ORF VM21510

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1093025574844
Annotathon code: ORF_VM21510
Sample :
  • GPS :8°24'54s; 124°14'23w
  • Tropical South Pacific: 600 miles from F. Polynesia - International
  • Open Ocean (-2m, 27.6°C, 0.1-0.8 microns)
Authors
Team : BioCell 2007
Username : Anouclo
Annotated on : 2008-03-19 18:52:37
  • CONNAN CHLOE
  • FIEVET ANOUCHKA

Synopsis

  • Taxonomy: Alphaproteobacteria (NCBI info)
    Rank: class - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 28211
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order:
    Bacteria; Proteobacteria; Alphaproteobacteria;

Genomic Sequence

>JCVI_READ_1093025574844 ORF_VM21510 genomic DNA
TCACTATTTTGTAACTAGCATCATTGTAAGCTTGTTTGAAAGTTTCTTCAAAGGTAGTGCAAGTTTTTATTTCAGCGTCTTTATAAAGACTTTCTGCAGC
AATATGTGAGTAAGCACCAAGCTCACCTTGTATAGCAATTTTTTTTTTAATCATTGGTTTTCATTATCTTTTTGATTTCCTCTAAATCTTCTTCAGTATC
TACACTTAGAGGTGATGAATTCACATAACCAACGTGTATAGACATTCCATTTTCCATTGCTCTTAATTGTTCTAATTTTCTTTCAATTTCCAGTTTTGAT
CTTTTAAGACCTACATAACGCGATAAAGCTTTATTAGTAAAGGCGTAAATTCCAATATGATGGTAAGGTTGCAGTTTTTGTATATTTTTGAGTCTTACAA
AATCTAAGGCTTTAACGTACATACCTGTTTTTAACTTTTCTTTTACCAAAACCTTAACTACATTTTCGTTCTCTAGCTCCTCATTTGAACTAATTTTACT
TGCTAAAGTGCCTATTTCACAATAGCCTTTGTTCATATAATCGACTAAATTATTTATAGTTTCTGGTAAGATATTTGGCATATCACCTTGTAAATTGACA
ATTATTTTTGGATTAGCATTTAAATTATTTTTAAAGACCTCATACACTCTATCGGTTCCAGTCTGATGT

Translation

[2 - 520/669]   indirect strand
>ORF_VM21510 Translation [2-520   indirect strand]
HQTGTDRVYEVFKNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISSNEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQ
PYHHIGIYAFTNKALSRYVGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIMKTND

[ Warning ] 5' incomplete: does not start with a Methionine

Phylogeny

Arbre réalisé à partir d'alignement multiple de Phylip par l'algorythme NJ raciné.
Arbre(s) issus de neighbor :


  18 Populations

Neighbor-Joining/UPGMA method version 3.6a2.1


 Neighbor-joining method

 Negative branch lengths allowed


  +HaemoRdKW2 [Gamma protéo bactérie]
  ! 
  !                               +---RhodoBisA5 [Rhizobiales]
  !                            +--7 
  !                         +-13  +---RhodoHaA2 [Rhizobiales]
  !                         !  !  
  !                         !  +-------Methylobac[Rhizobiales]
  !                         !  
  !                      +-16          +-MagnetoMS- [non Rhizobiales]
  !                      !  !    +-----2 
  !                      !  !  +-9     +MagnetoAMB [non Rhizobiales]
  !                      !  !  ! ! 
  !                      !  +-11 +------Parvibacul[Rhizobiales]
  !                      !     !  
  !                 +---15     +-------------Gluconobac[non Rhizobiales]
  !                 !    !  
  !                 !    !     +------Brucella  [Rhizobiales]
  !                 !    !  +-10  
  !                 !    !  !  !   +---Bartoquint[Rhizobiales]
  !                 !    !  !  +---5 
  !                 !    !  !      +---Bartobacil[Rhizobiales]
  !                 !    +-14  
  1-----------------6       !    +-----Agrobacter [Rhizobiales]
  !                 !       !  +-8 
  !                 !       +-12 +----Rhizobium [Rhizobiales]
  !                 !          !  
  !                 !          +-----Mesorhizob[Rhizobiales]
  !                 ! 
  !                 !  +--------------------Rickettsia [non Rhizobiales]
  !                 +--4 
  !                    ! +---------------Candidatus [non Rhizobiales]
  !                    +-3 
  !                      +----------------ORF_VM2151
  ! 
  +HaemopPitt [Gamma protéo bactérie]


Notre arbre d'origine:
  13 Populations

Neighbor-Joining/UPGMA method version 3.6a2.1


 Neighbor-joining method

 Negative branch lengths allowed


  +HaemopPitt [Gamma protéo bactérie]
  ! 
  !                        +------------------------------ORF_VM2151
  !                        !  
  !                        !                +--------Rhizobium          [alpha protéo bactérie]
  !                        !              +-5 
  !                        !            +-9 +---------Agrobacter        [alpha protéo bactérie]
  !                        !            ! ! 
  1------------------------2            ! +---------Mesorhizob          [alpha protéo bactérie]
  !                        !         +-10  
  !                        !         !  !      +----RhodoHaA2           [alpha protéo bactérie]
  !                        !         !  ! +----4 
  !                        !         !  ! !    +-----RhodoBisA5         [alpha protéo bactérie]
  !                        !         !  +-8 
  !                        !         !    ! +--------------Parvibacul   [alpha protéo bactérie]
  !                        +--------11    +-7 
  !                                  !      +-----------Methylobac      [alpha protéo bactérie]
  !                                  !  
  !                                  !         +------Bartoquint        [alpha protéo bactérie]
  !                                  !  +------3 
  !                                  +--6      +------Bartobacil        [alpha protéo bactérie]
  !                                     ! 
  !                                     +---------Brucella              [alpha protéo bactérie]
  ! 
  +HaemoRdKW2 [Gamma protéo bactérie]

Annotator commentaries

Nous avons réalisé un ORF finder Scient Program sur notre séquence avec le code bactérien, dans le but de déterminer les ORF codants dans le sens indirect et direct. Nous avons obtenu un seul ORF dans le sens indirect, c'est le frame N°2. En moyenne, une sequence codante pour une protéine necessite 60acides aminés, on peut donc emettre l'hypothèse que notre sequence est bien codante pour une protéine. Par contre, lors de la tradution de la séquence nous avons remarqué qu'elle ne contient pas de codon d'initiation, ce qui veut dire qu'il manque le début de la séquence.Ceci est du au fait que les sequences proviennent de prélèvements dans le pacifique sud tropical, et ne sont donc pas forcement complètes (coupures au hasard dues à la préparation des sequences d'ADN) Comme la séquence est incomplète, nous ne pouvons pas déterminer la masse moléculaire de la protéine Nous pouvons cependant rechercher les domaines protéiques contenues par notre sequence. Nous avons trouvé un domaine conservé grâce aux site INTERPRO et PFAM.C'est un domaine de CTP transferase allant du premier acide aminé à 144 de la protéine 3-deoxy-manno-octulosonate cytidylyltransferase.

Nous avons réalisé un blast contre la base de donnée nr,et également dans SWISSPROT où nous avons trouvé les mêmes résultats,ces derniers sont présentés pour les 1000 séquences ayant le plus de similarité avec la séquence d'intérêt. Ce premier blast a montré que l'ORF à étudié a une similarité importante avec la 3-deoxy-D-manno-octulosonate cytidylyltransférase présente chez Mesorhizobiun sp BNC1 car la E value est de 4*10^-29 et le score est de 130. On trouve pour la sequence la plus proche un pourcentage d'identité de 41% avec cette dernière et un pourcentage de similarité de 59%. On trouve également beaucoup de similarités avec des plantes notamment Zea mays. Le rapport taxonomique réalisé à partir du premier blast montre que les séquences les plus proche de l'ORF à étudié sont des protéines 3-deoxy-D-manno-octulosonate cytidylyltransférase des alpha protéobactéries. Ce qui confirme les résultats obtenus lors de la recherche des domaines protéiques. Nous avons donc décidé de prendre les alpha protéobactéries comme groupe de travail et les gamma protéobactéries comme groupe extérieur pour réaliser l'alignement multiple et l'arbre phylogénétique. Cet alignement multiple réalisé avec clustalW montre que la partie N terminale des différentes protéines ne sont pas conservées alors que l'on observe des domaines conservés au milieu et à la fin des séquences. Ce qui montre qu'il y a bien une homologie entre le groupe de travail et le groupe extérieur. L'arbre plylogénétique réalisé à partir de l'alignement multiple fait avec phylip nous montre que nous avons restreint le groupe de travail au rhizobiales et non aux alpha protéobactérie. De plus, l'ORF se trouve sur une branche extérieur ce qui ne nous permet pas de conclure sur son origine.Cet arbre n'est donc pas significatif. Nous avons donc refait notre alignement multiple sur clustalW en integrant des séquences provenant d'alpha protéo bactéries non rhizobiales. Cet alignement montre des domaines conservés comme pour le premier effectué. L'arbre obtenu par NJ et par parcimonie est cette fois significatif, car il nous permet de dire que notre séquence d'interêt appartient bien aux alopha protéo bactérie et qu'elle n'appartient pas au groupe des rhizobiales car elle est plus proche dans l'arbre d'une non rhizobiale. Cependant comme l'arbre nous montre des transferts horizontaux notament entre rhizobial et non rhizobial, on ne peut donc pas oculter el fait que notre séquence est peut etre une alpha protéo bactétie rhizobiale qui aurait subi un transfert horizontal avec les non rhizobiales.

Grâce à l'analyse de cette protéine sur Gene Ontology, on a pu préciser la fonction de cette protéine . En effet, nous avons trouvé que cette protéine intervient dans la voie de synthèse des lipopolysaccharides des bactéries à gram-et agit au niveau du cytoplasme. Elle catalyse la réaction CTP + 3-deoxy-D-manno-octulosonate _

diphosphate + CMP-3-deoxy-D-manno-octulosonate qui se fait dans le cytoplasme. 

Le fait qu'il y est une forte similarité avec les plantes nous permet d'emettre l'hypothèse que la voie dans laquelle intervient cette protéine est très conservées des bactéries aux plantes.

Multiple Alignement

Alignement multiple avec 21 sequences au lieu de 13 car ca ne suffisait pas pour faire choisir le 
groupe externe
CLUSTAL W (1.82) multiple sequence alignment


                            
alignement multiple sur clustalW avec 18 séquences

CLUSTAL W (1.82) multiple sequence alignment


MagnetoAMB-1gi|83313267|ref|YP      --------------MAELTPIIVIPARMQATRLPGKPLADIHGEPMIIHV
MagnetoMS-1gi|46201219|ref|ZP_      --------------MADLNPIIVIPARMHATRLPGKPLADIHGEPMIIHV
Parvibaculum                        ----MANLAQPAAKELAGHPLVVIPARMASTRLPGKPLADICGTPMIVQV
Rhizobium                           -----------MSDSNLDGVLVLIPARMASTRLPGKPLADICGLPMIVQV
Agrobacterium                       -----------MKNRDFEKAVVLIPARMASTRLPGKPLADIGGRPMIVQV
Mesorhizobium                       -----------------MTSIILIPARMASTRLPGKPLADIAGRTMIAQV
Bartoquintanagi|49473888|ref|Y      ---------------MALKPIIVIPARIGSTRLPQKALAEIAGKPMIVHV
Bartobacilliformis                  ---------------MTLKPLILIPARMGSTRLPEKVLAEISGKPMIVHV
Brucella                            -------------MLQTMKTLTLIPTRLGSTRLPNKPLADICGKPMIVHV
RhodoHaA2                           MGPFSTARARPRIPMTAPRTLVLIPARMAATRLPGKPLLDIGGVPMVVHV
RhodoBisA53                         --------------MSHPSTLVLIPARMAATRLPGKPLLDIAGLPMIVHV
Methylobacterium                    ----------------MSDPLILIPARLAATRLPSKPLADIAGEPMIVHV
Gluconobactergi|58038552|ref|Y      ---MRLTPVLGGGIRGAMHPIIVIPSRLASTRLPRKPLADIGGVPMIVRV
HaemoRdKW20                         -----------------MSFTVIIPARFASSRLPGKPLADIKGKPMIQHV
HaemopPittEE                        -----------------MSFTVIIPARFASSRLPGKPLADIAGKPMIQHV
Rickettsiagi|51473572|ref|YP_0      --------------MKNQNVAIIIPSRLNSTRLIQKPLQLIGSITLIERV
Candidatusgi|71083211|ref|YP_2      ----------------MAKTLILIPSRMSASRLPGKPLLTINNLSIISHV
ORF_VM21510                         --------------------------------------------------
                                                                                      

MagnetoAMB-1gi|83313267|ref|YP      WRRSVQAGLGPVVVACSEAEVFDAVHAHG-GQAVMTDPDHPSGSDRVWEA
MagnetoMS-1gi|46201219|ref|ZP_      WRRAVQTGLGPVVVACSETEVFDAVHAHG-GKAVMTDPNHPSGSDRVWEA
Parvibaculum                        WRRAMEAGVGRVVVAAAEKEIADAVREAG-GEAVLTDPDLPSGSDRVWQA
Rhizobium                           AMRAREAAIGRVVVAVDETRVFDAVAAAG-FEVVMTRVDHQSGSDRIFEA
Agrobacterium                       ALRAREAGAERIVVAVDDEQVFAAVQNAG-FDVMMTRGDHQSGSDRIFEA
Mesorhizobium                       VARALESGVGRVVVATDTEEVAAAARAEG-VEAVMTRADHQSGSDRIFEA
Bartoquintanagi|49473888|ref|Y      AEQAKKAAFGRTIVATDHHDIAKAVIAYG-HECIMTSSHHESGSDRIYEA
Bartobacilliformis                  AERAKEAALGPTIIATDHDAIAQAVTAYG-HEYVMTHTHHQSGSDRIYEA
Brucella                            ADRAAAAKLGRTVIATDSEEIFKVVAAHG-HEAIMTRGDHESGSDRIYEA
RhodoHaA2                           LRRALAANIGRVAVATDTPAIADAVRAHG-GEVVMTRADHPSGSDRIHEA
RhodoBisA53                         LRRAEAADVGPVAVATDTAEIAAAVEAHG-GRVVMTRADHPSGSDRVAEA
Methylobacterium                    WRRAVEAGIGPVVVATDTDAIAAAIEAQG-GLAVMTQPDHPSGSDRLAEA
Gluconobactergi|58038552|ref|Y      VRRALAAKAGPVVVAAGDPEILDVIRDIPDVRGVLTDSGLASGSDRVHAA
HaemoRdKW20                         FEKALQSGASRVIIATDNENVADVAKSFG-AEVCMTSVNHNSGTERLAEV
HaemopPittEE                        FEKALQSGASRVIIATDNENVADVAKNFG-AEVCMTSVNHNSGTERLAEV
Rickettsiagi|51473572|ref|YP_0      FKQVNKANIQHTYVATDSEEIANIIKKIG-GKVILTDSDIPTGTDRTYEA
Candidatusgi|71083211|ref|YP_2      FKRAEETNIGEVVVATEDQEILDDVEKNG-GRAVLTSNTHKTGTDRIFEA
ORF_VM21510                         ---------------------------------------HQTGTDRVYEV
                                                                             :*::*   .

MagnetoAMB-1gi|83313267|ref|YP      VRKLDPEGRFDAIVNVQGDLPTLDPQIIRAVFAPLAEPGVDVATLVTEIT
MagnetoMS-1gi|46201219|ref|ZP_      VMNVDPDGAFDAIVNVQGDLPTLEPQIIRAVFAPLAEPGVDVSTLVTEIT
Parvibaculum                        VCEVDPEGHHTVILNVQGDLPTLDPALIRTAYEALVRPGADISTLAATIT
Rhizobium                           LTKVDPEGKAKIIVNIQGDLPTIDPETVRAALRPLENEAVDIGTLTTEID
Agrobacterium                       LQKADPYGKAEYVINVQGDLPTIEAETIRASLRPMENAAVDIATLTVEIT
Mesorhizobium                       LQTIDPGATAEIVINLQGDLPTIPPEDIRAVVRPLENADTDIATLGVEIS
Bartoquintanagi|49473888|ref|Y      LNHIDPERCYNTILNVQGDLPTITPHEIISALRPLKNSLTDIATLGAKIV
Bartobacilliformis                  LTRIDPEQRYNAILNVQGDLPTVTPNALISVLQLLKNNLTDIATLGAEII
Brucella                            LAKLDPSGEIDAVVNVQGDLPTIDPDTIRRALLPLEDGPADIATLGVEIT
RhodoHaA2                           LQTLDPQRTIETVINLQGDFPTIRPEQIGAVLAPLDDPAVDIATLAAEIH
RhodoBisA53                         LGVLDPDGRIEIVVNLQGDFPTIRPDNIGAVLGPLADPAVDIATLCAEIH
Methylobacterium                    LEIVDPDGNHDVVVNVQGDLPTIDPAIIAASVTPLADPQVDIATLCAVIH
Gluconobactergi|58038552|ref|Y      LAEVDPEGRHDVVINLQGDLPLIEPSSLTAVLKPLEDPTFDIGTLAAPVT
HaemoRdKW20                         VEKLAIP-DNEIIVNIQGDEPLIPPVIVRQVADNLAKFNVNMASLAVKIH
HaemopPittEE                        VEKLAIP-DNEIIVNIQGDEPLIPPVIVRQVADNLAKFNVNMASLAVKIH
Rickettsiagi|51473572|ref|YP_0      FKLIPNNNNIHYIINVQGDIPFIEHRSILKIIEYLKNSEYDIVTPVVRVD
Candidatusgi|71083211|ref|YP_2      YEKLNIK-DIDFILNLQGDEPNINKNDIINLNNFMINSNSGIGTLAAEIK
ORF_VM21510                         FKNNLNA-NPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKIS
                                                ::*:*** * :    :      :      : :    : 

MagnetoAMB-1gi|83313267|ref|YP      NEEERTNPNVVKAVVGLRPGQ---RVGRALYFSRATVPANAG--------
MagnetoMS-1gi|46201219|ref|ZP_      VEEERTNPNVVKAVVGFESGQ---RVARALYFSRATVPANDG--------
Parvibaculum                        VEEERTNPNVVKAVASFGEG----RLARALYFTRATAPWGEG--------
Rhizobium                           NEEDKTAPHIVKIIGSPISGN----RLHALYFTRATAPYGQG--------
Agrobacterium                       DEEEKTNPNVVKVVGSPLSET----RLRALYFTRTTAPYGDG--------
Mesorhizobium                       DEEEKANPNVVKIVGVPVKTASDALRLRALYFTRATAPWGEG--------
Bartoquintanagi|49473888|ref|Y      EKDEKTDPNVVKIIGTPLSQNR----LRALYFTRATAPYGDG--------
Bartobacilliformis                  EDNEKNNPNIVKIIGTPIAQNR----LRALYFTRATAPYGNG--------
Brucella                            VEEEKTNPNVVKIVGSPLAGNRR---LRALYFTRATAPYGEG--------
RhodoHaA2                           TEEESTNPNVVKVVGSHIGTTR----LRALYFTRATAPWGDG--------
RhodoBisA53                         TEEEATNPNVVKVIGSPLSPAR----LRALYFTRATAPWGEG--------
Methylobacterium                    RPEEMDDPNVVKIIGHTVGPNR----LRALAFTRARAPWGEG--------
Gluconobactergi|58038552|ref|Y      SDAEHDASQVVKIACAFDGADV----ARALYFSRLPIPWGEG--------
HaemoRdKW20                         DAEELFNPNAVKVLTDKDGY--------VLYFSRSVIPYDRDQFMNLQDV
HaemopPittEE                        DAEELFNPNAVKVLTDKDGY--------VLYFSRSVIPYDRDQFMNLQNV
Rickettsiagi|51473572|ref|YP_0      RESIEASSNVTVAVDYMGKA---------LYFSRSLIPHGAE--------
Candidatusgi|71083211|ref|YP_2      NDKMLIDQNIVKVITETKLEKNN--FPIALNFTRDGFSRNDQ--------
ORF_VM21510                         SNEELENENVVKVLVKEKLKTG--MYVKALDFVRLKNIQKLQP-------
                                            : .                  * * *                

MagnetoAMB-1gi|83313267|ref|YP      -------PHYHHIGLYAYRRDSLERFVSLPQGVLESREKLEQLRALENGM
MagnetoMS-1gi|46201219|ref|ZP_      -------PHYHHIGLYAYRRDSLRRFVSLPQGVLERREKLEQLRALENGM
Parvibaculum                        -------PLYHHIGLYGYRREALARFVALPPSPLEVREKLEQLRALEAGM
Rhizobium                           -------PLYHHIGLYAYRRAALERFVSLGPSTLEKRESLEQLRALEAGM
Agrobacterium                       -------PLYHHIGLYTYRRAALETFVRLPPSPLELRERLEQLRALEAGM
Mesorhizobium                       -------PLFHHIGIYAYRRRALERFVALPPGTLEMRERLEQLRALEAGM
Bartoquintanagi|49473888|ref|Y      -------PLYHHIGIYAYRREALEKFVALKPSTLEQREKLEQLRALEHNM
Bartobacilliformis                  -------PLYHHIGLYAYRRKALEKFVSLKPSTLEQREKLEQLRALENNM
Brucella                            -------PLYHHIGLYAYRRSALERFVKLGPSPLEKREKLEQLRALEAGM
RhodoHaA2                           -------PRYHHIGLYAYRRAALERFVALPPSPLEQREKLEQLRALEAGM
RhodoBisA53                         -------PRYHHIGLYAYRRAALQRFIALPPSALEQREKLEQLRALEAGM
Methylobacterium                    -------PLFHHIGLYAYRRKALARFVALPQGELERREKLEQLRALEAGM
Gluconobactergi|58038552|ref|Y      -------PHWHHVGIYAWRRAALERFVTLPPSALERRESLEQLRALEAGM
HaemoRdKW20                         QKVQLSDAYLRHIGIYAYRAGFIKQYVQWAPTQLENLEKLEQLRVLYNGE
HaemopPittEE                        QKVQLADAYLRHIGIYAYRAGFIKQYVQWAPTQLENLEKLEQLRVLYNGE
Rickettsiagi|51473572|ref|YP_0      -------ELLYHLGIYGFRKNALEKFVSLKQTFLEKTERLEQLRILENGM
Candidatusgi|71083211|ref|YP_2      -------NIYHHIGIYSYKTSTLKKFVSLDQTFKEKKNRLEQLRALDNDL
ORF_VM21510                         ---------YHHIGIYAFTNKALSRYVGLKRSKLEIERKLEQLRAMENGM
                                               *:*:* :    :  ::       *  . ***** :  . 

MagnetoAMB-1gi|83313267|ref|YP      RIDCALVDTVP-LGVDTPADLERARALLKA-----
MagnetoMS-1gi|46201219|ref|ZP_      RIDCALVDTVP-LGVDTPADLERARALLKA-----
Parvibaculum                        AIEVALVDTVP-LGVDTPADLEKARAALARRSV--
Rhizobium                           RIDAEVVDTVP-LGVDTPADLEKARRILSAKSN--
Agrobacterium                       RIDAEIVRSVP-LGVDTPHDLEKARKILAGRTL--
Mesorhizobium                       RIEAEIVRSVP-LGVDTPADLERARQLLSARTESR
Bartoquintanagi|49473888|ref|Y      RIDVEIIDTIP-LGVDTQYDLERVRKILA------
Bartobacilliformis                  RIDVEIVDTAL-LGVDTHHDLEKVRKILA------
Brucella                            RIDVEIVKTVP-LGVDTQADLDRARTFCSQAGTI-
RhodoHaA2                           RIDVGIVDSVP-RGVDTPADLETARRVLAG-----
RhodoBisA53                         RIDVGIVDTVP-RGVDTAADLETARRILSSRN---
Methylobacterium                    RIDAMIVEDLP-LGVDTPADLERARTLLAIRRLN-
Gluconobactergi|58038552|ref|Y      TIGCARIDHAP-QGVDTPADLEHVRGLV-------
HaemoRdKW20                         RIHVELAKEVPAVGVDTAEDLEKVRAILAAN----
HaemopPittEE                        RIHVELAKEVPAVGVDTAEDLEKVRLILAKD----
Rickettsiagi|51473572|ref|YP_0      TIGTCLVEDVP-ISVDTEEDLKKAIKFCREN----
Candidatusgi|71083211|ref|YP_2      KINVALANFSP-IGVDTKEDYLAIKKIMEYKS---
ORF_VM21510                         SIHVGYVNSSP-LSVDTEEDLEEIKKIMKTND---
                                     *           .***  *               
on remarque qu'il y a des domaines conservés entre les différentes séquences surtout 
au niveau Cterm de la protéine et qu'il y a une homologie entre le groupe extérieur et 
le groupe de travail. 

CLUSTAL W (1.82) multiple sequence alignment

HaemoRdKW20                         -----------------MSFTVIIPARFASSRLPGKPLADIKGKPMIQHV
HaemopPittEE                        -----------------MSFTVIIPARFASSRLPGKPLADIAGKPMIQHV
Rhizobium                           -----------MSDSNLDGVLVLIPARMASTRLPGKPLADICGLPMIVQV
Agrobacterium                       -----------MKNRDFEKAVVLIPARMASTRLPGKPLADIGGRPMIVQV
Mesorhizobium                       -----------------MTSIILIPARMASTRLPGKPLADIAGRTMIAQV
RhodoHaA2                           MGPFSTARARPRIPMTAPRTLVLIPARMAATRLPGKPLLDIGGVPMVVHV
RhodoBisA53                         --------------MSHPSTLVLIPARMAATRLPGKPLLDIAGLPMIVHV
Parvibaculum                        ----MANLAQPAAKELAGHPLVVIPARMASTRLPGKPLADICGTPMIVQV
Methylobacterium                    ----------------MSDPLILIPARLAATRLPSKPLADIAGEPMIVHV
Bartoquintanagi|49473888|ref|Y      ---------------MALKPIIVIPARIGSTRLPQKALAEIAGKPMIVHV
Bartobacilliformis                  ---------------MTLKPLILIPARMGSTRLPEKVLAEISGKPMIVHV
Brucella                            -------------MLQTMKTLTLIPTRLGSTRLPNKPLADICGKPMIVHV
ORF_VM21510                         --------------------------------------------------
                                                                                      

HaemoRdKW20                         FEKALQSGASRVIIATDNENVADVAKSFGAEVCMTSVNHNSGTERLAEVV
HaemopPittEE                        FEKALQSGASRVIIATDNENVADVAKNFGAEVCMTSVNHNSGTERLAEVV
Rhizobium                           AMRAREAAIGRVVVAVDETRVFDAVAAAGFEVVMTRVDHQSGSDRIFEAL
Agrobacterium                       ALRAREAGAERIVVAVDDEQVFAAVQNAGFDVMMTRGDHQSGSDRIFEAL
Mesorhizobium                       VARALESGVGRVVVATDTEEVAAAARAEGVEAVMTRADHQSGSDRIFEAL
RhodoHaA2                           LRRALAANIGRVAVATDTPAIADAVRAHGGEVVMTRADHPSGSDRIHEAL
RhodoBisA53                         LRRAEAADVGPVAVATDTAEIAAAVEAHGGRVVMTRADHPSGSDRVAEAL
Parvibaculum                        WRRAMEAGVGRVVVAAAEKEIADAVREAGGEAVLTDPDLPSGSDRVWQAV
Methylobacterium                    WRRAVEAGIGPVVVATDTDAIAAAIEAQGGLAVMTQPDHPSGSDRLAEAL
Bartoquintanagi|49473888|ref|Y      AEQAKKAAFGRTIVATDHHDIAKAVIAYGHECIMTSSHHESGSDRIYEAL
Bartobacilliformis                  AERAKEAALGPTIIATDHDAIAQAVTAYGHEYVMTHTHHQSGSDRIYEAL
Brucella                            ADRAAAAKLGRTVIATDSEEIFKVVAAHGHEAIMTRGDHESGSDRIYEAL
ORF_VM21510                         --------------------------------------HQTGTDRVYEVF
                                                                            :*::*: :..

HaemoRdKW20                         EKLAIP-DNEIIVNIQGDEPLIPPVIVRQVADNLAKFNVNMASLAVKIHD
HaemopPittEE                        EKLAIP-DNEIIVNIQGDEPLIPPVIVRQVADNLAKFNVNMASLAVKIHD
Rhizobium                           TKVDPEGKAKIIVNIQGDLPTIDPETVRAALRPLENEAVDIGTLTTEIDN
Agrobacterium                       QKADPYGKAEYVINVQGDLPTIEAETIRASLRPMENAAVDIATLTVEITD
Mesorhizobium                       QTIDPGATAEIVINLQGDLPTIPPEDIRAVVRPLENADTDIATLGVEISD
RhodoHaA2                           QTLDPQRTIETVINLQGDFPTIRPEQIGAVLAPLDDPAVDIATLAAEIHT
RhodoBisA53                         GVLDPDGRIEIVVNLQGDFPTIRPDNIGAVLGPLADPAVDIATLCAEIHT
Parvibaculum                        CEVDPEGHHTVILNVQGDLPTLDPALIRTAYEALVRPGADISTLAATITV
Methylobacterium                    EIVDPDGNHDVVVNVQGDLPTIDPAIIAASVTPLADPQVDIATLCAVIHR
Bartoquintanagi|49473888|ref|Y      NHIDPERCYNTILNVQGDLPTITPHEIISALRPLKNSLTDIATLGAKIVE
Bartobacilliformis                  TRIDPEQRYNAILNVQGDLPTVTPNALISVLQLLKNNLTDIATLGAEIIE
Brucella                            AKLDPSGEIDAVVNVQGDLPTIDPDTIRRALLPLEDGPADIATLGVEITV
ORF_VM21510                         KNNLNA-NPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKISS
                                               ::*:*** * : .  :      :     ::.:*   *  

HaemoRdKW20                         AEELFNPNAVKVLTDKDGYV--------LYFSRSVIPYDRDQFMNLQDVQ
HaemopPittEE                        AEELFNPNAVKVLTDKDGYV--------LYFSRSVIPYDRDQFMNLQNVQ
Rhizobium                           EEDKTAPHIVKIIGSPISGN----RLHALYFTRATAPYGQG---------
Agrobacterium                       EEEKTNPNVVKVVGSPLSET----RLRALYFTRTTAPYGDG---------
Mesorhizobium                       EEEKANPNVVKIVGVPVKTASDALRLRALYFTRATAPWGEG---------
RhodoHaA2                           EEESTNPNVVKVVGSHIGTT----RLRALYFTRATAPWGDG---------
RhodoBisA53                         EEEATNPNVVKVIGSPLSPA----RLRALYFTRATAPWGEG---------
Parvibaculum                        EEERTNPNVVKAVASFGEGR----LARALYFTRATAPWGEG---------
Methylobacterium                    PEEMDDPNVVKIIGHTVGPN----RLRALAFTRARAPWGEG---------
Bartoquintanagi|49473888|ref|Y      KDEKTDPNVVKIIGTPLSQNR----LRALYFTRATAPYGDG---------
Bartobacilliformis                  DNEKNNPNIVKIIGTPIAQNR----LRALYFTRATAPYGNG---------
Brucella                            EEEKTNPNVVKIVGSPLAGNRR---LRALYFTRATAPYGEG---------
ORF_VM21510                         NEELENENVVKVLVKEKLKTG--MYVKALDFVRLKNIQKLQP--------
                                     ::    : ** :               * * *                 

HaemoRdKW20                         KVQLSDAYLRHIGIYAYRAGFIKQYVQWAPTQLENLEKLEQLRVLYNGER
HaemopPittEE                        KVQLADAYLRHIGIYAYRAGFIKQYVQWAPTQLENLEKLEQLRVLYNGER
Rhizobium                           ------PLYHHIGLYAYRRAALERFVSLGPSTLEKRESLEQLRALEAGMR
Agrobacterium                       ------PLYHHIGLYTYRRAALETFVRLPPSPLELRERLEQLRALEAGMR
Mesorhizobium                       ------PLFHHIGIYAYRRRALERFVALPPGTLEMRERLEQLRALEAGMR
RhodoHaA2                           ------PRYHHIGLYAYRRAALERFVALPPSPLEQREKLEQLRALEAGMR
RhodoBisA53                         ------PRYHHIGLYAYRRAALQRFIALPPSALEQREKLEQLRALEAGMR
Parvibaculum                        ------PLYHHIGLYGYRREALARFVALPPSPLEVREKLEQLRALEAGMA
Methylobacterium                    ------PLFHHIGLYAYRRKALARFVALPQGELERREKLEQLRALEAGMR
Bartoquintanagi|49473888|ref|Y      ------PLYHHIGIYAYRREALEKFVALKPSTLEQREKLEQLRALEHNMR
Bartobacilliformis                  ------PLYHHIGLYAYRRKALEKFVSLKPSTLEQREKLEQLRALENNMR
Brucella                            ------PLYHHIGLYAYRRSALERFVKLGPSPLEKREKLEQLRALEAGMR
ORF_VM21510                         --------YHHIGIYAFTNKALSRYVGLKRSKLEIERKLEQLRAMENGMS
                                             :***:* :    :  ::      **  . *****.:  .  

HaemoRdKW20                         IHVELAKEVPAVGVDTAEDLEKVRAILAAN----
HaemopPittEE                        IHVELAKEVPAVGVDTAEDLEKVRLILAKD----
Rhizobium                           IDAEVVDTVP-LGVDTPADLEKARRILSAKSN--
Agrobacterium                       IDAEIVRSVP-LGVDTPHDLEKARKILAGRTL--
Mesorhizobium                       IEAEIVRSVP-LGVDTPADLERARQLLSARTESR
RhodoHaA2                           IDVGIVDSVP-RGVDTPADLETARRVLAG-----
RhodoBisA53                         IDVGIVDTVP-RGVDTAADLETARRILSSRN---
Parvibaculum                        IEVALVDTVP-LGVDTPADLEKARAALARRSV--
Methylobacterium                    IDAMIVEDLP-LGVDTPADLERARTLLAIRRLN-
Bartoquintanagi|49473888|ref|Y      IDVEIIDTIP-LGVDTQYDLERVRKILA------
Bartobacilliformis                  IDVEIVDTAL-LGVDTHHDLEKVRKILA------
Brucella                            IDVEIVKTVP-LGVDTQADLDRARTFCSQAGTI-
ORF_VM21510                         IHVGYVNSSP-LSVDTEEDLEEIKKIMKTND---
                                    *..         .***  **:  :          




BLAST

ncbi/ nr/ 1000 séquences
Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
           5,633,163 sequences; 1,947,344,958 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs Taxonomy reports

Query=  Translation of ORF number 1 in reading frame 2 on the reverse strand.
Length

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|YP_676618.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...   130    4e-29 Gene info
ref|NP_949032.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   125    7e-28 Gene info
ref|YP_485387.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...   124    3e-27 Gene info
ref|YP_570661.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...   122    8e-27 Gene info
ref|YP_001242846.1|  CTP/CMP-3-deoxy-D-manno-octulosonate tran...   122    8e-27 Gene info
ref|YP_575727.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...   122    1e-26 Gene info
ref|NP_540821.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   121    1e-26 Gene info
ref|YP_765745.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   121    1e-26 Gene info
ref|YP_220819.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   121    2e-26 Gene info
ref|YP_001523053.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   121    2e-26 Gene info
ref|NP_697080.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   121    2e-26 Gene info
ref|YP_001258085.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   121    2e-26 Gene info
ref|YP_001203152.1|  CTP:CMP-3-deoxy-D-manno-octulosonate tran...   120    2e-26 Gene info
ref|YP_533585.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...   120    3e-26 Gene info
ref|YP_423531.1|  CMP-2-keto-3-deoxyoctulosonic acid synthetas...   120    3e-26 Gene info
ref|NP_384329.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   120    3e-26 Gene info
ref|YP_782678.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...   120    5e-26 Gene info
ref|ZP_01437309.1|  3-deoxy-manno-octulosonate cytidylyltransf...   120    5e-26
ref|YP_001329080.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   119    7e-26 Gene info
ref|ZP_00055493.2|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...   118    1e-25
ref|YP_467684.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   118    2e-25 Gene info
ref|NP_353135.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   117    2e-25 Gene info
ref|YP_265930.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   117    3e-25 Gene info
ref|ZP_01044510.1|  3-deoxy-manno-octulosonate cytidylyltransf...   117    3e-25
ref|YP_001411531.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   117    3e-25 Gene info
ref|ZP_01264324.1|  3-deoxy-manno-octulosonate cytidylyltransf...   116    4e-25
ref|YP_316905.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   115    9e-25 Gene info
ref|YP_033089.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   115    9e-25 Gene info
ref|YP_031930.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   115    1e-24 Gene info
ref|YP_001417529.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   115    1e-24 Gene info
ref|ZP_01227690.1|  3-deoxy-manno-octulosonate cytidylyltransf...   114    2e-24
ref|YP_989485.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...   114    2e-24 Gene info
ref|NP_106153.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   114    3e-24 Gene info
ref|YP_001368577.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   114    3e-24 Gene info
ref|NP_768062.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   111    1e-23 Gene info
gb|EDO75699.1|  3-deoxy-D-manno-octulosonate cytidylyltransfer...   111    2e-23
ref|ZP_02055986.1|  3-deoxy-D-manno-octulosonate cytidylyltran...   110    4e-23
ref|ZP_02019926.1|  3-deoxy-D-manno-octulosonate cytidylyltran...   110    4e-23
ref|YP_745814.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   109    8e-23 Gene info
ref|ZP_00050998.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...   108    1e-22
gb|EDP66484.1|  3-deoxy-manno-octulosonate cytidylyltransferas...   105    8e-22
ref|ZP_01547912.1|  3-deoxy-manno-octulosonate cytidylyltransf...   102    7e-21
ref|YP_001233783.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   102    1e-20 Gene info
pdb|1VIC|A  Chain A, Crystal Structure Of Cmp-Kdo Synthetase >...   101    2e-20 Related structures
ref|NP_438231.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   101    2e-20 GeoGene info
ref|ZP_01790947.1|  3-deoxy-manno-octulosonate cytidylyltransf...   101    2e-20
ref|YP_190516.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   101    2e-20 Gene info
ref|ZP_00154788.2|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...   101    2e-20
ref|YP_589652.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...   100    3e-20 Gene info
pdb|1VH3|A  Chain A, Crystal Structure Of Cmp-Kdo Synthetase >...   100    4e-20 Related structures
ref|ZP_01851551.1|  3-deoxy-D-manno-octulosonate cytidylyltran...   100    4e-20
ref|ZP_00204669.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...   100    5e-20
ref|YP_001290415.1|  3-deoxy-manno-octulosonate cytidylyltrans...   100    5e-20 Gene info
ref|ZP_01786422.1|  3-deoxy-manno-octulosonate cytidylyltransf...  99.4    7e-20
ref|YP_718870.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  99.4    8e-20 Gene info
ref|YP_001381481.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  99.0    9e-20 Gene info
ref|ZP_01797708.1|  hypothetical protein CGSHiR3021_11024 [Hae...  99.0    1e-19
ref|ZP_00157565.2|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  99.0    1e-19
ref|ZP_01552499.1|  3-deoxy-manno-octulosonate cytidylyltransf...  99.0    1e-19
ref|ZP_01789110.1|  3-deoxy-manno-octulosonate cytidylyltransf...  99.0    1e-19
ref|YP_001494640.1|  3-deoxy-manno-octulosonate cytidylyltrans...  98.6    1e-19 Gene info
ref|NP_872922.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  98.6    1e-19 Gene info
ref|YP_001052798.1|  3-deoxy-manno-octulosonate cytidylyltrans...  98.2    2e-19 Gene info
ref|YP_001291965.1|  3-deoxy-manno-octulosonate cytidylyltrans...  98.2    2e-19 Gene info
ref|ZP_00826914.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  97.8    2e-19
ref|YP_428245.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  97.8    2e-19 Gene info
ref|ZP_00135509.2|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  97.1    3e-19
ref|YP_001493369.1|  3-deoxy-manno-octulosonate cytidylyltrans...  96.3    7e-19 Gene info
ref|YP_001499282.1|  3-deoxy-manno-octulosonate cytidylyltrans...  96.3    7e-19 Gene info
ref|ZP_01883937.1|  3-deoxy-manno-octulosonate cytidylyltransf...  96.3    7e-19
ref|YP_246610.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  95.9    9e-19 Gene info
ref|ZP_01476022.1|  hypothetical protein VEx2w_02001386 [Vibri...  95.9    9e-19
gb|EDN73199.1|  3-deoxy-manno-octulosonate cytidylyltransferas...  95.9    9e-19
ref|ZP_00834646.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  95.5    1e-18
ref|ZP_00142038.1|  3-deoxy-manno-octulosonate cytidylyltransf...  95.1    1e-18
ref|ZP_00133756.2|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  95.1    2e-18
ref|ZP_01260428.1|  3-deoxy-manno-octulosonate cytidylyltransf...  94.7    2e-18
ref|YP_538158.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  94.7    2e-18 Gene info
ref|NP_360161.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  94.7    2e-18 Gene info
ref|YP_965718.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  94.7    2e-18 Gene info
ref|YP_692777.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  94.4    2e-18 Gene info
ref|YP_001492423.1|  3-deoxy-manno-octulosonate cytidylyltrans...  94.4    3e-18 Gene info
ref|YP_001155067.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  94.0    3e-18 Gene info
ref|YP_467376.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  94.0    3e-18 Gene info
ref|YP_454678.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  93.6    4e-18 Gene info
ref|YP_001301920.1|  3-deoxy-manno-octulosonate cytidylyltrans...  93.6    4e-18 Gene info
ref|ZP_01594272.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  93.6    4e-18
ref|NP_220762.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  93.6    4e-18 Gene info
ref|ZP_01042329.1|  3-deoxy-manno-octulosonate cytidylyltransf...  93.6    4e-18
ref|NP_935146.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  93.2    6e-18 Gene info
ref|YP_012325.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  92.8    8e-18 Gene info
ref|ZP_01987907.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  92.0    1e-17
ref|YP_001444735.1|  3-deoxy-manno-octulosonate cytidylyltrans...  91.3    2e-17 Gene info
ref|YP_155897.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  91.3    2e-17 Gene info
ref|ZP_01618423.1|  3-deoxy-manno-octulosonate cytidylyltransf...  91.3    2e-17
ref|ZP_01215100.1|  3-deoxy-manno-octulosonate cytidylyltransf...  91.3    2e-17
ref|ZP_01717482.1|  3-deoxy-manno-octulosonate cytidylyltransf...  91.3    2e-17
ref|YP_286406.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  91.3    2e-17 Gene info
ref|ZP_01075931.1|  3-deoxy-manno-octulosonate cytidylyltransf...  90.9    3e-17
ref|NP_797363.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  90.9    3e-17 Gene info
ref|ZP_01110540.1|  3-deoxy-manno-octulosonate cytidylyltransf...  90.9    3e-17
ref|NP_928922.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  90.9    3e-17 Gene info
ref|YP_001477951.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  90.9    3e-17 Gene info
ref|NP_760949.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  90.5    4e-17 Gene info
ref|ZP_01485856.1|  hypothetical protein VchoV5_02001524 [Vibr...  90.5    4e-17
ref|NP_231509.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  90.1    4e-17 Gene info
ref|ZP_01258157.1|  3-deoxy-manno-octulosonate cytidylyltransf...  90.1    5e-17
ref|YP_857280.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  90.1    5e-17 Gene info
ref|ZP_01959087.1|  hypothetical protein BACCAC_00683 [Bactero...  90.1    5e-17
ref|YP_001005844.1|  putative 3-deoxy-manno-octulosonate cytid...  89.7    6e-17 Gene info
ref|NP_245795.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  89.4    7e-17 Gene info
ref|ZP_01853368.1|  3-deoxy-manno-octulosonate cytidylyltransf...  89.4    8e-17
ref|ZP_01916342.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  89.4    8e-17
ref|ZP_01235323.1|  3-deoxy-manno-octulosonate cytidylyltransf...  89.4    9e-17
ref|ZP_01076606.1|  3-deoxy-manno-octulosonate cytidylyltransf...  89.4    9e-17
ref|NP_903014.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  89.0    1e-16 Gene info
ref|YP_679435.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  89.0    1e-16 Gene info
ref|ZP_00822345.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  89.0    1e-16
ref|YP_203561.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  89.0    1e-16 Gene info
ref|ZP_01925499.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  89.0    1e-16
ref|YP_827427.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  89.0    1e-16 Gene info
ref|ZP_01983471.1|  3-deoxy-manno-octulosonate cytidylyltransf...  88.6    1e-16
ref|YP_595364.1|  CMP-2-keto-3-deoxyoctulosonic acid synthetas...  88.6    1e-16 Gene info
ref|ZP_02033960.1|  hypothetical protein PARMER_04001 [Parabac...  88.6    1e-16
gb|EDO11980.1|  hypothetical protein BACOVA_02480 [Bacteroides...  88.6    1e-16
ref|YP_127221.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  88.6    2e-16 Gene info
ref|ZP_00830396.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  88.6    2e-16
ref|ZP_01977877.1|  3-deoxy-manno-octulosonate cytidylyltransf...  88.2    2e-16
ref|YP_095936.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  88.2    2e-16 Gene info
ref|ZP_01784878.1|  3-deoxy-manno-octulosonate cytidylyltransf...  88.2    2e-16
ref|NP_881372.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  88.2    2e-16 Gene info
ref|YP_001345013.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  88.2    2e-16 Gene info
ref|NP_884789.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  88.2    2e-16 Gene info
ref|ZP_01256661.1|  3-deoxy-manno-octulosonate cytidylyltransf...  87.8    2e-16
ref|NP_809658.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  87.8    2e-16 Gene info
ref|YP_277886.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  87.8    3e-16 Gene info
gb|EDP59058.1|  3-deoxy-manno-octulosonate cytidylyltransferas...  87.4    3e-16
ref|YP_001334611.1|  3-deoxy-manno-octulosonate cytidylyltrans...  87.4    3e-16 Gene info
ref|ZP_01876474.1|  3-deoxy-manno-octulosonate cytidylyltransf...  87.4    3e-16
ref|YP_001141390.1|  3-deoxy-manno-octulosonate cytidylyltrans...  87.4    3e-16 Gene info
ref|YP_001516521.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  87.4    3e-16 Gene info
ref|ZP_00710548.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  87.0    4e-16
ref|ZP_01165839.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  87.0    4e-16
ref|NP_905914.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  87.0    4e-16 Gene info
ref|YP_124211.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  87.0    4e-16 Gene info
ref|YP_001438508.1|  hypothetical protein ESA_02426 [Enterobac...  87.0    4e-16 Gene info
ref|YP_001250673.1|  3-deoxy-manno-octulosonate cytidylyltrans...  86.7    5e-16 Gene info
ref|ZP_01162194.1|  putative 3-deoxy-manno-octulosonate cytidy...  86.7    5e-16
ref|ZP_01876253.1|  3-deoxy-manno-octulosonate cytidylyltransf...  86.7    5e-16
ref|YP_959009.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  86.7    5e-16 Gene info
emb|CAJ49712.1|  3-deoxy-manno-octulosonate cytidylyltransfera...  86.7    6e-16
ref|NP_706836.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  86.7    6e-16 Gene info
ref|ZP_00716399.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  86.7    6e-16
ref|YP_309894.1|  CTP:CMP-3-deoxy-D-manno-octulosonate transfe...  86.3    6e-16 Gene info
ref|YP_403908.1|  CTP:CMP-3-deoxy-D-manno-octulosonate transfe...  86.3    6e-16 Gene info
ref|NP_286793.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  86.3    6e-16 Gene info
ref|NP_888551.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  86.3    7e-16 Gene info
ref|YP_844149.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  86.3    7e-16 Gene info
ref|ZP_00718760.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  86.3    7e-16
ref|NP_415438.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  86.3    8e-16 Gene info
ref|YP_206385.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  85.9    8e-16 Gene info
ref|YP_901286.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  85.9    8e-16 Gene info
ref|ZP_00922654.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  85.9    9e-16
ref|YP_799012.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  85.9    1e-15 Gene info
ref|NP_404993.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  85.9    1e-15 Gene info
emb|CAE11288.1|  Cap29eG protein [Neisseria meningitidis]          85.9    1e-15
ref|ZP_01418030.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  85.5    1e-15
ref|ZP_01221111.1|  3-deoxy-manno-octulosonate cytidylyltransf...  85.5    1e-15
ref|YP_607270.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  85.5    1e-15 Gene info
ref|YP_050645.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  85.5    1e-15 Gene info
ref|ZP_01094168.1|  3-deoxy-manno-octulosonate cytidylyltransf...  85.5    1e-15
ref|ZP_01691791.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  85.5    1e-15
ref|ZP_01134818.1|  CTP:CMP-3-deoxy-D-manno-octulosonate trans...  85.5    1e-15
ref|ZP_01017409.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  85.5    1e-15
ref|YP_130569.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  85.5    1e-15 Gene info
ref|NP_421728.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  85.5    1e-15 Gene info
ref|YP_001129928.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  85.1    1e-15 Gene info
ref|NP_520653.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  85.1    2e-15 Gene info
ref|NP_859699.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  84.7    2e-15 Gene info
pdb|1VH1|A  Chain A, Crystal Structure Of Cmp-Kdo Synthetase >...  84.7    2e-15 Related structures
ref|ZP_00416273.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  84.3    2e-15
ref|YP_088127.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  84.3    2e-15 Gene info
ref|NP_952945.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  84.3    2e-15 Gene info
ref|YP_001453712.1|  hypothetical protein CKO_02152 [Citrobact...  84.0    3e-15 Gene info
ref|ZP_01810652.1|  3-deoxy-manno-octulosonate cytidylyltransf...  84.0    3e-15
ref|NP_752984.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  84.0    3e-15 Gene info
ref|ZP_00724882.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  84.0    3e-15
ref|YP_151038.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  84.0    3e-15 Gene info
ref|NP_459963.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  84.0    3e-15 Gene info
ref|YP_340174.1|  CTP:CMP-3-deoxy-D-manno-octulosonate transfe...  83.6    4e-15 Gene info
ref|YP_661358.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  83.6    4e-15 Gene info
ref|ZP_01223759.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  83.6    4e-15
ref|YP_927515.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  83.6    5e-15 Gene info
ref|YP_852049.1|  KdsB [Escherichia coli APEC O1] >gb|ABJ00335...  83.6    5e-15 Gene info
ref|YP_001173126.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  83.6    5e-15 Gene info
ref|YP_433917.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  83.6    5e-15 Gene info
ref|NP_455474.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  83.6    5e-15 Gene info
ref|ZP_01065252.1|  3-deoxy-manno-octulosonate cytidylyltransf...  83.2    5e-15
ref|YP_357357.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  83.2    5e-15 Gene info
ref|YP_268854.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  83.2    5e-15 Gene info
gb|EDO53454.1|  hypothetical protein BACUNI_02732 [Bacteroides...  83.2    5e-15
ref|YP_067329.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  83.2    5e-15 Gene info
ref|ZP_01070401.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  83.2    5e-15
ref|YP_001482340.1|  3-deoxy-manno-octulosonate cytidylyltrans...  83.2    5e-15 Gene info
ref|ZP_01667693.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  83.2    5e-15
ref|YP_258900.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  83.2    6e-15 Gene info
ref|ZP_00946919.1|  3-deoxy-manno-octulosonate cytidylyltransf...  83.2    6e-15
ref|NP_878667.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  83.2    6e-15 Gene info
ref|ZP_00950767.1|  ethanolamine utilization protein-like prot...  82.8    7e-15
ref|YP_234722.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  82.8    8e-15 Gene info
ref|YP_273873.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  82.4    9e-15 Gene info
ref|ZP_01462487.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  82.4    1e-14
ref|NP_281974.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  82.4    1e-14 Gene info
ref|YP_974716.1|  putative 3-deoxy-manno-octulosonate cytidyly...  82.4    1e-14 Gene info
ref|YP_046963.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  82.0    1e-14 Gene info
ref|ZP_01816765.1|  3-deoxy-manno-octulosonate cytidylyltransf...  82.0    1e-14
ref|ZP_00366952.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  82.0    1e-14
ref|NP_273717.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  82.0    1e-14 Gene info
ref|NP_793615.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  82.0    1e-14 Gene info
ref|ZP_01449534.1|  3-deoxy-manno-octulosonate cytidylyltransf...  82.0    1e-14
ref|YP_178906.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  82.0    1e-14 Gene info
ref|ZP_01311477.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  81.6    1e-14
ref|YP_763823.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  81.6    2e-14 Gene info
ref|YP_001398266.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  81.6    2e-14 Gene info
ref|ZP_01092929.1|  3-deoxy-manno-octulosonate cytidylyltransf...  81.6    2e-14
ref|YP_349901.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  81.3    2e-14 Gene info
ref|ZP_01774143.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  81.3    2e-14
ref|ZP_01983779.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  81.3    2e-14
ref|ZP_01735244.1|  3-deoxy-manno-octulosonate cytidylyltransf...  81.3    2e-14
gb|AAA80194.1|  CMP-2-keto-3-deoxyoctulosonic acid synthetase      81.3    2e-14
ref|YP_001187112.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  81.3    2e-14 Gene info
ref|YP_001339992.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  80.9    2e-14 Gene info
ref|NP_283666.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  80.9    2e-14 Gene info
ref|YP_384236.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  80.9    3e-14 Gene info
ref|YP_898329.1|  3-deoxy-D-manno-octulosonate cytidyltransfer...  80.9    3e-14 Gene info
ref|YP_001354267.1|  3-deoxy-manno-octulosonate cytidylyltrans...  80.9    3e-14 Gene info
ref|YP_001269217.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  80.9    3e-14 Gene info
ref|YP_527530.1|  Chorismate synthase [Saccharophagus degradan...  80.9    3e-14 Gene info
sp|Q9PKL1|KDSB_CHLMU  3-deoxy-manno-octulosonate cytidylyltran...  80.9    3e-14
ref|NP_296831.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  80.9    3e-14 Gene info
ref|ZP_02006815.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  80.5    3e-14
gb|AAX77783.1|  unknown protein [synthetic construct]              80.5    3e-14
ref|YP_001358977.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  80.5    3e-14 Gene info
ref|YP_001300576.1|  3-deoxy-manno-octulosonate cytidylyltrans...  80.5    4e-14 Gene info
gb|EDO66641.1|  hypothetical protein FTAG_01438 [Francisella t...  80.5    4e-14
ref|YP_563139.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  80.5    4e-14 Gene info
ref|YP_170414.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  80.1    4e-14 Gene info
ref|YP_514054.1|  3-deoxy-D-manno-octulosonate cytidyltransfer...  80.1    4e-14 Gene info
ref|ZP_01660341.1|  3-deoxy-manno-octulosonate cytidylyltransf...  80.1    4e-14
ref|YP_963273.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  80.1    4e-14 Gene info
ref|YP_344816.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  80.1    5e-14 Gene info
ref|NP_870651.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  80.1    5e-14 Gene info
ref|YP_001176168.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  80.1    5e-14 Gene info
ref|YP_667546.1|  3-deoxy-D-manno-octulosonate cytidyltransfer...  80.1    5e-14 Gene info
ref|YP_001183647.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  80.1    5e-14 Gene info
ref|ZP_01870352.1|  3-deoxy-manno-octulosonate cytidylyltransf...  80.1    5e-14
ref|NP_219686.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  79.7    6e-14 Gene info
ref|ZP_01895799.1|  3-deoxy-manno-octulosonate cytidylyltransf...  79.7    6e-14
ref|YP_001467119.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  79.7    6e-14 Gene info
ref|YP_001021677.1|  3-deoxy-manno-octulosonate cytidylyltrans...  79.7    6e-14 Gene info
emb|CAM76131.1|  Acylneuraminate cytidylyltransferase [Magneto...  79.7    6e-14
ref|ZP_01713853.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  79.7    7e-14
ref|ZP_00725058.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  79.3    8e-14
ref|ZP_01640110.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  79.3    8e-14
ref|ZP_00968528.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  79.3    8e-14
ref|YP_790194.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  79.3    8e-14 Gene info
ref|YP_932976.1|  probable 3-deoxy-manno-octulosonate cytidyly...  79.3    9e-14 Gene info
ref|YP_670907.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  79.3    9e-14 Gene info
ref|NP_713753.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  79.3    9e-14 Gene info
ref|YP_904029.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  79.3    9e-14 Gene info
sp|P42216|KPSU5_ECOLI  3-deoxy-manno-octulosonate cytidylyltra...  79.0    1e-13
pdb|1H6J|A  Chain A, The Three-Dimensional Structure Of Capsul...  79.0    1e-13 Related structures
ref|NP_251669.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  79.0    1e-13 Gene info
ref|ZP_01499360.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  79.0    1e-13
emb|CAB89846.1|  CMP-KDO synthetase [Zea mays]                     79.0    1e-13 UniGene infoGene info
ref|YP_001084586.1|  3-deoxy-manno-octulosonate cytidylyltrans...  79.0    1e-13 Gene info
ref|YP_207410.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  79.0    1e-13 Gene info
ref|YP_542343.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  79.0    1e-13 Gene info
ref|YP_001219597.1|  3-deoxy-manno-octulosonate cytidylyltrans...  79.0    1e-13 Gene info
ref|YP_463211.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  78.6    1e-13 Gene info
ref|YP_001231725.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  78.6    1e-13 Gene info
ref|ZP_01329806.1|  hypothetical protein BpseS_03002136 [Burkh...  78.6    1e-13
ref|YP_001002821.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  78.6    1e-13 Gene info
ref|ZP_01541767.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  78.6    1e-13
ref|YP_733982.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  78.6    1e-13 Gene info
ref|YP_001050737.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  78.6    1e-13 Gene info
ref|YP_001366564.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  78.6    1e-13 Gene info
ref|ZP_00926232.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  78.6    2e-13
ref|ZP_00143436.1|  3-deoxy-manno-octulosonate cytidylyltransf...  78.6    2e-13
ref|YP_441296.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  78.6    2e-13 Gene info
ref|YP_524397.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  78.2    2e-13 Gene info
ref|ZP_02002010.1|  Acylneuraminate cytidylyltransferase [Begg...  78.2    2e-13
gb|ABC88657.1|  KpsU [Escherichia coli]                            78.2    2e-13
ref|YP_001474161.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  78.2    2e-13 Gene info
ref|ZP_01301239.1|  hypothetical protein Rgryl_01000565 [Ricke...  78.2    2e-13
ref|YP_546195.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  78.2    2e-13 Gene info
ref|ZP_01254358.1|  3-deoxy-manno-octulosonate cytidylyltransf...  78.2    2e-13
ref|ZP_01388864.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  78.2    2e-13
ref|YP_332493.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  77.8    2e-13 Gene info
ref|YP_107501.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  77.8    2e-13 Gene info
ref|YP_103838.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  77.8    2e-13 Gene info
ref|ZP_01738219.1|  3-deoxy-manno-octulosonate cytidylyltransf...  77.8    3e-13
ref|YP_113150.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  77.4    3e-13 Gene info
ref|YP_001347554.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  77.4    3e-13 Gene info
ref|YP_549763.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  77.4    3e-13 Gene info
gb|EDK89271.1|  3-deoxy-manno-octulosonate cytidylyltransferas...  77.4    3e-13
ref|NP_718065.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  77.4    3e-13 Gene info
ref|YP_001406579.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  77.0    4e-13 Gene info
gb|EAZ35266.1|  hypothetical protein OsJ_018749 [Oryza sativa ...  77.0    4e-13
ref|YP_986545.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  77.0    4e-13 Gene info
ref|NP_001056314.1|  Os05g0561500 [Oryza sativa (japonica cult...  77.0    4e-13 UniGene infoGene info
ref|ZP_01511061.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  77.0    4e-13
ref|YP_629360.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  77.0    4e-13 Gene info
ref|YP_393241.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  77.0    4e-13 Gene info
ref|ZP_01061526.1|  3-deoxy-manno-octulosonate cytidylyltransf...  77.0    4e-13
ref|YP_001490198.1|  3-deoxy-manno-octulosonate cytidylyltrans...  77.0    5e-13 Gene info
emb|CAO43705.1|  unnamed protein product [Vitis vinifera] >emb...  77.0    5e-13
ref|ZP_01898724.1|  3-deoxy-manno-octulosonate cytidylyltransf...  76.6    5e-13
ref|YP_001280288.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  76.6    5e-13 Gene info
ref|YP_390135.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  76.6    6e-13 Gene info
ref|ZP_01475320.1|  hypothetical protein VEx2w_02002051 [Vibri...  76.6    6e-13
ref|YP_725120.1|  3-Deoxy-manno-octulosonate cytidylyltransfer...  76.6    6e-13 Gene info
ref|NP_744057.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  76.3    6e-13 Gene info
ref|YP_001269120.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  76.3    6e-13 Gene info
ref|ZP_01308575.1|  3-deoxy-manno-octulosonate cytidylyltransf...  76.3    6e-13
ref|YP_001408050.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  76.3    7e-13 Gene info
ref|ZP_01102813.1|  3-deoxy-manno-octulosonate cytidylyltransf...  76.3    7e-13
ref|YP_001093981.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  76.3    7e-13 Gene info
emb|CAN72248.1|  hypothetical protein [Vitis vinifera]             75.9    8e-13
ref|YP_001209224.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  75.9    9e-13 Gene info
ref|NP_224444.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  75.9    9e-13 Gene info
ref|YP_582688.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  75.9    9e-13 Gene info
ref|ZP_00993330.1|  3-deoxy-manno-octulosonate cytidylyltransf...  75.9    9e-13
gb|EAY99013.1|  hypothetical protein OsI_020246 [Oryza sativa ...  75.9    9e-13
ref|YP_560222.1|  3-deoxy-D-manno-octulosonatecytidylyltransfe...  75.9    1e-12 Gene info
ref|YP_001528855.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  75.9    1e-12 Gene info
ref|ZP_00370040.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  75.9    1e-12
ref|ZP_00588167.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  75.5    1e-12
ref|NP_755564.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  75.1    2e-12 Gene info
ref|YP_580329.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  74.7    2e-12 Gene info
ref|ZP_01120753.1|  3-deoxy-manno-octulosonate cytidylyltransf...  74.7    2e-12
ref|NP_908026.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  74.7    2e-12 Gene info
ref|YP_007824.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  74.7    2e-12 Gene info
emb|CAB89847.1|  CMP-KDO synthetase [Zea mays]                     74.7    2e-12
ref|ZP_00987303.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  74.7    2e-12
ref|YP_982152.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  74.7    2e-12 Gene info
ref|NP_819514.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  74.7    2e-12 Gene info
ref|ZP_01451303.1|  3-deoxy-manno-octulosonate cytidylyltransf...  74.3    3e-12
ref|ZP_01627837.1|  3-deoxy-manno-octulosonate cytidylyltransf...  74.3    3e-12
ref|ZP_01106328.1|  3-deoxy-manno-octulosonate cytidylyltransf...  73.9    3e-12
ref|YP_522507.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  73.9    3e-12 Gene info
ref|YP_001295888.1|  3-deoxy-manno-octulosonate cytidylyltrans...  73.9    3e-12 Gene info
ref|YP_587862.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  73.9    3e-12 Gene info
ref|ZP_00511935.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  73.9    4e-12
ref|YP_294817.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  73.9    4e-12 Gene info
ref|YP_001120467.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  73.9    4e-12 Gene info
ref|ZP_01309671.1|  hypothetical protein CburR_01001288 [Coxiella  73.6    4e-12
ref|YP_172520.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  73.6    4e-12 Gene info
ref|ZP_01560002.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  73.6    4e-12
ref|ZP_01947082.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  73.6    4e-12
ref|YP_999600.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  73.6    4e-12 Gene info
ref|ZP_01126065.1|  3-deoxy-manno-octulosonate cytidylyltransf...  73.2    6e-12
emb|CAO39265.1|  unnamed protein product [Vitis vinifera]          73.2    6e-12
emb|CAN62581.1|  hypothetical protein [Vitis vinifera]             72.8    7e-12
ref|ZP_01554969.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  72.8    7e-12
ref|YP_370116.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  72.8    7e-12 Gene info
ref|YP_001100737.1|  CTP:CMP-3-deoxy-D-manno-octulosonate tran...  72.8    8e-12 Gene info
ref|NP_603704.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  72.4    1e-11 Gene info
ref|ZP_01521211.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  72.4    1e-11
ref|YP_970909.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  72.0    1e-11 Gene info
ref|ZP_01890888.1|  3-deoxy-manno-octulosonate cytidylyltransf...  72.0    1e-11
ref|ZP_01114393.1|  3-deoxy-manno-octulosonate cytidylyltransf...  72.0    1e-11
ref|ZP_01569844.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  72.0    1e-11
ref|ZP_00530852.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  72.0    1e-11
ref|YP_621811.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  72.0    1e-11 Gene info
ref|YP_626974.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  71.6    2e-11 Gene info
ref|NP_967763.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  71.6    2e-11 Gene info
ref|YP_159908.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  71.6    2e-11 Gene info
ref|YP_515325.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  71.2    2e-11 Gene info
ref|ZP_01642734.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  71.2    2e-11
ref|YP_942344.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  71.2    2e-11 Gene info
ref|YP_892244.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  71.2    2e-11 Gene info
ref|YP_912515.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  71.2    2e-11 Gene info
ref|YP_750447.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  71.2    2e-11 Gene info
emb|CAJ72637.1|  strongly similar to 3-deoxy-manno-octulosonat...  71.2    2e-11
ref|YP_315263.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  71.2    2e-11 Gene info
ref|ZP_01437376.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  70.9    3e-11
ref|YP_774485.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  70.9    3e-11 Gene info
ref|YP_264598.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  70.9    3e-11 Gene info
ref|NP_829460.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  70.5    3e-11 Gene info
ref|YP_219970.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  70.5    4e-11 Gene info
ref|ZP_00683553.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  70.5    4e-11
ref|NP_779535.2|  3-deoxy-manno-octulosonate cytidylyltransfer...  70.1    5e-11 Gene info
gb|AAO29184.1|  3-deoxy-manno-octulosonate cytidylyltransferas...  70.1    5e-11 Gene info
ref|ZP_00652359.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  70.1    5e-11
ref|ZP_01052336.1|  3-deoxy-manno-octulosonate cytidylyltransf...  70.1    5e-11
ref|YP_742272.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  70.1    6e-11 Gene info
ref|ZP_01581868.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  69.7    6e-11
ref|YP_664148.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  69.7    7e-11 Gene info
ref|ZP_02011619.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  69.3    9e-11
ref|ZP_01189425.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  68.9    1e-10
gb|EDP70035.1|  3-deoxy-manno-octulosonate cytidylyltransferas...  68.9    1e-10
gb|ABP49101.1|  putative CMP-2-keto-3-deoxyoctulosonic acid sy...  68.9    1e-10
ref|NP_207028.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  68.6    1e-10 Gene info
ref|NP_222936.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  68.6    1e-10 Gene info
ref|ZP_00590933.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  68.6    1e-10
ref|NP_175708.2|  cytidylyltransferase family [Arabidopsis tha...  68.6    2e-10 UniGene infoGene info
ref|ZP_01614810.1|  CTP:CMP-3-deoxy-D-manno-octulosonate trans...  68.6    2e-10
ref|YP_755594.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  68.6    2e-10 Gene info
ref|YP_374270.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  68.6    2e-10 Gene info
ref|ZP_01118271.1|  3-deoxy-manno-octulosonate cytidylyltransf...  68.2    2e-10
ref|NP_213474.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  68.2    2e-10 Gene info
ref|NP_299578.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  67.8    2e-10 Gene info
ref|YP_573641.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  67.8    2e-10 Gene info
ref|ZP_01507448.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  67.8    3e-10
ref|YP_001356460.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  67.8    3e-10 Gene info
ref|YP_200934.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  67.4    3e-10 Gene info
ref|NP_642410.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  67.4    3e-10 Gene info
ref|ZP_00953339.1|  3-deoxy-manno-octulosonate cytidylyltransf...  67.4    3e-10
ref|YP_001226543.1|  3-deoxy-manno-octulosonate cytidylyltrans...  67.4    4e-10 Gene info
ref|YP_378636.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  67.0    4e-10 Gene info
ref|YP_861860.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  67.0    4e-10 Gene info
ref|YP_866024.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  67.0    5e-10 Gene info
ref|ZP_00368261.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  66.6    5e-10
dbj|BAC10585.1|  3-deoxy-manno-octulosonate cytidyltransferase...  66.6    6e-10
gb|EAY56823.1|  CMP-2-keto-3-deoxyoctulosonic acid synthetase ...  66.6    6e-10
ref|ZP_01203049.1|  3-deoxy-manno-octulosonate cytidylyltransf...  66.2    7e-10
ref|YP_363987.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  66.2    7e-10 Gene info
ref|ZP_02061153.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  66.2    8e-10
ref|ZP_01084828.1|  3-deoxy-manno-octulosonate cytidylyltransf...  66.2    8e-10
ref|NP_662709.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  65.9    9e-10 Gene info
ref|YP_001223956.1|  3-deoxy-manno-octulosonate cytidylyltrans...  65.9    1e-09 Gene info
gb|AAM41403.1|  3-deoxy-manno-octulosonate cytidylyltransferas...  65.5    1e-09 Gene info
ref|NP_637479.2|  3-deoxy-manno-octulosonate cytidylyltransfer...  65.5    1e-09 Gene info
ref|ZP_01468866.1|  3-deoxy-manno-octulosonate cytidylyltransf...  65.5    1e-09
ref|NP_862007.1|  rb132 [Ruegeria sp. PR1b] >gb|AAN05153.1| RB...  65.5    1e-09 Gene info
ref|YP_391229.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  65.5    1e-09 Gene info
ref|YP_065950.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  65.1    2e-09 Gene info
ref|ZP_01049060.1|  3-deoxy-manno-octulosonate cytidylyltransf...  64.7    2e-09
ref|ZP_01291546.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  64.7    2e-09
ref|ZP_01123616.1|  3-deoxy-manno-octulosonate cytidylyltransf...  64.7    2e-09
ref|YP_001501842.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  64.3    2e-09 Gene info
ref|ZP_01289485.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  64.3    3e-09
ref|YP_380511.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  63.5    5e-09 Gene info
ref|YP_376227.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  63.2    6e-09 Gene info
ref|NP_896279.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  63.2    6e-09 Gene info
ref|YP_001196831.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  63.2    7e-09 Gene info
ref|ZP_01290476.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  62.8    8e-09
ref|YP_778062.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  62.8    8e-09 Gene info
ref|YP_001303972.1|  putative deoxyoctulonosic acid synthetase...  62.8    9e-09 Gene info
ref|YP_001018549.1|  putative 3-deoxy-manno-octulosonate cytid...  62.4    1e-08 Gene info
ref|NP_895740.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  62.4    1e-08 Gene info
ref|YP_563668.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  62.4    1e-08 Gene info
ref|ZP_01871576.1|  3-deoxy-manno-octulosonate cytidylyltransf...  62.0    1e-08
ref|YP_761586.1|  putative 3-deoxy-D-manno-octulosonate cytidy...  61.2    2e-08 Gene info
ref|ZP_01447401.1|  3-deoxy-manno-octulosonate cytidylyltransf...  60.8    3e-08
ref|ZP_01556142.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  60.8    3e-08
ref|YP_392403.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  60.5    4e-08 Gene info
ref|ZP_01471728.1|  3-deoxy-manno-octulosonate cytidylyltransf...  60.1    5e-08
ref|YP_002092.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  59.7    7e-08 Gene info
ref|YP_797632.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  58.9    1e-07 Gene info
ref|NP_711806.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  58.5    1e-07 Gene info
ref|ZP_01385231.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  58.5    2e-07
ref|ZP_01041362.1|  3-deoxy-manno-octulosonate cytidylyltransf...  58.2    2e-07
ref|NP_841718.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  58.2    2e-07 Gene info
ref|ZP_01004982.1|  3-deoxy-manno-octulosonate cytidylyltransf...  57.4    3e-07
ref|YP_099504.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  57.4    3e-07 Gene info
ref|YP_001130197.1|  3-deoxy-manno-octulosonate cytidylyltrans...  56.2    7e-07 Gene info
ref|NP_871254.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  56.2    7e-07 Gene info
ref|ZP_00371145.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  56.2    8e-07
ref|YP_746677.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  56.2    8e-07 Gene info
ref|ZP_00999541.1|  3-deoxy-manno-octulosonate cytidylyltransf...  55.8    9e-07
ref|YP_009565.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  55.8    9e-07 Gene info
ref|YP_363734.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  55.8    1e-06 Gene info
ref|ZP_01885924.1|  3-deoxy-manno-octulosonate cytidylyltransf...  55.1    2e-06
gb|EDP74455.1|  3-deoxy-manno-octulosonate cytidylyltransferas...  55.1    2e-06
ref|YP_390175.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  54.3    3e-06 Gene info
ref|ZP_01011644.1|  3-deoxy-manno-octulosonate cytidylyltransf...  53.9    3e-06
ref|ZP_01079010.1|  putative 3-deoxy-manno-octulosonate cytidy...  53.9    3e-06
gb|AAP35723.1|  unknown [Pseudomonas aeruginosa]                   53.9    4e-06
gb|AAK15335.1|AF332547_12  unknown [Pseudomonas aeruginosa] >g...  53.9    4e-06
ref|ZP_00976563.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  53.9    4e-06
ref|YP_163224.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  53.5    4e-06 Gene info
ref|YP_001301261.1|  putative CMP-KDO synthetase [Bacteroides ...  53.1    6e-06 Gene info
ref|ZP_01052746.1|  3-deoxy-manno-octulosonate cytidylyltransf...  52.8    7e-06
ref|ZP_01287684.1|  3-deoxy-manno-octulosonate cytidylyltransf...  52.4    1e-05
ref|YP_680781.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  52.4    1e-05 Gene info
ref|ZP_01291953.1|  3-deoxy-manno-octulosonate cytidylyltransf...  51.6    2e-05
ref|YP_496562.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  50.8    3e-05 Gene info
ref|ZP_01740488.1|  3-deoxy-manno-octulosonate cytidylyltransf...  50.1    6e-05
ref|ZP_01304764.1|  3-deoxy-manno-octulosonate cytidylyltransf...  49.7    6e-05
ref|ZP_01901480.1|  3-deoxy-manno-octulosonate cytidylyltransf...  49.7    6e-05
ref|ZP_01471764.1|  3-deoxy-manno-octulosonate cytidylyltransf...  49.3    8e-05
ref|ZP_00630990.1|  3-deoxy-manno-octulosonate cytidylyltransf...  49.3    9e-05 Gene info
ref|ZP_01750216.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  48.5    1e-04
ref|YP_612009.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  48.5    2e-04 Gene info
ref|YP_367078.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  47.8    2e-04 Gene info
gb|AAL06487.1|AF411798_1  F14G24.28/F14G24.28 [Arabidopsis tha...  47.8    3e-04 UniGene info
ref|ZP_01754139.1|  3-deoxy-manno-octulosonate cytidylyltransf...  47.8    3e-04
ref|YP_411130.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  47.4    3e-04 Gene info
ref|ZP_00207826.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  46.6    5e-04
ref|ZP_01055400.1|  3-deoxy-manno-octulosonate cytidylyltransf...  46.6    7e-04
ref|ZP_01154890.1|  3-deoxy-manno-octulosonate cytidylyltransf...  44.7    0.002
ref|YP_508158.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  44.7    0.002 Gene info
ref|YP_165311.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  43.9    0.004 Gene info
ref|YP_001534909.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  43.5    0.005 Gene info
ref|ZP_00954385.1|  3-deoxy-manno-octulosonate cytidylyltransf...  43.1    0.007
ref|ZP_00948929.1|  3-deoxy-manno-octulosonate cytidylyltransf...  43.1    0.007
ref|ZP_01881222.1|  3-deoxy-manno-octulosonate cytidylyltransf...  41.6    0.021
ref|ZP_01257523.1|  3-deoxy-manno-octulosonate cytidylyltransf...  41.2    0.023
ref|ZP_01036908.1|  3-deoxy-manno-octulosonate cytidylyltransf...  41.2    0.027
ref|ZP_00959567.1|  3-deoxy-manno-octulosonate cytidylyltransf...  40.8    0.032
ref|YP_419496.1|  CMP-2-keto-3-deoxyoctulosonic acid synthetas...  40.8    0.035 Gene info
ref|ZP_01002225.1|  3-deoxy-manno-octulosonate cytidylyltransf...  40.4    0.038
ref|YP_001264447.1|  3-deoxy-manno-octulosonate cytidylyltrans...  40.0    0.056 Gene info
ref|YP_001091627.1|  CMP-2-keto-3-deoxyoctulosonic acid synthe...  39.7    0.082 Gene info
ref|ZP_02036000.1|  hypothetical protein BACCAP_01597 [Bactero...  39.3    0.094
emb|CAM76620.1|  Acylneuraminate cytidylyltransferase [Magneto...  38.5    0.14 
gb|ABE01208.1|  IP14842p [Drosophila melanogaster]                 37.0    0.43  UniGene info
gb|EDO60805.1|  hypothetical protein CLOLEP_02410 [Clostridium le  36.2    0.79 
gb|AAF88146.1|AF174134_1  Mud protein [Drosophila melanogaster]    36.2    0.86 
ref|NP_727769.2|  mushroom body defect CG12047-PB, isoform B [...  36.2    0.87  UniGene infoGene info
ref|YP_001390979.1|  sensory box sigma-54 dependent transcript...  36.2    0.88  Gene info
gb|ABF00987.1|  mushroom body defect protein [Drosophila melanoga  36.2    0.90 
ref|NP_727770.1|  mushroom body defect CG12047-PA, isoform A [...  35.8    0.93  UniGene infoGene info
ref|YP_001254144.1|  signal-transduction and transcriptional-c...  35.8    0.95  Gene info
ref|YP_001010992.1|  UDP-N-acetylglucosamine pyrophosphorylase...  35.8    1.2   Gene info
ref|NP_536743.2|  mushroom body defect CG12047-PC, isoform C [...  35.0    1.8   UniGene infoGene info
gb|AAO59305.1|  kinesin [Gibberella moniliformis]                  35.0    2.0  
ref|ZP_01056429.1|  methyl-accepting chemotaxis protein [Roseo...  33.9    3.5  
gb|AAF89163.2|AF209068_1  Mud protein [Drosophila melanogaster]    33.9    3.9   UniGene info
ref|XP_001456021.1|  hypothetical protein [Paramecium tetraure...  33.5    5.5   Gene info
ref|ZP_01223330.1|  N-acetylglucosamine-1-phosphate uridyltran...  33.5    5.7  
gb|ABN08640.1|  hypothetical protein MtrDRAFT_AC157891g13v2 [M...  33.1    6.3  
ref|NP_347702.1|  TPR-repeat containing protein [Clostridium a...  33.1    6.8   Gene info
ref|NP_470683.1|  hypothetical protein lin1347 [Listeria innoc...  33.1    7.4   Gene info
ref|ZP_00056579.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  32.7    8.6  

>ref|YP_676618.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Mesorhizobium 
sp. BNC1]
 gb|ABG65453.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Mesorhizobium 
sp. BNC1]
Length=251

 Score =  130 bits (326),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 73/174 (41%), Positives = 103/174 (59%), Gaps = 6/174 (3%)

Query  1    HQTGTDRVYEVFKN-NLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKI  59
            HQ+G+DR++E  +  +  A  +I++NLQGD+P I PE I  +V  +     +I TL  +I
Sbjct  72   HQSGSDRIFEALQTIDPGATAEIVINLQGDLPTIPPEDIRAVVRPLENADTDIATLGVEI  131

Query  60   SSNEELENENVVKVLVKEKLKTG---MYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKAL  115
            S  EE  N NVVK+ V   +KT    + ++AL F R        P +HHIGIYA+  +AL
Sbjct  132  SDEEEKANPNVVKI-VGVPVKTASDALRLRALYFTRATAPWGEGPLFHHIGIYAYRRRAL  190

Query  116  SRYVGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  169
             R+V L    LE+  +LEQLRA+E GM I    V S PL VDT  DLE  ++++
Sbjct  191  ERFVALPPGTLEMRERLEQLRALEAGMRIEAEIVRSVPLGVDTPADLERARQLL  244


>ref|NP_949032.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase [Rhodopseudomonas 
palustris CGA009]
 emb|CAE29135.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase [Rhodopseudomonas 
palustris CGA009]
Length=245

 Score =  125 bits (315),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 73/176 (41%), Positives = 104/176 (59%), Gaps = 14/176 (7%)

Query  1    HQTGTDRVYEVFKNNLNANPKI--IVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASK  58
            H +G+DR++E  +  L+ + KI  ++NLQGD P I PE I  +++ +     +I TLA++
Sbjct  75   HPSGSDRIFEALQT-LDPDRKIETVINLQGDFPTIRPEQIGAVLEPLADPAVDIATLAAE  133

Query  59   ISSNEELENENVVKV----LVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNK  113
            I + EE  N NVVKV    L  ++L+      AL F R        P YHHIG+Y +   
Sbjct  134  IHTEEEATNPNVVKVIGSPLAADRLR------ALYFTRATAPWGDGPRYHHIGLYGYRRA  187

Query  114  ALSRYVGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  169
            AL R+V L  S LE+  KLEQLRA+E GM I VG V++ P  VDT  DLE  ++++
Sbjct  188  ALERFVALPPSPLELREKLEQLRALEAGMRIDVGIVDTVPRGVDTPADLETARRVL  243


>ref|YP_485387.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Rhodopseudomonas 
palustris HaA2]
 gb|ABD06476.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Rhodopseudomonas 
palustris HaA2]
Length=259

 Score =  124 bits (310),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 71/171 (41%), Positives = 100/171 (58%), Gaps = 4/171 (2%)

Query  1    HQTGTDRVYEVFKN-NLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKI  59
            H +G+DR++E  +  +     + ++NLQGD P I PE I  ++  ++    +I TLA++I
Sbjct  89   HPSGSDRIHEALQTLDPQRTIETVINLQGDFPTIRPEQIGAVLAPLDDPAVDIATLAAEI  148

Query  60   SSNEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRY  118
             + EE  N NVVKV+      T +  +AL F R        P YHHIG+YA+   AL R+
Sbjct  149  HTEEESTNPNVVKVVGSHIGTTRL--RALYFTRATAPWGDGPRYHHIGLYAYRRAALERF  206

Query  119  VGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  169
            V L  S LE   KLEQLRA+E GM I VG V+S P  VDT  DLE  ++++
Sbjct  207  VALPPSPLEQREKLEQLRALEAGMRIDVGIVDSVPRGVDTPADLETARRVL  257


>ref|YP_570661.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Rhodopseudomonas 
palustris BisB5]
 gb|ABE40760.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Rhodopseudomonas 
palustris BisB5]
Length=245

 Score =  122 bits (306),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 73/172 (42%), Positives = 102/172 (59%), Gaps = 6/172 (3%)

Query  1    HQTGTDRVYEVFKNNLNANPKI--IVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASK  58
            H +G+DR++E  +  L+   +I  ++NLQGD P I PE I  ++  +     +I TLA++
Sbjct  75   HPSGSDRIHEALQT-LDPERRIETVINLQGDFPTIRPEQIGAVLAPLADPAVDIATLAAE  133

Query  59   ISSNEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSR  117
            I + EE  N NVVKV V   ++  + ++AL F R        P YHHIG+YA+   AL R
Sbjct  134  IHTEEESTNPNVVKV-VGSPIRDNL-LRALYFTRATAPYGDGPRYHHIGLYAYRRAALER  191

Query  118  YVGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  169
            +V L  S LE   KLEQLRA+E GM I VG V+S P  VDT  DLE  ++ +
Sbjct  192  FVSLPPSPLEQREKLEQLRALEAGMRIDVGIVDSVPRGVDTPADLETARRAL  243


>ref|YP_001242846.1| Gene info CTP/CMP-3-deoxy-D-manno-octulosonate transferase [Bradyrhizobium 
sp. BTAi1]
 gb|ABQ38940.1| Gene info CTP/CMP-3-deoxy-D-manno-octulosonate transferase [Bradyrhizobium 
sp. BTAi1]
Length=246

 Score =  122 bits (306),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 70/174 (40%), Positives = 105/174 (60%), Gaps = 10/174 (5%)

Query  1    HQTGTDRVYEVF-KNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKI  59
            H +G+DR+YE   K +     +I+VNLQGD P ILP+ I +++  ++    +I TLA++I
Sbjct  75   HPSGSDRIYEASCKLDPAGEAEIVVNLQGDFPTILPQNIRDVLLPLSDPAVDIATLAAQI  134

Query  60   SSNEELENENVVKVL---VKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKAL  115
             + EE    +VVK +   + E+      ++AL F R        P YHHIG+YA+   AL
Sbjct  135  HTAEEDAAPSVVKAVGSPIGER-----RLRALYFTRATAPHGDGPRYHHIGLYAYRRAAL  189

Query  116  SRYVGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  169
             R+V L  S LE++ KLEQLRA+E GM I +G V++ P  VDT  DLE  ++++
Sbjct  190  ERFVSLPPSPLELQEKLEQLRALEAGMRIDIGIVDTVPRGVDTPPDLETARRLL  243


>ref|YP_575727.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Nitrobacter 
hamburgensis X14]
 gb|ABE61267.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Nitrobacter 
hamburgensis X14]
Length=258

 Score =  122 bits (305),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 71/174 (40%), Positives = 103/174 (59%), Gaps = 6/174 (3%)

Query  1    HQTGTDRVYEVFKNNLNANPKI--IVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASK  58
            H +G+DRV+E   + L+ + +I  I+NLQGD P I P+ I +++  +     +I TLA++
Sbjct  75   HPSGSDRVFEAL-DRLDPDGRIETIINLQGDFPTIRPDIIRDVLKPLADPAVDIATLAAE  133

Query  59   ISSNEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSR  117
            I S+EE  N NVVK +        +  +AL F R        P YHHIG+YA+  KAL R
Sbjct  134  IHSDEEATNPNVVKAVGSPVAPRRL--RALYFTRATAPHGDGPRYHHIGLYAYRRKALQR  191

Query  118  YVGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIMKT  171
            +V L  S LE + +LEQLRA+E GM I +  V+  P  VDT  DLE  ++I+ +
Sbjct  192  FVELPPSPLERQERLEQLRALEGGMRIDIMIVDDVPRGVDTAADLETARRILAS  245


>ref|NP_540821.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase [Brucella melitensis 
16M]
 gb|AAL53085.1| Gene info 3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE [Brucella melitensis 
16M]
Length=295

 Score =  121 bits (304),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 71/168 (42%), Positives = 97/168 (57%), Gaps = 3/168 (1%)

Query  1    HQTGTDRVYEVF-KNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKI  59
            H++G+DR+YE   K + +     +VN+QGD+P I P+TI   +  +  G  +I TL  +I
Sbjct  120  HESGSDRIYEALAKLDPSGEIDAVVNVQGDLPTIDPDTIRRALLPLEDGPADIATLGVEI  179

Query  60   SSNEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRY  118
            +  EE  N NVVK+ V   L     ++AL F R        P YHHIG+YA+   AL R+
Sbjct  180  TVEEEKTNPNVVKI-VGSPLAGNRRLRALYFTRATAPYGEGPLYHHIGLYAYRRSALERF  238

Query  119  VGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIK  166
            V L  S LE   KLEQLRA+E GM I V  V + PL VDT+ DL+  +
Sbjct  239  VKLGPSPLEKREKLEQLRALEAGMRIDVEIVKTVPLGVDTQADLDRAR  286


>ref|YP_765745.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) 
(CMP-2-keto-3-deoxyoctulosonic acid synthetase) (CKS). 
[Rhizobium leguminosarum bv. viciae 3841]
 emb|CAK05629.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) 
(CMP-2-keto-3-deoxyoctulosonic acid synthetase) (CKS).; 
putative 3-deoxy-manno-octulosonate cytidylyltransferase 
(CMP-KDO synthetase) (CMP-2-keto-3-deoxyoctulosonic acid synthetase) 
[Rhizobium leguminosarum bv. viciae 3841]
Length=251

 Score =  121 bits (304),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 69/171 (40%), Positives = 100/171 (58%), Gaps = 4/171 (2%)

Query  1    HQTGTDRVYEVF-KNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKI  59
            HQ+G+DR++E   K +     KIIVN+QGD+P I PET+   +  +     +IGTL ++I
Sbjct  78   HQSGSDRIFEALTKVDPEGKAKIIVNIQGDLPTIDPETVRAALRPLENEAVDIGTLTTEI  137

Query  60   SSNEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRY  118
             + E+    ++VK++      +G  + AL F R        P YHHIG+YA+   AL R+
Sbjct  138  DNEEDKTAPHIVKIIGSPI--SGNRLHALYFTRATAPYGQGPLYHHIGLYAYRRAALERF  195

Query  119  VGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  169
            V L  S LE    LEQLRA+E GM I    V++ PL VDT  DLE+ ++I+
Sbjct  196  VSLGPSTLEKRESLEQLRALEAGMRIDAEVVDTVPLGVDTPADLEKARRIL  246


>ref|YP_220819.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase [Brucella abortus 
biovar 1 str. 9-941]
 ref|YP_413538.1| Gene info Acylneuraminate cytidylyltransferase:3-deoxy-D-manno-octulosonate 
cytidylyltransferase [Brucella melitensis biovar Abortus 
2308]
 gb|AAX73458.1| Gene info KdsB, 3-deoxy-manno-octulosonate cytidylyltransferase [Brucella 
abortus biovar 1 str. 9-941]
 emb|CAJ09991.1| Gene info Acylneuraminate cytidylyltransferase:3-deoxy-D-manno-octulosonate 
cytidylyltransferase [Brucella melitensis biovar Abortus 
2308]
Length=251

 Score =  121 bits (303),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 71/168 (42%), Positives = 97/168 (57%), Gaps = 3/168 (1%)

Query  1    HQTGTDRVYEVF-KNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKI  59
            H++G+DR+YE   K + +     +VN+QGD+P I P+TI   +  +  G  +I TL  +I
Sbjct  76   HESGSDRIYEALAKLDPSGEIDAVVNVQGDLPTIDPDTIRRALLPLEDGPADIATLGVEI  135

Query  60   SSNEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRY  118
            +  EE  N NVVK+ V   L     ++AL F R        P YHHIG+YA+   AL R+
Sbjct  136  TVEEEKTNPNVVKI-VGSPLAGNRRLRALYFTRATAPYGEGPLYHHIGLYAYRRSALERF  194

Query  119  VGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIK  166
            V L  S LE   KLEQLRA+E GM I V  V + PL VDT+ DL+  +
Sbjct  195  VKLGPSPLEKREKLEQLRALEAGMRIDVEIVKTVPLGVDTQADLDRAR  242


>ref|YP_001523053.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Azorhizobium 
caulinodans ORS 571]
 dbj|BAF86135.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Azorhizobium 
caulinodans ORS 571]
Length=293

 Score =  121 bits (303),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 70/178 (39%), Positives = 103/178 (57%), Gaps = 10/178 (5%)

Query  1    HQTGTDRVYEVFKN-NLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKI  59
            H +G+DR++E     + +   +++VN+QGD+P I PETI   +  + +G  +I TL + I
Sbjct  120  HPSGSDRIFEALGVLDPDGAVQVVVNVQGDLPTIAPETIRAALVPLEEGPADIATLTAVI  179

Query  60   SSNEELENENVVKVL---VKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKAL  115
            +   E  + NVVKV+   + E       ++AL F R        P YHHIG+YA+   AL
Sbjct  180  TEEGERTDPNVVKVVGTPIGEN-----RLRALYFTRATAPTGEGPLYHHIGLYAYRRAAL  234

Query  116  SRYVGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIMKTND  173
             R+V L  S LE   +LEQLRA+E GM I V  V++ PL VDT E LE  + ++ +ND
Sbjct  235  ERFVSLPPSPLEKRERLEQLRALEAGMRIDVAVVDAVPLGVDTPEHLERARALLASND  292


>ref|NP_697080.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase [Brucella suis 
1330]
 gb|AAN28995.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase [Brucella suis 
1330]
Length=251

 Score =  121 bits (303),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 71/168 (42%), Positives = 97/168 (57%), Gaps = 3/168 (1%)

Query  1    HQTGTDRVYEVF-KNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKI  59
            H++G+DR+YE   K + +     +VN+QGD+P I P+TI   +  +  G  +I TL  +I
Sbjct  76   HESGSDRIYEALAKLDPSGEIDAVVNVQGDLPTIDPDTIRRALLPLEDGPADIATLGVEI  135

Query  60   SSNEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRY  118
            +  EE  N NVVK+ V   L     ++AL F R        P YHHIG+YA+   AL R+
Sbjct  136  TVEEEKTNPNVVKI-VGSPLAGNRRLRALYFTRATAPYGEGPLYHHIGLYAYRRSALERF  194

Query  119  VGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIK  166
            V L  S LE   KLEQLRA+E GM I V  V + PL VDT+ DL+  +
Sbjct  195  VKLGPSPLEKREKLEQLRALEAGMRIDVEIVKTVPLGVDTQADLDRAR  242


>ref|YP_001258085.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Brucella ovis 
ATCC 25840]
 gb|ABQ60463.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Brucella ovis 
ATCC 25840]
Length=306

 Score =  121 bits (303),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 71/168 (42%), Positives = 97/168 (57%), Gaps = 3/168 (1%)

Query  1    HQTGTDRVYEVF-KNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKI  59
            H++G+DR+YE   K + +     +VN+QGD+P I P+TI   +  +  G  +I TL  +I
Sbjct  131  HESGSDRIYEALAKLDPSGEVDAVVNVQGDLPTIDPDTIRRALLPLEDGPADIATLGVEI  190

Query  60   SSNEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRY  118
            +  EE  N NVVK+ V   L     ++AL F R        P YHHIG+YA+   AL R+
Sbjct  191  TVEEEKTNPNVVKI-VGSPLAGNRRLRALYFTRATAPYGEGPLYHHIGLYAYRRSALERF  249

Query  119  VGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIK  166
            V L  S LE   KLEQLRA+E GM I V  V + PL VDT+ DL+  +
Sbjct  250  VKLGPSPLEKREKLEQLRALEAGMRIDVEIVKTVPLGVDTQADLDRAR  297















ncbi/ nr/ 100 séquences

Job Title: ORF_VM21510 Traduction [2-520 sens indirect]
BLASTP 2.2.17 (Aug-26-2007)

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference:
Schäffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei 
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and 
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST 
protein database searches with composition-based statistics 
and other refinements", Nucleic Acids Res. 29:2994-3005.

RID: K0EVK7JU016


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
           5,613,418 sequences; 1,941,346,813 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs Taxonomy reports

Query=  ORF_VM21510 Traduction [2-520 sens indirect]
Length=173



                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|YP_676618.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...   130    4e-29 Gene info
ref|NP_949032.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   125    7e-28 Gene info
ref|YP_485387.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...   124    3e-27 Gene info
ref|YP_570661.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...   122    8e-27 Gene info
ref|YP_001242846.1|  CTP/CMP-3-deoxy-D-manno-octulosonate tran...   122    8e-27 Gene info
ref|YP_575727.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...   122    1e-26 Gene info
ref|NP_540821.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   121    1e-26 Gene info
ref|YP_765745.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   121    1e-26 Gene info
ref|YP_220819.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   121    2e-26 Gene info
ref|YP_001523053.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   121    2e-26 Gene info
ref|NP_697080.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   121    2e-26 Gene info
ref|YP_001258085.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   121    2e-26 Gene info
ref|YP_001203152.1|  CTP:CMP-3-deoxy-D-manno-octulosonate tran...   120    2e-26 Gene info
ref|YP_533585.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...   120    3e-26 Gene info
ref|YP_423531.1|  CMP-2-keto-3-deoxyoctulosonic acid synthetas...   120    3e-26 Gene info
ref|NP_384329.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   120    3e-26 Gene info
ref|YP_782678.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...   120    5e-26 Gene info
ref|ZP_01437309.1|  3-deoxy-manno-octulosonate cytidylyltransf...   120    5e-26
ref|YP_001329080.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   119    7e-26 Gene info
ref|ZP_00055493.2|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...   118    1e-25
ref|YP_467684.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   118    2e-25 Gene info
ref|NP_353135.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   117    2e-25 Gene info
ref|YP_265930.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   117    3e-25 Gene info
ref|ZP_01044510.1|  3-deoxy-manno-octulosonate cytidylyltransf...   117    3e-25
ref|YP_001411531.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   117    3e-25 Gene info
ref|ZP_01264324.1|  3-deoxy-manno-octulosonate cytidylyltransf...   116    4e-25
ref|YP_316905.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   115    9e-25 Gene info
ref|YP_033089.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   115    9e-25 Gene info
ref|YP_031930.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   115    1e-24 Gene info
ref|YP_001417529.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   115    1e-24 Gene info
ref|ZP_01227690.1|  3-deoxy-manno-octulosonate cytidylyltransf...   114    2e-24
ref|YP_989485.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...   114    2e-24 Gene info
ref|NP_106153.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   114    3e-24 Gene info
ref|YP_001368577.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   114    3e-24 Gene info
ref|NP_768062.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   111    1e-23 Gene info
gb|EDO75699.1|  3-deoxy-D-manno-octulosonate cytidylyltransfer...   111    2e-23
ref|ZP_02055986.1|  3-deoxy-D-manno-octulosonate cytidylyltran...   110    4e-23
ref|ZP_02019926.1|  3-deoxy-D-manno-octulosonate cytidylyltran...   110    4e-23
ref|YP_745814.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   109    8e-23 Gene info
ref|ZP_00050998.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...   108    1e-22
ref|ZP_01547912.1|  3-deoxy-manno-octulosonate cytidylyltransf...   102    7e-21
ref|YP_001233783.1|  3-deoxy-D-manno-octulosonate cytidylyltra...   102    1e-20 Gene info
pdb|1VIC|A  Chain A, Crystal Structure Of Cmp-Kdo Synthetase >...   101    2e-20 Related structures
ref|NP_438231.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   101    2e-20 GeoGene info
ref|ZP_01790947.1|  3-deoxy-manno-octulosonate cytidylyltransf...   101    2e-20
ref|YP_190516.1|  3-deoxy-manno-octulosonate cytidylyltransfer...   101    2e-20 Gene info
ref|ZP_00154788.2|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...   101    2e-20
ref|YP_589652.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...   100    3e-20 Gene info
pdb|1VH3|A  Chain A, Crystal Structure Of Cmp-Kdo Synthetase >...   100    4e-20 Related structures
ref|ZP_01851551.1|  3-deoxy-D-manno-octulosonate cytidylyltran...   100    4e-20
ref|ZP_00204669.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...   100    5e-20
ref|YP_001290415.1|  3-deoxy-manno-octulosonate cytidylyltrans...   100    5e-20 Gene info
ref|ZP_01786422.1|  3-deoxy-manno-octulosonate cytidylyltransf...  99.4    7e-20
ref|YP_718870.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  99.4    8e-20 Gene info
ref|YP_001381481.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  99.0    9e-20 Gene info
ref|ZP_01797708.1|  hypothetical protein CGSHiR3021_11024 [Hae...  99.0    1e-19
ref|ZP_00157565.2|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  99.0    1e-19
ref|ZP_01552499.1|  3-deoxy-manno-octulosonate cytidylyltransf...  99.0    1e-19
ref|ZP_01789110.1|  3-deoxy-manno-octulosonate cytidylyltransf...  99.0    1e-19
ref|YP_001494640.1|  3-deoxy-manno-octulosonate cytidylyltrans...  98.6    1e-19 Gene info
ref|NP_872922.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  98.6    1e-19 Gene info
ref|YP_001052798.1|  3-deoxy-manno-octulosonate cytidylyltrans...  98.2    2e-19 Gene info
ref|YP_001291965.1|  3-deoxy-manno-octulosonate cytidylyltrans...  98.2    2e-19 Gene info
ref|ZP_00826914.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  97.8    2e-19
ref|YP_428245.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  97.8    2e-19 Gene info
ref|ZP_00135509.2|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  97.1    3e-19
ref|YP_001493369.1|  3-deoxy-manno-octulosonate cytidylyltrans...  96.3    7e-19 Gene info
ref|YP_001499282.1|  3-deoxy-manno-octulosonate cytidylyltrans...  96.3    7e-19 Gene info
ref|ZP_01883937.1|  3-deoxy-manno-octulosonate cytidylyltransf...  96.3    7e-19
ref|YP_246610.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  95.9    9e-19 Gene info
ref|ZP_01476022.1|  hypothetical protein VEx2w_02001386 [Vibri...  95.9    9e-19
gb|EDN73199.1|  3-deoxy-manno-octulosonate cytidylyltransferas...  95.9    9e-19
ref|ZP_00834646.1|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  95.5    1e-18
ref|ZP_00142038.1|  3-deoxy-manno-octulosonate cytidylyltransf...  95.1    1e-18
ref|ZP_00133756.2|  COG1212: CMP-2-keto-3-deoxyoctulosonic aci...  95.1    2e-18
ref|ZP_01260428.1|  3-deoxy-manno-octulosonate cytidylyltransf...  94.7    2e-18
ref|YP_538158.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  94.7    2e-18 Gene info
ref|NP_360161.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  94.7    2e-18 Gene info
ref|YP_965718.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  94.7    2e-18 Gene info
ref|YP_692777.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  94.4    2e-18 Gene info
ref|YP_001492423.1|  3-deoxy-manno-octulosonate cytidylyltrans...  94.4    3e-18 Gene info
ref|YP_001155067.1|  3-deoxy-D-manno-octulosonate cytidylyltra...  94.0    3e-18 Gene info
ref|YP_467376.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  94.0    3e-18 Gene info
ref|YP_454678.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  93.6    4e-18 Gene info
ref|YP_001301920.1|  3-deoxy-manno-octulosonate cytidylyltrans...  93.6    4e-18 Gene info
ref|ZP_01594272.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  93.6    4e-18
ref|NP_220762.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  93.6    4e-18 Gene info
ref|ZP_01042329.1|  3-deoxy-manno-octulosonate cytidylyltransf...  93.6    4e-18
ref|NP_935146.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  93.2    6e-18 Gene info
ref|YP_012325.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  92.8    8e-18 Gene info
ref|ZP_01987907.1|  3-deoxy-D-manno-octulosonate cytidylyltran...  92.0    1e-17
ref|YP_001444735.1|  3-deoxy-manno-octulosonate cytidylyltrans...  91.3    2e-17 Gene info
ref|YP_155897.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  91.3    2e-17 Gene info
ref|ZP_01618423.1|  3-deoxy-manno-octulosonate cytidylyltransf...  91.3    2e-17
ref|ZP_01215100.1|  3-deoxy-manno-octulosonate cytidylyltransf...  91.3    2e-17
ref|ZP_01717482.1|  3-deoxy-manno-octulosonate cytidylyltransf...  91.3    2e-17
ref|YP_286406.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...  91.3    2e-17 Gene info
ref|ZP_01075931.1|  3-deoxy-manno-octulosonate cytidylyltransf...  90.9    3e-17
ref|NP_797363.1|  3-deoxy-manno-octulosonate cytidylyltransfer...  90.9    3e-17 Gene info
ref|ZP_01110540.1|  3-deoxy-manno-octulosonate cytidylyltransf...  90.9    3e-17

>ref|YP_676618.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Mesorhizobium 
sp. BNC1]
 gb|ABG65453.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Mesorhizobium 
sp. BNC1]
Length=251

 Score =  130 bits (326),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 73/174 (41%), Positives = 103/174 (59%), Gaps = 6/174 (3%)

Query  1    HQTGTDRVYEVFKN-NLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKI  59
            HQ+G+DR++E  +  +  A  +I++NLQGD+P I PE I  +V  +     +I TL  +I
Sbjct  72   HQSGSDRIFEALQTIDPGATAEIVINLQGDLPTIPPEDIRAVVRPLENADTDIATLGVEI  131

Query  60   SSNEELENENVVKVLVKEKLKTG---MYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKAL  115
            S  EE  N NVVK+ V   +KT    + ++AL F R        P +HHIGIYA+  +AL
Sbjct  132  SDEEEKANPNVVKI-VGVPVKTASDALRLRALYFTRATAPWGEGPLFHHIGIYAYRRRAL  190

Query  116  SRYVGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  169
             R+V L    LE+  +LEQLRA+E GM I    V S PL VDT  DLE  ++++
Sbjct  191  ERFVALPPGTLEMRERLEQLRALEAGMRIEAEIVRSVPLGVDTPADLERARQLL  244


>ref|NP_949032.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase [Rhodopseudomonas 
palustris CGA009]
 emb|CAE29135.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase [Rhodopseudomonas 
palustris CGA009]
Length=245

 Score =  125 bits (315),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 73/176 (41%), Positives = 104/176 (59%), Gaps = 14/176 (7%)

Query  1    HQTGTDRVYEVFKNNLNANPKI--IVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASK  58
            H +G+DR++E  +  L+ + KI  ++NLQGD P I PE I  +++ +     +I TLA++
Sbjct  75   HPSGSDRIFEALQT-LDPDRKIETVINLQGDFPTIRPEQIGAVLEPLADPAVDIATLAAE  133

Query  59   ISSNEELENENVVKV----LVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNK  113
            I + EE  N NVVKV    L  ++L+      AL F R        P YHHIG+Y +   
Sbjct  134  IHTEEEATNPNVVKVIGSPLAADRLR------ALYFTRATAPWGDGPRYHHIGLYGYRRA  187

Query  114  ALSRYVGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  169
            AL R+V L  S LE+  KLEQLRA+E GM I VG V++ P  VDT  DLE  ++++
Sbjct  188  ALERFVALPPSPLELREKLEQLRALEAGMRIDVGIVDTVPRGVDTPADLETARRVL  243


>ref|YP_485387.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Rhodopseudomonas 
palustris HaA2]
 gb|ABD06476.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Rhodopseudomonas 
palustris HaA2]
Length=259

 Score =  124 bits (310),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 71/171 (41%), Positives = 100/171 (58%), Gaps = 4/171 (2%)

Query  1    HQTGTDRVYEVFKN-NLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKI  59
            H +G+DR++E  +  +     + ++NLQGD P I PE I  ++  ++    +I TLA++I
Sbjct  89   HPSGSDRIHEALQTLDPQRTIETVINLQGDFPTIRPEQIGAVLAPLDDPAVDIATLAAEI  148

Query  60   SSNEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRY  118
             + EE  N NVVKV+      T +  +AL F R        P YHHIG+YA+   AL R+
Sbjct  149  HTEEESTNPNVVKVVGSHIGTTRL--RALYFTRATAPWGDGPRYHHIGLYAYRRAALERF  206

Query  119  VGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  169
            V L  S LE   KLEQLRA+E GM I VG V+S P  VDT  DLE  ++++
Sbjct  207  VALPPSPLEQREKLEQLRALEAGMRIDVGIVDSVPRGVDTPADLETARRVL  257


>ref|YP_570661.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Rhodopseudomonas 
palustris BisB5]
 gb|ABE40760.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Rhodopseudomonas 
palustris BisB5]
Length=245

 Score =  122 bits (306),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 73/172 (42%), Positives = 102/172 (59%), Gaps = 6/172 (3%)

Query  1    HQTGTDRVYEVFKNNLNANPKI--IVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASK  58
            H +G+DR++E  +  L+   +I  ++NLQGD P I PE I  ++  +     +I TLA++
Sbjct  75   HPSGSDRIHEALQT-LDPERRIETVINLQGDFPTIRPEQIGAVLAPLADPAVDIATLAAE  133

Query  59   ISSNEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSR  117
            I + EE  N NVVKV V   ++  + ++AL F R        P YHHIG+YA+   AL R
Sbjct  134  IHTEEESTNPNVVKV-VGSPIRDNL-LRALYFTRATAPYGDGPRYHHIGLYAYRRAALER  191

Query  118  YVGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  169
            +V L  S LE   KLEQLRA+E GM I VG V+S P  VDT  DLE  ++ +
Sbjct  192  FVSLPPSPLEQREKLEQLRALEAGMRIDVGIVDSVPRGVDTPADLETARRAL  243


>ref|YP_001242846.1| Gene info CTP/CMP-3-deoxy-D-manno-octulosonate transferase [Bradyrhizobium 
sp. BTAi1]
 gb|ABQ38940.1| Gene info CTP/CMP-3-deoxy-D-manno-octulosonate transferase [Bradyrhizobium 
sp. BTAi1]
Length=246

 Score =  122 bits (306),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 70/174 (40%), Positives = 105/174 (60%), Gaps = 10/174 (5%)

Query  1    HQTGTDRVYEVF-KNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKI  59
            H +G+DR+YE   K +     +I+VNLQGD P ILP+ I +++  ++    +I TLA++I
Sbjct  75   HPSGSDRIYEASCKLDPAGEAEIVVNLQGDFPTILPQNIRDVLLPLSDPAVDIATLAAQI  134

Query  60   SSNEELENENVVKVL---VKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKAL  115
             + EE    +VVK +   + E+      ++AL F R        P YHHIG+YA+   AL
Sbjct  135  HTAEEDAAPSVVKAVGSPIGER-----RLRALYFTRATAPHGDGPRYHHIGLYAYRRAAL  189

Query  116  SRYVGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  169
             R+V L  S LE++ KLEQLRA+E GM I +G V++ P  VDT  DLE  ++++
Sbjct  190  ERFVSLPPSPLELQEKLEQLRALEAGMRIDIGIVDTVPRGVDTPPDLETARRLL  243


>ref|YP_575727.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Nitrobacter 
hamburgensis X14]
 gb|ABE61267.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Nitrobacter 
hamburgensis X14]
Length=258

 Score =  122 bits (305),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 71/174 (40%), Positives = 103/174 (59%), Gaps = 6/174 (3%)

Query  1    HQTGTDRVYEVFKNNLNANPKI--IVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASK  58
            H +G+DRV+E   + L+ + +I  I+NLQGD P I P+ I +++  +     +I TLA++
Sbjct  75   HPSGSDRVFEAL-DRLDPDGRIETIINLQGDFPTIRPDIIRDVLKPLADPAVDIATLAAE  133

Query  59   ISSNEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSR  117
            I S+EE  N NVVK +        +  +AL F R        P YHHIG+YA+  KAL R
Sbjct  134  IHSDEEATNPNVVKAVGSPVAPRRL--RALYFTRATAPHGDGPRYHHIGLYAYRRKALQR  191

Query  118  YVGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIMKT  171
            +V L  S LE + +LEQLRA+E GM I +  V+  P  VDT  DLE  ++I+ +
Sbjct  192  FVELPPSPLERQERLEQLRALEGGMRIDIMIVDDVPRGVDTAADLETARRILAS  245


>ref|NP_540821.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase [Brucella melitensis 
16M]
 gb|AAL53085.1| Gene info 3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE [Brucella melitensis 
16M]
Length=295

 Score =  121 bits (304),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 71/168 (42%), Positives = 97/168 (57%), Gaps = 3/168 (1%)

Query  1    HQTGTDRVYEVF-KNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKI  59
            H++G+DR+YE   K + +     +VN+QGD+P I P+TI   +  +  G  +I TL  +I
Sbjct  120  HESGSDRIYEALAKLDPSGEIDAVVNVQGDLPTIDPDTIRRALLPLEDGPADIATLGVEI  179

Query  60   SSNEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRY  118
            +  EE  N NVVK+ V   L     ++AL F R        P YHHIG+YA+   AL R+
Sbjct  180  TVEEEKTNPNVVKI-VGSPLAGNRRLRALYFTRATAPYGEGPLYHHIGLYAYRRSALERF  238

Query  119  VGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIK  166
            V L  S LE   KLEQLRA+E GM I V  V + PL VDT+ DL+  +
Sbjct  239  VKLGPSPLEKREKLEQLRALEAGMRIDVEIVKTVPLGVDTQADLDRAR  286


>ref|YP_765745.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) 
(CMP-2-keto-3-deoxyoctulosonic acid synthetase) (CKS). 
[Rhizobium leguminosarum bv. viciae 3841]
 emb|CAK05629.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) 
(CMP-2-keto-3-deoxyoctulosonic acid synthetase) (CKS).; 
putative 3-deoxy-manno-octulosonate cytidylyltransferase 
(CMP-KDO synthetase) (CMP-2-keto-3-deoxyoctulosonic acid synthetase) 
[Rhizobium leguminosarum bv. viciae 3841]
Length=251

 Score =  121 bits (304),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 69/171 (40%), Positives = 100/171 (58%), Gaps = 4/171 (2%)

Query  1    HQTGTDRVYEVF-KNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKI  59
            HQ+G+DR++E   K +     KIIVN+QGD+P I PET+   +  +     +IGTL ++I
Sbjct  78   HQSGSDRIFEALTKVDPEGKAKIIVNIQGDLPTIDPETVRAALRPLENEAVDIGTLTTEI  137

Query  60   SSNEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRY  118
             + E+    ++VK++      +G  + AL F R        P YHHIG+YA+   AL R+
Sbjct  138  DNEEDKTAPHIVKIIGSPI--SGNRLHALYFTRATAPYGQGPLYHHIGLYAYRRAALERF  195

Query  119  VGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIM  169
            V L  S LE    LEQLRA+E GM I    V++ PL VDT  DLE+ ++I+
Sbjct  196  VSLGPSTLEKRESLEQLRALEAGMRIDAEVVDTVPLGVDTPADLEKARRIL  246


>ref|YP_220819.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase [Brucella abortus 
biovar 1 str. 9-941]
 ref|YP_413538.1| Gene info Acylneuraminate cytidylyltransferase:3-deoxy-D-manno-octulosonate 
cytidylyltransferase [Brucella melitensis biovar Abortus 
2308]
 gb|AAX73458.1| Gene info KdsB, 3-deoxy-manno-octulosonate cytidylyltransferase [Brucella 
abortus biovar 1 str. 9-941]
 emb|CAJ09991.1| Gene info Acylneuraminate cytidylyltransferase:3-deoxy-D-manno-octulosonate 
cytidylyltransferase [Brucella melitensis biovar Abortus 
2308]
Length=251

 Score =  121 bits (303),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 71/168 (42%), Positives = 97/168 (57%), Gaps = 3/168 (1%)

Query  1    HQTGTDRVYEVF-KNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKI  59
            H++G+DR+YE   K + +     +VN+QGD+P I P+TI   +  +  G  +I TL  +I
Sbjct  76   HESGSDRIYEALAKLDPSGEIDAVVNVQGDLPTIDPDTIRRALLPLEDGPADIATLGVEI  135

Query  60   SSNEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRY  118
            +  EE  N NVVK+ V   L     ++AL F R        P YHHIG+YA+   AL R+
Sbjct  136  TVEEEKTNPNVVKI-VGSPLAGNRRLRALYFTRATAPYGEGPLYHHIGLYAYRRSALERF  194

Query  119  VGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIK  166
            V L  S LE   KLEQLRA+E GM I V  V + PL VDT+ DL+  +
Sbjct  195  VKLGPSPLEKREKLEQLRALEAGMRIDVEIVKTVPLGVDTQADLDRAR  242


>ref|YP_001523053.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Azorhizobium 
caulinodans ORS 571]
 dbj|BAF86135.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Azorhizobium 
caulinodans ORS 571]
Length=293

 Score =  121 bits (303),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 70/178 (39%), Positives = 103/178 (57%), Gaps = 10/178 (5%)

Query  1    HQTGTDRVYEVFKN-NLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKI  59
            H +G+DR++E     + +   +++VN+QGD+P I PETI   +  + +G  +I TL + I
Sbjct  120  HPSGSDRIFEALGVLDPDGAVQVVVNVQGDLPTIAPETIRAALVPLEEGPADIATLTAVI  179

Query  60   SSNEELENENVVKVL---VKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKAL  115
            +   E  + NVVKV+   + E       ++AL F R        P YHHIG+YA+   AL
Sbjct  180  TEEGERTDPNVVKVVGTPIGEN-----RLRALYFTRATAPTGEGPLYHHIGLYAYRRAAL  234

Query  116  SRYVGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIMKTND  173
             R+V L  S LE   +LEQLRA+E GM I V  V++ PL VDT E LE  + ++ +ND
Sbjct  235  ERFVSLPPSPLEKRERLEQLRALEAGMRIDVAVVDAVPLGVDTPEHLERARALLASND  292


>ref|NP_697080.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase [Brucella suis 
1330]
 gb|AAN28995.1| Gene info 3-deoxy-manno-octulosonate cytidylyltransferase [Brucella suis 
1330]
Length=251

 Score =  121 bits (303),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 71/168 (42%), Positives = 97/168 (57%), Gaps = 3/168 (1%)

Query  1    HQTGTDRVYEVF-KNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKI  59
            H++G+DR+YE   K + +     +VN+QGD+P I P+TI   +  +  G  +I TL  +I
Sbjct  76   HESGSDRIYEALAKLDPSGEIDAVVNVQGDLPTIDPDTIRRALLPLEDGPADIATLGVEI  135

Query  60   SSNEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRY  118
            +  EE  N NVVK+ V   L     ++AL F R        P YHHIG+YA+   AL R+
Sbjct  136  TVEEEKTNPNVVKI-VGSPLAGNRRLRALYFTRATAPYGEGPLYHHIGLYAYRRSALERF  194

Query  119  VGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIK  166
            V L  S LE   KLEQLRA+E GM I V  V + PL VDT+ DL+  +
Sbjct  195  VKLGPSPLEKREKLEQLRALEAGMRIDVEIVKTVPLGVDTQADLDRAR  242


>ref|YP_001258085.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Brucella ovis 
ATCC 25840]
 gb|ABQ60463.1| Gene info 3-deoxy-D-manno-octulosonate cytidylyltransferase [Brucella ovis 
ATCC 25840]
Length=306

 Score =  121 bits (303),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 71/168 (42%), Positives = 97/168 (57%), Gaps = 3/168 (1%)

Query  1    HQTGTDRVYEVF-KNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKI  59
            H++G+DR+YE   K + +     +VN+QGD+P I P+TI   +  +  G  +I TL  +I
Sbjct  131  HESGSDRIYEALAKLDPSGEVDAVVNVQGDLPTIDPDTIRRALLPLEDGPADIATLGVEI  190

Query  60   SSNEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQP-YHHIGIYAFTNKALSRY  118
            +  EE  N NVVK+ V   L     ++AL F R        P YHHIG+YA+   AL R+
Sbjct  191  TVEEEKTNPNVVKI-VGSPLAGNRRLRALYFTRATAPYGEGPLYHHIGLYAYRRSALERF  249

Query  119  VGLKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIK  166
            V L  S LE   KLEQLRA+E GM I V  V + PL VDT+ DL+  +
Sbjct  250  VKLGPSPLEKREKLEQLRALEAGMRIDVEIVKTVPLGVDTQADLDRAR  297

ORF finding

SMS/ORF finder/ any codon/bacterial code/60AA/1,2&3/ direct


ORF Finder results
Results for 669 residue sequence "ORF_VM21510 ADN génomique (Tropical South Pacific: 600 miles from F. Polynesia)" 
starting "TCACTATTTT"

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.


SMS/ORF finder/ any codon/bacterial code/60AA/1,2&3/ reverse
ORF Finder results
Results for 669 residue sequence "ORF_VM21510 ADN génomique (Tropical South Pacific: 600 miles from F. Polynesia)" 
starting "TCACTATTTT"

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 2 to base 523.
CATCAGACTGGAACCGATAGAGTGTATGAGGTCTTTAAAAATAATTTAAATGCTAATCCA
AAAATAATTGTCAATTTACAAGGTGATATGCCAAATATCTTACCAGAAACTATAAATAAT
TTAGTCGATTATATGAACAAAGGCTATTGTGAAATAGGCACTTTAGCAAGTAAAATTAGT
TCAAATGAGGAGCTAGAGAACGAAAATGTAGTTAAGGTTTTGGTAAAAGAAAAGTTAAAA
ACAGGTATGTACGTTAAAGCCTTAGATTTTGTAAGACTCAAAAATATACAAAAACTGCAA
CCTTACCATCATATTGGAATTTACGCCTTTACTAATAAAGCTTTATCGCGTTATGTAGGT
CTTAAAAGATCAAAACTGGAAATTGAAAGAAAATTAGAACAATTAAGAGCAATGGAAAAT
GGAATGTCTATACACGTTGGTTATGTGAATTCATCACCTCTAAGTGTAGATACTGAAGAA
GATTTAGAGGAAATCAAAAAGATAATGAAAACCAATGATTAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
HQTGTDRVYEVFKNNLNANPKIIVNLQGDMPNILPETINNLVDYMNKGYCEIGTLASKIS
SNEELENENVVKVLVKEKLKTGMYVKALDFVRLKNIQKLQPYHHIGIYAFTNKALSRYVG
LKRSKLEIERKLEQLRAMENGMSIHVGYVNSSPLSVDTEEDLEEIKKIMKTND*

No ORFs were found in reading frame 3.