenotrophomona...   
. . Stenotrophomonas sp. RIT309................... 119  6e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: geranyl transferase [Stenotrophomonas sp....   
. . Xylella fastidiosa M12........................ 119  7e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Xylella fa...   
. . Thioalkalivibrio sp. ALJ24.................... 119  7e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Thioalkalivibrio sp...   
. . Xylella fastidiosa Dixon...................... 119  7e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Xylella fa...   
. . Thioalkalimicrobium cyclicum.................. 119  7e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: geranyltranstransferase [Thioalkalimicrob...   
. . Enterobacter cloacae.......................... 119  7e-29  9 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Enterobacter cloacae]     
. . Haemophilus influenzae PittEE................. 119  7e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus infl...   
. . Arenimonas metalli CF5-1...................... 119  7e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: hypothetical protein N787_10110 [Arenimonas me...   
. . Enterobacter sp. 638.......................... 119  7e-29  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Enterobacter sp....   
. . Buchnera aphidicola str. Sg (Schizaphis graminu 119  8e-29  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl-diphosphate synthase [Buchnera a...   
. . Cronobacter turicensis........................ 119  8e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Octaprenyl-diphosphate synthase / Dimethy...   
. . Acidithiobacillus ferrivorans................. 119  8e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: farnesyl-diphosphate synthase [Acidithiob...   
. . Cronobacter malonaticus....................... 119  9e-29  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Cronobacter malonati...   
. . Pseudomonas alcaliphila....................... 119  9e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Enterobacter cloacae subsp. cloacae GS1....... 119  9e-29  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [En...   
. . uncultured SAR86 cluster bacterium SAR86B..... 119  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: geranyltranstransferase [SAR86 cluster bacteri...   
. . Enterobacter sp. MGH 14....................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: farnesyl diphosphate syntha...   
. . Enterobacter cloacae UCICRE 5................. 119  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [En...   
. . Enterobacter hormaechei....................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Enterobacter hor...   
. . Aeromonas diversa............................. 119  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: Geranyltranstransferase [Aeromonas diversa]    
. . Enterobacter cloacae ECNIH3................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Enterobacter cloacae ECNIH3]   
. . Haemophilus pittmaniae........................ 119  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus pitt...   
. . Enterobacter cloacae BIDMC 8.................. 119  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyl transferase [Entero...   
. . Enterobacteriaceae............................ 119  1e-28  7 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: farnesyl diphosphate syntha...   
. . Cronobacter turicensis z3032.................. 119  1e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Cronobacter turi...   
. . Haemophilus haemolyticus M21639............... 119  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus haem...   
. . Legionella pneumophila str. Lens.............. 119  1e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: geranyltranstransferase [Legionella pneum...   
. . Cronobacter sakazakii......................... 119  1e-28  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Octaprenyl-diphosphate synthase / Dimethy...   
. . Legionella pneumophila subsp. pneumophila..... 119  1e-28  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: geranyltranstransferase [Legionella pneum...   
. . Xylella fastidiosa subsp. sandyi Ann-1........ 119  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: Polyprenyl synthetase [Xylella fastidiosa]     
. . Cronobacter sakazakii ATCC BAA-894............ 119  1e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Cronobacter saka...   
. . Enterobacter cloacae subsp. cloacae NCTC 9394. 119  1e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . Enterobacter cloacae subsp. cloacae ENHKU01... 119  1e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [En...   
. . Pseudomonas mendocina......................... 119  1e-28  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Aeromonas sp. MDS 7B(R)....................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyltranstransferase [Staphylococcus s...   
. . Cronobacter................................... 119  1e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: Octaprenyl-diphosphate synt...   
. . Tatlockia micdadei............................ 119  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: Geranyltranstransferase [Tatlockia micdadei]       
. . Cronobacter dublinensis....................... 119  1e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Octaprenyl-diphosphate synthase / Dimethy...   
. . Enterobacter sp. BIDMC 29..................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Enterobacter sp...   
. . Enterobacter sp. DC1.......................... 119  1e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Enterobacter sp. DC1]     
. . Enterobacter.................................. 119  2e-28  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyl transferase [Entero...   
. . Enterobacter sp. MGH 24....................... 119  2e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: farnesyl diphosphate syntha...   
. . Aeromonas molluscorum......................... 119  2e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: Geranyltranstransferase [Aeromonas mollus...   
. . Enterobacter asburiae L1...................... 119  2e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Enterobacter asburiae]    
. . Enterobacter sp. SST3......................... 119  2e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [En...   
. . Cronobacter dublinensis 1210.................. 119  3e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Octaprenyl-diphosphate synthase / Dimethylall...   
. . Spiribacter sp. UAH-SP71...................... 118  2e-28  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [Spiribacter sp. UAH...   
. . Cronobacter condimenti........................ 118  2e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Octaprenyl-diphosphate synthase / Dimethy...   
. . Dickeya....................................... 118  2e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Di...   
. . Pseudomonas pseudoalcaligenes................. 118  2e-28  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Haemophilus influenzae CGSHiCZ412602.......... 118  2e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: Octaprenyl diphosphate synthase [Haemophilus i...   
. . Lysobacter capsici AZ78....................... 118  2e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Lysobacter caps...   
. . Enterobacter mori............................. 118  2e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Enterobacter mori]    
. . Haemophilus influenzae 10810.................. 118  3e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus infl...   
. . Haemophilus influenzae NT127.................. 118  3e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus infl...   
. . Pseudomonas syringae group genomosp. 3........ 118  3e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Leclercia adecarboxylata...................... 118  3e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Leclercia adecarboxy...   
. . Haemophilus influenzae F3031.................. 118  3e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus infl...   
. . Haemophilus parainfluenzae HK262.............. 118  3e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus para...   
. . Legionella pneumophila subsp. pneumophila str.  118  3e-28  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: geranyltranstransferase [Legionella pneum...   
. . Enhydrobacter aerosaccus...................... 118  4e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Enhydrobac...   
. . Legionella pneumophila subsp. pneumophila LPE50 117  3e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: Octaprenyl diphosphate synthase [Legionel...   
. . Haemophilus influenzae RdAW................... 117  3e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus infl...   
. . Haemophilus influenzae PittHH................. 117  3e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus infl...   
. . Pasteurella bettyae........................... 117  4e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Pasteurella bett...   
. . Haemophilus influenzae 22.1-21................ 117  4e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus infl...   
. . Haemophilus influenzae R3021.................. 117  4e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus infl...   
. . Thioflavicoccus mobilis....................... 117  4e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: geranylgeranyl pyrophosphate synthase [Th...   
. . Proteus penneri............................... 117  4e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Proteus penneri]      
. . Legionella pneumophila str. Corby............. 117  5e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: geranyltranstransferase [Legionella pneum...   
. . Luminiphilus syltensis........................ 117  5e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: farnesyl-diphosphate synthase [Luminiphil...   
. . Alkanindiges illinoisensis.................... 117  5e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Alkanindiges illinoi...   
. . Pseudomonas viridiflava....................... 117  5e-28  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas viridifl...   
. . Haemophilus influenzae 86-028NP............... 117  5e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus infl...   
. . Haemophilus haemolyticus M19501............... 117  5e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus haem...   
. . Pseudomonas mendocina NK-01................... 117  5e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Aeromonas hydrophila HZM...................... 117  5e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyl transferase [Aeromonas hydrophila HZM]      
. . Pseudomonas viridiflava UASWS0038............. 117  5e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyltranstransferase [Pseudomonas viri...   
. . Enterobacter cloacae subsp. cloacae ATCC 13047 117  5e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Enterobacter clo...   
. . Legionella pneumophila str. Paris............. 117  6e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: geranyltranstransferase [Legionella pneum...   
. . Enterobacter cloacae subsp. dissolvens SDM.... 117  6e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [En...   
. . Legionella wadsworthii........................ 117  6e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: geranyl transferase [Legionella wadsworthii]   
. . Mangrovibacter sp. MFB070..................... 117  6e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Mangrovibacter sp. MFB070]     
. . Pseudomonas mendocina S5.2.................... 117  6e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas mendocina]         
. . Mannheimia succiniciproducens................. 117  6e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [ [Mannheimia suc...   
. . Proteus vulgaris.............................. 117  6e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Proteus vulgaris]    
. . Cronobacter pulveris.......................... 117  6e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Cronobacter pulveris]     
. . gamma proteobacterium SCGC AAA168-P09......... 117  6e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: hypothetical protein [gamma proteobacteri...   
. . Haemophilus influenzae KR494.................. 117  7e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: farnesyl diphosphate synthase [Haemophilu...   
. . Beggiatoa sp. PS.............................. 117  7e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: Polyprenyl synthetase [Beggiatoa sp. PS]            
. . Cellvibrio japonicus.......................... 117  7e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Cellvibrio...   
. . Enterobacter cloacae BWH 31................... 117  7e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Enterobact...   
. . Aeromonas caviae.............................. 117  7e-28  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyl transferase [Aeromonas caviae]              
. . Photobacterium aphoticum...................... 117  7e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Vibrionales: octaprenyl-diphosphate synthase synthetase [P...   
. . Azotobacter vinelandii........................ 116  8e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Azotobacte...   
. . Haemophilus haemolyticus M21621............... 116  9e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus haem...   
. . Enterobacter cloacae BWH 29................... 116  9e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Enterobact...   
. . Haemophilus haemolyticus M19107............... 116  9e-28  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus haem...   
. . Stenotrophomonas rhizophila................... 116  1e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: geranyl transferase [Stenotrophomonas rhizophila]   
. . Arenimonas donghaensis DSM 18148.............. 116  1e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: hypothetical protein N788_07945 [Arenimonas do...   
. . Pseudomonas syringae pv. glycinea str. race 4. 116  1e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyltranstransferase [Pseudomonas syringae ...   
. . Serratia...................................... 116  1e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Se...   
. . Xylella fastidiosa PLS229..................... 116  1e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Xylella fastidi...   
. . Pseudomonas savastanoi........................ 116  1e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Haemophilus sp. oral taxon 851................ 116  1e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus sp. ...   
. . Pseudomonas amygdali.......................... 116  1e-27  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Histophilus somni............................. 116  1e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Histophilus somni]    
. . Pseudomonas syringae group genomosp. 2........ 116  1e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . Pseudomonas mendocina ymp..................... 116  1e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Haemophilus somnus 129PT...................... 116  1e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Histophilus somni]    
. . Pseudomonas syringae.......................... 116  1e-27  36 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas syringae]     
. . Pseudomonas syringae pv. lachrymans str. M30227 116  1e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Enterobacter cancerogenus..................... 116  1e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Enterobacter can...   
. . Aeromonas sp. AE122........................... 116  1e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyl transferase [Aeromonas sp. AE122]      
. . Enterobacter sp. R4-368....................... 116  2e-27  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Enterobacter sp....   
. . Serratia plymuthica........................... 116  2e-27  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Serratia plymuth...   
. . Xylella fastidiosa 6c......................... 115  2e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Xylella fa...   
. . Xanthomonas albilineans....................... 115  2e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Xanthomona...   
. . Rheinheimera texasensis....................... 115  2e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: geranyl transferase [Rheinheimera texasen...   
. . Aeromonas hydrophila ML09-119................. 115  2e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyltranstransferase [Aeromonas hydrop...   
. . gamma proteobacterium WG36.................... 115  2e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: geranyl transferase [gamma proteobacteriu...   
. . Thiomicrospira arctica........................ 115  2e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: hypothetical protein [Thiomicrospira arct...   
. . Cronobacter sp. 1383.......................... 115  2e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Cronobacter sp. 1383]     
. . Legionella cherrii............................ 115  2e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: geranyl transferase [Legionella cherrii]       
. . Pseudomonas chlororaphis...................... 115  2e-27  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: hypothetical protein [Pseudomonas chloror...   
. . Pseudomonas thermotolerans.................... 115  2e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas thermoto...   
. . Pseudomonas mendocina AD6..................... 115  3e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas pseudoalcalig...   
. . Aeromonas dhakensis........................... 115  3e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyltranstransferase [Aeromonas hydrop...   
. . Haemophilus haemolyticus HK386................ 115  3e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pasteurellales: geranyltranstransferase [Haemophilus haem...   
. . Pseudomonas syringae BRIP34881................ 115  3e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: polyprenyl synthetase [Pseudomonas syringae]   
. . Pseudomonas syringae pv. actinidiae ICMP 19097 115  3e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas syringae pv. actinidiae ICMP 19073 115  3e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyltranstransferase [Pseudomonas syri...   
. . Serratia odorifera 4Rx13...................... 115  3e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Serratia plymuth...   
. . Pseudomonas syringae pv. actinidiae str. M30209 115  3e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Beggiatoa alba................................ 115  3e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: farnesyl-diphosphate synthase [Beggiatoa ...   
. . Pseudomonas syringae pv. oryzae str. 1_6...... 115  3e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Xylella fastidiosa 9a5c....................... 115  4e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Xylella fa...   
. . Serratia liquefaciens......................... 115  4e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Serratia liquefa...   
. . Thiothrix nivea............................... 115  4e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: farnesyl-diphosphate synthase [Thiothrix ...   
. . Serratia proteamaculans....................... 115  4e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Serratia proteam...   
. . Pseudomonas syringae pv. phaseolicola 1448A... 114  4e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Cellvibrio sp. BR............................. 114  4e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Cellvibrio...   
. . gamma proteobacterium Hiromi1................. 114  4e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: farnesyl diphosphate synthase [gamma proteoba...   
. . Yersinia intermedia........................... 114  5e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Yersinia interme...   
. . Lysobacter concretionis DSM 16239............. 114  5e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: geranyl transferase [Lysobacter concretionis K...   
. . Endozoicomonas numazuensis.................... 114  5e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: geranyl transferase [Endozoicomonas numazuensis]    
. . Serratia liquefaciens FK01.................... 114  5e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Serratia liquefacien...   
. . Pseudomonas sp. 12M76_air..................... 114  5e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyltranstransferase [Pseudomonas sp. 12M7...   
. . Pseudomonas avellanae......................... 114  6e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyltranstransferase [Pseudomonas avel...   
. . Pseudomonas syringae pv. pisi str. 1704B...... 114  6e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: polyprenyl synthetase [Pseudomonas syringae pv...   
. . Serratia marcescens........................... 114  6e-27  9 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranylgeranyl pyrophosphate synthase [Se...   
. . gamma proteobacterium SCGC AB-629-P17......... 114  6e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: farnesyl-diphosphate synthase [gamma prot...   
. . Simiduia agarivorans.......................... 114  6e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: farnesyl-diphosphate synthase [Simiduia a...   
. . Pseudomonas syringae pv. avellanae str. ISPaVe0 114  6e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas syringae pv. maculicola str. ES4326 114  6e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Enterobacter cloacae subsp. dissolvens SP1.... 114  6e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Enterobacter cloacae subs...   
. . Pseudomonas syringae pv. japonica str. M301072P 114  6e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: polyprenyl synthetase [Pseudomonas syringae pv...   
. . Pseudomonas syringae pv. syringae............. 114  6e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas syringae]     
. . Enterobacter aerogenes........................ 114  6e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Enterobacter aer...   
. . Pseudomonas syringae CC1557................... 114  6e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas syringae]     
. . Pseudomonas syringae pv. syringae B728a....... 114  7e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Yersinia rohdei............................... 114  7e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Yersinia rohdei]      
. . Serratia grimesii............................. 114  7e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Serratia grimesii]             
. . Acidithiobacillus ferrooxidans................ 114  7e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: farnesyl-diphosphate synthase [Acidithiob...   
. . Pseudomonas syringae pv. morsprunorum str. M302 114  7e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas syringae pv. actinidiae ICMP 19098 114  7e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Ignatzschineria larvae........................ 114  8e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: hypothetical protein [Ignatzschineria lar...   
. . Pseudomonas syringae BRIP39023................ 114  8e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: polyprenyl synthetase [Pseudomonas syringae]   
. . Neptuniibacter caesariensis................... 114  8e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: farnesyl-diphosphate synthase [Neptuniiba...   
. . Pseudomonas syringae pv. syringae SM.......... 114  8e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: polyprenyl synthetase [Pseudomonas syringae]   
. . Enterobacter gergoviae........................ 114  8e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Pluralibacter gergoviae]       
. . Pseudomonas syringae pv. avellanae str. ISPaVe0 114  8e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pectobacterium carotovorum subsp. carotovorum. 114  9e-27  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Pectobacterium carotovoru...   
. . Pseudomonas................................... 114  9e-27  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: geranylgeranyl pyrophosphat...   
. . Luteimonas sp. J29............................ 114  9e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: geranyl transferase [Luteimonas sp. J29]       
. . Serratia sp. S4............................... 114  9e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Serratia sp. S4]      
. . Lysobacter sp. URHA0019....................... 114  9e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: geranyl transferase [Lysobacter sp. URHA0...   
. . Pseudomonas syringae Cit 7.................... 114  9e-27  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas veronii........................... 114  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Escherichia coli O174:H21 str. 03-3269........ 114  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Escherichia coli]         
. . Rahnella aquatilis............................ 114  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Rahnella aquatilis]   
. . Escherichia vulneris NBRC 102420.............. 114  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichia vu...   
. . Yersinia aldovae.............................. 114  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Yersinia aldovae]     
. . Escherichia coli O39:NM str. F8704-2.......... 114  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Escherichia coli]         
. . Alcanivorax sp. DG881......................... 114  1e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: farnesyl-diphosphate synthase [Alcanivora...   
. . Pectobacterium atrosepticum................... 114  1e-26  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Pectobacterium a...   
. . Legionella fallonii LLAP-10................... 114  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: Farnesyl diphosphate synthase [Legionella fal...   
. . Shigella flexneri............................. 113  1e-26  7 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Shigella flexneri]    
. . Escherichia coli B088......................... 113  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia coli]     
. . Escherichia coli 907710....................... 113  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: polyprenyl synthetase [Escherichia coli]       
. . Pectobacterium betavasculorum................. 113  1e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Pectobacterium betavascul...   
. . Kangiella aquimarina.......................... 113  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: farnesyl-diphosphate synthase [Kangiella ...   
. . Escherichia coli P0304777.15.................. 113  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Escherichia coli P0299917.7................... 113  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Escherichia coli 2788150...................... 113  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Moraxella caprae.............................. 113  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Moraxella ...   
. . Escherichia coli E24377A...................... 113  1e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [En...   
. . Shigella dysenteriae CDC 74-1112.............. 113  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [En...   
. . Thiothrix lacustris........................... 113  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: geranyl transferase [Thiothrix lacustris]      
. . Kluyvera ascorbata ATCC 33433................. 113  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: polyprenyl synthetase [Kluyvera ascorbata ATCC...   
. . Escherichia coli 908675....................... 113  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: polyprenyl synthetase [Escherichia coli]       
. . Shigella flexneri VA-6........................ 113  1e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Shigella flexneri]    
. . Shigella flexneri 2a str. 301................. 113  1e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Shigella flexneri]    
. . Escherichia coli KTE142....................... 113  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Serratia sp. M24T3............................ 113  2e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Serratia sp. M24T3]   
. . Pectobacterium carotovorum.................... 113  2e-26  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Pectobacterium c...   
. . Legionella longbeachae........................ 113  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: geranyltranstransferase [Legionella longb...   
. . Shigella flexneri J1713....................... 113  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Shigella flexneri]    
. . Pectobacterium carotovorum subsp. odoriferum.. 113  2e-26  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Pectobacterium carotovoru...   
. . Marinomonas ushuaiensis DSM 15871............. 113  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: farnesyl-diphosphate synthase [Marinomonas ush...   
. . Escherichia coli APEC O1...................... 113  2e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia coli]     
. . Yersinia kristensenii ATCC 33638.............. 113  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Geranyltranstransferase [Yersinia kristensenii...   
. . Pseudomonas fuscovaginae...................... 113  2e-26  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Escherichia................................... 113  2e-26  7 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Es...   
. . Escherichia coli 536.......................... 113  2e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia coli]     
. . Kangiella koreensis........................... 113  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: farnesyl-diphosphate synthase [Kangiella ...   
. . Cronobacter helveticus........................ 113  2e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Cronobacter helveticus]   
. . Acidithiobacillus thiooxidans................. 113  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: farnesyl-diphosphate synthase [Acidithiob...   
. . Rahnella...................................... 113  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Ra...   
. . Escherichia coli UTI89........................ 113  2e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Es...   
. . Thiomicrospira halophila...................... 113  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: hypothetical protein [Thiomicrospira halo...   
. . Dickeya zeae.................................. 113  2e-26  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Dickeya zeae]         
. . Yersinia enterocolitica....................... 113  2e-26  11 hits Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Yersinia enteroc...   
. . Ewingella americana ATCC 33852................ 113  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: polyprenyl synthetase [Ewingella americana ATC...   
. . Pseudomonas chlororaphis O6................... 113  7e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: isopentenyl-diphosphate delta-isomerase/g...   
. . Escherichia coli WV_060327.................... 112  2e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia coli]     
. . Pseudomonas cichorii JBC1..................... 112  3e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: polyprenyl synthetase [Pseudomonas cichorii JBC1]   
. . Pseudomonas luteola........................... 112  3e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: hypothetical protein [Pseudomonas luteola]     
. . Pseudomonas extremaustralis................... 112  3e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas stutzeri.......................... 112  3e-26  12 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas fluorescens....................... 112  3e-26  8 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Alcanivorax hongdengensis..................... 112  3e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: farnesyl-diphosphate synthase [Alcanivora...   
. . Aeromonas..................................... 112  3e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: MULTISPECIES: geranyltranstransferase [Ae...   
. . Pseudomonas fluorescens LMG 5329.............. 112  3e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas fluorescens L...   
. . Pseudomonas sp. HPB0071....................... 112  3e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: hypothetical protein [Pseudomonas sp. HPB...   
. . Pseudomonas brassicacearum.................... 112  3e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas brassicacearum]    
. . Pseudomonas sp. P818.......................... 112  4e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas sp. P818]     
. . Salmonella enterica subsp. arizonae serovar 62: 112  4e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Salmonella enterica s...   
. . Pseudomonas sp. 2-92(2010).................... 112  4e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas sp. 2-92...   
. . Serratia marcescens BIDMC 80.................. 112  4e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Serratia marces...   
. . Serratia nematodiphila........................ 112  4e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Serratia nematodiphila]        
. . Pseudomonas sp. GM16.......................... 112  4e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . Pseudomonas syringae pv. aptata str. DSM 50252 112  4e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: polyprenyl synthetase [Pseudomonas syringae pv...   
. . Pseudomonas sp. CBZ-4......................... 112  4e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Serratia marcescens EGD-HP20.................. 112  4e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Serratia marcesc...   
. . Serratia marcescens subsp. marcescens Db11.... 112  4e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Serratia marcescens ...   
. . Pectobacterium wasabiae....................... 112  4e-26  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Pectobacterium w...   
. . Escherichia coli 2785200...................... 112  5e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Serratia marcescens BIDMC 81.................. 112  5e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Serratia marces...   
. . Salmonella bongori............................ 112  5e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Salmonella bongori]   
. . Legionella sainthelensi....................... 112  5e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: geranyl transferase [Legionella sainthele...   
. . Serratia marcescens BIDMC 50.................. 112  5e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Serratia marces...   
. . Escherichia coli HVH 21 (4-4517873)........... 112  5e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Yersinia enterocolitica LC20.................. 112  5e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Geranyltranstransferase [Yersinia enterocoliti...   
. . Escherichia coli ATCC 35150................... 112  5e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia coli]     
. . Escherichia coli SWW33........................ 112  5e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Balneatrix alpica............................. 112  5e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: geranyl transferase [Balneatrix alpica]        
. . Alcanivorax sp. P2S70......................... 112  5e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: farnesyl-diphosphate synthase [Alcanivora...   
. . Escherichia coli KTE19........................ 112  5e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Cronobacter sp. FGI57......................... 112  5e-26  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranylgeranyl pyrophosphate synthase [En...   
. . Escherichia coli ED1a......................... 112  6e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia coli]     
. . Yersinia frederiksenii........................ 112  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Yersinia frederi...   
. . Escherichia coli HVH 198 (4-3206106).......... 112  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Escherichia coli 2-052-05_S4_C3............... 112  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Escherichia coli]         
. . Escherichia coli 2-052-05_S3_C1............... 112  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Escherichia coli]         
. . Escherichia coli 1-176-05_S1_C1............... 112  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Escherichia coli]         
. . Escherichia coli NC101........................ 112  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Es...   
. . Escherichia coli O127:H6 str. E2348/69........ 112  6e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia coli]     
. . Escherichia coli 2-005-03_S4_C3............... 112  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Escherichia coli]         
. . Escherichia coli O157:H7 str. EDL933.......... 112  6e-26  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia coli]     
. . Escherichia coli MP021561.2................... 112  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Escherichia coli 4_1_47FAA.................... 112  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia coli]     
. . Pseudomonas sp. BAY1662....................... 112  8e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyltranstransferase [Pseudomonas sp. BAY1663]   
. . Klebsiella.................................... 111  6e-26  7 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Kl...   
. . Shigella...................................... 111  6e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Sh...   
. . Escherichia coli UMEA 3955-1.................. 111  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Escherichia coli P0305260.15.................. 111  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Escherichia coli STEC_MHI813.................. 111  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia coli]     
. . Escherichia coli O128:H2 str. 2011C-3317...... 111  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Escherichia coli O128:H2 ...   
. . Escherichia coli NA114........................ 111  6e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia coli]     
. . Escherichia coli HVH 177 (4-2876612).......... 111  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Escherichia coli UMEA 3718-1.................. 111  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Escherichia coli str. K-12 substr. MG1655..... 111  6e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [En...   
. . Escherichia coli P0301867.3................... 111  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Escherichia coli P0305260.3................... 111  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Escherichia coli 2848050...................... 111  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Escherichia coli MP021017.3................... 111  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Escherichia coli DEC2A........................ 111  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia coli]     
. . Escherichia coli 201600.1..................... 111  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Pseudomonas knackmussii B13................... 111  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: Geranylgeranyl pyrophosphate synthase,chlorop...   
. . Escherichia coli 180050....................... 111  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: farnesyl diphosphate syntha...   
. . Escherichia fergusonii........................ 111  6e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia ferg...   
. . Escherichia coli BWH 32....................... 111  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Pectobacterium carotovorum subsp. brasiliense. 111  6e-26  5 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Pectobacterium carotovoru...   
. . Escherichia coli 2-427-07_S4_C3............... 111  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Escherichia coli]         
. . Escherichia coli CHS 77....................... 111  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Escherichia coli]         
. . Escherichia coli BCE008_MS-01................. 111  6e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . gamma proteobacterium BDW918.................. 111  7e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: farnesyl-diphosphate synthase [gamma prot...   
. . Escherichia fergusonii B253................... 111  7e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Es...   
. . Escherichia coli E1520........................ 111  7e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia coli]     
. . Pseudomonas taeanensis........................ 111  7e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas taeanensis]   
. . Pseudomonas nitroreducens..................... 111  7e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas nitrored...   
. . Shigella boydii............................... 111  7e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Shigella boydii]      
. . gamma proteobacterium SCGC AAA007-O20......... 111  7e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: farnesyl-diphosphate synthase [gamma prot...   
. . Serratia fonticola............................ 111  7e-26  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Serratia fonticola]       
. . Serratia fonticola RB-25...................... 111  7e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Serratia fonticola]       
. . Escherichia fergusonii ECD227................. 111  7e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia ferg...   
. . Escherichia coli 3-475-03_S1_C2............... 111  8e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Escherichia coli]         
. . Serratia marcescens SM39...................... 111  8e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Serratia marcescens ...   
. . Serratia sp. Ag2.............................. 111  8e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Serratia sp. Ag2]              
. . Pseudomonas moraviensis....................... 111  8e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas stutzeri MF28..................... 111  8e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Escherichia coli B354......................... 111  8e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia coli]     
. . Escherichia coli KTE9......................... 111  8e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Citrobacter sp. MGH 55........................ 111  8e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Citrobacter sp....   
. . Dickeya dadantii.............................. 111  8e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Dickeya dadantii]     
. . Pseudomonas tolaasii.......................... 111  8e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas putida............................ 111  8e-26  13 hits Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: polyprenyl synthetase [Pseudomonas putida]     
. . Shigella dysenteriae 1012..................... 111  8e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Sh...   
. . Pectobacterium carotovorum subsp. carotovorum P 111  8e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Pectobacterium c...   
. . Escherichia coli B093......................... 111  9e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia coli]     
. . Escherichia coli KTE75........................ 111  9e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Escherichia coli MS 21-1...................... 111  9e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia coli]     
. . Pseudomonas sp. GM21.......................... 111  9e-26  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Escherichia coli M863......................... 111  9e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia coli]     
. . Serratia fonticola AU-P3(3)................... 111  9e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Octaprenyl-diphosphate synthase [Serratia...   
. . Pseudomonas sp. 20_BN......................... 111  9e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyltranstransferase [Pseudomonas sp. 20_BN]    
. . Escherichia coli 2-474-04_S1_C2............... 111  9e-26  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Escherichia coli]         
. . Salmonella enterica........................... 111  1e-25  21 hits Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Salmonella enter...   
. . Escherichia coli P0305260.4................... 111  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Escherichia coli 2730450...................... 111  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Xanthomonas oryzae............................ 111  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Xanthomona...   
. . Salmonella bongori N268-08.................... 111  1e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Dimethylallyl transferase [Salmonella bon...   
. . Klebsiella oxytoca M5al....................... 111  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Kl...   
. . Serratia marcescens WW4....................... 111  1e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Serratia marcesc...   
. . Pseudomonas chlororaphis subsp. aureofaciens 30 110  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Salmonella bongori serovar 48:z41:-- str. RKS30 110  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Salmonella bongori se...   
. . Pseudomonas sp. MT-1.......................... 110  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyltranstransferase [Pseudomonas sp. MT-1]     
. . Pseudomonas vranovensis....................... 110  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas vranoven...   
. . Pseudomonas sp. CHM02......................... 110  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas sp. CHM02]    
. . Pseudomonas putida S610....................... 110  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyltranstransferase [Pseudomonas putida]   
. . Edwardsiella ictaluri......................... 110  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Edwardsiella ict...   
. . Yersinia enterocolitica (type O:9) str. YE56/03 110  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Yersinia enteroc...   
. . Pectobacterium sp. SCC3193.................... 110  1e-25  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Geranyltranstransferase [Pectobacterium s...   
. . Serratia sp. DD3.............................. 110  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Serratia sp. DD3]    
. . Yersinia enterocolitica subsp. palearctica Y11 110  1e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Yersinia enteroc...   
. . Yersinia enterocolitica subsp. enterocolitica W 110  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Yersinia enteroc...   
. . Yersinia enterocolitica (type O:2) str. YE3094/ 110  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Yersinia enterocolit...   
. . Pseudomonas sp. URMO17WK12:I12................ 110  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas sp. URMO...   
. . Pectobacterium wasabiae WPP163................ 110  1e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Pectobacterium w...   
. . Escherichia coli 2-011-08_S1_C1............... 110  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Escherichia coli]         
. . Dickeya dianthicola........................... 110  1e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Dickeya dianthic...   
. . Yersinia similis.............................. 110  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Yersinia similis]              
. . Providencia rettgeri.......................... 110  1e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Providencia rett...   
. . Klebsiella pneumoniae 700603.................. 110  1e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Kl...   
. . Klebsiella oxytoca............................ 110  2e-25  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Klebsiella oxytoca]       
. . Klebsiella oxytoca KCTC 1686.................. 110  2e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Kl...   
. . Salmonella enterica subsp. arizonae serovar 62: 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Salmonella enter...   
. . Pseudomonas stutzeri DSM 4166................. 110  2e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Yersinia pestis............................... 110  2e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Yersinia pestis]      
. . Endozoicomonas montiporae..................... 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: geranyl transferase [Endozoicomonas montiporae]     
. . Cycloclasticus pugetii........................ 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: farnesyl-diphosphate synthase [Cycloclast...   
. . Cycloclasticus sp. P1......................... 110  2e-25  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: farnesyl-diphosphate synthase [Cycloclast...   
. . Yersinia pseudotuberculosis................... 110  2e-25  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Yersinia pseudot...   
. . Yersinia pseudotuberculosis YPIII............. 110  2e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Yersinia pseudot...   
. . Pseudomonas alkylphenolia..................... 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: polyprenyl synthetase [Pseudomonas alkylphenolia]   
. . Sedimenticola selenatireducens................ 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: geranyl transferase [Sedimenticola selena...   
. . Acinetobacter ursingii........................ 110  2e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyltranstransferase [Acinetobacter ur...   
. . Pectobacterium carotovorum subsp. carotovorum P 110  2e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Pectobacterium c...   
. . Moraxella macacae............................. 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: polyprenyl synthetase [Moraxella macacae]      
. . Cycloclasticus sp. PY97M...................... 110  2e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: polyprenyl synthetase [Cycloclasticus sp....   
. . Pseudomonas sp. AAC........................... 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas sp. AAC]           
. . Citrobacter rodentium......................... 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Citrobacter rode...   
. . Salmonella enterica subsp. enterica serovar Mue 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Salmonella enter...   
. . Xanthomonas sp. SHU199........................ 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Xanthomona...   
. . Candidatus Riesia pediculicola................ 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Candidatus Riesi...   
. . Pseudomonas sp. M1............................ 110  2e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyltranstransferase [Pseudomonas sp. M1]   
. . Providencia rettgeri DSM 1131................. 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Providencia rett...   
. . Citrobacter werkmanii NBRC 105721............. 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Citrobacter we...   
. . Xanthomonas sp. SHU308........................ 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Xanthomona...   
. . Cycloclasticus zancles........................ 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: Geranylgeranyl pyrophosphate synthase [Cy...   
. . Thiothrix flexilis............................ 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: hypothetical protein [Thiothrix flexilis]      
. . Klebsiella oxytoca 10-5243.................... 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Kl...   
. . Escherichia coli UMEA 3014-1.................. 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Escherichia coli KTE81........................ 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Providencia rustigianii....................... 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Providencia rust...   
. . Serratia marcescens subsp. marcescens ATCC 1388 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: octaprenyl diphosphate synthase/dimethylallylt...   
. . Salmonella enterica subsp. enterica serovar New 110  2e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Salmonella enter...   
. . Tolumonas sp. BRL6-1.......................... 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyl transferase [Tolumonas sp. BRL6-1]     
. . Enterobacter lignolyticus..................... 110  2e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Enterobacter lig...   
. . Salmonella enterica subsp. enterica serovar Bar 110  3e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Salmonella enter...   
. . Serratia marcescens VGH107.................... 110  3e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Serratia marcesc...   
. . Yersinia kristensenii......................... 110  3e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: polyprenyl synthetase family protein [Yersinia...   
. . Halotalea alkalilenta......................... 110  3e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: geranyl transferase [Halotalea alkalilenta]    
. . Escherichia coli KTE11........................ 110  3e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Es...   
. . Escherichia coli CFT073....................... 110  3e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia coli]     
. . Escherichia coli KTE94........................ 110  3e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Dickeya zeae Ech1591.......................... 110  3e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Dickeya zeae]         
. . uncultured Thiohalocapsa sp. PB-PSB1.......... 109  3e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: hypothetical protein [uncultured Thiohalo...   
. . Escherichia coli HVH 190 (4-3255514).......... 109  3e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Pseudomonas sp. GM80.......................... 109  3e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Yersinia enterocolitica subsp. palearctica 105. 109  3e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Yersinia enteroc...   
. . Pseudomonas sp. RIT357........................ 109  3e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas sp. RIT357]   
. . Raoultella.................................... 109  3e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyl transferase [Raoult...   
. . Raoultella ornithinolytica B6................. 109  3e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [En...   
. . marine gamma proteobacterium HTCC2080......... 109  3e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: farnesyl-diphosphate synthase [marine gam...   
. . Pseudomonas sp. PH1b.......................... 109  3e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas sp. PH1b]     
. . Edwardsiella tarda 080813..................... 109  3e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Octaprenyl diphosphate synthase / Dimethylally...   
. . Pseudomonas sp. GM30.......................... 109  4e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Edwardsiella piscicida........................ 109  4e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Edwardsiella piscicida]   
. . Klebsiella oxytoca 10-5250.................... 109  4e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Klebsiella oxytoca]   
. . Escherichia coli 3431......................... 109  4e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia coli]     
. . Erwinia chrysanthemi.......................... 109  4e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Erwinia chrysanthemi]     
. . Salmonella enterica subsp. enterica serovar Min 109  4e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Geranyltranstransferase [Salmonella enterica s...   
. . Dickeya dadantii Ech586....................... 109  4e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Dickeya dadantii]     
. . Escherichia coli O86:H34 str. 99-3124......... 109  4e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Escherichia coli]         
. . Salmonella enterica subsp. enterica serovar Pom 109  4e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Salmonella enter...   
. . gamma proteobacterium SCGC AAA076-E13......... 109  4e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: hypothetical protein [gamma proteobacteri...   
. . Xanthomonas sacchari.......................... 109  4e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Xanthomona...   
. . gamma proteobacterium SCGC AAA076-D02......... 109  4e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: hypothetical protein [gamma proteobacteri...   
. . Yersinia enterocolitica (type O:5) str. YE53/03 109  4e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Yersinia enteroc...   
. . Edwardsiella.................................. 109  4e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Ed...   
. . Pseudomonas agarici........................... 109  4e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Salmonella enterica subsp. enterica serovar Typ 109  4e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Salmonella enter...   
. . Salmonella enterica subsp. enterica serovar Typ 109  4e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Salmonella enter...   
. . Salmonella enterica subsp. enterica serovar Tal 109  5e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Salmonella enter...   
. . Pseudomonas sp. TJI-51........................ 109  5e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . Dasania marina................................ 109  5e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: hypothetical protein [Dasania marina]          
. . Acinetobacter ursingii NIPH 706............... 109  5e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: hypothetical protein [Acinetobacter ursin...   
. . Salmonella enterica subsp. enterica serovar Cho 109  6e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Salmonella enter...   
. . Salmonella enterica subsp. enterica serovar Ago 109  6e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Salmonella enterica ...   
. . Escherichia coli KOEGE 71 (186a).............. 108  6e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Pseudomonas sp. S9............................ 108  6e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Salmonella enterica subsp. enterica serovar Inv 108  6e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Geranyltranstransferase [Salmonella enter...   
. . Citrobacter freundii CFNIH1................... 108  6e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyl transferase [Citrobacter freundii CFNIH1]   
. . Coxiella burnetii............................. 108  6e-25  4 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: polyprenyl synthetase [Coxiella burnetii]      
. . Pseudomonas stutzeri KOS6..................... 108  6e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyltranstransferase [Pseudomonas stut...   
. . Pseudomonas stutzeri subgroup................. 108  6e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . Coxiella burnetii Dugway 5J108-111............ 108  6e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Legionellales: polyprenyl synthetase [Coxiella burnetii]      
. . Acinetobacter sp. ANC 3789.................... 108  6e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: hypothetical protein [Acinetobacter sp. A...   
. . Pseudomonas chloritidismutans AW-1............ 108  7e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomonas chl...   
. . Providencia alcalifaciens..................... 108  7e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Providencia alca...   
. . Pseudomonas sp. CMAA1215...................... 108  7e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas alcaligenes....................... 108  7e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Providencia alcalifaciens DSM 30120........... 108  7e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Providencia alca...   
. . Thiomicrospira pelophila...................... 108  7e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Thiotrichales: geranyl transferase [Thiomicrospira pelop...   
. . Pseudomonas psychrotolerans................... 108  7e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Salmonella enterica subsp. enterica serovar Gal 108  7e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Salmonella enter...   
. . Nitrococcus mobilis........................... 108  7e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: farnesyl-diphosphate synthase [Nitrococcu...   
. . Pseudomonas putida group...................... 108  8e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . Citrobacter farmeri GTC 1319.................. 108  8e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Citrobacter fa...   
. . Pseudomonas stutzeri NF13..................... 108  8e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyltranstransferase [Pseudomonas stut...   
. . Pseudomonas sp. CF149......................... 108  9e-25  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyltranstransferase [Pseudomonas sp. ...   
. . Thioalkalivibrio nitratireducens.............. 108  9e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: Octaprenyl-diphosphate synthase / Dimethy...   
. . Escherichia coli KTE33........................ 108  9e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Es...   
. . gamma proteobacterium SCGC AAA003-E02......... 108  9e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: hypothetical protein [Gammaproteobacteria...   
. . Marinomonas posidonica........................ 108  9e-25  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: farnesyl-diphosphate synthase [Marinomona...   
. . Citrobacter sp. A1............................ 108  1e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [En...   
. . Pseudomonas mosselii.......................... 108  1e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas mosselii]     
. . Pseudomonas sp. StFLB209...................... 108  1e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyltranstransferase [Pseudomonas sp. StFL...   
. . Pseudomonas fluorescens Pf0-1................. 108  1e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Citrobacter................................... 108  1e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Ci...   
. . Klebsiella sp. MS 92-3........................ 108  1e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Kl...   
. . Zymobacter palmae............................. 108  1e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: geranyl transferase [Zymobacter palmae]        
. . Providencia stuartii.......................... 108  1e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Providencia stua...   
. . Klebsiella pneumoniae subsp. pneumoniae MGH 785 108  1e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Kl...   
. . Pseudomonas fluorescens SBW25................. 108  1e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Citrobacter koseri............................ 108  1e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Citrobacter koseri]       
. . Citrobacter freundii MGH 56................... 108  1e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Citrobacter fre...   
. . Pseudomonas sp. GM25.......................... 108  1e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Klebsiella pneumoniae......................... 108  1e-24  18 hits Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Klebsiella...   
. . Klebsiella pneumoniae subsp. pneumoniae KPNIH2 108  1e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Klebsiella pneum...   
. . Pseudomonas mosselii SJ10..................... 108  1e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas mosselii SJ10]     
. . Escherichia coli 2851500...................... 108  1e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: farnesyl diphosphate synthase [Escherichi...   
. . Escherichia coli 1-176-05_S3_C2............... 108  1e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: geranyltranstransferase [Es...   
. . Pseudomonas stutzeri RCH2..................... 108  1e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranylgeranyl pyrophosphate synthase [Ps...   
. . Hafnia alvei BIDMC 31......................... 108  1e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Klebsiella pneum...   
. . Pseudomonas cremoricolorata................... 108  1e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas cremoricolorata]   
. . Pseudomonas stutzeri ATCC 14405 = CCUG 16156.. 108  1e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas putida W619....................... 108  1e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . marine gamma proteobacterium HTCC2143......... 108  1e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria: farnesyl-diphosphate synthase [marine gam...   
. . Citrobacter freundii.......................... 108  1e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Citrobacter freu...   
. . Pseudomonas stutzeri A1501.................... 108  1e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Providencia sneebia........................... 108  1e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Providencia snee...   
. . Pseudomonas stutzeri ATCC 17588 = LMG 11199... 107  1e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas pseudoalcaligenes KF707........... 107  1e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: Octaprenyl-PP synthase [Pseudomonas pseud...   
. . Trabulsiella guamensis ATCC 49490............. 107  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: octaprenyl diphosphate synthase/dimethylallylt...   
. . Pseudomonas sp. GM84.......................... 107  2e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas denitrificans..................... 107  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyltranstransferase [Pseudomonas deni...   
. . Acinetobacter gerneri......................... 107  2e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: hypothetical protein [Acinetobacter gerneri]   
. . Escherichia albertii.......................... 107  2e-24  3 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia albe...   
. . Pseudomonas alcaligenes NBRC 14159............ 107  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyltranstransferase [Pseudomonas alca...   
. . Pseudomonas sp. RIT288........................ 107  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomonas sp....   
. . Providencia alcalifaciens PAL-3............... 107  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: polyprenyl synthetase [Providencia alcalifacie...   
. . Pseudomonas fluorescens R124.................. 107  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas fulva............................. 107  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas fulva]        
. . Escherichia albertii TW07627.................. 107  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Escherichia albe...   
. . Pseudomonas sp. URMO17WK12:I8................. 107  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas sp. URMO...   
. . Pseudomonas sp. URMO17WK12:I11................ 107  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas sp. URMO...   
. . Pseudomonas sp. URMO17WK12:I3................. 107  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas sp. URMO...   
. . Providencia alcalifaciens 205/92.............. 107  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: polyprenyl synthetase [Providencia alcalifacie...   
. . Edwardsiella tarda............................ 107  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Edwardsiella tarda]   
. . Xanthomonas vesicatoria....................... 107  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Xanthomona...   
. . Pseudomonas fluorescens EGD-AQ6............... 107  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . Citrobacter koseri ATCC BAA-895............... 107  2e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Citrobacter koseri]   
. . Tolumonas auensis............................. 107  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Aeromonadales: geranyltranstransferase [Tolumonas auensis]    
. . Polycyclovorans algicola...................... 107  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: hypothetical protein [Polycyclovorans alg...   
. . Pseudomonas resinovorans...................... 107  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas resinovo...   
. . Pseudomonas sp. LAIL14HWK12:I7................ 107  2e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas sp. LAIL...   
. . Pseudomonas putida H8234...................... 107  2e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas sp. Chol1......................... 107  3e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas sp. MOIL14HWK12:I2................ 107  3e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas sp. MOIL...   
. . Pseudomonas sp. WCS358........................ 107  3e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas sp. WCS358]        
. . Acinetobacter gerneri MTCC 9824............... 107  3e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: Octaprenyl-diphosphate synthase [Acinetob...   
. . Pseudomonas protegens......................... 107  3e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas entomophila....................... 107  3e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Wohlfahrtiimonas chitiniclastica.............. 107  3e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: hypothetical protein [Wohlfahrtiimonas ch...   
. . gamma proteobacterium SCGC AAA076-F14......... 107  3e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria: geranyl transferase [gamma proteobacteriu...   
. . Xanthomonas................................... 107  3e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: MULTISPECIES: farnesyl-diphosphate syntha...   
. . Pseudomonas rhizosphaerae..................... 107  3e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas rhizosphaerae]     
. . Pseudomonas putida KT2440..................... 107  3e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas sp. TS44.......................... 107  3e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas putida DOT-T1E.................... 107  3e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas brenneri FH4...................... 107  3e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas sp. FH4]      
. . Pseudomonas plecoglossicida................... 107  3e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: polyprenyl synthetase [Pseudomonas plecog...   
. . Pseudomonas putida LS46....................... 107  3e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas putida BIRD-1..................... 107  3e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Thioalkalivibrio sp. AKL12.................... 107  3e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: farnesyl-diphosphate synthase [Thioalkali...   
. . Pseudomonas putida ND6........................ 107  3e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas putida F1......................... 107  3e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas sp. HMP271........................ 107  4e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas sp. HMP271]        
. . Thermithiobacillus tepidarius................. 107  4e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Acidithiobacillales: geranyl transferase [Thermithiobacillus t...   
. . Xanthomonas euvesicatoria..................... 106  4e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Xanthomonadales: farnesyl-diphosphate synthase [Xanthomona...   
. . Halomonas anticariensis....................... 106  4e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Oceanospirillales: farnesyl-diphosphate synthase [Halomonas ...   
. . Salmonella enterica subsp. houtenae str. ATCC B 106  4e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: geranyltranstransferase [Salmonella enter...   
. . Citrobacter sp. KTE32......................... 106  4e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: MULTISPECIES: farnesyl diphosphate syntha...   
. . Salmonella enterica subsp. houtenae serovar 50: 106  4e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Geranyltranstransferase [Salmonella enter...   
. . Thioalkalivibrio sp. AKL8..................... 106  4e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: farnesyl-diphosphate synthase [Thioalkali...   
. . Pseudomonas sp. 313........................... 106  4e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Pseudomonas monteilii......................... 106  5e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: farnesyl-diphosphate synthase [Pseudomona...   
. . Providencia burhodogranariea.................. 106  5e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Enterobacteriales: Geranyltranstransferase [Providencia burh...   
. . Thioalkalivibrio sp. AKL6..................... 106  5e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Chromatiales: farnesyl-diphosphate synthase [Thioalkali...   
. . Pseudomonas sp. H2............................ 106  5e-24  1 hit   Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: geranyl transferase [Pseudomonas sp. H2]            
. . Pseudomonas bauzanensis....................... 106  5e-24  2 hits  Bacteria:Proteobacteria:Gammaproteobacteria:Pseudomonadales: hypothetical protein CF98_22295 [Pseudomonas b...   
. . Proteobacteria bacterium JGI 0000113-P07...... 151  1e-40  1 hit   Bacteria:Proteobacteria:                 hypothetical protein [Proteobacteria bact...   
. . Candidatus Magnetoglobus multicellularis str. A 149  3e-40  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria: geranylgeranyl diphosphate synthase, type II [...   
. . delta proteobacterium MLMS-1.................. 143  2e-37  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria: farnesyl-diphosphate synthase [delta prot...   
. . Desulfovibrio cuneatus........................ 135  1e-34  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: polyprenyl synthetase [Desulfovibrio cune...   
. . Geobacter sp. M18............................. 131  4e-33  3 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: farnesyl-diphosphate synthase [Geobacter ...   
. . uncultured Desulfobacterium sp................ 131  4e-33  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: Geranylgeranyl pyrophosphate synthetase, chlo...   
. . Geobacter sp. M21............................. 130  5e-33  3 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: farnesyl-diphosphate synthase [Geobacter ...   
. . Bacteriovorax sp. BAL6_X...................... 130  7e-33  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Bdellovibrionales: polyprenyl synthetase [Bacteriovorax sp. ...   
. . Desulforegula conservatrix.................... 130  7e-33  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: hypothetical protein [Desulforegula conse...   
. . Syntrophobacter fumaroxidans.................. 130  8e-33  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Syntrophobacterales: farnesyl-diphosphate synthase [Syntrophob...   
. . Desulfocurvus vexinensis...................... 129  1e-32  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: polyprenyl synthetase [Desulfocurvus vexi...   
. . Desulfococcus oleovorans...................... 128  6e-32  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: polyprenyl synthetase [Desulfococcus oleo...   
. . Geobacter bemidjiensis........................ 127  6e-32  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: farnesyl-diphosphate synthase [Geobacter ...   
. . Desulfococcus multivorans..................... 127  8e-32  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: Polyprenyl synthetase [Desulfococcus mult...   
. . Geobacter bremensis........................... 126  2e-31  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfuromonadales: polyprenyl synthetase [Geobacter bremensis]    
. . Syntrophus aciditrophicus..................... 126  2e-31  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Syntrophobacterales: farnesyl-diphosphate synthase [Syntrophus...   
. . Desulfatirhabdium butyrativorans.............. 125  5e-31  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: hypothetical protein [Desulfatirhabdium b...   
. . Desulfovibrio desulfuricans................... 125  5e-31  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: polyprenyl synthetase [Desulfovibrio desu...   
. . Desulfobulbus japonicus....................... 125  6e-31  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: farnesyl-diphosphate synthase [Desulfobul...   
. . Smithella sp. F21............................. 125  6e-31  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Syntrophobacterales: hypothetical protein KN63_01815 [Smithella sp....   
. . Desulfomonile tiedjei......................... 125  7e-31  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Syntrophobacterales: geranylgeranyl pyrophosphate synthase [De...   
. . Desulfonauticus sp. A7A....................... 121  2e-29  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: polyprenyl synthetase [Desulfonauticus sp...   
. . Bdellovibrio bacteriovorus.................... 120  2e-29  3 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Bdellovibrionales: geranyl transferase [Bdellovibrio bacteriovorus]    
. . Smithella sp. SCADC........................... 120  2e-29  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Syntrophobacterales: hypothetical protein ER57_16905 [Smithella sp....   
. . Desulfotalea psychrophila..................... 120  3e-29  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: farnesyl-diphosphate synthase [Desulfotal...   
. . Bdellovibrio bacteriovorus HD100.............. 119  7e-29  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Bdellovibrionales: geranyltranstransferase [Bdellovibrio bac...   
. . Desulfosarcina sp. BuS5....................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: hypothetical protein [Desulfosarcina sp. ...   
. . Bdellovibrio bacteriovorus str. Tiberius...... 118  1e-28  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Bdellovibrionales: geranyltranstransferase [Bdellovibrio bac...   
. . Desulfurivibrio alkaliphilus.................. 118  2e-28  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: farnesyl-diphosphate synthase [Desulfuriv...   
. . Candidatus Entotheonella sp. TSY1............. 117  4e-28  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria: farnesyl-diphosphate synthase [Candidatus Ento...   
. . Nitrospina sp. AB-629-B06..................... 116  2e-27  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: polyprenyl synthetase [Nitrospina sp. AB-...   
. . Desulfatibacillum aliphaticivorans............ 115  2e-27  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: farnesyl-diphosphate synthase [Desulfatib...   
. . Bdellovibrio bacteriovorus W.................. 115  3e-27  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Bdellovibrionales: geranyltranstransferase [Bdellovibrio bacterio...   
. . Myxococcus xanthus............................ 115  3e-27  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: farnesyl-diphosphate synthase [Myxococcus...   
. . Desulfocapsa sulfexigens...................... 115  3e-27  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: geranylgeranyl pyrophosphate synthase [De...   
. . Desulfatibacillum alkenivorans................ 115  4e-27  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: polyprenyl synthetase [Desulfatibacillum ...   
. . Desulfomicrobium baculatum.................... 114  8e-27  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: farnesyl-diphosphate synthase [Desulfomic...   
. . Hippea alviniae............................... 114  8e-27  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfurellales: polyprenyl synthetase [Hippea alviniae]        
. . Nitrospina sp. AB-629-B18..................... 114  9e-27  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: hypothetical protein [Nitrospina sp. AB-6...   
. . Desulfovermiculus halophilus.................. 114  1e-26  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: polyprenyl synthetase [Desulfovermiculus ...   
. . delta proteobacterium PSCGC 5451.............. 112  4e-26  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria: hypothetical protein [delta proteobacteri...   
. . Plesiocystis pacifica......................... 112  4e-26  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: geranylgeranyl pyrophosphate synthase [Pl...   
. . Candidatus Desulfamplus magnetomortis BW-1.... 112  5e-26  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria: geranyltranstransferase [Candidatus Desulfamp...   
. . Desulfonatronospira thiodismutans............. 111  1e-25  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: farnesyl-diphosphate synthase [Desulfonat...   
. . Hyalangium minutum............................ 111  1e-25  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: Octaprenyl-diphosphate synthase [Hyalangium mi...   
. . Desulfovibrio africanus....................... 110  2e-25  3 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: polyprenyl synthetase [Desulfovibrio afri...   
. . Desulfovibrio acrylicus....................... 110  2e-25  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: polyprenyl synthetase [Desulfovibrio acry...   
. . Desulfovibrio africanus str. Walvis Bay....... 110  3e-25  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: farnesyl-diphosphate synthase [Desulfovib...   
. . Desulfobacterium autotrophicum................ 108  8e-25  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfobacterales: polyprenyl synthetase [Desulfobacterium a...   
. . Cystobacter violaceus Cb vi76................. 108  9e-25  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: geranyl transferase [Cystobacter violaceus Cb ...   
. . Hippea sp. KM1................................ 108  1e-24  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfurellales: hypothetical protein [Hippea sp. KM1]          
. . Myxococcus sp. (contaminant ex DSM 436)....... 108  1e-24  4 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Myxococcales: farnesyl-diphosphate synthase [Myxococcus...   
. . Desulfovibrio africanus PCS................... 107  3e-24  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: farnesyl-diphosphate synthase [Desulfovib...   
. . Hippea maritima............................... 107  3e-24  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfurellales: farnesyltranstransferase [Hippea maritima]     
. . Bacteriovorax sp. BSW11_IV.................... 107  5e-24  2 hits  Bacteria:Proteobacteria:Deltaproteobacteria:Bdellovibrionales: polyprenyl synthetase [Bacteriovorax sp. ...   
. . Desulfovibrio gigas........................... 106  4e-24  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: putative geranyltranstransferase [Desulfo...   
. . Desulfonatronovibrio hydrogenovorans.......... 106  5e-24  1 hit   Bacteria:Proteobacteria:Deltaproteobacteria:Desulfovibrionales: polyprenyl synthetase [Desulfonatronovibr...   
. . Methylibium petroleiphilum.................... 145  1e-38  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Methylibium petrol...   
. . Methylibium sp. T29........................... 145  1e-38  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Farnesyl diphosphate synthase [Methylibium sp....   
. . Polynucleobacter necessarius.................. 140  2e-36  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Polynucleobacter...   
. . Limnohabitans sp. Rim28....................... 136  3e-35  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Limnohabitans sp. R...   
. . Bordetella holmesii........................... 136  5e-35  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Bordetella holme...   
. . Limnohabitans sp. Rim47....................... 135  1e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Limnohabitans sp. R...   
. . Polaromonas sp. Cr4-12........................ 135  1e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Polaromonas sp. Cr...   
. . Leptothrix cholodnii.......................... 134  3e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Leptothrix cholodnii]   
. . Burkholderiales bacterium JOSHI_001........... 134  3e-34  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Burkholderiales ba...   
. . Ramlibacter tataouinensis..................... 134  4e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Ramlibacter tataou...   
. . Polaromonas sp. JS666......................... 134  5e-34  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Polaromonas sp. JS...   
. . Bordetella avium.............................. 133  5e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Bordetella avium]     
. . Comamonadaceae bacterium A1................... 133  8e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranylgeranyl pyrophosphate synthase [Comamo...   
. . Polaromonas naphthalenivorans................. 133  9e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Polaromonas naphth...   
. . Sphaerotilus natans subsp. natans DSM 6575.... 132  2e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Sphaerotilus natans sub...   
. . Bordetella hinzii............................. 132  2e-33  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Bordetella hinzii]        
. . Bordetella hinzii OH87 BAL007II............... 132  2e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Bordetella hinzii]        
. . Bordetella hinzii 8-296-03.................... 132  2e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Bordetella hinzii 8-296...   
. . Variovorax sp. URHB0020....................... 132  2e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Variovorax sp. URH...   
. . Polaromonas sp. EUR3 1.2.1.................... 131  4e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Polaromonas sp. EU...   
. . Bordetella bronchiseptica..................... 131  5e-33  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Bordetella bronc...   
. . Bordetella parapertussis...................... 130  5e-33  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Bordetella parap...   
. . Candidatus Burkholderia kirkii................ 130  9e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Octaprenyl-diphosphate synthase /Dimethyl...   
. . Bordetella pertussis.......................... 130  1e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Bordetella pertu...   
. . Polaromonas sp. CG9_12........................ 130  1e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Octaprenyl-diphosphate synthase / Dimethylall...   
. . Bordetella.................................... 130  1e-32  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: probable geranyltranstransf...   
. . Bordetella pertussis Tohama I................. 130  1e-32  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: geranyltranstransferase [Bo...   
. . Bordetella bronchiseptica MBORD665............ 129  1e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Bordetella bronchisepti...   
. . Bordetella petrii............................. 129  1e-32  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Bordetella petrii]        
. . Bordetella petrii DSM 12804................... 129  2e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Bordetella petrii]    
. . Achromobacter insuavis........................ 129  2e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Achromobacter in...   
. . Comamonas testosteroni........................ 129  3e-32  14 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Comamonas testosteroni]      
. . Comamonas testosteroni KF-1................... 129  4e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Comamonas testoste...   
. . Lautropia mirabilis........................... 129  5e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Lautropia mirabi...   
. . Comamonas testosteroni ATCC 11996............. 128  4e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Comamonas testoste...   
. . Comamonas sp. B-9............................. 128  4e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Comamonas sp. B-9]      
. . Achromobacter arsenitoxydans.................. 128  5e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Achromobacter ar...   
. . Achromobacter sp. RTa......................... 128  5e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Achromobacter sp. RTa]         
. . Comamonas testosteroni S44.................... 128  5e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Comamonas testoste...   
. . Achromobacter piechaudii...................... 127  8e-32  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Achromobacter pi...   
. . Limnobacter sp. MED105........................ 127  1e-31  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Limnobacter sp. ...   
. . Comamonas testosteroni CNB-2.................. 127  2e-31  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Comamonas testoste...   
. . Achromobacter xylosoxidans.................... 126  3e-31  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Octaprenyl-diphosphate synthase / Dimethy...   
. . Achromobacter xylosoxidans NH44784-1996....... 126  3e-31  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Achromobacter xy...   
. . Variovorax paradoxus.......................... 126  3e-31  5 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Variovorax paradoxus]   
. . Herbaspirillum lusitanum...................... 125  3e-31  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Herbaspirillum l...   
. . Pusillimonas sp. T7-7......................... 125  4e-31  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Pusillimonas sp....   
. . Alcaligenes sp. DH1f.......................... 125  4e-31  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Alcaligenes sp. DH1f]     
. . Bordetella sp. FB-8........................... 125  6e-31  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Bordetella sp. FB-8]      
. . Oligella urethralis DNF00040.................. 125  6e-31  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Oligella urethralis DNF00...   
. . Variovorax sp. JGI 0001016-M12................ 125  7e-31  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Variovorax sp. JGI...   
. . Burkholderia sp. JPY347....................... 125  7e-31  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia sp....   
. . Bordetella trematum........................... 125  9e-31  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Bordetella trematum]      
. . Herbaspirillum sp. YR522...................... 124  1e-30  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Herbaspirillum s...   
. . Burkholderia acidipaludis..................... 124  1e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Burkholderia acidipa...   
. . Achromobacter piechaudii ATCC 43553........... 124  1e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Achromobacter pi...   
. . Variovorax paradoxus S110..................... 124  1e-30  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Variovorax paradoxus]   
. . Variovorax paradoxus B4....................... 124  2e-30  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: putative farnesyl-diphosphate synthase [V...   
. . Herbaspirillum sp. CF444...................... 124  2e-30  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Herbaspirillum s...   
. . Thiomonas sp. FB-Cd........................... 124  2e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Thiomonas sp. FB-Cd]    
. . Curvibacter gracilis.......................... 123  4e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Curvibacter gracilis]   
. . Curvibacter lanceolatus....................... 123  4e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Curvibacter lanceo...   
. . Oligella urethralis........................... 123  5e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Oligella urethralis]     
. . Comamonadaceae bacterium B1................... 123  5e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranylgeranyl pyrophosphate synthase [Comamo...   
. . Comamonadaceae bacterium H1................... 122  6e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Comamonadaceae bac...   
. . Herbaspirillum................................ 122  1e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: geranyltranstransferase [He...   
. . Curvibacter putative symbiont of Hydra magnipap 122  2e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Probable geranyltranstransferase [Curvibacter...   
. . Herbaspirillum frisingense.................... 121  2e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Herbaspirillum f...   
. . Burkholderia sp. JV3.......................... 121  2e-29  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: farnesyl-diphosphate synthase [Stenotroph...   
. . Burkholderia sp. WSM3617...................... 120  3e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Burkholderia sprentiae]   
. . Herminiimonas sp. CN.......................... 120  3e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Herminiimonas sp. CN]     
. . Advenella kashmirensis........................ 120  3e-29  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Advenella kashmi...   
. . Herbaspirillum sp. GW103...................... 120  3e-29  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Herbaspirillum s...   
. . Hylemonella gracilis.......................... 120  4e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Hylemonella gracilis]   
. . Parasutterella excrementihominis.............. 119  7e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Parasutterella e...   
. . Parasutterella excrementihominis CAG:233...... 119  7e-29  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Parasutterella exc...   
. . Burkholderiales bacterium 1_1_47.............. 119  7e-29  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderiales ...   
. . Massilia sp. JS1662........................... 119  8e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Massilia sp. JS1662]           
. . Verminephrobacter eiseniae.................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Verminephrobacter ...   
. . Massilia timonae.............................. 119  1e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Massilia timonae]        
. . Sutterella wadsworthensis..................... 119  1e-28  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Sutterella wadswort...   
. . Sutterella wadsworthensis CAG:135............. 119  1e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: farnesyl-diphosphate synthase [Sutterella...   
. . Sutterella wadsworthensis 3_1_45B............. 118  2e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Sutterella wadsw...   
. . Tetrathiobacter kashmirensis WT001............ 118  2e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Advenella kashmi...   
. . Burkholderia sp. BT03......................... 118  3e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia sp....   
. . Burkholderia terrae........................... 117  3e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia ter...   
. . Burkholderia sp. JPY251....................... 117  4e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia sp....   
. . Oxalobacter formigenes........................ 117  4e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Oxalobacter formige...   
. . Derxia gummosa................................ 117  4e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Derxia gummosa]           
. . Aquabacterium sp. NJ1......................... 117  4e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Aquabacterium sp. NJ1]       
. . Burkholderia caribensis MBA4.................. 117  4e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Octaprenyl-diphosphate synthase [Burkholderia ...   
. . Burkholderia ambifaria........................ 117  6e-28  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia amb...   
. . Burkholderia sp. H160......................... 117  8e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia sp....   
. . Burkholderia ambifaria MC40-6................. 116  8e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia amb...   
. . Burkholderia pyrrocinia....................... 116  9e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Burkholderia pyrroci...   
. . Oxalobacteraceae bacterium IMCC9480........... 116  1e-27  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Oxalobacteraceae...   
. . Advenella mimigardefordensis DPN7............. 116  1e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: putative geranyltranstransferase IspA [Advenel...   
. . Burkholderia sp. MSh1......................... 116  1e-27  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Burkholderia sp. MSh1]    
. . Burkholderia ambifaria MEX-5.................. 116  1e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia amb...   
. . Burkholderia kururiensis...................... 116  1e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia kur...   
. . Burkholderia glumae........................... 116  1e-27  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia glu...   
. . Comamonas aquatica DA1877..................... 116  1e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Comamonas aquatica DA1877]   
. . Burkholderia cenocepacia...................... 115  2e-27  7 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia cen...   
. . Janthinobacterium sp. Marseille............... 115  2e-27  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Janthinobacteriu...   
. . Glomeribacter sp. 1016415..................... 115  2e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Glomeribacter sp. 10...   
. . Burkholderia sp. TJI49........................ 115  2e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: farnesyl-diphosphate synthase [Burkholderia sp...   
. . Burkholderia multivorans...................... 115  2e-27  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase family protein [Burkhold...   
. . Azohydromonas australica...................... 115  2e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Azohydromonas aust...   
. . Burkholderia multivorans CF2.................. 115  2e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia mul...   
. . Burkholderia cepacia.......................... 115  2e-27  6 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Burkholderia cepacia]     
. . Burkholderia.................................. 115  2e-27  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: geranyltranstransferase [Bu...   
. . Burkholderia gladioli BSR3.................... 115  2e-27  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: geranyltranstransferase [Bu...   
. . Burkholderia vietnamiensis AU4i............... 115  3e-27  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Octaprenyl diphosphate synthase [Burkhold...   
. . Burkholderia multivorans ATCC 17616........... 115  3e-27  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia mul...   
. . Herminiimonas arsenicoxydans.................. 115  3e-27  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Herminiimonas ar...   
. . Burkholderia sp. CCGE1002..................... 115  3e-27  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia sp....   
. . Herbaspirillum seropedicae.................... 115  3e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Herbaspirillum s...   
. . Burkholderia ambifaria AMMD................... 115  3e-27  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia amb...   
. . Burkholderia dolosa........................... 115  3e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia dol...   
. . Burkholderia cenocepacia H111................. 115  3e-27  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia cen...   
. . Burkholderia cenocepacia KC-01................ 115  3e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Octaprenyl diphosphate synthase [Burkhold...   
. . Burkholderia lata............................. 115  3e-27  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia lata]    
. . Burkholderia cenocepacia J2315................ 115  3e-27  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia cen...   
. . Burkholderia cepacia complex.................. 115  4e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: geranyltranstransferase [Bu...   
. . Brackiella oedipodis.......................... 115  4e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Brackiella oedipodis]     
. . Burkholderia sp. CCGE1001..................... 114  5e-27  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia sp....   
. . Burkholderia xenovorans....................... 114  5e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia xen...   
. . Oxalobacteraceae bacterium JGI 0001004-K23.... 114  6e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Oxalobacteraceae...   
. . Burkholderia phenoliruptrix................... 114  1e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia phe...   
. . Burkholderia phytofirmans..................... 114  1e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia phy...   
. . Pandoraea..................................... 114  1e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: geranyltranstransferase [Pa...   
. . Burkholderia sp. JPY366....................... 113  1e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Burkholderia sp. JPY...   
. . Rubrivivax gelatinosus........................ 113  1e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Rubrivivax gelatin...   
. . Burkholderia pseudomallei..................... 113  2e-26  31 hits Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia pse...   
. . Burkholderia sp. K24.......................... 113  2e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: geranyl transferase [Burkho...   
. . Burkholderia pseudomallei K96243.............. 113  2e-26  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia pse...   
. . Janthinobacterium lividum..................... 113  2e-26  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Farnesyl diphosphate synthase IspA [Janthinoba...   
. . Collimonas fungivorans........................ 113  2e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Collimonas fungi...   
. . Burkholderia pseudomallei BPC006.............. 112  2e-26  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia pse...   
. . Burkholderia bryophila........................ 112  2e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia bry...   
. . Burkholderia sp. lig30........................ 112  2e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Geranyltranstransferase [Burkholderia sp. lig30]    
. . Chitinimonas koreensis........................ 112  2e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Chitinimonas koreensis]   
. . Herbaspirillum massiliense.................... 112  3e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: hypothetical protein [Herbaspirillum mass...   
. . Burkholderia caledonica....................... 112  3e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Burkholderia caledon...   
. . pseudomallei group............................ 112  3e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: geranyltranstransferase [ps...   
. . Rubrivivax benzoatilyticus.................... 112  3e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Rubrivivax benzoat...   
. . Sutterella parvirubra......................... 112  3e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Sutterella parvi...   
. . Burkholderia sp. URHA0054..................... 112  3e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Burkholderia sp. URH...   
. . Comamonas badia............................... 112  4e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Comamonas badia]        
. . Burkholderia dilworthii....................... 112  5e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Burkholderia sp. WSM...   
. . Burkholderia oklahomensis..................... 112  5e-26  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia okl...   
. . Burkholderia ubonensis........................ 112  5e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia ubo...   
. . Burkholderia sp. CCGE1003..................... 112  5e-26  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia sp....   
. . Burkholderia sp. WSM2232...................... 112  5e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Burkholderia sp. WSM...   
. . Janthinobacterium sp. HH01.................... 112  5e-26  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: farnesyl diphosphate synthase IspA [Janth...   
. . Hylemonella gracilis str. Niagara R........... 112  6e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Hylemonella gracilis st...   
. . Acidovorax sp. JS42........................... 112  6e-26  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Acidovorax sp. JS42]    
. . Burkholderia thailandensis.................... 111  6e-26  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia tha...   
. . Burkholderia sp. WSM2230...................... 111  6e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Burkholderia sp. WSM...   
. . Burkholderia graminis......................... 111  6e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia gra...   
. . Burkholderia cepacia GG4...................... 111  8e-26  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia cep...   
. . Polynucleobacter necessarius subsp. asymbioticu 111  8e-26  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Polynucleobacter...   
. . Burkholderia thailandensis MSMB43............. 110  1e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia tha...   
. . Pandoraea sp. SD6-2........................... 110  1e-25  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Pandoraea sp. SD...   
. . Burkholderia thailandensis MSMB121............ 110  1e-25  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia tha...   
. . Burkholderia sp. WSM4176...................... 110  1e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Burkholderia sp....   
. . Duganella violaceinigra....................... 110  2e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Duganella violaceini...   
. . Hydrogenophaga sp. PBC........................ 110  2e-25  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Hydrogenophaga sp....   
. . Ralstonia sp. PBA............................. 110  2e-25  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Ralstonia sp. PBA]    
. . Oxalobacteraceae bacterium AB_14.............. 109  3e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Oxalobacteraceae...   
. . Burkholderia andropogonis..................... 109  4e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Burkholderia andropo...   
. . Pandoraea sp. B-6............................. 109  5e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyl transferase [Pandoraea sp. B-6]        
. . Sutterella wadsworthensis 2_1_59BFAA.......... 108  6e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Sutterella wadsw...   
. . Oxalobacter formigenes OXCC13................. 108  1e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Oxalobacter form...   
. . Sutterella sp. CAG:351........................ 108  1e-24  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Sutterella sp. CAG...   
. . Delftia acidovorans........................... 108  1e-24  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: farnesyl diphosphate synthase [Delftia ac...   
. . Delftia sp. 670............................... 108  1e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Delftia sp. 670]             
. . Delftia acidovorans CCUG 15835................ 108  1e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: farnesyl diphosphate syntha...   
. . Acidovorax radicis............................ 107  2e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Acidovorax radicis]     
. . Alicycliphilus denitrificans.................. 107  2e-24  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Alicycliphilus den...   
. . Alicycliphilus denitrificans BC............... 107  2e-24  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Alicycliphilus den...   
. . Janthinobacterium agaricidamnosum NBRC 102515 = 107  2e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase family protein [Janthin...   
. . Simplicispira psychrophila.................... 107  3e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Simplicispira psyc...   
. . Delftia....................................... 107  3e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: MULTISPECIES: polyprenyl synthetase [Delf...   
. . Acidovorax sp. CF316.......................... 107  3e-24  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Acidovorax sp. CF316]   
. . Cupriavidus taiwanensis....................... 107  3e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Cupriavidus taiw...   
. . Cupriavidus pinatubonensis.................... 107  3e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: geranyltranstransferase [Cupriavidus pina...   
. . Albidiferax ferrireducens..................... 107  4e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: polyprenyl synthetase [Albidiferax ferrir...   
. . Delftia sp. RIT313............................ 107  4e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Burkholderiales: Farnesyl diphosphate synthase [Delftia sp. RIT...   
. . Methylophilales bacterium HTCC2181............ 142  2e-37  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: geranyltranstransferase (farnesyldiphosph...   
. . Methylotenera................................. 139  6e-36  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: MULTISPECIES: geranyltranstransferase [Me...   
. . Nitrosomonas sp. Is79A3....................... 135  7e-35  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: geranyltranstransferase [Nitrosomonas sp....   
. . Thauera....................................... 135  1e-34  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: MULTISPECIES: polyprenyl synthetase [Thau...   
. . Aromatoleum aromaticum........................ 134  2e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: geranyltranstransferase [Aromatoleum arom...   
. . Azoarcus toluclasticus........................ 134  4e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: geranyltranstransferase [Azoarcus tolucla...   
. . Pseudogulbenkiania sp. MAI-1.................. 134  4e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyl transferase [Pseudogulbenkiania s...   
. . Nitrosomonas cryotolerans..................... 133  6e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: geranyl transferase [Nitrosomonas cryotol...   
. . Sideroxydans lithotrophicus................... 133  6e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Gallionellales: geranyltranstransferase [Sideroxydans lit...   
. . Lutiella nitroferrum.......................... 133  7e-34  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Pseudogulbenkian...   
. . Pseudogulbenkiania sp. NH8B................... 133  7e-34  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Pseudogulbenkian...   
. . Candidatus Accumulibacter sp. BA-92........... 133  8e-34  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: Farnesyl diphosphate synthase [Candidatus Accu...   
. . Conchiformibius kuhniae....................... 132  1e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyl transferase [Conchiformibius kuhn...   
. . Candidatus Accumulibacter sp. BA-93........... 132  1e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: Farnesyl diphosphate synthase [Candidatus Accu...   
. . beta proteobacterium L13...................... 132  1e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: hypothetical protein [beta proteobacteriu...   
. . Thauera phenylacetica......................... 132  2e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: polyprenyl synthetase [Thauera phenylacet...   
. . Kingella kingae............................... 132  2e-33  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Kingella kingae]      
. . Kinetoplastibacterium blastocrithidii......... 132  2e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: geranyltranstransferase [Kinetoplastibact...   
. . Conchiformibius steedae....................... 131  2e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyl transferase [Conchiformibius stee...   
. . Candidatus Accumulibacter sp. SK-02........... 131  3e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: Farnesyl diphosphate synthase [Candidatus Accu...   
. . Azoarcus sp. KH32C............................ 131  3e-33  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: polyprenyl synthetase [Azoarcus sp. KH32C]     
. . Microvirgula aerodenitrificans................ 131  3e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyl transferase [Microvirgula aeroden...   
. . Uliginosibacterium gangwonense................ 131  3e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: hypothetical protein [Uliginosibacterium ...   
. . Gallionella capsiferriformans................. 131  4e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Gallionellales: geranyltranstransferase [Gallionella caps...   
. . Thauera sp. MZ1T.............................. 131  4e-33  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: MULTISPECIES: geranyltranstransferase [Th...   
. . Azonexus hydrophilus.......................... 130  6e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: geranyl transferase [Azonexus hydrophilus]     
. . Tepidiphilus margaritifer..................... 130  6e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Hydrogenophilales: geranyl transferase [Tepidiphilus margari...   
. . Kingella oralis............................... 130  8e-33  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Kingella oralis]      
. . Nitrosomonas eutropha......................... 129  2e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: geranyltranstransferase [Nitrosomonas eut...   
. . Laribacter hongkongensis...................... 129  2e-32  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyl transferase [Laribacter hongkonge...   
. . Neisseria shayeganii.......................... 129  2e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria shayeg...   
. . Laribacter hongkongensis HLHK9................ 129  2e-32  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Laribacter hongk...   
. . Kingella kingae PYKK081....................... 129  2e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Kingella kingae]      
. . Nitrosomonas europaea......................... 129  3e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: geranyltranstransferase [Nitrosomonas eur...   
. . Azoarcus sp. BH72............................. 129  3e-32  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: geranyltranstransferase [Azoarcus sp. BH72]    
. . Thauera terpenica............................. 129  3e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: geranyl transferase [Thauera terpenica]        
. . Candidatus Accumulibacter phosphatis.......... 129  4e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: geranyltranstransferase [Candidatus Accum...   
. . Thauera terpenica 58Eu........................ 128  3e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: hypothetical protein M622_10035 [Thauera terpe...   
. . Nitrosomonas sp. AL212........................ 128  3e-32  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: geranyltranstransferase [Nitrosomonas sp....   
. . Sulfuritalea hydrogenivorans sk43H............ 128  4e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: polyprenyl synthetase [Sulfuritalea hydrogeni...   
. . Candidatus Accumulibacter sp. BA-91........... 128  5e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: Farnesyl diphosphate synthase [Candidatus Accu...   
. . Sulfuricella denitrificans.................... 127  8e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Hydrogenophilales: polyprenyl synthetase [Sulfuricella denit...   
. . Candidatus Accumulibacter sp. SK-01........... 127  9e-32  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: Farnesyl diphosphate synthase [Candidatus Accu...   
. . Kingella sp. Sch538........................... 126  2e-31  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyl transferase [Kingella sp. Sch538]      
. . Neisseria meningitidis........................ 126  2e-31  16 hits Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: polyprenyl synthetase family protein [Nei...   
. . Methylotenera mobilis......................... 126  2e-31  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: geranyltranstransferase [Methylotenera mo...   
. . Dechloromonas aromatica....................... 126  3e-31  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: geranyltranstransferase [Dechloromonas ar...   
. . Candidatus Kinetoplastibacterium galatii...... 126  3e-31  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: farnesyl diphosphate synthase [Candidatus...   
. . Candidatus Accumulibacter sp. BA-94........... 126  7e-31  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: Farnesyl diphosphate synthase [Candidatus Accu...   
. . Thauera sp. 63................................ 125  4e-31  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: geranyltranstransferase [Thauera sp. 63]       
. . Thauera linaloolentis......................... 125  8e-31  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: polyprenyl synthetase [Thauera linaloolen...   
. . Neisseria lactamica ATCC 23970................ 125  8e-31  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: polyprenyl synthetase family protein [Neisseri...   
. . Deefgea rivuli................................ 125  8e-31  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyl transferase [Deefgea rivuli]           
. . Neisseria meningitidis NM255.................. 124  1e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria mening...   
. . Neisseria lactamica........................... 124  1e-30  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria lactam...   
. . Nitrosospira briensis......................... 124  1e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: geranyl transferase [Nitrosospira briensis]    
. . Candidatus Accumulibacter sp. SK-12........... 124  1e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: Farnesyl diphosphate synthase [Candidatus Accu...   
. . Candidatus Kinetoplastibacterium oncopeltii... 124  1e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: farnesyl diphosphate synthase [Candidatus...   
. . Neisseria polysaccharea....................... 124  1e-30  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria polysa...   
. . Candidatus Snodgrassella alvi wkB2............ 124  2e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: Octaprenyl-diphosphate synthase / Dimethylally...   
. . Neisseria wadsworthii......................... 124  2e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria wadswo...   
. . Dechloromonas agitata......................... 124  2e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: geranyl transferase [Dechloromonas agitata]    
. . Candidatus Accumulibacter sp. SK-11........... 124  2e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: Farnesyl diphosphate synthase [Candidatus Accu...   
. . Neisseria meningitidis alpha704............... 124  2e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria mening...   
. . Neisseria mucosa.............................. 124  2e-30  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyl transferase [Neisseria mucosa]              
. . Kingella denitrificans........................ 123  2e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Kingella denitri...   
. . Neisseria flavescens.......................... 123  3e-30  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria flaves...   
. . Neisseria meningitidis H44/76................. 123  3e-30  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria mening...   
. . Neisseria subflava............................ 123  4e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria subflava]   
. . Neisseria weaveri............................. 123  4e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria weaveri]    
. . Neisseria mucosa C102......................... 123  4e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria mucosa]     
. . Chitinilyticum aquatile....................... 122  5e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyl transferase [Chitinilyticum aquat...   
. . Neisseria flavescens NRL30031/H210............ 122  5e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria flaves...   
. . Neisseria meningitidis 80179.................. 122  5e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria mening...   
. . Neisseria meningitidis alpha153............... 122  7e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria mening...   
. . Snodgrassella alvi SCGC AB-598-J21............ 122  8e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: Geranylgeranyl pyrophosphate synthase [Snodgra...   
. . Ferrovum myxofaciens.......................... 122  9e-30  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: geranyl transferase [Ferrovum myxofaciens]     
. . Neisseria meningitidis M04-240196............. 122  9e-30  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria mening...   
. . Neisseria gonorrhoeae......................... 122  1e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria gonorr...   
. . Leeia oryzae.................................. 122  1e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: hypothetical protein [Leeia oryzae]            
. . Methyloversatilis sp. NVD..................... 121  1e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: geranyltranstransferase [Methyloversatili...   
. . Neisseria mucosa ATCC 25996................... 121  1e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria mucosa]     
. . Azospira oryzae............................... 121  2e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: geranyltranstransferase [Azospira oryzae]      
. . Neisseria sp. oral taxon 014.................. 121  2e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria sp. or...   
. . Neisseria sicca............................... 121  2e-29  4 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria sicca]      
. . Neisseria sicca ATCC 29256.................... 120  2e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria sicca]      
. . Neisseria sp. GT4A_CT1........................ 120  2e-29  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria sp. GT...   
. . Neisseria macacae............................. 120  3e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria macacae]    
. . Neisseria meningitidis FAM18.................. 120  5e-29  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria mening...   
. . Neisseria meningitidis M6190.................. 120  5e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria mening...   
. . Nitrosospira multiformis...................... 120  6e-29  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Nitrosomonadales: geranyltranstransferase [Nitrosospira mul...   
. . Neisseria meningitidis M01-240355............. 119  7e-29  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria mening...   
. . Methyloversatilis universalis................. 119  7e-29  3 hits  Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: geranyl transferase [Methyloversatilis un...   
. . Chitiniphilus shinanonensis................... 118  2e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: hypothetical protein [Chitiniphilus shina...   
. . Chitinilyticum litopenaei..................... 118  2e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyl transferase [Chitinilyticum litop...   
. . Candidatus Snodgrassella alvi................. 118  3e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: Octaprenyl-diphosphate synthase / Dimethylally...   
. . Methylophilaceae bacterium 11................. 118  3e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: geranyl transferase [Methylophilaceae bac...   
. . Methylotenera sp. 1P/1........................ 117  4e-28  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Methylophilales: hypothetical protein [Methylotenera sp. 1...   
. . Eikenella corrodens........................... 117  7e-28  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Eikenella corrod...   
. . Simonsiella muelleri.......................... 116  1e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Simonsiella muel...   
. . beta proteobacterium SCGC AAA027-C02.......... 116  1e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria: geranyl transferase [beta proteobacterium...   
. . Rhodocyclaceae................................ 115  2e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: MULTISPECIES: geranyltranstransferase [Rh...   
. . Eikenella corrodens CC92I..................... 115  2e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: hypothetical protein [Eikenella corrodens]     
. . beta proteobacterium CB....................... 115  3e-27  3 hits  Bacteria:Proteobacteria:Betaproteobacteria: Polyprenyl synthetase [beta proteobacteri...   
. . Azovibrio restrictus.......................... 115  3e-27  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: geranyl transferase [Azovibrio restrictus]     
. . Neisseria meningitidis Z2491.................. 113  2e-26  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria mening...   
. . Chitinibacter tainanensis..................... 112  2e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyl transferase [Chitinibacter tainan...   
. . Thiobacillus thioparus........................ 112  4e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Hydrogenophilales: geranyltranstransferase [Thiobacillus thi...   
. . Neisseria cinerea............................. 111  8e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria cinerea]    
. . Neisseria meningitidis ATCC 13091............. 111  9e-26  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria mening...   
. . Methyloversatilis universalis FAM5............ 111  1e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Rhodocyclales: geranyltranstransferase [Methyloversatili...   
. . Neisseria meningitidis 93004.................. 110  1e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria mening...   
. . Neisseria lactamica 020-06.................... 109  4e-25  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria lactam...   
. . Thiobacillus denitrificans.................... 109  5e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Hydrogenophilales: geranyltranstransferase [Thiobacillus den...   
. . Vitreoscilla stercoraria...................... 108  6e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyl transferase [Vitreoscilla stercor...   
. . Neisseria lactamica Y92-1009.................. 108  6e-25  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria lactam...   
. . Neisseria meningitidis alpha14................ 107  2e-24  2 hits  Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Neisseria mening...   
. . Pseudogulbenkiania ferrooxidans EGD-HP2....... 106  4e-24  1 hit   Bacteria:Proteobacteria:Betaproteobacteria:Neisseriales: geranyltranstransferase [Pseudogulbenkian...   
. . Magnetococcus marinus......................... 130  5e-33  1 hit   Bacteria:Proteobacteria:                 farnesyl-diphosphate synthase [Magnetococ...   
. . Thiovulum sp. ES.............................. 128  4e-32  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Thiovulum sp. ES]     
. . Helicobacter pylori........................... 122  8e-30  230 hitsBacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori FD719..................... 121  2e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Shi470.................... 121  2e-29  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori 52........................ 121  2e-29  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori UM067..................... 121  2e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Shi417.................... 121  2e-29  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter macacae.......................... 121  3e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: hypothetical protein [Helicobacter macacae]    
. . Helicobacter pylori oki154.................... 120  3e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pylori o...   
. . Helicobacter pylori Hp H-27................... 120  3e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori FD577..................... 120  3e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp P-28b.................. 120  3e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Shi112.................... 120  3e-29  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori oki828.................... 120  3e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pylori o...   
. . Helicobacter pylori UM065..................... 120  3e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori XZ274..................... 120  3e-29  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp P-23................... 120  4e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori CPY1313................... 120  4e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori GAM118Bi.................. 120  4e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori Hp P-16................... 120  4e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori OK310..................... 120  4e-29  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori NQ4110.................... 120  5e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter hepaticus........................ 120  5e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter hep...   
. . Helicobacter pylori India7.................... 120  5e-29  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori FD703..................... 120  5e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori UM032..................... 120  5e-29  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: farnesyl diphosphate synthase [Helicobact...   
. . Helicobacter pylori FD535..................... 120  5e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori SJM180.................... 120  6e-29  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori CPY1124................... 120  6e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori UM077..................... 120  6e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp P-30................... 120  7e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori UM023..................... 119  7e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori R037c..................... 119  7e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp H-11................... 119  7e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori HUP-B14................... 119  7e-29  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori FD506..................... 119  7e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori R32b...................... 119  7e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori CPY3281................... 119  7e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori NCTC 11637................ 119  8e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori CPY6081................... 119  8e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori FD430..................... 119  8e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori UM114..................... 119  8e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Puno120................... 119  8e-29  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori FD662..................... 119  9e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori 83........................ 119  9e-29  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori F30....................... 119  9e-29  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori CPY6261................... 119  9e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori CPY1962................... 119  9e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp P-2.................... 119  9e-29  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Shi169.................... 119  1e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp A-8.................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori 908....................... 119  1e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori GC26...................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori CPY6311................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp P-26................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori GAM114Ai.................. 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori 35A....................... 119  1e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori GAM105Ai.................. 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori Hp H-28................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori NQ4099.................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori PZ5004.................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori PZ5056.................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori 51........................ 119  1e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori oki422.................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pylori o...   
. . Helicobacter pylori Aklavik86................. 119  1e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori B8........................ 119  1e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori PZ5026.................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp P-4.................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori R038b..................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori NQ4216.................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori GAM83Bi................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori 98-10..................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Aklavik117................ 119  1e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori R030b..................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori B38....................... 119  1e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori NY40...................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltrans transferase [Helicobacter pylori...   
. . Helicobacter pylori UM038..................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp H-45................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori UM066..................... 119  1e-28  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori GAM265BSii................ 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori FD568..................... 119  1e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori v225d..................... 119  1e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori R018c..................... 119  2e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp H-44................... 119  2e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori NQ4200.................... 119  2e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori PeCan18................... 119  2e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori PZ5086.................... 119  2e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori PeCan4.................... 119  2e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori UM037..................... 119  2e-28  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori HPAG1..................... 119  2e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori GAM103Bi.................. 119  2e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori Hp P-1.................... 119  2e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori G27....................... 119  2e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori PZ5080.................... 119  2e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp H-4.................... 119  2e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori GAM119Bi.................. 118  2e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori GAM96Ai................... 118  2e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori Hp H-21................... 118  2e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori NQ4228.................... 118  2e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori GAM260BSi................. 118  2e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori NQ4161.................... 118  2e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori F57....................... 118  2e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp H-24................... 118  2e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori BM012A.................... 118  2e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: Dimethylallyltransferase [Helicobacter py...   
. . Helicobacter pylori Cuz20..................... 118  2e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori 26695..................... 118  2e-28  8 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori FD423..................... 118  2e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori R055a..................... 118  2e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp A-9.................... 118  2e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp P-62................... 118  2e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp P-11................... 118  2e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp A-27................... 118  3e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp H-43................... 118  3e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori CCHI 33................... 118  3e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase family protein [Hel...   
. . Helicobacter pylori Hp A-14................... 118  3e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori F16....................... 118  3e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori GAM254Ai.................. 118  3e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori UM085..................... 118  3e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori GAM231Ai.................. 118  3e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori GAMchJs114i............... 118  3e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori GAMchJs117Ai.............. 118  3e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori Hp H-36................... 118  3e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori NQ4076.................... 118  3e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori UM111..................... 118  3e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori oki128.................... 117  3e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pylori o...   
. . Helicobacter pylori Hp A-6.................... 117  3e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp A-16................... 117  4e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp H-41................... 117  4e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori MALT...................... 117  4e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase family protein [Hel...   
. . Helicobacter pylori Hp A-26................... 117  4e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori ELS37..................... 117  4e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp A-4.................... 117  4e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori P12....................... 117  4e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp H-29................... 117  4e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori CPY1662................... 117  4e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase family protein [Hel...   
. . Helicobacter pylori GAM245Ai.................. 117  4e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori GAM101Biv................. 117  4e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori PZ5024.................... 117  4e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori GAM239Bi.................. 117  4e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori GAM121Aii................. 117  4e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori GAM201Ai.................. 117  4e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori SouthAfrica20............. 117  4e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase family protein [Hel...   
. . Helicobacter pylori Hp P-13................... 117  4e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Gambia94/24............... 117  4e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp H-23................... 117  4e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp H-1.................... 117  4e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase family protein [Hel...   
. . Helicobacter pylori Hp A-17................... 117  4e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori GAM112Ai.................. 117  5e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori GAM260Bi.................. 117  5e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori Hp H-5b................... 117  5e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori GAM100Ai.................. 117  5e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori F32....................... 117  5e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori GAM249T................... 117  5e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori GAM270ASi................. 117  5e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori GAM210Bi.................. 117  5e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori GAM115Ai.................. 117  5e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori GAM71Ai................... 117  5e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori GAM264Ai.................. 117  5e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori GAMchJs136i............... 117  5e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori GAM246Ai.................. 117  5e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori GAM80Ai................... 117  5e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori R036d..................... 117  5e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp H-18................... 117  5e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori GAM250AFi................. 117  6e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori Hp P-3.................... 117  6e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp A-11................... 117  6e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase family protein [Hel...   
. . Helicobacter pylori HP116Bi................... 117  6e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori GAMchJs106B............... 117  6e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori J99....................... 117  6e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori SouthAfrica50............. 117  6e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase family protein [Hel...   
. . Helicobacter pylori J166...................... 117  6e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyl transferase [Helicobacter pylori]      
. . Helicobacter pylori SouthAfrica7.............. 117  6e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp H-30................... 117  6e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp H-34................... 117  6e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori GAM93Bi................... 117  7e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori UM084..................... 117  7e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp A-5.................... 117  7e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori NQ4053.................... 117  7e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp H-3.................... 117  7e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter acinonychis...................... 117  7e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter aci...   
. . Helicobacter pylori SNT49..................... 117  8e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori R046Wa.................... 117  8e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp P-15................... 117  8e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp H-42................... 117  8e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp A-20................... 117  8e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori GAM244Ai.................. 117  9e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: polyprenyl synthetase [Helicobacter pylori]    
. . Helicobacter pylori Lithuania75............... 116  9e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Sulfuricurvum sp. MLSB........................ 116  9e-28  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyl transferase [Sulfuricurvum sp. MLSB]        
. . Helicobacter pylori CPY6271................... 116  1e-27  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp P-41................... 116  1e-27  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Puno135................... 116  1e-27  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori X47-2AL................... 116  1e-27  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter heilmannii ASB1.4................ 116  1e-27  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: Octaprenyl-diphosphate synthase [Helicobacter...   
. . Helicobacter pylori Hp P-8.................... 116  2e-27  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter sp. MIT 01-6451.................. 115  2e-27  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyl transferase [Helicobacter sp. MIT 01-6...   
. . Helicobacter cinaedi.......................... 115  2e-27  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter cin...   
. . Helicobacter magdeburgensis................... 115  2e-27  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyl transferase [Helicobacter magdeburgensis]   
. . Helicobacter pylori Hp H-19................... 115  2e-27  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori NQ4044.................... 115  3e-27  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori Hp H-9.................... 115  3e-27  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter sp. MIT 03-1616.................. 115  4e-27  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyl transferase [Helicobacter sp. MIT 03-1...   
. . uncultured Sulfuricurvum sp. RIFRC-1.......... 114  5e-27  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: hypothetical protein [uncultured Sulfuric...   
. . Helicobacter felis............................ 114  7e-27  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter felis]   
. . Helicobacter sp. MIT 05-5293.................. 113  1e-26  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyl transferase [Helicobacter sp. MIT 05-5...   
. . Helicobacter pylori Hp H-10................... 113  2e-26  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter cetorum.......................... 113  2e-26  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter cet...   
. . Helicobacter muridarum........................ 112  3e-26  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyl transferase [Helicobacter muridarum]        
. . Helicobacter trogontum........................ 112  4e-26  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyl transferase [Helicobacter trogontum]        
. . Helicobacter sp. MIT 09-6949.................. 111  6e-26  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyl transferase [Helicobacter sp. MIT 09-6...   
. . Helicobacter mustelae......................... 111  8e-26  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter mus...   
. . Helicobacter cetorum MIT 00-7128.............. 111  9e-26  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter cet...   
. . Wolinella succinogenes........................ 111  9e-26  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Wolinella succin...   
. . Sulfuricurvum kujiense........................ 110  1e-25  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Sulfuricurvum ku...   
. . Helicobacter sp. MIT 11-5569.................. 110  1e-25  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyl transferase [Helicobacter sp. MIT 11-5...   
. . Helicobacter pylori A45....................... 110  1e-25  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter pylori OK113..................... 110  1e-25  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pyl...   
. . Helicobacter bizzozeronii..................... 110  2e-25  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter biz...   
. . Sulfurimonas denitrificans.................... 110  2e-25  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Sulfurimonas den...   
. . Helicobacter winghamensis..................... 110  2e-25  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter win...   
. . Helicobacter pylori oki102.................... 109  4e-25  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Helicobacter pylori o...   
. . Sulfurimonas autotrophica..................... 107  1e-24  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Sulfurimonas aut...   
. . Campylobacter showae.......................... 116  3e-27  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: Octaprenyl-diphosphate synthase [Campylob...   
. . Campylobacter ureolyticus..................... 115  2e-27  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: hypothetical protein [Campylobacter ureol...   
. . Campylobacter showae RM3277................... 115  7e-27  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Campylobacter sh...   
. . Campylobacter showae CC57C.................... 114  1e-26  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Campylobacter sh...   
. . Campylobacter rectus.......................... 113  2e-25  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Campylobacter re...   
. . Arcobacter sp. L.............................. 110  2e-25  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Arcobacter sp. L]     
. . Arcobacter.................................... 109  5e-25  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: MULTISPECIES: geranyl transferase [Arcoba...   
. . Arcobacter butzleri........................... 108  7e-25  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Arcobacter butzl...   
. . Campylobacter gracilis........................ 108  2e-24  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Campylobacter gr...   
. . Arcobacter butzleri RM4018.................... 107  2e-24  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Arcobacter butzl...   
. . Campylobacter sp. MIT 97-5078................. 107  2e-24  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyl transferase [Campylobacter sp. MIT 97-...   
. . Campylobacter sp. 1485E....................... 107  2e-24  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyl diphosphate synthase / farnesyl diphos...   
. . Campylobacter jejuni.......................... 107  2e-24  16 hits Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Campylobacter je...   
. . Campylobacter jejuni subsp. jejuni 260.94..... 107  2e-24  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Campylobacter je...   
. . Campylobacter jejuni subsp. jejuni ATCC 33560. 107  2e-24  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Campylobacter je...   
. . Arcobacter cibarius........................... 107  3e-24  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyl transferase [Arcobacter cibarius]      
. . Campylobacter jejuni subsp. jejuni 327........ 107  3e-24  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Campylobacter je...   
. . Campylobacter jejuni subsp. jejuni LMG 23216.. 106  3e-24  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Campylobacter je...   
. . Campylobacter hominis......................... 106  4e-24  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Campylobacter ho...   
. . Campylobacter jejuni subsp. jejuni LMG 9872... 106  4e-24  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Campylobacter je...   
. . Campylobacter jejuni subsp. jejuni 81116...... 106  5e-24  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Campylobacter je...   
. . Campylobacter jejuni subsp. jejuni NCTC 11168. 106  5e-24  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Campylobacter je...   
. . Campylobacter jejuni RM1221................... 106  5e-24  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Campylobacter je...   
. . Campylobacter jejuni subsp. jejuni 2008-872... 106  5e-24  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Campylobacter je...   
. . Campylobacter jejuni subsp. doylei 269.97..... 106  5e-24  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Campylobacter je...   
. . Campylobacter jejuni subsp. jejuni 1336....... 106  5e-24  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Campylobacter je...   
. . Campylobacter coli............................ 106  5e-24  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Campylobacterales: geranyltranstransferase [Campylobacter coli]   
. . Nitratifractor salsuginis..................... 124  1e-30  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria: geranyltranstransferase [Nitratifractor s...   
. . Sulfurovum sp. NBC37-1........................ 118  2e-28  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria: geranyltranstransferase [Sulfurovum sp. N...   
. . Sulfurovum sp. AR............................. 116  9e-28  2 hits  Bacteria:Proteobacteria:Epsilonproteobacteria: geranyltranstransferase [Sulfurovum sp. AR]    
. . Caminibacter mediatlanticus................... 115  1e-27  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Nautiliales: geranyltranstransferase [Caminibacter med...   
. . Nitratiruptor sp. SB155-2..................... 113  1e-26  3 hits  Bacteria:Proteobacteria:Epsilonproteobacteria: geranyltranstransferase [Nitratiruptor sp...   
. . Nautilia profundicola......................... 112  3e-26  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Nautiliales: geranyltranstransferase [Nautilia profund...   
. . Lebetimonas sp. JH292......................... 106  5e-24  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Nautiliales: geranyl transferase [Lebetimonas sp. JH292]    
. . Lebetimonas................................... 106  5e-24  1 hit   Bacteria:Proteobacteria:Epsilonproteobacteria:Nautiliales: MULTISPECIES: geranyl transferase [Lebeti...   
. . zeta proteobacterium SCGC AB-604-B04.......... 121  1e-29  1 hit   Bacteria:Proteobacteria:Zetaproteobacteria: geranyl transferase [zeta proteobacterium...   
. . zeta proteobacterium SCGC AB-133-C04.......... 109  4e-25  1 hit   Bacteria:Proteobacteria:Zetaproteobacteria: geranyl transferase [zeta proteobacterium...   
. . Proteobacteria bacterium CAG:139.............. 120  4e-29  2 hits  Bacteria:Proteobacteria:                 polyprenyl synthetase [Proteobacteria bac...   
. . Proteobacteria bacterium JGI 0001013-N05...... 118  2e-28  1 hit   Bacteria:Proteobacteria:                 farnesyl-diphosphate synthase [Proteobact...   
. . Proteobacteria................................ 110  2e-25  1 hit   Bacteria:Proteobacteria:                 MULTISPECIES: farnesyl-diphosphate syntha...   
. .uncultured bacterium eBACmed86H08.............. 169  1e-47  1 hit   Bacteria::                               predicted geranyltranstransferase [uncultured ...   
. .uncultured bacterium 12AC_lac13................ 152  5e-41  1 hit   Bacteria::                               geranyltranstransferase [uncultured bacterium ...   
. .Megamonas funiformis CAG:377................... 149  7e-40  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Megamonas ...   
. .Firmicutes bacterium CAG:137................... 142  2e-37  2 hits  Bacteria:Firmicutes:                     polyprenyl synthetase [Firmicutes bacteri...   
. .Acidaminococcus intestini CAG:325.............. 140  8e-37  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: polyprenyl synthetase [Acidaminococcus in...   
. .Firmicutes bacterium CAG:124................... 137  1e-35  2 hits  Bacteria:Firmicutes:                     polyprenyl synthetase [Firmicutes bacteri...   
. .Acidaminococcus sp. CAG:542.................... 137  1e-35  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: polyprenyl synthetase [Acidaminococcus sp...   
. .uncultured bacterium........................... 135  6e-35  10 hits Bacteria::                               hypothetical protein ACD_29C00157G0002 [uncult...   
. .Firmicutes bacterium CAG:110................... 132  1e-33  2 hits  Bacteria:Firmicutes:                     polyprenyl synthetase [Firmicutes bacteri...   
. .Fusobacterium sp. CAG:649...................... 130  5e-33  2 hits  Bacteria:Fusobacteria:Fusobacteriales:   dimethylallyltranstransferase [Fusobacter...   
. .Dialister sp. CAG:357.......................... 130  5e-33  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: putative uncharacterized protein [Dialist...   
. .Streptococcus thermophilus CAG:236............. 130  5e-33  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase farnesyl diphosph...   
. .Ruminococcus sp. CAG:330....................... 129  1e-32  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Ruminococc...   
. .Eubacterium sp. CAG:161........................ 129  2e-32  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Eubacterium sp. CA...   
. .Eubacterium sp. CAG:115........................ 129  2e-32  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Eubacterium sp. CA...   
. .Coprobacillus sp. CAG:183...................... 129  2e-32  1 hit   Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: MULTISPECIES: hypothetical protein [Firmi...   
. .uncultured bacterium MedeBAC82F10.............. 129  3e-32  1 hit   Bacteria::                               predicted geranyltranstransferase [uncultured ...   
. .Coprobacillus sp. CAG:235...................... 128  3e-32  2 hits  Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: putative uncharacterized protein [Coproba...   
. .Ruminococcus sp. CAG:353....................... 128  3e-32  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Ruminococcus sp. C...   
. .Clostridium sp. CAG:964........................ 128  3e-32  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Clostridium sp. CA...   
. .Clostridium sp. CAG:306........................ 128  3e-32  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyltranstransferase [Clostridium sp....   
. .Eubacterium eligens CAG:72..................... 127  1e-31  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Eubacterium elig...   
. .Firmicutes bacterium CAG:341................... 127  1e-31  2 hits  Bacteria:Firmicutes:                     polyprenyl synthetase [Firmicutes bacteri...   
. .Eubacterium dolichum CAG:375................... 126  2e-31  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Eubacterium dolich...   
. .Eubacterium sp. CAG:251........................ 126  3e-31  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Eubacterium sp. CA...   
. .Dialister sp. CAG:486.......................... 125  5e-31  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: putative uncharacterized protein [Dialist...   
. .Ruminococcus sp. CAG:403....................... 125  6e-31  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Ruminococc...   
. .Ruminococcus sp. CAG:177....................... 124  1e-30  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Ruminococcus sp. C...   
. .Ruminococcus sp. CAG:724....................... 124  1e-30  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Ru...   
. .Akkermansia muciniphila CAG:154................ 124  1e-30  2 hits  Bacteria:Verrucomicrobia:Verrucomicrobiae:Verrucomicrobiales: polyprenyl synthetase [Akkermansia mucini...   
. .Dialister invisus CAG:218...................... 124  2e-30  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: geranyltranstransferase [Dialister invisu...   
. .Firmicutes bacterium CAG:308................... 123  3e-30  2 hits  Bacteria:Firmicutes:                     geranylgeranyl pyrophosphate synthase [Fi...   
. .Anaerotruncus sp. CAG:528...................... 123  3e-30  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Anaerotruncus sp. ...   
. .Firmicutes bacterium CAG:41.................... 123  3e-30  2 hits  Bacteria:Firmicutes:                     polyprenyl synthetase [Firmicutes bacteri...   
. .Clostridium sp. CAG:492........................ 123  3e-30  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Clostridium sp. CA...   
. .Dialister sp. CAG:588.......................... 123  4e-30  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: putative uncharacterized protein [Dialist...   
. .Clostridium sp. CAG:269........................ 122  4e-30  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Clostridium sp. CA...   
. .Clostridium sp. CAG:343........................ 122  5e-30  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Clostridium sp. CA...   
. .Firmicutes bacterium CAG:272................... 122  5e-30  2 hits  Bacteria:Firmicutes:                     polyprenyl synthetase [Firmicutes bacteri...   
. .Eubacterium sp. CAG:38......................... 122  5e-30  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Eubacterium sp. ...   
. .Akkermansia sp. CAG:344........................ 122  7e-30  2 hits  Bacteria:Verrucomicrobia:Verrucomicrobiae:Verrucomicrobiales: polyprenyl synthetase [Akkermansia sp. CA...   
. .Clostridium sp. CAG:75......................... 122  8e-30  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative uncharacterized protein [Clostri...   
. .Roseburia sp. CAG:197.......................... 122  1e-29  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative uncharacterized protein [Rosebur...   
. .Clostridium sp. CAG:352........................ 121  1e-29  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Clostridium sp. CA...   
. .Clostridium bartlettii CAG:1329................ 121  1e-29  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Clostridium bartle...   
. .Clostridium sp. CAG:571........................ 121  2e-29  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Roseburia sp. CAG:50........................... 121  2e-29  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Roseburia sp. CA...   
. .Roseburia sp. CAG:303.......................... 120  2e-29  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Roseburia sp. CAG:...   
. .Lactobacillus ruminis CAG:367.................. 120  2e-29  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus ru...   
. .Firmicutes bacterium CAG:555................... 120  4e-29  2 hits  Bacteria:Firmicutes:                     polyprenyl synthetase [Firmicutes bacteri...   
. .Eubacterium sp. CAG:252........................ 120  6e-29  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Eubacterium sp. ...   
. .Eubacterium sp. CAG:156........................ 119  1e-28  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Eubacterium sp. CA...   
. .Catenibacterium sp. CAG:290.................... 118  1e-28  2 hits  Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: polyprenyl synthetase [Catenibacterium sp...   
. .Eubacterium sp. CAG:274........................ 118  2e-28  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Eubacterium sp. CA...   
. .Clostridium sp. CAG:230........................ 118  2e-28  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative uncharacterized protein [Clostri...   
. .Ruminococcus sp. CAG:488....................... 117  3e-28  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Ruminococcus sp. C...   
. .Ruminococcus sp. CAG:563....................... 117  3e-28  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Ruminococcus sp. C...   
. .Clostridium sp. CAG:448........................ 117  4e-28  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Eubacterium sp. CAG:248........................ 117  5e-28  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Eubacterium sp. ...   
. .Peptostreptococcus anaerobius CAG:621.......... 117  7e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: MULTISPECIES: putative geranyltranstransf...   
. .Ruminococcus sp. CAG:60........................ 117  7e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Rumino...   
. .Roseburia sp. CAG:18........................... 117  8e-28  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Ro...   
. .uncultured Termite group 1 bacterium........... 117  8e-28  1 hit   Bacteria:Elusimicrobia:                  geranyltranstransferase [uncultured Termi...   
. .Eubacterium sp. CAG:76......................... 117  8e-28  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Eubacterium sp. ...   
. .Veillonella sp. CAG:933........................ 116  1e-27  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: polyprenyl synthetase [Veillonella sp. CA...   
. .Firmicutes bacterium CAG:103................... 116  1e-27  2 hits  Bacteria:Firmicutes:                     geranyltranstransferase [Firmicutes bacte...   
. .Clostridium sp. CAG:265........................ 115  2e-27  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Clostridium sp. CA...   
. .Coprococcus sp. CAG:131........................ 115  2e-27  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Co...   
. .Eubacterium sp. CAG:603........................ 115  3e-27  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative uncharacterized protein [Eubacte...   
. .Firmicutes bacterium CAG:145................... 115  3e-27  2 hits  Bacteria:Firmicutes:                     putative uncharacterized protein [Firmicu...   
. .Clostridium sp. CAG:470........................ 115  3e-27  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Clostridium sp. CA...   
. .Clostridium leptum CAG:27...................... 115  4e-27  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Clostridium leptum...   
. .Coprococcus eutactus CAG:665................... 114  9e-27  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Coprococcus eutact...   
. .Clostridium sp. CAG:273........................ 114  9e-27  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Roseburia sp. CAG:309.......................... 114  1e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Roseburia sp. CAG:...   
. .Roseburia sp. CAG:380.......................... 114  1e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative uncharacterized protein [Rosebur...   
. .Coprococcus sp. CAG:782........................ 113  1e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Coprococcus sp. CA...   
. .Clostridium sp. CAG:264........................ 113  1e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Clostridium sp. CAG:813........................ 113  1e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Clostridium sp. CA...   
. .Clostridium sp. CAG:413........................ 113  2e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Clostridium sp. CA...   
. .Eubacterium sp. CAG:146........................ 113  2e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Eubacterium sp. CA...   
. .Clostridium sp. CAG:277........................ 113  2e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative uncharacterized protein [Clostri...   
. .Eubacterium sp. CAG:86......................... 112  2e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Eubacterium sp. ...   
. .Clostridium sp. CAG:411........................ 112  2e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative uncharacterized protein [Clostri...   
. .Eubacterium sp. CAG:202........................ 112  3e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Eubacterium sp. CA...   
. .Eubacterium sp. CAG:180........................ 112  3e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Eubacterium sp. CA...   
. .Firmicutes bacterium CAG:475................... 112  3e-26  2 hits  Bacteria:Firmicutes:                     polyprenyl synthetase [Firmicutes bacteri...   
. .Roseburia intestinalis CAG:13.................. 112  3e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Ro...   
. .Roseburia sp. CAG:45........................... 112  4e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Ro...   
. .Clostridium sp. CAG:389........................ 112  5e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Clostridium sp. CA...   
. .Brachyspira sp. CAG:700........................ 111  6e-26  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Br...   
. .Blautia sp. CAG:237............................ 111  7e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Blautia sp. CAG:237]    
. .Fusobacterium sp. CAG:815...................... 111  8e-26  2 hits  Bacteria:Fusobacteria:Fusobacteriales:   polyprenyl synthetase [Fusobacterium sp. ...   
. .Clostridium sp. CAG:510........................ 111  8e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative uncharacterized protein [Clostri...   
. .Ruminococcus sp. CAG:57........................ 111  9e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Ruminococcus sp. C...   
. .Dorea formicigenerans CAG:28................... 111  9e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative uncharacterized protein [Dorea f...   
. .Clostridium sp. CAG:221........................ 111  9e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Clostridium sp. CA...   
. .Firmicutes bacterium CAG:212................... 110  1e-25  2 hits  Bacteria:Firmicutes:                     putative uncharacterized protein [Firmicu...   
. .Clostridium sp. CAG:967........................ 110  1e-25  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative uncharacterized protein [Clostri...   
. .Eubacterium hallii CAG:12...................... 110  1e-25  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Eubacterium hallii...   
. .Ruminococcus sp. CAG:108....................... 110  2e-25  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Ruminococcus sp. C...   
. .Clostridium sp. CAG:122........................ 110  2e-25  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative uncharacterized protein [Clostri...   
. .Roseburia inulinivorans CAG:15................. 110  2e-25  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative uncharacterized protein [Rosebur...   
. .Clostridium sp. CAG:62......................... 110  2e-25  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative uncharacterized protein [Clostri...   
. .Firmicutes bacterium CAG:102................... 110  2e-25  2 hits  Bacteria:Firmicutes:                     polyprenyl synthetase [Firmicutes bacteri...   
. .Roseburia sp. CAG:100.......................... 110  2e-25  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative uncharacterized protein [Rosebur...   
. .Coraliomargarita sp. CAG:312................... 109  3e-25  2 hits  Bacteria:Verrucomicrobia:Opitutae:Puniceicoccales: polyprenyl synthetase superfamily [Corali...   
. .Ruminococcus sp. CAG:254....................... 109  6e-25  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Ruminococc...   
. .Clostridium sp. CAG:729........................ 108  6e-25  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyltranstransferase [Clostridium sp....   
. .Erysipelotrichaceae bacterium CAG:64........... 108  6e-25  1 hit   Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: MULTISPECIES: hypothetical protein [Firmi...   
. .Streptococcus salivarius CAG:79................ 108  6e-25  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase farnesyl diphosph...   
. .Lachnospiraceae bacterium CAG:364.............. 108  7e-25  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative uncharacterized protein [Lachnos...   
. .Faecalibacterium sp. CAG:74.................... 108  8e-25  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Faecalibacterium s...   
. .Lachnospiraceae bacterium CAG:215.............. 108  8e-25  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative uncharacterized protein [Lachnos...   
. .Eubacterium rectale CAG:36..................... 108  9e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: MULTISPECIES: Geranylgeranyl pyrophosphat...   
. .Roseburia sp. CAG:182.......................... 108  1e-24  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Ro...   
. .Clostridium sp. CAG:226........................ 108  1e-24  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: predicted protein [Clostridium sp. CAG:226]    
. .Clostridium sp. CAG:590........................ 108  1e-24  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Ruminococcus obeum CAG:39...................... 108  1e-24  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Ruminococcus obeum...   
. .Dorea sp. CAG:105.............................. 107  2e-24  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative uncharacterized protein [Dorea s...   
. .Clostridium sp. CAG:253........................ 107  2e-24  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative uncharacterized protein [Clostri...   
. .Faecalibacterium sp. CAG:82.................... 107  3e-24  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Faecalibac...   
. .Ruminococcus gnavus CAG:126.................... 107  3e-24  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: putative uncharacterized protein [Ruminoc...   
. .Bacteroides pectinophilus CAG:437.............. 106  4e-24  2 hits  Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: putative uncharacterized protein [Bactero...   
. .Ruminococcus sp. CAG:579....................... 106  4e-24  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Ruminococcus sp. C...   
. .Blautia sp. CAG:257............................ 106  4e-24  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Blautia sp. CAG:257]    
. .Sebaldella termitidis.......................... 154  5e-42  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Sebaldella...   
. .Leptotrichia sp. oral taxon 225................ 134  4e-34  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   putative geranyltranstransferase [Leptotr...   
. .Fusobacterium nucleatum........................ 133  4e-34  26 hits Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium nucleatum subsp. vincentii 4_1_13 133  7e-34  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium sp. CM21......................... 132  8e-34  2 hits  Bacteria:Fusobacteria:Fusobacteriales:   geranyl transferase [Fusobacterium sp. CM21]   
. .Fusobacterium nucleatum subsp. vincentii ATCC 4 132  9e-34  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Leptotrichia buccalis.......................... 132  9e-34  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Leptotrich...   
. .Fusobacterium nucleatum subsp. vincentii 3_1_36 132  1e-33  2 hits  Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium nucleatum subsp. vincentii 3_1_27 132  2e-33  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   hypothetical protein HMPREF0405_00455 [Fusobac...   
. .Leptotrichia hofstadii......................... 132  2e-33  2 hits  Bacteria:Fusobacteria:Fusobacteriales:   geranyl transferase [Leptotrichia hofstadii]   
. .Leptotrichia shahii............................ 131  2e-33  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Leptotrich...   
. .Leptotrichia sp. oral taxon 879................ 131  3e-33  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   putative geranyltranstransferase [Leptotr...   
. .Fusobacterium nucleatum subsp. animalis 21_1A.. 131  3e-33  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium nucleatum CTI-3.................. 131  3e-33  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   geranylgeranyl diphosphate synthase, type...   
. .Fusobacterium nucleatum CTI-6.................. 131  3e-33  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   hypothetical protein [Fusobacterium nucle...   
. .Fusobacterium nucleatum subsp. polymorphum ATCC 131  3e-33  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium sp. OBRC1........................ 131  3e-33  2 hits  Bacteria:Fusobacteria:Fusobacteriales:   geranyl transferase [Fusobacterium sp. OB...   
. .Leptotrichia hofstadii F0254................... 130  4e-33  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Leptotrich...   
. .Fusobacterium nucleatum subsp. nucleatum ATCC 2 130  4e-33  2 hits  Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Leptotrichia wadei............................. 130  5e-33  2 hits  Bacteria:Fusobacteria:Fusobacteriales:   putative geranyltranstransferase [Leptotr...   
. .Fusobacterium gonidiaformans................... 130  5e-33  2 hits  Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Cetobacterium somerae.......................... 130  5e-33  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   hypothetical protein [Cetobacterium somerae]   
. .Fusobacterium nucleatum subsp. animalis 7_1.... 130  6e-33  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium nucleatum subsp. animalis D11.... 130  6e-33  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium mortiferum....................... 130  7e-33  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium nucleatum subsp. fusiforme ATCC 5 130  9e-33  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium nucleatum subsp. animalis OT 420. 130  1e-32  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium nucleatum CTI-5.................. 130  1e-32  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   geranylgeranyl diphosphate synthase, type...   
. .Fusobacterium sp. CM1.......................... 129  1e-32  2 hits  Bacteria:Fusobacteria:Fusobacteriales:   geranyl transferase [Fusobacterium sp. CM1]    
. .Fusobacterium nucleatum subsp. nucleatum ATCC 2 129  1e-32  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium gonidiaformans 3-1-5R............ 129  1e-32  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium sp. CM22......................... 129  2e-32  2 hits  Bacteria:Fusobacteria:Fusobacteriales:   geranyl transferase [Fusobacterium sp. CM22]   
. .Fusobacterium nucleatum 13_3C.................. 129  3e-32  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   geranyl transferase [Fusobacterium nuclea...   
. .Fusobacterium nucleatum subsp. animalis 11_3_2. 129  3e-32  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Leptotrichia trevisanii........................ 128  3e-32  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   geranyl transferase [Leptotrichia trevisa...   
. .Leptotrichia goodfellowii...................... 128  4e-32  2 hits  Bacteria:Fusobacteria:Fusobacteriales:   geranyl transferase [Leptotrichia goodfel...   
. .Fusobacterium nucleatum ChDC F128.............. 128  5e-32  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium nucleatum CTI-2.................. 128  6e-32  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   hypothetical protein [Fusobacterium nucle...   
. .Fusobacterium varium........................... 127  1e-31  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium ulcerans......................... 126  2e-31  2 hits  Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium nucleatum CTI-1.................. 126  2e-31  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   geranylgeranyl diphosphate synthase, type...   
. .Fusobacterium ulcerans ATCC 49185.............. 126  2e-31  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium necrophorum BL................... 126  2e-31  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacterium n...   
. .Fusobacterium necrophorum...................... 126  2e-31  3 hits  Bacteria:Fusobacteria:Fusobacteriales:   geranyl transferase [Fusobacterium necrop...   
. .Fusobacterium necrophorum D12.................. 126  2e-31  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium necrophorum subsp. funduliforme B 126  2e-31  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   dimethylallyltransferase [Fusobacterium necrop...   
. .Fusobacterium necrophorum DJ-1................. 126  3e-31  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacterium n...   
. .Fusobacterium periodonticum.................... 125  4e-31  4 hits  Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium necrophorum subsp. funduliforme A 125  7e-31  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Leptotrichia goodfellowii F0264................ 122  3e-30  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   geranyltranstransferase [Leptotrichia goo...   
. .Psychrilyobacter atlanticus.................... 122  5e-30  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   geranyl transferase [Psychrilyobacter atl...   
. .Fusobacterium periodonticum 1_1_41FAA.......... 122  5e-30  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium perfoetens....................... 122  6e-30  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   geranyl transferase [Fusobacterium perfoe...   
. .Fusobacterium periodonticum D10................ 120  2e-29  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium periodonticum ATCC 33693......... 120  3e-29  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium sp. oral taxon 370............... 119  7e-29  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   farnesyl-diphosphate synthase [Fusobacter...   
. .Fusobacterium russii........................... 118  2e-28  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   geranyl transferase [Fusobacterium russii]     
. .Leptotrichia sp. oral taxon 215................ 117  4e-28  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   putative geranyltranstransferase [Leptotr...   
. .Streptobacillus moniliformis................... 116  7e-28  1 hit   Bacteria:Fusobacteria:Fusobacteriales:   polyprenyl synthetase [Streptobacillus mo...   
. .Viridibacillus arenosi FSL R5-213.............. 151  9e-41  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Viridibacillus arenos...   
. .Kurthia sp. JC8E............................... 147  2e-39  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Kurthia sp...   
. .Ureibacillus thermosphaericus.................. 142  1e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Ureibacillus thermo...   
. .Paenisporosarcina quisquiliarum TG20........... 142  1e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Paenisporosarcina s...   
. .Kurthia massiliensis........................... 142  2e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Kurthia sp...   
. .Planomicrobium sp. ES2......................... 142  3e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  Farnesyl diphosphate synthase [Planomicrobium...   
. .Solibacillus silvestris........................ 141  4e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Solibacill...   
. .Paenisporosarcina sp. TG-14.................... 141  4e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Paenisporosarcina s...   
. .Kurthia huakuii................................ 139  2e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Kurthia hu...   
. .Sporosarcina sp. EUR3 2.2.2.................... 139  3e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Sporosarci...   
. .Planococcus antarcticus........................ 135  6e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Planococcu...   
. .Planomicrobium glaciei CHR43................... 135  8e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Planomicrobium ...   
. .Paenisporosarcina sp. HGH0030.................. 134  2e-34  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Paenisporosarcina s...   
. .Sporosarcina ureae............................. 112  4e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Sporosarci...   
. .Sporosarcina newyorkensis...................... 111  6e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Sporosarci...   
. .Planococcus donghaensis........................ 107  2e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Planococcu...   
. .Planococcus halocryophilus..................... 106  4e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  Octaprenyl-diphosphate synthase [Planococ...   
. .Listeria seeligeri............................. 148  9e-40  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria seeligeri]   
. .Listeria monocytogenes......................... 148  9e-40  227 hitsBacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria monocyt...   
. .Listeria monocytogenes FSL J2-071.............. 148  1e-39  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  LOW QUALITY PROTEIN: geranyltranstransferase [...   
. .Listeria monocytogenes SLCC2376................ 148  1e-39  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria monocyt...   
. .Lysinibacillus fusiformis...................... 147  2e-39  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Lysinibaci...   
. .Bacillus sp. B14905............................ 147  2e-39  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus s...   
. .Lysinibacillus sphaericus...................... 147  2e-39  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Lysinibacillus s...   
. .Listeria monocytogenes FSL J1-208.............. 147  2e-39  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria monocyt...   
. .Listeria seeligeri FSL N1-067.................. 147  2e-39  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria seeligeri]   
. .Lysinibacillus sphaericus C3-41................ 147  3e-39  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Lysinibaci...   
. .Lysinibacillus boronitolerans.................. 147  3e-39  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Lysinibaci...   
. .Listeria monocytogenes FSL F2-208.............. 146  4e-39  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria monocytogene...   
. .Lysinibacillus fusiformis ZC1.................. 145  1e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Lysinibaci...   
. .Lysinibacillus fusiformis ZB2.................. 145  1e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Lysinibacillus f...   
. .Listeria monocytogenes serotype 4b str. F2365.. 145  1e-38  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria monocyt...   
. .Listeria monocytogenes SLCC2755................ 145  2e-38  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria monocyt...   
. .Listeria seeligeri FSL S4-171.................. 145  2e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria seeligeri FS...   
. .Listeria monocytogenes FSL J1-194.............. 145  2e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria monocyt...   
. .Listeria ivanovii subsp. londoniensis.......... 144  2e-38  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Listeria ivanovii subsp. ...   
. .Listeria ivanovii FSL F6-596................... 144  2e-38  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria ivanovii FSL...   
. .Listeria monocytogenes EGD-e................... 144  5e-38  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria monocyt...   
. .Brochothrix campestris FSL F6-1037............. 142  1e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Brochothrix campestri...   
. .Bacillus isronensis............................ 142  1e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus i...   
. .Listeria monocytogenes J0161................... 142  3e-37  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria monocyt...   
. .Geobacillus thermocatenulatus.................. 142  3e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Geobacillu...   
. .Listeria monocytogenes 10403S.................. 142  3e-37  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria monocyt...   
. .Virgibacillus alimentarius..................... 141  4e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Virgibacillus sp. J18]    
. .Geobacillus thermoleovorans.................... 141  6e-37  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Geobacillu...   
. .Geobacillus sp. WSUCF1......................... 141  7e-37  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Dimethylallyltransferase [Geobacillus sp....   
. .Geobacillus.................................... 141  7e-37  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: farnesyl-diphosphate syntha...   
. .Geobacillus sp. G1w1........................... 140  8e-37  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Geobacillu...   
. .Anoxybacillus flavithermus..................... 140  9e-37  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranylgeranyl pyrophosphate synthase [An...   
. .Staphylococcus aureus C0673.................... 140  1e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein V070_00570 [Staphylococcu...   
. .Geobacillus vulcani............................ 140  1e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Geobacillu...   
. .Lysinibacillus sp. GY32........................ 140  1e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Lysinibaci...   
. .Bacillus thermoamylovorans..................... 140  1e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  Farnesyl diphosphate synthase [Bacillus therm...   
. .Listeria marthii FSL S4-120.................... 140  1e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria marthii FSL ...   
. .Geobacillus sp. Y412MC61....................... 139  2e-36  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: farnesyl-diphosphate syntha...   
. .Geobacillus kaustophilus GBlys................. 139  2e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: polyprenyl synthetase [Geob...   
. .Geobacillus stearothermophilus................. 139  3e-36  8 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Geobacillu...   
. .Geobacillus sp. A8............................. 139  3e-36  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Geobacillu...   
. .Macrococcus caseolyticus....................... 138  5e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Macrococcu...   
. .Geobacillus thermodenitrificans NG80-2......... 138  6e-36  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: farnesyl-diphosphate syntha...   
. .Listeria ivanovii.............................. 138  9e-36  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria ivanovii]    
. .Staphylococcus sciuri.......................... 137  1e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus sciuri]    
. .Halobacillus trueperi.......................... 137  1e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  Farnesyl diphosphate synthase [Halobacillus t...   
. .Listeria aquatica FSL S10-1188................. 137  1e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  putative geranyltranstransferase [Listeriaceae...   
. .Bacillus fordii................................ 137  1e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Bacillus fordii]         
. .Geobacillus sp. JF8............................ 137  1e-35  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Geobacillu...   
. .Staphylococcus vitulinus....................... 137  2e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Staphylococcus vitu...   
. .Virgibacillus sp. SK37......................... 137  2e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Virgibacillus s...   
. .Brochothrix thermosphacta...................... 137  2e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Brochothrix thermos...   
. .Oceanobacillus picturae........................ 137  2e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  Farnesyl diphosphate synthase [Oceanobacillus...   
. .Anoxybacillus kamchatkensis.................... 136  3e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Anoxybacil...   
. .Virgibacillus halodenitrificans................ 135  6e-35  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Virgibacillus halod...   
. .Anoxybacillus flavithermus NBRC 109594......... 135  8e-35  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranylgeranyl pyrophosphate synthase [An...   
. .Anoxybacillus flavithermus WK1................. 135  1e-34  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Anoxybacil...   
. .Bacillus bataviensis........................... 135  1e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Bacillus bataviensis]   
. .Staphylococcus epidermidis..................... 135  1e-34  19 hits Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus e...   
. .Anoxybacillus sp. DT3-1........................ 135  1e-34  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranylgeranyl pyrophosphate synthase [An...   
. .Listeria rocourtiae FSL F6-920................. 134  1e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  putative geranyltranstransferase [Listeria roc...   
. .Sediminibacillus halophilus.................... 134  2e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Sediminibacillus ha...   
. .Bacillus sp. NSP22.2........................... 134  2e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Bacillus sp. NSP22.2]    
. .Paenibacillus.................................. 134  2e-34  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: polyprenyl synthetase [Paen...   
. .Geomicrobium sp. JCM 19039..................... 134  2e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  octaprenyl-diphosphate synthase [Geomicrobium...   
. .Sporolactobacillus laevolacticus............... 134  2e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Sporolacto...   
. .Anoxybacillus flavithermus TNO-09.006.......... 134  2e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Anoxybacillus flav...   
. .Staphylococcus epidermidis SK135............... 134  2e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus e...   
. .Staphylococcus epidermidis ATCC 12228.......... 134  2e-34  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus e...   
. .Staphylococcus epidermidis NIHLM001............ 134  3e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus e...   
. .Paenibacillus sp. PAMC 26794................... 134  3e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus sp. ...   
. .Anoxybacillus sp. SK3-4........................ 134  3e-34  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranylgeranyl pyrophosphate synthase [An...   
. .Staphylococcus epidermidis NIHLM061............ 134  3e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus e...   
. .Staphylococcus epidermidis VCU118.............. 133  4e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus epider...   
. .Staphylococcus epidermidis VCU028.............. 133  4e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus epider...   
. .Staphylococcus epidermidis W23144.............. 133  4e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus e...   
. .Staphylococcus epidermidis VCU144.............. 133  4e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus epider...   
. .Bacillus sp. UNC41MFS5......................... 133  4e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus s...   
. .Staphylococcus epidermidis NIH05005............ 133  4e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus e...   
. .Staphylococcus epidermidis Scl22............... 133  4e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus e...   
. .Staphylococcus................................. 133  5e-34  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: geranyltranstransferase [St...   
. .Staphylococcus epidermidis BVS058A4............ 133  5e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Staphylococcus epid...   
. .Staphylococcus epidermidis NIHLM040............ 133  5e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus e...   
. .Paenibacillus sp. FSL H7-689................... 133  6e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranylgeranyl pyrophosphate synthetase [Paeni...   
. .Staphylococcus epidermidis VCU071.............. 133  6e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus epider...   
. .Paenibacillus sp. FSL R5-192................... 133  7e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranylgeranyl pyrophosphate synthetase [Paeni...   
. .Amphibacillus xylanus.......................... 133  7e-34  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Amphibacil...   
. .Geobacillus thermoglucosidasius NBRC 107763.... 132  1e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Geobacillus thermogl...   
. .Geobacillus sp. Y4.1MC1........................ 132  1e-33  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Geobacillu...   
. .Geomicrobium sp. JCM 19037..................... 132  1e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  octaprenyl-diphosphate synthase [Geomicrobium...   
. .Bacillus methanolicus.......................... 132  1e-33  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus m...   
. .Bacillus cellulosilyticus...................... 132  1e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus c...   
. .Staphylococcus carnosus........................ 131  2e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus c...   
. .Anoxybacillus sp. KU2-6(11).................... 131  2e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Anoxybacillus s...   
. .Halobacillus halophilus........................ 131  2e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Halobacill...   
. .Staphylococcus sp. URHA0057.................... 131  3e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus sp. U...   
. .Staphylococcus massiliensis.................... 131  3e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus m...   
. .Bacillus sp. SG-1.............................. 130  5e-33  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus s...   
. .Geobacillus thermoglucosidasius................ 130  5e-33  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Geobacillu...   
. .Listeria weihenstephanensis FSL R9-0317........ 130  5e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  putative geranyltranstransferase [Listeria wei...   
. .Geobacillus thermoglucosidasius GT20........... 130  5e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Geobacillu...   
. .Bacillus vireti................................ 130  6e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Bacillus vireti]        
. .Paenibacillus sp. FSL R7-0331.................. 130  7e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus sp. FSL R...   
. .Listeriaceae bacterium FSL M6-0635............. 130  7e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein EP58_13200 [Listeriaceae ...   
. .Geobacillus sp. WCH70.......................... 130  8e-33  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Geobacillu...   
. .Staphylococcus sp. E463........................ 130  8e-33  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus s...   
. .Listeriaceae bacterium FSL A5-0209............. 130  1e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein EP56_06550 [Listeriaceae ...   
. .Bacillus sp. 2_A_57_CT2........................ 130  1e-32  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus s...   
. .Listeria riparia FSL S10-1204.................. 129  1e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeriaceae bacteriu...   
. .Pontibacillus marinus.......................... 129  1e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Pontibacillus marinus]    
. .Listeriaceae bacterium FSL A5-0281............. 129  2e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein EP57_06975 [Listeriaceae ...   
. .Bacillus oceanisediminis....................... 129  2e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus o...   
. .Bacillus sp. L1(2012).......................... 129  2e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Bacillus sp. L1(2012)]   
. .Staphylococcus chromogenes MU 970.............. 128  3e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  octaprenyl-diphosphate synthase [Staphylococcu...   
. .Paenibacillus sp. TCA20........................ 128  4e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranylgeranyl pyrophosphate synthetase [Paen...   
. .Bacillus methanolicus MGA3..................... 128  5e-32  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus m...   
. .Bacillus cibi.................................. 128  5e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus cibi]       
. .Bacillus indicus LMG 22858..................... 128  5e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus indicu...   
. .Listeria grayi................................. 128  5e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria grayi]       
. .Gracilibacillus halophilus..................... 127  6e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl diphosphate synthase [Gracilib...   
. .Bacillus kribbensis............................ 127  7e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus k...   
. .Bacillus sp. BL4-6............................. 127  8e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus sp. BL...   
. .Sporolactobacillus vineae...................... 127  8e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Sporolactobacillus v...   
. .Bacillus sp. URHB0009.......................... 127  8e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus s...   
. .Paenibacillus wynnii........................... 127  9e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus wynnii]        
. .Paenibacillus sp. A9........................... 127  9e-32  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Paenibacillus sp. A9]    
. .Listeria grayi FSL F6-1183..................... 126  2e-31  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria grayi FSL F6...   
. .Bacillus firmus DS1............................ 126  2e-31  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Bacillus firmus DS1]         
. .Paenibacillus sp. URHA0014..................... 126  2e-31  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus sp. ...   
. .Bacillus sp. 37MA.............................. 126  2e-31  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Bacillus sp. 37MA]       
. .Paenibacillus graminis......................... 125  3e-31  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus graminis]      
. .Staphylococcus aureus.......................... 125  3e-31  75 hits Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Paenibacillus alginolyticus.................... 125  3e-31  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus algi...   
. .Thermicanus aegyptius.......................... 125  3e-31  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Thermicanus aegypt...   
. .Paenibacillus sp. FSL H7-0357.................. 125  4e-31  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus sp. FSL H...   
. .Staphylococcus aureus subsp. aureus MRSA252.... 125  4e-31  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Sporolactobacillus terrae...................... 125  5e-31  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Sporolactobacillus t...   
. .Staphylococcus aureus subsp. aureus 55/2053.... 125  5e-31  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Paenibacillus barengoltzii..................... 125  7e-31  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Paenibacillus baren...   
. .Bacillus aidingensis........................... 125  7e-31  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus a...   
. .Paenibacillus sp. FSL R5-0345.................. 125  9e-31  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus sp. FSL R...   
. .Lysinibacillus sp. 13S34_air................... 124  8e-31  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  Farnesyl diphosphate synthase [Lysinibacillus...   
. .Staphylococcus haemolyticus DNF00585........... 124  9e-31  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus haemolytic...   
. .Amphibacillus jilinensis....................... 124  9e-31  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Amphibacillus jilin...   
. .Bacillus massiliosenegalensis.................. 124  9e-31  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Bacillus massiliose...   
. .Gracilibacillus lacisalsi...................... 124  1e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Gracilibacillus lac...   
. .Staphylococcus aureus subsp. aureus CIG290..... 124  1e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  ispA protein [Staphylococcus aureus subsp. aur...   
. .Paenibacillus sp. oral taxon 786 str. D14...... 124  1e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: farnesyl-diphosphate syntha...   
. .Salinicoccus albus............................. 124  1e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Salinicoccus albus]       
. .Staphylococcus aureus subsp. aureus IS-105..... 124  1e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Gemella sanguinis.............................. 124  1e-30  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Gemella sanguinis]        
. .Staphylococcus aureus W51776................... 124  1e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Aneurinibacillus terranovensis................. 124  1e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Aneurinibacillus t...   
. .Paenibacillus larvae........................... 124  1e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  putative polyprenyl synthetase [Paenibaci...   
. .Staphylococcus aureus subsp. aureus 71193...... 124  1e-30  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Staphylococcus aureus subsp. aureus COL........ 124  1e-30  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Staphylococcus aureus subsp. aureus 6850....... 124  1e-30  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase, putative [Staphy...   
. .Staphylococcus aureus subsp. aureus LGA251..... 124  1e-30  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Staphylococcus aureus VET1853R................. 124  1e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Staphylococcus aureus SMMC0005................. 124  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Staphylococcus aureus M0102.................... 124  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Staphylococcus aureus RF122.................... 124  2e-30  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Staphylococcus aureus H12930................... 124  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Staphylococcus aureus subsp. aureus MW2........ 124  2e-30  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Staphylococcus aureus HOAG6017................. 124  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Staphylococcus aureus subsp. aureus M013....... 124  2e-30  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Staphylococcus aureus VET0235R................. 124  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Staphylococcus aureus LAMC6094................. 124  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Staphylococcus aureus UCIM6126................. 124  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Staphylococcus aureus subsp. aureus HO 5096 041 124  2e-30  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Staphylococcus aureus subsp. aureus Mu50....... 124  2e-30  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Staphylococcus aureus DAR116................... 124  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Staphylococcus aureus M0900.................... 124  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Staphylococcus aureus M13559................... 124  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus aureus...   
. .Staphylococcus aureus AMMC6073................. 124  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Staphylococcus aureus 10S00488................. 124  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Paenibacillus sp. UNC451MF..................... 124  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus sp. ...   
. .Paenibacillus sp. HW567........................ 124  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus sp. ...   
. .Staphylococcus aureus subsp. aureus D139....... 124  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Staphylococcus aureus DAR1291.................. 124  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Aneurinibacillus aneurinilyticus............... 124  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Aneurinibacillus...   
. .Staphylococcus aureus subsp. aureus str. JKD600 123  2e-30  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Staphylococcus aureus subsp. aureus 21320...... 123  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Paenibacillus pini JCM 16418................... 123  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  octaprenyl-diphosphate synthase [Paenibacillu...   
. .Staphylococcus aureus W73649................... 123  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Staphylococcus aureus M0391.................... 123  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Staphylococcus aureus subsp. aureus 103564..... 123  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus aureus...   
. .Staphylococcus aureus M0439.................... 123  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Staphylococcus aureus subsp. aureus JKD6159.... 123  2e-30  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Staphylococcus aureus M0822.................... 123  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Staphylococcus aureus PLAC6058................. 123  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Staphylococcus aureus 1110803248............... 123  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Staphylococcus aureus M0367.................... 123  3e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Staphylococcus aureus subsp. aureus CIG1165.... 123  3e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  ispA protein [Staphylococcus aureus subsp. aur...   
. .Staphylococcus pasteuri........................ 123  3e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus p...   
. .Paenibacillus macerans......................... 123  3e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl diphosphate synthase [Paenibacillus m...   
. .Staphylococcus aureus subsp. aureus MSHR1132... 123  3e-30  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Paenibacillus ginsengihumi..................... 123  3e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Paenibacil...   
. .Staphylococcus aureus subsp. aureus ED133...... 123  4e-30  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Bacillus sp. J33............................... 123  4e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus s...   
. .Paenibacillus sp. FSL H7-0737.................. 123  4e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus sp. FSL H...   
. .Paenibacillus sp. FSL R5-0912.................. 123  5e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus sp. FSL R...   
. .Paenibacillus sp. FSL P4-0081.................. 123  5e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus sp. FSL P...   
. .Paenibacillus sp. FSL H8-237................... 123  6e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  poluprenyl synthetase [Paenibacillus sp. FSL H...   
. .Gemella cunicula............................... 122  6e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Gemella cuniculi]         
. .Paenibacillus odorifer......................... 122  6e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus odorifer]      
. .Staphylococcus warneri......................... 122  6e-30  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus w...   
. .Staphylococcus aureus M1216.................... 122  6e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Paenibacillus sp. FSL R7-277................... 122  7e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranylgeranyl pyrophosphate synthetase [Paeni...   
. .Staphylococcus epidermidis VCU006.............. 122  7e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Staphylococcus aureus M1515.................... 122  7e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Staphylococcus aureus subsp. aureus IS-55...... 122  7e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus a...   
. .Staphylococcus aureus subsp. aureus CO-98...... 122  8e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  putative geranyltranstransferase [Staphylococc...   
. .Staphylococcus haemolyticus.................... 122  9e-30  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus h...   
. .Staphylococcus simiae.......................... 122  9e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus s...   
. .Staphylococcus aureus LAMC6078................. 122  9e-30  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Staphylococcus warneri L37603.................. 122  1e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus w...   
. .Staphylococcus aureus H24662................... 122  1e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Paenibacillus sp. FSL R7-269................... 122  1e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  poluprenyl synthetase [Paenibacillus sp. FSL R...   
. .Staphylococcus warneri VCU121.................. 121  1e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus w...   
. .Staphylococcus agnetis......................... 121  1e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  octaprenyl-diphosphate synthase [Staphylococcu...   
. .Bacillus sp. 1NLA3E............................ 121  1e-29  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Bacillus sp. 1NLA3E]    
. .Paenibacillus terrigena........................ 121  1e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Paenibacillus terri...   
. .Staphylococcus aureus F87619................... 121  2e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Staphylococcus lentus.......................... 121  2e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus lentus]    
. .Alicyclobacillus herbarius..................... 121  2e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Alicyclobacillus he...   
. .Staphylococcus aureus M0570.................... 120  2e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Staphylococcus aureus]    
. .Paenibacillus sanguinis........................ 120  3e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Paenibacil...   
. .Sporolactobacillus inulinus.................... 120  3e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Sporolacto...   
. .Paenibacillus sp. FSL R7-0273.................. 120  3e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus sp. FSL R...   
. .Staphylococcus hominis......................... 120  3e-29  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus h...   
. .Paenibacillus larvae subsp. larvae 08-100...... 120  4e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  putative polyprenyl synthetase [Paenibacillus ...   
. .Listeria innocua............................... 120  4e-29  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria innocua]     
. .Staphylococcus saprophyticus................... 120  4e-29  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus s...   
. .Staphylococcus saprophyticus subsp. saprophytic 120  4e-29  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus s...   
. .Listeria innocua Clip11262..................... 120  4e-29  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria innocua]     
. .Listeria innocua ATCC 33091.................... 120  5e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria innocua]     
. .Bacillus subtilis BEST7613..................... 120  5e-29  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranylgeranyl pyrophosphate synthase [Bacill...   
. .Staphylococcus arlettae CVD059................. 119  6e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: geranyltranstransferase [St...   
. .Paenibacillus harenae.......................... 119  7e-29  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus hare...   
. .Paenibacillus sp. HGF7......................... 119  1e-28  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: farnesyl-diphosphate syntha...   
. .Jeotgalicoccus sp. 13MG44_air.................. 119  1e-28  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  Farnesyl diphosphate synthase [Jeotgalicoccus...   
. .Listeria fleischmannii......................... 119  1e-28  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  putative geranyltranstransferase [Listeri...   
. .Alicyclobacillus pohliae....................... 119  1e-28  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Alicyclobacillus po...   
. .Paenibacillus alvei............................ 119  1e-28  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Paenibacil...   
. .Staphylococcus aureus M0480.................... 119  1e-28  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus sp. M0...   
. .Bacillus ginsengihumi.......................... 118  2e-28  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus g...   
. .Staphylococcus sp. AL1......................... 118  2e-28  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus s...   
. .Bacillus subtilis.............................. 118  2e-28  18 hits Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus subtilis]   
. .Listeria welshimeri............................ 118  2e-28  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria welshim...   
. .Paenibacillus sp. MSt1......................... 118  3e-28  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus sp. MSt1]      
. .Bacillus subtilis subsp. spizizenii TU-B-10.... 118  3e-28  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus s...   
. .Staphylococcus hominis SK119................... 118  3e-28  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus h...   
. .Staphylococcus hominis subsp. hominis C80...... 118  3e-28  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus h...   
. .Paenibacillus elgii............................ 118  3e-28  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Paenibacil...   
. .Paenibacillus sp. JDR-2........................ 117  4e-28  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Paenibacil...   
. .Paenibacillus ehimensis........................ 117  6e-28  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus ehim...   
. .Bacillus thuringiensis......................... 117  7e-28  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus t...   
. .Paenibacillus assamensis....................... 117  7e-28  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus assa...   
. .Gemella bergeri................................ 116  8e-28  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  putative geranyltranstransferase [Gemella...   
. .Staphylococcus xylosus......................... 116  1e-27  5 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus x...   
. .Cohnella laeviribosi........................... 116  2e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Cohnella laeviribosi]    
. .Jeotgalicoccus psychrophilus................... 115  2e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Jeotgalicoccus psych...   
. .Bacillus sp. NSP9.1............................ 115  2e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus s...   
. .Bacillus sp. UNC438CL73TsuS30.................. 115  2e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus s...   
. .Bacillus lehensis G1........................... 115  2e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl diphosphate synthase [Bacillus lehens...   
. .Paenibacillus pasadenensis..................... 115  3e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus pasa...   
. .Listeria fleischmannii subsp. coloradonensis... 115  3e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Listeria fleisch...   
. .Paenibacillus mucilaginosus.................... 114  5e-27  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Paenibacil...   
. .Bacillales..................................... 114  5e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: farnesyl-diphosphate syntha...   
. .Paenibacillus mucilaginosus KNP414............. 114  5e-27  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Paenibacil...   
. .Bacillus subtilis E1........................... 114  6e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus s...   
. .Terribacillus aidingensis...................... 114  6e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Terribacillus aidingensis]     
. .Paenibacillus mucilaginosus K02................ 114  7e-27  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Paenibacil...   
. .Bacillus vallismortis.......................... 114  7e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus v...   
. .Bacillus sp. BSC154............................ 114  8e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus sp. BS...   
. .Bacillus subtilis subsp. spizizenii str. W23... 114  8e-27  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus s...   
. .Bacillus subtilis subsp. subtilis RO-NN-1...... 114  8e-27  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus s...   
. .Bacillus sp. JS................................ 114  8e-27  3 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus s...   
. .Paenibacillus sp. OSY-SE....................... 114  9e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus sp. ...   
. .Oceanobacillus iheyensis....................... 114  9e-27  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Oceanobaci...   
. .Bacillus subtilis subsp. subtilis str. BAB-1... 114  1e-26  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Bacillus subtilis]    
. .Paenibacillus curdlanolyticus.................. 114  1e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Paenibacil...   
. .Bacillus subtilis subsp. inaquosorum KCTC 13429 114  1e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Bacillus subtilis]       
. .Bacillus mojavensis............................ 114  1e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus m...   
. .Bacillus sp. JCM 19047......................... 114  1e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  (2E,6E)-farnesyl diphosphate synthase [Bacill...   
. .Lentibacillus jeotgali......................... 113  1e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Lentibacillus jeotgali]   
. .Paenibacillus popilliae........................ 113  1e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranylgeranyl pyrophosphate synthase [Pa...   
. .Paenibacillus senegalensis..................... 113  1e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Paenibacil...   
. .Marinococcus halotolerans...................... 113  1e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Marinococc...   
. .Paenibacillus taiwanensis...................... 113  1e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus taiw...   
. .Bacillus alcalophilus ATCC 27647............... 113  1e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus alcalo...   
. .Oceanobacillus kimchii......................... 113  2e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Oceanobaci...   
. .Gemella haemolysans............................ 113  2e-26  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Gemella haemolys...   
. .Bacillus atrophaeus............................ 113  2e-26  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  Geranyltranstransferase farnesyldiphospha...   
. .Bacillus sonorensis............................ 112  2e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  (2E,6E)-farnesyl diphosphate synthase Isp...   
. .Bacillus sp. TS-2.............................. 112  2e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Bacillus sp. TS-2]        
. .Staphylococcus pettenkoferi.................... 112  2e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus p...   
. .Bacillus atrophaeus 1942....................... 112  3e-26  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus a...   
. .Bacillus licheniformis S 16.................... 112  3e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus lichen...   
. .Bacillus tequilensis........................... 112  3e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus t...   
. .Bacillus megaterium............................ 112  3e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Bacillus megaterium]      
. .Bacillus amyloliquefaciens..................... 112  4e-26  7 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus a...   
. .Paenibacillus dendritiformis................... 112  4e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Paenibacil...   
. .Bacillus sp. 17376............................. 112  4e-26  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Bacillus sp. 17376]      
. .Bacillus sp. CPSM8............................. 111  6e-26  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus s...   
. .Bacillus....................................... 111  6e-26  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: geranyltranstransferase Isp...   
. .Bacillus pseudofirmus.......................... 111  7e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus p...   
. .Cohnella thermotolerans........................ 111  7e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Cohnella thermotol...   
. .Bacillus licheniformis ATCC 14580.............. 111  7e-26  4 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: farnesyl-diphosphate syntha...   
. .Bacillus chagannorensis........................ 111  9e-26  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus c...   
. .Thalassobacillus devorans...................... 110  1e-25  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Thalassobacillus dev...   
. .Bacillus siamensis............................. 110  1e-25  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus s...   
. .Bacillus amyloliquefaciens EBL11............... 110  1e-25  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus a...   
. .Bacillus amyloliquefaciens subsp. plantarum AS4 110  1e-25  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: farnesyl-diphosphate syntha...   
. .Alicyclobacillus hesperidum.................... 110  1e-25  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Alicyclobacillus h...   
. .Bacillus amyloliquefaciens FZB42............... 110  1e-25  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: farnesyl-diphosphate syntha...   
. .Bacillus amyloliquefaciens subsp. plantarum M27 110  1e-25  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus a...   
. .Staphylococcus simulans UMC-CNS-990............ 110  2e-25  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus simula...   
. .Staphylococcus simulans........................ 110  2e-25  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Staphylococcus simu...   
. .Gemella morbillorum............................ 110  2e-25  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Gemella morbillo...   
. .Bacillus coahuilensis.......................... 110  3e-25  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus c...   
. .Bacillus amyloliquefaciens CAU-B946............ 110  3e-25  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus a...   
. .Bacillus amyloliquefaciens subsp. plantarum Tri 109  3e-25  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus amylol...   
. .Bacillus marmarensis........................... 109  3e-25  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus m...   
. .Bacillus subtilis group........................ 109  4e-25  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: farnesyl-diphosphate syntha...   
. .Bacillus bogoriensis........................... 109  4e-25  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus b...   
. .Paenibacillus alvei A6-6i-x.................... 109  5e-25  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus alvei]    
. .Paenibacillus sp. UNC217MF..................... 109  5e-25  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Paenibacillus sp. ...   
. .Bacillus infantis NRRL B-14911................. 109  5e-25  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: farnesyl-diphosphate syntha...   
. .Bacillus akibai JCM 9157....................... 108  8e-25  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Bacillus akibai JCM ...   
. .Bacillus pumilus............................... 108  8e-25  6 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus p...   
. .Bacillus pumilus ATCC 7061..................... 108  8e-25  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus p...   
. .Bacillus stratosphericus....................... 108  9e-25  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Bacillus stratos...   
. .Bacillus altitudinis 41KF2b.................... 108  9e-25  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Bacillus altitudinis ...   
. .Bacillus nealsonii............................. 108  1e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Bacillus nealsonii]     
. .Bacillus halodurans............................ 108  1e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus h...   
. .Bacillus aerophilus KACC 16563................. 108  1e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  MULTISPECIES: farnesyl-diphosphate syntha...   
. .Jeotgalicoccus marinus......................... 108  1e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Jeotgalicoccus marinus]   
. .Bacillus sp. JGI 001006-L10.................... 108  1e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus s...   
. .Bacillus aurantiacus........................... 107  1e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus a...   
. .Anoxybacillus tepidamans....................... 107  2e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Anoxybacil...   
. .Bacillus sp. FJAT-14515........................ 107  2e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus s...   
. .Bacillus wakoensis JCM 9140.................... 107  2e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Bacillus wakoensis J...   
. .Bacillus sp. JCM 19045......................... 107  2e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  (2E,6E)-farnesyl diphosphate synthase [Bacill...   
. .Bacillus pumilus SAFR-032...................... 107  3e-24  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Bacillus p...   
. .Caldibacillus debilis.......................... 107  3e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Caldibacil...   
. .Geobacillus caldoxylosilyticus NBRC 107762..... 107  4e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Geobacillus caldoxyl...   
. .Virgibacillus sp. CM-4......................... 106  4e-24  2 hits  Bacteria:Firmicutes:Bacilli:Bacillales:  hypothetical protein [Virgibacillus sp. C...   
. .Staphylococcus pseudintermedius................ 106  4e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyltranstransferase [Staphylococcus p...   
. .Geobacillus caldoxylosilyticus................. 106  5e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  farnesyl-diphosphate synthase [Geobacillu...   
. .Bacillus sp. SB49.............................. 106  5e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  geranyl transferase [Bacillus sp. SB49]        
. .Thermoactinomyces sp. Gus2-1................... 106  6e-24  1 hit   Bacteria:Firmicutes:Bacilli:Bacillales:  polyprenyl synthetase [Thermoactinomyces sp. G...   
. .Mitsuokella multacida.......................... 150  2e-40  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Mitsuokell...   
. .Zymophilus raffinosivorans..................... 149  6e-40  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: hypothetical protein [Zymophilus raffinos...   
. .Megamonas hypermegale.......................... 149  6e-40  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Megamonas ...   
. .Megamonas funiformis........................... 149  6e-40  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Megamonas ...   
. .Megamonas rupellensis.......................... 148  8e-40  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: geranyl transferase [Megamonas rupellensis]    
. .Facklamia hominis.............................. 146  4e-39  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Facklamia hominis]       
. .Selenomonas artemidis.......................... 146  7e-39  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Selenomona...   
. .Clostridium termitidis......................... 146  8e-39  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: Geranylgeranyl pyrophosphate synthase [ [...   
. .Selenomonas sp. FOBRC9......................... 145  1e-38  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Selenomona...   
. .Clostridium cellobioparum...................... 145  1e-38  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [ [Clostrid...   
. .Selenomonas sp. oral taxon 137................. 144  2e-38  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Selenomona...   
. .Turicibacter................................... 144  3e-38  1 hit   Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: MULTISPECIES: farnesyl-diphosphate syntha...   
. .Streptococcus pneumoniae....................... 144  5e-38  32 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pn...   
. .Streptococcus mitis............................ 143  7e-38  30 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mitis]       
. .Lactococcus garvieae........................... 143  7e-38  10 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactococcu...   
. .Streptococcus castoreus........................ 142  2e-37  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Streptococcus castor...   
. .Aerococcus viridans............................ 142  2e-37  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Aerococcus virid...   
. .Selenomonas noxia.............................. 142  2e-37  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Selenomona...   
. .Aerococcus urinae.............................. 142  3e-37  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Aerococcus urinae]    
. .Lactococcus garvieae IPLA 31405................ 141  4e-37  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactococcu...   
. .Lactococcus garvieae ATCC 49156................ 141  4e-37  4 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactococcu...   
. .Lactococcus garvieae Lg2....................... 141  4e-37  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactococcu...   
. .Streptococcus pyogenes......................... 140  6e-37  19 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus py...   
. .Acidaminococcus sp. BV3L6...................... 140  7e-37  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: geranyltranstransferase domain protein [A...   
. .Streptococcus canis............................ 140  7e-37  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus ca...   
. .Acidaminococcus................................ 140  8e-37  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: MULTISPECIES: farnesyl-diphosphate syntha...   
. .Streptococcus dysgalactiae..................... 140  1e-36  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus dy...   
. .Lactobacillus reuteri.......................... 140  1e-36  9 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Streptococcus pyogenes MGAS8232................ 140  1e-36  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus py...   
. .Selenomonas ruminantium........................ 140  1e-36  4 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: geranyl transferase [Selenomonas ruminant...   
. .Desulfurispora thermophila..................... 139  2e-36  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranyl transferase [Desulfurispora therm...   
. .Streptococcus pyogenes MGAS10270............... 139  2e-36  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Dimethylallyltransferase / Geranyltranstr...   
. .Streptococcus.................................. 139  2e-36  7 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: geranyltranstransferase [St...   
. .Streptococcus dysgalactiae subsp. equisimilis G 139  2e-36  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus dy...   
. .Streptococcus pyogenes MGAS10394............... 139  2e-36  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus py...   
. .Enterococcus faecium........................... 139  2e-36  18 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Enterococc...   
. .Streptococcus pyogenes GA06023................. 139  2e-36  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: polyprenyl synthetase [Streptococcus pyog...   
. .Streptococcus pyogenes Alab49.................. 139  3e-36  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus py...   
. .Selenomonas bovis.............................. 139  3e-36  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: geranyl transferase [Selenomonas bovis]        
. .Streptococcus pyogenes MGAS15252............... 139  3e-36  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus py...   
. .Streptococcus pyogenes MGAS6180................ 139  3e-36  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus py...   
. .Desulfosporosinus orientis..................... 139  3e-36  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Desulfospo...   
. .Streptococcus pyogenes GA16797................. 139  3e-36  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: polyprenyl synthetase [Streptococcus pyog...   
. .Lactobacillus fuchuensis....................... 139  3e-36  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Lactobacillus fuchue...   
. .Streptococcus pyogenes MGAS9429................ 139  3e-36  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus py...   
. .Selenomonas noxia F0398........................ 139  3e-36  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Selenomona...   
. .Clostridiales bacterium 9401234................ 139  3e-36  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Clostridiales bacte...   
. .Streptococcus pyogenes GA03799................. 139  4e-36  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: polyprenyl synthetase [Streptococcus pyog...   
. .Lactobacillus gastricus........................ 139  4e-36  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Streptococcus pyogenes GA03747................. 139  4e-36  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: polyprenyl synthetase [Streptococcus pyog...   
. .Enterococcus faecium Com15..................... 139  5e-36  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Enterococc...   
. .Enterococcus saccharolyticus................... 139  5e-36  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Enterococcus saccha...   
. .Enterococcus faecium E980...................... 139  5e-36  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Enterococc...   
. .Enterococcus faecium E1007..................... 139  5e-36  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranylgeranyl diphosphate synthase, type...   
. .Enterococcus faecium E1861..................... 139  5e-36  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranylgeranyl diphosphate synthase, type...   
. .Enterococcus faecium EnGen0176................. 138  5e-36  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranylgeranyl diphosphate synthase, type...   
. .Enterococcus faecium UC7256.................... 138  5e-36  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Enterococcus faecium]     
. .Anaerovibrio lipolyticus....................... 138  6e-36  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: geranyl transferase [Anaerovibrio lipolyt...   
. .Clostridium stercorarium....................... 138  6e-36  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl diphosphate synthase [ [[Clostri...   
. .Enterococcus faecium EnGen0263................. 138  6e-36  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranylgeranyl diphosphate synthase, type II [...   
. .Enterococcus faecium TX1330.................... 138  7e-36  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Enterococc...   
. .Lactobacillus reuteri 100-23................... 138  7e-36  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Enterococcus faecium UC8668.................... 138  7e-36  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Enterococcus faecium]     
. .Enterococcus faecium SD2A-2.................... 138  8e-36  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Enterococcus fae...   
. .Streptococcus parauberis....................... 137  9e-36  5 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pa...   
. .Streptococcus parauberis NCFD 2020............. 137  9e-36  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pa...   
. .Streptococcus parauberis KRS-02109............. 137  1e-35  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: Octaprenyl-diphosphate synthase [Streptoc...   
. .Streptococcus thermophilus..................... 137  1e-35  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: (2E,6E)-farnesyl diphosphate synthase [St...   
. .Mitsuokella sp. oral taxon 131................. 137  1e-35  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: putative geranyltranstransferase [Mitsuok...   
. .Enterococcus faecium EnGen0165................. 137  1e-35  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranylgeranyl diphosphate synthase, type...   
. .Desulfosporosinus youngiae..................... 137  1e-35  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Desulfospo...   
. .Acidaminococcus fermentans..................... 137  1e-35  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Acidaminoc...   
. .Lactobacillus sakei............................ 137  1e-35  4 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Enterococcus durans............................ 137  2e-35  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: octaprenyl-diphosphate synthase/ dimethyl...   
. .Streptococcus sp. SK140........................ 137  2e-35  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sp...   
. .Selenomonas sp. oral taxon 149................. 137  2e-35  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Selenomona...   
. .Enterococcus faecium 1,231,501................. 137  2e-35  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Enterococc...   
. .Lactobacillus reuteri SD2112................... 137  2e-35  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Enterococcus faecium EnGen0171................. 137  2e-35  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranylgeranyl diphosphate synthase, type...   
. .Enterococcus faecium E0045..................... 137  2e-35  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranylgeranyl diphosphate synthase, type...   
. .Enterococcus faecalis TX1337RF................. 137  2e-35  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Enterococc...   
. .Enterococcus gallinarum........................ 137  2e-35  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Enterococc...   
. .Streptococcus ferus............................ 137  2e-35  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Streptococcus ferus]     
. .Enterococcus faecium E0120..................... 137  2e-35  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranylgeranyl diphosphate synthase, type...   
. .Enterococcus................................... 137  3e-35  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: farnesyl-diphosphate syntha...   
. .Lactobacillus reuteri DSM 20016................ 136  3e-35  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Enterococcus saccharolyticus 30_1.............. 136  3e-35  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: farnesyl-diphosphate syntha...   
. .Selenomonas flueggei........................... 136  3e-35  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Selenomona...   
. .Streptococcus henryi........................... 136  4e-35  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus he...   
. .Enterococcus casseliflavus ATCC 12755.......... 136  4e-35  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: farnesyl-diphosphate syntha...   
. .Lactobacillus sakei subsp. sakei 23K........... 136  4e-35  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Enterococcus hirae............................. 136  5e-35  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Enterococc...   
. .Anaerovibrio sp. RM50.......................... 135  6e-35  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: geranyl transferase [Anaerovibrio sp. RM50]    
. .Desulfosporosinus sp. OT....................... 135  6e-35  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Desulfospo...   
. .Lactobacillus reuteri TD1...................... 135  7e-35  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Thermobrachium celere.......................... 135  7e-35  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: Octaprenyl diphosphate synthase / Dimethy...   
. .Streptococcus cristatus........................ 135  9e-35  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus cr...   
. .Streptococcus sinensis......................... 135  9e-35  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: Octaprenyl-diphosphate synthase [Streptococcus...   
. .Streptococcus devriesei........................ 135  1e-34  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Streptococcus devrie...   
. .Streptococcus pyogenes str. Manfredo........... 135  1e-34  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus py...   
. .Enterococcus casseliflavus..................... 135  1e-34  4 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Enterococcus cas...   
. .Acetivibrio cellulolyticus..................... 135  1e-34  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Acetivibri...   
. .Ruminococcus albus............................. 135  1e-34  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Ruminococcus albus]     
. .Youngiibacter fragile.......................... 134  2e-34  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Yo...   
. .Ruminococcaceae bacterium D16.................. 134  2e-34  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Ruminococc...   
. .Pelotomaculum thermopropionicum................ 134  2e-34  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Pelotomacu...   
. .Selenomonas sp. F0473.......................... 134  2e-34  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: hypothetical protein [Selenomonas sp. F0473]   
. .Streptococcus equinus.......................... 134  2e-34  5 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus eq...   
. .Desulfitobacterium metallireducens DSM 15288... 134  2e-34  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Desulfitobacter...   
. .Caloramator sp. ALD01.......................... 134  2e-34  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Caloramato...   
. .Clostridiales bacterium S5-A11................. 134  2e-34  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein HMPREF1633_00680 [Clostri...   
. .Streptococcus oligofermentans.................. 134  2e-34  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl diphosphate synthase [Streptococ...   
. .Enterococcus casseliflavus 14-MB-W-14.......... 134  2e-34  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Enterococcus cas...   
. .Enterococcus flavescens ATCC 49996............. 134  3e-34  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Enterococcus cas...   
. .Streptococcus merionis......................... 134  3e-34  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Streptococcus merio...   
. .Lactobacillus coryniformis..................... 134  3e-34  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Enterococcus casseliflavus EC30................ 134  3e-34  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Enterococc...   
. .Lactobacillus coryniformis subsp. coryniformis  134  3e-34  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Streptococcus parauberis KRS-02083............. 133  3e-34  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: Geranylgeranyl pyrophosphate synthetase [...   
. .Selenomonas sp. oral taxon 892................. 133  4e-34  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: putative geranyltranstransferase [Selenom...   
. .Streptococcus bovis ATCC 33317................. 133  4e-34  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus bovis A...   
. .Streptococcus massiliensis..................... 133  5e-34  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Streptococcus massi...   
. .Streptococcus mutans........................... 133  5e-34  39 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mu...   
. .Desulfosporosinus meridiei..................... 133  5e-34  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Desulfospo...   
. .Lactobacillus mali............................. 133  5e-34  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Eremococcus coleocola.......................... 133  5e-34  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Eremococcus coleocola]    
. .Desulfotomaculum hydrothermale................. 133  5e-34  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: Farnesyl diphosphate synthase [Desulfotom...   
. .Eremococcus coleocola ACS-139-V-Col8........... 133  5e-34  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Eremococcus cole...   
. .Enterococcus italicus.......................... 133  5e-34  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Enterococc...   
. .Streptococcus salivarius....................... 133  6e-34  9 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sa...   
. .Enterococcus mundtii........................... 133  6e-34  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranylgeranyl diphosphate synthase, type...   
. .Lactobacillus sucicola DSM 21376............... 132  8e-34  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: octaprenyl-diphosphate synthase [Lactobacillu...   
. .Lactococcus lactis............................. 132  8e-34  14 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactococcu...   
. .Streptococcus salivarius CCHSS3................ 132  8e-34  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sa...   
. .Granulicatella elegans......................... 132  9e-34  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Granulicatella e...   
. .Lactobacillus sanfranciscensis................. 132  1e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyltranstransferase [Lactobacillus s...   
. .Lactococcus lactis subsp. cremoris MG1363...... 132  1e-33  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactococcu...   
. .Streptococcus sp. HSISS3....................... 132  1e-33  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Geranyltranstransferase [Streptococcus sp...   
. .Streptococcus ictaluri......................... 132  1e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus ic...   
. .Lactococcus lactis subsp. cremoris SK11........ 132  1e-33  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactococcu...   
. .Streptococcus agalactiae....................... 132  1e-33  12 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus ag...   
. .Streptococcus agalactiae FSL S3-026............ 132  1e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus ag...   
. .Lactococcus lactis subsp. cremoris KW2......... 132  1e-33  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactococcus lactis]   
. .Streptococcus agalactiae 2603V/R............... 132  1e-33  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus ag...   
. .Lactobacillus fructivorans..................... 132  1e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyltranstransferase [Lactobacillus f...   
. .Streptococcus agalactiae GB00112............... 132  1e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus ag...   
. .Streptococcus suis............................. 132  1e-33  32 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: geranylgeranyl pyrophosphate synthase [St...   
. .Clostridium clariflavum........................ 132  2e-33  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [ [Clostrid...   
. .Streptococcus vestibularis..................... 132  2e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus ve...   
. .Desulfosporosinus sp. HMP52.................... 132  2e-33  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranyl transferase [Desulfosporosinus sp. HMP52]   
. .Enterococcus mundtii CRL35..................... 132  2e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Enterococcus mu...   
. .Carnobacterium sp. 17-4........................ 132  2e-33  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Carnobacte...   
. .Ruminococcus albus SY3......................... 132  2e-33  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranyl transferase [Ruminococcus albus SY3]        
. .Thermincola potens............................. 132  2e-33  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Thermincol...   
. .Streptococcus mutans SF12...................... 131  2e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: putative farnesyl diphosphate synthase [S...   
. .Streptococcus marimammalium.................... 131  2e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Streptococcus marim...   
. .Sulfobacillus thermosulfidooxidans............. 131  2e-33  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Sulfobacillus therm...   
. .Weissella thailandensis fsh4-2................. 131  2e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Weissella thailanden...   
. .Streptococcus mutans M21....................... 131  2e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: putative farnesyl diphosphate synthase [S...   
. .Enterococcus mundtii QU 25..................... 131  3e-33  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: octaprenyl-diphosphate synthase/ dimethyl...   
. .Lactococcus lactis subsp. cremoris UC509.9..... 131  3e-33  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Dimethylallyltransferase/geranyltranstran...   
. .Streptococcus mutans 66-2A..................... 131  3e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: putative farnesyl diphosphate synthase [S...   
. .Melissococcus plutonius........................ 131  3e-33  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Melissococ...   
. .Streptococcus thoraltensis..................... 131  4e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Streptococcus thora...   
. .Streptococcus mutans 1SM1...................... 131  4e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: putative farnesyl diphosphate synthase [S...   
. .Streptococcus sp. C150......................... 130  4e-33  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sp...   
. .Streptococcus porcinus......................... 130  4e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus po...   
. .Streptococcus mutans 5SM3...................... 130  4e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: putative farnesyl diphosphate synthase [S...   
. .Streptococcus mutans NLML8..................... 130  4e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: putative farnesyl diphosphate synthase [S...   
. .Streptococcus mutans NCTC 11060................ 130  4e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl diphosphate synthase [Streptococ...   
. .Streptococcus mutans SM1....................... 130  5e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: putative farnesyl diphosphate synthase [S...   
. .Streptococcus mutans 15VF2..................... 130  5e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: putative farnesyl diphosphate synthase [S...   
. .Streptococcus mutans SF1....................... 130  5e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: putative farnesyl diphosphate synthase [S...   
. .Streptococcus mutans GS-5...................... 130  5e-33  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mu...   
. .Streptococcus mutans NVAB...................... 130  5e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: putative farnesyl diphosphate synthase [S...   
. .Streptococcus mutans 1ID3...................... 130  5e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: putative farnesyl diphosphate synthase [S...   
. .Melissococcus plutonius DAT561................. 130  5e-33  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Melissococ...   
. .Clostridiales bacterium VE202-01............... 130  5e-33  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridia...   
. .Clostridium saccharogumia...................... 130  5e-33  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [ [Clostrid...   
. .Streptococcus entericus........................ 130  5e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Streptococcus enter...   
. .Streptococcus thermophilus MTCC 5461........... 130  7e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase, farnesyl diphosp...   
. .Solobacterium moorei........................... 130  7e-33  2 hits  Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: putative geranyltranstransferase [Solobac...   
. .Desulfotomaculum alcoholivorax................. 130  8e-33  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranyl transferase [Desulfotomaculum alc...   
. .Clostridium sp. D3RC-2......................... 130  8e-33  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Proteiniclasticum r...   
. .Oscillibacter sp. ER4.......................... 130  9e-33  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Oscillibacter sp. ER4]   
. .Lactobacillus antri............................ 130  9e-33  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Clostridium sp. BNL1100........................ 130  1e-32  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridiu...   
. .Lactococcus lactis subsp. cremoris GE214....... 130  1e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: Geranyltranstransferase [Lactococcus lactis su...   
. .Dialister succinatiphilus...................... 129  1e-32  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Dialister ...   
. .Lactobacillus amylolyticus..................... 129  1e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus am...   
. .Selenomonas sputigena.......................... 129  1e-32  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Selenomona...   
. .Selenomonas sp. CM52........................... 129  1e-32  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Selenomona...   
. .Streptococcus mutans SF14...................... 129  1e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: putative farnesyl diphosphate synthase [S...   
. .Lactobacillus malefermentans................... 129  2e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Streptococcus mutans UA159..................... 129  2e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mu...   
. .Streptococcus mutans LJ23...................... 129  2e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mu...   
. .Streptococcus mutans N66....................... 129  2e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: putative farnesyl diphosphate synthase [S...   
. .Lactobacillus fermentum........................ 129  2e-32  5 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Centipeda periodontii.......................... 129  2e-32  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Centipeda ...   
. .Streptococcus mutans NN2025.................... 129  2e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mu...   
. .Streptococcus mutans N34....................... 129  2e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: putative farnesyl diphosphate synthase [S...   
. .Streptococcus mutans NMT4863................... 129  2e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: putative farnesyl diphosphate synthase [S...   
. .Streptococcus suis R61......................... 129  2e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus suis]   
. .Streptococcus suis 89/1591..................... 129  2e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus suis]   
. .Streptococcus suis ST3......................... 129  2e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus suis]   
. .Streptococcus suis D12......................... 129  2e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus suis]   
. .Streptococcus suis 05ZYH33..................... 129  2e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus suis]   
. .Streptococcus thermophilus LMG 18311........... 129  2e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus th...   
. .Lactobacillus delbrueckii...................... 129  2e-32  7 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus de...   
. .Lactobacillus coleohominis..................... 129  2e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Candidatus Desulforudis audaxviator............ 129  2e-32  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Candidatus...   
. .Lactobacillus delbrueckii subsp. lactis CRL581. 129  2e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Thermoanaerobacterium thermosaccharolyticum.... 129  3e-32  2 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: geranylgeranyl pyrophosphate synthase [Th...   
. .Carnobacterium maltaromaticum.................. 129  3e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Carnobacte...   
. .Lactobacillus delbrueckii subsp. lactis........ 129  3e-32  4 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Geranylgeranyl pyrophosphate synthase [Lactob...   
. .Carnobacterium maltaromaticum LMA28............ 129  3e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl diphosphate synthase [Carnobacte...   
. .Lactobacillus delbrueckii subsp. bulgaricus ND0 128  3e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus de...   
. .Weissella cibaria.............................. 128  3e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Weissella cibaria]    
. .Lactococcus lactis subsp. lactis KF147......... 128  3e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactococcu...   
. .Lactococcus lactis subsp. lactis Il1403........ 128  3e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactococcu...   
. .Lactococcus lactis subsp. lactis A12........... 128  3e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: Farnesyl diphosphate synthase [Lactococcu...   
. .Enterococcus gallinarum EGD-AAK12.............. 128  3e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Enterococcus ga...   
. .Lactococcus lactis subsp. lactis Dephy 1....... 128  3e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: Octaprenyl diphosphate synthase / Dimethy...   
. .Carboxydothermus hydrogenoformans.............. 128  4e-32  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: farnesyl-diphosphate synthase [Carboxydot...   
. .Lactococcus lactis subsp. lactis NCDO 2118..... 128  4e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: Geranyltranstransferase [Lactococcus lactis su...   
. .Lactococcus lactis subsp. lactis KLDS 4.0325... 128  4e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactococcu...   
. .Lactococcus lactis subsp. lactis IO-1.......... 128  4e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactococcus lactis]   
. .Catellicoccus marimammalium.................... 128  4e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: Octaprenyl-diphosphate synthase [Catellic...   
. .Lactobacillus curvatus......................... 128  4e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Carboxydothermus ferrireducens................. 128  4e-32  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: polyprenyl synthetase [Carboxydothermus f...   
. .Streptococcus mutans 11SSST2................... 128  4e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: putative farnesyl diphosphate synthase [S...   
. .Streptococcus plurextorum...................... 128  4e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Streptococcus plurex...   
. .Succinispira mobilis........................... 128  4e-32  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: hypothetical protein [Succinispira mobilis]    
. .Lactobacillus fermentum F-6.................... 128  5e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Geranyltranstransferase [Lactobacillus fe...   
. .Megasphaera micronuciformis.................... 128  5e-32  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Megasphaer...   
. .Streptococcus ratti............................ 128  5e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus ra...   
. .Streptococcus suis TL13........................ 128  5e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Geranylgeranyl pyrophosphate synthase [St...   
. .Streptococcus mutans N29....................... 128  5e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: putative farnesyl diphosphate synthase [S...   
. .Alkaliphilus metalliredigens................... 128  5e-32  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Alkaliphil...   
. .Lactobacillus salivarius....................... 128  6e-32  7 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Lactobacillus fermentum IFO 3956............... 127  5e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Streptococcus uberis 0140J..................... 127  5e-32  6 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Chain A, Crystal Structure Of Geranylgeranyl Dipho...   
. .Clostridium sp. ASF356......................... 127  6e-32  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Clostridium sp. ASF...   
. .Streptococcus urinalis......................... 127  6e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Streptococcus urina...   
. .Thermoanaerobacter italicus.................... 127  6e-32  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: farnesyl-diphosphate synthase [Thermoanae...   
. .Streptococcus urinalis 2285-97................. 127  7e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus ur...   
. .Eubacterium sp. 3_1_31......................... 127  7e-32  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Eubacterium sp. 3_1...   
. .Lactobacillus fermentum NB-22.................. 127  7e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Eubacterium eligens............................ 127  8e-32  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [ [Eubacter...   
. .Streptococcus mutans NFSM1..................... 127  8e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: putative farnesyl diphosphate synthase [S...   
. .Lactobacillus fermentum CECT 5716.............. 127  8e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Clostridium difficile.......................... 127  8e-32  14 hits Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase family protein [[Cl...   
. .Lactobacillus oris............................. 127  8e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Lactobacillus oris F0423....................... 127  9e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Lactobacillus pobuzihii........................ 127  9e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Lactobacillus pobuz...   
. .Lactobacillus delbrueckii subsp. bulgaricus PB2 127  9e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus de...   
. .Lactobacillus delbrueckii subsp. bulgaricus ATC 127  9e-32  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus de...   
. .Lactobacillus casei............................ 127  9e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Lactobacillus casei]           
. .Enterococcus gilvus............................ 127  9e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Enterococcus gilvus]     
. .Lactobacillus delbrueckii ZN7a-9............... 127  9e-32  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: Geranylgeranyl diphosphate synthase [Lact...   
. .Clostridium thermocellum....................... 127  1e-31  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridiu...   
. .Clostridium difficile CD69..................... 127  1e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase family protein [[Cl...   
. .Desulfotomaculum reducens...................... 127  1e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Desulfotom...   
. .Thermoanaerobacterium thermosaccharolyticum DSM 127  1e-31  2 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: farnesyl-diphosphate synthase [Thermoanae...   
. .Selenomonas sp. FOBRC6......................... 127  1e-31  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Selenomona...   
. .Clostridium difficile F253..................... 127  1e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase family protein [[Cl...   
. .Lactobacillus delbrueckii subsp. bulgaricus.... 127  1e-31  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Geranylgeranyl pyrophosphate synthase [Lactob...   
. .Enterococcus avium............................. 127  1e-31  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Enterococcus avium]   
. .Phascolarctobacterium sp. YIT 12068............ 126  1e-31  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Phascolarc...   
. .Dialister invisus.............................. 126  1e-31  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Dialister ...   
. .Veillonella sp. oral taxon 158................. 126  2e-31  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Veillonell...   
. .Streptococcus didelphis........................ 126  2e-31  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Streptococcus didel...   
. .Desulfosporosinus acidiphilus.................. 126  2e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Desulfospo...   
. .Lactobacillus sp. F9-1......................... 126  2e-31  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyltranstransferase [Lactobacillus f...   
. .Streptococcus iniae............................ 126  2e-31  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus in...   
. .Syntrophobotulus glycolicus.................... 126  2e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Syntrophob...   
. .Anaerotruncus sp. G3(2012)..................... 126  2e-31  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Anaerotruncus sp. G...   
. .Clostridium difficile 050-P50-2011............. 126  2e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [[Clostridi...   
. .Eubacterium dolichum........................... 126  2e-31  1 hit   Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: hypothetical protein [ [[Eubacterium] dol...   
. .Clostridium difficile CD17..................... 126  2e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase family protein [[Cl...   
. .Clostridium sp. MSTE9.......................... 126  2e-31  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridiu...   
. .Clostridium difficile 630...................... 126  2e-31  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [[Clostridi...   
. .Clostridium difficile 70-100-2010.............. 126  2e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [[Clostridi...   
. .Clostridium difficile NAP08.................... 126  2e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [[Clostridi...   
. .Clostridium thermocellum ATCC 27405............ 126  2e-31  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridiu...   
. .Clostridium thermocellum JW20.................. 126  2e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridiu...   
. .Lactobacillus sp. wkB10........................ 126  3e-31  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: Octaprenyl diphosphate synthase [Lactobacillus...   
. .Streptococcus equi............................. 126  3e-31  5 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus equi]   
. .Desulfotomaculum ruminis....................... 126  3e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Desulfotom...   
. .Anaerofustis stercorihominis................... 126  3e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Anaerofust...   
. .Clostridium ultunense.......................... 126  3e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Clostridium ultu...   
. .Thermoanaerobacter............................. 125  3e-31  3 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: MULTISPECIES: farnesyl-diphosphate syntha...   
. .Clostridium difficile P42...................... 125  3e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase family protein [[Cl...   
. .Clostridium cellulolyticum..................... 125  3e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [ [Clostrid...   
. .Lactobacillus vini............................. 125  3e-31  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Clostridiales bacterium VE202-08............... 125  3e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Clostridiales bacte...   
. .Clostridium glycolicum......................... 125  3e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [[Clostridi...   
. .Desulfotomaculum alkaliphilum.................. 125  4e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Desulfotomaculum al...   
. .Streptococcus pseudoporcinus................... 125  4e-31  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus ps...   
. .Peptostreptococcaceae bacterium VA2............ 125  4e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Peptostrep...   
. .Clostridium methylpentosum..................... 125  4e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [ [Clostrid...   
. .Clostridium cellulosi.......................... 125  4e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: Heterodimeric geranylgeranyl pyrophosphate sy...   
. .Streptococcus equi subsp. zooepidemicus S31A1.. 125  4e-31  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus equi]   
. .Ruminococcus sp. FC2018........................ 125  5e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranyl transferase [Ruminococcus sp. FC2...   
. .Veillonella sp. AS16........................... 125  5e-31  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: putative geranyltranstransferase [Veillonella ...   
. .Streptococcus equi subsp. zooepidemicus MGCS105 125  5e-31  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus equi]   
. .Lactobacillus suebicus......................... 125  5e-31  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Lactobacillus suebicus]   
. .Streptococcus equi subsp. zooepidemicus........ 125  5e-31  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus equi]   
. .Streptococcus equi subsp. zooepidemicus ATCC 35 125  5e-31  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus equi]   
. .Clostridium spiroforme......................... 125  5e-31  1 hit   Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: hypothetical protein [ [[Clostridium] spi...   
. .Clostridium sporosphaeroides................... 125  6e-31  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [ [Clostrid...   
. .Lactobacillus vaginalis........................ 125  6e-31  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Desulfitobacterium hafniense................... 125  6e-31  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Desulfitob...   
. .Lactobacillus acidipiscis...................... 125  7e-31  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Streptococcus equi subsp. ruminatorum CECT 5772 124  8e-31  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus equi su...   
. .Thermoanaerobacter kivui....................... 124  8e-31  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: farnesyl diphosphate synthase [Thermoanaerobac...   
. .Halanaerobium saccharolyticum.................. 124  8e-31  1 hit   Bacteria:Firmicutes:Clostridia:Halanaerobiales: Octaprenyl-diphosphate synthase / Dimethy...   
. .Eubacterium cylindroides DSM 3983.............. 124  9e-31  1 hit   Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: putative geranyltranstransferase [ [[Eubacteri...   
. .Lactobacillus salivarius UCC118................ 124  9e-31  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Lactobacillus plantarum........................ 124  1e-30  12 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: Polyprenyl synthetase [Lactobacillus plan...   
. .Clostridium sticklandii........................ 124  1e-30  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [ [[Clostridium] ...   
. .Enterococcus faecalis.......................... 124  1e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Enterococcus fae...   
. .Lactobacillus salivarius CECT 5713............. 124  1e-30  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Eubacterium cylindroides....................... 124  1e-30  1 hit   Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: Geranylgeranyl pyrophosphate synthase [ [...   
. .Lactobacillus salivarius DSM 20555............. 124  1e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Clostridium mangenotii......................... 124  1e-30  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [ [[Clostri...   
. .Lactobacillus plantarum subsp. plantarum P-8... 124  1e-30  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Geranyltranstransferase [Lactobacillus pl...   
. .Veillonella parvula............................ 124  1e-30  4 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Veillonell...   
. .Weissella halotolerans......................... 124  1e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Weissella haloto...   
. .Sporomusa ovata................................ 124  1e-30  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: geranyltranstransferase CrtE [Sporomusa o...   
. .Lactobacillus plantarum 4_3.................... 124  1e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus pl...   
. .Lactobacillus psittaci......................... 124  1e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Lactobacillus psittaci]   
. .Abiotrophia defectiva.......................... 124  1e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: putative geranyltranstransferase [Abiotro...   
. .Streptococcus parasanguinis.................... 124  1e-30  8 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Streptococcus parasa...   
. .Lactobacillus farciminis....................... 124  1e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Clostridium difficile Y270..................... 124  1e-30  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase family protein [[Cl...   
. .Caloramator australicus........................ 124  1e-30  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Caloramato...   
. .Eubacterium saphenum........................... 124  2e-30  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Eubacterium saph...   
. .Clostridium papyrosolvens...................... 124  2e-30  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [ [Clostrid...   
. .Clostridium papyrosolvens C7................... 124  2e-30  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [ [Clostrid...   
. .Veillonella parvula DSM 2008................... 124  2e-30  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Veillonell...   
. .Lactobacillus gasseri.......................... 124  2e-30  4 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus ga...   
. .Lactobacillus gasseri ATCC 33323............... 124  2e-30  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus ga...   
. .Lactobacillus pasteurii........................ 124  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus pa...   
. .Lactobacillus plantarum subsp. plantarum ATCC 1 124  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Caloranaerobacter azorensis H53214............. 124  2e-30  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Caloranaerobact...   
. .Moorella thermoacetica......................... 124  2e-30  2 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: polyprenyl synthetase [Moorella thermoace...   
. .Desulfitobacterium hafniense DCB-2............. 124  2e-30  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Desulfitob...   
. .Facklamia ignava............................... 124  2e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Facklamia ignava]        
. .Moorella thermoacetica ATCC 39073.............. 124  2e-30  2 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: farnesyl-diphosphate synthase [Moorella t...   
. .Veillonella sp. 3_1_44......................... 123  2e-30  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Veillonell...   
. .Veillonella parvula ACS-068-V-Sch12............ 123  2e-30  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Veillonell...   
. .Weissella paramesenteroides.................... 123  3e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Weissella parame...   
. .Lactobacillus gasseri K7....................... 123  3e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Lactobacillus gasseri K7]      
. .Lactobacillus helveticus....................... 123  3e-30  6 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus he...   
. .Lactobacillus gasseri 202-4.................... 123  3e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus ga...   
. .Streptococcus parasanguinis CC87K.............. 123  3e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Streptococcus paras...   
. .Lactobacillus gasseri JV-V03................... 123  3e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus ga...   
. .Veillonella sp. 6_1_27......................... 123  3e-30  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Veillonell...   
. .Pediococcus pentosaceus........................ 123  3e-30  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Pediococcu...   
. .Leuconostoc fallax............................. 123  4e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Leuconosto...   
. .Eubacterium ramulus............................ 123  4e-30  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: putative geranyltranstransferase [Eubacte...   
. .Thermoanaerobacterium saccharolyticum.......... 123  4e-30  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: farnesyl-diphosphate synthase [Thermoanae...   
. .Veillonella parvula HSIVP1..................... 123  4e-30  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: Geranyltranstransferase [Veillonella parv...   
. .Lactobacillus mucosae.......................... 123  4e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Anaerotruncus colihominis...................... 123  4e-30  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Anaerotruncus colih...   
. .Enterococcus malodoratus....................... 123  4e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Enterococcus malodo...   
. .Facklamia sourekii............................. 123  4e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Facklamia sourekii]       
. .Lactobacillus versmoldensis.................... 122  4e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Clostridium autoethanogenum.................... 122  4e-30  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: Polyprenyl synthetase [Clostridium autoet...   
. .Lactobacillus equi............................. 122  4e-30  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Lactobacillus equi]       
. .Veillonella dispar............................. 122  4e-30  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Veillonell...   
. .Pediococcus pentosaceus ATCC 25745............. 122  5e-30  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Pediococcu...   
. .Clostridium ljungdahlii........................ 122  5e-30  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Lactobacillus plantarum ZJ316.................. 122  5e-30  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Polyprenyl synthetase [Lactobacillus plan...   
. .Lactobacillus plantarum JDM1................... 122  5e-30  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Thermoanaerobacterium xylanolyticum............ 122  5e-30  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: farnesyl-diphosphate synthase [Thermoanae...   
. .Veillonella atypica............................ 122  5e-30  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Veillonell...   
. .Veillonella sp. HPA0037........................ 122  5e-30  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: hypothetical protein [Veillonella sp. HPA...   
. .Lactobacillus helveticus H9.................... 122  6e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: Geranyltranstransferase [Lactobacillus helveti...   
. .Lactobacillus rossiae.......................... 122  6e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Lactobacillus rossiae]   
. .Veillonella.................................... 122  6e-30  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: MULTISPECIES: farnesyl-diphosphate syntha...   
. .Lactobacillus buchneri......................... 122  6e-30  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Lactobacillus helveticus H10................... 122  6e-30  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus he...   
. .Lactobacillus hominis.......................... 122  7e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus ho...   
. .Lactobacillus helveticus CIRM-BIA 951.......... 122  7e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: Geranylgeranyl diphosphate synthase [Lact...   
. .Subdoligranulum sp. 4_3_54A2FAA................ 122  7e-30  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Subdoligranulum sp....   
. .Phascolarctobacterium sp. CAG:207.............. 122  7e-30  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: geranyltranstransferase [Phascolarctobact...   
. .Halanaerobium praevalens....................... 122  7e-30  1 hit   Bacteria:Firmicutes:Clostridia:Halanaerobiales: farnesyl-diphosphate synthase [Halanaerob...   
. .Lactococcus raffinolactis...................... 122  7e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactococcu...   
. .Caldanaerobius polysaccharolyticus............. 122  9e-30  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: hypothetical protein [Caldanaerobius poly...   
. .Lactobacillus equi DPC 6820.................... 122  9e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus equi]   
. .Streptococcus sp. oral taxon 071 str. 73H25AP.. 122  9e-30  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: geranyltranstransferase [St...   
. .Clostridiales bacterium S5-A14a................ 122  9e-30  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridiales b...   
. .Alkaliphilus oremlandii........................ 122  1e-29  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Alkaliphil...   
. .Clostridium bartlettii......................... 122  1e-29  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [[Clostridi...   
. .Lactobacillus plantarum subsp. plantarum ST-III 122  1e-29  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Veillonella sp. ICM51a......................... 121  1e-29  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: polyprenyl synthetase [Veillonella sp. ICM51a]      
. .Clostridium celatum............................ 121  1e-29  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: putative geranyltranstransferase [Clostri...   
. .Lactobacillus buchneri CD034................... 121  1e-29  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Desulfitobacterium dichloroeliminans........... 121  1e-29  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Desulfitob...   
. .Lactobacillus helveticus CNRZ32................ 121  2e-29  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus he...   
. .Sharpea azabuensis............................. 121  2e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Sharpea az...   
. .Lactobacillus saerimneri....................... 121  2e-29  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Lactobacillus saerim...   
. .Clostridium bartlettii DORA_8_9................ 121  2e-29  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein Q606_CBAC00381G0006 [Clos...   
. .Lactobacillus pentosus MP-10................... 121  2e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus pentos...   
. .Lactobacillus saerimneri 30a................... 121  2e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus sa...   
. .Lachnospiraceae bacterium 3-1.................. 121  2e-29  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl diphosphate synthase, type...   
. .Clostridium phytofermentans.................... 121  3e-29  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridiu...   
. .Thermosediminibacter oceani.................... 120  2e-29  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: farnesyl-diphosphate synthase [Thermosedi...   
. .Lactococcus chungangensis...................... 120  2e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Lactococcus chungang...   
. .Streptococcus oralis........................... 120  2e-29  12 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus oralis]      
. .Desulfotomaculum............................... 120  3e-29  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: MULTISPECIES: farnesyl-diphosphate syntha...   
. .Streptococcus oralis ATCC 49296................ 120  3e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus or...   
. .Streptococcus oralis SK304..................... 120  3e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus or...   
. .Streptococcus mitis SK569...................... 120  3e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mi...   
. .Lactobacillus sp. ASF360....................... 120  3e-29  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranylgeranyl diphosphate synthase, type...   
. .Lactobacillus ruminis.......................... 120  4e-29  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Streptococcus pneumoniae GA13856............... 120  4e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pn...   
. .Lactobacillus ruminis ATCC 25644............... 120  4e-29  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Lactobacillus.................................. 120  4e-29  4 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: farnesyl-diphosphate syntha...   
. .Lactobacillus ruminis ATCC 27782............... 120  4e-29  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Thermoanaerobacter sp. A7A..................... 120  4e-29  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: farnesyl-diphosphate synthase [Thermoanae...   
. .Butyricicoccus pullicaecorum................... 120  4e-29  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Butyricicoccus pull...   
. .Weissella sp. SG25............................. 120  4e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Weissella oryzae]         
. .Clostridium kluyveri........................... 120  4e-29  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Clostridium haemolyticum NCTC 9693............. 120  4e-29  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridium hae...   
. .Natranaerobius thermophilus.................... 120  4e-29  1 hit   Bacteria:Firmicutes:Clostridia:Natranaerobiales: farnesyl-diphosphate synthase [Natranaero...   
. .Candidatus Stoquefichus massiliensis........... 120  4e-29  1 hit   Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: farnesyl-diphosphate synthase [Candidatus...   
. .Thermoanaerobacter wiegelii.................... 120  4e-29  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: farnesyl-diphosphate synthase [Thermoanae...   
. .Lactobacillus paraplantarum.................... 120  5e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Lactobacillus paraplantarum]   
. .Streptococcus pseudopneumoniae................. 120  5e-29  6 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus ps...   
. .Streptococcus pseudopneumoniae G42............. 120  5e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus ps...   
. .Coprococcus catus.............................. 120  5e-29  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: Geranylgeranyl pyrophosphate synthase [Co...   
. .Clostridium haemolyticum NCTC 8350............. 120  5e-29  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridium hae...   
. .Atopococcus tabaci............................. 120  5e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Atopococcus tabaci]      
. .Thermoanaerobacter pseudethanolicus ATCC 33223. 120  5e-29  2 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: MULTISPECIES: farnesyl-diphosphate syntha...   
. .Streptococcus sp. I-P16........................ 120  5e-29  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sp...   
. .Streptococcus pneumoniae G54................... 120  5e-29  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pn...   
. .Clostridium straminisolvens JCM 21531.......... 120  5e-29  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: octaprenyl diphosphate synthase [ [ [Clostrid...   
. .Streptococcus oralis SK1074.................... 120  5e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus or...   
. .Lactobacillus parabrevis....................... 120  6e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Streptococcus ovis............................. 120  6e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Streptococcus ovis]      
. .Streptococcus mitis SK1080..................... 119  6e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mi...   
. .Clostridium botulinum.......................... 119  6e-29  23 hits Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Clostridium botulinum BKT015925................ 119  6e-29  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Helcococcus sueciensis......................... 119  6e-29  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Helcococcus suecien...   
. .Streptococcus pneumoniae 70585................. 119  6e-29  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pn...   
. .Streptococcus pneumoniae GA44511............... 119  6e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pn...   
. .Streptococcus pseudopneumoniae IS7493.......... 119  6e-29  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus ps...   
. .Streptococcus pneumoniae GA41317............... 119  6e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pn...   
. .Streptococcus mitis SK1073..................... 119  6e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mi...   
. .Veillonella montpellierensis................... 119  7e-29  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Veillonell...   
. .Clostridium kluyveri DSM 555................... 119  7e-29  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Streptococcus pneumoniae 2072047............... 119  7e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pn...   
. .Streptococcus pneumoniae TIGR4................. 119  7e-29  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pn...   
. .Streptococcus mitis bv. 2 str. F0392........... 119  7e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mi...   
. .Phascolarctobacterium sp. CAG:266.............. 119  7e-29  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: geranyltranstransferase [Phascolarctobact...   
. .Streptococcus mitis SK616...................... 119  7e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mi...   
. .Streptococcus pneumoniae SP6-BS73.............. 119  7e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pn...   
. .Streptococcus pneumoniae gamPNI0373............ 119  8e-29  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: putative geranyltranstransferase [Strepto...   
. .Streptococcus pneumoniae GA47210............... 119  8e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pn...   
. .Streptococcus pneumoniae SP14-BS69............. 119  8e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pn...   
. .Streptococcus pneumoniae GA41301............... 119  8e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pn...   
. .Lactobacillus casei subsp. casei ATCC 393...... 119  8e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus casei ...   
. .Lactobacillus kefiranofaciens.................. 119  8e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus ke...   
. .Streptococcus pseudopneumoniae 5247............ 119  9e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus ps...   
. .Streptococcus pneumoniae GA47373............... 119  9e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pn...   
. .Streptococcus mitis NCTC 12261................. 119  9e-29  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mi...   
. .Streptococcus pneumoniae R6.................... 119  1e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pn...   
. .Streptococcus pneumoniae 2070109............... 119  1e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pneumon...   
. .Streptococcus pneumoniae SP19-BS75............. 119  1e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pn...   
. .Lactobacillus rhamnosus........................ 119  1e-28  9 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Clostridium novyi B str. NCTC 9691............. 119  1e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridium nov...   
. .Streptococcus mitis bv. 2 str. SK95............ 119  1e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mi...   
. .Streptococcus australis........................ 119  1e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus au...   
. .Streptococcus mitis 29/42...................... 119  1e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mi...   
. .Clostridiales bacterium BV3C26................. 119  1e-28  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Clostridiales bact...   
. .Streptococcus pneumoniae OXC141................ 119  1e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pn...   
. .Lactobacillus paralimentarius.................. 119  1e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Clostridium botulinum D str. 1873.............. 119  1e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Lactobacillus zeae............................. 119  1e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Streptococcus mitis 11/5....................... 119  1e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mi...   
. .Streptococcus sp. C300......................... 119  1e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sp...   
. .Lactobacillus acidophilus 30SC................. 119  1e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: geranyltranstransferase [La...   
. .Streptococcus sp. DORA_10...................... 119  1e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: Geranyltranstransferase [Streptococcus sp. DOR...   
. .Streptococcus parasanguinis ATCC 15912......... 119  1e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pa...   
. .Lactobacillus johnsonii........................ 119  1e-28  5 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus jo...   
. .Streptococcus sp. BS35b........................ 119  1e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sp...   
. .Streptococcus sp. GMD2S........................ 119  1e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: geranyltranstransferase [St...   
. .Streptococcus oralis Uo5....................... 119  1e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus or...   
. .Clostridium sordellii.......................... 119  1e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase family protein [ [[...   
. .Streptococcus sp. GMD6S........................ 119  1e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: geranyltranstransferase [St...   
. .Streptococcus mitis SK575...................... 119  1e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mi...   
. .Lachnospiraceae bacterium AC2014............... 119  2e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Lachnospir...   
. .Clostridium phytofermentans ISDg............... 119  3e-28  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridiu...   
. .Streptococcus mitis 21/39...................... 118  2e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mi...   
. .Streptococcus mitis 18/56...................... 118  2e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mi...   
. .Clostridium novyi A str. BKT29909.............. 118  2e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridium nov...   
. .Streptococcus sp. VT 162....................... 118  2e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Streptococcus sp. VT 162]      
. .Streptococcus pneumoniae INV104................ 118  2e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pn...   
. .Clostridium novyi A str. 4552.................. 118  2e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridium nov...   
. .Clostridium botulinum C/D str. It1............. 118  2e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridium bot...   
. .Lactobacillus oryzae JCM 18671................. 118  2e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranylgeranyl diphosphate synthase, type II ...   
. .Desulfotomaculum thermocisternum............... 118  2e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranyl transferase [Desulfotomaculum the...   
. .Streptococcus mitis 13/39...................... 118  2e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mi...   
. .Streptococcus sp. M143......................... 118  2e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sp...   
. .Lactobacillus plantarum AY01................... 118  2e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus pl...   
. .Streptococcus mitis SK579...................... 118  2e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mi...   
. .Streptococcus oralis SK100..................... 118  2e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus or...   
. .Lactobacillus amylovorus....................... 118  2e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus am...   
. .Streptococcus pneumoniae GA47901............... 118  2e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pn...   
. .Streptococcus sp. M334......................... 118  2e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sp...   
. .Epulopiscium sp. 'N.t. morphotype B'........... 118  2e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranyl transferase [Epulopiscium sp. 'N....   
. .Lactobacillus crispatus........................ 118  2e-28  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus cr...   
. .Streptococcus pneumoniae ATCC 700669........... 118  2e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pn...   
. .Streptococcus criceti.......................... 118  2e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus cr...   
. .Clostridium hiranonis.......................... 118  2e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [ [[Clostri...   
. .Eggerthia catenaformis......................... 118  2e-28  2 hits  Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: hypothetical protein [Eggerthia catenafor...   
. .Streptococcus oralis SK10...................... 118  2e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus or...   
. .Veillonella montpellierensis DNF00314.......... 118  2e-28  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Veillonella mon...   
. .Lactobacillus rhamnosus Lc 705................. 118  2e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Streptococcus sp. AZ_3a........................ 118  2e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl diphosphate synthase [Streptococ...   
. .Lactobacillus johnsonii DPC 6026............... 118  2e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus jo...   
. .Streptococcus pneumoniae GA47976............... 118  2e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pn...   
. .Eubacterium saburreum.......................... 118  2e-28  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Lachnoanaerobacu...   
. .Allofustis seminis............................. 118  2e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Allofustis seminis]      
. .Lactobacillus kitasatonis...................... 118  2e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Lactobacillus kitasa...   
. .Streptococcus mitis B6......................... 118  2e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mi...   
. .Dialister micraerophilus....................... 118  2e-28  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Dialister ...   
. .Streptococcus pseudopneumoniae 1321............ 118  3e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus ps...   
. .Lactobacillus sp. wkB8......................... 118  3e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: Octaprenyl diphosphate synthase [Lactobacillus...   
. .Eubacterium sp. 14-2........................... 118  3e-28  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl diphosphate synthase, type...   
. .Lactobacillus johnsonii FI9785................. 118  3e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus jo...   
. .Lactobacillus johnsonii NCC 533................ 118  3e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus jo...   
. .Streptococcus pneumoniae SPNA45................ 118  3e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pn...   
. .Lachnoanaerobaculum sp. ICM7................... 118  3e-28  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Lachnospiraceae ...   
. .Pseudobutyrivibrio sp. MD2005.................. 118  3e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Pseudobuty...   
. .Lactobacillus pentosus IG1..................... 118  3e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus pentos...   
. .Streptococcus sp. SK643........................ 117  3e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sp...   
. .Clostridium lundense........................... 117  3e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridiu...   
. .Streptococcus parasanguinis F0449.............. 117  3e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pa...   
. .Streptococcus orisratti........................ 117  3e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Streptococcus orisr...   
. .Streptococcus mitis ATCC 6249.................. 117  3e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mi...   
. .Streptococcus pseudopneumoniae SK674........... 117  4e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus ps...   
. .Lactobacillus crispatus ST1.................... 117  4e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus cr...   
. .Streptococcus sp. CM6.......................... 117  4e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: polyprenyl synthetase [Streptococcus sp. CM6]       
. .Streptococcus oralis SK313..................... 117  4e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus or...   
. .Lactobacillus parafarraginis................... 117  4e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Streptococcus mitis 17/34...................... 117  4e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mi...   
. .Streptococcus oralis ATCC 35037................ 117  4e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus or...   
. .Desulfotomaculum gibsoniae..................... 117  4e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Desulfotom...   
. .Thermoanaerobacter sp. X514.................... 117  4e-28  2 hits  Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: MULTISPECIES: farnesyl-diphosphate syntha...   
. .Lactobacillus otakiensis....................... 117  5e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus ot...   
. .Streptococcus sp. F0441........................ 117  5e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Streptococcus sp. F...   
. .Streptococcus parasanguinis FW213.............. 117  5e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pa...   
. .Leuconostoc lactis............................. 117  5e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Leuconosto...   
. .Eubacterium saburreum F0468.................... 117  5e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Lachnoanaerobacu...   
. .Ruminococcus flavefaciens...................... 117  5e-28  4 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranyl transferase [Ruminococcus flavefa...   
. .Clostridium botulinum A3 str. Loch Maree....... 117  6e-28  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Eubacteriaceae bacterium CM5................... 117  6e-28  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Eubacteriaceae b...   
. .Streptococcus mitis 27/7....................... 117  6e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mi...   
. .Ammonifex degensii............................. 117  6e-28  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: farnesyl-diphosphate synthase [Ammonifex ...   
. .Streptococcus sp. oral taxon 058............... 117  6e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sp...   
. .Streptococcus parasanguinis F0405.............. 117  7e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pa...   
. .Clostridium botulinum C/D str. BKT75002........ 117  7e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridium bot...   
. .unclassified Peptostreptococcaceae (miscellaneo 117  7e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: MULTISPECIES: geranyltranstransferase [un...   
. .Clostridium sporogenes......................... 117  7e-28  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Lactobacillus johnsonii ATCC 33200............. 116  8e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus jo...   
. .Anaeroarcus burkinensis........................ 116  8e-28  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: geranyl transferase [Anaeroarcus burkinen...   
. .Clostridium novyi.............................. 116  8e-28  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Eubacteriaceae bacterium ACC19a................ 116  8e-28  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Eubacteriaceae b...   
. .Pediococcus acidilactici....................... 116  9e-28  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Pediococcu...   
. .Lactobacillus acidophilus...................... 116  9e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus ac...   
. .Lactococcus garvieae DCC43..................... 116  9e-28  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactococcu...   
. .Lactobacillus animalis......................... 116  9e-28  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: solanesyl diphosphate synthase, sds [Lactobaci...   
. .Veillonella ratti.............................. 116  1e-27  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: hypothetical protein [Veillonella ratti]       
. .Lactobacillus jensenii......................... 116  1e-27  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus je...   
. .Enterococcus dispar............................ 116  1e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Enterococcus dis...   
. .Lachnospiraceae bacterium A2................... 116  1e-27  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl diphosphate synthase, type...   
. .Anaeromusa acidaminophila...................... 116  1e-27  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: hypothetical protein [Anaeromusa acidamin...   
. .Clostridium botulinum 84....................... 116  1e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Clostridium botu...   
. .Clostridium novyi A str. 4570.................. 116  1e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridium nov...   
. .Streptococcus sp. HPH0090...................... 116  1e-27  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Streptococcus sp. H...   
. .Clostridium sporogenes PA 3679................. 116  1e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Streptococcus downei F0415..................... 116  1e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: geranyltranstransferase [St...   
. .Streptococcus sobrinus......................... 116  1e-27  8 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus so...   
. .Streptococcus infantis......................... 116  1e-27  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus in...   
. .Enterococcus moraviensis....................... 115  2e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Enterococcus mor...   
. .Megasphaera sp. UPII 135-E..................... 115  2e-27  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Megasphaer...   
. .Lactobacillus crispatus JV-V01................. 115  2e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus cr...   
. .Clostridium botulinum F str. Langeland......... 115  2e-27  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Anaerococcus hydrogenalis...................... 115  2e-27  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Anaerococcus hydrog...   
. .Streptococcus porci............................ 115  2e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Streptococcus porci]      
. .Coprococcus sp. ART55/1........................ 115  2e-27  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: Geranylgeranyl pyrophosphate synthase [Co...   
. .Streptococcus sp. F0442........................ 115  2e-27  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Streptococcus sp. F...   
. .Clostridium sp. CL-2........................... 115  2e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridiu...   
. .Streptococcus parasanguinis ATCC 903........... 115  2e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pa...   
. .Clostridium botulinum B str. Osaka05........... 115  2e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridiu...   
. .Robinsoniella sp. KNHs210...................... 115  2e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Robinsonie...   
. .Clostridium bifermentans....................... 115  2e-27  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase family protein [ [[...   
. .Streptococcus oralis SK610..................... 115  2e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus or...   
. .Alloiococcus otitis............................ 115  2e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Alloiococcus otitis]     
. .Clostridium josui.............................. 115  3e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [ [Clostrid...   
. .Clostridium bifermentans ATCC 19299............ 115  3e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase family protein [ [[...   
. .Streptococcus mitis SK564...................... 115  3e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mi...   
. .Clostridium botulinum Bf....................... 115  3e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Catenibacterium mitsuokai...................... 115  3e-27  1 hit   Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: hypothetical protein [Catenibacterium mit...   
. .Pediococcus acidilactici 7_4................... 115  3e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Pediococcu...   
. .Allobaculum stercoricanis...................... 115  3e-27  1 hit   Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: hypothetical protein [Allobaculum stercor...   
. .Streptococcus minor............................ 115  3e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Streptococcus minor]     
. .Syntrophomonas wolfei.......................... 115  3e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Syntrophom...   
. .Clostridium botulinum Ba4 str. 657............. 115  3e-27  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Clostridium acidurici.......................... 115  3e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridiu...   
. .Streptococcus mitis SK597...................... 115  3e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus mi...   
. .Lactobacillus iners............................ 115  3e-27  5 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus in...   
. .Lactobacillus iners LactinV 09V1-c............. 115  3e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus in...   
. .Lactobacillus jensenii 27-2-CHN................ 115  3e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus je...   
. .Leuconostoc.................................... 115  3e-27  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: farnesyl-diphosphate syntha...   
. .Selenomonas ruminantium subsp. lactilytica TAM6 115  4e-27  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Selenomona...   
. .Lactobacillus gallinarum....................... 115  4e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Lactobacillus gallin...   
. .Lactobacillus iners UPII 60-B.................. 115  4e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus in...   
. .Lachnoanaerobaculum sp. OBRC5-5................ 115  4e-27  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Lachnospiraceae ...   
. .Lactobacillus iners LEAF 2062A-h1.............. 114  4e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus in...   
. .Lactobacillus iners DSM 13335.................. 114  4e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: geranyltranstransferase [La...   
. .Lactobacillus iners SPIN 2503V10-D............. 114  4e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus in...   
. .Clostridium leptum............................. 114  4e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [ [Clostrid...   
. .Streptococcus tigurinus AZ_3a.................. 114  4e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus ti...   
. .Desulfovirgula thermocuniculi.................. 114  4e-27  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: geranyl transferase [Desulfovirgula therm...   
. .Pediococcus.................................... 114  5e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: solanesyl diphosphate synth...   
. .Caldanaerobacter subterraneus.................. 114  5e-27  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: farnesyl-diphosphate synthase [Caldanaero...   
. .Clostridium botulinum A str. Hall.............. 114  5e-27  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Megasphaera genomosp. type_1................... 114  5e-27  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Megasphaer...   
. .Clostridium botulinum A str. ATCC 3502......... 114  5e-27  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Clostridium tunisiense......................... 114  5e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Clostridium tunisie...   
. .Clostridium perfringens........................ 114  5e-27  9 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Lachnobacterium bovis.......................... 114  6e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Lachnobact...   
. .Lactobacillus brevis........................... 114  6e-27  6 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Streptococcus suis D9.......................... 114  6e-27  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus suis]   
. .Clostridiisalibacter paucivorans............... 114  6e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridii...   
. .Clostridium botulinum CFSAN001628.............. 114  6e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Clostridium botu...   
. .Lactobacillus buchneri ATCC 11577.............. 114  7e-27  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: farnesyl-diphosphate syntha...   
. .Caldicellulosiruptor hydrothermalis............ 114  8e-27  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: farnesyl-diphosphate synthase [Caldicellu...   
. .Leuconostoc citreum............................ 114  8e-27  4 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Leuconosto...   
. .Clostridium sp. NCR............................ 114  8e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridium sp....   
. .Lachnospiraceae bacterium NC2004............... 114  8e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Lachnospir...   
. .Dorea sp. AGR2135.............................. 114  9e-27  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Dorea sp. ...   
. .Leuconostoc citreum KM20....................... 114  1e-26  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Leuconosto...   
. .Dolosigranulum pigrum.......................... 114  1e-26  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Dolosigranulum pigrum]   
. .Leuconostoc citreum LBAE C11................... 114  1e-26  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Leuconosto...   
. .Clostridiales bacterium VE202-14............... 114  1e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridia...   
. .Erysipelotrichaceae............................ 113  1e-26  1 hit   Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: MULTISPECIES: hypothetical protein [Erysi...   
. .Clostridium beijerinckii....................... 113  1e-26  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridiu...   
. .Selenomonas sp. AE3005......................... 113  1e-26  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: geranyl transferase [Selenomonas sp. AE3005]   
. .Anaerococcus hydrogenalis ACS-025-V-Sch4....... 113  1e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: putative geranyltranstransferase [Anaeroc...   
. .Streptococcus parasanguinis SK236.............. 113  1e-26  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus pa...   
. .Megasphaera sp. UPII 199-6..................... 113  1e-26  2 hits  Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Megasphaer...   
. .Clostridium algidicarnis....................... 113  1e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridiu...   
. .Coprobacillus.................................. 113  1e-26  1 hit   Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: MULTISPECIES: geranyltranstransferase [Co...   
. .Clostridium botulinum A2 str. Kyoto............ 113  1e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Coprococcus eutactus........................... 113  1e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Coprococcu...   
. .Facklamia languida............................. 113  2e-26  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Facklamia languida]   
. .Clostridium tyrobutyricum...................... 113  2e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Streptococcus parasanguinis DORA_23_24......... 113  2e-26  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: Geranyltranstransferase [Streptococcus parasan...   
. .Clostridium botulinum NCTC 2916................ 113  2e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Clostridium sartagoforme....................... 113  2e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Clostridium sartag...   
. .Lactobacillus ultunensis....................... 113  2e-26  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus ul...   
. .Lachnoanaerobaculum sp. MSX33.................. 113  2e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase family protein [Lachno...   
. .Ruminococcus sp. JC304......................... 113  2e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Ruminococc...   
. .Clostridium botulinum A2B2 87.................. 113  2e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridiu...   
. .Clostridium botulinum F str. 230613............ 113  2e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Lachnospiraceae bacterium 2_1_46FAA............ 113  2e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Lachnospir...   
. .Desulfotomaculum kuznetsovii................... 113  2e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Desulfotom...   
. .Halothermothrix orenii......................... 113  2e-26  1 hit   Bacteria:Firmicutes:Clostridia:Halanaerobiales: farnesyl-diphosphate synthase [Halothermo...   
. .Lactobacillus brevis ATCC 367.................. 113  2e-26  10 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: Chain A, Crystal Structure Of Geranylgeranyl Pyrop...   
. .Ruminococcus callidus.......................... 113  2e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: putative geranyltranstransferase [Ruminoc...   
. .Streptococcus sp. 2_1_36FAA.................... 112  2e-26  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sp...   
. .Clostridium beijerinckii MBC34-26.............. 112  2e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Streptococcus sp. HSISM1....................... 112  2e-26  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Geranyltranstransferase [Streptococcus sp...   
. .Pediococcus claussenii......................... 112  2e-26  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Pediococcu...   
. .Firmicutes bacterium ASF500.................... 112  2e-26  2 hits  Bacteria:Firmicutes:                     hypothetical protein [Firmicutes bacteriu...   
. .Firmicutes bacterium M10-2..................... 112  3e-26  2 hits  Bacteria:Firmicutes:                     hypothetical protein C815_00804 [Firmicutes ba...   
. .Lactobacillus ceti............................. 112  3e-26  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Lactobacillus ceti]       
. .Clostridium sp. 7_2_43FAA...................... 112  3e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Helcococcus kunzii............................. 112  3e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Helcococcus kunzii]      
. .Anaerococcus sp. ph9........................... 112  3e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranyl transferase [Anaerococcus sp. PH9]     
. .Bulleidia extructa............................. 112  3e-26  1 hit   Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: putative geranyltranstransferase [Bulleid...   
. .Kandleria vitulina............................. 112  3e-26  3 hits  Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: farnesyl-diphosphate synthase [Kandleria ...   
. .Clostridium perfringens ATCC 13124............. 112  3e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Alkaliphilus transvaalensis.................... 112  3e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Alkaliphil...   
. .Eubacterium nodatum ATCC 33099................. 112  3e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Eubacterium nodatum ATC...   
. .Clostridium botulinum H04402 065............... 112  3e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Roseburia intestinalis......................... 112  3e-26  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: Geranylgeranyl pyrophosphate synthase [Ro...   
. .Roseburia intestinalis XB6B4................... 112  3e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: Geranylgeranyl pyrophosphate synthase [Ro...   
. .Roseburia intestinalis L1-82................... 112  4e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Roseburia ...   
. .Ruminococcus sp. 80/3.......................... 112  4e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Rumino...   
. .Clostridium innocuum........................... 112  4e-26  1 hit   Bacteria:Firmicutes:Erysipelotrichi:Erysipelotrichales: geranyl transferase [ [ [[Clostridium] innocuum]    
. .unclassified Lachnospiraceae................... 112  4e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: MULTISPECIES: farnesyl-diphosphate syntha...   
. .Clostridium carboxidivorans.................... 112  4e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Eubacterium brachy............................. 112  4e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: putative geranyltranstransferase [Eubacte...   
. .Streptococcus sobrinus DSM 20742............... 112  4e-26  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: dimethylallyltransferase/ geranyltranstra...   
. .Lactobacillus brevis DSM 20054................. 112  5e-26  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: putative geranyltranstransferase [Lactoba...   
. .Acetobacterium dehalogenans.................... 112  5e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Acetobacte...   
. .Pseudobutyrivibrio ruminis..................... 112  5e-26  3 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Pseudobuty...   
. .Lachnospiraceae bacterium 1_4_56FAA............ 112  5e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Lachnospir...   
. .Clostridium pasteurianum....................... 111  5e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Streptococcus sobrinus W1703................... 111  6e-26  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus so...   
. .Clostridiales bacterium BV3Ac2................. 111  6e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Peptoniphilus sp. ...   
. .Lactobacillus hayakitensis..................... 111  6e-26  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Lactobacillus hayak...   
. .Peptostreptococcus stomatis.................... 111  6e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Peptostrep...   
. .Syntrophothermus lipocalidus................... 111  8e-26  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Syntrophot...   
. .Lactobacillus namurensis....................... 111  8e-26  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Lactobacillus namure...   
. .Clostridium beijerinckii NCIMB 8052............ 111  8e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Dorea formicigenerans.......................... 111  9e-26  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Dorea form...   
. .Enterococcus haemoperoxidus.................... 111  9e-26  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Enterococcus hae...   
. .Halanaerobium hydrogeniformans................. 111  9e-26  3 hits  Bacteria:Firmicutes:Clostridia:Halanaerobiales: farnesyl-diphosphate synthase [Halanaerob...   
. .Clostridium tetanomorphum DSM 665.............. 111  1e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Clostri...   
. .Clostridium sp. KNHs209........................ 111  1e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridiu...   
. .Lactobacillus brevis KB290..................... 111  1e-25  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Farnesyl diphosphate synthase [Lactobacil...   
. .Leuconostoc gelidum............................ 111  1e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Leuconosto...   
. .Selenomonas sp. ND2010......................... 110  1e-25  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: geranyl transferase [Selenomonas sp. ND2010]   
. .Lactobacillus murinus.......................... 110  1e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Lactobacillus murinus]   
. .Streptococcus salivarius K12................... 110  1e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sa...   
. .Roseburia hominis.............................. 110  1e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Roseburia ...   
. .Ruminococcus champanellensis................... 110  1e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Ruminococc...   
. .Clostridium sp. KNHs205........................ 110  1e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridiu...   
. .Eubacterium hallii............................. 110  1e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [ [Eubacter...   
. .Clostridium drakei............................. 110  1e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridiu...   
. .Lachnospiraceae bacterium oral taxon 082....... 110  1e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Lachnospiraceae ...   
. .Clostridium perfringens str. 13................ 110  1e-25  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Clostridium perfringens C str. JGS1495......... 110  2e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Enterococcus caccae............................ 110  2e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Enterococcus cac...   
. .Lachnospiraceae oral taxon 107................. 110  2e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Lachnospiraceae ...   
. .Streptococcus sanguinis........................ 110  2e-25  16 hits Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Streptococcus sangu...   
. .Dorea formicigenerans ATCC 27755............... 110  2e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Dorea form...   
. .Streptococcus salivarius M18................... 110  2e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sa...   
. .Enterococcus columbae.......................... 110  2e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Enterococcus columbae]   
. .Eubacterium sp. AS15b.......................... 110  2e-25  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Eubacterium sp. ...   
. .Thermaerobacter marianensis.................... 110  2e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Thermaerob...   
. .Streptococcus sanguinis SK408.................. 110  2e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sa...   
. .Streptococcus sanguinis SK1.................... 110  2e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sa...   
. .Roseburia inulinivorans........................ 110  2e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Roseburia ...   
. .Clostridium perfringens CPE str. F4969......... 110  2e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Clostridium perfringens E str. JGS1987......... 110  2e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Eubacterium limosum............................ 110  2e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Eubacteriu...   
. .Frigovirgula patagoniensis..................... 110  2e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Proteocate...   
. .Eubacterium desmolans.......................... 110  2e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Eubacterium desmolans]   
. .Eubacterium yurii.............................. 110  2e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [ [[Eubacterium] ...   
. .Streptococcus sanguinis SK115.................. 110  3e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: geranyltranstransferase [St...   
. .Caldicellulosiruptor acetigenus................ 110  3e-25  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: farnesyl-diphosphate synthase [Caldicellu...   
. .Leuconostoc kimchii IMSNU 11154................ 110  3e-25  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: farnesyl-diphosphate syntha...   
. .Caldicellulosiruptor obsidiansis............... 110  3e-25  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: farnesyl-diphosphate synthase [Caldicellu...   
. .Selenomonas infelix............................ 109  3e-25  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Selenomona...   
. .Streptococcus salivarius JIM8777............... 109  3e-25  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sa...   
. .Streptococcus salivarius 57.I.................. 109  3e-25  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sa...   
. .Filifactor alocis.............................. 109  3e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Filifactor alocis]    
. .Streptococcus caballi.......................... 109  3e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus ca...   
. .Pseudoramibacter alactolyticus................. 109  4e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Pseudorami...   
. .Eubacterium ventriosum......................... 109  4e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Eubacteriu...   
. .Ruminococcus gnavus............................ 109  4e-25  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [ [[Ruminoc...   
. .Streptococcus sanguinis SK355.................. 109  4e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sa...   
. .Streptococcus sanguinis SK678.................. 109  4e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sa...   
. .Streptococcus gordonii......................... 109  4e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus go...   
. .Lactobacillus kisonensis....................... 109  4e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Lactobacillus fabifermentans T30PCM01.......... 109  4e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacillus f...   
. .Streptococcus sanguinis SK353.................. 109  4e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sa...   
. .Clostridium perfringens WAL-14572.............. 109  5e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranylgeranyl pyrophosphate synthase [Cl...   
. .Peptoniphilus duerdenii........................ 109  5e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Peptoniphilus du...   
. .Streptococcus infantarius...................... 109  5e-25  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus in...   
. .Caldicellulosiruptor kronotskyensis............ 109  5e-25  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: farnesyl-diphosphate synthase [Caldicellu...   
. .Streptococcus anginosus DORA_7................. 109  5e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: Geranyltranstransferase [Streptococcus anginos...   
. .Streptococcus salivarius SK126................. 108  5e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sa...   
. .Streptococcus anginosus........................ 108  6e-25  5 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus an...   
. .Lactobacillus fabifermentans................... 108  6e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyl transferase [Lactobacillus fabife...   
. .Eubacterium plexicaudatum...................... 108  6e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein [Eubacterium plexica...   
. .Alkalibacterium sp. AK22....................... 108  6e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: Octaprenyl diphosphate synthase [Alkalibacteri...   
. .Ruminococcus albus 8........................... 108  6e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: polyprenyl synthetase [Ruminococcus albus]     
. .Lactobacillus rhamnosus LRHMDP2................ 108  6e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: Geranyltranstransferase [Lactobacillus rh...   
. .Streptococcus sanguinis SK1057................. 108  6e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sa...   
. .Butyrivibrio fibrisolvens...................... 108  6e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: Geranylgeranyl pyrophosphate synthase [Bu...   
. .Streptococcus sp. oral taxon 056............... 108  6e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sp...   
. .Lachnospiraceae................................ 108  6e-25  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: MULTISPECIES: farnesyl-diphosphate syntha...   
. .Streptococcus sanguinis SK1056................. 108  6e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sa...   
. .Ruminococcus flavefaciens 007c................. 108  6e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: hypothetical protein RF007C_07400 [Ruminococcu...   
. .Peptostreptococcus sp. MV1..................... 108  7e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Peptostreptococ...   
. .Faecalibacterium prausnitzii................... 108  7e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: putative geranyltranstransferase [Faecali...   
. .Streptococcus sanguinis SK1087................. 108  8e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sa...   
. .Caldicellulosiruptor bescii.................... 108  8e-25  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: farnesyl-diphosphate synthase [Caldicellu...   
. .Streptococcus sp. ACS2......................... 108  9e-25  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: polyprenyl synthetase [Streptococcus sp. ACS2]      
. .Acetobacterium woodii.......................... 108  9e-25  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Acetobacte...   
. .Lactobacillus rhamnosus GG..................... 108  1e-24  4 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Lactobacil...   
. .Veillonella magna.............................. 108  1e-24  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: farnesyl-diphosphate synthase [Veillonell...   
. .Eubacterium rectale............................ 108  1e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Eubacteriu...   
. .Clostridium sp. D5............................. 108  1e-24  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridiu...   
. .Leuconostoc carnosum........................... 108  1e-24  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Leuconosto...   
. .Caldicellulosiruptor kristjanssonii............ 108  1e-24  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: farnesyl-diphosphate synthase [Caldicellu...   
. .Streptococcus sanguinis SK160.................. 108  1e-24  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sa...   
. .Clostridium sp. HMP27.......................... 108  1e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridium sp....   
. .Lachnospiraceae bacterium V9D3004.............. 108  1e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Lachnospir...   
. .Dorea longicatena.............................. 108  1e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Dorea long...   
. .Clostridiales bacterium VE202-21............... 107  1e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Clostridia...   
. .Streptococcus infantarius subsp. infantarius CJ 107  1e-24  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus in...   
. .Streptococcus sanguinis SK36................... 107  2e-24  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sa...   
. .Ruminococcus obeum............................. 107  2e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [ [[Ruminoc...   
. .Streptococcus sanguinis SK49................... 107  2e-24  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sa...   
. .Streptococcus sanguinis SK72................... 107  2e-24  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sa...   
. .Streptococcus sanguinis SK405.................. 107  2e-24  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sa...   
. .Lachnospira multipara.......................... 107  2e-24  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Lachnospir...   
. .Caldicellulosiruptor lactoaceticus............. 107  2e-24  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: farnesyl-diphosphate synthase [Caldicellu...   
. .Caldicellulosiruptor owensensis................ 107  2e-24  1 hit   Bacteria:Firmicutes:Clostridia:Thermoanaerobacterales: farnesyl-diphosphate synthase [Caldicellu...   
. .Leuconostoc mesenteroides P45.................. 107  2e-24  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Leuconostoc mes...   
. .Streptococcus sanguinis VMC66.................. 107  2e-24  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus sa...   
. .Leuconostoc mesenteroides...................... 107  2e-24  3 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Leuconosto...   
. .Lachnospiraceae bacterium 2_1_58FAA............ 107  3e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: MULTISPECIES: farnesyl-diphosphate syntha...   
. .Johnsonella ignava............................. 107  3e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Johnsonell...   
. .Orenia marismortui............................. 107  3e-24  1 hit   Bacteria:Firmicutes:Clostridia:Halanaerobiales: hypothetical protein [Orenia marismortui]      
. .Leuconostoc pseudomesenteroides................ 107  3e-24  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Leuconosto...   
. .Lactobacillus gigeriorum....................... 107  3e-24  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Lactobacillus gi...   
. .Streptococcus pasteurianus ATCC 43144.......... 107  3e-24  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: MULTISPECIES: geranyltranstransferase [St...   
. .Marvinbryantia formatexigens................... 107  3e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Marvinbrya...   
. .Dehalobacter sp. E1............................ 107  3e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Dehalobact...   
. .Clostridium intestinale........................ 107  3e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: geranyltranstransferase [Clostridium inte...   
. .Vagococcus lutrae.............................. 107  3e-24  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: hypothetical protein [Vagococcus lutrae]       
. .Streptococcus anginosus SK1138................. 107  3e-24  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus an...   
. .Leuconostoc mesenteroides subsp. mesenteroides  107  3e-24  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Leuconosto...   
. .Leuconostoc mesenteroides subsp. mesenteroides  107  3e-24  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: farnesyl-diphosphate synthase [Leuconosto...   
. .Granulicatella adiacens........................ 107  3e-24  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Granulicatella a...   
. .Streptococcus sp. HSISS4....................... 106  4e-24  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: Geranyltranstransferase [Streptococcus sp...   
. .Peptococcaceae bacterium SCADC................. 106  4e-24  2 hits  Bacteria:Firmicutes:Clostridia:Clostridiales: geranyl transferase [Peptococcaceae bacterium ...   
. .Streptococcus anginosus C238................... 106  4e-24  2 hits  Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus an...   
. .Selenomonas sp. oral taxon 138................. 106  4e-24  1 hit   Bacteria:Firmicutes:Negativicutes:Selenomonadales: putative geranyltranstransferase [Selenom...   
. .Streptococcus anginosus 1505................... 106  4e-24  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranylgeranyl pyrophosphate synthase [St...   
. .Ruminococcus lactaris.......................... 106  4e-24  1 hit   Bacteria:Firmicutes:Clostridia:Clostridiales: farnesyl-diphosphate synthase [Ruminococc...   
. .Streptococcus thermophilus TH1477.............. 106  6e-24  1 hit   Bacteria:Firmicutes:Bacilli:Lactobacillales: geranyltranstransferase [Streptococcus thermop...   
. .Candidatus Phaeomarinobacter ectocarpi......... 146  8e-39  1 hit   Bacteria::                               Octaprenyl diphosphate synthase / Dimethylall...   
. .Micrococcus luteus............................. 142  1e-37  2 hits  Bacteria:Actinobacteria:Actinobacteria:Actinomycetales: RecName: Full=Farnesyl diphosphate syn...   
. .Rubrobacter xylanophilus....................... 130  6e-33  2 hits  Bacteria:Actinobacteria:Actinobacteria:Rubrobacterales: farnesyl-diphosphate synthase [Rubrobacte...   
. .Rubrobacter xylanophilus DSM 9941.............. 124  2e-30  4 hits  Bacteria:Actinobacteria:Actinobacteria:Rubrobacterales: farnesyl-diphosphate synthase [Rubrobacte...   
. .Solirubrobacter soli........................... 107  3e-24  1 hit   Bacteria:Actinobacteria:Actinobacteria:Solirubrobacterales: polyprenyl synthetase [Solirubrobacter soli]   
. .Mastigocoleus testarum......................... 142  2e-37  3 hits  Bacteria:Cyanobacteria:Stigonematales:   farnesyl-diphosphate synthase [Mastigocol...   
. .Fischerella muscicola.......................... 128  4e-32  2 hits  Bacteria:Cyanobacteria:Stigonematales:   farnesyl-diphosphate synthase [Fischerell...   
. .Fischerella.................................... 125  5e-31  1 hit   Bacteria:Cyanobacteria:Stigonematales:   MULTISPECIES: farnesyl-diphosphate syntha...   
. .Chlorogloeopsis fritschii...................... 125  8e-31  1 hit   Bacteria:Cyanobacteria:Stigonematales:   farnesyl-diphosphate synthase [Chlorogloe...   
. .Fischerella sp. PCC 9339....................... 125  1e-30  1 hit   Bacteria:Cyanobacteria:Stigonematales:   farnesyl-diphosphate synthase [Fischerell...   
. .Fischerella sp. PCC 9605....................... 122  1e-29  1 hit   Bacteria:Cyanobacteria:Stigonematales:   farnesyl-diphosphate synthase [Fischerell...   
. .Mastigocladopsis repens........................ 121  2e-29  1 hit   Bacteria:Cyanobacteria:Stigonematales:   farnesyl-diphosphate synthase [Mastigocla...   
. .Chlorogloeopsis sp. PCC 7702................... 121  2e-29  1 hit   Bacteria:Cyanobacteria:Stigonematales:   farnesyl-diphosphate synthase [cyanobacte...   
. .Fischerella sp. PCC 9431....................... 120  5e-29  2 hits  Bacteria:Cyanobacteria:Stigonematales:   farnesyl-diphosphate synthase [Fischerell...   
. .Hapalosiphon welwitschii UTEX B 1830........... 119  2e-28  1 hit   Bacteria:Cyanobacteria:Stigonematales:   farnesyl-diphosphate synthase [Fischerell...   
. .Synechococcus sp. CAUP A 1101.................. 133  8e-34  2 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Synechococcus s...   
. .Pleurocapsa minor.............................. 132  1e-33  1 hit   Bacteria:Cyanobacteria:Pleurocapsales:   geranylgeranyl pyrophosphate synthase [Pl...   
. .Moorea producta................................ 132  3e-33  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  farnesyl-diphosphate synthase [Moorea pro...   
. .Lyngbya aestuarii.............................. 131  3e-33  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  polyprenyl synthetase family protein [Lyn...   
. .Cyanothece..................................... 131  3e-33  2 hits  Bacteria:Cyanobacteria:Chroococcales:    MULTISPECIES: farnesyl-diphosphate syntha...   
. .Stanieria cyanosphaera......................... 131  3e-33  1 hit   Bacteria:Cyanobacteria:Pleurocapsales:   Farnesyltranstransferase [Stanieria cyano...   
. .Oscillatoria sp. PCC 10802..................... 131  4e-33  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  farnesyl-diphosphate synthase [Oscillator...   
. .Microcystis aeruginosa......................... 131  5e-33  12 hits Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Microcysti...   
. .Microcystis aeruginosa PCC 9808................ 131  5e-33  1 hit   Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Microcysti...   
. .Lyngbya sp. PCC 8106........................... 130  6e-33  2 hits  Bacteria:Cyanobacteria:Oscillatoriales:  farnesyl-diphosphate synthase [Lyngbya sp...   
. .Rivularia sp. PCC 7116......................... 130  8e-33  3 hits  Bacteria:Cyanobacteria:Nostocales:       geranylgeranyl pyrophosphate synthase [Ri...   
. .Synechococcus sp. JA-3-3Ab..................... 130  9e-33  3 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Synechococ...   
. .Microcystis aeruginosa PCC 9807................ 130  1e-32  1 hit   Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Microcysti...   
. .Microcystis aeruginosa PCC 9806................ 130  1e-32  1 hit   Bacteria:Cyanobacteria:Chroococcales:    Geranylgeranyl pyrophosphate synthase hom...   
. .Cyanothece sp. PCC 7424........................ 130  1e-32  3 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Cyanothece...   
. .Microcystis aeruginosa PCC 9443................ 130  1e-32  1 hit   Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Microcysti...   
. .Prochlorothrix hollandica...................... 129  1e-32  1 hit   Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochlorot...   
. .Cyanothece sp. ATCC 51142...................... 129  1e-32  2 hits  Bacteria:Cyanobacteria:Chroococcales:    MULTISPECIES: farnesyl-diphosphate syntha...   
. .Synechococcus elongatus........................ 129  1e-32  3 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl diphosphate synthase (SelFPS) [Synec...   
. .Microcystis aeruginosa TAIHU98................. 129  2e-32  1 hit   Bacteria:Cyanobacteria:Chroococcales:    geranylgeranyl pyrophosphate synthase [Mi...   
. .cyanobacterium UCYN-A.......................... 129  3e-32  2 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [cyanobacte...   
. .Oscillatoria nigroviridis...................... 129  3e-32  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  Farnesyltranstransferase [Oscillatoria ni...   
. .Microcystis aeruginosa PCC 9432................ 129  3e-32  1 hit   Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Microcysti...   
. .Microcystis aeruginosa PCC 7806................ 129  3e-32  1 hit   Bacteria:Cyanobacteria:Chroococcales:    geranylgeranyl pyrophosphate synthase [Mi...   
. .Microcystis aeruginosa SPC 777................. 129  3e-32  1 hit   Bacteria:Cyanobacteria:Chroococcales:    Farnesyl diphosphate synthase [Microcysti...   
. .Microcoleus vaginatus.......................... 129  3e-32  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  farnesyl-diphosphate synthase [Microcoleu...   
. .Microcystis aeruginosa NIES-843................ 129  3e-32  2 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Microcysti...   
. .Microcystis aeruginosa PCC 9717................ 129  3e-32  1 hit   Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Microcysti...   
. .Geminocystis herdmanii......................... 129  3e-32  1 hit   Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Geminocystis herdma...   
. .Microcystis aeruginosa PCC 9809................ 129  4e-32  1 hit   Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Microcysti...   
. .Xenococcus sp. PCC 7305........................ 128  4e-32  2 hits  Bacteria:Cyanobacteria:Pleurocapsales:   geranylgeranyl pyrophosphate synthase [Xe...   
. .Prochlorococcus sp. W11........................ 128  5e-32  1 hit   Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Synechococcus sp. JA-2-3B'a(2-13).............. 128  5e-32  3 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Synechococ...   
. .Prochlorococcus marinus........................ 128  5e-32  20 hits Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Richelia intracellularis....................... 128  5e-32  2 hits  Bacteria:Cyanobacteria:Nostocales:       Octaprenyl-diphosphate synthase / Dimethylall...   
. .Candidatus Atelocyanobacterium thalassa isolate 128  6e-32  1 hit   Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Candidatus Atel...   
. .Microcystis sp. T1-4........................... 127  7e-32  2 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Microcysti...   
. .Prochlorococcus marinus str. MIT 9215.......... 127  8e-32  2 hits  Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Prochlorococcus marinus str. MIT 9322.......... 127  8e-32  1 hit   Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Prochlorococcus marinus str. MIT 9107.......... 127  8e-32  1 hit   Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Geitlerinema sp. PCC 7407...................... 127  8e-32  3 hits  Bacteria:Cyanobacteria:Oscillatoriales:  farnesyl-diphosphate synthase [Geitlerine...   
. .Cyanothece sp. PCC 7822........................ 127  9e-32  3 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Cyanothece...   
. .Gloeocapsa sp. PCC 73106....................... 127  9e-32  2 hits  Bacteria:Cyanobacteria:Chroococcales:    geranylgeranyl pyrophosphate synthase [Gl...   
. .Prochlorococcus sp. MIT 0601................... 127  1e-31  1 hit   Bacteria:Cyanobacteria:Prochlorales:     Octaprenyl diphosphate synthase [Prochlorococc...   
. .Prochlorococcus sp. scB241_528O2............... 127  1e-31  1 hit   Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Prochlorococcus marinus str. MIT 9302.......... 127  2e-31  1 hit   Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Prochlorococcus marinus str. MIT 9312.......... 127  2e-31  2 hits  Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .filamentous cyanobacterium ESFC-1.............. 127  2e-31  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  farnesyl-diphosphate synthase [filamentou...   
. .Synechococcus sp. RS9916....................... 127  2e-31  2 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Synechococ...   
. .Prochlorococcus sp. MIT 0602................... 126  2e-31  1 hit   Bacteria:Cyanobacteria:Prochlorales:     Octaprenyl diphosphate synthase [Prochlorococc...   
. .Prochlorococcus sp. scB241_528J8............... 126  2e-31  1 hit   Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Prochlorococcus marinus str. MIT 9301.......... 126  2e-31  2 hits  Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Prochlorococcus marinus str. MIT 9202.......... 126  2e-31  1 hit   Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Synechococcus sp. RCC307....................... 126  2e-31  3 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Synechococ...   
. .Prochlorococcus marinus subsp. pastoris str. CC 126  2e-31  2 hits  Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Synechocystis sp. PCC 7509..................... 126  3e-31  1 hit   Bacteria:Cyanobacteria:Chroococcales:    geranylgeranyl pyrophosphate synthase [Sy...   
. .Prochlorococcus................................ 126  3e-31  8 hits  Bacteria:Cyanobacteria:Prochlorales:     MULTISPECIES: farnesyl-diphosphate syntha...   
. .Pleurocapsa sp. PCC 7319....................... 126  3e-31  1 hit   Bacteria:Cyanobacteria:Pleurocapsales:   farnesyl-diphosphate synthase [Pleurocaps...   
. .Prochlorococcus marinus str. AS9601............ 126  3e-31  2 hits  Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .[Scytonema hofmanni] UTEX 2349................. 126  3e-31  1 hit   Bacteria:Cyanobacteria:Nostocales:       farnesyl-diphosphate synthase [ [[Scytone...   
. .Prochlorococcus marinus str. GP2............... 125  4e-31  1 hit   Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Calothrix sp. 336/3............................ 125  4e-31  1 hit   Bacteria:Cyanobacteria:Nostocales:       farnesyl-diphosphate synthase [Calothrix sp. 3...   
. .Prochlorococcus marinus str. LG................ 125  4e-31  1 hit   Bacteria:Cyanobacteria:Prochlorales:     Octaprenyl diphosphate synthase [Prochlorococc...   
. .Crocosphaera watsonii.......................... 125  4e-31  3 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Crocosphae...   
. .Crocosphaera watsonii WH 8502.................. 125  4e-31  1 hit   Bacteria:Cyanobacteria:Chroococcales:    Octaprenyl-diphosphate synthase / Dimethy...   
. .Crocosphaera watsonii WH 8501.................. 125  4e-31  1 hit   Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Crocosphae...   
. .Scytonema hofmanni............................. 125  4e-31  2 hits  Bacteria:Cyanobacteria:Nostocales:       farnesyl-diphosphate synthase [Scytonema ...   
. .Synechococcus sp. PCC 7336..................... 125  4e-31  1 hit   Bacteria:Cyanobacteria:Chroococcales:    hypothetical protein [Synechococcus sp. P...   
. .Prochlorococcus marinus str. MIT 9515.......... 125  5e-31  2 hits  Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Prochlorococcus marinus subsp. marinus str. CCM 125  5e-31  2 hits  Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Cyanobium gracile.............................. 125  6e-31  1 hit   Bacteria:Cyanobacteria:Chroococcales:    geranylgeranyl pyrophosphate synthase [Cy...   
. .Prochlorococcus sp. MIT 0604................... 125  6e-31  1 hit   Bacteria:Cyanobacteria:Prochlorales:     Octaprenyl diphosphate synthase [Prochlorococc...   
. .Prochlorococcus sp. scB241_527L22.............. 125  7e-31  1 hit   Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Planktothrix................................... 125  7e-31  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  MULTISPECIES: farnesyl-diphosphate syntha...   
. .Leptolyngbya sp. PCC 7375...................... 125  7e-31  2 hits  Bacteria:Cyanobacteria:Oscillatoriales:  geranylgeranyl pyrophosphate synthase [Le...   
. .Prochlorococcus sp. scB241_528P14.............. 125  8e-31  1 hit   Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Halothece sp. PCC 7418......................... 125  1e-30  3 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Halothece ...   
. .Prochlorococcus sp. scB243_498A3............... 124  1e-30  1 hit   Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Tolypothrix bouteillei Iicb1................... 124  1e-30  1 hit   Bacteria:Cyanobacteria:Nostocales:       farnesyl-diphosphate synthase [Tolypothrix bou...   
. .Oscillatoriales cyanobacterium JSC-12.......... 124  1e-30  2 hits  Bacteria:Cyanobacteria:Oscillatoriales:  geranylgeranyl pyrophosphate synthase [Os...   
. .Trichodesmium erythraeum....................... 124  1e-30  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  farnesyl-diphosphate synthase [Trichodesm...   
. .Prochlorococcus sp. scB243_495P20.............. 124  1e-30  1 hit   Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Leptolyngbya nodulosa.......................... 124  2e-30  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  farnesyl-diphosphate synthase [Nodosiline...   
. .Prochlorococcus marinus str. MIT 9314.......... 124  2e-30  1 hit   Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Crinalium epipsammum........................... 124  2e-30  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  polyprenyl synthetase [Crinalium epipsammum]   
. .Prochlorococcus marinus str. SB................ 124  2e-30  1 hit   Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Leptolyngbya sp. Heron Island J................ 124  2e-30  2 hits  Bacteria:Cyanobacteria:Oscillatoriales:  farnesyl-diphosphate synthase [Leptolyngb...   
. .Cyanobacterium stanieri........................ 123  3e-30  1 hit   Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Cyanobacte...   
. .Gloeocapsa sp. PCC 7428........................ 123  3e-30  3 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Gloeocapsa...   
. .Prochlorococcus sp. scB243_495D8............... 123  3e-30  1 hit   Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Synechococcus sp. WH 5701...................... 123  3e-30  2 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Synechococ...   
. .Prochlorococcus marinus str. MIT 9303.......... 123  4e-30  2 hits  Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Microcoleus sp. PCC 7113....................... 123  4e-30  3 hits  Bacteria:Cyanobacteria:Oscillatoriales:  geranylgeranyl pyrophosphate synthase [Mi...   
. .Calothrix parietina............................ 123  4e-30  1 hit   Bacteria:Cyanobacteria:Nostocales:       farnesyl-diphosphate synthase [Calothrix ...   
. .Synechococcus elongatus PCC 6301............... 123  4e-30  2 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Synechococ...   
. .Arthrospira.................................... 123  4e-30  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  MULTISPECIES: farnesyl-diphosphate syntha...   
. .Synechococcus sp. CB0101....................... 123  5e-30  1 hit   Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Synechococ...   
. .Cyanobacterium aponinum........................ 123  6e-30  1 hit   Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Cyanobacte...   
. .Cyanobium sp. CACIA14.......................... 122  5e-30  1 hit   Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Cyanobium sp. C...   
. .Nostoc punctiforme............................. 122  6e-30  1 hit   Bacteria:Cyanobacteria:Nostocales:       farnesyl-diphosphate synthase [Nostoc pun...   
. .Calothrix sp. PCC 7103......................... 122  8e-30  1 hit   Bacteria:Cyanobacteria:Nostocales:       farnesyl-diphosphate synthase [Calothrix ...   
. .Prochlorococcus marinus str. MIT 9313.......... 121  1e-29  2 hits  Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Prochlorococcus sp. MIT 0801................... 121  2e-29  1 hit   Bacteria:Cyanobacteria:Prochlorales:     Octaprenyl diphosphate synthase [Prochlorococc...   
. .Synechococcus sp. PCC 7002..................... 121  2e-29  3 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Synechococ...   
. .Prochlorococcus sp. MIT 0701................... 121  2e-29  1 hit   Bacteria:Cyanobacteria:Prochlorales:     Octaprenyl diphosphate synthase [Prochlorococc...   
. .Leptolyngbya sp. PCC 6406...................... 121  2e-29  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  geranylgeranyl pyrophosphate synthase [Le...   
. .Coleofasciculus chthonoplastes................. 121  2e-29  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  farnesyl-diphosphate synthase [Coleofasci...   
. .Synechococcus sp. NKBG 042902.................. 121  2e-29  1 hit   Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Synechococ...   
. .Prochlorococcus marinus str. NATL1A............ 120  2e-29  2 hits  Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Prochlorococcus marinus str. NATL2A............ 120  2e-29  2 hits  Bacteria:Cyanobacteria:Prochlorales:     farnesyl-diphosphate synthase [Prochloroc...   
. .Oscillatoria acuminata......................... 120  3e-29  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  geranylgeranyl pyrophosphate synthase [Os...   
. .Calothrix sp. PCC 7507......................... 120  3e-29  3 hits  Bacteria:Cyanobacteria:Nostocales:       farnesyl-diphosphate synthase [Calothrix ...   
. .Synechocystis sp. PCC 6714..................... 120  3e-29  1 hit   Bacteria:Cyanobacteria:Chroococcales:    Octaprenyl diphosphate synthase / Dimethylally...   
. .Microchaete sp. PCC 7126....................... 120  3e-29  1 hit   Bacteria:Cyanobacteria:Nostocales:       farnesyl-diphosphate synthase [Microchaet...   
. .Synechococcus sp. CB0205....................... 120  4e-29  1 hit   Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Synechococ...   
. .Dolichospermum circinale....................... 120  4e-29  2 hits  Bacteria:Cyanobacteria:Nostocales:       farnesyl-diphosphate synthase [Dolichospe...   
. .Chroococcidiopsis thermalis.................... 120  4e-29  1 hit   Bacteria:Cyanobacteria:Pleurocapsales:   farnesyl-diphosphate synthase [Chroococci...   
. .Thermosynechococcus sp. NK55................... 120  4e-29  3 hits  Bacteria:Cyanobacteria:Chroococcales:    geranylgeranyl diphosphate synthase type ...   
. .Synechocystis sp. PCC 6803..................... 120  5e-29  7 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Synechocys...   
. .Prochlorococcus marinus str. PAC1.............. 120  5e-29  1 hit   Bacteria:Cyanobacteria:Prochlorales:     Octaprenyl diphosphate synthase [Prochlorococc...   
. .Pseudanabaena sp. PCC 7367..................... 119  8e-29  3 hits  Bacteria:Cyanobacteria:Oscillatoriales:  farnesyl-diphosphate synthase [Pseudanaba...   
. .Synechococcus sp. CC9311....................... 119  9e-29  3 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Synechococ...   
. .Richelia intracellularis HH01.................. 119  1e-28  1 hit   Bacteria:Cyanobacteria:Nostocales:       Octaprenyl-diphosphate synthase [Richelia...   
. .Cyanothece sp. PCC 7425........................ 119  1e-28  3 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Cyanothece...   
. .Synechococcus sp. PCC 7502..................... 118  2e-28  3 hits  Bacteria:Cyanobacteria:Chroococcales:    geranylgeranyl pyrophosphate synthase [Sy...   
. .Synechococcus sp. WH 7805...................... 118  2e-28  2 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Synechococ...   
. .Synechococcus sp. WH 8016...................... 118  3e-28  2 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Synechococ...   
. .Thermosynechococcus elongatus.................. 118  3e-28  1 hit   Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Thermosyne...   
. .Anabaena sp. 90................................ 118  4e-28  3 hits  Bacteria:Cyanobacteria:Nostocales:       geranyltranstransferase [Anabaena sp. 90]      
. .Synechococcus sp. WH 7803...................... 118  4e-28  3 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Synechococ...   
. .Arthrospira platensis str. Paraca.............. 117  5e-28  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  farnesyl-diphosphate synthase [Arthrospira pla...   
. .Arthrospira platensis.......................... 117  6e-28  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  farnesyl-diphosphate synthase [Arthrospir...   
. .Aphanizomenon flos-aquae....................... 117  9e-28  1 hit   Bacteria:Cyanobacteria:Nostocales:       farnesyl-diphosphate synthase [Aphanizome...   
. .Gloeobacter kilaueensis........................ 116  9e-28  1 hit   Bacteria:Cyanobacteria:Gloeobacteria:Gloeobacterales: polyprenyl synthetase [Gloeobacter kilaue...   
. .Anabaena sp. PCC 7108.......................... 116  1e-27  1 hit   Bacteria:Cyanobacteria:Nostocales:       farnesyl-diphosphate synthase [Anabaena s...   
. .Anabaena cylindrica............................ 116  1e-27  1 hit   Bacteria:Cyanobacteria:Nostocales:       farnesyl-diphosphate synthase [Anabaena c...   
. .Kamptonema..................................... 116  2e-27  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  MULTISPECIES: farnesyl-diphosphate syntha...   
. .Nostoc sp. PCC 7524............................ 115  2e-27  3 hits  Bacteria:Cyanobacteria:Nostocales:       geranylgeranyl pyrophosphate synthase [No...   
. .Leptolyngbya sp. PCC 7376...................... 115  2e-27  3 hits  Bacteria:Cyanobacteria:Oscillatoriales:  farnesyl-diphosphate synthase [Leptolyngb...   
. .Synechococcus sp. PCC 6312..................... 115  2e-27  3 hits  Bacteria:Cyanobacteria:Chroococcales:    geranylgeranyl pyrophosphate synthase [Sy...   
. .Acaryochloris sp. CCMEE 5410................... 115  2e-27  1 hit   Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Acaryochlo...   
. .Cylindrospermum stagnale....................... 115  3e-27  1 hit   Bacteria:Cyanobacteria:Nostocales:       geranylgeranyl pyrophosphate synthase [Cy...   
. .Acaryochloris marina........................... 115  3e-27  1 hit   Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Acaryochlo...   
. .Pseudanabaena sp. PCC 6802..................... 115  4e-27  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  hypothetical protein [Pseudanabaena sp. P...   
. .Cylindrospermopsis raciborskii................. 114  7e-27  1 hit   Bacteria:Cyanobacteria:Nostocales:       farnesyl-diphosphate synthase [Cylindrosp...   
. .Nostoc sp. PCC 7107............................ 114  9e-27  3 hits  Bacteria:Cyanobacteria:Nostocales:       farnesyl-diphosphate synthase [Nostoc sp....   
. .Raphidiopsis brookii........................... 113  2e-26  1 hit   Bacteria:Cyanobacteria:Nostocales:       farnesyl-diphosphate synthase [Raphidiops...   
. .Nodularia spumigena............................ 112  3e-26  1 hit   Bacteria:Cyanobacteria:Nostocales:       farnesyl-diphosphate synthase [Nodularia ...   
. .Nostoc sp. PCC 7120............................ 112  5e-26  3 hits  Bacteria:Cyanobacteria:Nostocales:       farnesyl-diphosphate synthase [Nostoc sp....   
. .Spirulina subsalsa............................. 110  2e-25  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  farnesyl-diphosphate synthase [Spirulina ...   
. .Pseudanabaena biceps........................... 110  2e-25  1 hit   Bacteria:Cyanobacteria:Oscillatoriales:  Farnesyltranstransferase [Pseudanabaena b...   
. .Rubidibacter lacunae........................... 110  2e-25  1 hit   Bacteria:Cyanobacteria:Chroococcales:    geranylgeranyl pyrophosphate synthase [Ru...   
. .Anabaena variabilis............................ 109  5e-25  1 hit   Bacteria:Cyanobacteria:Nostocales:       farnesyl-diphosphate synthase [Anabaena v...   
. .Cyanothece sp. CCY0110......................... 107  4e-24  2 hits  Bacteria:Cyanobacteria:Chroococcales:    farnesyl-diphosphate synthase [Cyanothece...   
. .Turneriella parva.............................. 139  3e-36  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: farnesyl-diphosphate synthase [Turneriell...   
. .Leptospira genomosp. 5......................... 126  2e-31  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira yanagawae]   
. .Leptospira interrogans......................... 122  3e-30  13 hits Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira interro...   
. .Leptospira biflexa............................. 122  6e-30  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranyltranstransferase [Leptospira biflexa]   
. .Leptospira borgpetersenii...................... 122  7e-30  8 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira borgpet...   
. .Leptospira..................................... 122  7e-30  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: MULTISPECIES: geranylgeranyl pyrophosphat...   
. .Leptospira borgpetersenii serovar Mini str. 200 122  7e-30  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira borgpet...   
. .Leptospira weilii.............................. 122  8e-30  5 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira weilii]      
. .Leptospira kirschneri.......................... 122  8e-30  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira kirschn...   
. .Leptospira borgpetersenii serovar Pomona str. 2 122  1e-29  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira borgpet...   
. .Leptospira interrogans serovar Copenhageni str. 122  1e-29  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Le...   
. .Leptospira interrogans str. FPW2026............ 122  1e-29  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Le...   
. .Leptospira interrogans serovar Bataviae str. L1 122  1e-29  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira interro...   
. .Leptospira interrogans serovar Copenhageni str. 122  1e-29  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Le...   
. .Leptospira interrogans serovar Pomona str. Kenn 122  1e-29  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Le...   
. .Leptospira interrogans serovar Lai str. 56601.. 122  1e-29  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Le...   
. .Leptospira interrogans serovar Manilae......... 122  1e-29  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Le...   
. .Leptospira alexanderi.......................... 121  2e-29  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Le...   
. .Leptospira sp. P2653........................... 121  3e-29  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira sp. P2653]   
. .Leptospira weilii str. 2006001853.............. 121  3e-29  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira weilii]      
. .Leptospira alstoni............................. 121  3e-29  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira alstoni]     
. .Leptospira weilii str. 2006001855.............. 121  2e-28  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: ribosomal RNA large subunit methyltransfe...   
. .Leptospira borgpetersenii str. UI 09149........ 120  3e-29  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira borgpet...   
. .Leptospira wolffii............................. 120  3e-29  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranyltranstransferase family protein [L...   
. .Leptospira noguchii............................ 120  4e-29  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira noguchii]    
. .Leptospira interrogans str. HAI1536............ 120  6e-29  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: MULTISPECIES: polyprenyl synthetase [Lept...   
. .Leptospira sp. Fiocruz LV3954.................. 120  7e-29  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: MULTISPECIES: polyprenyl synthetase [Lept...   
. .Leptospira noguchii str. 2001034031............ 120  7e-29  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira noguchii]    
. .Leptospira santarosai.......................... 120  7e-29  6 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira santaro...   
. .Leptospira kmetyi.............................. 119  8e-29  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Le...   
. .Leptospira noguchii str. 2006001870............ 119  9e-29  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Le...   
. .Leptospira interrogans serovar Bataviae str. HA 119  9e-29  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira interro...   
. .Leptospira noguchii str. Bonito................ 119  9e-29  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira noguchii]    
. .Leptospira borgpetersenii serovar Hardjo-bovis  119  1e-28  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Le...   
. .Leptospira borgpetersenii serovar Hardjo-bovis  119  1e-28  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Le...   
. .Leptospira santarosai str. HAI1349............. 119  1e-28  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Le...   
. .Leptospira santarosai str. MOR084.............. 119  2e-28  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Le...   
. .Leptospira santarosai str. JET................. 119  2e-28  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranyltranstransferase [Leptospira santa...   
. .Leptospira borgpetersenii str. Noumea 25....... 118  2e-28  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira borgpetersen...   
. .Leptospira borgpetersenii serovar Castellonis s 118  2e-28  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira borgpetersen...   
. .Leptospira borgpetersenii serovar Ballum....... 118  3e-28  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Le...   
. .Leptospira santarosai str. CBC1531............. 117  7e-28  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira santaro...   
. .Leptospira santarosai str. HAI134.............. 117  7e-28  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira santaro...   
. .Leptospira weilii serovar Ranarum str. ICFT.... 116  1e-27  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira weilii]      
. .Leptospira broomii............................. 115  3e-27  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Le...   
. .Leptospira fainei.............................. 115  5e-27  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: putative geranyltranstransferase [Leptosp...   
. .Leptospira inadai.............................. 110  2e-25  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Le...   
. .Leptospira genomosp. 4......................... 109  5e-25  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira terpstrae]   
. .Leptospira wolbachii........................... 108  1e-24  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: polyprenyl synthetase [Leptospira wolbachii]   
. .Brachyspira hampsonii.......................... 115  2e-27  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Br...   
. .Brachyspira pilosicoli......................... 114  5e-27  4 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Br...   
. .Brachyspira alvinipulli........................ 114  5e-27  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Br...   
. .Brachyspira pilosicoli B2904................... 114  7e-27  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Br...   
. .Brachyspira pilosicoli 95/1000................. 114  8e-27  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Br...   
. .Brachyspira pilosicoli P43/6/78................ 114  9e-27  2 hits  Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Br...   
. .Brachyspira hampsonii 30446.................... 114  9e-27  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Br...   
. .Brachyspira intermedia......................... 112  2e-26  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Br...   
. .Brachyspira innocens........................... 112  4e-26  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Br...   
. .Brachyspira hyodysenteriae..................... 112  6e-26  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Br...   
. .Brachyspira murdochii.......................... 111  6e-26  1 hit   Bacteria:Spirochaetes:Spirochaetia:Spirochaetales: geranylgeranyl pyrophosphate synthase [Br...   
. .Plautia stali symbiont......................... 138  7e-36  3 hits  Bacteria::                               geranyltranstransferase [Plautia stali sy...   
. .candidate division EM 19 bacterium JGI 0000106- 134  6e-35  1 hit   Bacteria::                               hypothetical protein [candidate division ...   
. .Calescamantes.................................. 129  6e-33  2 hits  Bacteria::                               MULTISPECIES: hypothetical protein [Cales...   
. .Acholeplasma granularum........................ 133  5e-34  1 hit   Bacteria:Tenericutes:Mollicutes:Acholeplasmatales: hypothetical protein [Acholeplasma granul...   
. .Acholeplasma laidlawii......................... 123  2e-30  1 hit   Bacteria:Tenericutes:Mollicutes:Acholeplasmatales: geranyltranstransferase [Acholeplasma lai...   
. .Acholeplasma oculi............................. 113  1e-26  1 hit   Bacteria:Tenericutes:Mollicutes:Acholeplasmatales: Terpenoid synthase [Acholeplasma oculi]            
. .Methylacidiphilum fumariolicum................. 133  8e-34  1 hit   Bacteria:Verrucomicrobia:Methylacidiphilales: farnesyl-diphosphate synthase [Methylacid...   
. .Methylacidiphilum infernorum................... 131  2e-33  1 hit   Bacteria:Verrucomicrobia:Methylacidiphilales: farnesyl-diphosphate synthase [Methylacid...   
. .Verrucomicrobia bacterium SCGC AB-629-E09...... 125  7e-31  1 hit   Bacteria:Verrucomicrobia:                hypothetical protein [Verrucomicrobia bac...   
. .Verrucomicrobia bacterium SCGC AAA300-O17...... 123  3e-30  1 hit   Bacteria:Verrucomicrobia:                hypothetical protein [Verrucomicrobia bac...   
. .Verrucomicrobia bacterium LP2A................. 119  1e-28  1 hit   Bacteria:Verrucomicrobia:                farnesyl-diphosphate synthase [Verrucomic...   
. .Verrucomicrobia bacterium SCGC AAA164-E04...... 118  2e-28  1 hit   Bacteria:Verrucomicrobia:                farnesyl-diphosphate synthase [Verrucomic...   
. .Verrucomicrobium sp. 3C........................ 125  4e-31  1 hit   Bacteria:Verrucomicrobia:Verrucomicrobiae:Verrucomicrobiales: hypothetical protein [Verrucomicrobium sp...   
. .Akkermansia muciniphila........................ 124  9e-31  1 hit   Bacteria:Verrucomicrobia:Verrucomicrobiae:Verrucomicrobiales: farnesyl-diphosphate synthase [Akkermansi...   
. .Verrucomicrobiae bacterium DG1235.............. 120  2e-29  2 hits  Bacteria:Verrucomicrobia:Verrucomicrobiae:Verrucomicrobiales: polyprenyl synthetase [Verrucomicrobiae b...   
. .Coraliomargarita akajimensis................... 120  4e-29  1 hit   Bacteria:Verrucomicrobia:Opitutae:Puniceicoccales: polyprenyl synthetase [Coraliomargarita a...   
. .bacterium UASB14............................... 133  8e-34  1 hit   Bacteria::                               polyprenyl synthetase [bacterium UASB14]           
. .bacterium UASB270.............................. 132  1e-33  1 hit   Bacteria::                               polyprenyl synthetase [bacterium UASB270]          
. .Thermotoga maritima............................ 131  2e-33  1 hit   Bacteria:Thermotogae:Thermotogae:Thermotogales: geranyltranstransferase [Thermotoga marit...   
. .Thermotoga..................................... 131  2e-33  2 hits  Bacteria:Thermotogae:Thermotogae:Thermotogales: MULTISPECIES: geranyltranstransferase [Th...   
. .Thermotoga sp. EMP............................. 130  5e-33  2 hits  Bacteria:Thermotogae:Thermotogae:Thermotogales: geranyltranstransferase [Thermotoga sp. EMP]   
. .Thermotoga neapolitana......................... 123  3e-30  1 hit   Bacteria:Thermotogae:Thermotogae:Thermotogales: geranyltranstransferase [Thermotoga neapo...   
. .Thermotoga maritima MSB8....................... 119  9e-29  7 hits  Bacteria:Thermotogae:Thermotogae:Thermotogales: Chain A, Crystal Structure Of Geranyltranstransfer...   
. .Thermotoga hypogea............................. 106  4e-24  1 hit   Bacteria:Thermotogae:Thermotogae:Thermotogales: polyprenyl synthetase [Thermotoga hypogea]     
. .Petrotoga mobilis.............................. 127  5e-32  1 hit   Bacteria:Thermotogae:Thermotogae:Thermotogales: polyprenyl synthetase [Petrotoga mobilis]      
. .Kosmotoga olearia.............................. 113  1e-26  1 hit   Bacteria:Thermotogae:Thermotogae:Thermotogales: Polyprenyl synthetase [Kosmotoga olearia]      
. .Marinitoga piezophila.......................... 111  8e-26  1 hit   Bacteria:Thermotogae:Thermotogae:Thermotogales: geranylgeranyl pyrophosphate synthase [Ma...   
. .Candidatus Caldatribacteirum californiense..... 130  6e-33  1 hit   Bacteria::                               hypothetical protein [Candidatus Caldatri...   
. .Candidatus Caldatribacterium saccharofermentans 128  3e-32  1 hit   Bacteria::                               hypothetical protein [Candidatus Caldatri...   
. .bacterium LF-3................................. 129  1e-32  1 hit   Bacteria::                               farnesyl-diphosphate synthase [bacterium ...   
. .symbiont bacterium UwTKB of Urostylis westwoodi 129  2e-32  1 hit   Bacteria::                               polyprenyl synthetase [symbiont bacterium UwT...   
. .endosymbiont of unidentified scaly snail isolat 129  3e-32  1 hit   Bacteria::                               farnesyl diphosphate synthase [endosymbiont o...   
. .Anaerobaculum hydrogeniformans................. 128  4e-32  1 hit   Bacteria:Synergistetes:Synergistia:Synergistales: geranyltranstransferase [Anaerobaculum hy...   
. .Anaerobaculum mobile........................... 121  1e-29  1 hit   Bacteria:Synergistetes:Synergistia:Synergistales: geranyltranstransferase [Anaerobaculum mo...   
. .Synergistetes bacterium JGI 0000079-D21........ 113  2e-26  1 hit   Bacteria:Synergistetes:                  geranyltranstransferase [Synergistetes ba...   
. .unclassified Aminicenantes..................... 127  6e-32  1 hit   Bacteria::                               MULTISPECIES: farnesyl-diphosphate syntha...   
. .Aminicenantes.................................. 127  1e-31  1 hit   Bacteria::                               MULTISPECIES: hypothetical protein [Amini...   
. .Aminicenantes bacterium SCGC AAA252-K06........ 126  2e-31  1 hit   Bacteria::                               farnesyl-diphosphate synthase [candidate ...   
. .Flavobacterium sp. CF313....................... 125  4e-31  2 hits  Bacteria:Bacteroidetes:Flavobacteriia:Flavobacteriales: polyprenyl synthetase [Variovorax sp. CF313]   
. .Bacteroides pectinophilus...................... 110  3e-25  1 hit   Bacteria:Bacteroidetes:Bacteroidia:Bacteroidales: farnesyl-diphosphate synthase [ [[Bactero...   
. .Candidatus Nitrospira defluvii................. 124  1e-30  3 hits  Bacteria:Nitrospirae:Nitrospira:Nitrospirales: farnesyl-diphosphate synthase [Candidatus...   
. .Leptospirillum ferrodiazotrophum............... 117  3e-28  1 hit   Bacteria:Nitrospirae:Nitrospira:Nitrospirales: Geranyltranstransferase [Leptospirillum ferrod...   
. .Leptospirillum ferriphilum..................... 117  8e-28  2 hits  Bacteria:Nitrospirae:Nitrospira:Nitrospirales: geranylgeranyl pyrophosphate synthase [Le...   
. .Leptospirillum ferriphilum YSK................. 116  9e-28  1 hit   Bacteria:Nitrospirae:Nitrospira:Nitrospirales: polyprenyl synthetase [Leptospirillum ferriphi...   
. .Leptospirillum sp. Group II '5-way CG'......... 116  2e-27  1 hit   Bacteria:Nitrospirae:Nitrospira:Nitrospirales: Geranyltranstransferase [Leptospirillum sp. Gr...   
. .Thermodesulfovibrio thiophilus................. 113  1e-26  1 hit   Bacteria:Nitrospirae:Nitrospira:Nitrospirales: polyprenyl synthetase [Thermodesulfovibri...   
. .Thermodesulfovibrio yellowstonii............... 109  5e-25  1 hit   Bacteria:Nitrospirae:Nitrospira:Nitrospirales: farnesyl-diphosphate synthase [Thermodesu...   
. .Thermodesulfovibrio islandicus................. 109  5e-25  1 hit   Bacteria:Nitrospirae:Nitrospira:Nitrospirales: polyprenyl synthetase [Thermodesulfovibri...   
. .Leptospirillum ferrooxidans.................... 106  5e-24  1 hit   Bacteria:Nitrospirae:Nitrospira:Nitrospirales: farnesyl-diphosphate synthase [Leptospiri...   
. .Acidobacteriaceae bacterium KBS 89............. 124  4e-30  1 hit   Bacteria:Acidobacteria:Acidobacteriales: hypothetical protein [Acidobacteriaceae b...   
. .Acidobacteriaceae bacterium URHE0068........... 122  6e-30  1 hit   Bacteria:Acidobacteria:Acidobacteriales: polyprenyl synthetase [Acidobacteriaceae ...   
. .Acidobacteriaceae bacterium KBS 96............. 122  7e-30  1 hit   Bacteria:Acidobacteria:Acidobacteriales: hypothetical protein [Acidobacteriaceae b...   
. .Terriglobus roseus............................. 122  1e-29  1 hit   Bacteria:Acidobacteria:Acidobacteriales: farnesyl-diphosphate synthase [Terriglobu...   
. .Granulicella mallensis......................... 122  1e-29  1 hit   Bacteria:Acidobacteria:Acidobacteriales: farnesyl-diphosphate synthase [Granulicel...   
. .Acidobacteriaceae bacterium KBS 83............. 121  1e-29  1 hit   Bacteria:Acidobacteria:Acidobacteriales: polyprenyl synthetase [Acidobacteriaceae ...   
. .Acidobacterium sp. PMMR2....................... 120  3e-29  1 hit   Bacteria:Acidobacteria:Acidobacteriales: polyprenyl synthetase [Acidobacterium sp....   
. .Acidobacteria bacterium KBS 146................ 119  8e-29  1 hit   Bacteria:Acidobacteria:Acidobacteriales: polyprenyl synthetase [Acidobacteria bact...   
. .Acidobacterium capsulatum...................... 119  1e-28  1 hit   Bacteria:Acidobacteria:Acidobacteriales: farnesyl-diphosphate synthase [Acidobacte...   
. .Acidobacteriaceae bacterium TAA166............. 115  3e-27  1 hit   Bacteria:Acidobacteria:Acidobacteriales: farnesyl-diphosphate synthase [Acidobacte...   
. .Granulicella sp. MP5ACTX9...................... 107  2e-24  1 hit   Bacteria:Acidobacteria:Acidobacteriales: farnesyl-diphosphate synthase [Granulicel...   
. .Candidatus Chloracidobacterium thermophilum.... 121  2e-29  2 hits  Bacteria:Acidobacteria:                  farnesyl-diphosphate synthase [Candidatus...   
. .Candidatus Koribacter versatilis............... 120  4e-29  1 hit   Bacteria:Acidobacteria:                  farnesyl-diphosphate synthase [Candidatus...   
. .Candidatus Solibacter usitatus................. 120  5e-29  1 hit   Bacteria:Acidobacteria:Solibacteres:Solibacterales: farnesyl-diphosphate synthase [Candidatus...   
. .Bryobacter aggregatus.......................... 114  8e-27  1 hit   Bacteria:Acidobacteria:                  polyprenyl synthetase [Bryobacter aggrega...   
. .Planctomyces maris............................. 122  5e-30  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: geranylgeranyl pyrophosphate synthetase [...   
. .Rhodopirellula sallentina...................... 109  8e-25  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: Polyprenyl synthetase [Rhodopirellula sal...   
. .Singulisphaera acidiphila...................... 107  5e-24  1 hit   Bacteria:Planctomycetes:Planctomycetacia:Planctomycetales: geranylgeranyl pyrophosphate synthetase [...   
. .Clostridiales bacterium NK3B98................. 121  2e-29  1 hit   Bacteria::                               farnesyl-diphosphate synthase [Clostridia...   
. .Halyomorpha halys symbiont..................... 121  2e-29  3 hits  Bacteria::                               IspA protein [Halyomorpha halys symbiont]      
. .Desulfurobacterium thermolithotrophum.......... 120  3e-29  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: farnesyl-diphosphate synthase [Desulfurob...   
. .Desulfurobacterium sp. TC5-1................... 119  1e-28  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: farnesyl-diphosphate synthase [Desulfurob...   
. .Thermovibrio ammonificans...................... 119  1e-28  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: farnesyl-diphosphate synthase [Thermovibr...   
. .Hydrogenivirga sp. 128-5-R1-1.................. 118  2e-28  2 hits  Bacteria:Aquificae:Aquificae:Aquificales: farnesyl-diphosphate synthase [Hydrogeniv...   
. .Thermocrinis sp. GBS........................... 117  4e-28  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: farnesyl-diphosphate synthase [Thermocrin...   
. .Hydrogenobaculum............................... 113  1e-26  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: MULTISPECIES: Polyprenyl synthetase [Hydr...   
. .Hydrogenobaculum sp. Y04AAS1................... 112  1e-26  3 hits  Bacteria:Aquificae:Aquificae:Aquificales: Polyprenyl synthetase [Hydrogenobaculum s...   
. .Aquifex aeolicus............................... 111  5e-26  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: farnesyl-diphosphate synthase [Aquifex ae...   
. .Hydrogenobacter thermophilus................... 107  1e-24  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: farnesyl-diphosphate synthase [Hydrogenob...   
. .Thermocrinis albus............................. 107  1e-24  1 hit   Bacteria:Aquificae:Aquificae:Aquificales: farnesyl-diphosphate synthase [Thermocrin...   
. .Candidatus Protochlamydia amoebophila.......... 120  5e-29  1 hit   Bacteria:Chlamydiae:Chlamydiales:        farnesyltranstransferase [Candidatus Prot...   
. .Parachlamydia acanthamoebae.................... 115  3e-27  2 hits  Bacteria:Chlamydiae:Chlamydiales:        farnesyltranstransferase [Parachlamydia a...   
. .Parachlamydia acanthamoebae UV7................ 114  7e-27  2 hits  Bacteria:Chlamydiae:Chlamydiales:        farnesyltranstransferase [Parachlamydia a...   
. .Waddlia chondrophila........................... 112  3e-26  1 hit   Bacteria:Chlamydiae:Chlamydiales:        Farnesyltranstransferase [Waddlia chondro...   
. .Chlamydia sp. 'Rubis'.......................... 109  4e-25  1 hit   Bacteria:Chlamydiae:Chlamydiales:        Farnesyl diphosphate synthase [Chlamydia sp. ...   
. .Mucispirillum schaedleri....................... 119  2e-28  1 hit   Bacteria:Deferribacteres:Deferribacteres:Deferribacterales: hypothetical protein [Mucispirillum schae...   
. .Chrysiogenes arsenatis......................... 118  2e-28  1 hit   Bacteria:Chrysiogenetes:Chrysiogenetes:Chrysiogenales: hypothetical protein [Chrysiogenes arsena...   
. .Desulfurispirillum indicum..................... 113  2e-26  1 hit   Bacteria:Chrysiogenetes:Chrysiogenetes:Chrysiogenales: farnesyl-diphosphate synthase [Desulfuris...   
. .Ruminococcus sp. NK3A76........................ 115  4e-27  1 hit   Bacteria::                               geranyl transferase [Ruminococcus sp. NK3...   
. .Chthonomonas calidirosea....................... 112  4e-26  1 hit   Bacteria:Armatimonadetes:Chthonomonadetes:Chthonomonadales: farnesyl-diphosphate synthase [Chthonomon...   
. .Fimbriimonas ginsengisoli Gsoil 348............ 110  3e-25  1 hit   Bacteria:Armatimonadetes:                polyprenyl synthetase [Fimbriimonas ginsengiso...   
. .Fibrobacter succinogenes....................... 110  1e-25  1 hit   Bacteria:Fibrobacteres:Fibrobacterales:  polyprenyl synthetase [Fibrobacter succin...   
. .Caldisericum exile............................. 110  3e-25  1 hit   Bacteria:Caldiserica:Caldisericia:Caldisericales: geranyltranstransferase [Caldisericum exile]   
. .Cloacimonetes bacterium JGI OTU-5.............. 107  2e-24  1 hit   Bacteria::                               hypothetical protein [candidate division ...   
. .bacterium MP-01................................ 107  3e-24  1 hit   Bacteria::                               hypothetical protein EG19_05985 [bacterium MP-01]   
. .Thermodesulfobacterium thermophilum............ 107  3e-24  1 hit   Bacteria:Thermodesulfobacteria:Thermodesulfobacteria:Thermodesulfobacteriales: farnesyl-diphosphate synthase [Thermodesu...   
. .Thermodesulfobacterium commune DSM 2178........ 107  4e-24  1 hit   Bacteria:Thermodesulfobacteria:Thermodesulfobacteria:Thermodesulfobacteriales: hypothetical protein HL41_01275 [Thermodesulfo...   
. .Haloplasma contractile......................... 106  5e-24  1 hit   Bacteria::Haloplasmatales:               geranylgeranyl pyrophosphate synthase [Ha...   
. uncultured marine thaumarchaeote KM3_88_D08..... 157  2e-43  1 hit   Archaea:Thaumarchaeota:                  geranyltranstransferase (ispA) [uncultured mar...   
. uncultured marine thaumarchaeote KM3_54_G03..... 147  2e-39  1 hit   Archaea:Thaumarchaeota:                  geranyltranstransferase (ispA) [uncultured mar...   
. Methanocaldococcus jannaschii................... 109  6e-25  1 hit   Archaea:Euryarchaeota:Methanococci:Methanococcales: serralysin [Methanocaldococcus jannaschii]     
. Methanocaldococcus sp. FS406-22................. 108  2e-24  3 hits  Archaea:Euryarchaeota:Methanococci:Methanococcales: serralysin [Methanocaldococcus sp. FS406-22]   
. Methanocaldococcus sp. JH146.................... 107  2e-24  1 hit   Archaea:Euryarchaeota:Methanococci:Methanococcales: Polyprenyl synthetase [Methanocaldococcus sp. ...   
. Nicotiana sylvestris............................ 133  2e-33  2 hits  Eukaryota:Streptophyta:Solanales:        PREDICTED: geranylgeranyl pyrophosphate s...   
. Nicotiana tomentosiformis....................... 130  2e-32  2 hits  Eukaryota:Streptophyta:Solanales:        PREDICTED: geranylgeranyl pyrophosphate s...   
. Nicotiana tabacum............................... 129  4e-32  4 hits  Eukaryota:Streptophyta:Solanales:        geranylgeranyl diphosphate synthase 2 [Nicotia...   
. Nicotiana attenuata............................. 109  9e-25  1 hit   Eukaryota:Streptophyta:Solanales:        geranylgeranyl pyrophosphate synthase [Nicotia...   
. Solanum pennellii............................... 128  9e-32  1 hit   Eukaryota:Streptophyta:Solanales:        geranylgeranyl pyrophosphate synthase 1 [Solan...   
. Solanum lycopersicum............................ 127  3e-31  2 hits  Eukaryota:Streptophyta:Solanales:        geranylgeranyl pyrophosphate synthase 1 [...   
. Solanum tuberosum............................... 126  6e-31  1 hit   Eukaryota:Streptophyta:Solanales:        PREDICTED: geranylgeranyl pyrophosphate s...   
. Capsicum annuum................................. 108  2e-24  2 hits  Eukaryota:Streptophyta:Solanales:        RecName: Full=Geranylgeranyl pyrophos...   
. Ipomoea batatas................................. 112  1e-25  2 hits  Eukaryota:Streptophyta:Solanales:        geranylgeranyl pyrophosphate synthase [Ipomoea...   
. Erythranthe guttata............................. 131  8e-33  2 hits  Eukaryota:Streptophyta:Lamiales:         hypothetical protein MIMGU_mgv1a018377mg [Mimu...   
. Coffea canephora................................ 124  3e-30  2 hits  Eukaryota:Streptophyta:Gentianales:      unnamed protein product [Coffea canephora]         
. Picrorhiza kurrooa.............................. 113  3e-26  1 hit   Eukaryota:Streptophyta:Lamiales:         geranylgeranyl diphosphate synthase [Picrorhiz...   
. Scoparia dulcis................................. 110  2e-25  1 hit   Eukaryota:Streptophyta:Lamiales:         putative geranylgeralyl diphosphate synthase-2...   
. Antirrhinum majus............................... 110  3e-25  1 hit   Eukaryota:Streptophyta:Lamiales:         geranyl diphosphate synthase large subunit [An...   
. Catharanthus roseus............................. 110  3e-25  5 hits  Eukaryota:Streptophyta:Gentianales:      geranylgeranyl diphosphate synthase [Catharant...   
. Salvia miltiorrhiza............................. 109  8e-25  3 hits  Eukaryota:Streptophyta:Lamiales:         geranylgeranyl diphosphate synthase [Salvia mi...   
. Mentha x piperita............................... 108  1e-24  17 hits Eukaryota:Streptophyta:Lamiales:         Chain A, Mint Heterotetrameric Geranyl Pyrophospha...   
. Genlisea aurea.................................. 108  1e-24  2 hits  Eukaryota:Streptophyta:Lamiales:         hypothetical protein M569_06014 [Genlisea aurea]    
. Mentha canadensis............................... 108  2e-24  1 hit   Eukaryota:Streptophyta:Lamiales:         geranyl pyrophosphate synthase large subunit [...   
. Gentiana rigescens.............................. 108  2e-24  1 hit   Eukaryota:Streptophyta:Gentianales:      GPPS [Gentiana rigescens]                           
. Eucommia ulmoides............................... 107  3e-24  2 hits  Eukaryota:Streptophyta:Garryales:        putative geranylgeranyl pyrophosphate synthase...   
. Daucus carota................................... 118  5e-28  1 hit   Eukaryota:Streptophyta:Apiales:          GGPP synthase [Daucus carota]                      
. Daucus carota subsp. sativus.................... 118  5e-28  1 hit   Eukaryota:Streptophyta:Apiales:          putative geranylgeranyl pyrophosphate synthase...   
. Chrysanthemum x morifolium...................... 115  5e-27  1 hit   Eukaryota:Streptophyta:Asterales:        geranylgeranyl pyrophosphate synthase [Chrysa...   
. Chrysanthemum boreale........................... 115  6e-27  1 hit   Eukaryota:Streptophyta:Asterales:        geranylgeranyl pyrophosphate synthase [Chrysan...   
. Helianthus annuus............................... 112  8e-26  1 hit   Eukaryota:Streptophyta:Asterales:        geranylgeranyl pyrophosphate synthase [Heliant...   
. Tagetes erecta.................................. 110  5e-25  1 hit   Eukaryota:Streptophyta:Asterales:        GGDP synthase [Tagetes erecta]                      
. Stevia rebaudiana............................... 108  1e-24  1 hit   Eukaryota:Streptophyta:Asterales:        geranylgeranyl diphosphate synthase [Stevia re...   
. Panax notoginseng............................... 107  3e-24  1 hit   Eukaryota:Streptophyta:Apiales:          geranylgeranyl pyrophosphate synthase [Panax n...   
. Theobroma cacao................................. 130  2e-32  8 hits  Eukaryota:Streptophyta:Malvales:         Geranylgeranyl pyrophosphate synthase 1 [...   
. Citrus clementina............................... 129  8e-32  4 hits  Eukaryota:Streptophyta:Sapindales:       hypothetical protein CICLE_v10013734mg [C...   
. Populus trichocarpa............................. 129  9e-32  10 hits Eukaryota:Streptophyta:Malpighiales:     hypothetical protein POPTR_0004s08970g [P...   
. Citrus sinensis................................. 127  3e-31  5 hits  Eukaryota:Streptophyta:Sapindales:       PREDICTED: heterodimeric geranylgeranyl p...   
. Pyrus x bretschneideri.......................... 124  6e-30  2 hits  Eukaryota:Streptophyta:Rosales:          PREDICTED: geranylgeranyl pyrophosphate s...   
. Malus domestica................................. 124  6e-30  3 hits  Eukaryota:Streptophyta:Rosales:          PREDICTED: geranylgeranyl pyrophosphate s...   
. Ricinus communis................................ 123  8e-30  2 hits  Eukaryota:Streptophyta:Malpighiales:     geranyl geranyl pyrophosphate synthase, p...   
. Prunus persica.................................. 122  1e-29  4 hits  Eukaryota:Streptophyta:Rosales:          hypothetical protein PRUPE_ppa021460mg [P...   
. Prunus mume..................................... 122  2e-29  2 hits  Eukaryota:Streptophyta:Rosales:          PREDICTED: geranylgeranyl pyrophosphate s...   
. Jatropha curcas................................. 120  8e-29  3 hits  Eukaryota:Streptophyta:Malpighiales:     geranylgeranyl diphosphate synthase [Jatropha ...   
. Capsella rubella................................ 114  1e-26  2 hits  Eukaryota:Streptophyta:Brassicales:      hypothetical protein CARUB_v10016271mg [C...   
. Brassica napus.................................. 113  3e-26  3 hits  Eukaryota:Streptophyta:Brassicales:      BnaC09g51100D [Brassica napus]                     
. Brassica rapa................................... 113  3e-26  1 hit   Eukaryota:Streptophyta:Brassicales:      PREDICTED: geranylgeranyl pyrophosphate s...   
. Cicer arietinum................................. 113  3e-26  2 hits  Eukaryota:Streptophyta:Fabales:          PREDICTED: heterodimeric geranylgeranyl p...   
. Eutrema salsugineum............................. 113  4e-26  6 hits  Eukaryota:Streptophyta:Brassicales:      hypothetical protein EUTSA_v10022745mg [E...   
. Arabidopsis lyrata subsp. lyrata................ 112  6e-26  6 hits  Eukaryota:Streptophyta:Brassicales:      hypothetical protein ARALYDRAFT_900253 [A...   
. Elaeagnus umbellata............................. 112  1e-25  1 hit   Eukaryota:Streptophyta:Rosales:          geranylgeranyl pyrophosphate synthase [Elaeagn...   
. Glycine max..................................... 112  1e-25  3 hits  Eukaryota:Streptophyta:Fabales:          PREDICTED: geranylgeranyl pyrophosphate s...   
. Phaseolus vulgaris.............................. 111  2e-25  2 hits  Eukaryota:Streptophyta:Fabales:          hypothetical protein PHAVU_002G026400g [P...   
. Lupinus albus................................... 110  3e-25  1 hit   Eukaryota:Streptophyta:Fabales:          geranylgeranyl pyrophosphate synthase [Lupinus...   
. Fragaria vesca subsp. vesca..................... 110  5e-25  1 hit   Eukaryota:Streptophyta:Rosales:          PREDICTED: geranylgeranyl pyrophosphate s...   
. Morus notabilis................................. 109  6e-25  1 hit   Eukaryota:Streptophyta:Rosales:          Geranylgeranyl pyrophosphate synthase [Morus n...   
. Cucumis sativus................................. 109  8e-25  6 hits  Eukaryota:Streptophyta:Cucurbitales:     PREDICTED: geranylgeranyl pyrophosphate s...   
. Arabidopsis thaliana............................ 109  8e-25  14 hits Eukaryota:Streptophyta:Brassicales:      unknown [Arabidopsis thaliana]                      
. Cucumis melo.................................... 109  9e-25  3 hits  Eukaryota:Streptophyta:Cucurbitales:     PREDICTED: geranylgeranyl pyrophosphate s...   
. Arabis alpina................................... 108  9e-25  2 hits  Eukaryota:Streptophyta:Brassicales:      hypothetical protein AALP_AA3G350400 [Arabis a...   
. Humulus lupulus................................. 108  1e-24  1 hit   Eukaryota:Streptophyta:Rosales:          geranyl diphosphate synthase large subunit [Hu...   
. Corylus avellana................................ 108  1e-24  1 hit   Eukaryota:Streptophyta:Fagales:          geranylgeranyl diphosphate synthase [Corylus a...   
. Medicago truncatula............................. 108  2e-24  5 hits  Eukaryota:Streptophyta:Fabales:          Geranylgeranyl pyrophosphate synthase [Me...   
. Medicago sativa................................. 108  2e-24  1 hit   Eukaryota:Streptophyta:Fabales:          geranylgeranyl-diphosphate synthase [Medicago ...   
. Hevea brasiliensis.............................. 107  3e-24  2 hits  Eukaryota:Streptophyta:Malpighiales:     RecName: Full=Geranylgeranyl pyrophos...   
. Citrullus lanatus............................... 107  3e-24  1 hit   Eukaryota:Streptophyta:Cucurbitales:     geranylgeranyl diphosphate synthase [Citrullus...   
. Croton sublyratus............................... 107  5e-24  1 hit   Eukaryota:Streptophyta:Malpighiales:     geranylgeranyl pyrophosphate synthase [Croton...   
. Adonis aestivalis var. palaestina............... 119  3e-28  1 hit   Eukaryota:Streptophyta:Ranunculales:     geranylgeranyl diphosphate synthase [Adonis ae...   
. Musa acuminata subsp. malaccensis............... 117  8e-28  5 hits  Eukaryota:Streptophyta:Liliopsida:Zingiberales: PREDICTED: geranylgeranyl pyrophosphate s...   
. Amborella trichopoda............................ 116  1e-27  4 hits  Eukaryota:Streptophyta:Amborellales:     hypothetical protein AMTR_s00059p00132310...   
. Phoenix dactylifera............................. 116  3e-27  1 hit   Eukaryota:Streptophyta:Liliopsida:Arecales: PREDICTED: geranylgeranyl pyrophosphate s...   
. Oryza sativa Indica Group....................... 108  1e-24  1 hit   Eukaryota:Streptophyta:Liliopsida:Poales: hypothetical protein OsI_01173 [Oryza sativa I...   
. Oryza sativa Japonica Group..................... 108  2e-24  4 hits  Eukaryota:Streptophyta:Liliopsida:Poales: Os01g0248701 [Oryza sativa Japonica Group]     
. Abies grandis................................... 119  4e-28  3 hits  Eukaryota:Streptophyta:Coniferopsida:Coniferales: geranyl diphosphate synthase [Abies grandis]        
. Picea glauca.................................... 115  4e-27  1 hit   Eukaryota:Streptophyta:Coniferopsida:Coniferales: isoprenyl diphosphate synthase [Picea glauca]       
. Picea abies..................................... 115  5e-27  3 hits  Eukaryota:Streptophyta:Coniferopsida:Coniferales: isoprenyl diphosphate synthase [Picea abies]        
. Picea sitchensis................................ 115  9e-27  2 hits  Eukaryota:Streptophyta:Coniferopsida:Coniferales: unknown [Picea sitchensis]                          
. Taxus x media................................... 113  3e-26  4 hits  Eukaryota:Streptophyta:Coniferopsida:Coniferales: geranylgeranyl diphosphate synthase [Taxus x m...   
. Taxus canadensis................................ 113  3e-26  1 hit   Eukaryota:Streptophyta:Coniferopsida:Coniferales: geranylgeranyl diphosphate synthase [Taxus can...   
. Pinus massoniana................................ 113  3e-26  2 hits  Eukaryota:Streptophyta:Coniferopsida:Coniferales: geranylgeranyl diphosphate synthase [Pinus mas...   
. Ginkgo biloba................................... 110  4e-25  3 hits  Eukaryota:Streptophyta:Ginkgoopsida:Ginkgoales: geranylgeranyl diphosphate synthase [Ginkgo bi...   
. Cephalotaxus mannii............................. 109  9e-25  1 hit   Eukaryota:Streptophyta:Coniferopsida:Coniferales: geranyl geranyl diphosphate synthase-like prot...   
. Selaginella moellendorffii...................... 114  2e-26  4 hits  Eukaryota:Streptophyta:Isoetopsida:Selaginellales: hypothetical protein SELMODRAFT_231193 [S...   
. Physcomitrella patens........................... 114  8e-27  2 hits  Eukaryota:Streptophyta:Bryopsida:Funariales: predicted protein [Physcomitrella patens]      
. Ostreococcus tauri.............................. 127  3e-31  2 hits  Eukaryota:Chlorophyta:Mamiellophyceae:Mamiellales: geranylgeranyl diphosphate synthase (ISS)...   
. Ostreococcus lucimarinus CCE9901................ 124  1e-30  2 hits  Eukaryota:Chlorophyta:Mamiellophyceae:Mamiellales: predicted protein [Ostreococcus lucimarin...   
. Chlamydomonas reinhardtii....................... 121  3e-29  2 hits  Eukaryota:Chlorophyta:Chlorophyceae:Chlamydomonadales: geranylgeranyl diphosphate synthase [Chla...   
. Micromonas sp. RCC299........................... 120  7e-29  2 hits  Eukaryota:Chlorophyta:Mamiellophyceae:Mamiellales: geranyl pyrophosphate synthase [Micromona...   
. Volvox carteri f. nagariensis................... 117  6e-28  2 hits  Eukaryota:Chlorophyta:Chlorophyceae:Chlamydomonadales: hypothetical protein VOLCADRAFT_109214 [V...   
. Dunaliella viridis.............................. 117  1e-27  1 hit   Eukaryota:Chlorophyta:Chlorophyceae:Chlamydomonadales: geranylgeranyl diphosphate synthase [Dunaliell...   
. Bathycoccus prasinos............................ 116  2e-27  2 hits  Eukaryota:Chlorophyta:Mamiellophyceae:Mamiellales: geranylgeranyl pyrophosphate synthase [Ba...   
. Micromonas pusilla CCMP1545..................... 116  3e-27  2 hits  Eukaryota:Chlorophyta:Mamiellophyceae:Mamiellales: geranyl pyrophosphate synthase [Micromona...   
. Auxenochlorella protothecoides.................. 116  5e-27  1 hit   Eukaryota:Chlorophyta:Trebouxiophyceae:Chlorellales: Geranylgeranyl pyrophosphate synthase, chlorop...   
. Coccomyxa subellipsoidea C-169.................. 107  3e-24  2 hits  Eukaryota:Chlorophyta:Trebouxiophyceae:  Polyprenyl synthetase [Coccomyxa subellip...   
. Paulinella chromatophora........................ 129  2e-32  2 hits  Eukaryota::Euglyphida:                   geranylgeranyl pyrophosphate synthase [Pa...   
. Bombus impatiens................................ 128  3e-30  1 hit   Eukaryota:Arthropoda:Insecta:Hymenoptera: PREDICTED: 1-deoxy-D-xylulose-5-phosphate...   
. Galdieria sulphuraria........................... 122  1e-29  2 hits  Eukaryota::Bangiophyceae:Cyanidiales:    geranylgeranyl pyrophosphate synthetase [...   
. Vaucheria litorea............................... 122  2e-29  1 hit   Eukaryota:Xanthophyceae:Vaucheriales:    farnesyltransferase [Vaucheria litorea]             
. Amphimedon queenslandica........................ 119  1e-27  1 hit   Eukaryota:Porifera:Demospongiae:Haplosclerida: PREDICTED: hypothetical protein LOC100641...   
. Pantholops hodgsonii............................ 115  1e-27  3 hits  Eukaryota:Chordata:Mammalia:             PREDICTED: geranylgeranyl pyrophosphate s...   
. Thalassiosira pseudonana CCMP1335............... 114  7e-27  2 hits  Eukaryota:Bacillariophyta:Coscinodiscophyceae: geranylgeranyl pyrophosphate synthetase [...   
. Ceratitis capitata.............................. 114  8e-27  1 hit   Eukaryota:Arthropoda:Insecta:Diptera:    PREDICTED: farnesyl diphosphate synthase-...   
. Guillardia theta CCMP2712....................... 114  1e-26  2 hits  Eukaryota::Cryptophyta:Pyrenomonadales:  hypothetical protein GUITHDRAFT_157722 [G...   
. Nannochloropsis gaditana........................ 114  1e-26  2 hits  Eukaryota:Eustigmatophyceae:Eustigmatales: geranylgeranyl pyrophosphate synthase [Nannoch...   
. Cyanophora paradoxa............................. 112  4e-26  3 hits  Eukaryota::Glaucocystophyceae:           prenyl transferase CrtE [Cyanophora paradoxa]     
. Phaeodactylum tricornutum CCAP 1055/1........... 112  4e-26  2 hits  Eukaryota:Bacillariophyta:Bacillariophyceae:Naviculales: farnesyltranstransferase [Phaeodactylum t...   
. synthetic construct............................. 113  1e-26  1 hit   ::                                       geranylgeranyl diphosphate synthase [synthetic...   

BLAST

PROTOCOLE:


a) NCBI "blastp" ; contre "NR" ; max target sequences "5000"


b) NCBI "blastp" ; contre "SWISSPROT" ; max target sequences "5000"



ANALYSE DES RÉSULTATS:



__________________________________________________

      |  nombre de  | e-value | e-value | e-value |

      |  résultats  |   min   |   max   |  seuil  |

______|_____________|_________|_________|_________|

      |             |         |         |         |

  NR  |    5000     |  2e-56  |  6e-24  |  6e-24  |

______|_____________|_________|_________|_________|

      |             |         |         |         |

  SP  |     97      |  1e-39  |    8.4  |  5e-04  |

______|_____________|_________|_________|_________|






NR :

   ___________________________________________________________________________________________________

  |    descriptions :                                                     | min e-value | max e-value |

  |_______________________________________________________________________|_____________|_____________|

  | • geranyl transferase                                                 |    1e-47    |    6e-24    |

  | • diphosphate synthase                                                |    8e-44    |    6e-24    |

  | • pyrophosphate synthase                                              |    2e-40    |    5e-24    |

  | • polyprenyl synthetase                                               |    1e-41    |    6e-24    |

  | • octaprenyl-diphosphate synthase synthetase                          |    1e-38    |    2e-24    |

  | • Dimethylallyltransferase                                            |    1e-37    |    1e-25    |

  | • farnesyl diphosphate synthase IspA                                  |    2e-33    |    6e-24    |

  | • geranylgeranyl pyrophosphate synthase 1                             |    2e-32    |    5e-24    |

  |_______________________________________________________________________|_____________|_____________|





SP :

   ___________________________________________________________________________________________________

  |    descriptions :                                                     | min e-value | max e-value |

  |_______________________________________________________________________|_____________|_____________|

  | • transferase                                                         |    6e-26    |    8e-05    |

  | • Farnesyl diphosphate synthase                                       |    1e-39    |    0.71     |

  | • pyrophosphate synthase                                              |    8e-27    |    7.6      |

  | • geranylgeranyl pyrophosphate                                        |    8e-27    |    0.022    |

  | • Geranylgeranyl diphosphate                                          |    4e-28    |    2e-10    |

  | • Trans-prenyltransferase                                             |    3e-08    |    4e-08    |

  | • Solanesyl-diphosphate synthase                                      |    2e-10    |    0.001    |

  | • Octaprenyl-diphosphate synthase                                     |    8e-16    |    1e-14    |

  |_______________________________________________________________________|_____________|_____________|




La comparaison de l'ORF par rapport à d'autres séquences protéines se fait grâce au Blastp, nous l'avons fait sur 2 bases de données différentes : NR et Swissprot. NR est beaucoup plus vaste que Swissprot (qui est contenu dans NR, il est donc plus sélectif), c'est pourquoi nous observons plus de résultats selon NR que Swissprot (5000 par rapport à 97). La gamme de e-value est donc différente selon les bases de données, de 2e-56 à 6e-24 pour NR et de 1e-39 à 8.4 pour Swissprot. Ainsi, pour NR le seuil est défini à 6e-24 car cette valeur est la limite obtenue par Blastp (les paramètres définis en cours ne nous permettent pas d'aller au-dessus de 5000 résultats), et pour Swissprot nous l'avons défini à 0.13 car la fonction suivante (Fusicoccadiene synthase) n'est présente qu'une seule fois dans le Blastp, c'est donc une fonction qui s'est introduite, elle est considérée comme "intrus", et sa e-value se rapproche de 0 (0.16), valeur vers laquelle les séquences sont non-fiables. De plus, jusqu'à cette valeur seuil, nous observons les mêmes fonctions (Geranylgeranyl diphosphate, Solanesyl-diphosphate synthase), elles sont redondantes.


Nous observons néanmoins des quelques différences pour les fonction obtenues selon la base de donnée utilisée, en effet nous ne retrouvon spas la Dimethylallyltransferase pour SP, et à contrario nous ne retrouvons pas la Solanesyl-diphosphate synthase et la Trans-prenyltransferase chez NR.


RÉSULTATS BRUTS:


________________________________________________________________________________________________

a) NR

________________________________________________________________________________________________

BLASTP 2.2.30+
Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro
A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and
David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new
generation of protein database search programs", Nucleic
Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Stephen
F. Altschul, John C. Wootton, E. Michael Gertz, Richa
Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and
Yi-Kuo Yu (2005) "Protein database searches using
compositionally adjusted substitution matrices", FEBS J.
272:5101-5109.


RID: 5FBG8PN5013


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
           51,919,432 sequences; 18,654,704,860 total letters
Query= 
Length=208


                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|WP_018037340.1|  hypothetical protein [alpha proteobacteri...    192   2e-56
ref|WP_014953626.1|  geranyltranstransferase [alpha proteobact...    169   1e-47
gb|AAY82729.1|  predicted geranyltranstransferase [uncultured ...    169   1e-47
ref|WP_017971727.1|  hypothetical protein [alpha proteobacteri...    164   8e-46
ref|WP_018038474.1|  hypothetical protein [alpha proteobacteri...    163   2e-45
ref|WP_029454238.1|  geranyl transferase [Candidatus Pelagibac...    162   6e-45
ref|WP_006956361.1|  geranyltranstransferase [Idiomarina baltica]    162   7e-45
ref|WP_029563167.1|  geranyl transferase [alpha proteobacteriu...    162   7e-45
ref|WP_029455572.1|  geranyl transferase [Candidatus Pelagibac...    161   1e-44
ref|WP_029016529.1|  geranyl transferase [alpha proteobacteriu...    160   2e-44
ref|WP_008121855.1|  farnesyl-diphosphate synthase [Phyllobact...    159   7e-44
gb|KGM31584.1|  farnesyl-diphosphate synthase [Inquilinus limo...    159   8e-44
ref|WP_008544493.1|  geranyltranstransferase [Candidatus Pelag...    158   1e-43
gb|AIF20070.1|  geranyltranstransferase (ispA) [uncultured mar...    157   2e-43
ref|WP_008937211.1|  geranyltranstransferase [Marinobacter san...    157   4e-43
ref|WP_026376961.1|  geranyl transferase [Aestuariibacter sale...    157   6e-43
ref|WP_022941304.1|  geranyltranstransferase [Psychromonas had...    156   7e-43
ref|WP_013696043.1|  geranyltranstransferase [Candidatus Pelag...    155   2e-42
ref|WP_019051708.1|  farnesyl-diphosphate synthase [Sphingobiu...    155   3e-42
ref|WP_004857792.1|  farnesyl-diphosphate synthase [Bartonella...    155   3e-42
ref|WP_017184152.1|  farnesyl-diphosphate synthase [Sphingobiu...    155   4e-42
ref|WP_012861886.1|  farnesyl-diphosphate synthase [Sebaldella...    154   5e-42
ref|WP_004272414.1|  farnesyl-diphosphate synthase [Azospirill...    154   6e-42
ref|WP_021034136.1|  geranyltranstransferase [Vibrio alginolyt...    153   1e-41
ref|WP_023786021.1|  polyprenyl synthetase [Hyphomicrobium nit...    153   1e-41
ref|WP_005381567.1|  geranyltranstransferase [Vibrio alginolyt...    152   2e-41
ref|WP_005383621.1|  geranyltranstransferase [Vibrio alginolyt...    152   2e-41
dbj|GAJ77499.1|  octaprenyl diphosphate synthase [Vibrio sp. J...    152   2e-41
ref|WP_005391389.1|  MULTISPECIES: geranyltranstransferase [Vi...    152   3e-41
gb|KFZ30452.1|  geranyl transferase [Idiomarina salinarum]           152   3e-41
ref|WP_014231017.1|  MULTISPECIES: geranyltranstransferase [Vi...    152   3e-41
ref|WP_031381482.1|  geranyl transferase [Vibrio parahaemolyti...    152   5e-41
ref|WP_025768892.1|  geranyl transferase [Vibrio parahaemolyti...    152   5e-41
gb|AHN97609.1|  geranyltranstransferase [uncultured bacterium ...    152   5e-41
ref|WP_017023083.1|  geranyltranstransferase [Aliivibrio logei]      152   5e-41
ref|WP_008035714.1|  farnesyl-diphosphate synthase [Rhodobacte...    151   8e-41
ref|WP_020431381.1|  Octaprenyl-diphosphate synthase [Vibrio f...    151   8e-41
ref|WP_020328093.1|  Octaprenyl-diphosphate synthase [Vibrio f...    151   9e-41
gb|ETT85357.1|  geranyltranstransferase [Viridibacillus arenos...    151   9e-41
ref|WP_032080541.1|  geranyl transferase [Vibrio fluvialis]          151   9e-41
ref|WP_007876763.1|  polyprenyl synthetase [Ochrobactrum sp. C...    151   9e-41
gb|KEG21379.1|  hypothetical protein H710_00328 [Bartonella ba...    151   1e-40
dbj|GAK18438.1|  octaprenyl diphosphate synthase [Vibrio sp. J...    151   1e-40
ref|WP_024895777.1|  farnesyl-diphosphate synthase [Ochrobactr...    151   1e-40
ref|WP_004862734.1|  farnesyl-diphosphate synthase [Bartonella...    151   1e-40
ref|WP_017635683.1|  geranyltranstransferase [Vibrio sp. 712i1]      150   1e-40
ref|WP_028826705.1|  hypothetical protein [Proteobacteria bact...    151   1e-40
ref|WP_019614181.1|  hypothetical protein [Psychromonas ossiba...    150   1e-40
ref|WP_012549705.1|  geranyltranstransferase [Aliivibrio salmo...    150   1e-40
ref|WP_005765883.1|  farnesyl-diphosphate synthase [Bartonella...    150   1e-40
ref|WP_017044191.1|  geranyltranstransferase [Vibrio ordalii]        150   1e-40
ref|WP_021712091.1|  farnesyl diphosphate synthase [Vibrio ezu...    150   1e-40
ref|WP_021132482.1|  geranylgeranyl pyrophosphate synthase [Ph...    150   2e-40
gb|KGD75174.1|  geranyl transferase [Tatumella morbirosei]           150   2e-40
ref|WP_023403868.1|  farnesyl diphosphate synthase [Vibrio hal...    150   2e-40
ref|WP_020057748.1|  farnesyl-diphosphate synthase [alpha prot...    150   2e-40
ref|WP_010319092.1|  geranyltranstransferase [Vibrio ordalii]        150   2e-40
ref|WP_004723990.1|  geranyltranstransferase [Vibrio furnissii]      150   2e-40
ref|WP_015467093.1|  Octaprenyl-diphosphate synthase / Dimethy...    150   2e-40
ref|WP_028684477.1|  geranyl transferase [Phaseolibacter flect...    150   2e-40
ref|WP_014102360.1|  farnesyl-diphosphate synthase [Micavibrio...    150   2e-40
ref|WP_005839650.1|  farnesyl-diphosphate synthase [Mitsuokell...    150   2e-40
ref|WP_017668782.1|  hypothetical protein [Sandarakinorhabdus ...    149   3e-40
gb|ETR70678.1|  geranylgeranyl diphosphate synthase, type II [...    149   3e-40
ref|WP_006997294.1|  geranyltranstransferase [Candidatus Pelag...    149   3e-40
ref|WP_025564266.1|  geranyl transferase [Psychromonas sp. SP041]    149   4e-40
gb|KEC56478.1|  hypothetical protein O9A_00132 [Bartonella koe...    149   4e-40
ref|WP_020394072.1|  hypothetical protein [Thiothrix disciformis]    149   4e-40
ref|WP_008898299.1|  geranyltranstransferase [Rheinheimera sp....    149   4e-40
ref|WP_004866114.1|  farnesyl-diphosphate synthase [Bartonella...    149   5e-40
ref|WP_027306708.1|  geranyl transferase [Candidatus Pelagibac...    149   5e-40
ref|WP_018413891.1|  geranyltranstransferase [Candidatus Pelag...    149   5e-40
ref|WP_017051718.1|  geranyltranstransferase [Vibrio genomosp....    149   5e-40
ref|WP_027831071.1|  geranyl transferase [Marinobacter sp. HL-58]    149   5e-40
ref|WP_011281811.1|  geranyltranstransferase [Candidatus Pelag...    149   5e-40
ref|WP_019553017.1|  hypothetical protein [Zymophilus raffinos...    149   6e-40
dbj|GAK86985.1|  octaprenyl diphosphate synthase [Vibrio ponti...    149   6e-40
ref|WP_026986188.1|  farnesyl-diphosphate synthase [Fodinicurv...    149   6e-40
ref|WP_015562227.1|  farnesyl-diphosphate synthase [Megamonas ...    149   6e-40
ref|WP_008537858.1|  farnesyl-diphosphate synthase [Megamonas ...    149   6e-40
ref|WP_022228407.1|  farnesyl-diphosphate synthase [Megamonas ...    149   7e-40
ref|WP_007435962.1|  polyprenyl synthetase [Acetobacteraceae b...    148   7e-40
ref|WP_026296938.1|  geranyl transferase [Megamonas rupellensis]     148   8e-40
ref|WP_017035675.1|  geranyltranstransferase [Vibrio genomosp....    148   8e-40
ref|WP_002725821.1|  farnesyl-diphosphate synthase [Phaeospiri...    149   8e-40
ref|WP_012985571.1|  geranyltranstransferase [Listeria seeligeri]    148   9e-40
ref|WP_012581362.1|  geranyltranstransferase [Listeria monocyt...    148   9e-40
ref|WP_013857402.1|  MULTISPECIES: geranyltranstransferase [Vi...    148   9e-40
ref|WP_013572303.1|  geranyltranstransferase [Vibrio vulnificus]     148   1e-39
gb|AIL69902.1|  geranylgeranyl pyrophosphate synthase [Vibrio ...    148   1e-39
ref|WP_028869820.1|  geranyl transferase [Psychromonas arctica]      148   1e-39
dbj|GAK23820.1|  octaprenyl-diphosphate synthase [Vibrio sp. J...    148   1e-39
ref|WP_027307327.1|  geranyl transferase [Candidatus Pelagibac...    148   1e-39
ref|WP_026050427.1|  geranyl transferase [Vibrio vulnificus]         148   1e-39
ref|WP_011149683.1|  geranyltranstransferase [Vibrio vulnificus]     148   1e-39
ref|WP_032551644.1|  geranyl transferase [Vibrio fortis]             148   1e-39
gb|EFD90404.1|  LOW QUALITY PROTEIN: geranyltranstransferase [...    148   1e-39
ref|WP_014930472.1|  geranyltranstransferase [Listeria monocyt...    148   1e-39
ref|WP_008487106.1|  geranyltranstransferase [Idiomarina xiame...    148   1e-39
ref|WP_005440174.1|  MULTISPECIES: geranyltranstransferase [Vi...    148   1e-39
ref|WP_015398541.1|  geranyltranstransferase [Bartonella austr...    148   1e-39
ref|WP_028792582.1|  farnesyl-diphosphate synthase [Thalassoba...    148   1e-39
ref|WP_011078419.1|  geranyltranstransferase [Vibrio vulnificus]     148   1e-39
ref|WP_010446358.1|  geranyltranstransferase [Vibrio rotiferia...    148   1e-39
ref|WP_016798312.1|  geranyltranstransferase [Vibrio cyclitrop...    148   1e-39
ref|WP_010705813.1|  geranyltranstransferase [Bartonella vinso...    148   2e-39
ref|WP_025116086.1|  farnesyl-diphosphate synthase [Lysinibaci...    147   2e-39
ref|WP_008179901.1|  farnesyl-diphosphate synthase [Bacillus s...    147   2e-39
ref|WP_010436376.1|  geranyltranstransferase [Vibrio cyclitrop...    147   2e-39
ref|WP_008986357.1|  geranyltranstransferase [Photobacterium l...    147   2e-39
ref|WP_010859742.1|  geranyltranstransferase [Lysinibacillus s...    147   2e-39
gb|KEJ96890.1|  farnesyl-diphosphate synthase [Sulfitobacter s...    147   2e-39
ref|WP_027889637.1|  geranyl transferase [Megamonas hypermegale]     147   2e-39
gb|KGK70516.1|  geranyl transferase [Vibrio vulnificus]              147   2e-39
gb|EYS95449.1|  hypothetical protein X470_00037 [Bartonella ba...    147   2e-39
ref|WP_003738880.1|  geranyltranstransferase [Listeria monocyt...    147   2e-39
ref|WP_003747568.1|  geranyltranstransferase [Listeria seeligeri]    147   2e-39
gb|AIF12168.1|  geranyltranstransferase (ispA) [uncultured mar...    147   2e-39
ref|WP_020169150.1|  geranyltranstransferase [Candidatus Pelag...    147   2e-39
ref|WP_010303153.1|  farnesyl-diphosphate synthase [Kurthia sp...    147   2e-39
ref|WP_028464446.1|  farnesyl-diphosphate synthase [Nisaea den...    147   2e-39
ref|WP_014576115.1|  farnesyl-diphosphate synthase [Marinobact...    147   2e-39
ref|WP_017066825.1|  geranyltranstransferase [Vibrio crassostr...    147   2e-39
ref|WP_008845701.1|  farnesyl diphosphate synthase [Glaciecola...    147   2e-39
gb|AAZ21431.1|  geranyltranstransferase [Candidatus Pelagibact...    146   2e-39
ref|WP_019222867.1|  farnesyl-diphosphate synthase [Bartonella...    147   3e-39
ref|WP_017070489.1|  geranyltranstransferase [Vibrio crassostr...    147   3e-39
emb|CED70775.1|  geranyltranstransferase [Aliivibrio wodanis]        147   3e-39
ref|WP_018455921.1|  geranylgeranyl pyrophosphate synthase [Me...    147   3e-39
ref|WP_012295058.1|  farnesyl-diphosphate synthase [Lysinibaci...    147   3e-39
ref|WP_016994730.1|  farnesyl-diphosphate synthase [Lysinibaci...    147   3e-39
ref|WP_023933243.1|  geranyltranstransferase [Photobacterium l...    147   3e-39
ref|WP_007552907.1|  farnesyl-diphosphate synthase [Bartonella...    147   3e-39
ref|WP_004741514.1|  geranyltranstransferase [Vibrio splendidus]     147   3e-39
gb|AIV04732.1|  geranyl transferase [Vibrio harveyi]                 147   3e-39
ref|WP_017243402.1|  hypothetical protein [Vibrio breoganii]         147   3e-39
ref|WP_028467931.1|  geranyl transferase [Neptunomonas japonica]     147   3e-39
ref|WP_011240722.1|  farnesyl-diphosphate synthase [Zymomonas ...    147   3e-39
pdb|4KKM|A  Chain A, Crystal Structure Of A Fpp/gfpp Synthase ...    147   3e-39
ref|WP_005447589.1|  MULTISPECIES: geranyltranstransferase [Vi...    147   4e-39
ref|WP_019824927.1|  geranyltranstransferase [Vibrio splendidus]     147   4e-39
ref|WP_008176481.1|  farnesyl-diphosphate synthase [Marinobact...    147   4e-39
ref|WP_005866752.1|  farnesyl-diphosphate synthase [Bartonella...    147   4e-39
ref|WP_009360477.1|  geranyltranstransferase [alpha proteobact...    147   4e-39
ref|WP_004413203.1|  geranyltranstransferase [Vibrio orientalis]     147   4e-39
ref|WP_010702987.1|  geranyltranstransferase [Bartonella bovis]      147   4e-39
emb|CBI78400.1|  geranyltranstransferase [Bartonella rochalima...    147   4e-39
gb|EFR84685.1|  geranyltranstransferase [Listeria monocytogene...    146   4e-39
ref|WP_028769082.1|  geranyl transferase [Shewanella fidelis]        146   4e-39
ref|WP_017076220.1|  geranyltranstransferase [Vibrio splendidus]     146   4e-39
gb|KEY91707.1|  farnesyl diphosphate synthase [Candidatus Phot...    147   4e-39
ref|WP_008218630.1|  geranyltranstransferase [Vibrionales bact...    146   4e-39
ref|WP_006710488.1|  geranyltranstransferase [Vibrio ichthyoen...    146   4e-39
ref|WP_006908990.1|  hypothetical protein [Facklamia hominis]        146   4e-39
ref|WP_008138904.1|  geranylgeranyl pyrophosphate synthase [Br...    147   5e-39
ref|WP_028955763.1|  farnesyl-diphosphate synthase [Sulfitobac...    146   5e-39
ref|WP_017063336.1|  geranyltranstransferase [Vibrio crassostr...    146   5e-39
ref|WP_009847465.1|  geranyltranstransferase [Vibrio sp. MED222]     146   5e-39
ref|WP_002437027.1|  geranyltranstransferase [Escherichia herm...    146   5e-39
ref|WP_006705526.1|  geranyltranstransferase [Candidatus Regie...    147   5e-39
ref|WP_017096792.1|  geranyltranstransferase [Vibrio tasmanien...    146   5e-39
ref|WP_016767603.1|  geranyltranstransferase [Vibrio cyclitrop...    146   5e-39
ref|WP_017103890.1|  geranyltranstransferase [Vibrio tasmanien...    146   6e-39
ref|WP_017099514.1|  geranyltranstransferase [Vibrio tasmanien...    146   6e-39
ref|WP_012604642.1|  MULTISPECIES: geranyltranstransferase [Vi...    146   6e-39
ref|WP_017110414.1|  geranyltranstransferase [Vibrio tasmanien...    146   6e-39
gb|KGK21342.1|  geranyl transferase [Vibrio navarrensis]             146   6e-39
ref|WP_027566019.1|  geranylgeranyl pyrophosphate synthase [Br...    146   6e-39
ref|WP_004734404.1|  geranyltranstransferase [Vibrio splendidus]     146   6e-39
ref|WP_012565792.1|  farnesyl-diphosphate synthase [Rhodospiri...    146   6e-39
ref|WP_028133810.1|  geranylgeranyl pyrophosphate synthase [Br...    146   7e-39
ref|WP_017028258.1|  hypothetical protein [Vibrio breoganii]         146   7e-39
ref|WP_012977222.1|  farnesyl-diphosphate synthase [Azospirill...    146   7e-39
ref|WP_007466618.1|  Octaprenyl-diphosphate synthase [Photobac...    146   7e-39
ref|WP_011628694.1|  farnesyl-diphosphate synthase [Alkalilimn...    146   7e-39
ref|WP_017069503.1|  geranyltranstransferase [Vibrio crassostr...    146   7e-39
ref|WP_012817111.1|  farnesyl-diphosphate synthase [Zymomonas ...    146   7e-39
ref|WP_009348924.1|  farnesyl-diphosphate synthase [Selenomona...    146   7e-39
ref|WP_012533019.1|  geranyltranstransferase [Aliivibrio fisch...    146   7e-39
ref|WP_020592640.1|  hypothetical protein [Kiloniella laminariae]    146   8e-39
ref|WP_026762218.1|  geranyl transferase [Selenomonas artemidis]     145   8e-39
ref|WP_004625715.1|  Geranylgeranyl pyrophosphate synthase [ [...    146   8e-39
emb|CDO58311.1|  Octaprenyl diphosphate synthase / Dimethylall...    146   8e-39
ref|WP_017060780.1|  geranyltranstransferase [Vibrio crassostr...    145   9e-39
ref|WP_027288587.1|  farnesyl-diphosphate synthase [Rhodovibri...    145   9e-39
gb|ETS05995.1|  hypothetical protein Q655_01466 [Bartonella he...    145   9e-39
ref|WP_004744528.1|  geranyltranstransferase [Vibrio tubiashii]      145   9e-39
ref|WP_009658405.1|  farnesyl-diphosphate synthase [Selenomona...    145   1e-38
ref|WP_011069949.1|  geranyltranstransferase [Wigglesworthia g...    145   1e-38
ref|WP_004231163.1|  farnesyl-diphosphate synthase [Lysinibaci...    145   1e-38
ref|WP_024336956.1|  geranylgeranyl pyrophosphate synthase [Br...    146   1e-38
gb|EJZ35634.1|  geranyltranstransferase [Bradyrhizobium sp. CC...    146   1e-38
dbj|GAL11386.1|  octaprenyl-diphosphate synthase synthetase [V...    145   1e-38
ref|WP_027627780.1|  farnesyl-diphosphate synthase [ [Clostrid...    145   1e-38
ref|WP_005774552.1|  farnesyl-diphosphate synthase [Bartonella...    145   1e-38
ref|WP_023854293.1|  geranylgeranyl pyrophosphate synthase [Ca...    145   1e-38
gb|KGK20115.1|  geranyl transferase [Vibrio navarrensis]             145   1e-38
ref|WP_011830216.1|  polyprenyl synthetase [Methylibium petrol...    145   1e-38
ref|WP_007646580.1|  geranyltranstransferase [Shewanella sp. H...    145   1e-38
emb|CBI81407.1|  geranyltranstransferase [Bartonella sp. 1-1C]       145   1e-38
ref|WP_011866567.1|  geranyltranstransferase [Shewanella loihica]    145   1e-38
ref|WP_023648947.1|  geranyltranstransferase [Candidatus Pelag...    145   1e-38
ref|WP_014924514.1|  farnesyl-diphosphate synthase [Bartonella...    146   1e-38
ref|WP_014249476.1|  farnesyl-diphosphate synthase [Azospirill...    145   1e-38
gb|EWS53835.1|  Farnesyl diphosphate synthase [Methylibium sp....    145   1e-38
ref|WP_016790439.1|  geranyltranstransferase [Vibrio cyclitrop...    145   1e-38
ref|WP_010701731.1|  geranyltranstransferase [Bartonella bovis]      145   1e-38
ref|WP_025033303.1|  geranylgeranyl pyrophosphate synthase [Br...    145   1e-38
ref|WP_021020932.1|  geranyltranstransferase [Vibrio gazogenes]      145   1e-38
gb|KGK10559.1|  geranyl transferase [Vibrio navarrensis]             145   1e-38
ref|WP_018387410.1|  MULTISPECIES: geranylgeranyl pyrophosphat...    145   1e-38
ref|WP_006589845.1|  farnesyl-diphosphate synthase [Bartonella...    145   1e-38
ref|WP_008103965.1|  geranyltranstransferase [Pantoea sp. YR343]     145   1e-38
ref|WP_009370206.1|  geranyltranstransferase [Lysinibacillus f...    145   1e-38
ref|WP_005418104.1|  geranyltranstransferase [Aliivibrio fisch...    145   1e-38
ref|WP_024848970.1|  farnesyl-diphosphate synthase [Aminobacte...    145   1e-38
ref|WP_003726251.1|  geranyltranstransferase [Listeria monocyt...    145   1e-38
ref|WP_018644366.1|  geranylgeranyl pyrophosphate synthase [Br...    145   2e-38
ref|WP_006705856.1|  geranyltranstransferase [Candidatus Regie...    145   2e-38
gb|AHE48490.1|  ispA product [Aeromonas hydrophila 4AK4]             145   2e-38
ref|WP_028969289.1|  farnesyl-diphosphate synthase [Sphingomon...    145   2e-38
ref|WP_003731325.1|  geranyltranstransferase [Listeria monocyt...    145   2e-38
ref|WP_011261435.1|  geranyltranstransferase [Aliivibrio fisch...    145   2e-38
ref|WP_014491139.1|  geranylgeranyl pyrophosphate synthase [Br...    145   2e-38
gb|EFS03327.1|  geranyltranstransferase [Listeria seeligeri FS...    145   2e-38
gb|AHY55377.1|  geranyltranstransferase [Bradyrhizobium japoni...    145   2e-38
ref|WP_015488321.1|  farnesyl-diphosphate synthase [Thalassoli...    145   2e-38
ref|WP_003727475.1|  geranyltranstransferase [Listeria monocyt...    145   2e-38
ref|WP_028781019.1|  geranyl transferase [Shewanella sp. 38A_G...    145   2e-38
ref|WP_028139640.1|  geranylgeranyl pyrophosphate synthase [Br...    145   2e-38
ref|WP_014626423.1|  farnesyl-diphosphate synthase [Rhodospiri...    145   2e-38
gb|KGK17027.1|  geranyl transferase [Vibrio navarrensis]             145   2e-38
ref|WP_017025858.1|  geranyltranstransferase [Vibrio rumoiensis]     145   2e-38
ref|WP_011181292.1|  farnesyl-diphosphate synthase [Bartonella...    145   2e-38
ref|WP_021185857.1|  Octaprenyl-diphosphate synthase [Pantoea ...    145   2e-38
gb|AIS59758.1|  geranyl transferase [Listeria ivanovii subsp. ...    144   2e-38
ref|WP_025887264.1|  geranyl transferase [Shewanella haliotis]       144   2e-38
ref|WP_007887002.1|  geranyltranstransferase [Pantoea sp. GM01]      145   2e-38
ref|WP_009752921.1|  farnesyl-diphosphate synthase [Selenomona...    144   2e-38
gb|ETS10824.1|  hypothetical protein Q653_00545 [Bartonella he...    145   2e-38
ref|WP_018316753.1|  geranylgeranyl pyrophosphate synthase [Br...    145   2e-38
ref|WP_028155283.1|  geranylgeranyl pyrophosphate synthase [Br...    145   2e-38
gb|EZQ05774.1|  farnesyl-diphosphate synthase [Azospirillum br...    144   2e-38
ref|WP_028169159.1|  geranylgeranyl pyrophosphate synthase [Br...    145   2e-38
ref|WP_012326077.1|  geranyltranstransferase [Shewanella woodyi]     144   2e-38
ref|WP_026317478.1|  farnesyl-diphosphate synthase [Ahrensia k...    144   2e-38
gb|EFR97020.1|  geranyltranstransferase [Listeria ivanovii FSL...    144   2e-38
ref|WP_014414713.1|  farnesyl-diphosphate synthase [Rhodospiri...    145   3e-38
ref|WP_014198454.1|  farnesyl-diphosphate synthase [Azospirill...    144   3e-38
ref|WP_007004945.1|  farnesyl-diphosphate synthase [Roseomonas...    144   3e-38
ref|WP_008968826.1|  geranylgeranyl pyrophosphate synthase [Br...    145   3e-38
ref|WP_028343566.1|  geranylgeranyl pyrophosphate synthase [Br...    145   3e-38
ref|WP_027580772.1|  geranylgeranyl pyrophosphate synthase [Br...    145   3e-38
ref|WP_025012017.1|  geranyl transferase [Shewanella algae]          144   3e-38
emb|CDO47548.1|  geranyltranstransferase [Bartonella henselae]       144   3e-38
gb|AIS62592.1|  geranyl transferase [Listeria ivanovii subsp. ...    144   3e-38
ref|WP_005300670.1|  geranyltranstransferase [Photobacterium d...    144   3e-38
gb|KDO13286.1|  geranyl transferase [Vibrio sp. PPCK-2014]           144   3e-38
ref|WP_002043513.1|  geranyltranstransferase [Vibrio cholerae]       144   3e-38
ref|WP_000568606.1|  geranyltranstransferase [Vibrio sp. RC341]      144   3e-38
ref|WP_025902491.1|  geranyl transferase [Tatumella sp. UCD-D_...    144   3e-38
ref|WP_006785568.1|  MULTISPECIES: farnesyl-diphosphate syntha...    144   3e-38
ref|WP_017089741.1|  geranyltranstransferase [Vibrio splendidus]     144   3e-38
ref|WP_011179846.1|  farnesyl-diphosphate synthase [Bartonella...    144   4e-38
ref|WP_011390368.1|  farnesyl-diphosphate synthase [Rhodospiri...    144   4e-38
ref|WP_033131596.1|  geranyl transferase [Aeromonas sp. AE235]       144   4e-38
ref|WP_029989981.1|  geranyl transferase [Tatumella ptyseos]         144   4e-38
gb|AIU67572.1|  geranyl transferase [Vibrio coralliilyticus]         144   4e-38
ref|WP_006646671.1|  geranyltranstransferase [Photobacterium s...    144   4e-38
ref|WP_027575198.1|  geranylgeranyl pyrophosphate synthase [Br...    144   5e-38
ref|WP_000743812.1|  geranyltranstransferase [Streptococcus pn...    144   5e-38
ref|WP_000568617.1|  geranyltranstransferase [Vibrio cholerae]       144   5e-38
ref|WP_003732268.1|  geranyltranstransferase [Listeria monocyt...    144   5e-38
ref|WP_021706664.1|  farnesyl diphosphate synthase [Vibrio pro...    144   5e-38
ref|WP_019674761.1|  hypothetical protein [Rheinheimera perluc...    144   5e-38
ref|WP_007642247.1|  farnesyl diphosphate synthase [Glaciecola...    144   5e-38
ref|WP_011566876.1|  farnesyl-diphosphate synthase [Roseobacte...    144   5e-38
ref|WP_000568620.1|  geranyltranstransferase [Vibrio cholerae]       144   5e-38
ref|WP_021709194.1|  farnesyl diphosphate synthase [Vibrio azu...    144   5e-38
ref|WP_000568621.1|  geranyltranstransferase [Vibrio cholerae]       144   5e-38
ref|WP_028760690.1|  geranyl transferase [Shewanella putrefaci...    144   6e-38
ref|WP_004856385.1|  farnesyl-diphosphate synthase [Bartonella...    144   6e-38
emb|CBI79921.1|  geranyltranstransferase [Bartonella sp. AR 15-3]    144   6e-38
ref|WP_006959562.1|  geranyltranstransferase [Vibrio coralliil...    144   6e-38
ref|WP_029079537.1|  geranylgeranyl pyrophosphate synthase [Br...    144   6e-38
ref|WP_007476488.1|  farnesyl-diphosphate synthase [Bartonella...    144   6e-38
ref|WP_015689298.1|  geranylgeranyl pyrophosphate synthase [Br...    144   6e-38
ref|WP_014610172.1|  geranyltranstransferase [Shewanella putre...    143   6e-38
ref|WP_026989589.1|  farnesyl-diphosphate synthase [Fodinicurv...    144   6e-38
ref|WP_021456493.1|  geranyltranstransferase [Vibrio coralliil...    143   6e-38
ref|WP_006881320.1|  geranyltranstransferase [Vibrio brasilien...    143   6e-38
ref|WP_019276546.1|  geranyltranstransferase [Vibrio coralliil...    143   6e-38
gb|AHF78022.1|  Polyprenyl synthetase [Sodalis sp. HS1]              144   6e-38
ref|WP_011918952.1|  geranyltranstransferase [Shewanella putre...    143   6e-38
gb|KEQ41791.1|  geranyltranstransferase [Streptococcus mitis]        143   7e-38
gb|AIR61016.1|  geranyl transferase [Cedecea neteri]                 143   7e-38
ref|WP_019298882.1|  farnesyl-diphosphate synthase [Lactococcu...    143   7e-38
ref|WP_018269205.1|  geranylgeranyl pyrophosphate synthase [Br...    144   7e-38
ref|WP_008454568.1|  geranyltranstransferase [Enterobacter sp....    143   7e-38
ref|WP_001897757.1|  geranyltranstransferase [Vibrio cholerae]       143   8e-38
ref|WP_013500391.1|  geranylgeranyl pyrophosphate synthase [Rh...    144   8e-38
gb|AHF75062.1|  Geranyltranstransferase (farnesyldiphosphate s...    143   8e-38
ref|WP_000568609.1|  geranyltranstransferase [Vibrio mimicus]        143   9e-38
ref|WP_005476040.1|  geranyltranstransferase [Vibrio sp. 16]         143   9e-38
ref|WP_032479728.1|  geranyl transferase [Vibrio cholerae]           143   9e-38
ref|WP_000568611.1|  geranyltranstransferase [Vibrio cholerae]       143   9e-38
gb|AHX59874.1|  geranyltranstransferase [Aeromonas media WS]         143   9e-38
ref|WP_013508115.1|  geranyltranstransferase [Pantoea sp. At-9b]     143   9e-38
pdb|4LLS|A  Chain A, Crystal Structure Of A Farnesyl Diphospha...    143   9e-38
ref|WP_029627802.1|  geranyl transferase [Vibrio cholerae]           143   9e-38
ref|WP_000568608.1|  geranyltranstransferase [Vibrio mimicus]        143   9e-38
ref|WP_022577675.1|  geranyltranstransferase [Vibrio mimicus]        143   9e-38
ref|WP_005527419.1|  octaprenyl-diphosphate synthase [Vibrio m...    143   9e-38
ref|WP_019830213.1|  geranyltranstransferase [Vibrio cholerae]       143   1e-37
ref|WP_000568607.1|  geranyltranstransferase [Vibrio mimicus]        143   1e-37
ref|WP_000568614.1|  geranyltranstransferase [Vibrio cholerae]       143   1e-37
ref|WP_011846283.1|  geranyltranstransferase [Shewanella baltica]    143   1e-37
ref|WP_000568610.1|  geranyltranstransferase [Vibrio mimicus]        143   1e-37
ref|WP_006085153.1|  geranyltranstransferase [Shewanella baltica]    143   1e-37
ref|WP_000568613.1|  MULTISPECIES: geranyltranstransferase [Vi...    143   1e-37
dbj|GAL26893.1|  dimethylallyltransferase [Vibrio variabilis]        143   1e-37
ref|WP_000568623.1|  geranyltranstransferase [Vibrio sp. RC586]      143   1e-37
gb|AIT09963.1|  octaprenyl-diphosphate synthase [Francisella s...    143   1e-37
ref|WP_011790102.1|  geranyltranstransferase [Shewanella sp. W...    143   1e-37
ref|WP_000568615.1|  geranyltranstransferase [Vibrio cholerae]       143   1e-37
ref|WP_015670125.1|  putative geranyltranstransferase [Bradyrh...    143   1e-37
ref|WP_021138135.1|  geranyltranstransferase [Aeromonas salmon...    143   1e-37
ref|WP_000568622.1|  geranyltranstransferase [Vibrio cholerae]       143   1e-37
ref|WP_006610268.1|  geranylgeranyl pyrophosphate synthase [Br...    143   1e-37
sp|O66126.1|ISPA_MICLU  RecName: Full=Farnesyl diphosphate syn...    142   1e-37
ref|WP_000568612.1|  geranyltranstransferase [Vibrio cholerae]       143   1e-37
ref|WP_031336989.1|  geranylgeranyl pyrophosphate synthase [Rh...    143   1e-37
ref|WP_026501153.1|  farnesyl-diphosphate synthase [Bartonella...    143   1e-37
ref|WP_026111669.1|  geranyl transferase [Erwinia toletana]          143   1e-37
gb|EUJ38235.1|  geranyltranstransferase [Brochothrix campestri...    142   1e-37
ref|WP_028740001.1|  farnesyl-diphosphate synthase [Rhizobium ...    143   1e-37
ref|WP_013045938.1|  dimethylallyltransferase [Candidatus Puni...    143   1e-37
ref|WP_000568616.1|  geranyltranstransferase [Vibrio cholerae]       142   1e-37
ref|WP_012138964.1|  geranyltranstransferase [Marinobacter lip...    143   1e-37
ref|WP_008078619.1|  geranyltranstransferase [Vibrio sinaloensis]    142   1e-37
ref|WP_016837753.1|  hypothetical protein [Ureibacillus thermo...    142   1e-37
ref|WP_019414105.1|  hypothetical protein [Paenisporosarcina s...    142   1e-37
ref|WP_008404235.1|  farnesyl-diphosphate synthase [Bacillus i...    142   1e-37
gb|KGM88781.1|  Geranylgeranyl pyrophosphate synthase [Roseova...    142   1e-37
ref|WP_009832822.1|  farnesyl-diphosphate synthase [Marinomona...    142   1e-37
ref|WP_000568619.1|  geranyltranstransferase [Vibrio cholerae]       142   1e-37
ref|WP_005370104.1|  geranyltranstransferase [Photobacterium a...    142   1e-37
ref|WP_015465432.1|  geranyltranstransferase [Psychromonas sp....    142   1e-37
ref|WP_011439417.1|  geranylgeranyl pyrophosphate synthase [Rh...    143   1e-37
ref|WP_014077390.1|  farnesyl-diphosphate synthase [Sphingobiu...    142   1e-37
gb|AIR65454.1|  geranyl transferase [Cedecea neteri]                 142   1e-37
ref|WP_010398513.1|  farnesyl-diphosphate synthase [Paracoccus...    142   2e-37
ref|WP_021323473.1|  geranyltranstransferase [Photorhabdus tem...    142   2e-37
ref|WP_007292569.1|  farnesyl-diphosphate synthase [delta prot...    143   2e-37
gb|KFZ38257.1|  geranyl transferase [Shewanella sp. YQH10]           142   2e-37
emb|CDN99515.1|  geranyltranstransferase [Photobacterium phosp...    142   2e-37
ref|WP_010287830.1|  farnesyl-diphosphate synthase [Kurthia sp...    142   2e-37
pdb|3P8R|A  Chain A, Crystal Structure Of Polyprenyl Synthase ...    142   2e-37
ref|WP_006080883.1|  geranyltranstransferase [Shewanella baltica]    142   2e-37
ref|WP_022181433.1|  polyprenyl synthetase [Firmicutes bacteri...    142   2e-37
pdb|4F62|A  Chain A, Crystal Structure Of A Putative Farnesyl-...    143   2e-37
ref|WP_027696886.1|  geranyl transferase [Vibrio litoralis]          142   2e-37
gb|ETS33090.1|  geranylgeranyl pyrophosphate synthase [Photorh...    142   2e-37
ref|WP_008965423.1|  geranylgeranyl pyrophosphate synthase [Br...    142   2e-37
ref|WP_009029280.1|  geranylgeranyl pyrophosphate synthase [Br...    142   2e-37
ref|WP_011923763.1|  geranylgeranyl pyrophosphate synthase [Br...    142   2e-37
ref|WP_006230848.1|  geranyltranstransferase [Photobacterium p...    142   2e-37
ref|WP_027970631.1|  geranyl transferase [Streptococcus castor...    142   2e-37
ref|WP_005598987.1|  geranyltranstransferase [Vibrio scophthalmi]    142   2e-37
ref|WP_004262325.1|  geranyltranstransferase [Aerococcus virid...    142   2e-37
ref|WP_021077538.1|  farnesyl diphosphate synthase [Bradyrhizo...    142   2e-37
ref|WP_004252565.1|  geranyltranstransferase [Proteus mirabilis]     142   2e-37
ref|WP_008759291.1|  farnesyl-diphosphate synthase [Rhodobacte...    142   2e-37
ref|WP_008107823.1|  geranyltranstransferase (farnesyldiphosph...    142   2e-37
ref|WP_026871959.1|  farnesyl-diphosphate synthase [Inquilinus...    142   2e-37
ref|WP_007346447.1|  farnesyl-diphosphate synthase [Bartonella...    142   2e-37
ref|WP_006694052.1|  farnesyl-diphosphate synthase [Selenomona...    142   2e-37
ref|WP_027840699.1|  farnesyl-diphosphate synthase [Mastigocol...    142   2e-37
emb|CEG22932.1|  Farnesyl diphosphate synthase [Planomicrobium...    142   3e-37
ref|WP_013668634.1|  geranyltranstransferase [Aerococcus urinae]     142   3e-37
ref|WP_003722490.1|  geranyltranstransferase [Listeria monocyt...    142   3e-37
ref|WP_025948986.1|  farnesyl-diphosphate synthase [Geobacillu...    142   3e-37
ref|WP_006002490.1|  geranyltranstransferase [Glaciecola punicea]    142   3e-37
ref|WP_014600808.1|  geranyltranstransferase [Listeria monocyt...    142   3e-37
ref|WP_028337348.1|  geranylgeranyl pyrophosphate synthase [Br...    142   3e-37
gb|AIF81352.1|  geranyltranstransferase [endosymbiont of Acant...    142   3e-37
gb|KER05001.1|  geranylgeranyl pyrophosphate synthase [Photorh...    142   3e-37
dbj|GAL19796.1|  dimethylallyltransferase [Vibrio maritimus]         140   3e-37
ref|WP_014823481.1|  farnesyl-diphosphate synthase [Solibacill...    141   4e-37
ref|WP_004258632.1|  farnesyl-diphosphate synthase [Lactococcu...    141   4e-37
gb|KFN18332.1|  geranyl transferase [Aeromonas salmonicida]          141   4e-37
ref|WP_029270051.1|  geranyl transferase [Virgibacillus sp. J18]     141   4e-37
ref|WP_014024465.1|  farnesyl-diphosphate synthase [Lactococcu...    141   4e-37
ref|WP_017369007.1|  farnesyl-diphosphate synthase [Lactococcu...    141   4e-37
ref|WP_021102549.1|  Octaprenyl-diphosphate synthase / Dimethy...    141   4e-37
ref|WP_019934409.1|  geranyltranstransferase [Oceanimonas smir...    141   4e-37
ref|WP_014570955.1|  farnesyl-diphosphate synthase [Lactococcu...    141   4e-37
ref|WP_015835556.1|  geranyltranstransferase [Photorhabdus asy...    142   4e-37
ref|WP_013545554.1|  farnesyl-diphosphate synthase [Bartonella...    141   4e-37
ref|WP_013933712.1|  farnesyl-diphosphate synthase [Zymomonas ...    141   4e-37
ref|WP_017380062.1|  hypothetical protein [Paenisporosarcina s...    141   4e-37
ref|WP_019292001.1|  farnesyl-diphosphate synthase [Lactococcu...    141   5e-37
ref|WP_028774601.1|  geranyl transferase [Shewanella waksmanii]      141   5e-37
ref|WP_009818853.1|  farnesyl-diphosphate synthase [Roseovariu...    141   6e-37
ref|WP_011638238.1|  geranyltranstransferase [Shewanella frigi...    141   6e-37
ref|WP_028036338.1|  geranyl transferase [Candidatus Pelagibac...    141   6e-37
ref|WP_011760546.1|  geranyltranstransferase [Shewanella amazo...    141   6e-37
gb|KDE39737.1|  Octaprenyl diphosphate synthase [Nitrincola la...    141   6e-37
ref|WP_012047358.1|  geranylgeranyl pyrophosphate synthase [Br...    141   6e-37
ref|WP_014196322.1|  farnesyl-diphosphate synthase [Geobacillu...    141   6e-37
ref|WP_011054706.1|  geranyltranstransferase [Streptococcus py...    140   6e-37
ref|WP_004245120.1|  geranyltranstransferase [Proteus mirabilis]     141   6e-37
ref|WP_021736785.1|  geranyltranstransferase domain protein [A...    140   7e-37
ref|WP_012560817.1|  geranyltranstransferase [Streptococcus py...    139   7e-37
ref|WP_020754127.1|  Dimethylallyltransferase [Geobacillus sp....    141   7e-37
ref|WP_011231875.1|  MULTISPECIES: farnesyl-diphosphate syntha...    141   7e-37
gb|KGJ02375.1|  farnesyl-diphosphate synthase [Paracoccus halo...    140   7e-37
ref|WP_003044290.1|  geranyltranstransferase [Streptococcus ca...    140   7e-37
ref|WP_033137767.1|  geranyl transferase [Aeromonas sp. 4287D]       140   7e-37
emb|CDP79380.1|  geranyltranstransferase [Bartonella schoenbuc...    141   7e-37
ref|WP_010704359.1|  geranyltranstransferase [Bartonella schoe...    140   7e-37
ref|WP_027524026.1|  geranylgeranyl pyrophosphate synthase [Br...    141   7e-37
dbj|BAP55665.1|  polyprenyl synthetase [Thioploca ingrica]           140   8e-37
ref|WP_022227154.1|  polyprenyl synthetase [Acidaminococcus in...    140   8e-37
ref|WP_020945203.1|  geranyltranstransferase [Proteus mirabilis]     141   8e-37
ref|WP_014548821.1|  Octaprenyl-diphosphate synthase / Dimethy...    140   8e-37
gb|AIR04465.1|  geranyl transferase [Cedecea neteri]                 140   8e-37
ref|WP_009015276.1|  MULTISPECIES: farnesyl-diphosphate syntha...    140   8e-37
gb|KFZ90419.1|  geranyltranstransferase [Thiobacillus prosperus]     140   8e-37
ref|WP_005317578.1|  geranyltranstransferase [Aeromonas salmon...    140   8e-37
ref|WP_033019356.1|  farnesyl-diphosphate synthase [Geobacillu...    140   8e-37
emb|CBI83005.1|  geranyltranstransferase [Bartonella schoenbuc...    140   9e-37
ref|WP_026455721.1|  geranyl transferase [Aeromonas enteropelo...    140   9e-37
ref|WP_005343523.1|  geranyltranstransferase [Aeromonas veronii]     140   9e-37
emb|CCK77783.1|  Geranyltranstransferase (Farnesyl-diphosphate...    140   9e-37
ref|WP_003394143.1|  geranylgeranyl pyrophosphate synthase [An...    140   9e-37
ref|WP_010945192.1|  geranyltranstransferase [Haemophilus ducr...    140   9e-37
ref|WP_027441921.1|  farnesyl-diphosphate synthase [Porphyroba...    140   9e-37
ref|WP_010548462.1|  geranyltranstransferase [gamma proteobact...    140   9e-37
ref|WP_011410520.1|  geranyltranstransferase [Sodalis glossini...    140   9e-37
gb|KGD87418.1|  farnesyl-diphosphate synthase [Rhizobium sp. Y...    140   9e-37
ref|WP_009384542.1|  geranyltranstransferase [Vibrio sp. N418]       140   9e-37
gb|AHC73819.1|  geranyltranstransferase [Candidatus Endolissoc...    140   9e-37
ref|WP_005349523.1|  geranyltranstransferase [Aeromonas veronii]     140   9e-37
ref|WP_011500740.1|  geranylgeranyl pyrophosphate synthase [Rh...    141   1e-36
ref|WP_005338839.1|  geranyltranstransferase [Aeromonas veronii]     140   1e-36
gb|EZX24661.1|  hypothetical protein V070_00570 [Staphylococcu...    140   1e-36
ref|WP_003051809.1|  geranyltranstransferase [Streptococcus dy...    140   1e-36
ref|WP_013950557.1|  geranyltranstransferase [Candidatus Midic...    140   1e-36
ref|WP_029304283.1|  geranyl transferase [Aeromonas hydrophila]      140   1e-36
ref|WP_012278153.1|  geranyltranstransferase [Shewanella halif...    140   1e-36
ref|WP_031408373.1|  farnesyl-diphosphate synthase [Geobacillu...    140   1e-36
ref|WP_006074253.1|  geranyltranstransferase [Vibrio shilonii]       140   1e-36
ref|WP_028238642.1|  geranyl transferase [Pseudomonas azotifig...    140   1e-36
ref|WP_024361175.1|  farnesyl-diphosphate synthase [Lysinibaci...    140   1e-36
ref|WP_003675661.1|  farnesyl-diphosphate synthase [Lactobacil...    140   1e-36
ref|WP_009091736.1|  geranyltranstransferase [Pantoea sp. Sc1]       140   1e-36
ref|WP_020913654.1|  Polyprenyl synthetase [Shewanella piezoto...    140   1e-36
ref|WP_029167513.1|  geranyl transferase [alpha proteobacteriu...    140   1e-36
ref|WP_020058280.1|  hypothetical protein [alpha proteobacteri...    140   1e-36
ref|WP_016192782.1|  geranyltranstransferase [Erwinia tracheip...    140   1e-36
ref|WP_002983903.1|  geranyltranstransferase [Streptococcus py...    140   1e-36
emb|CEE01986.1|  Farnesyl diphosphate synthase [Bacillus therm...    140   1e-36
ref|WP_029544110.1|  geranyl transferase [Selenomonas ruminant...    140   1e-36
ref|WP_023043751.1|  geranyltranstransferase [Photorhabdus tem...    140   1e-36
ref|WP_011497000.1|  geranyltranstransferase [Shewanella denit...    140   1e-36
gb|EFR87820.1|  geranyltranstransferase [Listeria marthii FSL ...    140   1e-36
ref|WP_007598109.1|  geranylgeranyl pyrophosphate synthase [Br...    140   2e-36
gb|KFC85849.1|  polyprenyl synthetase [Hafnia alvei ATCC 13337]      140   2e-36
gb|KFA99034.1|  geranyl transferase [Vibrio sp. ER1A]                140   2e-36
ref|WP_012358283.1|  geranyltranstransferase [Polynucleobacter...    140   2e-36
ref|WP_025800018.1|  geranyl transferase [Hafnia alvei]              140   2e-36
ref|WP_019445925.1|  geranyltranstransferase [Aeromonas sp. 159]     140   2e-36
ref|WP_029499107.1|  farnesyl-diphosphate synthase [Kurthia hu...    139   2e-36
ref|WP_012820586.1|  MULTISPECIES: farnesyl-diphosphate syntha...    139   2e-36
ref|WP_020278543.1|  MULTISPECIES: polyprenyl synthetase [Geob...    139   2e-36
ref|WP_005503728.1|  geranyltranstransferase [Grimontia hollisae]    140   2e-36
ref|WP_026176757.1|  geranyl transferase [Desulfurispora therm...    139   2e-36
ref|WP_008224136.1|  geranyltranstransferase [Rheinheimera nan...    139   2e-36
gb|AIN47191.1|  Octaprenyl diphosphate synthase / Dimethylally...    139   2e-36
gb|KDA96071.1|  geranyltranstransferase [Pantoea agglomerans E...    139   2e-36
ref|WP_018298571.1|  hypothetical protein [Fangia hongkongensis]     139   2e-36
ref|WP_004156272.1|  geranyltranstransferase [Erwinia amylovora]     139   2e-36
ref|WP_020905315.1|  Dimethylallyltransferase / Geranyltranstr...    139   2e-36
ref|WP_010255381.1|  MULTISPECIES: geranyltranstransferase [Pa...    139   2e-36
ref|WP_004954657.1|  geranyltranstransferase [Serratia odorifera]    139   2e-36
ref|WP_003056941.1|  MULTISPECIES: geranyltranstransferase [St...    139   2e-36
ref|WP_003062185.1|  geranyltranstransferase [Streptococcus dy...    139   2e-36
ref|WP_011217558.1|  geranyltranstransferase [Photobacterium p...    139   2e-36
ref|WP_006786873.1|  farnesyl-diphosphate synthase [Thiorhodos...    139   2e-36
ref|WP_005960689.1|  farnesyl-diphosphate synthase [endosymbio...    139   2e-36
ref|WP_004168974.1|  geranyltranstransferase [Erwinia amylovora]     139   2e-36
ref|WP_011184747.1|  geranyltranstransferase [Streptococcus py...    139   2e-36
ref|WP_002375275.1|  farnesyl-diphosphate synthase [Enterococc...    139   2e-36
ref|WP_019644662.1|  hypothetical protein [Novispirillum iters...    139   2e-36
ref|WP_021734044.1|  polyprenyl synthetase [Streptococcus pyog...    139   2e-36
ref|WP_024534547.1|  farnesyl-diphosphate synthase [Sporosarci...    139   3e-36
ref|WP_002992347.1|  geranyltranstransferase [Streptococcus py...    139   3e-36
ref|WP_031584528.1|  geranyl transferase [Selenomonas bovis]         139   3e-36
gb|EWH11367.1|  Octaprenyl-diphosphate synthase [Catenovulum a...    139   3e-36
ref|WP_014407686.1|  geranyltranstransferase [Streptococcus py...    139   3e-36
ref|WP_011284950.1|  geranyltranstransferase [Streptococcus py...    139   3e-36
ref|WP_033016440.1|  farnesyl-diphosphate synthase [Geobacillu...    139   3e-36
gb|EZH84910.1|  geranyl transferase [Aeromonas hydrophila AD9]       139   3e-36
ref|WP_019517375.1|  farnesyl-diphosphate synthase [Sphingomon...    139   3e-36
ref|WP_014183539.1|  farnesyl-diphosphate synthase [Desulfospo...    139   3e-36
gb|EZI35555.1|  Polyprenyl synthetase [Pantoea agglomerans]          139   3e-36
ref|WP_023612801.1|  polyprenyl synthetase [Streptococcus pyog...    139   3e-36
ref|WP_028023685.1|  geranyl transferase [Enterovibrio calvien...    139   3e-36
ref|WP_025082482.1|  geranyl transferase [Lactobacillus fuchue...    139   3e-36
ref|WP_014802528.1|  farnesyl-diphosphate synthase [Turneriell...    139   3e-36
ref|WP_021322371.1|  farnesyl-diphosphate synthase [Geobacillu...    139   3e-36
ref|WP_002989117.1|  geranyltranstransferase [Streptococcus py...    139   3e-36
ref|WP_009880630.1|  geranyltranstransferase [Streptococcus py...    139   3e-36
gb|AAF12843.1|AF203881_16  geranyltransferase [Zymomonas mobil...    139   3e-36
ref|WP_006696308.1|  farnesyl-diphosphate synthase [Selenomona...    139   3e-36
ref|WP_019213482.1|  hypothetical protein [Clostridiales bacte...    139   3e-36
ref|WP_023837921.1|  farnesyl-diphosphate synthase [Blastomona...    139   3e-36
ref|WP_014543606.1|  geranyltranstransferase [Erwinia sp. Ejp617]    139   3e-36
ref|WP_027253847.1|  geranyl transferase [Photobacterium halot...    139   3e-36
ref|WP_029686923.1|  geranyl transferase [Tatumella saanichensis]    139   4e-36
ref|WP_012668901.1|  geranyltranstransferase [Erwinia pyrifoliae]    139   4e-36
ref|WP_023610133.1|  polyprenyl synthetase [Streptococcus pyog...    139   4e-36
ref|WP_014268471.1|  geranyltranstransferase [Serratia symbiot...    139   4e-36
ref|WP_011071705.1|  geranyltranstransferase [Shewanella oneid...    139   4e-36
ref|WP_010671200.1|  geranyltranstransferase [Pantoea agglomer...    139   4e-36
gb|AIR87190.1|  geranyl transferase [Pantoea rwandensis]             139   4e-36
ref|WP_007122167.1|  farnesyl-diphosphate synthase [Lactobacil...    139   4e-36
ref|WP_012156211.1|  geranyltranstransferase [Shewanella peale...    139   4e-36
ref|WP_014354389.1|  geranyltranstransferase [Wigglesworthia g...    139   4e-36
ref|WP_028763303.1|  geranyl transferase [Shewanella colwelliana]    139   4e-36
ref|WP_023611798.1|  polyprenyl synthetase [Streptococcus pyog...    139   4e-36
ref|WP_007154562.1|  farnesyl-diphosphate synthase [Marinobact...    139   4e-36
gb|KEY42205.1|  geranyltranstransferase [Pantoea agglomerans]        139   4e-36
ref|WP_008280892.1|  farnesyl-diphosphate synthase [Roseovariu...    138   4e-36
ref|WP_020504168.1|  hypothetical protein [Lamprocystis purpurea]    139   4e-36
ref|WP_029007585.1|  farnesyl-diphosphate synthase [Azospirill...    139   5e-36
ref|WP_017409292.1|  geranyltranstransferase [Aeromonas hydrop...    139   5e-36
ref|WP_024944270.1|  geranyl transferase [Aeromonas hydrophila]      139   5e-36
ref|WP_002315412.1|  farnesyl-diphosphate synthase [Enterococc...    139   5e-36
ref|WP_012657073.1|  farnesyl-diphosphate synthase [Macrococcu...    138   5e-36
ref|WP_024967251.1|  geranyl transferase [Pantoea sp. IMH]           139   5e-36
ref|WP_016175683.1|  hypothetical protein [Enterococcus saccha...    139   5e-36
ref|WP_002291883.1|  farnesyl-diphosphate synthase [Enterococc...    139   5e-36
ref|WP_011414043.1|  farnesyl-diphosphate synthase [Erythrobac...    139   5e-36
ref|WP_030126396.1|  geranyl transferase [Streptococcus pyogenes]    138   5e-36
ref|WP_002329021.1|  geranylgeranyl diphosphate synthase, type...    139   5e-36
ref|WP_011329015.1|  geranyltranstransferase [Pseudoalteromona...    139   5e-36
ref|WP_019293750.1|  farnesyl-diphosphate synthase [Lactococcu...    138   5e-36
ref|WP_011707087.1|  geranyltranstransferase [Aeromonas hydrop...    139   5e-36
ref|WP_012143662.1|  geranyltranstransferase [Shewanella sedim...    138   5e-36
ref|WP_002341237.1|  geranylgeranyl diphosphate synthase, type...    139   5e-36
ref|WP_006474060.1|  farnesyl-diphosphate synthase [endosymbio...    138   5e-36
ref|WP_010728499.1|  geranylgeranyl diphosphate synthase, type...    138   5e-36
ref|WP_005497628.1|  geranyltranstransferase [Shewanella benth...    138   5e-36
ref|WP_017216364.1|  geranyltranstransferase [Pseudoalteromona...    139   5e-36
gb|KER61704.1|  geranyl transferase [Aeromonas hydrophila]           138   5e-36
ref|WP_013050402.1|  geranyltranstransferase [Shewanella viola...    138   5e-36
ref|WP_009734522.1|  geranylgeranyl pyrophosphate synthase [Br...    139   5e-36
ref|WP_024636550.1|  geranyl transferase [Enterococcus faecium]      138   5e-36
ref|WP_016503997.1|  geranyltranstransferase [Candidatus Photo...    138   5e-36
ref|WP_008879803.1|  MULTISPECIES: farnesyl-diphosphate syntha...    138   6e-36
ref|WP_027397064.1|  geranyl transferase [Anaerovibrio lipolyt...    138   6e-36
ref|WP_015359888.1|  farnesyl diphosphate synthase [ [[Clostri...    138   6e-36
ref|WP_020167860.1|  MULTISPECIES: geranyltranstransferase [Me...    139   6e-36
gb|KAI94299.1|  geranylgeranyl pyrophosphate synthase [Rhodomi...    138   6e-36
gb|EXU77025.1|  geranyl transferase [Erwinia mallotivora]            138   6e-36
gb|EOH52128.1|  geranylgeranyl diphosphate synthase, type II [...    138   6e-36
gb|KCZ60657.1|  farnesyl-diphosphate synthase [Hyphomonas sp. ...    138   7e-36
ref|WP_002310268.1|  farnesyl-diphosphate synthase [Enterococc...    138   7e-36
gb|KGM28473.1|  geranyl transferase [Photorhabdus luminescens]       138   7e-36
ref|WP_012442237.1|  geranyltranstransferase [Erwinia tasmanie...    138   7e-36
ref|WP_003663861.1|  farnesyl-diphosphate synthase [Lactobacil...    138   7e-36
gb|AHI31339.1|  farnesyl-diphosphate synthase [Marinobacter sp...    138   7e-36
ref|WP_010372083.1|  geranyltranstransferase [Pseudoalteromona...    138   7e-36
ref|WP_010618789.1|  geranyltranstransferase [Plautia stali sy...    138   7e-36
ref|WP_024634768.1|  geranyl transferase [Enterococcus faecium]      138   7e-36
ref|WP_013417842.1|  geranylgeranyl pyrophosphate synthase [Rh...    138   7e-36
ref|WP_022591635.1|  geranyltranstransferase [Vibrio nigripulc...    138   8e-36
emb|CDG96624.1|  geranyltranstransferase (=farnesyldiphosphate...    138   8e-36
ref|WP_016628680.1|  geranyltranstransferase [Enterococcus fae...    138   8e-36
ref|WP_004236435.1|  geranyltranstransferase [Morganella morga...    138   8e-36
ref|WP_015422963.1|  Octaprenyl-diphosphate synthase [Morganel...    138   9e-36
ref|WP_014092746.1|  geranyltranstransferase [Listeria ivanovii]     138   9e-36
ref|WP_013794148.1|  geranyltranstransferase [Streptococcus pa...    137   9e-36
ref|WP_023432609.1|  geranyltranstransferase (farnesyl-diphosp...    138   9e-36
gb|KEQ20801.1|  geranyl transferase [Lactobacillus reuteri]          137   9e-36
ref|WP_019252446.1|  farnesyl-diphosphate synthase [Lactobacil...    137   9e-36
ref|WP_003104262.1|  geranyltranstransferase [Streptococcus pa...    137   9e-36
emb|CDG87218.1|  geranyltranstransferase (=farnesyldiphosphate...    138   9e-36
ref|WP_027514555.1|  geranylgeranyl pyrophosphate synthase [Br...    138   1e-35
ref|WP_005705768.1|  geranyltranstransferase [Haemophilus para...    137   1e-35
ref|WP_021934109.1|  polyprenyl synthetase [Firmicutes bacteri...    137   1e-35
ref|WP_032115112.1|  geranyl transferase [Arsenophonus endosym...    138   1e-35
ref|WP_003107296.1|  Octaprenyl-diphosphate synthase [Streptoc...    137   1e-35
ref|WP_007615948.1|  geranylgeranyl pyrophosphate synthase [Br...    138   1e-35
ref|WP_009114046.1|  geranyltranstransferase [Brenneria sp. En...    138   1e-35
ref|WP_017932247.1|  hypothetical protein [Robiginitomaculum a...    137   1e-35
ref|WP_022487775.1|  polyprenyl synthetase [Acidaminococcus sp...    137   1e-35
ref|WP_002945171.1|  (2E,6E)-farnesyl diphosphate synthase [St...    137   1e-35
ref|WP_028149141.1|  geranylgeranyl pyrophosphate synthase [Br...    138   1e-35
emb|CDH06938.1|  geranyltranstransferase (=farnesyldiphosphate...    138   1e-35
ref|WP_025904938.1|  geranyl transferase [Staphylococcus sciuri]     137   1e-35
ref|WP_021771199.1|  putative geranyltranstransferase [Mitsuok...    137   1e-35
ref|WP_016959716.1|  geranyltranstransferase [Enterovibrio nor...    137   1e-35
ref|WP_010726382.1|  geranylgeranyl diphosphate synthase, type...    137   1e-35
ref|WP_031592192.1|  geranyl transferase [Pantoea agglomerans]       137   1e-35
ref|WP_007780038.1|  farnesyl-diphosphate synthase [Desulfospo...    137   1e-35
ref|WP_027563259.1|  MULTISPECIES: geranylgeranyl pyrophosphat...    138   1e-35
emb|CDH22921.1|  geranyltranstransferase (=farnesyldiphosphate...    137   1e-35
emb|CDH21675.1|  geranyltranstransferase (=farnesyldiphosphate...    137   1e-35
ref|WP_012938227.1|  farnesyl-diphosphate synthase [Acidaminoc...    137   1e-35
ref|WP_013344390.1|  geranyltranstransferase [Ferrimonas balea...    137   1e-35
emb|CDQ29454.1|  Farnesyl diphosphate synthase [Halobacillus t...    137   1e-35
dbj|BAD18313.1|  geranyltranstransferase [Geobacillus stearoth...    138   1e-35
gb|EUJ17562.1|  putative geranyltranstransferase [Listeriaceae...    137   1e-35
ref|WP_016264854.1|  farnesyl-diphosphate synthase [Lactobacil...    137   1e-35
ref|WP_015344509.1|  Farnesyl diphosphate synthase [Candidatus...    137   1e-35
ref|WP_018708511.1|  hypothetical protein [Bacillus fordii]          137   1e-35
ref|WP_020960525.1|  farnesyl-diphosphate synthase [Geobacillu...    137   1e-35
ref|WP_022549932.1|  geranyltranstransferase [Vibrio nigripulc...    137   1e-35
ref|WP_028724004.1|  geranyl transferase [Pantoea ananatis]          137   1e-35
ref|WP_022611606.1|  geranyltranstransferase [Vibrio nigripulc...    137   1e-35
emb|CDH32887.1|  geranyltranstransferase (=farnesyldiphosphate...    137   1e-35
ref|WP_025151759.1|  geranyl transferase [Morganella morganii]       137   1e-35
ref|WP_014593071.1|  geranyltranstransferase [Pantoea ananatis]      137   2e-35
ref|WP_014499601.1|  farnesyl-diphosphate synthase [Buchnera a...    137   2e-35
ref|WP_003852522.1|  MULTISPECIES: geranyltranstransferase [Pa...    137   2e-35
ref|WP_013024867.1|  geranyltranstransferase [Pantoea ananatis]      137   2e-35
gb|KGD79032.1|  geranyl transferase [Pantoea vagans]                 137   2e-35
ref|WP_016911710.1|  hypothetical protein [Staphylococcus vitu...    137   2e-35
ref|WP_012988160.1|  geranyltranstransferase [Xenorhabdus bovi...    137   2e-35
ref|WP_012637412.1|  farnesyl-diphosphate synthase [Thioalkali...    137   2e-35
ref|WP_031554950.1|  farnesyl-diphosphate synthase [Parvularcu...    137   2e-35
ref|WP_005881067.1|  octaprenyl-diphosphate synthase/ dimethyl...    137   2e-35
gb|AIF43476.1|  farnesyl-diphosphate synthase [Virgibacillus s...    137   2e-35
ref|WP_001041145.1|  geranyltranstransferase [Streptococcus sp...    137   2e-35
ref|WP_009442321.1|  farnesyl-diphosphate synthase [Selenomona...    137   2e-35
ref|WP_011282783.1|  geranyltranstransferase [Candidatus Bloch...    137   2e-35
gb|KDA03955.1|  geranyltranstransferase [Hyphomonas oceanitis ...    137   2e-35
ref|WP_002332076.1|  farnesyl-diphosphate synthase [Enterococc...    137   2e-35
ref|WP_005272756.1|  geranyltranstransferase [Yersinia bercovi...    137   2e-35
ref|WP_003672223.1|  farnesyl-diphosphate synthase [Lactobacil...    137   2e-35
ref|WP_022675572.1|  farnesyl-diphosphate synthase [Novosphing...    137   2e-35
ref|WP_029569708.1|  geranyl transferase [Pantoea ananatis]          137   2e-35
ref|WP_029091146.1|  hypothetical protein [Brochothrix thermos...    137   2e-35
ref|WP_010727890.1|  geranylgeranyl diphosphate synthase, type...    137   2e-35
ref|WP_002324428.1|  geranylgeranyl diphosphate synthase, type...    137   2e-35
ref|WP_002334684.1|  farnesyl-diphosphate synthase [Enterococc...    137   2e-35
ref|WP_020175064.1|  polyprenyl synthetase [Methyloferula stel...    137   2e-35
ref|WP_003126210.1|  farnesyl-diphosphate synthase [Enterococc...    137   2e-35
ref|WP_018029408.1|  hypothetical protein [Streptococcus ferus]      137   2e-35
ref|WP_011148024.1|  geranyltranstransferase [Photorhabdus lum...    137   2e-35
ref|WP_011520457.1|  geranyltranstransferase [Candidatus Bauma...    137   2e-35
ref|WP_002325461.1|  geranylgeranyl diphosphate synthase, type...    137   2e-35
ref|WP_028118011.1|  geranyl transferase [Ferrimonas senticii]       137   2e-35
ref|WP_017969502.1|  hypothetical protein [alpha proteobacteri...    137   2e-35
ref|WP_028176808.1|  geranylgeranyl pyrophosphate synthase [Br...    137   2e-35
emb|CDO01937.1|  Farnesyl diphosphate synthase [Oceanobacillus...    137   2e-35
gb|KEO98866.1|  farnesyl-diphosphate synthase [Erythrobacter l...    137   3e-35
ref|WP_021318056.1|  farnesyl-diphosphate synthase [Sphingobiu...    137   3e-35
ref|WP_001041144.1|  geranyltranstransferase [Streptococcus in...    136   3e-35
ref|WP_010864311.1|  polyprenyl synthetase [Plesiomonas shigel...    137   3e-35
ref|WP_002286656.1|  MULTISPECIES: farnesyl-diphosphate syntha...    137   3e-35
ref|WP_003668404.1|  farnesyl-diphosphate synthase [Lactobacil...    136   3e-35
ref|WP_004408430.1|  geranyltranstransferase [Vibrio nigripulc...    136   3e-35
emb|CDG47169.1|  Farnesyl diphosphate synthase [Serratia symbi...    137   3e-35
ref|WP_005471165.1|  MULTISPECIES: farnesyl-diphosphate syntha...    136   3e-35
gb|ETR77501.1|  geranylgeranyl pyrophosphate synthase [Afipia ...    137   3e-35
ref|WP_021724314.1|  Putative Geranyltranstransferase [Avibact...    136   3e-35
gb|EYU17237.1|  geranylgeranyl pyrophosphate synthase [Photorh...    137   3e-35
ref|WP_022603441.1|  geranyltranstransferase [Vibrio nigripulc...    136   3e-35
ref|WP_000347241.1|  geranyltranstransferase [Escherichia coli]      136   3e-35
ref|WP_006689502.1|  farnesyl-diphosphate synthase [Selenomona...    136   3e-35
gb|AHG73063.1|  Farnesyl-diphosphate synthase [Mannheimia vari...    136   3e-35
ref|WP_021507168.1|  geranyltranstransferase [Pantoea dispersa]      136   3e-35
ref|WP_026340019.1|  geranyl transferase [Amphritea japonica]        136   3e-35
ref|WP_033009416.1|  farnesyl-diphosphate synthase [Geobacillu...    136   3e-35
ref|WP_019416955.1|  farnesyl-diphosphate synthase [Anoxybacil...    136   3e-35
ref|WP_016245779.1|  farnesyl diphosphate synthase [Escherichi...    136   3e-35
ref|WP_019427639.1|  hypothetical protein [Limnohabitans sp. R...    136   3e-35
ref|WP_002713693.1|  hypothetical protein [Afipia clevelandensis]    136   4e-35
ref|WP_018165591.1|  geranyltranstransferase [Streptococcus he...    136   4e-35
ref|WP_005235358.1|  MULTISPECIES: farnesyl-diphosphate syntha...    136   4e-35
ref|WP_022594586.1|  geranyltranstransferase [Vibrio nigripulc...    136   4e-35
ref|WP_004096672.1|  geranyltranstransferase [Hafnia alvei]          136   4e-35
ref|WP_011374388.1|  farnesyl-diphosphate synthase [Lactobacil...    136   4e-35
ref|WP_004873465.1|  geranyltranstransferase [Yersinia mollare...    136   4e-35
ref|WP_006923502.1|  farnesyl-diphosphate synthase [Bartonella...    136   4e-35
gb|KFE38347.1|  geranyltranstransferase [Yersinia ruckeri]           136   4e-35
ref|WP_023654212.1|  geranyltranstransferase [Erwinia piriflor...    136   4e-35
ref|WP_004718655.1|  geranyltranstransferase [Yersinia ruckeri]      136   4e-35
ref|WP_028100075.1|  farnesyl-diphosphate synthase [Dongia sp....    136   4e-35
ref|WP_007420198.1|  geranyltranstransferase [Idiomarina sp. A...    136   5e-35
ref|WP_018953042.1|  farnesyl-diphosphate synthase [Thioalkali...    136   5e-35
ref|WP_012232475.1|  farnesyl-diphosphate synthase [Bartonella...    136   5e-35
ref|WP_011962114.1|  geranyltranstransferase [Haemophilus infl...    136   5e-35
ref|WP_025738834.1|  geranyl transferase [Salinivibrio socompe...    136   5e-35
ref|WP_005710269.1|  geranyltranstransferase [Haemophilus para...    136   5e-35
ref|WP_010719791.1|  farnesyl-diphosphate synthase [Enterococc...    136   5e-35
ref|WP_005012631.1|  geranyltranstransferase [Bordetella holme...    136   5e-35
ref|WP_027278723.1|  geranylgeranyl pyrophosphate synthase [Rh...    136   5e-35
ref|WP_002537008.1|  Octaprenyl-diphosphate synthase [Grimonti...    136   5e-35
ref|WP_031374686.1|  geranyl transferase [Pantoea sp. 3.5.2]         136   5e-35
ref|WP_027553378.1|  geranylgeranyl pyrophosphate synthase [Br...    136   5e-35
ref|WP_024509482.1|  geranylgeranyl pyrophosphate synthase [Br...    136   5e-35
ref|WP_008814284.1|  geranyltranstransferase [Enterobacteriace...    136   5e-35
ref|WP_029667812.1|  hypothetical protein [candidate division ...    134   6e-35
ref|WP_019378275.1|  hypothetical protein [Virgibacillus halod...    135   6e-35
ref|WP_027542175.1|  geranylgeranyl pyrophosphate synthase [Br...    136   6e-35
ref|WP_017970258.1|  hypothetical protein [alpha proteobacteri...    135   6e-35
ref|WP_027406245.1|  geranyl transferase [Anaerovibrio sp. RM50]     135   6e-35
ref|WP_009624081.1|  farnesyl-diphosphate synthase [Desulfospo...    135   6e-35
ref|WP_025015874.1|  geranyl transferase [Lactobacillus sakei]       135   6e-35
gb|EKD92145.1|  hypothetical protein ACD_29C00157G0002 [uncult...    135   6e-35
ref|WP_024581927.1|  geranylgeranyl pyrophosphate synthase [Br...    136   6e-35
gb|KGD84466.1|  geranyl transferase [Pantoea stewartii subsp. ...    135   6e-35
ref|WP_006830437.1|  farnesyl-diphosphate synthase [Planococcu...    135   6e-35
ref|WP_005753924.1|  geranyltranstransferase [Pasteurella mult...    135   7e-35
ref|WP_013967156.1|  geranyltranstransferase [Nitrosomonas sp....    135   7e-35
ref|WP_019254001.1|  farnesyl-diphosphate synthase [Lactobacil...    135   7e-35
ref|WP_011083768.1|  MULTISPECIES: geranylgeranyl pyrophosphat...    135   7e-35
ref|WP_013167536.1|  geranylgeranyl pyrophosphate synthase [St...    135   7e-35
ref|WP_018662069.1|  Octaprenyl diphosphate synthase / Dimethy...    135   7e-35
ref|WP_006709494.1|  geranyltranstransferase [Serratia symbiot...    135   7e-35
ref|WP_021014959.1|  Geranyltranstransferase [Serratia sp. ATC...    135   7e-35
ref|WP_029003631.1|  geranylgeranyl pyrophosphate synthase [Az...    135   7e-35
ref|WP_012589858.1|  polyprenyl synthetase [Methylocella silve...    135   8e-35
gb|ETP67928.1|  farnesyl-diphosphate synthase [Planomicrobium ...    135   8e-35
ref|WP_014391015.1|  geranyltranstransferase [Pasteurella mult...    135   8e-35
emb|CDS58897.1|  geranyltranstransferase [Serratia symbiotica]       135   8e-35
ref|WP_006318022.1|  geranylgeranyl pyrophosphate synthase [An...    135   8e-35
ref|WP_022679692.1|  farnesyl-diphosphate synthase [Sandarakin...    135   9e-35
dbj|GAL32980.1|  dimethylallyltransferase [Vibrio maritimus]         132   9e-35
ref|WP_018014065.1|  farnesyl-diphosphate synthase [Terediniba...    135   9e-35
emb|CDG16561.1|  Geranyltranstransferase [Xenorhabdus doucetiae]     135   9e-35
ref|WP_005589517.1|  geranyltranstransferase [Streptococcus cr...    135   9e-35
ref|WP_026821460.1|  geranyl transferase [Arsenophonus nasoniae]     135   9e-35
ref|WP_028876788.1|  geranyl transferase [Teredinibacter turne...    135   9e-35
emb|CBA71639.1|  geranyltranstransferase [Arsenophonus nasoniae]     135   9e-35
gb|KGM38108.1|  Octaprenyl-diphosphate synthase [Streptococcus...    135   9e-35
ref|WP_027975731.1|  geranyl transferase [Streptococcus devrie...    135   1e-34
ref|WP_002926447.1|  MULTISPECIES: polyprenyl synthetase [Thau...    135   1e-34
ref|WP_012574601.1|  farnesyl-diphosphate synthase [Anoxybacil...    135   1e-34
gb|AHG75847.1|  Farnesyl-diphosphate synthase [Mannheimia vari...    135   1e-34
ref|WP_007084623.1|  polyprenyl synthetase [Bacillus bataviensis]    135   1e-34
ref|WP_007680447.1|  farnesyl-diphosphate synthase [alpha prot...    135   1e-34
ref|WP_013922567.1|  Octaprenyl-diphosphate synthase / Dimethy...    135   1e-34
gb|AHG77859.1|  Farnesyl-diphosphate synthase [Mannheimia vari...    135   1e-34
gb|AHG79393.1|  Farnesyl-diphosphate synthase [Mannheimia vari...    135   1e-34
ref|WP_026297660.1|  geranyl transferase [Succinimonas amyloly...    135   1e-34
ref|WP_013201023.1|  geranyltranstransferase [Erwinia billingiae]    135   1e-34
ref|WP_017371403.1|  geranyltranstransferase [Enterobacteriace...    135   1e-34
ref|WP_015820636.1|  farnesyl-diphosphate synthase [Terediniba...    135   1e-34
ref|WP_011888744.1|  geranyltranstransferase [Streptococcus py...    135   1e-34
ref|WP_015509507.1|  geranyltranstransferase [Enterococcus cas...    135   1e-34
ref|WP_002496871.1|  geranyltranstransferase [Staphylococcus e...    135   1e-34
ref|WP_019431233.1|  hypothetical protein [Limnohabitans sp. R...    135   1e-34
ref|WP_027187278.1|  polyprenyl synthetase [Desulfovibrio cune...    135   1e-34
ref|WP_020366198.1|  geranyltranstransferase [Staphylococcus e...    134   1e-34
ref|WP_026009353.1|  farnesyl-diphosphate synthase [Sphingomon...    135   1e-34
ref|WP_009373878.1|  geranylgeranyl pyrophosphate synthase [An...    135   1e-34
ref|WP_010252615.1|  farnesyl-diphosphate synthase [Acetivibri...    135   1e-34
emb|CDL83282.1|  Geranyltranstransferase [Xenorhabdus szentirm...    135   1e-34
ref|WP_010845027.1|  Farnesyl diphosphate synthase [Xenorhabdu...    135   1e-34
ref|WP_022196479.1|  geranyltranstransferase [Azospirillum sp....    135   1e-34
ref|WP_029525295.1|  polyprenyl synthetase [Polaromonas sp. Cr...    135   1e-34
gb|EYE89702.1|  farnesyl-diphosphate synthase [Fervidicella me...    134   1e-34
ref|WP_010661444.1|  farnesyl-diphosphate synthase [Ochrobactr...    135   1e-34
ref|WP_009821184.1|  farnesyl-diphosphate synthase [Sphingomon...    135   1e-34
ref|WP_013498620.1|  polyprenyl synthetase [Ruminococcus albus]      135   1e-34
ref|WP_028885541.1|  geranyl transferase [Teredinibacter turne...    134   1e-34
ref|WP_005726323.1|  geranyltranstransferase [Pasteurella mult...    134   1e-34
gb|EUJ51203.1|  putative geranyltranstransferase [Listeria roc...    134   1e-34
ref|WP_013527677.1|  geranyltranstransferase [Haemophilus infl...    134   1e-34
ref|WP_006926004.1|  farnesyl-diphosphate synthase [Bartonella...    135   2e-34
ref|WP_026771186.1|  hypothetical protein [Sediminibacillus ha...    134   2e-34
ref|WP_005721989.1|  geranyltranstransferase [Pasteurella mult...    134   2e-34
ref|WP_005751409.1|  geranyltranstransferase [Pasteurella mult...    134   2e-34
ref|WP_026569994.1|  hypothetical protein [Bacillus sp. NSP22.2]     134   2e-34
ref|WP_023388281.1|  geranylgeranyl pyrophosphate synthase [Yo...    134   2e-34
ref|WP_026738817.1|  geranyl transferase [Lonsdalea quercina]        135   2e-34
ref|WP_011445896.1|  farnesyl-diphosphate synthase [Novosphing...    135   2e-34
ref|WP_008980560.1|  farnesyl-diphosphate synthase [Ruminococc...    134   2e-34
ref|WP_027669646.1|  geranyl transferase [Rheinheimera baltica]      134   2e-34
dbj|GAK71372.1|  geranyltranstransferase [Rhizobium rubi NBRC ...    134   2e-34
ref|WP_007524174.1|  geranyltranstransferase [Haemophilus sput...    134   2e-34
ref|WP_012032364.1|  farnesyl-diphosphate synthase [Pelotomacu...    134   2e-34
ref|WP_013183605.1|  geranyltranstransferase [Xenorhabdus nema...    135   2e-34
ref|WP_026327699.1|  geranyl transferase [Selenomonas bovis]         134   2e-34
ref|WP_027531418.1|  geranylgeranyl pyrophosphate synthase [Br...    135   2e-34
ref|WP_009727822.1|  hypothetical protein [Selenomonas sp. F0473]    134   2e-34
ref|WP_024516519.1|  geranylgeranyl pyrophosphate synthase [Br...    134   2e-34
gb|EQB09082.1|  farnesyl-diphosphate synthase [Novosphingobium...    134   2e-34
ref|WP_004230797.1|  geranyltranstransferase [Streptococcus eq...    134   2e-34
ref|WP_031343024.1|  farnesyl-diphosphate synthase [Novosphing...    134   2e-34
ref|WP_008382858.1|  geranylgeranyl pyrophosphate synthase [Rh...    135   2e-34
ref|WP_022632541.1|  Geranyltranstransferase [Dickeya solani]        134   2e-34
ref|WP_024630989.1|  MULTISPECIES: polyprenyl synthetase [Paen...    134   2e-34
ref|WP_014550780.1|  geranyltranstransferase [Haemophilus infl...    134   2e-34
dbj|GAK12807.1|  octaprenyl-diphosphate synthase [Geomicrobium...    134   2e-34
ref|WP_005688429.1|  geranyltranstransferase [Haemophilus infl...    134   2e-34
ref|WP_004583355.1|  geranyltranstransferase [Marinobacter nan...    134   2e-34
gb|KGK79629.1|  farnesyl-diphosphate synthase [Thalassobacter ...    134   2e-34
gb|AHF07376.1|  farnesyl-diphosphate synthase [Desulfitobacter...    134   2e-34
ref|WP_011238321.1|  geranyltranstransferase [Aromatoleum arom...    134   2e-34
ref|WP_027308271.1|  farnesyl-diphosphate synthase [Caloramato...    134   2e-34
gb|KGF12588.1|  hypothetical protein HMPREF1633_00680 [Clostri...    134   2e-34
ref|WP_023511040.1|  farnesyl-diphosphate synthase [Sporolacto...    134   2e-34
ref|WP_004889604.1|  polyprenyl synthetase [Anoxybacillus flav...    134   2e-34
ref|WP_002456184.1|  geranyltranstransferase [Staphylococcus e...    134   2e-34
gb|AIL64725.1|  Farnesyl diphosphate synthase [Rickettsiales b...    134   2e-34
ref|WP_005666876.1|  geranyltranstransferase [Haemophilus infl...    134   2e-34
ref|WP_024025069.1|  farnesyl-diphosphate synthase [Marinomona...    134   2e-34
ref|WP_016426975.1|  hypothetical protein [Paenisporosarcina s...    134   2e-34
ref|WP_012073110.1|  geranyltranstransferase [Actinobacillus s...    134   2e-34
ref|WP_019961340.1|  hypothetical protein [Woodsholea maritima]      134   2e-34
ref|WP_012091277.1|  farnesyl-diphosphate synthase [Ochrobactr...    134   2e-34
ref|WP_015605173.1|  farnesyl diphosphate synthase [Streptococ...    134   2e-34
ref|WP_002440017.1|  geranyltranstransferase [Staphylococcus e...    134   2e-34
ref|WP_016610294.1|  geranyltranstransferase [Enterococcus cas...    134   2e-34
ref|WP_010747996.1|  geranyltranstransferase [Enterococcus cas...    134   3e-34
emb|CDG20102.1|  Geranyltranstransferase [Xenorhabdus poinarii...    134   3e-34
ref|WP_018372962.1|  hypothetical protein [Streptococcus merio...    134   3e-34
ref|WP_012348377.1|  polyprenyl synthetase [Leptothrix cholodnii]    134   3e-34
ref|WP_027967930.1|  geranyl transferase [Streptococcus equinus]     134   3e-34
ref|WP_012561298.1|  geranylgeranyl pyrophosphate synthase [Ol...    134   3e-34
ref|WP_010011067.1|  farnesyl-diphosphate synthase [Lactobacil...    134   3e-34
ref|WP_015856979.1|  farnesyl-diphosphate synthase [Bartonella...    134   3e-34
ref|WP_029206320.1|  geranyl transferase [alpha proteobacteriu...    134   3e-34
ref|WP_002503165.1|  geranyltranstransferase [Staphylococcus e...    134   3e-34
gb|KEY48472.1|  geranyl transferase [Streptococcus equinus]          134   3e-34
ref|WP_011509215.1|  geranylgeranyl pyrophosphate synthase [Ni...    134   3e-34
ref|WP_006060763.1|  hypothetical protein [Holdemania filiformis]    133   3e-34
ref|WP_009553524.1|  polyprenyl synthetase [Burkholderiales ba...    134   3e-34
ref|WP_026080992.1|  polyprenyl synthetase [Paenibacillus sp. ...    134   3e-34
ref|WP_021095253.1|  geranylgeranyl pyrophosphate synthase [An...    134   3e-34
ref|WP_021225437.1|  farnesyl-diphosphate synthase [Sphingobiu...    134   3e-34
ref|WP_006117976.1|  geranyltranstransferase [Pantoea stewartii]     134   3e-34
ref|WP_026742879.1|  geranyl transferase [Lonsdalea quercina]        134   3e-34
ref|WP_032604602.1|  geranyl transferase [Staphylococcus epide...    134   3e-34
ref|WP_005225775.1|  farnesyl-diphosphate synthase [Enterococc...    134   3e-34
ref|WP_032100005.1|  farnesyl-diphosphate synthase [Anoxybacil...    134   3e-34
ref|WP_003677287.1|  farnesyl-diphosphate synthase [Lactobacil...    134   3e-34
ref|WP_014598985.1|  geranylgeranyl pyrophosphate synthase [Ol...    134   3e-34
ref|WP_002495739.1|  geranyltranstransferase [Staphylococcus e...    134   3e-34
ref|WP_003108180.1|  Geranylgeranyl pyrophosphate synthetase [...    133   3e-34
ref|WP_032109120.1|  geranyl transferase [Haemophilus sp. FF7]       134   4e-34
ref|WP_021768371.1|  putative geranyltranstransferase [Leptotr...    134   4e-34
ref|WP_018990899.1|  geranyltranstransferase [Azoarcus tolucla...    134   4e-34
ref|WP_024303247.1|  geranyl transferase [Pseudogulbenkiania s...    134   4e-34
ref|WP_028481424.1|  farnesyl-diphosphate synthase [Nesiotobac...    134   4e-34
ref|WP_021684005.1|  putative geranyltranstransferase [Selenom...    133   4e-34
gb|EHR83444.1|  geranyltranstransferase [Staphylococcus epider...    133   4e-34
gb|EGG73494.1|  geranyltranstransferase [Staphylococcus epider...    133   4e-34
ref|WP_010654243.1|  farnesyl-diphosphate synthase [Fluoribact...    134   4e-34
ref|WP_002446511.1|  geranyltranstransferase [Staphylococcus e...    133   4e-34
ref|WP_018274590.1|  farnesyl-diphosphate synthase [Terediniba...    133   4e-34
gb|EUJ31790.1|  geranyltranstransferase [Listeriaceae bacteriu...    132   4e-34
ref|WP_013900629.1|  polyprenyl synthetase [Ramlibacter tataou...    134   4e-34
gb|EGG61893.1|  geranyltranstransferase [Staphylococcus epider...    133   4e-34
ref|WP_014065415.1|  geranyltranstransferase [Haemophilus para...    133   4e-34
ref|WP_024349800.1|  farnesyl-diphosphate synthase [Aurantimon...    134   4e-34
ref|WP_019606292.1|  farnesyl-diphosphate synthase [Terediniba...    133   4e-34
ref|WP_018355540.1|  geranyltranstransferase [Pasteurella pneu...    133   4e-34
ref|WP_008798033.1|  farnesyl-diphosphate synthase [Fusobacter...    133   4e-34
ref|WP_026563642.1|  farnesyl-diphosphate synthase [Bacillus s...    133   4e-34
ref|WP_002503987.1|  geranyltranstransferase [Staphylococcus e...    133   4e-34
ref|WP_020362143.1|  geranyltranstransferase [Staphylococcus e...    133   4e-34
gb|KFN85766.1|  geranyltranstransferase [Streptococcus bovis A...    133   4e-34
ref|WP_026500436.1|  farnesyl-diphosphate synthase [Bartonella...    133   5e-34
gb|EEX49921.1|  polyprenyl synthetase [Pasteurella dagmatis AT...    134   5e-34
ref|WP_011482681.1|  polyprenyl synthetase [Polaromonas sp. JS...    134   5e-34
ref|WP_032855152.1|  geranyl transferase [Pasteurella dagmatis]      133   5e-34
ref|WP_002456496.1|  MULTISPECIES: geranyltranstransferase [St...    133   5e-34
ref|WP_005696154.1|  geranyltranstransferase [Haemophilus para...    133   5e-34
ref|WP_025725325.1|  hypothetical protein [Acholeplasma granul...    133   5e-34
ref|WP_018372080.1|  hypothetical protein [Streptococcus massi...    133   5e-34
ref|WP_017347895.1|  geranyltranstransferase [Pantoea sp. A4]        133   5e-34
ref|WP_012417839.1|  geranyltranstransferase [Bordetella avium]      133   5e-34
ref|WP_009143655.1|  geranyltranstransferase [Succinatimonas h...    133   5e-34
ref|WP_018142074.1|  MULTISPECIES: farnesyl-diphosphate syntha...    133   5e-34
gb|EWY39788.1|  farnesyl-diphosphate synthase [Skermanella sti...    133   5e-34
ref|WP_019319076.1|  geranyltranstransferase [Streptococcus mu...    133   5e-34
ref|WP_014901977.1|  farnesyl-diphosphate synthase [Desulfospo...    133   5e-34
ref|WP_002476813.1|  hypothetical protein [Staphylococcus epid...    133   5e-34
ref|WP_003690067.1|  farnesyl-diphosphate synthase [Lactobacil...    133   5e-34
ref|WP_007018369.1|  farnesyl-diphosphate synthase [Bermanella...    133   5e-34
ref|WP_028125069.1|  geranyl transferase [Eremococcus coleocola]     133   5e-34
ref|WP_008412624.1|  Farnesyl diphosphate synthase [Desulfotom...    133   5e-34
ref|WP_017464195.1|  geranyltranstransferase [Staphylococcus e...    133   5e-34
ref|WP_002497916.1|  geranyltranstransferase [Staphylococcus e...    133   5e-34
ref|WP_006418007.1|  geranyltranstransferase [Eremococcus cole...    133   5e-34
ref|WP_007207118.1|  farnesyl-diphosphate synthase [Enterococc...    133   5e-34
ref|WP_032603732.1|  geranyl transferase [Staphylococcus epide...    133   6e-34
ref|WP_005633575.1|  geranyltranstransferase [Haemophilus haem...    133   6e-34
ref|WP_004172193.1|  geranyltranstransferase [Erwinia amylovora]     130   6e-34
ref|WP_028462422.1|  geranyl transferase [Nitrosomonas cryotol...    133   6e-34
gb|ETT44747.1|  geranylgeranyl pyrophosphate synthetase [Paeni...    133   6e-34
ref|WP_002888854.1|  geranyltranstransferase [Streptococcus sa...    133   6e-34
ref|WP_025200142.1|  farnesyl-diphosphate synthase [Brucella i...    133   6e-34
emb|CDL80721.1|  Geranyltranstransferase [Xenorhabdus cabanill...    133   6e-34
ref|WP_013028843.1|  geranyltranstransferase [Sideroxydans lit...    133   6e-34
gb|EHM69506.1|  geranyltranstransferase [Staphylococcus epider...    133   6e-34
ref|WP_011943359.1|  MULTISPECIES: geranyltranstransferase [Th...    132   6e-34
ref|WP_015873986.1|  geranyltranstransferase [Candidatus Hamil...    133   6e-34
ref|WP_010735997.1|  geranylgeranyl diphosphate synthase, type...    133   6e-34
ref|WP_008944118.1|  farnesyl-diphosphate synthase [Oceanibacu...    133   6e-34
ref|WP_022419603.1|  polyprenyl synthetase [Acidiphilium sp. C...    133   6e-34
ref|WP_008954538.1|  geranyltranstransferase [Pseudogulbenkian...    133   7e-34
gb|ETT29571.1|  geranylgeranyl pyrophosphate synthetase [Paeni...    133   7e-34
gb|ETX27988.1|  farnesyl-diphosphate synthase [Roseivivax isop...    132   7e-34
gb|EGS79687.1|  geranyltranstransferase [Staphylococcus epider...    132   7e-34
ref|WP_015009915.1|  farnesyl-diphosphate synthase [Amphibacil...    133   7e-34
gb|EKD54350.1|  hypothetical protein ACD_60C00091G0015 [uncult...    133   7e-34
ref|WP_014087783.1|  geranyltranstransferase [Pseudogulbenkian...    133   7e-34
ref|WP_008802924.1|  farnesyl-diphosphate synthase [Fusobacter...    133   7e-34
ref|WP_005819593.1|  geranyltranstransferase [Actinobacillus m...    133   7e-34
ref|WP_005823324.1|  geranyltranstransferase [Actinobacillus m...    133   7e-34
ref|WP_012494216.1|  geranylgeranyl pyrophosphate synthase [Rh...    133   7e-34
ref|WP_029086351.1|  farnesyl-diphosphate synthase [Brevundimo...    133   7e-34
ref|WP_011156092.1|  geranylgeranyl pyrophosphate synthase [Rh...    133   7e-34
ref|WP_009059446.1|  farnesyl-diphosphate synthase [Methylacid...    133   8e-34
dbj|BAO80255.1|  geranylgeranyl pyrophosphate synthase [Comamo...    133   8e-34
dbj|GAK49561.1|  polyprenyl synthetase [bacterium UASB14]            133   8e-34
ref|WP_029929494.1|  farnesyl-diphosphate synthase [Ochrobactr...    133   8e-34
gb|EXL04205.1|  farnesyl-diphosphate synthase [Ochrobactrum an...    133   8e-34
ref|WP_019815695.1|  dimethylallyltransferase [Osedax symbiont...    132   8e-34
dbj|BAP00278.1|  farnesyl diphosphate synthase [Wolbachia endo...    132   8e-34
dbj|GAJ25427.1|  octaprenyl-diphosphate synthase [Lactobacillu...    132   8e-34
ref|WP_014572853.1|  farnesyl-diphosphate synthase [Lactococcu...    132   8e-34
gb|EXI79375.1|  Farnesyl diphosphate synthase [Candidatus Accu...    133   8e-34
ref|WP_029599717.1|  geranyl transferase [Fusobacterium nuclea...    132   8e-34
ref|WP_013220101.1|  farnesyl-diphosphate synthase [Nitrosococ...    132   8e-34
gb|KGF72497.1|  farnesyl-diphosphate synthase [Synechococcus s...    133   8e-34
ref|WP_013990725.1|  geranyltranstransferase [Streptococcus sa...    132   8e-34
ref|WP_004690486.1|  MULTISPECIES: farnesyl-diphosphate syntha...    133   8e-34
ref|WP_027101287.1|  polyprenyl synthetase [Comamonadaceae bac...    132   8e-34
ref|WP_032841847.1|  geranyl transferase [Fusobacterium sp. CM21]    132   8e-34
ref|WP_005890920.1|  farnesyl-diphosphate synthase [Fusobacter...    132   9e-34
ref|WP_012806561.1|  farnesyl-diphosphate synthase [Leptotrich...    132   9e-34
ref|WP_006702550.1|  geranyltranstransferase [Granulicatella e...    132   9e-34
ref|WP_007865743.1|  polyprenyl synthetase [Polaromonas sp. CF...    133   9e-34
ref|WP_033152199.1|  geranyl transferase [Streptococcus equinus]     132   9e-34
ref|WP_024921401.1|  MULTISPECIES: geranylgeranyl pyrophosphat...    133   9e-34
ref|WP_026958485.1|  geranyl transferase [Aliagarivorans taiwa...    132   9e-34
ref|WP_011800901.1|  polyprenyl synthetase [Polaromonas naphth...    133   9e-34
ref|WP_006022466.1|  hypothetical protein [Afipia broomeae]          132   1e-33
ref|WP_014081941.1|  farnesyltranstransferase [Lactobacillus s...    132   1e-33
ref|WP_011995883.1|  geranylgeranyl pyrophosphate synthase [Xa...    132   1e-33
ref|WP_011835496.1|  farnesyl-diphosphate synthase [Lactococcu...    132   1e-33
ref|WP_019723632.1|  farnesyl-diphosphate synthase [Enterococc...    132   1e-33
ref|WP_021151988.1|  Geranyltranstransferase [Streptococcus sp...    132   1e-33
ref|WP_008090591.1|  geranyltranstransferase [Streptococcus ic...    132   1e-33
ref|WP_018651145.1|  geranyltranstransferase [Actinobacillus c...    132   1e-33
dbj|GAJ42508.1|  geranyltranstransferase [Geobacillus thermogl...    132   1e-33
ref|WP_014991654.1|  geranyltranstransferase [Actinobacillus s...    132   1e-33
ref|WP_004685843.1|  farnesyl-diphosphate synthase [Brucella m...    132   1e-33
dbj|GAJ72007.1|  LOW QUALITY PROTEIN: octaprenyl diphosphate s...    132   1e-33
ref|WP_002964858.1|  MULTISPECIES: farnesyl-diphosphate syntha...    132   1e-33
ref|WP_013400415.1|  farnesyl-diphosphate synthase [Geobacillu...    132   1e-33
dbj|GAK03326.1|  octaprenyl-diphosphate synthase [Geomicrobium...    132   1e-33
ref|WP_015144480.1|  geranylgeranyl pyrophosphate synthase [Pl...    132   1e-33
ref|WP_002718194.1|  hypothetical protein [Afipia felis]             133   1e-33
ref|WP_022943547.1|  geranyltranstransferase [Pseudoalteromona...    132   1e-33
ref|WP_006013673.1|  farnesyl-diphosphate synthase [Brucella o...    132   1e-33
ref|WP_016957814.1|  hypothetical protein [Catenovulum agarivo...    132   1e-33
ref|WP_011675820.1|  farnesyl-diphosphate synthase [Lactococcu...    132   1e-33
ref|WP_014132188.1|  farnesyl-diphosphate synthase [Pelagibact...    132   1e-33
ref|WP_000256278.1|  geranyltranstransferase [Streptococcus ag...    132   1e-33
ref|WP_025673662.1|  geranyl transferase [Salinivibrio socompe...    132   1e-33
ref|WP_025199426.1|  farnesyl-diphosphate synthase [Brucella s...    132   1e-33
ref|WP_027074823.1|  geranyl transferase [Mannheimia granuloma...    132   1e-33
ref|WP_026606873.1|  geranylgeranyl pyrophosphate synthase [Me...    132   1e-33
ref|WP_000256280.1|  geranyltranstransferase [Streptococcus ag...    132   1e-33
ref|WP_004437718.1|  farnesyl-diphosphate synthase [Bacillus m...    132   1e-33
ref|WP_012429188.1|  geranyl diphosphate synthase/farnesyl dip...    132   1e-33
ref|WP_027009515.1|  geranyl transferase [Conchiformibius kuhn...    132   1e-33
ref|WP_021037005.1|  geranyltranstransferase [Lactococcus lactis]    132   1e-33
ref|WP_009874417.1|  farnesyl-diphosphate synthase [Buchnera a...    132   1e-33
ref|WP_013488317.1|  farnesyl-diphosphate synthase [Bacillus c...    132   1e-33
ref|WP_013034850.1|  geranyltranstransferase [Erwinia amylovora]     131   1e-33
ref|WP_021887369.1|  polyprenyl synthetase [Firmicutes bacteri...    132   1e-33
ref|WP_000256279.1|  geranyltranstransferase [Streptococcus ag...    132   1e-33
ref|WP_010021529.1|  farnesyltranstransferase [Lactobacillus f...    132   1e-33
ref|WP_031491371.1|  geranyl transferase [Succinivibrio dextri...    132   1e-33
gb|EXI90411.1|  Farnesyl diphosphate synthase [Candidatus Accu...    132   1e-33
ref|WP_008936288.1|  MULTISPECIES: farnesyl-diphosphate syntha...    132   1e-33
dbj|GAK60439.1|  polyprenyl synthetase [bacterium UASB270]           132   1e-33
ref|WP_000256277.1|  geranyltranstransferase [Streptococcus ag...    132   1e-33
ref|WP_017510063.1|  hypothetical protein [beta proteobacteriu...    132   1e-33
ref|WP_012824536.1|  polyprenyl synthetase [Halothiobacillus n...    132   1e-33
ref|WP_023371202.1|  geranylgeranyl pyrophosphate synthase [St...    132   1e-33
ref|WP_024405564.1|  geranyl transferase [Streptococcus suis]        132   1e-33
ref|WP_016856967.1|  geranyltranstransferase [Candidatus Hamil...    132   1e-33
ref|WP_008799654.1|  farnesyl-diphosphate synthase [Fusobacter...    132   1e-33
ref|WP_004287228.1|  geranyltranstransferase [Francisella phil...    132   1e-33
ref|WP_029598722.1|  geranyl transferase [Fusobacterium nuclea...    132   1e-33
ref|WP_012280580.1|  geranyltranstransferase [Francisella phil...    132   2e-33
ref|WP_014255238.1|  farnesyl-diphosphate synthase [ [Clostrid...    132   2e-33
ref|WP_022966074.1|  farnesyl-diphosphate synthase [Pseudomona...    132   2e-33
ref|WP_003092675.1|  geranyltranstransferase [Streptococcus ve...    132   2e-33
gb|KGK91719.1|  geranyl transferase [Desulfosporosinus sp. HMP52]    132   2e-33
ref|WP_027621594.1|  farnesyl-diphosphate synthase [ [Clostrid...    132   2e-33
ref|WP_014498942.1|  geranyltranstransferase [Buchnera aphidic...    132   2e-33
ref|WP_012619559.1|  farnesyl-diphosphate synthase [Buchnera a...    131   2e-33
ref|WP_009210802.1|  farnesyl-diphosphate synthase [Aurantimon...    132   2e-33
ref|WP_004357434.1|  polyprenyl synthetase [Thauera phenylacet...    132   2e-33
gb|EYT94962.1|  farnesyl-diphosphate synthase [Enterococcus mu...    132   2e-33
ref|WP_006222900.1|  hypothetical protein [Brucella abortus]         132   2e-33
ref|WP_006035111.1|  geranyltranstransferase (Farnesyl-diphosp...    132   2e-33
gb|EFG34188.1|  hypothetical protein HMPREF0405_00455 [Fusobac...    132   2e-33
ref|WP_028035597.1|  farnesyl-diphosphate synthase [Chelativor...    132   2e-33
ref|WP_024783803.1|  geranyl transferase [Streptococcus mutans]      132   2e-33
ref|WP_029014580.1|  farnesyl-diphosphate synthase [Azospirill...    132   2e-33
ref|WP_004082783.1|  geranyltranstransferase [Thermotoga marit...    131   2e-33
ref|WP_012310757.1|  MULTISPECIES: geranyltranstransferase [Th...    131   2e-33
gb|EXI61788.1|  geranyltranstransferase [Mannheimia haemolytic...    132   2e-33
ref|WP_003788164.1|  geranyltranstransferase [Kingella kingae]       132   2e-33
ref|WP_013710298.1|  farnesyl-diphosphate synthase [Carnobacte...    132   2e-33
ref|WP_026745600.1|  geranyl transferase [Leptotrichia hofstadii]    132   2e-33
ref|WP_002271257.1|  putative farnesyl diphosphate synthase [S...    131   2e-33
gb|KDB53312.1|  polyprenyl synthetase [Sphaerotilus natans sub...    132   2e-33
ref|WP_002309176.1|  putative farnesyl diphosphate synthase [S...    131   2e-33
ref|WP_029579695.1|  geranyl transferase [Bordetella hinzii]         132   2e-33
ref|WP_002268051.1|  putative farnesyl diphosphate synthase [S...    131   2e-33
ref|WP_032964507.1|  geranyl transferase [Bordetella hinzii]         132   2e-33
ref|WP_018370002.1|  hypothetical protein [Streptococcus marim...    131   2e-33
ref|WP_012225423.1|  farnesyl-diphosphate synthase [Gluconacet...    132   2e-33
gb|EXM37786.1|  geranyl transferase [Ruminococcus albus SY3]         132   2e-33
ref|WP_020373288.1|  hypothetical protein [Sulfobacillus therm...    131   2e-33
emb|CCC57514.1|  geranyltranstransferase [Weissella thailanden...    131   2e-33
gb|KFJ64743.1|  polyprenyl synthetase family protein [Francise...    131   2e-33
gb|KFJ45383.1|  polyprenyl synthetase family protein [Francise...    131   2e-33
ref|WP_013120563.1|  farnesyl-diphosphate synthase [Thermincol...    132   2e-33
ref|WP_002283921.1|  putative farnesyl diphosphate synthase [S...    131   2e-33
gb|KCB35509.1|  polyprenyl synthetase [Bordetella hinzii 8-296...    132   2e-33
ref|WP_015238054.1|  geranyltranstransferase [Kinetoplastibact...    132   2e-33
gb|KES18580.1|  Geranylgeranyl pyrophosphate synthase [Gilliam...    131   2e-33
ref|WP_023924387.1|  farnesyl-diphosphate synthase [Rhodobacte...    131   2e-33
ref|WP_007710024.1|  farnesyl-diphosphate synthase [Sphingobiu...    132   2e-33
ref|WP_015900394.1|  geranyltranstransferase [Staphylococcus c...    131   2e-33
ref|WP_028963082.1|  polyprenyl synthetase [Sulfobacillus ther...    131   2e-33
ref|WP_004689227.1|  farnesyl-diphosphate synthase [Brucella s...    132   2e-33
ref|WP_028248757.1|  polyprenyl synthetase [Variovorax sp. URH...    132   2e-33
ref|WP_029623148.1|  farnesyl-diphosphate synthase [Sphingomon...    132   2e-33
ref|WP_024856735.1|  geranyl transferase [Ruminococcus albus]        131   2e-33
ref|WP_009338349.1|  geranylgeranyl pyrophosphate synthase [Af...    132   2e-33
ref|WP_023492999.1|  farnesyl diphosphate synthase IspA [Methy...    131   2e-33
gb|KFZ43139.1|  farnesyl-diphosphate synthase [Anoxybacillus s...    131   2e-33
ref|WP_024496074.1|  geranyl transferase [Candidatus Schmidhem...    131   2e-33
ref|WP_027845999.1|  farnesyl-diphosphate synthase [Mastigocol...    132   2e-33
ref|WP_027022197.1|  geranyl transferase [Conchiformibius stee...    131   2e-33
ref|WP_014499068.1|  farnesyl-diphosphate synthase [Buchnera a...    132   2e-33
ref|XP_009796773.1|  PREDICTED: geranylgeranyl pyrophosphate s...    133   2e-33
ref|WP_014643707.1|  farnesyl-diphosphate synthase [Halobacill...    131   2e-33
ref|WP_018451159.1|  farnesyl-diphosphate synthase [Leptotrich...    131   2e-33
ref|WP_012462737.1|  farnesyl-diphosphate synthase [Methylacid...    131   2e-33
ref|WP_008179964.1|  farnesyl-diphosphate synthase [Moorea pro...    132   3e-33
ref|WP_006011228.1|  farnesyl diphosphate synthase [Glaciecola...    131   3e-33
ref|WP_003034818.1|  geranyltranstransferase [Francisella novi...    131   3e-33
gb|KFB77909.1|  Farnesyl diphosphate synthase [Candidatus Accu...    131   3e-33
ref|WP_014104641.1|  farnesyl-diphosphate synthase [Gluconacet...    131   3e-33
ref|WP_021743290.1|  putative geranyltranstransferase [Leptotr...    131   3e-33
ref|WP_008795844.1|  farnesyl-diphosphate synthase [Fusobacter...    131   3e-33
ref|WP_023519346.1|  octaprenyl-diphosphate synthase/ dimethyl...    131   3e-33
ref|WP_003022464.1|  geranyltranstransferase [Francisella tula...    131   3e-33
ref|WP_015082271.1|  Dimethylallyltransferase/geranyltranstran...    131   3e-33
ref|WP_015434824.1|  polyprenyl synthetase [Azoarcus sp. KH32C]      131   3e-33
ref|WP_023066783.1|  polyprenyl synthetase family protein [Lyn...    131   3e-33
ref|WP_028639284.1|  farnesyl-diphosphate synthase [Novosphing...    131   3e-33
ref|WP_026480320.1|  farnesyl-diphosphate synthase [Ahrensia s...    131   3e-33
ref|WP_023040358.1|  geranylgeranyl diphosphate synthase, type...    131   3e-33
ref|WP_011255696.1|  geranyltranstransferase [Ehrlichia rumina...    130   3e-33
ref|WP_029869172.1|  farnesyl-diphosphate synthase [Rhizobium ...    131   3e-33
ref|WP_023037764.1|  hypothetical protein [Fusobacterium nucle...    131   3e-33
ref|WP_006251551.1|  geranyltranstransferase [Mannheimia haemo...    131   3e-33
ref|WP_012593538.1|  MULTISPECIES: farnesyl-diphosphate syntha...    131   3e-33
ref|WP_029055300.1|  geranyl transferase [Staphylococcus sp. U...    131   3e-33
ref|WP_005896118.1|  farnesyl-diphosphate synthase [Fusobacter...    131   3e-33
ref|WP_028499075.1|  geranyl transferase [Microvirgula aeroden...    131   3e-33
ref|WP_018607807.1|  hypothetical protein [Uliginosibacterium ...    131   3e-33
ref|WP_002304438.1|  putative farnesyl diphosphate synthase [S...    131   3e-33
ref|WP_009382509.1|  geranyltranstransferase [Staphylococcus m...    131   3e-33
ref|WP_006685729.1|  geranyltranstransferase [Citrobacter youn...    131   3e-33
ref|WP_015194596.1|  Farnesyltranstransferase [Stanieria cyano...    131   3e-33
ref|WP_008830307.1|  farnesyl-diphosphate synthase [Sphingomon...    131   3e-33
ref|WP_032834419.1|  geranyl transferase [Fusobacterium sp. OB...    131   3e-33
ref|WP_005622512.1|  geranyltranstransferase [Actinobacillus u...    131   3e-33
ref|WP_013773663.1|  farnesyl-diphosphate synthase [Melissococ...    131   3e-33
ref|WP_024786508.1|  geranyl transferase [Streptococcus mutans]      131   3e-33
ref|WP_006471267.1|  MULTISPECIES: polyprenyl synthetase [Ochr...    131   3e-33
ref|WP_018381273.1|  hypothetical protein [Streptococcus thora...    131   4e-33
ref|WP_002271502.1|  putative farnesyl diphosphate synthase [S...    131   4e-33
ref|WP_027540897.1|  geranylgeranyl pyrophosphate synthase [Br...    131   4e-33
ref|WP_026439329.1|  farnesyl-diphosphate synthase [Acidocella...    131   4e-33
ref|WP_019805862.1|  geranyltranstransferase [Streptococcus mu...    130   4e-33
ref|WP_028233392.1|  farnesyl-diphosphate synthase [Pseudochro...    131   4e-33
ref|WP_026780538.1|  polyprenyl synthetase [Polaromonas sp. EU...    131   4e-33
gb|EZP84905.1|  Geranyltranstransferase [Novosphingobium resin...    131   4e-33
ref|WP_008494183.1|  farnesyl-diphosphate synthase [Acidocella...    131   4e-33
ref|WP_017715635.1|  farnesyl-diphosphate synthase [Oscillator...    131   4e-33
ref|WP_015432754.1|  Farnesyl diphosphate synthase [Biberstein...    131   4e-33
ref|WP_015719450.1|  farnesyl-diphosphate synthase [Geobacter ...    131   4e-33
ref|WP_008534419.1|  geranyltranstransferase [Streptococcus sp...    130   4e-33
ref|WP_013294197.1|  geranyltranstransferase [Gallionella caps...    131   4e-33
gb|AHG86605.1|  Farnesyl diphosphate synthase [Bibersteinia tr...    131   4e-33
ref|WP_019803221.1|  geranyltranstransferase [Streptococcus mu...    130   4e-33
ref|WP_006804886.1|  farnesyl-diphosphate synthase [Leptotrich...    130   4e-33
ref|WP_024276464.1|  geranylgeranyl pyrophosphate synthase [Hy...    131   4e-33
emb|CBX31342.1|  Geranylgeranyl pyrophosphate synthetase, chlo...    131   4e-33
ref|WP_003084108.1|  geranyltranstransferase [Streptococcus po...    130   4e-33
gb|EKE10081.1|  geranyltranstransferase (farnesyl-diphosphate ...    131   4e-33
ref|WP_004310077.1|  MULTISPECIES: geranyltranstransferase [Th...    131   4e-33
ref|WP_024344253.1|  geranyl transferase [Streptococcus equinus]     130   4e-33
ref|WP_002279431.1|  putative farnesyl diphosphate synthase [S...    130   4e-33
ref|WP_018982956.1|  hypothetical protein [Salinimonas chungwh...    130   4e-33
ref|WP_011017072.1|  farnesyl-diphosphate synthase [Fusobacter...    130   4e-33
gb|KEI34693.1|  octaprenyl diphosphate synthase [Francisella s...    130   4e-33
ref|WP_011661630.1|  geranylgeranyl pyrophosphate synthase [Rh...    131   4e-33
ref|WP_002292151.1|  putative farnesyl diphosphate synthase [S...    130   4e-33
ref|WP_024782838.1|  geranyl transferase [Streptococcus mutans]      130   4e-33
ref|WP_002312507.1|  farnesyl diphosphate synthase [Streptococ...    130   4e-33
ref|WP_019317266.1|  geranyltranstransferase [Streptococcus mu...    130   5e-33
ref|WP_002307732.1|  putative farnesyl diphosphate synthase [S...    130   5e-33
ref|WP_006836879.1|  farnesyl-diphosphate synthase [Bacillus s...    130   5e-33
ref|WP_021746709.1|  putative geranyltranstransferase [Leptotr...    130   5e-33
ref|WP_010926330.1|  geranyltranstransferase [Bordetella bronc...    131   5e-33
ref|WP_002276708.1|  putative farnesyl diphosphate synthase [S...    130   5e-33
ref|WP_022070582.1|  dimethylallyltranstransferase [Fusobacter...    130   5e-33
ref|WP_024412411.1|  geranyl transferase [Streptococcus suis]        130   5e-33
ref|WP_011712724.1|  farnesyl-diphosphate synthase [Magnetococ...    130   5e-33
ref|WP_002268627.1|  putative farnesyl diphosphate synthase [S...    130   5e-33
ref|WP_026972998.1|  geranyl transferase [Aliagarivorans marinus]    130   5e-33
ref|WP_002264711.1|  geranyltranstransferase [Streptococcus mu...    130   5e-33
ref|WP_002801309.1|  farnesyl-diphosphate synthase [Microcysti...    131   5e-33
ref|WP_006954763.1|  Octaprenyl-diphosphate synthase / Dimethy...    130   5e-33
ref|WP_013876649.1|  farnesyl-diphosphate synthase [Geobacillu...    130   5e-33
ref|WP_002280391.1|  putative farnesyl diphosphate synthase [S...    130   5e-33
ref|WP_015838272.1|  farnesyl-diphosphate synthase [Geobacter ...    130   5e-33
ref|WP_002791260.1|  farnesyl-diphosphate synthase [Microcysti...    131   5e-33
ref|WP_006088886.1|  hypothetical protein [Brucella abortus]         130   5e-33
ref|WP_023002591.1|  MULTISPECIES: farnesyl-diphosphate syntha...    130   5e-33
gb|EUJ36506.1|  putative geranyltranstransferase [Listeria wei...    130   5e-33
ref|WP_022382231.1|  putative uncharacterized protein [Dialist...    130   5e-33
ref|WP_002302675.1|  putative farnesyl diphosphate synthase [S...    130   5e-33
ref|WP_011155246.1|  geranyltranstransferase [Ehrlichia rumina...    130   5e-33
ref|WP_010680282.1|  farnesyl-diphosphate synthase [Fusobacter...    130   5e-33
ref|WP_013069157.1|  farnesyl-diphosphate synthase [Rhodobacte...    130   5e-33
ref|WP_015695148.1|  farnesyl-diphosphate synthase [Melissococ...    130   5e-33
ref|WP_023051194.1|  hypothetical protein [Cetobacterium somerae]    130   5e-33
ref|WP_024720556.1|  farnesyl-diphosphate synthase [Clostridia...    130   5e-33
ref|WP_003249264.1|  farnesyl-diphosphate synthase [Geobacillu...    130   5e-33
ref|WP_006467789.1|  farnesyl-diphosphate synthase [Ochrobactr...    131   5e-33
ref|WP_010928554.1|  geranyltranstransferase [Bordetella parap...    130   5e-33
ref|WP_027088974.1|  farnesyl-diphosphate synthase [ [Clostrid...    130   5e-33
ref|WP_008193971.1|  geranyltranstransferase [Thermotoga sp. EMP]    130   5e-33
ref|WP_022096738.1|  geranyltranstransferase farnesyl diphosph...    130   5e-33
ref|WP_018368270.1|  hypothetical protein [Streptococcus enter...    130   5e-33
ref|WP_018860679.1|  MULTISPECIES: farnesyl-diphosphate syntha...    130   5e-33
emb|CDM13777.1|  Geranyltranstransferase (farnesyldiphosphate ...    129   5e-33
ref|WP_029666121.1|  MULTISPECIES: hypothetical protein [Cales...    129   6e-33
ref|WP_030538736.1|  farnesyl-diphosphate synthase [Sphingobiu...    130   6e-33
ref|WP_028994675.1|  geranyl transferase [Azonexus hydrophilus]      130   6e-33
ref|WP_008700031.1|  farnesyl-diphosphate synthase [Fusobacter...    130   6e-33
ref|WP_017889463.1|  hypothetical protein [Candidatus Caldatri...    130   6e-33
ref|WP_011470980.1|  geranylgeranyl pyrophosphate synthase [Rh...    130   6e-33
ref|WP_009007299.1|  farnesyl-diphosphate synthase [Fusobacter...    130   6e-33
ref|WP_028874929.1|  geranyl transferase [Tepidiphilus margari...    130   6e-33
gb|AHE56120.1|  hypothetical protein NX02_22505 [Sphingomonas ...    130   6e-33
ref|WP_009785595.1|  farnesyl-diphosphate synthase [Lyngbya sp...    130   6e-33
ref|WP_026019737.1|  farnesyl-diphosphate synthase [Gluconacet...    130   6e-33
ref|WP_011565679.1|  farnesyl-diphosphate synthase [Rubrobacte...    130   6e-33
ref|WP_013949687.1|  geranylgeranyl pyrophosphate synthase [Hy...    130   6e-33
gb|EKD72452.1|  hypothetical protein ACD_45C00675G0016 [uncult...    130   6e-33
ref|WP_024029803.1|  polyprenyl synthetase [Bacillus vireti]         130   6e-33
gb|AIQ53818.1|  polyprenyl synthetase [Paenibacillus sp. FSL R...    130   7e-33
ref|WP_006074528.1|  farnesyl-diphosphate synthase [Brucella s...    130   7e-33
ref|WP_002951006.1|  geranyltranstransferase, farnesyl diphosp...    130   7e-33
ref|WP_019313538.1|  geranyltranstransferase [Streptococcus mu...    130   7e-33
ref|WP_021266998.1|  polyprenyl synthetase [Bacteriovorax sp. ...    130   7e-33
ref|WP_006526489.1|  putative geranyltranstransferase [Solobac...    130   7e-33
ref|WP_005883734.1|  farnesyl-diphosphate synthase [Fusobacter...    130   7e-33
ref|WP_027359433.1|  hypothetical protein [Desulforegula conse...    130   7e-33
gb|KDU97352.1|  farnesyl-diphosphate synthase [Gluconacetobact...    130   7e-33
gb|EXL10367.1|  farnesyl-diphosphate synthase [Aquamicrobium d...    130   7e-33
gb|KGL40106.1|  hypothetical protein EP58_13200 [Listeriaceae ...    130   7e-33
pdb|3LVS|A  Chain A, Crystal Structure Of Farnesyl Diphosphate...    130   7e-33
ref|WP_006248961.1|  geranyltranstransferase [Mannheimia haemo...    130   7e-33
ref|WP_003798238.1|  geranyltranstransferase [Kingella oralis]       130   8e-33
ref|WP_027363445.1|  geranyl transferase [Desulfotomaculum alc...    130   8e-33
ref|WP_031576350.1|  hypothetical protein [Proteiniclasticum r...    130   8e-33
ref|WP_015864441.1|  farnesyl-diphosphate synthase [Geobacillu...    130   8e-33
ref|WP_015120450.1|  geranylgeranyl pyrophosphate synthase [Ri...    130   8e-33
ref|WP_011698279.1|  farnesyl-diphosphate synthase [Syntrophob...    130   8e-33
ref|WP_010012210.1|  farnesyl-diphosphate synthase [Lactobacil...    130   8e-33
gb|EYU45809.1|  hypothetical protein MIMGU_mgv1a018377mg [Mimu...    131   8e-33
ref|WP_007682072.1|  farnesyl-diphosphate synthase [Novosphing...    130   8e-33
ref|WP_006936674.1|  farnesyl-diphosphate synthase [Labrenzia ...    130   8e-33
ref|WP_017637923.1|  geranyltranstransferase [Staphylococcus s...    130   8e-33
gb|AIK16820.1|  geranyl transferase [Haemophilus parasuis]           130   8e-33
ref|WP_033120560.1|  hypothetical protein [Oscillibacter sp. ER4]    130   9e-33
ref|WP_007123393.1|  farnesyl-diphosphate synthase [Lactobacil...    130   9e-33
ref|WP_029407354.1|  geranyl transferase [Thiomicrospira sp. M...    130   9e-33
ref|WP_011429285.1|  farnesyl-diphosphate synthase [Synechococ...    130   9e-33
ref|WP_005913394.1|  farnesyl-diphosphate synthase [Fusobacter...    130   9e-33
ref|WP_006998769.1|  Octaprenyl-diphosphate synthase /Dimethyl...    130   9e-33
ref|WP_029495071.1|  geranyl transferase [Fusobacterium nuclea...    130   9e-33
ref|WP_012172971.1|  geranylgeranyl pyrophosphate synthase [Az...    130   9e-33
ref|WP_014905514.1|  geranyltranstransferase [Bordetella pertu...    130   1e-32
ref|WP_014313787.1|  farnesyl-diphosphate synthase [Clostridiu...    130   1e-32
ref|WP_005909551.1|  farnesyl-diphosphate synthase [Fusobacter...    130   1e-32
emb|CDS54466.1|  Octaprenyl-diphosphate synthase / Dimethylall...    130   1e-32
ref|WP_012383434.1|  polyprenyl synthetase [Beijerinckia indica]     130   1e-32
ref|WP_023039233.1|  geranylgeranyl diphosphate synthase, type...    130   1e-32
ref|WP_003813107.1|  MULTISPECIES: probable geranyltranstransf...    130   1e-32
gb|KGL45212.1|  hypothetical protein EP56_06550 [Listeriaceae ...    130   1e-32
ref|WP_009332892.1|  farnesyl-diphosphate synthase [Bacillus s...    130   1e-32
ref|WP_024387162.1|  geranyl transferase [Streptococcus suis]        129   1e-32
ref|WP_002789403.1|  farnesyl-diphosphate synthase [Microcysti...    130   1e-32
ref|WP_003820295.1|  MULTISPECIES: geranyltranstransferase [Bo...    130   1e-32
ref|WP_029491982.1|  geranyl transferase [Fusobacterium nuclea...    130   1e-32
ref|WP_003014898.1|  geranyltranstransferase [Francisella tula...    129   1e-32
ref|WP_032090066.1|  farnesyl-diphosphate synthase [bacterium ...    129   1e-32
ref|WP_026018721.1|  farnesyl-diphosphate synthase [Gluconacet...    130   1e-32
ref|WP_029335166.1|  farnesyl-diphosphate synthase [Gluconacet...    130   1e-32
ref|WP_013778462.1|  farnesyl-diphosphate synthase [Tepidanaer...    129   1e-32
ref|WP_028587258.1|  polyprenyl synthetase [Desulfocurvus vexi...    129   1e-32
ref|WP_008859007.1|  farnesyl-diphosphate synthase [Dialister ...    129   1e-32
ref|WP_033157107.1|  geranyl transferase [Methylomonas sp. LW13]     129   1e-32
gb|AHG81583.1|  Farnesyl diphosphate synthase [Bibersteinia tr...    129   1e-32
gb|KEY62520.1|  Geranyltranstransferase [Lactococcus lactis su...    130   1e-32
ref|WP_006351527.1|  geranyltranstransferase [Lactobacillus am...    129   1e-32
ref|WP_002785005.1|  Geranylgeranyl pyrophosphate synthase hom...    130   1e-32
ref|WP_032837448.1|  geranyl transferase [Fusobacterium sp. CM1]     129   1e-32
ref|WP_012598016.1|  farnesyl-diphosphate synthase [Cyanothece...    130   1e-32
emb|CEG10338.1|  Farnesyl diphosphate synthase [Afipia felis]        130   1e-32
ref|WP_002768329.1|  farnesyl-diphosphate synthase [Microcysti...    130   1e-32
gb|KDB49862.1|  geranyl transferase [Haemophilus parasuis HPS11]     129   1e-32
ref|WP_006192447.1|  farnesyl-diphosphate synthase [Selenomona...    129   1e-32
ref|WP_021116021.1|  geranyltranstransferase [Haemophilus para...    129   1e-32
ref|WP_021024154.1|  geranyltranstransferase [Salinivibrio cos...    129   1e-32
ref|WP_015088774.1|  polyprenyl synthetase family protein [Can...    129   1e-32
ref|WP_009646036.1|  farnesyl-diphosphate synthase [Selenomona...    129   1e-32
ref|WP_029585858.1|  geranylgeranyl pyrophosphate synthase [Br...    130   1e-32
gb|EQB12558.1|  farnesyl-diphosphate synthase [Sphingobium qui...    129   1e-32
ref|WP_022411466.1|  farnesyl-diphosphate synthase [Ruminococc...    129   1e-32
gb|EUJ46379.1|  geranyltranstransferase [Listeriaceae bacteriu...    129   1e-32
ref|WP_024784998.1|  geranyl transferase [Streptococcus mutans]      129   1e-32
ref|WP_027448550.1|  geranyl transferase [Pontibacillus marinus]     129   1e-32
ref|WP_026099851.1|  farnesyl-diphosphate synthase [Prochlorot...    129   1e-32
ref|WP_002295784.1|  putative farnesyl diphosphate synthase [S...    129   1e-32
gb|KDC84007.1|  polyprenyl synthetase [Bordetella bronchisepti...    129   1e-32
ref|WP_009546110.1|  MULTISPECIES: farnesyl-diphosphate syntha...    129   1e-32
ref|WP_027231146.1|  farnesyl-diphosphate synthase [Phyllobact...    129   1e-32
gb|KEQ55311.1|  Geranyltranstransferase [Sphingobium chlorophe...    129   1e-32
ref|WP_005902542.1|  farnesyl-diphosphate synthase [Fusobacter...    129   1e-32
ref|WP_013301624.1|  geranyltranstransferase (farnesyl-diphosp...    129   1e-32
dbj|BAA82614.1|  farnesyl diphosphate synthase (SelFPS) [Synec...    129   1e-32
ref|WP_008801700.1|  farnesyl-diphosphate synthase [Fusobacter...    129   1e-32
ref|WP_028355554.1|  geranyl transferase [Bordetella petrii]         129   1e-32
ref|YP_002049403.1|  geranylgeranyl pyrophosphate synthase [Pa...    129   2e-32
ref|WP_011634551.1|  geranyltranstransferase [Nitrosomonas eut...    129   2e-32
emb|CDH46241.1|  geranyltranstransferase (=farnesyldiphosphate...    129   2e-32
gb|KEA65037.1|  Octaprenyl diphosphate synthase [Marinobacteri...    129   2e-32
ref|WP_021112418.1|  geranyltranstransferase [Haemophilus para...    129   2e-32
ref|WP_021953234.1|  polyprenyl synthetase [Eubacterium sp. CA...    129   2e-32
ref|WP_026641219.1|  geranyl transferase [Bordetella petrii]         129   2e-32
gb|KGL41577.1|  hypothetical protein EP57_06975 [Listeriaceae ...    129   2e-32
ref|WP_021956493.1|  polyprenyl synthetase [Eubacterium sp. CA...    129   2e-32
ref|WP_031303844.1|  farnesyl-diphosphate synthase [Sphingobiu...    129   2e-32
ref|WP_013847259.1|  farnesyl-diphosphate synthase [Sphingobiu...    129   2e-32
ref|WP_010619906.1|  farnesyl-diphosphate synthase [Lactobacil...    129   2e-32
ref|WP_027824160.1|  geranyl transferase [Laribacter hongkonge...    129   2e-32
gb|KEZ14894.1|  Farnesyl diphosphate synthase [Haemophilus par...    129   2e-32
ref|WP_005712343.1|  geranyltranstransferase [Haemophilus para...    129   2e-32
ref|WP_009119269.1|  geranyltranstransferase [Neisseria shayeg...    129   2e-32
ref|WP_013262646.1|  farnesyl-diphosphate synthase [gamma prot...    129   2e-32
ref|WP_019318739.1|  geranyltranstransferase [Streptococcus mu...    129   2e-32
ref|WP_002262106.1|  geranyltranstransferase [Streptococcus mu...    129   2e-32
ref|WP_002275942.1|  geranyltranstransferase [Streptococcus mu...    129   2e-32
ref|WP_003538307.1|  MULTISPECIES: hypothetical protein [Firmi...    129   2e-32
ref|WP_002290509.1|  putative farnesyl diphosphate synthase [S...    129   2e-32
ref|WP_021110952.1|  geranyltranstransferase [Haemophilus para...    129   2e-32
ref|WP_029174048.1|  geranyl transferase [Streptococcus suis]        129   2e-32
ref|WP_021816314.1|  farnesyl-diphosphate synthase [Lactobacil...    129   2e-32
ref|WP_024411534.1|  geranyl transferase [Streptococcus suis]        129   2e-32
ref|WP_024400284.1|  geranyl transferase [Streptococcus suis]        129   2e-32
ref|WP_021114982.1|  geranyltranstransferase [Haemophilus para...    129   2e-32
ref|WP_012697792.1|  geranyltranstransferase [Laribacter hongk...    129   2e-32
ref|WP_006306072.1|  farnesyl-diphosphate synthase [Centipeda ...    129   2e-32
ref|WP_002266418.1|  geranyltranstransferase [Streptococcus mu...    129   2e-32
ref|XP_007033023.1|  Geranylgeranyl pyrophosphate synthase 1 [...    130   2e-32
gb|EQF19772.1|  polyprenyl synthetase family protein [Clostrid...    126   2e-32
ref|WP_032848036.1|  geranyl transferase [Fusobacterium sp. CM22]    129   2e-32
ref|WP_010786697.1|  geranyltranstransferase [Haemophilus para...    129   2e-32
ref|WP_029172745.1|  geranyl transferase [Streptococcus suis]        129   2e-32
ref|WP_024413791.1|  geranyl transferase [Streptococcus suis]        129   2e-32
ref|WP_002284577.1|  putative farnesyl diphosphate synthase [S...    129   2e-32
ref|WP_002282320.1|  putative farnesyl diphosphate synthase [S...    129   2e-32
ref|WP_002942937.1|  geranyltranstransferase [Streptococcus suis]    129   2e-32
ref|WP_024412070.1|  geranyl transferase [Streptococcus suis]        129   2e-32
ref|WP_012249966.1|  geranyltranstransferase [Bordetella petrii]     129   2e-32
ref|WP_002936266.1|  geranyltranstransferase [Streptococcus suis]    129   2e-32
ref|WP_009910557.1|  geranyltranstransferase [Streptococcus suis]    129   2e-32
ref|WP_025885830.1|  farnesyl-diphosphate synthase [Asaia prun...    129   2e-32
ref|WP_024408667.1|  geranyl transferase [Streptococcus suis]        129   2e-32
ref|WP_024587248.1|  farnesyl-diphosphate synthase [Aliihoefle...    129   2e-32
ref|WP_019380194.1|  farnesyl-diphosphate synthase [Bacillus o...    129   2e-32
gb|EUJ30814.1|  putative geranyltranstransferase [Listeriaceae...    127   2e-32
ref|WP_014888558.1|  geranyltranstransferase [secondary endosy...    129   2e-32
ref|WP_014638453.1|  geranyltranstransferase [Streptococcus suis]    129   2e-32
ref|WP_012027575.1|  geranyltranstransferase [Streptococcus suis]    129   2e-32
gb|EFM56700.1|  geranyltranstransferase [Brucella inopinata BO1]     129   2e-32
ref|XP_009621105.1|  PREDICTED: geranylgeranyl pyrophosphate s...    130   2e-32
dbj|BAP58757.1|  polyprenyl synthetase [symbiont bacterium UwT...    129   2e-32
ref|WP_017727020.1|  hypothetical protein [Bacillus sp. L1(2012)]    129   2e-32
ref|WP_011226128.1|  geranyltranstransferase [Streptococcus th...    129   2e-32
ref|WP_024409920.1|  geranyl transferase [Streptococcus suis]        129   2e-32
ref|WP_003792050.1|  geranyltranstransferase [Kingella kingae]       129   2e-32
ref|WP_014161057.1|  farnesyl-diphosphate synthase [Pseudoxant...    129   2e-32
ref|WP_014954461.1|  polyprenyl synthetase [alpha proteobacter...    129   2e-32
ref|WP_006393711.1|  geranyltranstransferase [Achromobacter in...    129   2e-32
ref|WP_003615520.1|  geranyltranstransferase [Lactobacillus de...    129   2e-32
ref|WP_006916203.1|  farnesyl-diphosphate synthase [Lactobacil...    129   2e-32
ref|WP_002734754.1|  geranylgeranyl pyrophosphate synthase [Mi...    129   2e-32
gb|EKD50966.1|  Polyprenyl synthetase [uncultured bacterium]         129   2e-32
gb|AHG59932.1|  Ispa [Buchnera aphidicola str. USDA (Myzus per...    129   2e-32
ref|WP_012302123.1|  farnesyl-diphosphate synthase [Candidatus...    129   2e-32
ref|WP_016396441.1|  farnesyl-diphosphate synthase [Lactobacil...    129   2e-32
ref|WP_011111751.1|  geranyltranstransferase [Nitrosomonas eur...    129   3e-32
ref|WP_012953507.1|  farnesyl-diphosphate synthase [cyanobacte...    129   3e-32
ref|WP_015178756.1|  Farnesyltranstransferase [Oscillatoria ni...    129   3e-32
ref|WP_032889226.1|  geranyl transferase [Fusobacterium nuclea...    129   3e-32
gb|KGG82503.1|  polyprenyl synthetase [Comamonas testosteroni]       129   3e-32
ref|WP_002753468.1|  farnesyl-diphosphate synthase [Microcysti...    129   3e-32
ref|WP_026239007.1|  geranyl transferase [Leptotrichia wadei]        129   3e-32
ref|WP_002748822.1|  geranylgeranyl pyrophosphate synthase [Mi...    129   3e-32
ref|WP_024416397.1|  geranyl transferase [Streptococcus suis]        129   3e-32
ref|WP_015311544.1|  geranylgeranyl pyrophosphate synthase [Th...    129   3e-32
ref|WP_016516815.1|  Farnesyl diphosphate synthase [Microcysti...    129   3e-32
ref|WP_019390331.1|  geranyltranstransferase [Kingella kingae]       129   3e-32
ref|WP_010054193.1|  farnesyl-diphosphate synthase [Carnobacte...    129   3e-32
emb|CDR81038.1|  Geranylgeranyl pyrophosphate synthase [Lactob...    129   3e-32
gb|AAY78591.1|  predicted geranyltranstransferase [uncultured ...    129   3e-32
ref|WP_015076781.1|  farnesyl diphosphate synthase [Carnobacte...    129   3e-32
ref|WP_008692739.1|  farnesyl-diphosphate synthase [Fusobacter...    129   3e-32
ref|WP_006634137.1|  farnesyl-diphosphate synthase [Microcoleu...    129   3e-32
ref|WP_025895743.1|  geranyl transferase [Lactobacillus delbru...    128   3e-32
ref|WP_022703284.1|  farnesyl-diphosphate synthase [Pseudorhod...    128   3e-32
ref|WP_012264853.1|  farnesyl-diphosphate synthase [Microcysti...    129   3e-32
ref|WP_004159491.1|  farnesyl-diphosphate synthase [Microcysti...    129   3e-32
ref|WP_022001565.1|  putative uncharacterized protein [Coproba...    128   3e-32
ref|WP_013439853.1|  geranyltranstransferase [Lactobacillus de...    128   3e-32
ref|WP_014714782.1|  geranyltranstransferase [Francisella noat...    128   3e-32
ref|WP_025547509.1|  farnesyl-diphosphate synthase [Sphingobiu...    129   3e-32
gb|KGG90636.1|  polyprenyl synthetase [Comamonas testosteroni]       129   3e-32
ref|WP_028031919.1|  farnesyl-diphosphate synthase [Catellibac...    128   3e-32
ref|WP_007348936.1|  farnesyl-diphosphate synthase [Marinobact...    129   3e-32
gb|KDP13468.1|  octaprenyl-diphosphate synthase [Staphylococcu...    128   3e-32
ref|WP_011764932.1|  geranyltranstransferase [Azoarcus sp. BH72]     129   3e-32
ref|WP_017292475.1|  hypothetical protein [Geminocystis herdma...    129   3e-32
ref|WP_010373095.1|  geranyltranstransferase [Weissella cibaria]     128   3e-32
ref|WP_021328302.1|  Polyprenyl synthetase [candidate division...    128   3e-32
ref|WP_012897509.1|  farnesyl-diphosphate synthase [Lactococcu...    128   3e-32
ref|WP_003131348.1|  farnesyl-diphosphate synthase [Lactococcu...    128   3e-32
ref|WP_021722025.1|  Farnesyl diphosphate synthase [Lactococcu...    128   3e-32
gb|KEZ20215.1|  Geranylgeranyl pyrophosphate synthase precurso...    129   3e-32
ref|WP_004211215.1|  hypothetical protein [Sphingobium yanoiku...    129   3e-32
ref|WP_029179920.1|  geranyl transferase [Streptococcus suis]        128   3e-32
ref|WP_031346201.1|  geranyl transferase [Thauera terpenica]         129   3e-32
gb|ERE46241.1|  farnesyl-diphosphate synthase [Enterococcus ga...    128   3e-32
ref|WP_027493664.1|  geranyl transferase [Rhodanobacter sp. OR...    129   3e-32
dbj|BAN68722.1|  farnesyl diphosphate synthase [endosymbiont o...    129   3e-32
ref|WP_028536286.1|  geranyl transferase [Paludibacterium yong...    128   3e-32
gb|AIS04076.1|  Dimethylallyltransferase/geranyltranstransfera...    128   3e-32
ref|WP_010337451.1|  farnesyl-diphosphate synthase [Sphingobiu...    129   3e-32
ref|WP_017873100.1|  hypothetical protein [Candidatus Caldatri...    128   3e-32
gb|EPZ17059.1|  hypothetical protein M622_10035 [Thauera terpe...    128   3e-32
ref|WP_026749350.1|  geranyl transferase [Leptotrichia trevisa...    128   3e-32
gb|KDO50836.1|  hypothetical protein CISIN_1g038404mg [Citrus ...    128   3e-32
ref|WP_022475881.1|  polyprenyl synthetase [Ruminococcus sp. C...    128   3e-32
ref|WP_032093865.1|  geranyl transferase [Necropsobacter rosorum]    128   3e-32
ref|WP_022298504.1|  polyprenyl synthetase [Clostridium sp. CA...    128   3e-32
ref|WP_018939957.1|  farnesyl-diphosphate synthase [Thioalkali...    128   3e-32
ref|WP_023189850.1|  Octaprenyl diphosphate synthase / Dimethy...    128   3e-32
ref|WP_017499861.1|  farnesyl-diphosphate synthase [alpha prot...    128   3e-32
ref|WP_022247460.1|  farnesyltranstransferase [Clostridium sp....    128   3e-32
ref|WP_027158076.1|  geranyl transferase [Methylobacter luteus]      128   3e-32
ref|WP_007804426.1|  farnesyl-diphosphate synthase [Rhodanobac...    128   3e-32
ref|WP_013648416.1|  geranyltranstransferase [Nitrosomonas sp....    128   3e-32
ref|WP_015768508.1|  geranyltranstransferase [Candidatus Accum...    129   4e-32
gb|KFD27469.1|  hypothetical protein IH86_14560 [Sphingobium y...    129   4e-32
ref|WP_007400436.1|  farnesyl-diphosphate synthase [Gluconacet...    129   4e-32
ref|WP_024380048.1|  geranyl transferase [Streptococcus suis]        128   4e-32
dbj|GAK39917.1|  geranylgeranyl pyrophosphate synthetase [Paen...    128   4e-32
ref|WP_011344880.1|  farnesyl-diphosphate synthase [Carboxydot...    128   4e-32
ref|WP_024402667.1|  geranyl transferase [Streptococcus suis]        128   4e-32
ref|WP_031559595.1|  geranyl transferase [Lactococcus lactis]        128   4e-32
ref|WP_015230257.1|  geranylgeranyl pyrophosphate synthase [Da...    128   4e-32
ref|WP_013392503.1|  geranyltranstransferase [Achromobacter xy...    128   4e-32
ref|WP_008351985.1|  geranyltranstransferase [Thiovulum sp. ES]      128   4e-32
gb|AHA58682.1|  geranylgeranyl diphosphate synthase 2 [Nicotia...    129   4e-32
ref|WP_020399280.1|  hypothetical protein [Kordiimonas gwangya...    128   4e-32
gb|AII12358.1|  Geranyltranstransferase [Lactococcus lactis su...    128   4e-32
ref|YP_008702383.1|  farnesyl-diphosphate synthase [Lactococcu...    128   4e-32
ref|WP_024385022.1|  geranyl transferase [Streptococcus suis]        128   4e-32
gb|KCV65451.1|  polyprenyl synthetase [Bordetella bronchisepti...    128   4e-32
ref|WP_002798592.1|  farnesyl-diphosphate synthase [Microcysti...    129   4e-32
ref|WP_026738002.1|  geranyl transferase [Leptotrichia goodfel...    128   4e-32
ref|WP_006511523.1|  geranylgeranyl pyrophosphate synthase [Xe...    128   4e-32
ref|WP_015426158.1|  geranyltranstransferase [Lactococcus lactis]    128   4e-32
gb|EUJ24904.1|  putative geranyltranstransferase [Listeriaceae...    127   4e-32
gb|AHI25717.1|  Polyprenyl synthetase [Gluconacetobacter xylin...    129   4e-32
gb|EJP71078.1|  geranylgeranyl pyrophosphate ligase, ic [SAR86...    128   4e-32
ref|WP_009490076.1|  Octaprenyl-diphosphate synthase [Catellic...    128   4e-32
ref|WP_022187819.1|  geranyltranstransferase [Azospirillum sp....    128   4e-32
ref|WP_015933684.1|  geranylgeranyl pyrophosphate synthase [Me...    129   4e-32
ref|WP_003078772.1|  polyprenyl synthetase [Comamonas testoste...    128   4e-32
dbj|BAO30467.1|  polyprenyl synthetase [Sulfuritalea hydrogeni...    128   4e-32
gb|EFM61679.1|  geranyltranstransferase [Brucella sp. NF 2653]       128   4e-32
ref|WP_004265476.1|  farnesyl-diphosphate synthase [Lactobacil...    128   4e-32
ref|WP_028051921.1|  polyprenyl synthetase [Carboxydothermus f...    128   4e-32
ref|WP_002275376.1|  putative farnesyl diphosphate synthase [S...    128   4e-32
ref|WP_013356981.1|  geranyltranstransferase [Pantoea vagans]        127   4e-32
ref|WP_027010689.1|  polyprenyl synthetase [Comamonas sp. B-9]       128   4e-32
ref|WP_027971134.1|  geranyl transferase [Streptococcus plurex...    128   4e-32
ref|WP_012460702.1|  farnesyl-diphosphate synthase [Brucella a...    128   4e-32
ref|WP_009201105.1|  geranyltranstransferase [Anaerobaculum hy...    128   4e-32
ref|WP_025787214.1|  geranyl transferase [Vibrio parahaemolyti...    128   4e-32
ref|WP_003052845.1|  polyprenyl synthetase [Comamonas testoste...    129   4e-32
ref|WP_019880349.1|  hypothetical protein [Succinispira mobilis]     128   4e-32
ref|WP_016868367.1|  farnesyl-diphosphate synthase [Fischerell...    128   4e-32
ref|WP_015639224.1|  Geranyltranstransferase [Lactobacillus fe...    128   5e-32
ref|WP_009798501.1|  geranylgeranyl pyrophosphate synthase [Ni...    128   5e-32
ref|WP_019479927.1|  farnesyl-diphosphate synthase [Prochloroc...    128   5e-32
ref|WP_005917889.1|  farnesyl-diphosphate synthase [Fusobacter...    128   5e-32
ref|WP_006943206.1|  farnesyl-diphosphate synthase [Megasphaer...    128   5e-32
ref|WP_005672244.1|  geranyltranstransferase [Lautropia mirabi...    129   5e-32
ref|WP_018691048.1|  hypothetical protein [Algicola sagamiensis]     128   5e-32
ref|WP_011433454.1|  farnesyl-diphosphate synthase [Synechococ...    128   5e-32
ref|WP_004435557.1|  farnesyl-diphosphate synthase [Bacillus m...    128   5e-32
ref|WP_012262971.1|  geranyltranstransferase [Actinobacillus p...    128   5e-32
ref|WP_003705930.1|  farnesyl-diphosphate synthase [Lactobacil...    127   5e-32
dbj|BAA96458.1|  farnesyl diphosphate synthase [Rhodobacter ca...    128   5e-32
ref|WP_021461656.1|  geranyltranstransferase [Gallibacterium a...    128   5e-32
ref|WP_008164218.1|  geranyltranstransferase [Achromobacter ar...    128   5e-32
ref|WP_003089307.1|  geranyltranstransferase [Streptococcus ra...    128   5e-32
gb|KEZ51640.1|  farnesyl-diphosphate synthase [Bacillus cibi]        128   5e-32
gb|KEZ50957.1|  farnesyl-diphosphate synthase [Bacillus indicu...    128   5e-32
ref|WP_015647206.1|  Geranylgeranyl pyrophosphate synthase [St...    128   5e-32
ref|WP_008978360.1|  geranyltranstransferase [Erysipelotrichac...    127   5e-32
ref|WP_002281291.1|  putative farnesyl diphosphate synthase [S...    128   5e-32
ref|WP_019313876.1|  geranyltranstransferase [Streptococcus mu...    127   5e-32
ref|WP_012208041.1|  polyprenyl synthetase [Petrotoga mobilis]       127   5e-32
gb|KFB74499.1|  Farnesyl diphosphate synthase [Candidatus Accu...    128   5e-32
ref|WP_003620236.1|  farnesyl-diphosphate synthase [Gluconacet...    128   5e-32
ref|WP_012063633.1|  farnesyl-diphosphate synthase [Alkaliphil...    128   5e-32
ref|WP_012658748.1|  geranyltranstransferase [Streptococcus ub...    127   5e-32
ref|WP_021223997.1|  farnesyl-diphosphate synthase [Sphingobiu...    127   5e-32
ref|WP_003683815.1|  farnesyl-diphosphate synthase [Lactobacil...    127   5e-32
ref|WP_032522620.1|  farnesyl-diphosphate synthase [Prochloroc...    128   5e-32
ref|WP_003756021.1|  geranyltranstransferase [Listeria grayi]        128   5e-32
ref|WP_007079955.1|  farnesyl-diphosphate synthase [Rhodanobac...    128   5e-32
emb|CDN17184.1|  Octaprenyl-diphosphate synthase / Dimethylall...    128   5e-32
pdb|4LFE|A  Chain A, Crystal Structure Of Geranylgeranyl Dipho...    127   5e-32
gb|KGD85629.1|  geranyl transferase [Achromobacter sp. RTa]          128   5e-32
ref|WP_003069162.1|  polyprenyl synthetase [Comamonas testoste...    128   5e-32
ref|WP_019312746.1|  geranyltranstransferase [Streptococcus mu...    127   6e-32
ref|WP_012175083.1|  polyprenyl synthetase [Desulfococcus oleo...    128   6e-32
ref|WP_014108118.1|  geranyltranstransferase [Glaciecola nitra...    128   6e-32
ref|WP_023041538.1|  hypothetical protein [Fusobacterium nucle...    128   6e-32
ref|WP_027283270.1|  farnesyl-diphosphate synthase [Rubritepid...    127   6e-32
ref|WP_004034848.1|  hypothetical protein [Clostridium sp. ASF...    127   6e-32
ref|WP_003466361.1|  polyprenyl diphosphate synthase [Gracilib...    127   6e-32
gb|KFF41514.1|  farnesyl-diphosphate synthase [Candidatus Atel...    128   6e-32
ref|WP_020484944.1|  farnesyl-diphosphate synthase [Methylomon...    127   6e-32
ref|WP_006740680.1|  hypothetical protein [Streptococcus urina...    127   6e-32
ref|WP_012529688.1|  farnesyl-diphosphate synthase [Geobacter ...    127   6e-32
ref|WP_008994832.1|  farnesyl-diphosphate synthase [Novosphing...    128   6e-32
ref|WP_022811377.1|  MULTISPECIES: farnesyl-diphosphate syntha...    127   6e-32
ref|WP_003709870.1|  farnesyl-diphosphate synthase [Lactobacil...    128   6e-32
ref|WP_012995156.1|  farnesyl-diphosphate synthase [Thermoanae...    127   6e-32
ref|WP_024532461.1|  geranyl transferase [Streptococcus suis]        127   6e-32
ref|WP_026694686.1|  farnesyl-diphosphate synthase [Bacillus k...    127   7e-32
ref|WP_011313823.1|  geranylgeranyl pyrophosphate synthase [Ni...    128   7e-32
ref|WP_006739080.1|  geranyltranstransferase [Streptococcus ur...    127   7e-32
ref|WP_029343675.1|  geranyl transferase [Lactococcus lactis]        127   7e-32
ref|WP_008688512.1|  hypothetical protein [Eubacterium sp. 3_1...    127   7e-32
ref|WP_010561681.1|  geranyltranstransferase [Pseudoalteromona...    127   7e-32
ref|WP_023466856.1|  farnesyl-diphosphate synthase [Lactobacil...    127   7e-32
ref|WP_005601072.1|  geranyltranstransferase [Actinobacillus p...    127   7e-32
ref|WP_008203348.1|  farnesyl-diphosphate synthase [Microcysti...    127   7e-32
ref|WP_002961740.1|  geranyltranstransferase [Pseudoalteromona...    127   7e-32
ref|WP_008550402.1|  farnesyl-diphosphate synthase [Pseudovibr...    127   7e-32
ref|WP_018346017.1|  geranyltranstransferase [Gallibacterium a...    127   7e-32
gb|EUK18296.1|  geranylgeranyl pyrophosphate synthase [Commens...    127   8e-32
ref|WP_019316255.1|  geranyltranstransferase [Streptococcus mu...    127   8e-32
ref|WP_012739320.1|  farnesyl-diphosphate synthase [ [Eubacter...    127   8e-32
gb|KEK21158.1|  farnesyl-diphosphate synthase [Bacillus sp. BL...    127   8e-32
ref|WP_029815424.1|  geranyl transferase [Vibrio parahaemolyti...    127   8e-32
ref|WP_026039088.1|  geranyl transferase [Sporolactobacillus v...    127   8e-32
ref|WP_011304680.1|  geranyltranstransferase [Ehrlichia canis]       127   8e-32
gb|KGH30242.1|  polyprenyl synthetase [Comamonas testosteroni]       127   8e-32
ref|WP_012007895.1|  farnesyl-diphosphate synthase [Prochloroc...    127   8e-32
ref|XP_006430612.1|  hypothetical protein CICLE_v10013734mg [C...    129   8e-32
ref|WP_027320118.1|  farnesyl-diphosphate synthase [Bacillus s...    127   8e-32
ref|WP_002285419.1|  putative farnesyl diphosphate synthase [S...    127   8e-32
ref|WP_014562536.1|  farnesyl-diphosphate synthase [Lactobacil...    127   8e-32
ref|WP_032516702.1|  farnesyl-diphosphate synthase [Prochloroc...    127   8e-32
ref|WP_020876973.1|  Polyprenyl synthetase [Desulfococcus mult...    127   8e-32
ref|WP_006225054.1|  geranyltranstransferase [Achromobacter pi...    127   8e-32
ref|WP_032514188.1|  farnesyl-diphosphate synthase [Prochloroc...    127   8e-32
ref|WP_015171401.1|  farnesyl-diphosphate synthase [Geitlerine...    127   8e-32
ref|WP_023506963.1|  polyprenyl synthetase [Sulfuricella denit...    127   8e-32
ref|WP_019965315.1|  hypothetical protein [Pannonibacter phrag...    127   8e-32
ref|WP_021383981.1|  polyprenyl synthetase family protein [[Cl...    127   8e-32
ref|WP_015700843.1|  geranyltranstransferase [Pantoea ananatis]      127   8e-32
ref|WP_003713335.1|  farnesyl-diphosphate synthase [Lactobacil...    127   8e-32
ref|WP_013033721.1|  farnesyl-diphosphate synthase [Nitrosococ...    127   8e-32
ref|WP_005483001.1|  geranyltranstransferase [Vibrio parahaemo...    127   8e-32
ref|WP_003715733.1|  farnesyl-diphosphate synthase [Lactobacil...    127   9e-32
ref|WP_017868235.1|  hypothetical protein [Lactobacillus pobuz...    127   9e-32
ref|WP_024415226.1|  geranyl transferase [Streptococcus suis]        127   9e-32
ref|XP_002305196.2|  hypothetical protein POPTR_0004s08970g [P...    129   9e-32
ref|WP_026172788.1|  farnesyl-diphosphate synthase [Asticcacau...    127   9e-32
ref|WP_004560605.1|  geranyltranstransferase [Lactobacillus de...    127   9e-32
ref|WP_003618453.1|  geranyltranstransferase [Lactobacillus de...    127   9e-32
ref|WP_024406380.1|  geranyl transferase [Streptococcus suis]        127   9e-32
ref|WP_020817671.1|  farnesyl-diphosphate synthase [Sphingobiu...    127   9e-32
gb|KGE17960.1|  polyprenyl synthetase [Paenibacillus wynnii]         127   9e-32
ref|WP_009604496.1|  geranylgeranyl pyrophosphate synthase [SA...    127   9e-32
ref|WP_025542374.1|  geranyl transferase [Vibrio parahaemolyti...    127   9e-32
gb|ADZ24718.1|  geranylgeranyl pyrophosphate synthase 1 [Solan...    128   9e-32
ref|WP_013322785.1|  farnesyl-diphosphate synthase [Cyanothece...    127   9e-32
gb|KFD32912.1|  geranyl transferase [Lactobacillus casei]            127   9e-32
ref|WP_010780212.1|  hypothetical protein [Enterococcus gilvus]      127   9e-32
ref|WP_006530495.1|  geranylgeranyl pyrophosphate synthase [Gl...    127   9e-32
ref|WP_017815275.1|  hypothetical protein [Paenibacillus sp. A9]     127   9e-32
ref|WP_023978695.1|  farnesyl-diphosphate synthase [Asaia sp. ...    127   9e-32
ref|WP_002879683.1|  Geranylgeranyl diphosphate synthase [Lact...    127   9e-32
ref|WP_015296332.1|  Dimethylallyltransferase [Vibrio parahaem...    127   9e-32
gb|KFB69986.1|  Farnesyl diphosphate synthase [Candidatus Accu...    127   9e-32
ref|WP_020261746.1|  MULTISPECIES: hypothetical protein [Amini...    127   1e-31
ref|WP_003518751.1|  farnesyl-diphosphate synthase [Clostridiu...    127   1e-31
ref|WP_025627757.1|  geranyl transferase [Vibrio parahaemolyti...    127   1e-31
ref|WP_027950851.1|  geranyl transferase [Haliea salexigens]         127   1e-31
ref|WP_021374959.1|  polyprenyl synthetase family protein [[Cl...    127   1e-31
ref|WP_011877437.1|  farnesyl-diphosphate synthase [Desulfotom...    127   1e-31
gb|EXS68188.1|  farnesyl-diphosphate synthase [Sphingobium sp....    127   1e-31
ref|WP_026602008.1|  geranyl transferase [Methylomonas sp. 11b]      127   1e-31
ref|WP_011770540.1|  geranyltranstransferase [Psychromonas ing...    127   1e-31
gb|KGG12228.1|  Octaprenyl diphosphate synthase [Prochlorococc...    127   1e-31
ref|WP_022098645.1|  geranyltranstransferase [Eubacterium elig...    127   1e-31
ref|WP_009469963.1|  farnesyl-diphosphate synthase [gamma prot...    127   1e-31
emb|CDR77737.1|  Geranylgeranyl pyrophosphate synthase [Lactob...    127   1e-31
ref|WP_025504998.1|  geranyl transferase [Vibrio parahaemolyti...    127   1e-31
ref|WP_005496250.1|  geranyltranstransferase [Vibrio parahaemo...    127   1e-31
ref|WP_018137819.1|  MULTISPECIES: farnesyl-diphosphate syntha...    127   1e-31
emb|CDR84922.1|  Geranylgeranyl pyrophosphate synthase [Lactob...    127   1e-31
ref|WP_018082068.1|  farnesyl-diphosphate synthase [Asticcacau...    127   1e-31
ref|WP_013297793.1|  farnesyl-diphosphate synthase [Thermoanae...    127   1e-31
ref|WP_025636991.1|  geranyl transferase [Vibrio parahaemolyti...    127   1e-31
ref|WP_005568332.1|  geranyltranstransferase [Aggregatibacter ...    127   1e-31
ref|WP_009656932.1|  farnesyl-diphosphate synthase [Selenomona...    127   1e-31
ref|WP_021407142.1|  polyprenyl synthetase family protein [[Cl...    127   1e-31
ref|WP_005946931.1|  farnesyl-diphosphate synthase [Fusobacter...    127   1e-31
ref|WP_025554120.1|  geranyl transferase [Vibrio parahaemolyti...    127   1e-31
emb|CDR75240.1|  Geranylgeranyl pyrophosphate synthase [Lactob...    127   1e-31
ref|WP_013041408.1|  farnesyl-diphosphate synthase [Sphingobiu...    127   1e-31
ref|WP_010185120.1|  farnesyl-diphosphate synthase [Sphingomon...    127   1e-31
ref|WP_025442210.1|  geranyl transferase [Vibrio parahaemolyti...    127   1e-31
ref|WP_022366739.1|  polyprenyl synthetase [Firmicutes bacteri...    127   1e-31
ref|WP_031854359.1|  geranyl transferase [Vibrio parahaemolyti...    127   1e-31
ref|WP_008252384.1|  geranyltranstransferase [Limnobacter sp. ...    127   1e-31
ref|WP_016180540.1|  geranyltranstransferase [Enterococcus avium]    127   1e-31
ref|WP_025930496.1|  farnesyl-diphosphate synthase [Prochloroc...    127   1e-31
ref|WP_029854975.1|  geranyl transferase [Vibrio parahaemolyti...    126   1e-31
emb|CCF21331.1|  Putative Geranyltranstransferase (Farnesyl-di...    127   1e-31
ref|WP_009145018.1|  farnesyl-diphosphate synthase [Phascolarc...    126   1e-31
ref|WP_011235365.1|  geranyltranstransferase [Idiomarina loihi...    127   1e-31
ref|WP_016402703.1|  octaprenyl-diphosphate synthase [Agarivor...    127   1e-31
ref|WP_007069215.1|  farnesyl-diphosphate synthase [Dialister ...    126   1e-31
gb|EUJ30042.1|  geranyltranstransferase [Listeria grayi FSL F6...    126   2e-31
ref|WP_009758643.1|  farnesyl-diphosphate synthase [Ahrensia s...    127   2e-31
ref|WP_009352586.1|  farnesyl-diphosphate synthase [Veillonell...    126   2e-31
ref|WP_022000264.1|  geranyltranstransferase [Acetobacter sp. ...    127   2e-31
ref|WP_014283153.1|  farnesyl-diphosphate synthase [Pseudovibr...    127   2e-31
ref|WP_032525706.1|  farnesyl-diphosphate synthase [Prochloroc...    127   2e-31
ref|WP_031415495.1|  geranyl transferase [Vibrio parahaemolyti...    126   2e-31
ref|WP_011376631.1|  farnesyl-diphosphate synthase [Prochloroc...    127   2e-31
ref|WP_029809437.1|  geranyl transferase [Vibrio parahaemolyti...    126   2e-31
ref|WP_026840163.1|  polyprenyl synthetase [Geobacter bremensis]     126   2e-31
ref|WP_005488700.1|  geranyltranstransferase [Vibrio parahaemo...    126   2e-31
gb|EID89062.1|  geranyltranstransferase [Staphylococcus aureus...    125   2e-31
ref|WP_012839362.1|  polyprenyl synthetase [Comamonas testoste...    127   2e-31
ref|WP_025517844.1|  geranyl transferase [Vibrio parahaemolyti...    126   2e-31
ref|WP_013820059.1|  farnesyl-diphosphate synthase [Methylomon...    126   2e-31
ref|WP_008193606.1|  farnesyl-diphosphate synthase [Labrenzia ...    126   2e-31
ref|WP_032136495.1|  geranyl transferase [Kingella sp. Sch538]       126   2e-31
ref|WP_025955866.1|  MULTISPECIES: farnesyl-diphosphate syntha...    126   2e-31
ref|WP_028078633.1|  geranyl transferase [Solobacterium moorei]      126   2e-31
ref|WP_018399100.1|  farnesyl-diphosphate synthase [filamentou...    127   2e-31
gb|EGQ77948.1|  geranyltranstransferase [Fusobacterium nucleat...    125   2e-31
gb|AIM15555.1|  farnesyl-diphosphate synthase [Bacillus sp. X1...    126   2e-31
ref|WP_008696517.1|  farnesyl-diphosphate synthase [Fusobacter...    126   2e-31
gb|EWG10703.1|  polyprenyl synthetase [Bacillus firmus DS1]          126   2e-31
ref|WP_023042162.1|  geranylgeranyl diphosphate synthase, type...    126   2e-31
ref|WP_027262791.1|  farnesyl-diphosphate synthase [Leisingera...    126   2e-31
ref|WP_018366871.1|  hypothetical protein [Streptococcus didel...    126   2e-31
ref|WP_025914727.1|  farnesyl-diphosphate synthase [Prochloroc...    126   2e-31
ref|WP_014828219.1|  farnesyl-diphosphate synthase [Desulfospo...    126   2e-31
emb|CDI04508.1|  geranyltranstransferase (=farnesyldiphosphate...    126   2e-31
ref|WP_005980807.1|  farnesyl-diphosphate synthase [Fusobacter...    126   2e-31
ref|WP_015599217.1|  geranylgeranyl pyrophosphate synthase [Hy...    126   2e-31
gb|KGG15455.1|  Octaprenyl diphosphate synthase [Prochlorococc...    126   2e-31
ref|WP_002256332.1|  polyprenyl synthetase family protein [Nei...    126   2e-31
ref|WP_025926655.1|  farnesyl-diphosphate synthase [Prochloroc...    126   2e-31
ref|WP_028554193.1|  polyprenyl synthetase [Paenibacillus sp. ...    126   2e-31
gb|KDE63415.1|  farnesyl-diphosphate synthase [Fusobacterium n...    126   2e-31
ref|WP_029657651.1|  geranyl transferase [Staphylococcus aureus]     124   2e-31
ref|WP_018393881.1|  hypothetical protein [Bacillus sp. 37MA]        126   2e-31
ref|WP_009166793.1|  farnesyltranstransferase [Lactobacillus f...    126   2e-31
ref|WP_029042306.1|  geranylgeranyl pyrophosphate synthase [Cu...    126   2e-31
ref|WP_022419748.1|  polyprenyl synthetase [Eubacterium dolich...    126   2e-31
ref|WP_003101069.1|  geranyltranstransferase [Streptococcus in...    126   2e-31
ref|WP_025521801.1|  geranyl transferase [Vibrio parahaemolyti...    126   2e-31
ref|WP_013625053.1|  farnesyl-diphosphate synthase [Syntrophob...    126   2e-31
ref|WP_022809873.1|  farnesyl-diphosphate synthase [candidate ...    126   2e-31
ref|WP_016316189.1|  hypothetical protein [Anaerotruncus sp. G...    126   2e-31
ref|WP_024386340.1|  geranyl transferase [Streptococcus suis]        126   2e-31
ref|WP_015831552.1|  geranyltranstransferase [Methylotenera mo...    126   2e-31
ref|WP_007098242.1|  farnesyl-diphosphate synthase [Synechococ...    127   2e-31
ref|WP_003428409.1|  farnesyl-diphosphate synthase [[Clostridi...    126   2e-31
gb|KFL47573.1|  geranyltranstransferase [Sphingobium sp. ba1]        126   2e-31
ref|WP_004799375.1|  hypothetical protein [ [[Eubacterium] dol...    126   2e-31
ref|WP_021362460.1|  polyprenyl synthetase family protein [[Cl...    126   2e-31
ref|WP_009063787.1|  farnesyl-diphosphate synthase [Clostridiu...    126   2e-31
ref|WP_029797075.1|  geranyl transferase [Vibrio parahaemolyti...    126   2e-31
ref|WP_009888951.1|  farnesyl-diphosphate synthase [[Clostridi...    126   2e-31
ref|WP_027131829.1|  geranyl transferase [Fusobacterium necrop...    126   2e-31
ref|WP_005960668.1|  farnesyl-diphosphate synthase [Fusobacter...    126   2e-31
ref|WP_005597262.1|  geranyltranstransferase [Actinobacillus p...    126   2e-31
gb|AAY90002.1|  predicted dimethylallyltransferase FN1327 [unc...    125   2e-31
ref|WP_011863127.1|  farnesyl-diphosphate synthase [Prochloroc...    126   2e-31
ref|WP_003438132.1|  farnesyl-diphosphate synthase [[Clostridi...    126   2e-31
ref|WP_023461382.1|  farnesyl-diphosphate synthase [Asticcacau...    126   2e-31
ref|WP_002806476.1|  farnesyl-diphosphate synthase [Prochloroc...    126   2e-31
ref|WP_005556817.1|  geranyltranstransferase [Aggregatibacter ...    126   2e-31
ref|WP_003419181.1|  farnesyl-diphosphate synthase [[Clostridi...    126   2e-31
ref|WP_025948230.1|  farnesyl-diphosphate synthase [Prochloroc...    125   2e-31
ref|WP_011935168.1|  farnesyl-diphosphate synthase [Synechococ...    126   2e-31
ref|WP_007688684.1|  geranyltranstransferase [Sphingobium indi...    125   2e-31
ref|WP_011837915.1|  farnesyl-diphosphate synthase [Clostridiu...    126   2e-31
gb|EYD69896.1|  dimethylallyltransferase [Fusobacterium necrop...    126   2e-31
ref|WP_011417686.1|  farnesyl-diphosphate synthase [Syntrophus...    126   2e-31
ref|WP_004463384.1|  farnesyl-diphosphate synthase [Clostridiu...    126   2e-31
ref|WP_015676462.1|  polyprenyl synthetase [Leptospira yanagawae]    126   2e-31
ref|WP_011132703.1|  farnesyl-diphosphate synthase [Prochloroc...    126   2e-31
ref|WP_027938889.1|  hypothetical protein [Anaerobiospirillum ...    126   2e-31
ref|WP_028347703.1|  geranylgeranyl pyrophosphate synthase [Br...    126   2e-31
gb|KFC24912.1|  farnesyl-diphosphate synthase [Sulfitobacter s...    126   2e-31
gb|KGG53441.1|  Octaprenyl diphosphate synthase [Lactobacillus...    126   3e-31
ref|WP_024068224.1|  Octaprenyl-diphosphate synthase / Dimethy...    126   3e-31
ref|WP_009632207.1|  geranylgeranyl pyrophosphate synthase [Sy...    126   3e-31
ref|WP_022259319.1|  polyprenyl synthetase [Eubacterium sp. CA...    126   3e-31
ref|WP_011288788.1|  geranyltranstransferase [Dechloromonas ar...    126   3e-31
gb|KDE63384.1|  farnesyl-diphosphate synthase [Fusobacterium n...    126   3e-31
ref|WP_012679185.1|  geranyltranstransferase [Streptococcus equi]    126   3e-31
gb|KEF31216.1|  Octaprenyl-diphosphate synthase [Marinobacter ...    126   3e-31
ref|WP_003610278.1|  geranyltranstransferase [Weissella confusa]     125   3e-31
gb|KAJ30545.1|  farnesyl-diphosphate synthase [Sulfitobacter p...    126   3e-31
ref|WP_006388364.1|  geranyltranstransferase [Achromobacter xy...    126   3e-31
ref|WP_024575532.1|  MULTISPECIES: geranylgeranyl pyrophosphat...    126   3e-31
gb|ETO40187.1|  Octaprenyl-diphosphate synthase [Lactobacillus...    125   3e-31
ref|WP_013843033.1|  farnesyl-diphosphate synthase [Desulfotom...    126   3e-31
ref|WP_025956777.1|  MULTISPECIES: farnesyl-diphosphate syntha...    126   3e-31
ref|WP_013744848.1|  geranyltranstransferase [Gallibacterium a...    126   3e-31
ref|XP_006482126.1|  PREDICTED: heterodimeric geranylgeranyl p...    127   3e-31
ref|WP_007049641.1|  farnesyl-diphosphate synthase [Anaerofust...    126   3e-31
ref|WP_009825807.1|  farnesyl-diphosphate synthase [Sulfitobac...    126   3e-31
ref|WP_008037505.1|  farnesyl-diphosphate synthase [Bartonella...    126   3e-31
ref|WP_005584348.1|  geranyltranstransferase [Clostridium ultu...    126   3e-31
gb|KDD81624.1|  geranyl transferase [Haemophilus parasuis ST4-2]     126   3e-31
ref|WP_013150273.1|  MULTISPECIES: farnesyl-diphosphate syntha...    125   3e-31
ref|WP_019504326.1|  farnesyl-diphosphate synthase [Pleurocaps...    126   3e-31
ref|WP_005850958.1|  farnesyl-diphosphate synthase [Sulfitobac...    126   3e-31
ref|WP_021422193.1|  polyprenyl synthetase family protein [[Cl...    125   3e-31
ref|NP_001234087.1|  geranylgeranyl pyrophosphate synthase 1 [...    127   3e-31
ref|XP_003082280.1|  geranylgeranyl diphosphate synthase (ISS)...    127   3e-31
ref|WP_011818606.1|  farnesyl-diphosphate synthase [Prochloroc...    126   3e-31
gb|AIQ69971.1|  polyprenyl synthetase [Paenibacillus graminis]       125   3e-31
ref|WP_031872025.1|  geranyl transferase [Staphylococcus aureus]     125   3e-31
ref|WP_015925355.1|  farnesyl-diphosphate synthase [ [Clostrid...    125   3e-31
ref|WP_013540174.1|  polyprenyl synthetase [Variovorax paradoxus]    126   3e-31
ref|WP_010579695.1|  farnesyl-diphosphate synthase [Lactobacil...    125   3e-31
ref|WP_029636151.1|  farnesyl-diphosphate synthase [ [[Scytone...    126   3e-31
ref|WP_029197144.1|  polyprenyl synthetase [Paenibacillus algi...    125   3e-31
ref|WP_029473443.1|  hypothetical protein [Clostridiales bacte...    125   3e-31
ref|WP_018589764.1|  farnesyl-diphosphate synthase [[Clostridi...    125   3e-31
ref|WP_016832778.1|  geranyltranstransferase [Herbaspirillum l...    125   3e-31
ref|WP_015389566.1|  farnesyl diphosphate synthase [Candidatus...    126   3e-31
ref|WP_028987017.1|  polyprenyl synthetase [Thermicanus aegypt...    125   3e-31
ref|WP_022079330.1|  geranylgeranyl pyrophosphate synthase [Ac...    126   4e-31
ref|WP_032524607.1|  farnesyl-diphosphate synthase [Prochloroc...    125   4e-31
ref|WP_031514852.1|  hypothetical protein [Desulfotomaculum al...    125   4e-31
ref|WP_007894665.1|  geranyltranstransferase [Streptococcus ps...    125   4e-31
ref|WP_008793425.1|  farnesyl-diphosphate synthase [Fusobacter...    125   4e-31
ref|WP_009852533.1|  geranyltranstransferase [beta proteobacte...    125   4e-31
ref|WP_004253095.1|  geranyltranstransferase [Thauera sp. 63]        125   4e-31
gb|KFB85911.1|  farnesyl-diphosphate synthase [Calothrix sp. 3...    125   4e-31
ref|WP_013741551.1|  geranyltranstransferase [Pusillimonas sp....    125   4e-31
ref|WP_026900452.1|  farnesyl-diphosphate synthase [Peptostrep...    125   4e-31
ref|WP_005538893.1|  geranyltranstransferase [Aggregatibacter ...    125   4e-31
gb|KGG13972.1|  Octaprenyl diphosphate synthase [Prochlorococc...    125   4e-31
ref|WP_007312295.1|  farnesyl-diphosphate synthase [Crocosphae...    125   4e-31
ref|WP_007829284.1|  polyprenyl synthetase [Variovorax sp. CF313]    125   4e-31
ref|WP_012820988.1|  geranyltranstransferase [Aggregatibacter ...    125   4e-31
ref|WP_006355547.1|  farnesyl-diphosphate synthase [ [Clostrid...    125   4e-31
emb|CDZ24171.1|  Heterodimeric geranylgeranyl pyrophosphate sy...    125   4e-31
ref|WP_009917750.1|  Trans-Isoprenyl Diphosphate Synthase [Lis...    122   4e-31
ref|WP_021830522.1|  Octaprenyl-diphosphate synthase / Dimethy...    125   4e-31
ref|WP_005546393.1|  geranyltranstransferase [Aggregatibacter ...    125   4e-31
ref|WP_005575278.1|  geranyltranstransferase [Aggregatibacter ...    125   4e-31
ref|WP_021320509.1|  geranyltranstransferase [Streptococcus equi]    125   4e-31
ref|WP_029808204.1|  geranyl transferase [Vibrio parahaemolyti...    125   4e-31
ref|WP_029838887.1|  geranyl transferase [Vibrio parahaemolyti...    125   4e-31
ref|WP_007307608.1|  farnesyl-diphosphate synthase [Crocosphae...    125   4e-31
gb|AIQ19597.1|  polyprenyl synthetase [Paenibacillus sp. FSL H...    125   4e-31
ref|WP_025140257.1|  geranyl transferase [Alcaligenes sp. DH1f]      125   4e-31
ref|WP_026134839.1|  farnesyl-diphosphate synthase [Scytonema ...    125   4e-31
ref|WP_029802475.1|  geranyl transferase [Vibrio parahaemolyti...    125   4e-31
ref|WP_017327421.1|  hypothetical protein [Synechococcus sp. P...    125   4e-31
ref|WP_000183386.1|  geranyltranstransferase [Staphylococcus a...    125   4e-31
ref|WP_029842246.1|  geranyl transferase [Vibrio parahaemolyti...    125   4e-31
gb|AHE66517.1|  geranylgeranyl pyrophosphate synthase [Legione...    124   4e-31
ref|WP_018290310.1|  hypothetical protein [Verrucomicrobium sp...    125   4e-31
ref|WP_004873145.1|  farnesyl-diphosphate synthase [Acidithiob...    125   5e-31
ref|WP_027301402.1|  farnesyl-diphosphate synthase [Rhodospiri...    125   5e-31
ref|WP_028976401.1|  geranyl transferase [Sporolactobacillus t...    125   5e-31
ref|WP_022105717.1|  putative uncharacterized protein [Dialist...    125   5e-31
ref|WP_029826245.1|  geranyl transferase [Vibrio parahaemolyti...    125   5e-31
ref|WP_018183268.1|  hypothetical protein [Kaistia granuli]          125   5e-31
ref|WP_019321493.1|  geranyltranstransferase [Streptococcus mu...    125   5e-31
ref|WP_028324582.1|  hypothetical protein [Desulfatirhabdium b...    125   5e-31
ref|WP_029597505.1|  geranyl transferase [Fusobacterium nuclea...    125   5e-31
ref|WP_028504728.1|  geranyl transferase [Ruminococcus sp. FC2...    125   5e-31
gb|ETS93211.1|  putative geranyltranstransferase [Veillonella ...    125   5e-31
ref|WP_011820467.1|  farnesyl-diphosphate synthase [Prochloroc...    125   5e-31
ref|WP_025534925.1|  geranyl transferase [Vibrio parahaemolyti...    125   5e-31
ref|WP_020904154.1|  geranyltranstransferase [Vibrio parahaemo...    125   5e-31
ref|WP_012515262.1|  geranyltranstransferase [Streptococcus equi]    125   5e-31
ref|WP_025526244.1|  geranyl transferase [Vibrio parahaemolyti...    125   5e-31
ref|WP_026033820.1|  geranyl transferase [Dyella japonica]           125   5e-31
ref|WP_011125281.1|  farnesyl-diphosphate synthase [Prochloroc...    125   5e-31
ref|WP_009460305.1|  MULTISPECIES: farnesyl-diphosphate syntha...    125   5e-31
ref|WP_029508359.1|  geranyl transferase [Lactobacillus suebicus]    125   5e-31
ref|WP_013216732.1|  geranylgeranyl pyrophosphate synthase [Hy...    125   5e-31
ref|WP_012678289.1|  geranyltranstransferase [Streptococcus equi]    125   5e-31
ref|WP_014622518.1|  geranyltranstransferase [Streptococcus equi]    125   5e-31
ref|WP_002811624.1|  farnesyl-diphosphate synthase [Nitrosococ...    125   5e-31
ref|WP_029999754.1|  geranyl transferase [Vibrio parahaemolyti...    125   5e-31
ref|WP_017944141.1|  hypothetical protein [alpha proteobacteri...    122   5e-31
ref|WP_028983829.1|  geranyl transferase [Sporolactobacillus t...    125   5e-31
ref|WP_001819915.1|  geranyltranstransferase [Staphylococcus a...    125   5e-31
ref|WP_027180914.1|  polyprenyl synthetase [Desulfovibrio desu...    125   5e-31
ref|WP_004609794.1|  hypothetical protein [ [[Clostridium] spi...    125   5e-31
ref|WP_008437873.1|  farnesyl-diphosphate synthase [Rhodanobac...    125   6e-31
ref|WP_011256934.1|  geranyltranstransferase [Wolbachia endosy...    125   6e-31
ref|XP_005536487.1|  geranylgeranyl diphosphate synthase, chlo...    126   6e-31
ref|WP_015107969.1|  geranylgeranyl pyrophosphate synthase [Cy...    125   6e-31
gb|AIQ95223.1|  Octaprenyl diphosphate synthase [Prochlorococc...    125   6e-31
ref|WP_028579849.1|  farnesyl-diphosphate synthase [Desulfobul...    125   6e-31
ref|WP_020071675.1|  farnesyl-diphosphate synthase [ [Clostrid...    125   6e-31
ref|WP_010131685.1|  farnesyl-diphosphate synthase [Microbulbi...    125   6e-31
ref|WP_008853281.1|  farnesyl-diphosphate synthase [Commensali...    125   6e-31
gb|KFN39652.1|  hypothetical protein KN63_01815 [Smithella sp....    125   6e-31
gb|KFG92054.1|  Farnesyl-diphosphate synthase [Sphingobium her...    125   6e-31
ref|WP_026350081.1|  geranyl transferase [Bordetella sp. FB-8]       125   6e-31
ref|WP_003717330.1|  farnesyl-diphosphate synthase [Lactobacil...    125   6e-31
ref|WP_022428686.1|  farnesyl-diphosphate synthase [Ruminococc...    125   6e-31
ref|WP_005810943.1|  farnesyl-diphosphate synthase [Desulfitob...    125   6e-31
ref|XP_006364641.1|  PREDICTED: geranylgeranyl pyrophosphate s...    126   6e-31
ref|WP_019654720.1|  polyprenyl synthetase [Variovorax paradoxus]    125   6e-31
gb|KGF28852.1|  geranyl transferase [Oligella urethralis DNF00...    125   6e-31
ref|WP_016311713.1|  hypothetical protein [Paenibacillus baren...    125   7e-31
ref|WP_014809351.1|  geranylgeranyl pyrophosphate synthase [De...    125   7e-31
ref|WP_005957243.1|  farnesyl-diphosphate synthase [Fusobacter...    125   7e-31
ref|WP_025972226.1|  farnesyl-diphosphate synthase [Prochloroc...    125   7e-31
ref|WP_025894673.1|  MULTISPECIES: farnesyl-diphosphate syntha...    125   7e-31
ref|WP_026788489.1|  MULTISPECIES: farnesyl-diphosphate syntha...    125   7e-31
ref|WP_028259543.1|  polyprenyl synthetase [Variovorax sp. JGI...    125   7e-31
ref|WP_003704072.1|  farnesyl-diphosphate synthase [Lactobacil...    124   7e-31
ref|WP_018003247.1|  hypothetical protein [Verrucomicrobia bac...    125   7e-31
ref|WP_025508734.1|  geranyl transferase [Vibrio parahaemolyti...    124   7e-31
gb|EXI91860.1|  Farnesyl diphosphate synthase [Candidatus Accu...    126   7e-31
ref|WP_006516935.1|  geranylgeranyl pyrophosphate synthase [Le...    125   7e-31
ref|WP_025623421.1|  geranyl transferase [Vibrio parahaemolyti...    124   7e-31
ref|WP_026700249.1|  farnesyl-diphosphate synthase [Bacillus a...    125   7e-31
ref|WP_018439742.1|  geranyltranstransferase [Burkholderia sp....    125   7e-31
ref|WP_025958420.1|  MULTISPECIES: farnesyl-diphosphate syntha...    125   7e-31
ref|WP_010494356.1|  farnesyl-diphosphate synthase [Lactobacil...    125   7e-31
gb|KFD31830.1|  Farnesyl diphosphate synthase [Staphylococcus ...    124   8e-31
ref|WP_004333852.1|  polyprenyl synthetase [Thauera linaloolen...    125   8e-31
gb|KED05048.1|  geranyltranstransferase [Streptococcus equi su...    124   8e-31
ref|WP_029824607.1|  geranyl transferase [Vibrio parahaemolyti...    124   8e-31
ref|WP_029801804.1|  geranyl transferase [Vibrio parahaemolyti...    124   8e-31
emb|CEA05000.1|  Farnesyl diphosphate synthase [Lysinibacillus...    124   8e-31
gb|AHX14233.1|  geranyl transferase [Dyella jiangningensis]          125   8e-31
ref|WP_025568870.1|  geranyl transferase [Vibrio parahaemolyti...    124   8e-31
ref|WP_025621010.1|  geranyl transferase [Vibrio parahaemolyti...    124   8e-31
ref|WP_024597198.1|  geranyl transferase [Pseudoalteromonas ha...    125   8e-31
ref|WP_025558669.1|  geranyl transferase [Vibrio parahaemolyti...    124   8e-31
ref|WP_025932042.1|  farnesyl-diphosphate synthase [Prochloroc...    125   8e-31
gb|AIS52383.1|  farnesyl diphosphate synthase [Thermoanaerobac...    124   8e-31
gb|KFJ36533.1|  polyprenyl synthetase family protein [Neisseri...    125   8e-31
ref|WP_029850129.1|  geranyl transferase [Vibrio parahaemolyti...    124   8e-31
ref|WP_005488668.1|  Octaprenyl-diphosphate synthase / Dimethy...    124   8e-31
ref|WP_016875703.1|  farnesyl-diphosphate synthase [Chlorogloe...    125   8e-31
ref|WP_027467650.1|  geranyl transferase [Deefgea rivuli]            125   8e-31
ref|WP_025881683.1|  MULTISPECIES: farnesyl-diphosphate syntha...    125   8e-31
ref|WP_025888611.1|  MULTISPECIES: farnesyl-diphosphate syntha...    125   8e-31
ref|WP_029844479.1|  geranyl transferase [Vibrio parahaemolyti...    124   8e-31
emb|CDX02429.1|  Farnesyl diphosphate synthase [Desulfitobacte...    125   8e-31
ref|WP_000183385.1|  geranyltranstransferase [Staphylococcus a...    124   8e-31
gb|AIQ36997.1|  polyprenyl synthetase [Paenibacillus sp. FSL R...    125   9e-31
ref|WP_025514486.1|  geranyl transferase [Bordetella trematum]       125   9e-31
ref|WP_029855224.1|  geranyl transferase [Vibrio parahaemolyti...    124   9e-31
ref|WP_012420304.1|  farnesyl-diphosphate synthase [Akkermansi...    124   9e-31
gb|KGF27561.1|  geranyl transferase [Staphylococcus haemolytic...    124   9e-31
ref|WP_017472275.1|  hypothetical protein [Amphibacillus jilin...    124   9e-31
ref|WP_025900665.1|  MULTISPECIES: farnesyl-diphosphate syntha...    124   9e-31
gb|ERK47022.1|  putative geranyltranstransferase [ [[Eubacteri...    124   9e-31
ref|WP_019154456.1|  hypothetical protein [Bacillus massiliose...    124   9e-31
ref|WP_003708049.1|  farnesyl-diphosphate synthase [Lactobacil...    124   9e-31
ref|WP_025942433.1|  farnesyl-diphosphate synthase [Prochloroc...    124   9e-31
ref|WP_025612759.1|  geranyl transferase [Vibrio parahaemolyti...    124   9e-31
ref|WP_025906614.1|  MULTISPECIES: farnesyl-diphosphate syntha...    124   9e-31
gb|EUC68594.1|  farnesyl-diphosphate synthase [Alcanivorax sp....    124   1e-30
ref|WP_002234502.1|  geranyltranstransferase [Neisseria mening...    124   1e-30
ref|WP_017313374.1|  farnesyl-diphosphate synthase [Fischerell...    125   1e-30
ref|WP_003645160.1|  Polyprenyl synthetase [Lactobacillus plan...    124   1e-30
ref|WP_003708149.1|  geranyltranstransferase [Neisseria lactam...    124   1e-30
ref|WP_013361558.1|  geranyltranstransferase [ [[Clostridium] ...    124   1e-30
ref|WP_015226614.1|  farnesyl-diphosphate synthase [Halothece ...    125   1e-30
ref|WP_018931661.1|  hypothetical protein [Gracilibacillus lac...    124   1e-30
ref|WP_025933678.1|  farnesyl-diphosphate synthase [Prochloroc...    124   1e-30
gb|EHT68023.1|  ispA protein [Staphylococcus aureus subsp. aur...    124   1e-30
ref|WP_011589443.1|  farnesyl-diphosphate synthase [Alcanivora...    124   1e-30
ref|WP_025040963.1|  geranyl transferase [Nitrosospira briensis]     124   1e-30
ref|WP_009225791.1|  MULTISPECIES: farnesyl-diphosphate syntha...    124   1e-30
ref|WP_016624155.1|  geranyltranstransferase [Enterococcus fae...    124   1e-30
ref|WP_028791708.1|  farnesyl-diphosphate synthase [Thalassosp...    124   1e-30
ref|WP_014568268.1|  farnesyl-diphosphate synthase [Lactobacil...    124   1e-30
ref|WP_015535947.1|  Geranylgeranyl pyrophosphate synthase [ [...    124   1e-30
ref|WP_003699850.1|  farnesyl-diphosphate synthase [Lactobacil...    124   1e-30
ref|WP_008112874.1|  geranyltranstransferase [Herbaspirillum s...    124   1e-30
gb|EXI68258.1|  Farnesyl diphosphate synthase [Candidatus Accu...    124   1e-30
ref|WP_015397058.1|  farnesyl diphosphate synthase [Candidatus...    124   1e-30
ref|WP_024620745.1|  farnesyl-diphosphate synthase [ [[Clostri...    124   1e-30
ref|WP_015640318.1|  Geranyltranstransferase [Lactobacillus pl...    124   1e-30
ref|WP_004695813.1|  farnesyl-diphosphate synthase [Veillonell...    124   1e-30
ref|WP_023458966.1|  farnesyl-diphosphate synthase [Asticcacau...    124   1e-30
ref|WP_022791305.1|  geranyltranstransferase [Weissella haloto...    124   1e-30
ref|WP_005576131.1|  geranyltranstransferase [Aggregatibacter ...    124   1e-30
ref|WP_021170066.1|  geranyltranstransferase CrtE [Sporomusa o...    124   1e-30
ref|WP_026366386.1|  geranyl transferase [Salinicoccus albus]        124   1e-30
ref|WP_003750548.1|  geranyltranstransferase [Neisseria polysa...    124   1e-30
ref|WP_024002829.1|  geranyltranstransferase [Lactobacillus pl...    124   1e-30
ref|WP_028372206.1|  geranyl transferase [Legionella lansingen...    124   1e-30
ref|WP_024021571.1|  farnesyl-diphosphate synthase [Sphingobiu...    124   1e-30
ref|WP_027796258.1|  geranyl transferase [Burkholderia acidipa...    124   1e-30
ref|WP_027824664.1|  geranyl transferase [Lactobacillus psittaci]    124   1e-30
ref|WP_013554881.1|  geranyltranstransferase [Nitratifractor s...    124   1e-30
ref|WP_028972366.1|  geranyl transferase [Sporomusa ovata]           124   1e-30
ref|WP_000183369.1|  geranyltranstransferase [Staphylococcus a...    124   1e-30
ref|WP_022188857.1|  polyprenyl synthetase [Ruminococcus sp. C...    124   1e-30
gb|KGG71650.1|  farnesyl-diphosphate synthase [Tolypothrix bou...    124   1e-30
ref|WP_009768826.1|  geranylgeranyl pyrophosphate synthase [Os...    124   1e-30
ref|WP_011399574.1|  farnesyl-diphosphate synthase [Hahella ch...    124   1e-30
ref|WP_011613509.1|  farnesyl-diphosphate synthase [Trichodesm...    124   1e-30
ref|WP_031551931.1|  geranyl transferase [Gemella sanguinis]         124   1e-30
ref|WP_023391154.1|  putative geranyltranstransferase [Abiotro...    124   1e-30
ref|WP_019866224.1|  farnesyl-diphosphate synthase [Methylovul...    124   1e-30
ref|WP_031576081.1|  geranyl transferase [Streptococcus parasa...    124   1e-30
ref|WP_021998395.1|  geranylgeranyl pyrophosphate synthase [Ru...    124   1e-30
ref|WP_010019413.1|  farnesyl-diphosphate synthase [Lactobacil...    124   1e-30
ref|WP_028864887.1|  geranyl transferase [Psychromonas aquimar...    124   1e-30
ref|WP_029186528.1|  geranyl transferase [Streptococcus suis]        124   1e-30
ref|WP_021413663.1|  polyprenyl synthetase family protein [[Cl...    124   1e-30
ref|WP_031784871.1|  geranyl transferase [Staphylococcus aureus]     124   1e-30
gb|ETO93704.1|  farnesyl-diphosphate synthase [Legionella oakr...    124   1e-30
ref|WP_027417564.1|  polyprenyl synthetase [Aneurinibacillus t...    124   1e-30
ref|WP_022197949.1|  polyprenyl synthetase [Akkermansia mucini...    124   1e-30
ref|WP_006218302.1|  geranyltranstransferase [Achromobacter pi...    124   1e-30
ref|WP_025952898.1|  farnesyl-diphosphate synthase [Prochloroc...    124   1e-30
ref|WP_012746713.1|  polyprenyl synthetase [Variovorax paradoxus]    124   1e-30
ref|WP_008909828.1|  farnesyl-diphosphate synthase [Caloramato...    124   1e-30
ref|WP_026398165.1|  farnesyl-diphosphate synthase [Acetobacte...    124   1e-30
ref|WP_024095032.1|  putative polyprenyl synthetase [Paenibaci...    124   1e-30
ref|WP_000183384.1|  geranyltranstransferase [Staphylococcus a...    124   1e-30
ref|XP_001420781.1|  predicted protein [Ostreococcus lucimarin...    124   1e-30
ref|WP_020083980.1|  hypothetical protein [Hyphomicrobium zava...    124   1e-30
ref|WP_013247295.1|  farnesyl-diphosphate synthase [Candidatus...    124   1e-30
ref|WP_025787361.1|  geranyl transferase [Staphylococcus aureus]     124   1e-30
ref|WP_000183378.1|  geranyltranstransferase [Staphylococcus a...    124   1e-30
ref|WP_020977292.1|  geranyltranstransferase, putative [Staphy...    124   1e-30
ref|WP_000183380.1|  geranyltranstransferase [Staphylococcus a...    124   1e-30
ref|WP_031920205.1|  geranyl transferase [Staphylococcus aureus]     124   1e-30
ref|WP_005838391.1|  geranyltranstransferase [Eubacterium saph...    124   2e-30
ref|WP_017302091.1|  farnesyl-diphosphate synthase [Nodosiline...    124   2e-30
ref|WP_004617705.1|  farnesyl-diphosphate synthase [ [Clostrid...    124   2e-30
ref|WP_031907272.1|  geranyl transferase [Staphylococcus aureus]     124   2e-30
gb|AHN29672.1|  Octaprenyl-diphosphate synthase / Dimethylally...    124   2e-30
ref|WP_020814566.1|  farnesyl-diphosphate synthase [ [Clostrid...    124   2e-30
ref|WP_021006303.1|  putative farnesyl-diphosphate synthase [V...    124   2e-30
ref|WP_022027072.1|  geranyltranstransferase [Dialister invisu...    124   2e-30
ref|WP_012864361.1|  farnesyl-diphosphate synthase [Veillonell...    124   2e-30
ref|WP_001561148.1|  geranyltranstransferase [Staphylococcus a...    124   2e-30
ref|XP_007033017.1|  Geranylgeranyl pyrophosphate synthase 1 [...    125   2e-30
pdb|1RTR|A  Chain A, Crystal Structure Of S. Aureus Farnesyl P...    124   2e-30
ref|WP_032515052.1|  farnesyl-diphosphate synthase [Prochloroc...    124   2e-30
ref|WP_025176419.1|  geranyl transferase [Staphylococcus aureus]     124   2e-30
ref|WP_019182617.1|  farnesyl-diphosphate synthase [Stenotroph...    124   2e-30
ref|WP_009115302.1|  geranyltranstransferase [Neisseria wadswo...    124   2e-30
ref|WP_026609907.1|  geranyl transferase [Methylocaldum szeged...    124   2e-30
ref|WP_000183379.1|  geranyltranstransferase [Staphylococcus a...    124   2e-30
ref|WP_018306758.1|  farnesyl-diphosphate synthase [Desulfitob...    124   2e-30
emb|CDR82234.1|  Geranylgeranyl pyrophosphate synthase [Lactob...    124   2e-30
ref|WP_010215888.1|  farnesyl-diphosphate synthase [Sphingomon...    124   2e-30
ref|WP_022681239.1|  farnesyl-diphosphate synthase [Sphingobiu...    124   2e-30
ref|WP_027459055.1|  geranyl transferase [Dechloromonas agitata]     124   2e-30
ref|WP_031786577.1|  geranyl transferase [Staphylococcus aureus]     124   2e-30
ref|WP_000183375.1|  geranyltranstransferase [Staphylococcus a...    124   2e-30
ref|WP_010162876.1|  farnesyl-diphosphate synthase [Sphingomon...    124   2e-30
ref|WP_011564435.1|  farnesyl-diphosphate synthase [Rubrobacte...    124   2e-30
ref|WP_007877888.1|  geranyltranstransferase [Herbaspirillum s...    124   2e-30
ref|WP_003647534.1|  geranyltranstransferase [Lactobacillus ga...    124   2e-30
ref|WP_003653411.1|  geranyltranstransferase [Lactobacillus ga...    124   2e-30
ref|WP_025823530.1|  farnesyl-diphosphate synthase [Asaia asti...    124   2e-30
ref|WP_031793219.1|  geranyl transferase [Staphylococcus aureus]     124   2e-30
ref|WP_000183374.1|  geranyltranstransferase [Staphylococcus a...    124   2e-30
ref|WP_009560303.1|  geranyltranstransferase [Lactobacillus pa...    124   2e-30
ref|WP_031913931.1|  geranyl transferase [Staphylococcus aureus]     124   2e-30
ref|WP_031873689.1|  geranyl transferase [Staphylococcus aureus]     124   2e-30
ref|WP_031911516.1|  geranyl transferase [Staphylococcus aureus]     124   2e-30
ref|WP_000183376.1|  geranyltranstransferase [Staphylococcus a...    124   2e-30
ref|WP_024603829.1|  geranyl transferase [Pseudoalteromonas ha...    124   2e-30
ref|WP_032830203.1|  geranyl transferase [Legionella pneumophila]    124   2e-30
gb|EKD22087.1|  hypothetical protein ACD_87C00167G0001 [uncult...    124   2e-30
gb|EXI76808.1|  Farnesyl diphosphate synthase [Candidatus Accu...    124   2e-30
ref|WP_012243253.1|  geranyltranstransferase [Acholeplasma lai...    123   2e-30
ref|WP_000183383.1|  geranyltranstransferase [Staphylococcus a...    124   2e-30
gb|KCW69363.1|  hypothetical protein EUGRSUZ_F02847 [Eucalyptu...    123   2e-30
ref|WP_003640352.1|  farnesyl-diphosphate synthase [Lactobacil...    124   2e-30
ref|WP_031765934.1|  geranyl transferase [Staphylococcus aureus]     124   2e-30
ref|WP_001658165.1|  geranyltranstransferase [Staphylococcus a...    124   2e-30
gb|KGG81418.1|  farnesyl-diphosphate synthase [Caloranaerobact...    124   2e-30
gb|EYL79217.1|  geranyltranstransferase [Staphylococcus aureus...    124   2e-30
ref|WP_009603179.1|  geranyltranstransferase [Vibrio sp. N384]       124   2e-30
ref|WP_025775055.1|  polyprenyl synthetase [Moorella thermoace...    124   2e-30
ref|WP_031881774.1|  geranyl transferase [Staphylococcus aureus]     124   2e-30
ref|WP_015944621.1|  farnesyl-diphosphate synthase [Desulfitob...    124   2e-30
ref|WP_031883872.1|  geranyl transferase [Staphylococcus aureus]     124   2e-30
ref|WP_015203057.1|  polyprenyl synthetase [Crinalium epipsammum]    124   2e-30
ref|WP_012030981.1|  geranyltranstransferase [Dichelobacter no...    123   2e-30
gb|KFD93749.1|  polyprenyl synthetase family protein [Vibrio c...    122   2e-30
ref|WP_027031532.1|  farnesyl-diphosphate synthase [Mesorhizob...    124   2e-30
ref|WP_006702185.1|  hypothetical protein [Facklamia ignava]         124   2e-30
ref|WP_028548772.1|  polyprenyl synthetase [Paenibacillus sp. ...    124   2e-30
ref|WP_032519097.1|  farnesyl-diphosphate synthase [Prochloroc...    124   2e-30
gb|KFA59636.1|  Octaprenyl-diphosphate synthase / Dimethylally...    123   2e-30
gb|EOR48413.1|  geranyltranstransferase [Staphylococcus aureus...    123   2e-30
gb|EGA98131.1|  geranyltranstransferase [Staphylococcus aureus...    123   2e-30
ref|WP_029848979.1|  geranyl transferase [Vibrio parahaemolyti...    123   2e-30
ref|WP_032828981.1|  geranyl transferase [Legionella pneumophila]    124   2e-30
ref|WP_028530652.1|  polyprenyl synthetase [Paenibacillus sp. ...    124   2e-30
ref|WP_011393022.1|  farnesyl-diphosphate synthase [Moorella t...    124   2e-30
ref|WP_000183373.1|  geranyltranstransferase [Staphylococcus a...    124   2e-30
ref|WP_018903117.1|  polyprenyl synthetase [Variovorax paradoxus]    124   2e-30
ref|WP_027059133.1|  farnesyl-diphosphate synthase [Mesorhizob...    124   2e-30
ref|WP_031766465.1|  geranyl transferase [Staphylococcus aureus]     124   2e-30
gb|EES97498.1|  polyprenyl synthetase [Staphylococcus aureus s...    123   2e-30
gb|AIR10277.1|  Geranyltranstransferase [Lactobacillus salivar...    123   2e-30
ref|WP_021622928.1|  geranyltranstransferase [Aneurinibacillus...    124   2e-30
ref|WP_005617324.1|  geranyltranstransferase [Actinobacillus p...    124   2e-30
ref|WP_008713907.1|  farnesyl-diphosphate synthase [Veillonell...    123   2e-30
ref|WP_001802671.1|  geranyltranstransferase [Staphylococcus a...    123   2e-30
ref|WP_031927561.1|  geranyl transferase [Staphylococcus aureus]     123   2e-30
ref|WP_002241027.1|  geranyltranstransferase [Neisseria mening...    124   2e-30
ref|WP_006280305.1|  MULTISPECIES: geranyltranstransferase [Wo...    123   2e-30
ref|WP_033075995.1|  geranyl transferase [Thalassotalea sp. ND...    124   2e-30
dbj|GAF08944.1|  octaprenyl-diphosphate synthase [Paenibacillu...    123   2e-30
gb|KGJ31727.1|  geranyl transferase [Neisseria mucosa]               124   2e-30
ref|WP_031924376.1|  geranyl transferase [Staphylococcus aureus]     123   2e-30
ref|WP_005700419.1|  geranyltranstransferase [Aggregatibacter ...    123   2e-30
ref|WP_007759583.1|  geranylgeranyl pyrophosphate synthase [Rh...    124   2e-30
ref|WP_001573196.1|  geranyltranstransferase [Staphylococcus a...    123   2e-30
gb|EOR37588.1|  geranyltranstransferase [Staphylococcus aureus...    123   2e-30
ref|WP_006912341.1|  farnesyl-diphosphate synthase [Salinispha...    123   2e-30
ref|WP_031403991.1|  polyprenyl synthetase [Thiomonas sp. FB-Cd]     124   2e-30
ref|WP_004697474.1|  farnesyl-diphosphate synthase [Veillonell...    123   2e-30
ref|WP_031811185.1|  geranyl transferase [Staphylococcus aureus]     123   2e-30
ref|WP_014532764.1|  geranyltranstransferase [Staphylococcus a...    123   2e-30
ref|WP_001655774.1|  geranyltranstransferase [Staphylococcus a...    123   2e-30
ref|WP_031903173.1|  geranyl transferase [Staphylococcus aureus]     123   2e-30
ref|WP_031292093.1|  farnesyl-diphosphate synthase [Leptolyngb...    124   2e-30
gb|KGB64527.1|  polyprenyl synthetase family protein [Pisciric...    123   2e-30
ref|WP_031587433.1|  geranyl transferase [Staphylococcus aureus]     123   2e-30
ref|WP_003783388.1|  geranyltranstransferase [Kingella denitri...    123   2e-30
ref|WP_016211128.1|  polyprenyl synthetase family protein [Pis...    123   2e-30
ref|WP_015919021.1|  geranyltranstransferase [Thermotoga neapo...    123   3e-30
ref|WP_015222066.1|  farnesyl-diphosphate synthase [Cyanobacte...    123   3e-30
ref|XP_003492871.1|  PREDICTED: 1-deoxy-D-xylulose-5-phosphate...    128   3e-30
ref|WP_001639561.1|  geranyltranstransferase [Staphylococcus a...    123   3e-30
gb|EHT18927.1|  ispA protein [Staphylococcus aureus subsp. aur...    123   3e-30
ref|WP_023372622.1|  geranyltranstransferase [Staphylococcus p...    123   3e-30
ref|WP_022355863.1|  geranylgeranyl pyrophosphate synthase [Fi...    123   3e-30
ref|WP_002827710.1|  geranyltranstransferase [Weissella parame...    123   3e-30
ref|WP_019979362.1|  hypothetical protein [Verrucomicrobia bac...    123   3e-30
gb|KDA99277.1|  geranyl transferase [Lactobacillus gasseri K7]       123   3e-30
ref|WP_022073662.1|  polyprenyl synthetase [Anaerotruncus sp. ...    123   3e-30
ref|WP_031816413.1|  geranyl transferase [Vibrio parahaemolyti...    122   3e-30
ref|WP_014918577.1|  geranyltranstransferase [Lactobacillus he...    123   3e-30
gb|ESA37550.1|  geranylgeranyl pyrophosphate synthase [Leptoly...    124   3e-30
ref|WP_006381979.1|  geranyltranstransferase [Stenotrophomonas...    123   3e-30
ref|WP_012511753.1|  farnesyl-diphosphate synthase [Stenotroph...    123   3e-30
gb|AHJ64592.1|  Dimethylallyltransferase [Granulibacter bethes...    124   3e-30
emb|CDP01617.1|  unnamed protein product [Coffea canephora]          124   3e-30
ref|WP_009575567.1|  Octaprenyl-diphosphate synthase [gamma pr...    123   3e-30
gb|EGY31904.1|  IspA protein [Aggregatibacter aphrophilus ATCC...    123   3e-30
ref|WP_002181945.1|  polyprenyl synthetase [Leptospira interro...    122   3e-30
gb|KFN09517.1|  farnesyl diphosphate synthase [Paenibacillus m...    123   3e-30
ref|WP_000981873.1|  geranyltranstransferase [Staphylococcus a...    123   3e-30
ref|WP_003650274.1|  geranyltranstransferase [Lactobacillus ga...    123   3e-30
ref|WP_023917479.1|  hypothetical protein [Streptococcus paras...    123   3e-30
ref|WP_015187539.1|  farnesyl-diphosphate synthase [Gloeocapsa...    123   3e-30
ref|WP_003649080.1|  geranyltranstransferase [Lactobacillus ga...    123   3e-30
ref|WP_003686607.1|  geranyltranstransferase [Neisseria flaves...    123   3e-30
ref|WP_025923341.1|  farnesyl-diphosphate synthase [Prochloroc...    123   3e-30
ref|WP_012676537.1|  polyprenyl synthetase [Persephonella marina]    123   3e-30
ref|WP_019532751.1|  farnesyl-diphosphate synthase [Paenibacil...    123   3e-30
ref|WP_022230386.1|  polyprenyl synthetase [Firmicutes bacteri...    123   3e-30
ref|WP_006808496.1|  geranyltranstransferase [Leptotrichia goo...    122   3e-30
ref|WP_008600930.1|  farnesyl-diphosphate synthase [Veillonell...    123   3e-30
ref|WP_023440278.1|  farnesyl-diphosphate synthase [Pediococcu...    123   3e-30
ref|WP_024958690.1|  geranyl transferase [Stenotrophomonas mal...    121   3e-30
ref|WP_006170816.1|  farnesyl-diphosphate synthase [Synechococ...    123   3e-30
ref|WP_022090371.1|  polyprenyl synthetase [Clostridium sp. CA...    123   3e-30
ref|WP_002221917.1|  geranyltranstransferase [Neisseria mening...    123   3e-30
ref|WP_000183372.1|  geranyltranstransferase [Staphylococcus a...    123   4e-30
ref|WP_014291658.1|  geranyltranstransferase [Oceanimonas sp. ...    123   4e-30
ref|WP_011825590.1|  farnesyl-diphosphate synthase [Prochloroc...    123   4e-30
ref|WP_026584287.1|  farnesyl-diphosphate synthase [Bacillus s...    123   4e-30
ref|WP_010008565.1|  farnesyl-diphosphate synthase [Leuconosto...    123   4e-30
ref|WP_021739788.1|  putative geranyltranstransferase [Eubacte...    123   4e-30
ref|WP_011630928.1|  farnesyl-diphosphate synthase [Granulibac...    123   4e-30
ref|WP_022513418.1|  putative uncharacterized protein [Dialist...    123   4e-30
ref|WP_014758784.1|  farnesyl-diphosphate synthase [Thermoanae...    123   4e-30
ref|WP_027701591.1|  farnesyl-diphosphate synthase [ [[Clostri...    123   4e-30
ref|WP_021148146.1|  Geranyltranstransferase [Veillonella parv...    123   4e-30
ref|WP_006499582.1|  farnesyl-diphosphate synthase [Lactobacil...    123   4e-30
ref|WP_006875377.1|  hypothetical protein [Anaerotruncus colih...    123   4e-30
ref|WP_010740496.1|  hypothetical protein [Enterococcus malodo...    123   4e-30
ref|WP_028118877.1|  geranyl transferase [Facklamia sourekii]        123   4e-30
ref|WP_020712160.1|  hypothetical protein [Acidobacteriaceae b...    124   4e-30
ref|WP_033067094.1|  farnesyl-diphosphate synthase [Thalassosp...    123   4e-30
ref|WP_004519176.1|  geranyltranstransferase [Neisseria subflava]    123   4e-30
ref|WP_004284471.1|  geranyltranstransferase [Neisseria weaveri]     123   4e-30
ref|WP_013478902.1|  farnesyl-diphosphate synthase [Asticcacau...    123   4e-30
ref|WP_027477021.1|  polyprenyl synthetase [Curvibacter gracilis]    123   4e-30
ref|WP_015183082.1|  geranylgeranyl pyrophosphate synthase [Mi...    123   4e-30
ref|WP_029075120.1|  geranylgeranyl pyrophosphate synthase [Ka...    123   4e-30
gb|AHJ61970.1|  Dimethylallyltransferase [Granulibacter bethes...    123   4e-30
ref|WP_010623675.1|  farnesyl-diphosphate synthase [Lactobacil...    122   4e-30
ref|WP_023163059.1|  Polyprenyl synthetase [Clostridium autoet...    122   4e-30
ref|WP_025020271.1|  geranyl transferase [Lactobacillus equi]        122   4e-30
gb|AHN26566.1|  Octaprenyl-diphosphate synthase / Dimethylally...    122   4e-30
ref|WP_005386631.1|  farnesyl-diphosphate synthase [Veillonell...    122   4e-30
ref|WP_003747772.1|  geranyltranstransferase [Neisseria mucosa]      123   4e-30
ref|WP_015199069.1|  farnesyl-diphosphate synthase [Calothrix ...    123   4e-30
ref|WP_023757442.1|  farnesyl-diphosphate synthase [Mesorhizob...    123   4e-30
ref|WP_022450909.1|  polyprenyl synthetase [Clostridium sp. CA...    122   4e-30
gb|AIQ25276.1|  polyprenyl synthetase [Paenibacillus sp. FSL H...    123   4e-30
ref|WP_011243072.1|  farnesyl-diphosphate synthase [Synechococ...    123   4e-30
ref|WP_008891280.1|  farnesyl-diphosphate synthase [Thalassosp...    122   4e-30
ref|WP_029640176.1|  farnesyl-diphosphate synthase [alpha prot...    122   4e-30
ref|WP_006626248.1|  MULTISPECIES: farnesyl-diphosphate syntha...    123   4e-30
ref|WP_031256789.1|  polyprenyl synthetase [Curvibacter lanceo...    123   4e-30
ref|WP_002833548.1|  farnesyl-diphosphate synthase [Pediococcu...    122   5e-30
ref|WP_029552720.1|  farnesyl-diphosphate synthase [Synechococ...    123   5e-30
gb|AIQ42551.1|  polyprenyl synthetase [Paenibacillus sp. FSL R...    123   5e-30
ref|WP_013237780.1|  geranylgeranyl pyrophosphate synthase [Cl...    122   5e-30
ref|WP_028451925.1|  geranyl transferase [Chitinilyticum aquat...    122   5e-30
ref|WP_018027173.1|  hypothetical protein [Oligella urethralis]      123   5e-30
ref|WP_003681130.1|  geranyltranstransferase [Neisseria flaves...    122   5e-30
gb|KGD64188.1|  geranylgeranyl pyrophosphate synthetase [Alcan...    122   5e-30
ref|WP_007090870.1|  farnesyl-diphosphate synthase [Thalassosp...    122   5e-30
ref|WP_028855082.1|  geranyl transferase [Psychrilyobacter atl...    122   5e-30
ref|WP_031852871.1|  geranyl transferase [Vibrio parahaemolyti...    122   5e-30
gb|AIQ59762.1|  polyprenyl synthetase [Paenibacillus borealis]       122   5e-30
ref|WP_015380269.1|  Polyprenyl synthetase [Lactobacillus plan...    122   5e-30
ref|WP_011101471.1|  farnesyl-diphosphate synthase [Lactobacil...    122   5e-30
ref|WP_008820539.1|  farnesyl-diphosphate synthase [Fusobacter...    122   5e-30
ref|WP_022238035.1|  polyprenyl synthetase [Clostridium sp. CA...    122   5e-30
gb|AIQ30986.1|  polyprenyl synthetase [Paenibacillus sp. FSL P...    123   5e-30
dbj|BAO82514.1|  geranylgeranyl pyrophosphate synthase [Comamo...    123   5e-30
ref|WP_002238653.1|  geranyltranstransferase [Neisseria mening...    122   5e-30
ref|WP_012195671.1|  farnesyl-diphosphate synthase [Prochloroc...    122   5e-30
ref|WP_002649512.1|  geranylgeranyl pyrophosphate synthetase [...    122   5e-30
ref|WP_022295729.1|  polyprenyl synthetase [Firmicutes bacteri...    122   5e-30
ref|WP_006365006.1|  geranyltranstransferase [Gemella sanguinis]     122   5e-30
ref|WP_027822373.1|  geranyl transferase [Lactobacillus planta...    122   5e-30
ref|WP_025458235.1|  geranyl transferase [Neisseria polysaccha...    122   5e-30
ref|WP_013787963.1|  farnesyl-diphosphate synthase [Thermoanae...    122   5e-30
ref|WP_022432184.1|  geranyltranstransferase [Eubacterium sp. ...    122   5e-30
ref|WP_017745414.1|  farnesyl-diphosphate synthase [Scytonema ...    122   5e-30
ref|WP_005379772.1|  farnesyl-diphosphate synthase [Veillonell...    122   5e-30
ref|WP_016475577.1|  hypothetical protein [Veillonella sp. HPA...    122   5e-30
gb|KEF41787.1|  farnesyl-diphosphate synthase [Cyanobium sp. C...    122   5e-30
ref|WP_027130512.1|  geranyl transferase [Gemella cuniculi]          122   6e-30
gb|ETT57488.1|  poluprenyl synthetase [Paenibacillus sp. FSL H...    123   6e-30
ref|WP_012410126.1|  farnesyl-diphosphate synthase [Nostoc pun...    122   6e-30
ref|WP_012387120.1|  geranyltranstransferase [Leptospira biflexa]    122   6e-30
ref|WP_005418069.1|  octaprenyl-diphosphate synthase [Stenotro...    122   6e-30
ref|WP_029462082.1|  polyprenyl synthetase [Comamonadaceae bac...    122   6e-30
gb|AHI12165.1|  Geranyltranstransferase [Lactobacillus helveti...    122   6e-30
ref|WP_007406116.1|  farnesyl-diphosphate synthase [Sphingomon...    122   6e-30
ref|WP_017261766.1|  hypothetical protein [Lactobacillus rossiae]    122   6e-30
gb|AIQ75636.1|  polyprenyl synthetase [Paenibacillus odorifer]       122   6e-30
ref|WP_026444623.1|  polyprenyl synthetase [Acidobacteriaceae ...    122   6e-30
ref|WP_005379085.1|  MULTISPECIES: farnesyl-diphosphate syntha...    122   6e-30
ref|WP_026744411.1|  geranyl transferase [Leucothrix mucor]          122   6e-30
ref|WP_033110307.1|  geranylgeranyl pyrophosphate synthase [Le...    122   6e-30
ref|WP_008484894.1|  geranyltranstransferase [Gallaecimonas xi...    122   6e-30
ref|WP_013727955.1|  farnesyl-diphosphate synthase [Lactobacil...    122   6e-30
ref|WP_015364978.1|  geranyltranstransferase [Staphylococcus w...    122   6e-30
ref|WP_014563377.1|  geranyltranstransferase [Lactobacillus he...    122   6e-30
ref|WP_006190383.1|  geranyltranstransferase [Staphylococcus a...    122   6e-30
ref|XP_009370114.1|  PREDICTED: geranylgeranyl pyrophosphate s...    124   6e-30
ref|XP_008381504.1|  PREDICTED: geranylgeranyl pyrophosphate s...    124   6e-30
ref|WP_027129225.1|  geranyl transferase [Fusobacterium perfoe...    122   6e-30
ref|WP_015219156.1|  farnesyl-diphosphate synthase [Cyanobacte...    123   6e-30
gb|KGD62296.1|  geranylgeranyl pyrophosphate synthetase [Alcan...    122   6e-30
ref|WP_029144144.1|  geranyl transferase [Methylotenera mobilis]     122   6e-30
ref|WP_022396021.1|  polyprenyl synthetase [Akkermansia sp. CA...    122   7e-30
ref|WP_002761642.1|  polyprenyl synthetase [Leptospira borgpet...    122   7e-30
gb|ETT59365.1|  geranylgeranyl pyrophosphate synthetase [Paeni...    122   7e-30
ref|WP_008470861.1|  geranyltranstransferase [Lactobacillus ho...    122   7e-30
ref|WP_004755419.1|  MULTISPECIES: geranylgeranyl pyrophosphat...    122   7e-30
ref|WP_023190671.1|  Geranylgeranyl diphosphate synthase [Lact...    122   7e-30
ref|WP_027279649.1|  farnesyl-diphosphate synthase [Roseomonas...    122   7e-30
ref|WP_000183371.1|  geranyltranstransferase [Staphylococcus a...    122   7e-30
ref|WP_009325719.1|  hypothetical protein [Subdoligranulum sp....    122   7e-30
ref|WP_002240234.1|  geranyltranstransferase [Neisseria mening...    122   7e-30
ref|WP_006011035.1|  geranyltranstransferase [Ehrlichia chaffe...    121   7e-30
ref|WP_017504471.1|  farnesyl-diphosphate synthase [alpha prot...    122   7e-30
ref|WP_007528454.1|  geranylgeranyl pyrophosphate synthase [Rh...    122   7e-30
ref|WP_000183382.1|  geranyltranstransferase [Staphylococcus a...    122   7e-30
ref|WP_021718310.1|  geranyltranstransferase [Phascolarctobact...    122   7e-30
ref|WP_031888919.1|  geranyl transferase [Staphylococcus aureus]     122   7e-30
ref|WP_014553081.1|  farnesyl-diphosphate synthase [Halanaerob...    122   7e-30
ref|WP_004281147.1|  polyprenyl synthetase [Leptospira borgpet...    122   7e-30
ref|WP_003139063.1|  farnesyl-diphosphate synthase [Lactococcu...    122   7e-30
ref|WP_000183381.1|  geranyltranstransferase [Staphylococcus a...    122   7e-30
ref|WP_020721398.1|  hypothetical protein [Acidobacteriaceae b...    122   7e-30
gb|EKE02234.1|  Polyprenyl synthetase [uncultured bacterium]         122   7e-30
ref|WP_007289170.1|  Polyprenyl synthetase [Thermosinus carbox...    120   7e-30
ref|WP_021889983.1|  geranyltranstransferase [Succinatimonas s...    122   8e-30
ref|WP_019624613.1|  MULTISPECIES: farnesyl-diphosphate syntha...    122   8e-30
ref|WP_004506225.1|  polyprenyl synthetase [Leptospira weilii]       122   8e-30
ref|WP_019490810.1|  farnesyl-diphosphate synthase [Calothrix ...    122   8e-30
ref|WP_022024373.1|  putative uncharacterized protein [Clostri...    122   8e-30
gb|KEQ01328.1|  Geranylgeranyl pyrophosphate synthase [Snodgra...    122   8e-30
ref|WP_016859661.1|  farnesyl-diphosphate synthase [Fischerell...    122   8e-30
ref|WP_020767756.1|  polyprenyl synthetase [Leptospira kirschn...    122   8e-30
dbj|GAK33649.1|  farnesyl diphosphate synthase [alpha proteoba...    122   8e-30
gb|KDP55263.1|  putative geranyltranstransferase [Staphylococc...    122   8e-30
ref|WP_022576467.1|  geranyltranstransferase [Helicobacter pyl...    122   8e-30
ref|WP_018865355.1|  farnesyl-diphosphate synthase [Thioalkali...    122   8e-30
ref|XP_002531191.1|  geranyl geranyl pyrophosphate synthase, p...    123   8e-30
ref|WP_019338621.1|  farnesyl-diphosphate synthase [Stenotroph...    122   9e-30
ref|WP_011275690.1|  geranyltranstransferase [Staphylococcus h...    122   9e-30
ref|WP_002463476.1|  geranyltranstransferase [Staphylococcus s...    122   9e-30
ref|WP_031595958.1|  geranyl transferase [Ferrovum myxofaciens]      122   9e-30
gb|KFX72228.1|  geranyl transferase [alpha proteobacterium qin...    117   9e-30
ref|WP_006279837.1|  geranyltranstransferase [Wolbachia endosy...    121   9e-30
ref|WP_031578786.1|  geranyl transferase [Ruminobacter sp. RM87]     122   9e-30
gb|KGJ29531.1|  geranyl transferase [Staphylococcus haemolyticus]    122   9e-30
ref|WP_031873209.1|  geranyl transferase [Staphylococcus aureus]     122   9e-30
ref|WP_026487561.1|  hypothetical protein [Caldanaerobius poly...    122   9e-30
ref|WP_023858872.1|  geranyltranstransferase [Lactobacillus equi]    122   9e-30
ref|WP_014581310.1|  geranyltranstransferase [Neisseria mening...    122   9e-30
ref|WP_000743793.1|  MULTISPECIES: geranyltranstransferase [St...    122   9e-30
gb|KGF08980.1|  farnesyl-diphosphate synthase [Clostridiales b...    122   9e-30
ref|WP_012159464.1|  farnesyl-diphosphate synthase [Alkaliphil...    122   1e-29
ref|WP_022086804.1|  putative uncharacterized protein [Rosebur...    122   1e-29
ref|WP_029605482.1|  farnesyl-diphosphate synthase [Kozakia ba...    122   1e-29
gb|EFR90887.1|  geranyltranstransferase [Listeria innocua FSL ...    119   1e-29
ref|WP_017452408.1|  MULTISPECIES: geranyltranstransferase [He...    122   1e-29
gb|AHF01026.1|  geranyltranstransferase [Thioalkalimicrobium a...    122   1e-29
ref|WP_014787013.1|  farnesyl-diphosphate synthase [Terriglobu...    122   1e-29
gb|KFC83363.1|  polyprenyl synthetase [Buttiauxella agrestis A...    122   1e-29
gb|EJE56034.1|  geranyltranstransferase [Staphylococcus aureus...    121   1e-29
ref|WP_007287345.1|  farnesyl-diphosphate synthase [[Clostridi...    122   1e-29
gb|AHX06717.1|  polyprenyl synthetase family protein [Ehrlichi...    120   1e-29
ref|WP_003689930.1|  geranyltranstransferase [Neisseria gonorr...    122   1e-29
ref|WP_002451914.1|  geranyltranstransferase [Staphylococcus w...    122   1e-29
ref|WP_031865465.1|  geranyl transferase [Staphylococcus aureus]     122   1e-29
ref|WP_003644314.1|  farnesyl-diphosphate synthase [Lactobacil...    122   1e-29
gb|KFH26746.1|  geranyl transferase [Helicobacter pylori]            122   1e-29
ref|WP_009541090.1|  Octaprenyl-diphosphate synthase [Caenispi...    122   1e-29
ref|WP_018151505.1|  hypothetical protein [Leeia oryzae]             122   1e-29
ref|WP_002753686.1|  polyprenyl synthetase [Leptospira borgpet...    122   1e-29
ref|WP_022264394.1|  polyprenyl synthetase [Clostridium sp. CA...    121   1e-29
ref|WP_010362347.1|  geranyltranstransferase [Pseudoalteromona...    122   1e-29
ref|WP_029942171.1|  farnesyl-diphosphate synthase [Sphingomon...    122   1e-29
ref|WP_000966663.1|  geranylgeranyl pyrophosphate synthase [Le...    122   1e-29
gb|EUB26616.1|  polyprenyl synthetase [Veillonella sp. ICM51a]       121   1e-29
ref|WP_021615676.1|  putative geranyltranstransferase [Aggrega...    122   1e-29
ref|WP_001970545.1|  geranylgeranyl pyrophosphate synthase [Le...    122   1e-29
ref|WP_006718086.1|  geranyltranstransferase [Aggregatibacter ...    121   1e-29
ref|WP_008229107.1|  farnesyl-diphosphate synthase [Roseobacte...    122   1e-29
ref|WP_026194046.1|  geranyl transferase [zeta proteobacterium...    121   1e-29
gb|KEK48348.1|  farnesyl diphosphate synthase [Staphylococcus ...    121   1e-29
ref|WP_002101451.1|  polyprenyl synthetase [Leptospira interro...    122   1e-29
ref|WP_000227106.1|  geranylgeranyl pyrophosphate synthase [Le...    122   1e-29
ref|WP_002465796.1|  geranyltranstransferase [Staphylococcus w...    121   1e-29
ref|WP_026731737.1|  farnesyl-diphosphate synthase [Fischerell...    122   1e-29
ref|WP_029758369.1|  geranyl transferase [Fusobacterium nuclea...    121   1e-29
ref|WP_018411771.1|  geranyltranstransferase [Methyloversatili...    121   1e-29
emb|CCP12634.1|  geranyltranstransferase [Stenotrophomonas mal...    121   1e-29
ref|WP_012127163.1|  geranyltranstransferase [Vibrio campbellii]     121   1e-29
ref|WP_002070668.1|  geranylgeranyl pyrophosphate synthase [Le...    122   1e-29
ref|XP_005708113.1|  geranylgeranyl pyrophosphate synthetase [...    122   1e-29
ref|WP_014806721.1|  geranyltranstransferase [Anaerobaculum mo...    121   1e-29
gb|KFE40897.1|  octaprenyl-diphosphate synthase [Staphylococcu...    121   1e-29
ref|XP_007216391.1|  hypothetical protein PRUPE_ppa021460mg [P...    122   1e-29
ref|WP_028388339.1|  geranyl transferase [Legionella fairfield...    121   1e-29
ref|WP_009431352.1|  polyprenyl synthetase [Peptoniphilus sp. ...    120   1e-29
emb|CDR21722.1|  putative geranyltranstransferase [Staphylococ...    121   1e-29
ref|WP_015589433.1|  Geranylgeranyl pyrophosphate synthase [Wo...    120   1e-29
ref|WP_026253507.1|  geranyl transferase [Oligella ureolytica]       121   1e-29
ref|WP_015594886.1|  polyprenyl synthetase [Bacillus sp. 1NLA3E]     121   1e-29
gb|ETT44250.1|  poluprenyl synthetase [Paenibacillus sp. FSL R...    122   1e-29
dbj|GAK46122.1|  polyprenyl synthetase [alpha proteobacterium ...    121   1e-29
ref|WP_031463991.1|  geranyl transferase [Staphylococcus warneri]    121   1e-29
ref|WP_016535169.1|  polyprenyl synthetase [Cedecea davisae]         121   1e-29
ref|WP_002070306.1|  geranylgeranyl pyrophosphate synthase [Le...    122   1e-29
ref|WP_022072520.1|  polyprenyl synthetase [Clostridium bartle...    121   1e-29
ref|WP_005213072.1|  putative geranyltranstransferase [Clostri...    121   1e-29
ref|WP_014267017.1|  farnesyl-diphosphate synthase [Granulicel...    122   1e-29
ref|WP_026335820.1|  polyprenyl synthetase [Acidobacteriaceae ...    121   1e-29
ref|WP_019616888.1|  geranyltranstransferase [Psychromonas oss...    121   1e-29
ref|WP_014940008.1|  farnesyl-diphosphate synthase [Lactobacil...    121   1e-29
ref|WP_000966665.1|  geranylgeranyl pyrophosphate synthase [Le...    122   1e-29
ref|WP_000966664.1|  geranylgeranyl pyrophosphate synthase [Le...    122   1e-29
ref|WP_018755136.1|  hypothetical protein [Paenibacillus terri...    121   1e-29
ref|WP_011130481.1|  farnesyl-diphosphate synthase [Prochloroc...    121   1e-29
ref|WP_016708071.1|  geranyltranstransferase [Pseudoalteromona...    121   1e-29
ref|WP_015262815.1|  farnesyl-diphosphate synthase [Desulfitob...    121   1e-29
ref|WP_003744458.1|  geranyltranstransferase [Neisseria mucosa]      121   1e-29
emb|CBA28811.1|  Probable geranyltranstransferase [Curvibacter...    122   2e-29
ref|WP_022077383.1|  geranylgeranyl pyrophosphate synthase [Cl...    121   2e-29
gb|AIQ97667.1|  Octaprenyl diphosphate synthase [Prochlorococc...    121   2e-29
ref|WP_007511992.1|  MULTISPECIES: farnesyl-diphosphate syntha...    121   2e-29
emb|CDR63484.1|  putative geranyltranstransferase [Staphylococ...    121   2e-29
ref|WP_031787248.1|  geranyl transferase [Staphylococcus aureus]     121   2e-29
ref|WP_019662099.1|  farnesyl-diphosphate synthase [Stenotroph...    121   2e-29
ref|WP_015447096.1|  MULTISPECIES: farnesyl-diphosphate syntha...    121   2e-29
ref|WP_029936688.1|  farnesyl-diphosphate synthase [Sphingomon...    121   2e-29
gb|AFA52568.1|  farnesyltransferase [Vaucheria litorea]              122   2e-29
ref|WP_003627594.1|  geranyltranstransferase [Lactobacillus he...    121   2e-29
ref|WP_006461985.1|  geranyltranstransferase [Herbaspirillum f...    121   2e-29
ref|WP_029969332.1|  polyprenyl synthetase [Desulfonauticus sp...    121   2e-29
ref|WP_022787329.1|  farnesyl-diphosphate synthase [Clostridia...    121   2e-29
ref|WP_017317433.1|  farnesyl-diphosphate synthase [Mastigocla...    121   2e-29
ref|WP_033161795.1|  farnesyl-diphosphate synthase [Sharpea az...    121   2e-29
ref|XP_008229240.1|  PREDICTED: geranylgeranyl pyrophosphate s...    122   2e-29
ref|WP_022036412.1|  geranyltranstransferase [Roseburia sp. CA...    121   2e-29
emb|CDR58673.1|  putative geranyltranstransferase [Staphylococ...    121   2e-29
ref|WP_009150121.1|  farnesyl-diphosphate synthase [Thiorhodov...    121   2e-29
ref|WP_014038017.1|  farnesyl-diphosphate synthase [Stenotroph...    121   2e-29
ref|WP_001087924.1|  geranyltranstransferase [Helicobacter pyl...    121   2e-29
ref|WP_027826094.1|  geranyl transferase [Lactobacillus saerim...    121   2e-29
gb|ETI92652.1|  hypothetical protein Q606_CBAC00381G0006 [Clos...    121   2e-29
ref|WP_002635187.1|  polyprenyl synthetase [Leptospira weilii]       120   2e-29
ref|WP_013833550.1|  farnesyl-diphosphate synthase [Novosphing...    121   2e-29
ref|WP_012306710.1|  farnesyl-diphosphate synthase [Synechococ...    121   2e-29
ref|WP_022564800.1|  IspA protein [Halyomorpha halys symbiont]       121   2e-29
emb|CCB81428.1|  geranyltranstransferase [Lactobacillus pentos...    121   2e-29
ref|WP_003865035.1|  hypothetical protein [ [[Eubacterium] bif...    120   2e-29
ref|WP_026023688.1|  geranyl transferase [Staphylococcus lentus]     121   2e-29
ref|WP_001064320.1|  geranyltranstransferase [Helicobacter pyl...    121   2e-29
ref|WP_012880573.1|  geranyltranstransferase [Anaplasma centrale]    121   2e-29
ref|WP_001064303.1|  geranyltranstransferase [Helicobacter pyl...    121   2e-29
ref|WP_008519694.1|  farnesyl-diphosphate synthase [alpha prot...    121   2e-29
ref|WP_024773475.1|  geranyl transferase [Helicobacter pylori]       121   2e-29
gb|KGG27959.1|  Octaprenyl diphosphate synthase [Prochlorococc...    121   2e-29
gb|EKD70761.1|  hypothetical protein ACD_46C00409G0001 [uncult...    117   2e-29
ref|WP_007010972.1|  farnesyl-diphosphate synthase [Novosphing...    121   2e-29
ref|WP_002767790.1|  polyprenyl synthetase [Leptospira borgpet...    120   2e-29
ref|WP_014238517.1|  geranyltranstransferase [Azospira oryzae]       121   2e-29
ref|WP_027166634.1|  farnesyl-diphosphate synthase [Mesorhizob...    121   2e-29
gb|AHZ85839.1|  geranyl transferase [Bdellovibrio bacteriovorus]     120   2e-29
ref|WP_032647410.1|  MULTISPECIES: geranyl transferase [Entero...    121   2e-29
ref|WP_009554625.1|  geranyltranstransferase [Lactobacillus sa...    121   2e-29
ref|WP_008308048.1|  geranylgeranyl pyrophosphate synthase [Le...    121   2e-29
ref|WP_027275962.1|  geranyl transferase [Leminorella grimontii]     121   2e-29
ref|WP_014100740.1|  farnesyl-diphosphate synthase [Candidatus...    121   2e-29
ref|WP_010576510.1|  geranylgeranyl pyrophosphate synthase [Le...    121   2e-29
ref|WP_026961089.1|  hypothetical protein [Alicyclobacillus he...    121   2e-29
ref|WP_005530648.1|  geranyltranstransferase [Vibrio campbellii]     121   2e-29
gb|EUC79469.1|  putative geranyltranstransferase [Streptococcu...    120   2e-29
ref|WP_017323615.1|  farnesyl-diphosphate synthase [cyanobacte...    121   2e-29
ref|WP_029647973.1|  geranyl transferase [Helicobacter pylori]       121   2e-29
ref|WP_009175102.1|  geranyltranstransferase [Neisseria sp. or...    121   2e-29
ref|WP_016288655.1|  geranylgeranyl diphosphate synthase, type...    121   2e-29
ref|WP_032128995.1|  geranyl transferase [Stenotrophomonas mal...    120   2e-29
ref|WP_028669230.1|  hypothetical protein [Saccharospirillum i...    120   2e-29
ref|WP_024949473.1|  geranyl transferase [Helicobacter pylori]       121   2e-29
ref|WP_006097808.1|  farnesyl-diphosphate synthase [Coleofasci...    121   2e-29
ref|WP_014069111.1|  geranyltranstransferase [Enterobacter asb...    121   2e-29
ref|WP_001087923.1|  geranyltranstransferase [Helicobacter pyl...    121   2e-29
ref|WP_003766422.1|  geranyltranstransferase [Neisseria sicca]       121   2e-29
ref|WP_010648214.1|  geranyltranstransferase [Vibrio campbellii]     120   2e-29
ref|WP_021303804.1|  geranyltranstransferase [Helicobacter pyl...    121   2e-29
ref|WP_023026472.1|  geranyltranstransferase [Streptococcus sp...    120   2e-29
ref|WP_030006210.1|  farnesyl-diphosphate synthase [Synechococ...    121   2e-29
ref|WP_031394987.1|  farnesyl-diphosphate synthase [Sphingomon...    121   2e-29
gb|KGI51579.1|  geranyl transferase [Helicobacter sanguini]          120   2e-29
ref|WP_013276097.1|  farnesyl-diphosphate synthase [Thermosedi...    120   2e-29
ref|WP_033122949.1|  geranyl transferase [Helicobacter pylori]       121   2e-29
ref|WP_019461444.1|  MULTISPECIES: farnesyl-diphosphate syntha...    121   2e-29
ref|WP_026227617.1|  farnesyl-diphosphate synthase [Hoeflea sp...    121   2e-29
ref|WP_008097755.1|  polyprenyl synthetase [Verrucomicrobiae b...    120   2e-29
ref|WP_022687869.1|  farnesyl-diphosphate synthase [Sphingomon...    121   2e-29
ref|WP_031365827.1|  geranyl transferase [Lactococcus chungang...    120   2e-29
ref|WP_017375727.1|  hypothetical protein [Piscirickettsia sal...    121   2e-29
ref|WP_031796541.1|  geranyl transferase [Staphylococcus aureus]     120   2e-29
gb|KFZ28432.1|  geranyl transferase [Idiomarina sp. MCCC 1A10513]    120   2e-29
gb|KEQ50415.1|  geranyltranstransferase [Streptococcus oralis]       120   2e-29
ref|WP_019272048.1|  geranyltranstransferase [Neisseria