ORF KT22940

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1093025574849
Annotathon code: ORF_KT22940
Sample :
  • GPS :8°24'54s; 124°14'23w
  • Tropical South Pacific: 600 miles from F. Polynesia - International
  • Open Ocean (-2m, 27.6°C, 0.1-0.8 microns)
Authors
Team : BioCell 2007
Username : Genavengers
Annotated on : 2008-03-19 18:52:37
  • DEPOORTER FLORENT
  • GAMBARELLI GUILLAUME

Synopsis

  • Taxonomy: Flavobacteriales (NCBI info)
    Rank: order - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 200644
    Kingdom: Bacteria - Phylum: Bacteroidetes - Class: Flavobacteria - Order: Flavobacteriales
    Bacteria; Bacteroidetes; Flavobacteria; Flavobacteriales;

Genomic Sequence

>JCVI_READ_1093025574849 ORF_KT22940 genomic DNA
ATCGTTACTTTTACCAAAGGAGCTGCATGTTCCAGTAACCAACTAACGATCGCATGACCCGCCTCATGGAATGCAATGGTTTTCTTTTCCTCCTGAGTCA
CAATTTTATTTTTCTTTTCAAGACCTCCTACAATTCGGTCTACTGCATCAAGAAAATCCTGCTTACCCACAGACTTTTTGTTTTTTCTTGCTGCTATCAG
CGCAGCTTCATTACATACATTGGCAATATCAGCTCCAGAAAAACCCGGTGTTTGTTTGGACAGAAATTCCACGTCTAGTGTTTTTGTGGTTTTTAGGGGC
TTTAGGTGAACCTTGAAAATTTCACGTCTTTCATTTAAATCAGGCAGGTCTACGTATATCTGTCTATCGAATCGACCTGCACGCATGAGTGCTTTGTCCA
AGACATCAGCACGGTTAGTGGCTGCAAGAACTATAACGTTAGTGTTAGTTCCAAAACCATCCATTTCTGTAAGCAACTGGTTCAATGTATTTTCTCGCTC
ATCGTTGGATCCAGTAAAATTATTTTTTCCCCTTGCTCGACCAATTGCATCGATCTCATCAATAAAAATAATGGAGGGTGATTTTTCTTTGGCTTGTTTG
AATAAATCTCTAACCCTGGATGCACCAACTCCTACAAACATTTCGACAAAATCAGAGCCAGATAGAGAGAAAAAAGGAACTTTGGCTTCACCTGCTACTG
CTTTAGCCAACAGTGTTTTACCCGTTCCAGGTGATCCTACAAGCAACGCTCCTTTTGGAATTTTTCCACCCAAAACGGTATATTTTTTTGGATTTTTAAG
GAAATCTACAATTTCCTGAATTTCTTCCTTGGCACCCTCTAAACCGGCTACGTCTTTGAAGGTTGTTTTAACTTCGGTATTTTGATCAAAGAGTTTTGCT
TTAGATTTACCGATATTAAATATTTGACCACCCGGTCCTCCGGCCCCTCC

Translation

[1 - 948/950]   indirect strand
>ORF_KT22940 Translation [1-948   indirect strand]
GGAGGPGGQIFNIGKSKAKLFDQNTEVKTTFKDVAGLEGAKEEIQEIVDFLKNPKKYTVLGGKIPKGALLVGSPGTGKTLLAKAVAGEAKVPFFSLSGSD
FVEMFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEMDGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYV
DLPDLNERREIFKVHLKPLKTTKTLDVEFLSKQTPGFSGADIANVCNEAALIAARKNKKSVGKQDFLDAVDRIVGGLEKKNKIVTQEEKKTIAFHEAGHA
IVSWLLEHAAPLVKVT

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Phylogeny

----------
Parcimonie
----------


  +-----------------------------------------------------------------Chlorobiu4 (Green Sulfur) (Espece OutGroup)
  !  
  !                                         +-----------------------Chlorobiu5 (Green Sulfur)
  !                                         !  
  !                                         !                    +--Pelodict2  (Green Sulfur)
  !  +-------------------------------------21  +----------------20  
 22  !                                      !  !                 +--Prosthechl (Green Sulfur)
  !  !                                      !  !  
  !  !                                      +-19                 +--Chlorobiu6 (Green Sulfur)
  !  !                                         !     +----------18  
  !  !                                         !     !           +--Prosthechl (Green Sulfur)
  !  !                                         +----17  
  !  !                                               !     +--------Chlorobiu2 (Green Sulfur)
  +-13                                               +----15  
     !                                                     !  +-----Chlorobiu3 (Green Sulfur)
     !                                                     +-16  
     !                                                        !  +--Chlorobiu1 (Green Sulfur)
     !                                                        +-14  
     !                                                           +--Pelodict1  (Green Sulfur)
     !  
     !                          +-----------------------------------Psychrofle (CFB Flavobacteriales)
     !                          !  
     +--------------------------9  +--------------------------------Gramella   (CFB Flavobacteriales)
                                !  !  
                                +--7  +-----------------------------Croceibact (CFB Flavobacteriales)
                                   !  !  
                                   +--6                          +--Flavobacle (CFB Flavobacteriales)
                                      !  +-----------------------4  
                                      !  !                       +--Robigni    (CFB Flavobacteriales)
                                      +--3  
                                         !     +--------------------Flavobact2 (CFB Flavobacteriales)
                                         !     !  
                                         +----11  +-----------------Flavobactu (CFB Flavobacteriales)
                                               !  !  
                                               +-10  +--------------Flavobacle (CFB Flavobacteriales) 
                                                  !  !  
                                                  +--5  +-----------Cellulopha (CFB Flavobacteriales) 
                                                     !  !  
                                                     +--8  +--------ORF_KT2294 (notre ORF)
                                                        !  !  
                                                        +-12     +--Flavobactu (CFB Flavobacteriales)
                                                           !  +--2  
                                                           +--1  +--Flavobactu (CFB Flavobacteriales)
                                                              !  
                                                              +-----Flavobact1 (CFB Flavobacteriales)



----------------
Neighbor-Joining
----------------

                        +ORF_KT2294 (Notre ORF)
                        !  
                        !        +-------Flavobact2 (CFB)
                        !        !  
                        !        !  +-------Flavobactu (CFB)
                        !     +-15  !  
  +--------------------10     !  !  !     +------Gramella  (CFB) 
  !                     !     !  !  !     !  
  !                     !     !  +-17  +-20     +-----Croceibact (CFB)
  !                     !     !     !  !  !  +-18  
  !                     !     !     !  !  +-21  +---------Psychrofle (CFB)
  !                     !     !     !  !     !  
  !                     !     !     +-19     +------Cellulopha (CFB)
  !                     +----14        !  
  !                           !        !      +---Flavobacle (CFB)
  !                           !        !  +--11  
  !                           !        +-16   +----Robigni (CFB)  
  !                           !           !  
  !                           !           +----Flavobacle (CFB)
  !                           !  
  !                           !     +------Flavobactu (CFB)
  !                           !  +-12  
  !                           +-13  +--------Flavobactu (CFB)
  !                              !  
  !                              +------Flavobact1 (CFB)
  ! 
  !         +----Chlorobiu2 (Green sulfur)
  !       +-4 
  !       ! +----Chlorobiu3 (Green sulfur)
  !     +-5 
  !     ! !  +--Pelodict1  (Green sulfur)
  !     ! +--2 
  !   +-6    +--Chlorobiu1 (Green sulfur)
  !   ! ! 
  !   ! !   +----Pelodict2 (Green sulfur)
  ! +-7 +---1 
  ! ! !     +---Prosthechl (Green sulfur)
  ! ! ! 
  9-8 +-------Chlorobiu5 (Green sulfur)
  ! ! 
  ! ! +----Chlorobiu6 (Green sulfur)
  ! +-3 
  !   +----Prosthechl (Green sulfur)
  ! 
  +-------Chlorobiu4 (Green sulfur) (Espece OutGroup)

Annotator commentaries


Recherche d'ORF


En premier lieu, nous avons cherché la présence d'ORF sur SMS en utilisant comme critères, le code bacterien, sur les 2 brins dans les 6 cadres en utilisant le codon méthionine. Nous avons trouvée plusieurs ORFs sur les 2 brins. Nous avons donc procédé a plusieurs blastp contre nr afin de déterminer une séquence codante. Il s'avère que les ORF trouvés sur le brin direct ne présente que peu (ou pas) d'homologies avec les banques proteique. Cependant, l'ORF sur le brin indirect présente plus de mille hits de trés bon niveau (e-value comprisent entre 2e-104 et 4e-58 et scores entre 380 et 233). Nous avons donc choisi ce dernier comme étant codant. En raison d'un alignement multiple exact dés le premier nucléotide, le correcteur nous a alors suggéré de rechercher un ORF en n'utilisant plus le codon méthionine. L'ORF étudié s'étend alors sur toute la longueur de la séquence proposée.


Domaines Proteiques


Le blast, tout comme la recherche interpro effectuée, nous montre la présence de trois domaines proteiques enregistré dans la banque Pfam : - le domaine AAA (PF00004) (e-value 2.2e-69) - le domaine Peptidase_M41 (PF01434) (e-value 2e-25) - le domaine FtsH_ext (PF01434) (e-value 4.1e-13)

Les e-values de ces domaines sont pertinentes, ce qui semble impliquer la présence de ces domaines sur notre ORF. Les fiches descriptives de ces domaines désigne le premier domaine (FtsH_ext) comme un domaine de la proteine FtsH qui est la seule proteine membranaire liant l'ATP universellement concervée chez les procaryote, le second (AAA) comme un site ATP-binding et le dernier (Peptidase_M41) comme un site responsable d'une activité metalloendopeptidase.


BLAST


Comme indiqué précedemment le BLASTp contre nr effectué sur notre ORF nous donne plus de 1000 homologues de trés bon niveau. L'ensemble des homologues présent dans le blast indiquent la proteine FtsH conservée universellement chez les procaryotes (source Pfam), qui est une proteine membranaire ATP dépendante et qui dégrade des proteines dont la stabilité thermodynamique faible. Cette proteine est impliquée dans la protection de la cellule lors d'un stress osmotique. Les domaines AAA qui lie l'ATP et Peptidase peuvent donc etre présents sur cette proteine, et si celle ci correspond bien a notre ORF, il semble donc logique que nous les retrouvions tous deux. De plus, le domaine FtsH_ext, ici conservé, appuie avec une quasi-certitude l'hypothèse de la présence de cette proteine. Le blast (et le rapport de lignée qui lui est lié) nous permet aussi de determiner un groupe d'étude (les CFB) ainsi qu'un groupe exterieur (les green sulfur). Notons que nous restons dans un cadre bacteriens la proteine FtsH étant majoritairement procaryote.



Alignement Multiple


Nous effectuons alors un alignement multiple (infobiogen) avec les groupes choisi (CFB et Green Sulfur). Nous observons alors une forte conservation sur la totalité de notre ORF ce qui appuie donc l'hypothèse de la présence des domaines proteiques cités. Cet alignement nous permet alors de constituer des arbres taxonomiques.



Arbres et taxonomie


Nous construisons en premier lieu un arbre parcimonieux. Notre ORF se retrouve inclus dans le taxon des CFB. Notons que les deux groupes choisis sont parfaitement homogènes et que notre ORF est bien placé dans le groupe des CFB. L'arbre Neighbor-joining construit par la suite nous montre la meme homogénéité, seulement, notre ORF n'est ici pas inclus dans un groupe précis. Il peut s'agir d'une exclusion liée a la construction d'un arbre NJ, qui prend en compte la longueur des séquences. Notre ORF étant plus court que les autre séquences de l'alignement multiple celui-ci se retrouve donc exclu. Nous emmettons alors l'hypothèse que notre ORF provient d'un organisme appartenant au groupe des CFB et plus précisément, que cet organisme pourrait bien appartenir a l'ordre des Flavobacteriales.

(Note : En raison des problemes de serveurs NCBI, il ne nous a pas été possible de refaire un lignage en incluant toute la premiere partie de l'ORF. Seul l'alignement multiple, et les arbres en découlant ont été modifiés. L'ajout d'autre espèces afin d'elargir notre champs de vision n'a pu etre possible)


Conclusion


Aux vues des résultats présent, nous pouvons envisager que l'ORF choisi, provient donc d'une bacterie de l'ordre des Flavobacteriales et qu'il pourrait coder pour la protéine FtsH (contenant les domaines FtsH_ext, AAA et Protéase_M41) impliquée dans la régulation osmotique ayant une activitée Metalloprotéase ATP-dépendante.


Multiple Alignement

*-------*
*Clustal*
*-------*

CLUSTAL W (1.82) multiple sequence alignment


Flavobact1       ---------------MAQNSNSNFKFSPWMSIVLVLTIFFTISLFSDGLDLSNPGKTSLS
Flavobactu3      ------------MAKDNNPNPSKFKISPWLIYTAILLVFLFISFATGGSNLSEPAQLTSS
Flavobactu2      --------------MSKEIKKNSFKFNPWWIYGVITAIFVTMWFSGQ-SRWVEPTKTSIS
Robigni          ------------MAKDNKTPQKKPRFSSWWIYGLIIVFLIGFQFFGSDS-LSPTSKTTTS
Flavobacle1      ------------MAKDNNTTPKKPKFSSWWIYGLIAVFLIGFQFIGGGN-LANTKKTTTS
Flavobacle2      ------------MAKDNKNLNKKPKVNPYWIYGIIIAVFLSIQLFSGGFGDSSASETTTS
Croceibact       --MAKEQPNKAKPAGKNSQEPKKPKFSPYWIYAGIILIFLGIQFFAGGG-FNEPSKTNPA
Gramella         ---------MANQKPKKKLDPKKPKFSAYWIYAAIIIIFLGLNLFGDGG-FSEPAKTNPA
Cellulopha       --------MAKEEKKNSGTPPNKPKFSSYWIYGLIVVIFIAISMLTGSTGIGEAKKTSLY
Psychrofle       ------MAKKATQKKSTNKESKKPKFNSYWIYIGIIVIFLGVQFFGGSG-FSEPDKTSLA
Flavobactu1      -----------MAEKSKKPTPNKPKFSAWWIYTAIILVFLALNFFSSGSDFGNPKEILEN
Flavobact2       MSEQNKSNQRPGNGKPILPGGGKPKFNVWWIAVPIVLAFLAYSLISDAV--NSPKETNKS
ORF_KT22940      ------------------------------------------------------------
Pelodict1        ---MAKKPLKPSNPYKNEPENNI-PRPKFSIMYYVVVIVLLIGVQLAFFWQGSTQEIPYS
Chlorobiu1       ---MSKKTSRPSNPYKNEPESNL-PRPKFSIMYYVVVIVLLIGIQLAFFWSGSTQEIPYS
Chlorobiu2       ---MANNLFKPSNPYRKEPETNE-RRPKFSIMYYLVVILLLIGIQLAFFWSGSSVEIPYS
Chlorobiu3       ---MANNLFKPSNPYNNEPETKE-KRPKFSIMYYLVVILLLIGIQLAFFWSGTSTEIPYS
Prosthechl2      ---MANNLFKPQNPYKNDPDNNNEKKPKFSLVYYVVIILILVGLQLAFFWSGSSQEITYS
Chlorobiu6       ---MPNNLFKPQNPYKNDPENND-KKPKFSLLYYVVIVLLLIGLQLAFFWSGSSEEIPYS
Prosthechl1      ---MPKNSLKPSNPYNSEPENTE-KRPKLPMMYYVAVILLLIGVQLAFFWSGSTREIPYS
Pelodict2        ---MAKNSLKPSNPYNSEPETPQ-PRPKLPMIYYVVVIALLIGLQLAFFWSGSSREIPYS
Chlorobiu5       ---MANNPFKLNNPYNNEPDNGP-RKPRFSIFYYIAVILLIIGFQLAFFWSGSTREIAYS
Chlorobiu4       -----------------------MPRPKIPFFYSLIALALIIGVQLAFFWSGSTPEVPYS
                                                                             

Flavobact1       KFNEYLNAGQVDKVIFTN--TKATVFLKN-EALKDKRHDKVKNDITGKLNTKGPHYTFEI
Flavobactu3      KFNTLLEKGQIEKVIVYN--KAEAEVYLN-AAALKDPANKKVAKDIFDRANKGPHYTLEI
Flavobactu2      KFYEFLDANQVDKVEIVN--DKTVEVYLKKEALTQKVHAKIPKLDLLQKPNLGPHYTFQI
Robigni          ELQEFLRNGDIDKILIITNTRQARVYLTEEAMTKDVHRDVSDQ-PFSLSSGSVPQYVLDY
Flavobacle1      ELQEYLRNGDIEKIIIITNTDQAKVFLTDEALQKAVHKEVAEK-PFLPSTGAIPQYILDF
Flavobacle2      EFYEYLRNGDIDKVEIIN-DRIARVYLTKEAQELEVHKKSKPK-SFLPSVTPAPNYQFQF
Croceibact       EFETYLENGDVKRVVIVN-RKMAQVFLTDEAKAKDTHKKTEDS-KFLPAAG-TPDYTFEF
Gramella         EFKEYLRNGDVKKVEIIN-RNQARVYLTEEAKEKEVHKKNIDP-DLFPTGE-SPVYSFQF
Cellulopha       QFEQYLQDGDVQRVEIVN-KNSVKVYLTKEAESKEVHNKGRGT-GFFKPAAGAPDYRFEI
Psychrofle       QFESFLRDGDVEKVNIVKNSRIAEVFLTTEAKAKPKHKGTGED-PVFASSG-NPDYNFEF
Flavobactu1      QLITYAKDGDVKRIDISKSKQVAYIYLTEEASQKEKHSKPQDNGMSLLSSSGGADYEFRY
Flavobact2       EFFSYLEDGDVKEVIVWN-GRYAEVFLTKEALSNETKHKDALK-PSAMNQGKVPQYKFEF
ORF_KT22940      ------------------------------------------------------------
Pelodict1        TFRKLIAENKIESVKIAPEKIYIKLKPGVQTGIAVKEPPKDGPGMLLPQSASKQDEIFVN
Chlorobiu1       TFRKLIAENKIESVKIAPERIYVKLKPGSVTGVAVKEPKKEGP-GILPQSSSKPDEIFVN
Chlorobiu2       TFRKYIAENKVESVRISPERIFVVLKPEAKPVVTAPEPPKDGPGIFMPRSSTPSNEIFVT
Chlorobiu3       TFRKYIAEDKIESVKIAPERIYVQLKTEPG----VPPPAKESPESLLPGKSSPSREIFVT
Prosthechl2      TFRKYITENKIESVKIAPERIYVKLKPGVVP-VTAASENGKAPAIVNPESSKESQDVYVN
Chlorobiu6       EFRSYIEENKIESVKIAPERIYVNLKPGVIP-SVAKNGDG--------SLSAEPTEVYVT
Prosthechl1      SFRTFVVENKVESVKIAPEKLYVTLKPGVDSGLPVVEEKNEPTRQFLPTGKKNPNEVEVN
Pelodict2        TFRTFITENKVESVRIAPEKIYVTLKPGVDSGLPKQEEGNDTTRKLLPGAKTPENEVTVN
Chlorobiu5       DFRKLIDQNRVESVKLAPEKIYVQLKEDSLSTATNKPFGQNPPAFQMPGKNSSKNEVTVN
Chlorobiu4       TFRSLIAENKVESVKLAPEKIMVQLKQGVTVSVGAAEGDQ-PSVSAPKSSSKPSNELVVT
                                                                             

Flavobact1       GDLRTFQEALAKAD----AEKKINS---YEKEPESMWGEVISMLLPIAILIGLWIFMMRR
Flavobactu3      GNDQIFQTKLEKAV----NEGKLKD---FNFIQKNNWSDILISLLPIIIIIGVWIFIMRK
Flavobactu2      ATNSESFQNKLEEA----RKTNSIG---VDYKTSSEWTDLVG-FLPIILLIGFWIYMMRR
Robigni          GDLQNFENDIKKIK----QENNLDT-VVDYDTESNVFMELLLTILPFVLIIGIWIYLMRR
Flavobacle1      GDLQIFQNEITEIK----KAESLDT-VVEFDKESNYLGELLLGILPFVLIIGIWIYLMRR
Flavobacle2      GDLKLFQEAIDEIK----NENKLNT-KVAFDSEQNVWGDLLLTLLPFALIIGIWIFIMRR
Croceibact       GDLQNFENMISDAK----KNNSIST-VVTYKTESNVWGDILLTLLPFVLIIGIWIFIMRR
Gramella         GDLQNFENDINEIK----NEDNLDT-VVTYDTSSDVLGDLFWALLPFILIIGVWIFIMRK
Cellulopha       GDLQNFENDINEII----DANSLDT-RVSYETEGDMWG-LLASFLPFILIIGLWIFIMRR
Psychrofle       GDLQNFENSIEKIK----KDENINT-SVYYETRSNYFSEILIGLLPIILIVGIWIFIMKR
Flavobactu1      GTLENFENTLNDIQ----ENQGIEIPRKYLKADNTFFGDMLLTLLPIAVIIGIWIFIMRR
Flavobact2       GDLEIFQPQLEEAV----ENNNLET-TVVFKTQDNTFMNAIWSFLPIILLIGVWIFIMRR
ORF_KT22940      ------------------------------------------------------------
Pelodict1        PVRDDTLIELLESKGIKYQGM----------ASSTWISELLQWILPFGLLIGIYFFVFRR
Chlorobiu1       PVRDDGLIELLESKGIKYQGL----------PSSTWISELLQWILPFALLLGIYFFVFRR
Chlorobiu2       PVRDDTLVELLESKGIKYQGM----------PSNTWLGELLQWILPFALLIGIYFFVFRR
Chlorobiu3       PVRDDELIGLLESKGIRYQGI----------AGSTWIGELLQWILPFGLLIGIYFFVLRR
Prosthechl2      PVRDEELIPLLENQGISYKGI----------PGNNWIAELLQWILPFGLLIGIYFFVFRR
Chlorobiu6       PVVDDGLIELLESKGISYQGI----------PGNTWIGELLQWILPFALLIGIYFFVFRR
Prosthechl1      PVRDEGLTALLEEHGVTYEGT----------PGTTWIGELIQWILPFALLLGLYFFIFRR
Pelodict2        PVRDESLTALLETHGVRYEGS----------PGTTWISELIQWVLPFALLFGLYFFIFRR
Chlorobiu5       PVRDEQLIPLLESKGIHYEAI----------PGNGWINELLQWLLPFGLLIGIYFFMFRR
Chlorobiu4       PVRDDKLIELLESKGVRYQGV----------QGNSWIGELLQWIIPFGLLLGMYFFVFRR
                                                                             

Flavobact1       MS-GGSGGGGG-QIFSIGKSKAKLFD-EKNDTRITFENVAGLEGAKEEIQEIVEFLKTPE
Flavobactu3      MS-GGGAGGGG-QIFNIGKSKAKLFD-EKTDIKTTFKDVAGLEGAKEEIQEIVEFLKNPE
Flavobactu2      MS-GGGSGAGGPQIFSIGKSKAKLFD-EKTDIKTTFKDVAGLEGAKEEIQEIVEFLKNPT
Robigni          MS-GGAGGGAGGQIFNIGKSKAKLFD-EKTDTRTSFKDVAGLEGAKEEVEEIVEFLKNPD
Flavobacle1      MS-GGGGGGAGGQIFNIGKSKAKLFD-EKTDTRTSFKDVAGLEGAKEEVEEIVEFLRNPD
Flavobacle2      MS-SGGGGGAGGQIFNIGKSKAKLFD-EKADIKTSFKDVAGLEGAKEEVQEIVDFLKFPE
Croceibact       MSGAGGGGGPGGQIFNIGKSKAKLFD-QNTDVKVSFKDVAGLEGAKEEVQEIVDFLKNPD
Gramella         MS-SGAGGGAGGQIFNIGKSKAKLFD-QNTDVKTSFKDVAGLEGAKEEVQEIVDFLKQPE
Cellulopha       MS-SGGGGGPGGQIFNIGKSKAKLFD-EKTDIKTTFKDVAGLEGAKEEIQEIVDFLKNPE
Psychrofle       MS-KGGGGGPGGQIFNIGKSKAKLFD-EKKDVKTSFKDVAGLEGAKDEVQEIVDFLKHPD
Flavobactu1      MS-SGGAGGAGGQIFNIGKSKAKLFD-EKTDVKTSFKDVAGLEGAKEEVQEIVDFLKNPD
Flavobact2       MS-GGGAGGGGGQIFNIGKSKAKLFD-QKTDVKTTFKDVAGLEGAKEEIQEIVDFLKNPE
ORF_KT22940      ----GGAGGPGGQIFNIGKSKAKLFD-QNTEVKTTFKDVAGLEGAKEEIQEIVDFLKNPK
Pelodict1        MG------GPGSQFMNIGKNKAALYENLDEHSRITFKDVAGLDEAKAEVMEVVDFLKDPK
Chlorobiu1       MG------GPGSQFMNISKNKAALYENLDEHTRITFKDVAGLDEAKAEVMEVVDFLKDPK
Chlorobiu2       MG------GPGSQFMNIGKNKAALYENLDEHTRITFKDVAGLDEVKAEVMEVVDFLKDPK
Chlorobiu3       MG------APGSQFMNIGKNKAALYENLDEHTRITFKDVAGLDEAKAEVMEVVDFLKDPK
Prosthechl2      MG------GPGSQFMNIGKNKAALYENLDEHTRITFKDVAGLDEAKGEVMEVVDFLKDPK
Chlorobiu6       LG------GPGSQFMNISKNKAALYENLDEHTRITFKDVAGLDEAKAEVMEVVGFLKDPK
Prosthechl1      MGGA---GGPGAQFMNISKNKAALYENLDEHTRITFTDVAGLDEAKAEVMEVVDFLKDPK
Pelodict2        MG-A---GGPGAQFMNIGKNKAALYENLDEHTRITFKDVAGLDEAKAEVMEVVDFLKDPK
Chlorobiu5       MG------GPGSQFMNIGKNKAALYENLDEHTRITFKDVAGLDEAKAEVMEVVDFLKDPK
Chlorobiu4       MG------GPGSQFMNIGKNKAALYENFDEHTRITFKDVAGLDEAKAEVMEVVDFLKDPK
                         . * *::.*.*.** *::  . . : :* :****: .* *: *:* **: * 

Flavobact1       KYTSIGGKIPKGALLVGPPGTGKTLLAKAVAGEAKVPFFSLSGSDFVEMFVGVGASRVRD
Flavobactu3      KYTNLGGKIPKGALLVGPPGTGKTLLAKAVAGEAQVPFFSLSGSDFVEMFVGVGASRVRD
Flavobactu2      KYTNLGGKIPKGALLVGPPGTGKTLLAKAVAGEAQVPFFSLSGSDFVEMFVGVGASRVRD
Robigni          KYTSLGGKIPKGALLVGPPGTGKTLLAKAVAGEAKVPFFSLSGSDFVEMFVGVGASRVRD
Flavobacle1      KYTSLGGKIPKGALLVGPPGTGKTLLAKAVAGEAKVPFFSLSGSDFVEMFVGVGASRVRD
Flavobacle2      KYTALGGKIPKGALLVGPPGTGKTLLAKAVAGEAKVPFFSLSGSDFVEMFVGVGASRVRD
Croceibact       KYTNLGGKIPKGALLVGQPGTGKTLLAKAVAGEAKVPFFSLSGSDFVEMFVGVGASRVRD
Gramella         KYTALGGKIPKGALLVGPPGTGKTLLAKAVAGEAKVPFFSLSGSDFVEMFVGVGASRVRD
Cellulopha       KYTSLGGKIPKGALLVGQPGTGKTLLAKAVAGEAKVPFFSLSGSDFVEMFVGVGASRVRD
Psychrofle       KYTNLGGKIPKGALLVGPPGTGKTLLAKAVAGEAGVPFFSLSGSDFVEMFVGVGASRVRD
Flavobactu1      KYTNLGGKIPKGALLVGPPGTGKTLLAKAVAGEAKVPFFSLSGSDFVEMFVGVGASRVRD
Flavobact2       KYTSLGGKIPKGALLIGSPGTGKTLLAKAVAGEAKVPFFSLSGSDFVEMFVGVGASRVRD
ORF_KT22940      KYTVLGGKIPKGALLVGSPGTGKTLLAKAVAGEAKVPFFSLSGSDFVEMFVGVGASRVRD
Pelodict1        KYTTLGGKLPKGVLLVGPPGTGKTLLAKAVAGEADVPFFSISGSDFVEMFVGVGAARVRD
Chlorobiu1       KYTTLGGKLPKGVLLVGPPGTGKTLLAKAVAGEADVPFFSISGSDFVEMFVGVGAARVRD
Chlorobiu2       KYTKLGGKLPKGVLLVGPPGTGKTLLAKAVAGEAEVPFFSISGSDFVEMFVGVGAARVRD
Chlorobiu3       KYTKLGGKLPKGVLLVGPPGTGKTLLAKAVAGEADVPFFSLSGSDFVEMFVGVGAARVRD
Prosthechl2      KYTKLGGKLPKGVLLVGPPGTGKTLLAKAVAGEADVPFFSISGSDFVEMFVGVGAARVRD
Chlorobiu6       KYTKLGGKLPKGVLLVGPPGTGKTLLAKAVAGEADVPFFSISGSDFVEMFVGVGAARVRD
Prosthechl1      KYTRLGGKLPKGVLLVGPPGTGKTLLAKAVAGEADVPFFSISGSDFVEMFVGVGAARVRD
Pelodict2        KYTRLGGKLPKGVLLVGPPGTGKTLLAKAVAGEADVPFFSISGSDFVEMFVGVGAARVRD
Chlorobiu5       KYTKLGGKLPKGVLLVGPPGTGKTLLAKAVAGEANVPFFSISGSDFVEMFVGVGAARVRD
Chlorobiu4       KYTTLGGKLPKGVLLVGPPGTGKTLLAKAVAGEADVPFFSLSGSDFVEMFVGVGAARVRD
                 *** :***:***.**:* **************** *****:**************:****

Flavobact1       LFKQAKEKSPSIIFIDEIDAVGRARGKNNMTGANDERENTLNQLLTEMDGFGTNSNVIVL
Flavobactu3      LFKQAKEKSPAIIFIDEIDAVGRARGKSNMSGGNDERENTLNQLLTEMDGFGTNSNVIVL
Flavobactu2      LFKQAKDKSPSIIFIDEIDAVGRARGKGNMSGGNDERENTLNQLLTEMDGFGTNSNVIVI
Robigni          LFKQAKDKSPAIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEMDGFGTNTNVIVL
Flavobacle1      LFKQAKDKSPAIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEMDGFGTNTNVIVL
Flavobacle2      LFKQAKEKSPSIIFIDEIDAIGRARGKNAMSGSNDERENTLNQLLTEMDGFGTNSNVIVL
Croceibact       LFKQAKDKSPAIIFIDEIDAIGRARGKNNMSGSNDERENTLNQLLTEMDGFGTNTNVIVL
Gramella         LFKQAKEKSPSIIFIDEIDAIGRARGKSNFSGSNDERENTLNQLLTEMDGFGTNTNVIVI
Cellulopha       LFKQAKEKSPAIIFIDEIDAIGRARGKNNFSGGNDERENTLNQLLTEMDGFGTNTNVIVL
Psychrofle       LFKQAKEKSPSIIFIDEIDAIGRSRGKGGMSGSNDERENTLNQLLTEMDGFGTNTNVIVI
Flavobactu1      LFKQAKEKSPAIIFIDEIDAIGRARGKANFSGSNDERENTLNQLLTEMDGFGTNTNVIVL
Flavobact2       LFKQAKEKSPSIIFIDEIDAIGRARGKSNFSGSNDERENTLNQLLTEMDGFGTNTNVIVL
ORF_KT22940      LFKQAKEKSPSIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEMDGFGTNTNVIVL
Pelodict1        LFKQAKEKAPCIIFIDEIDAVGRSRGKGAMMGANDERENTLNQLLVEMDGFATDKGVILI
Chlorobiu1       LFKQAKEKAPCIIFIDEIDAVGRSRGKGAMMGANDERENTLNQLLVEMDGFATDKGVILM
Chlorobiu2       LFRQAKEKAPCIIFIDEIDAVGRSRGKGAMMGANDERENTLNQLLVEMDGFATDKGVILM
Chlorobiu3       LFKQAKEKAPCIIFIDEIDAVGRSRGKGAMMGANDERENTLNQLLVEMDGFATDKGVILM
Prosthechl2      LFRQAKEKAPCIIFIDEIDAVGRSRGKGAMMGTNDERENTLNQLLVEMDGFATDKGVILM
Chlorobiu6       LFREAKEKAPCIIFIDEIDAVGRSRGKGAMMGANDERENTLNQLLVEMDGFATDKGVILM
Prosthechl1      LFKQAKEKAPCIIFIDEIDAVGRSRGKGAMMGGNDERENTLNQLLVEMDGFATDKGVILM
Pelodict2        LFRQAKEKAPCIIFIDEIDAVGRSRGKGAMMGGNDERENTLNQLLVEMDGFATDKGVILM
Chlorobiu5       LFKSAKEKAPCIIFIDEIDAVGRSRGKGFMMGANDERENTLNQLLVEMDGFATDKGVILM
Chlorobiu4       LFKQAKEKAPCIIFIDEIDAVGRSRGKGVMMGANDERENTLNQLLVEMDGFATDKGVILI
                 **:.**:*:*.*********:**:***  : * ************.*****.*:..**::

Flavobact1       AATNRADVLDKALLRAGRFDRQIYVDLPDIRERKEIFEVHLKPLK-KSEELDTEFLAKQT
Flavobactu3      AATNRADVLDKALMRAGRFDRQIFVDLPDIRERAEIFKVHLAPIK-KVEGLDLDFLAKQT
Flavobactu2      AATNRADVLDKALMRAGRFDRQIYVDLPNITERAEIFAVHLAPLK-KVENLDTEFLAKHT
Robigni          AATNRADVLDKALMRAGRFDRQIYVDLPDIRERKEIFEVHLRPIK-TAETLDLDFLARQT
Flavobacle1      AATNRADVLDKALMRAGRFDRQIYVDLPDIRERKEIFEVHLRPIK-TAETLDLDFLARQT
Flavobacle2      AATNRADILDKALMRAGRFDRQIYVDLPDVRERKEIFEVHLRPLK-KEETLDIDFLAKQT
Croceibact       AATNRADVLDKALMRAGRFDRQIYVDLPDVRERKEIFEVHLRPLKKVAEELDVDFLAKQT
Gramella         AATNRADVLDKALMRAGRFDRQIYVDLPDLNERKEIFDVHLKPLKKVADELDTDFLAKQT
Cellulopha       AATNRADVLDKALMRAGRFDRQIYVDLPDVRERKEIFEVHLRPLKKVDEELDVDFLAKQT
Psychrofle       AATNRADVLDKALMRAGRFDRQIYVDLPDVKEREEIFEVHLKPLKKAENELDTMFLAKQT
Flavobactu1      AATNRADVLDTALMRAGRFDRQIYVDLPDVRERKEIFEVHLRPLKKVAEELDTEFMAKQT
Flavobact2       AATNRADILDKALMRAGRFDRQIYVDLPDVKEREEIFEVHLRPLKKVDNELDTSFLAKQT
ORF_KT22940      AATNRADVLDKALMRAGRFDRQIYVDLPDLNERREIFKVHLKPLK-TTKTLDVEFLSKQT
Pelodict1        AATNRPDVLDSALLRPGRFDRQIMVDKPDLKGRIDIFKVHTKSLS-LSEDVNLKALASQT
Chlorobiu1       AATNRPDVLDSALLRPGRFDRQIMVDKPDLKGRIDIFKVHTKKLS-LSADVNLKALASQT
Chlorobiu2       AATNRPDVLDSALLRPGRFDRQIMVDKPDLKGRIDIFKVHTKNLS-LSPDVNLKTLASQT
Chlorobiu3       AATNRPDVLDSALLRPGRFDRQIMVDKPDLKGRIDIFTVHTKKLS-LSPDVNLKALASQT
Prosthechl2      AATNRPDVLDTALLRPGRFDRQIMVDKPDLKGRIDILKVHTKSLS-LSTDVNLKVLASQT
Chlorobiu6       AATNRPDVLDNALLRPGRFDRQIMVDKPDLKGRVDTFKVHTKKLS-LSPDVNVKVLASQT
Prosthechl1      AATNRPDVLDPALLRPGRFDRQIMVDKPDLKGRMDTFRVHTKKLS-LSPDVNLKALASQT
Pelodict2        AATNRPDVLDPALLRPGRFDRQIMVDKPDLKGRMDTFRVHTKNMS-LSPDVNLKALASQT
Chlorobiu5       AATNRADVLDSALLRPGRFDRQIVVDRPDLKGRTDIFAVHTKNLS-LSPDVNLKALASQT
Chlorobiu4       AATNRPDVLDSALLRPGRFDRQIMVDKPDLKGRVDILKVHTKSLS-LGNDVNLKTLASQT
                 *****.*:** **:*.******* ** *::  * : : **   :.     ::   :: :*

Flavobact1       PGFSGADIANVCNEAALIAARKDKKAVDKQDFLDAVDRIVGGLEKKNKIVTPAEKRAIAI
Flavobactu3      PGFSGADIANVCNEAALIAARNNKPAVDKQDFLDAVDRIIGGLEKKNKIITPEEKRAIAI
Flavobactu2      PGFSGADIANVCNEAALIAARNNKTAVDKQDFLDAVDRIVGGLEKKNKIITPEEKKAIAI
Robigni          PGFSGADIANVCNEAALIAARKERKAVTKQDFLDAVDRIVGGLEKKNKIITPEEKKTIAY
Flavobacle1      PGFSGADIANVCNEAALIAARKEKKAVSKQDFLDAVDRIVGGLEKKNKIITAGEKKTIAY
Flavobacle2      PGFSGADIANVCNEAALIAARKGKKAVNKQDFLDAVDRIVGGLEKKNKIITPGEKRAVAF
Croceibact       PGFSGADIANVCNEAALIAARKGNKAVGKQDFLDAVDRIVGGLEKKNKIITKDEKKAIAF
Gramella         PGFSGADIANVCNEAALIAARKGNKAVGKQDFLDAVDRIVGGLEKKNKIITPSEKKAIAF
Cellulopha       PGFSGADIANMCNEAALIAARKSKKAVGKQDFLDAVDRIVGGLEKKNKIITPDEKRAIAF
Psychrofle       PGFSGADIANLCNEAALIAARNNSKAVGKQDFLDAVDRIVGGLEKKNKIMSKDEKKAIAF
Flavobactu1      PGFSGADIANVCNEAALIAARQGKAAVGRQDFLDAVDRIVGGLEKKNKIITPEEKRAIAF
Flavobact2       PGFSGADIANVCNEAALIAARKGKKAVDKQDFLDAVDRIVGGLEKKNKLITPSEKKTIAY
ORF_KT22940      PGFSGADIANVCNEAALIAARKNKKSVGKQDFLDAVDRIVGGLEKKNKIVTQEEKKTIAF
Pelodict1        PGFAGAEIANTANEAALLASRRNKVSIEMKDFEDAIERCVAGLEKKNKVINPREKQIVAY
Chlorobiu1       PGFAGAEIANAANEAALLASRRNKQSIEMKDFEDAIERVVAGLEKKNKVINPREKQIVAY
Chlorobiu2       PGFAGAEIANAANEAALLASRREKQSIEMKDFEDAIERVVAGLEKKNKVINPRERQIVAY
Chlorobiu3       PGFAGAEIANAANEAALLASRQNKLTIEMKDFEDAIERVIAGLEKRNKVINPREKQIVAY
Prosthechl2      PGFAGAEIANAANEAALLASRKGKQSIEMKDFEDAIERVVAGLEKKNKVINPQEKRIVAY
Chlorobiu6       PGFAGAEIANAANEAALLASRRGKQSIEMKDFEDAIERVVAGLEKKNKVINPKEKKVVAY
Prosthechl1      PGFAGAEIANAANEAALLASRRNKESIEMKDFEDAIERVVAGLEKKNKVINPKEKRIVAY
Pelodict2        PGFAGAEIANAANEAALLASRRNKESIEMKDFEDAIERVVAGLEKKNKVINPKEKRIVAY
Chlorobiu5       PGFAGAEIANAANEAALLASRRGKQSIEMKDFEDAIERVIAGLEKKNKVINPREKEIVAY
Chlorobiu4       PGFAGAEIANAANEAALLASRRNKQTIDMKDFEDAIERVVAGLEKKNKVINPRERQIVAY
                 ***:**:*** .*****:*:*.   ::  :** **::* :.****:**::.  *:. :* 

Flavobact1       HEAGHATVSWMLEHAAPLVKVTIVPRGQSLG--AAWYLPEERLIVRPDQMLDEMCATMGG
Flavobactu3      HEAGHATVSWMLEHAAPLIKVTIVPRGQSLG--AAWYLPEERQIVRTDQMLDEMCATMGG
Flavobactu2      HEAGHATVSWMLEHAAPLIKVTIVPRGQSLG--AAWYLPEERQIVRPNQMLDEMCATMGG
Robigni          HEAGHATVSWMLEHAAPLVKVTIVPRGQSLG--AAWYLPEERLLVRTEQMLDEMCATLGG
Flavobacle1      HEAGHATTSWMLEHAAPLVKVTIVPRGQSLG--AAWYLPEERLIVRPEQMLDEMCATLGG
Flavobacle2      HEAGHATVSWMLEHAAPLVKVTIVPRGQSLG--AAWYLPEERLIVRPEQMLDEMCAALGG
Croceibact       HEAGHATVSWMLEHAAPLVKVTIVPRGQSLG--AAWYLPEERLIVRPDQMLDEMCATMGG
Gramella         HEAGHATVSWMLEHAAPLVKVTIVPRGQSLG--AAWYLPEERLIVRPEQMLDEMCAALGG
Cellulopha       HEAGHATVSWMLEHAAPLVKVTIVPRGQSLG--AAWYLPEERLIVRPEQMLDEMCAALGG
Psychrofle       HEAGHATVSWMLEYASPLVKVTIVPRGRSLG--AAWYLPEERQIVRTEQILDEMCATMGG
Flavobactu1      HEAGHATVSWMLEHAAPLVKVTIVPRGRSLG--AAWYLPEERLIVRPEQMLDEMCAAMGG
Flavobact2       HEAGHATVSWMTEHAAPLIKVTIVPRGQSLG--AAWYLPEERQIVRPEQMLDEMCATMGG
ORF_KT22940      HEAGHAIVSWLLEHAAPLVKVT--------------------------------------
Pelodict1        HEAGHAIVSWMMPENDPVQKISIVPRGMSALGYTMNIPLEDRYLMTKSELLARICGLLGG
Chlorobiu1       HEAGHAIVGWMMPENDPVQKISIVPRGMSALGYTMNIPLEDRYLMTKNELLARICSLLGG
Chlorobiu2       HEAGHAIVSWMMPENDPVQKISIVPRGMSALGYTMNIPLEDRYLMTKRELFARICGLLGG
Chlorobiu3       HEAGHAIVSWMMPENDPVQKISIVPRGMSALGYTMNIPLEDRYLMTKKELIARICGLLGG
Prosthechl2      HEAGHAIISWLLAENDAVQKISIVPRGMSALGYTLNLPLEDRYLMTKTELFSRICGLLGG
Chlorobiu6       HESGHAIISWMMAENDAVQKISIVPRGMSALGYTMNLPLEDRYLMTKHELYSRICGLLGG
Prosthechl1      HEAGHAIVSWMMAENDPVQKISIVPRGMSALGYTMNIPLEDRYLMTKKELWARICGLLGG
Pelodict2        HEAGHAIVSWMMPENDPVQKISIVPRGMSALGYTMNIPLEDRYLMTKRELFARICGLLGG
Chlorobiu5       HESGHAIVSWLMPENDPVQKISIVPRGVSALGYTLNIPLEDRYLMTRSELIARICGLLGG
Chlorobiu4       HEAGHAIVSWMMVENDPVQKISIVPRGMSALGYTMNIPLEDRYLMTRRELFARICGLLGG
                 **:***  .*:     .: *::                                      

Flavobact1       RAAEKVIFNEISTGALSDLEKVTRQARAMVTIYGLNDKLGNITFYDSTGQSDY--NFSKP
Flavobactu3      RAAEKVTFDRISTGALSDLEKVTRQARAMVTIYGLNDKIGNVTYYDSTGQSEY--NFSKP
Flavobactu2      RAAEKVIFNNISTGALSDLEKVTKQARAMVTVYGLNDKLGNITYYDSSGQSDY--NFSKP
Robigni          RAAEKVIFDKISTGALSDLEKVTKQARAMVTIYGLNEAIGNLTYYDSSGQNEY--GFTKP
Flavobacle1      RAAEKVIFDQISTGALSDLEKVTKQARAMVTVYGLNDEIGNLTYYDSSGQNEY--GFTKP
Flavobacle2      RAAEKVIFDKISTGALSDLEKVTKQARAMVTIYGLSDKVGNLTYYDSSGQSEY--GFTKP
Croceibact       RAAEKVIFNKISTGALSDLEKVTKQARAMVTIYGLSEKVGNITYYDSSGQNEY--NFSKP
Gramella         RAAEKVIFNKISTGALSDLEKVTKQARAMVTIYGLNEAVGNLTYYDSSGQGEY--NFTKP
Cellulopha       RAAEKVIFNKISTGALSDLEKVTKQARMMVTVYGLNDKVGNLTYYDSTGQSDN--GFTKP
Psychrofle       RAAEKVIFNKISTGALSDLEKVTKQAKAMVTVYGLSEKIGNLTYYDSSEQSDY--NFTKP
Flavobactu1      RAAEKVTFNKISTGALSDLEKVTKQARMMVTTYGLNDEIGNLTYYDSSGQNEY--NFSKP
Flavobact2       RAAEKVIFNNISTGALSDLEKVTKQARAMVTIYGLNDKVGNITYYDSSGQQEY--SMSKP
ORF_KT22940      ------------------------------------------------------------
Pelodict1        RIAEQIIFSEISTGAQNDLEKVTSIAYNMVMVYGMSEKLGNLSFFESNNPYYGSPGIDKK
Chlorobiu1       RIAEQIIFNEISTGAQNDLEKVTSIAYNMVMVYGMSDKLGNLSFFESNNPYYGSPGIDKK
Chlorobiu2       RIAEEIIFSEISTGAQNDLEKITGIAYNMVLVYGMSERLGNLSFYESNNPYSGGPGIDKK
Chlorobiu3       RIAEEIVFGEISTGAQNDLEKITGIAYNMVMVYGMSEKLGNLSFYESNNPYYGSPGVDKK
Prosthechl2      RIAEDIVFNEISTGAQNDLEKVTEIAYNMVVVYGMSEKLGNISYYESNNPYYGGPGVDKK
Chlorobiu6       RIAEEIIFDEISTGAQNDLEKITEIAYNMVVVYGMSKKLGNISYYESNNPYYGGPGVDKK
Prosthechl1      RLAEEAVFGEISTGAQNDLEKITGIAYNMVTVYGMSEKLGNLSFYESNNPYYGAPGMEKK
Pelodict2        RIAEESVFGEISTGAQNDLEKITGIAYNMVMVYGMSDKIGNLSYYESNNPYYGAPGVEKK
Chlorobiu5       RVAEEIIFGEISTGAQNDLERVTEIAYNMVIVYGMSEKVGYLSFLESNNPYYGGPGIDKK
Chlorobiu4       RIAEQVIFGEISTGAQNDLEKVTSIAYNMVMVYGMSEKLGNISFYDSHNSGYG---MEKK
                                                                             

Flavobact1       YSEETAKVIDSEISKLIEQQYQRAIHLLETNKDKLTQLADILIEKEVIFKDDLETIFGKR
Flavobactu3      YSDETAKIIDAEISELIEGQYQRAIEILEENKDKLNQLADILIEKEVIFKDDLETIFGKR
Flavobactu2      YSEETARTIDQEISILIEGQYQRAIALLELHKDKLNQLADILIEKEVIFKDDLETIFGKR
Robigni          YSEETARKIDQEISRIVEAQYARAIDVLKKNKDKLIELAERLLDKEVIFKEDLEKIFGKR
Flavobacle1      YSEETARKIDAEISQIIEEQYKRAIDVLEKNKDKLTELAERLLEKEVIFKEDLEKIFGKR
Flavobacle2      YSEQTAELIDKEISDIIEKQYERAIKLLEQHKDKLTELAEVLLDKEVIFKDNLEKIFGKR
Croceibact       YSEKTSELIDKEISEIVEKQYERAIDLLSQHKDKLTELAEILLEKEVIFKDDLEKIFGKR
Gramella         YSEKTSELIDKEISNLIEDQYKRAIDLLEHNKDKLSELAEILLDKEVIFKDDLEKIFGKR
Cellulopha       YSEQTAEVIDKEISNIIEEQYQRAIDLLTKEKDKLTQLAELLLEKEVIFKDNLQDIFGER
Psychrofle       YSDKTSELIDEEISRIIEEQYLRAIGILEKHKDQLTQLADLLLEKEVIFKDDLVKIFGER
Flavobactu1      YSERTAELIDKEISKIIEAQYQRAIKILEDNKDKLNELAEVLLDKEVIFKDNLEKIFGKR
Flavobact2       YSEETAVIIDQEISKIIEAQYQRAIKILEENKDKLTQLAEVLLEKEVIFKDDLENIFGKR
ORF_KT22940      ------------------------------------------------------------
Pelodict1        YGEETARLIDREVMAIVEESRLRVMDLLTVNREKLEKLASELLLKEMLQYPQIEEILGKR
Chlorobiu1       YGEETARLIDREVMAIVEESRIKVTELLTRNREKLEKLASELLLKEMLQYSQIEEILGKR
Chlorobiu2       YSEKTAQLIDSEVKVIEEKARQTVTDLLTLNRDKLEALARELLAKEMLQYCQIEEILGKR
Chlorobiu3       YGEETARLIDDEVSAIVADARRMVFEMLTANREKLERLATELLAREMLQYCQIEEILGKR
Prosthechl2      YSDHTARLIDEEVHDTISRAEQAVREILTKNRDRLEALAQELLRKEVVQYCQIEEILGKR
Chlorobiu6       YSEHTARLIDEEVHQLIDQAQQQVREILTENHDKLEMLAQELLKNEVLHYCKIEEILGRR
Prosthechl1      YGEETAHLIDREVKEIVESAAASVRALLEENRDKLERLAGELLAKEMLQYCQIEEILGKR
Pelodict2        FGGETARLIDEEVKAIVESAADTVRTMLKEHRSKLEALARELLTKEMLQYCQIEEILGKR
Chlorobiu5       YGDETARLIDNEVKEIVEAARKQVHQMLSDNRDKLEMLAKELLSKEIVQYCRIEEILGKR
Chlorobiu4       YGEETARLIDQEVRHIIEEARVAVLELLAEHRDKLERLASELLQKEMLQQSQIEEILGKR
                                                                             

Flavobact1       PFDKEEEITVSE------------------------------------------------
Flavobactu3      TWDKNLEEVVS-------------------------------------------------
Flavobactu2      PFDKENFVEAIPQIV---------------------------------------------
Robigni          PFEKFDKLGQEKTLDAPDAGDKGAAEADGSENDAEPKASKPAGGKDPESPEEQEEKTVEK
Flavobacle1      PFDKAFDEKGQEVTKEESKTDEDTSTIEEKEKENK-------------------------
Flavobacle2      PFDKKEIIAEEEE-----------------------------------------------
Croceibact       PFEKSEAVQLKGTVSYEKDNDAEEDLVSQEVPTPTQAEDESGEDKAL-------------
Gramella         PFEREERESKTAKERKALEKKTKNDAESDDSTGETKDEEGKLTENDSVNK----------
Cellulopha       PFGKIEDEAKPVV-----------------------------------------------
Psychrofle       PFVKPEMIDNTERQKKKSDDREADQKASEEKAKQEKESEDKTDEDNNDDSKKDDKVESN-
Flavobactu1      PFDKGEEVEVNDTSVTES------------------------------------------
Flavobact2       PFIKEEAVALKSSTRSIAPTTNSKEEEE--------------------------------
ORF_KT22940      ------------------------------------------------------------
Pelodict1        PEGLFPVQPEEEFAPENGTESSRSSALQ--------------NNSDQFSDKEQAELEEAV
Chlorobiu1       PEGLFPVHLEEEPLPDIDEESAETATDPKESP-------A--NGSAPLSDTEQAELEAAV
Chlorobiu2       PEGGFPAHLHTECNGNGTRQETAE---------------E--PEIPVISSEERLELEAAV
Chlorobiu3       PPGLYQEHLEDPCSPVKSALNDAGNIPA-----------A--PIEGALGEKERMDLEAAV
Prosthechl2      PAGNGPEHIDRECDEHVVQAEATDTPAEKQ------------SNEDPVSKEERLKLEAAV
Chlorobiu6       PGASDDDAMSEECGKKAADRETGPDSNGK----------------TPVDEEELKNLEAAV
Prosthechl1      PGGGNSE-HEVDCSEKPEEE-----KPEIPAA-------DSNGKDPEISEEELLELQAAA
Pelodict2        PGGQEEDSGEVDCSKKSAENGMVAHEPETTAD-------AESTEKVGLSATELAELEAAA
Chlorobiu5       PAGKFSEHLAHDCQNGVDMAMSQLHTEPEEAAS-----PAVSAQQETATDPERKELEEAV
Chlorobiu4       PGGNLFPSSYDDVEEVEVDAAPSVTCEAAVVENGTAVSATTDKAKSQLSPCEQKALEEAV
                                                                             

Flavobact1       -----------------------
Flavobactu3      -----------------------
Flavobactu2      -----------------------
Robigni          EN---------------------
Flavobacle1      -----------------------
Flavobacle2      -----------------------
Croceibact       -----------------------
Gramella         -----------------------
Cellulopha       -----------------------
Psychrofle       -----------------------
Flavobactu1      -----------------------
Flavobact2       -----------------------
ORF_KT22940      -----------------------
Pelodict1        ARLRGERKAEEK-----------
Chlorobiu1       ARLKEARNIPEN-----------
Chlorobiu2       ARLKENREQPET-----------
Chlorobiu3       ARLRQEREKQEN-----------
Prosthechl2      EEIRKKRESSES-----------
Chlorobiu6       EKIRQSKNAEEN-----------
Prosthechl1      ERLKESRNASEN-----------
Pelodict2        ERLRQSRNVSDN-----------
Chlorobiu5       ERLRQSRNLSSN-----------
Chlorobiu4       ARIQRAREQREAQQQQQNPPSEV
                                        
                                        


BLAST

--------------------------------
Blastp contre nr, 1000 résultats
--------------------------------

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_01122231.1|  putative transmembrane AAA-metalloprotease...   380    2e-104
ref|ZP_01107151.1|  putative transmembrane AAA-metalloprotease...   377    2e-103
ref|ZP_01050223.1|  putative transmembrane AAA-metalloprotease...   376    6e-103
gb|EDP72069.1|  putative transmembrane AAA-metalloprotease Fts...   374    2e-102
ref|ZP_01734498.1|  putative transmembrane AAA-metalloprotease...   373    4e-102
ref|ZP_01890010.1|  putative transmembrane AAA-metalloprotease...   373    4e-102
ref|ZP_00951422.1|  putative transmembrane AAA-metalloprotease...   372    8e-102
ref|YP_862717.1|  cell division protease FtsH [Gramella forset...   371    1e-101 Gene info
ref|ZP_01059097.1|  putative transmembrane AAA-metalloprotease...   369    7e-101
ref|ZP_01203187.1|  AAA-metalloprotease FtsH [Flavobacteria ba...   369    9e-101
ref|YP_001295524.1|  Cell division protein FtsH [Flavobacteriu...   366    5e-100 Gene info
ref|YP_001194946.1|  ATP-dependent metalloprotease FtsH [Flavo...   360    2e-98  Gene info
ref|ZP_01252640.1|  putative transmembrane AAA-metalloprotease...   356    5e-97 
ref|ZP_01054196.1|  putative transmembrane AAA-metalloprotease...   354    2e-96 
ref|NP_904399.1|  cell division protein FtsH, putative [Porphy...   353    4e-96  Gene info
ref|YP_001299216.1|  AAA-metalloprotease FtsH with ATPase doma...   353    5e-96  Gene info
ref|ZP_01117899.1|  putative transmembrane AAA-metalloprotease...   351    2e-95 
ref|YP_098059.1|  AAA-metalloprotease FtsH with ATPase domain ...   348    1e-94  Gene info
ref|ZP_01960089.1|  hypothetical protein BACCAC_01700 [Bactero...   348    1e-94 
ref|ZP_02067816.1|  hypothetical protein BACOVA_04826 [Bactero...   347    3e-94 
ref|NP_812918.1|  AAA-metalloprotease FtsH, with ATPase domain...   346    4e-94  Gene info
ref|ZP_02072212.1|  hypothetical protein BACUNI_03657 [Bactero...   341    1e-92 
ref|YP_001303211.1|  AAA-metalloprotease FtsH, with ATPase dom...   341    2e-92  Gene info
ref|ZP_02033846.1|  hypothetical protein PARMER_03885 [Parabac...   337    4e-91 
ref|ZP_01884310.1|  cell division protein, ATP-dependent metal...   326    6e-88 
ref|ZP_01721530.1|  cell division protein FtsH, putative [Algo...   319    9e-86 
ref|ZP_01687892.1|  respiratory chain complexes assembly prote...   308    1e-82 
ref|YP_677240.1|  cell division protein, ATP-dependent metallo...   306    7e-82  Gene info
gb|ABS30436.1|  putative ATP-dependent metalloprotease [Candid...   297    3e-79 
ref|ZP_01308873.1|  ATP-dependent metalloprotease FtsH putativ...   297    3e-79 
ref|XP_638674.1|  AAA ATPase domain-containing protein [Dictyo...   293    5e-78  Gene info
emb|CAO21625.1|  unnamed protein product [Vitis vinifera]           286    5e-76 
gb|EAY98309.1|  hypothetical protein OsI_019542 [Oryza sativa ...   286    7e-76 
gb|AAU44017.1|  putative AAA-metalloprotease FtsH (fragment) [...   285    9e-76 
gb|EAZ34562.1|  hypothetical protein OsJ_018045 [Oryza sativa ...   285    9e-76 
ref|NP_001055745.1|  Os05g0458400 [Oryza sativa (japonica cult...   285    9e-76  UniGene infoGene info
gb|EAY76461.1|  hypothetical protein OsI_004308 [Oryza sativa ...   285    1e-75 
ref|ZP_00589380.1|  Peptidase M41, FtsH [Pelodictyon phaeoclat...   284    2e-75 
ref|NP_001044774.1|  Os01g0842600 [Oryza sativa (japonica cult...   283    5e-75  UniGene infoGene info
ref|NP_001039676.1|  hypothetical protein LOC515757 [Bos tauru...   283    7e-75  UniGene infoGene info
ref|XP_419121.1|  PREDICTED: hypothetical protein [Gallus gallus]   283    7e-75  UniGene infoGene info
emb|CAL56917.1|  FtsH protease, putative (ISS) [Ostreococcus taur   281    1e-74 
ref|XP_697627.1|  PREDICTED: hypothetical protein [Danio rerio]     280    3e-74  UniGene infoGene info
ref|XP_612083.3|  PREDICTED: similar to ATP-dependent zinc met...   280    4e-74  UniGene infoGene info
ref|XP_547682.2|  PREDICTED: similar to AFG3-like protein 2 (P...   280    4e-74  UniGene infoGene info
ref|XP_001171770.1|  PREDICTED: AFG3 ATPase family gene 3-like...   280    4e-74  Gene info
ref|NP_006787.1|  AFG3 ATPase family gene 3-like 2 [Homo sapie...   280    6e-74  UniGene infoGene info
ref|XP_512199.2|  PREDICTED: AFG3 ATPase family gene 3-like 2 ...   279    6e-74  Gene info
sp|Q9Y4W6|AFG32_HUMAN  AFG3-like protein 2 (Paraplegin-like pr...   279    6e-74  Gene info
ref|XP_001422694.1|  predicted protein [Ostreococcus lucimarin...   279    7e-74  Gene info
ref|NP_001015906.1|  AFG3(ATPase family gene 3)-like 1 [Xenopu...   279    8e-74  UniGene infoGene info
ref|XP_001371403.1|  PREDICTED: similar to AFG3 ATPase family ...   279    9e-74  Gene info
gb|AAK77908.1|AF397903_1  AAA-metalloprotease FtsH [Pisum sativum   279    9e-74 
gb|EAU92673.1|  hypothetical protein CC1G_01718 [Coprinopsis c...   278    1e-73 
ref|XP_001094146.1|  PREDICTED: AFG3 ATPase family gene 3-like...   278    1e-73  UniGene infoGene info
gb|AAH73566.1|  LOC443667 protein [Xenopus laevis]                  278    1e-73  UniGene infoGene info
dbj|BAE29204.1|  unnamed protein product [Mus musculus]             278    2e-73  UniGene infoGene info
dbj|BAE30959.1|  unnamed protein product [Mus musculus] >dbj|B...   278    2e-73  UniGene infoGene info
emb|CAF90270.1|  unnamed protein product [Tetraodon nigroviridis]   278    2e-73 
gb|AAH24282.1|  Similar to AFG3 ATPase family gene 3-like 2 (y...   278    2e-73  UniGene infoGene info
ref|NP_081406.1|  AFG3(ATPase family gene 3)-like 2 [Mus muscu...   278    2e-73  UniGene infoGene info
ref|XP_001171710.1|  PREDICTED: AFG3 ATPase family gene 3-like...   278    2e-73  Gene info
gb|AAF79577.1|AC022464_35  F22G5.10 [Arabidopsis thaliana]          277    3e-73 
ref|XP_225866.4|  PREDICTED: similar to AFG3-like protein 2 (P...   277    3e-73  UniGene infoGene info
gb|EAX01551.1|  AFG3 ATPase family gene 3-like 2 (yeast), isof...   277    3e-73  Gene info
ref|XP_001482624.1|  hypothetical protein PGUG_05644 [Pichia g...   277    3e-73  Gene info
ref|NP_172231.2|  FTSH10 (FtsH protease 10); ATPase [Arabidops...   277    3e-73  UniGene infoGene info
ref|XP_001632616.1|  predicted protein [Nematostella vectensis...   277    3e-73  Gene info
gb|AAH71038.1|  LOC432063 protein [Xenopus laevis]                  277    4e-73  UniGene infoGene info
ref|NP_001072759.1|  hypothetical protein LOC780216 [Xenopus t...   277    4e-73  UniGene infoGene info
ref|XP_001377922.1|  PREDICTED: similar to AFG3(ATPase family ...   276    4e-73  Gene info
ref|XP_569263.1|  ATPase [Cryptococcus neoformans var. neoform...   276    5e-73  Gene info
ref|XP_001510851.1|  PREDICTED: similar to AFG3(ATPase family ...   276    6e-73  Gene info
ref|XP_001528708.1|  hypothetical protein LELG_01228 [Lodderom...   276    8e-73  Gene info
ref|XP_459952.1|  hypothetical protein DEHA0E15455g [Debaryomy...   276    8e-73  Gene info
ref|XP_001382776.2|  Mitochondrial respiratory chain complexes...   274    3e-72  Gene info
ref|NP_473411.2|  AFG3(ATPase family gene 3)-like 1 [Mus muscu...   274    3e-72  UniGene infoGene info
ref|XP_001094032.1|  PREDICTED: AFG3 ATPase family gene 3-like...   273    4e-72  UniGene infoGene info
ref|NP_982906.1|  ABL041Wp [Ashbya gossypii ATCC 10895] >gb|AA...   273    5e-72 
ref|XP_757045.1|  hypothetical protein UM00898.1 [Ustilago may...   273    6e-72  Gene info
ref|XP_783782.2|  PREDICTED: similar to AFG3 ATPase family gen...   273    7e-72  UniGene infoGene info
ref|XP_001602382.1|  PREDICTED: similar to SD01613p [Nasonia vitr   272    1e-71  Gene info
ref|NP_730248.2|  CG6512-PA, isoform A [Drosophila melanogaste...   271    1e-71  UniGene infoGene info
ref|XP_624548.2|  PREDICTED: similar to CG6512-PB, isoform B [Api   271    1e-71  UniGene infoGene info
ref|XP_001458505.1|  hypothetical protein [Paramecium tetraure...   271    2e-71  Gene info
ref|XP_001643369.1|  hypothetical protein Kpol_467p23 [Vanderw...   271    2e-71  Gene info
gb|EDL92813.1|  AFG3(ATPase family gene 3)-like 1 (yeast) (pre...   270    3e-71  Gene info
sp|Q920A7|AFG31_MOUSE  AFG3-like protein 1 >gb|AAK66971.1|AF32...   270    4e-71  Gene info
ref|NP_730250.1|  CG6512-PB, isoform B [Drosophila melanogaste...   270    4e-71  UniGene infoGene info
ref|XP_969110.1|  PREDICTED: similar to CG6512-PB, isoform B [...   270    4e-71  UniGene infoGene info
ref|XP_308807.4|  AGAP006949-PA [Anopheles gambiae str. PEST] ...   270    6e-71  Gene info
ref|XP_719629.1|  hypothetical protein CaO19_9604 [Candida alb...   270    6e-71  Gene info
emb|CAF97727.1|  unnamed protein product [Tetraodon nigroviridis]   268    1e-70 
ref|XP_001354111.1|  GA19652-PA [Drosophila pseudoobscura] >gb...   268    2e-70  Gene info
ref|XP_001272939.1|  mitochondrial inner membrane AAA protease...   268    2e-70  Gene info
ref|XP_662161.1|  hypothetical protein AN4557.2 [Aspergillus n...   268    2e-70  Gene info
ref|XP_001653295.1|  metalloprotease m41 ftsh [Aedes aegypti] ...   267    3e-70  Gene info
ref|XP_455697.1|  unnamed protein product [Kluyveromyces lacti...   267    3e-70  Gene info
ref|XP_001209595.1|  hypothetical protein ATEG_06909 [Aspergil...   267    4e-70  Gene info
ref|XP_749403.1|  mitochondrial inner membrane AAA protease Yt...   266    4e-70  Gene info
ref|XP_001265837.1|  mitochondrial inner membrane AAA protease...   266    5e-70  Gene info
ref|XP_001248025.1|  hypothetical protein CIMG_01796 [Coccidio...   266    6e-70  Gene info
dbj|BAE60037.1|  unnamed protein product [Aspergillus oryzae]       266    7e-70 
ref|XP_001433814.1|  hypothetical protein [Paramecium tetraure...   266    8e-70  Gene info
ref|XP_447770.1|  unnamed protein product [Candida glabrata] >...   265    1e-69  Gene info
emb|CAA56955.1|  YTA12 (=RCA1) [Saccharomyces cerevisiae]           265    1e-69 
gb|AAO32953.1|  putative AFG3-like protein 2 [Schistosoma japonic   265    1e-69  UniGene info
gb|EDN64476.1|  ATPase [Saccharomyces cerevisiae YJM789]            265    1e-69 
gb|AAA62606.1|  Rca1p                                               265    1e-69 
ref|NP_013807.1|  Component, with Afg3p, of the mitochondrial ...   265    1e-69  Gene info
gb|AAT93118.1|  YMR089C [Saccharomyces cerevisiae]                  265    1e-69 
ref|XP_001527410.1|  cell division protein ftsH [Lodderomyces ...   265    2e-69  Gene info
ref|XP_001439517.1|  hypothetical protein GSPATT00038737001 [P...   265    2e-69  Gene info
ref|XP_001689949.1|  membrane AAA-metalloprotease [Chlamydomon...   264    3e-69  Gene info
ref|XP_721746.1|  ATP-dependent metalloprotease [Candida albic...   263    5e-69  Gene info
ref|XP_499951.1|  hypothetical protein [Yarrowia lipolytica] >...   263    7e-69  Gene info
ref|YP_077024.1|  cell division protein [Symbiobacterium therm...   262    8e-69  Gene info
ref|YP_001129665.1|  ATP-dependent metalloprotease FtsH [Prost...   262    9e-69  Gene info
ref|ZP_01386541.1|  ATP-dependent metalloprotease FtsH [Chloro...   262    1e-68 
ref|XP_001539851.1|  hypothetical protein HCAG_05318 [Ajellomy...   262    1e-68  Gene info
ref|XP_459165.1|  hypothetical protein DEHA0D17061g [Debaryomy...   261    2e-68  Gene info
ref|XP_447208.1|  unnamed protein product [Candida glabrata] >...   261    2e-68  Gene info
ref|XP_001391774.1|  hypothetical protein An07g07000 [Aspergil...   261    2e-68  Gene info
ref|NP_982566.1|  AAR025Cp [Ashbya gossypii ATCC 10895] >gb|AA...   260    3e-68 
ref|ZP_00512338.1|  Peptidase M41, FtsH [Chlorobium limicola D...   260    3e-68 
emb|CAA54091.1|  Afg3p [Saccharomyces cerevisiae]                   260    4e-68 
ref|NP_519647.1|  PROBABLE ATP-DEPENDENT ZINC METALLOPEPTIDASE...   260    4e-68  Gene info
emb|CAF92797.1|  unnamed protein product [Tetraodon nigroviridis]   260    5e-68 
gb|EDN62985.1|  ATP dependent metalloprotease [Saccharomyces cere   259    5e-68 
ref|NP_010933.1|  Component, with Yta12p, of the mitochondrial...   259    5e-68  Gene info
ref|YP_544892.1|  ATP-dependent metalloprotease FtsH [Methylob...   259    5e-68  Gene info
ref|ZP_00944796.1|  Cell division protein ftsH [Ralstonia sola...   259    5e-68 
ref|YP_374011.1|  Peptidase M41, FtsH [Pelodictyon luteolum DS...   259    5e-68  Gene info
ref|XP_001487202.1|  conserved hypothetical protein [Pichia gu...   259    7e-68  Gene info
ref|XP_001007289.1|  ATP-dependent metalloprotease FtsH family...   259    7e-68  Gene info
ref|YP_913086.1|  ATP-dependent metalloprotease FtsH [Chlorobi...   259    9e-68  Gene info
ref|ZP_02010254.1|  ATP-dependent metalloprotease FtsH [Ralsto...   259    1e-67 
ref|ZP_01664237.1|  Vesicle-fusing ATPase [Ralstonia pickettii...   259    1e-67 
ref|XP_386992.1|  hypothetical protein FG06816.1 [Gibberella zeae   258    1e-67  Gene info
ref|YP_378329.1|  Peptidase M41, FtsH [Chlorobium chlorochroma...   258    1e-67  Gene info
ref|XP_001382432.2|  AAA+-type ATPase [Pichia stipitis CBS 605...   258    2e-67  Gene info
ref|NP_661033.1|  cell division protein FtsH [Chlorobium tepid...   258    2e-67  Gene info
ref|XP_001623522.1|  predicted protein [Nematostella vectensis...   258    2e-67  Gene info
ref|XP_367530.1|  hypothetical protein MGG_07441 [Magnaporthe ...   257    3e-67  Gene info
gb|AAC84037.1|  ATP-dependent zinc metallopeptidase FtsH [Heli...   257    3e-67 
gb|EDP30080.1|  Human spg, putative [Brugia malayi]                 257    3e-67 
ref|YP_359086.1|  cell division protein FtsH [Carboxydothermus...   257    3e-67  Gene info
ref|ZP_00591252.1|  Peptidase M41, FtsH [Prosthecochloris aest...   257    3e-67 
ref|YP_445161.1|  cell division protein FtsH [Salinibacter rub...   257    3e-67  Gene info
ref|XP_971016.1|  PREDICTED: similar to protein kinase N2 [Tribol   257    4e-67  UniGene infoGene info
gb|EDP41917.1|  hypothetical protein MGL_3598 [Malassezia globosa   256    5e-67 
ref|YP_001279440.1|  ATP-dependent metalloprotease FtsH [Psych...   256    5e-67  Gene info
ref|XP_001643056.1|  hypothetical protein Kpol_401p3 [Vanderwa...   256    5e-67  Gene info
ref|YP_265020.1|  putative ATP-dependent metalloprotease FtsH ...   256    5e-67  Gene info
gb|AAL36270.1|  putative AAA-type ATPase [Arabidopsis thaliana]     256    6e-67  UniGene info
ref|YP_581281.1|  ATP-dependent metalloprotease FtsH [Psychrob...   256    6e-67  Gene info
ref|YP_584336.1|  ATP-dependent metalloprotease FtsH [Ralstoni...   256    6e-67  Gene info
ref|NP_850129.1|  FTSH3 (FtsH protease 3); ATP-dependent pepti...   256    7e-67  UniGene infoGene info
gb|AAC33234.1|  putative AAA-type ATPase [Arabidopsis thaliana]     256    7e-67 
ref|NP_596797.1|  hypothetical protein SPBC543.09 [Schizosacch...   256    7e-67  Gene info
ref|ZP_00532235.1|  Peptidase M41, FtsH [Chlorobium phaeobacte...   256    7e-67 
ref|YP_293364.1|  Peptidase M41, FtsH [Ralstonia eutropha JMP1...   256    9e-67  Gene info
gb|EAT77998.2|  hypothetical protein SNOG_14806 [Phaeosphaeria no   255    1e-66 
ref|YP_428987.1|  ATP-dependent metalloprotease FtsH [Moorella...   255    1e-66  Gene info
ref|YP_296378.1|  Peptidase M41, FtsH [Ralstonia eutropha JMP1...   254    2e-66  Gene info
ref|YP_726904.1|  FtsH endopeptidase [Ralstonia eutropha H16] ...   254    3e-66  Gene info
gb|AAN03852.1|AF512565_1  paraplegin [Mus musculus]                 253    4e-66  UniGene infoGene info
gb|EDL11706.1|  mCG132921, isoform CRA_a [Mus musculus]             253    4e-66 
ref|NP_491165.2|  Y47G6A.10 [Caenorhabditis elegans] >gb|AAF60...   253    4e-66  UniGene infoGene info
ref|YP_001359254.1|  cell division protein FtsH [Sulfurovum sp...   253    5e-66  Gene info
gb|EAY69190.1|  Peptidase M41 [Burkholderia dolosa AUO158]          253    6e-66 
ref|XP_001667853.1|  Hypothetical protein CBG14947 [Caenorhabd...   253    6e-66  Gene info
ref|ZP_01570130.1|  ATP-dependent metalloprotease FtsH [Burkho...   253    6e-66 
ref|ZP_00438574.1|  COG0465: ATP-dependent Zn proteases [Burkh...   253    6e-66 
ref|ZP_00986088.1|  COG0465: ATP-dependent Zn proteases [Burkh...   253    7e-66 
ref|YP_001210748.1|  ATP-dependent Zn proteases [Pelotomaculum...   253    7e-66  Gene info
ref|XP_001139499.1|  PREDICTED: paraplegin isoform 1 [Pan troglod   252    9e-66  Gene info
ref|YP_368679.1|  Peptidase M41, FtsH [Burkholderia sp. 383] >...   252    9e-66  Gene info
ref|ZP_01514400.1|  ATP-dependent metalloprotease FtsH [Chloro...   252    9e-66 
ref|XP_001140165.1|  PREDICTED: paraplegin isoform 3 [Pan troglod   252    1e-65  Gene info
ref|XP_001377432.1|  PREDICTED: similar to Spastic paraplegia ...   252    1e-65  Gene info
ref|YP_001379230.1|  ATP-dependent metalloprotease FtsH [Anaer...   252    1e-65  Gene info
gb|EDL11707.1|  mCG132921, isoform CRA_b [Mus musculus]             252    1e-65 
ref|NP_001012545.1|  spastic paraplegia 7 [Gallus gallus] >emb...   252    1e-65  UniGene infoGene info
ref|YP_443288.1|  cell division protein FtsH [Burkholderia tha...   252    1e-65  Gene info
ref|ZP_00982270.1|  COG0465: ATP-dependent Zn proteases [Burkh...   252    1e-65 
ref|YP_107981.1|  FtsH endopeptidase [Burkholderia pseudomalle...   252    1e-65  Gene info
ref|XP_001511408.1|  PREDICTED: similar to paired box 9 [Ornithor   252    1e-65  UniGene infoGene info
ref|XP_001458565.1|  hypothetical protein [Paramecium tetraure...   252    1e-65  Gene info
ref|YP_001119095.1|  ATP-dependent metalloprotease FtsH [Burkh...   252    1e-65  Gene info
ref|YP_773066.1|  ATP-dependent metalloprotease FtsH [Burkhold...   252    1e-65  Gene info
ref|YP_834942.1|  ATP-dependent metalloprotease FtsH [Burkhold...   252    1e-65  Gene info
gb|EAW66729.1|  spastic paraplegia 7, paraplegin (pure and com...   252    1e-65  Gene info
ref|YP_001085696.1|  cell division protein [Acinetobacter baum...   252    1e-65  Gene info
gb|EAW66727.1|  spastic paraplegia 7, paraplegin (pure and com...   252    1e-65  Gene info
ref|ZP_01666881.1|  ATP-dependent metalloprotease FtsH [Thermo...   251    1e-65 
dbj|BAA88164.1|  FtsH2 [Cyanidioschyzon merolae]                    251    1e-65 
ref|ZP_01500547.1|  ATP-dependent metalloprotease FtsH [Burkho...   251    2e-65 
ref|XP_001140249.1|  PREDICTED: paraplegin isoform 4 [Pan troglod   251    2e-65  Gene info
ref|YP_001111501.1|  ATP-dependent metalloprotease FtsH [Desul...   251    2e-65  Gene info
ref|NP_003110.1|  spastic paraplegia 7 isoform 1 [Homo sapiens...   251    2e-65  UniGene infoGene info
gb|AAD28099.1|  paraplegin [Homo sapiens]                           251    2e-65  Gene info
ref|XP_645267.1|  hypothetical protein DDB_0185211 [Dictyostel...   251    2e-65  Gene info
ref|NP_694816.3|  spastic paraplegia 7 homolog [Mus musculus] ...   251    2e-65  UniGene infoGene info
gb|AAO21098.1|  paraplegin [Mus musculus]                           251    2e-65  UniGene infoGene info
gb|AAH51051.1|  Spg7 protein [Mus musculus]                         251    2e-65  UniGene infoGene info
ref|XP_001488280.1|  PREDICTED: similar to paraplegin [Equus caba   251    2e-65  UniGene infoGene info
gb|AAH36104.1|  Spastic paraplegia 7 (pure and complicated aut...   251    2e-65  UniGene infoGene info
ref|YP_001155793.1|  ATP-dependent metalloprotease FtsH [Polyn...   251    2e-65  Gene info
ref|ZP_01461709.1|  peptidase M41, FtsH [Stigmatella aurantiac...   251    3e-65 
ref|ZP_01513339.1|  ATP-dependent metalloprotease FtsH [Burkho...   251    3e-65 
ref|YP_559743.1|  Peptidase M41, FtsH [Burkholderia xenovorans...   251    3e-65  Gene info
ref|YP_632507.1|  ATP-dependent metalloprotease FtsH [Myxococc...   250    3e-65  Gene info
ref|YP_047405.1|  cell division protein [Acinetobacter sp. ADP...   250    3e-65  Gene info
ref|XP_546777.2|  PREDICTED: similar to Paraplegin (Spastic pa...   250    3e-65  UniGene infoGene info
emb|CAJ72341.1|  strongly similar to ATP-dependent zinc-metall...   250    4e-65 
gb|AAH55488.1|  Spg7 protein [Mus musculus]                         250    4e-65  UniGene infoGene info
gb|AAH35929.1|  SPG7 protein [Homo sapiens]                         250    5e-65  UniGene infoGene info
ref|YP_001539488.1|  ATP-dependent metalloprotease FtsH [Salin...   249    5e-65  Gene info
ref|YP_847544.1|  ATP-dependent metalloprotease FtsH [Syntroph...   249    6e-65  Gene info
ref|XP_689768.1|  PREDICTED: hypothetical protein [Danio rerio...   249    7e-65  UniGene infoGene info
ref|XP_001140079.1|  PREDICTED: paraplegin isoform 2 [Pan troglod   249    7e-65  Gene info
gb|EAZ02414.1|  hypothetical protein OsI_023646 [Oryza sativa ...   249    9e-65 
ref|ZP_01551916.1|  ATP-dependent metalloprotease FtsH [Methyl...   249    9e-65 
gb|AAH24466.1|  Spg7 protein [Mus musculus]                         249    1e-64  UniGene infoGene info
gb|AAH24986.1|  Spg7 protein [Mus musculus]                         249    1e-64  UniGene infoGene info
ref|YP_001099475.1|  Cell division protease [Herminiimonas ars...   249    1e-64  Gene info
gb|AAH96690.1|  Spg7 protein [Mus musculus]                         249    1e-64  UniGene infoGene info
ref|ZP_01872077.1|  ZINC METALLOPEPTIDASE [Caminibacter mediat...   248    1e-64 
ref|YP_001353927.1|  peptidase M41 (cell division protein) [Ja...   248    1e-64  Gene info
ref|NP_903467.1|  cell division protein FtsH [Chromobacterium ...   248    1e-64  Gene info
ref|NP_568604.1|  VAR1 (VARIEGATED 1); ATP-dependent peptidase...   248    1e-64  UniGene infoGene info
ref|ZP_00766456.1|  Peptidase M41, FtsH [Chloroflexus aurantia...   248    2e-64 
ref|YP_960649.1|  ATP-dependent metalloprotease FtsH [Marinoba...   248    2e-64  Gene info
gb|EAZ38336.1|  hypothetical protein OsJ_021819 [Oryza sativa ...   248    2e-64 
ref|YP_001161114.1|  ATP-dependent metalloprotease FtsH [Salin...   248    2e-64  Gene info
ref|NP_001058625.1|  Os06g0725900 [Oryza sativa (japonica cult...   248    2e-64  UniGene infoGene info
ref|YP_506309.1|  ATP-dependent metalloprotease FtsH [Neoricke...   248    2e-64  Gene info
ref|YP_970963.1|  ATP-dependent metalloprotease FtsH [Acidovor...   248    2e-64  Gene info
ref|YP_001394005.1|  FtsH2 [Clostridium kluyveri DSM 555] >gb|...   248    3e-64  Gene info
ref|XP_001433748.1|  hypothetical protein [Paramecium tetraure...   247    3e-64  Gene info
emb|CAO62015.1|  unnamed protein product [Vitis vinifera]           247    3e-64 
ref|XP_001559267.1|  hypothetical protein BC1G_01931 [Botryoti...   247    3e-64  Gene info
ref|ZP_00106389.1|  COG0465: ATP-dependent Zn proteases [Nosto...   247    3e-64 
ref|ZP_01519700.1|  ATP-dependent metalloprotease FtsH [Comamo...   247    3e-64 
ref|YP_114285.1|  cell division protein FtsH [Methylococcus ca...   247    4e-64  Gene info
ref|NP_681318.1|  cell division protein [Thermosynechococcus e...   247    4e-64  Gene info
ref|YP_986620.1|  ATP-dependent metalloprotease FtsH [Acidovor...   247    4e-64  Gene info
sp|O82150|FTSH_TOBAC  Cell division protease ftsH homolog, chl...   247    4e-64 
ref|YP_476269.1|  metalloprotease, ATP-dependent, FtsH family ...   247    4e-64  Gene info
ref|XP_001334746.1|  PREDICTED: similar to Spg7 protein [Danio re   247    4e-64  Gene info
ref|YP_559117.1|  Peptidase M41, FtsH [Burkholderia xenovorans...   246    5e-64  Gene info
ref|ZP_01664914.1|  peptidase M41, FtsH [Ralstonia pickettii 1...   246    5e-64 
ref|YP_644577.1|  ATP-dependent metalloprotease FtsH [Rubrobac...   246    5e-64  Gene info
ref|YP_001565939.1|  ATP-dependent metalloprotease FtsH [Delft...   246    5e-64 
emb|CAJ73838.1|  strongly similar to cell division protein Fts...   246    5e-64 
ref|ZP_01567651.1|  ATP-dependent metalloprotease FtsH [Burkho...   246    5e-64 
ref|YP_473500.1|  metalloprotease, ATP-dependent, FtsH family ...   246    5e-64  Gene info
ref|NP_001095492.1|  hypothetical protein LOC515269 [Bos tauru...   246    5e-64  Gene info
emb|CAD32530.1|  putative zinc metallopeptidase [uncultured bacte   246    5e-64 
ref|XP_500430.1|  hypothetical protein [Yarrowia lipolytica] >...   246    6e-64  Gene info
gb|EAY56376.1|  ATP-dependent Zn protease [Leptospirillum sp. Gro   246    6e-64 
ref|YP_001115466.1|  ATP-dependent metalloprotease FtsH [Burkh...   246    6e-64  Gene info
ref|XP_001598464.1|  hypothetical protein SS1G_00553 [Scleroti...   246    6e-64  Gene info
ref|XP_001601862.1|  PREDICTED: similar to paraplegin [Nasonia vi   246    7e-64  Gene info
ref|YP_757642.1|  ATP-dependent metalloprotease FtsH [Maricaul...   246    7e-64  Gene info
ref|YP_516434.1|  hypothetical protein DSY0201 [Desulfitobacte...   246    8e-64  Gene info
ref|NP_050804.1|  hypothetical chloroplast RF25 [Guillardia th...   246    8e-64  Gene info
ref|ZP_01371644.1|  ATP-dependent metalloprotease FtsH [Desulf...   246    9e-64 
ref|YP_644941.1|  ATP-dependent metalloprotease FtsH [Rubrobac...   246    9e-64  Gene info
ref|YP_847305.1|  ATP-dependent metalloprotease FtsH [Syntroph...   246    9e-64  Gene info
ref|ZP_00982862.1|  COG0465: ATP-dependent Zn proteases [Burkh...   246    9e-64 
ref|YP_844685.1|  ATP-dependent metalloprotease FtsH [Syntroph...   246    9e-64  Gene info
ref|YP_001567512.1|  ATP-dependent metalloprotease FtsH [Petro...   246    9e-64 
ref|YP_710241.1|  cell division protein [Borrelia afzelii PKo]...   246    1e-63  Gene info
gb|EAY71977.1|  ATP-dependent Zn protease [Burkholderia dolosa AU   245    1e-63 
ref|YP_661147.1|  ATP-dependent metalloprotease FtsH [Pseudoal...   245    1e-63  Gene info
ref|YP_549665.1|  ATP-dependent metalloprotease FtsH [Polaromo...   245    1e-63  Gene info
ref|YP_476882.1|  cell division protein FtsH [Synechococcus sp...   245    1e-63  Gene info
sp|Q9BAE0|FTSH_MEDSA  Cell division protease ftsH homolog, chl...   245    1e-63 
ref|ZP_01561086.1|  ATP-dependent metalloprotease FtsH [Burkho...   245    1e-63 
ref|YP_995021.1|  ATP-dependent metalloprotease FtsH [Verminep...   245    1e-63  Gene info
ref|ZP_01864646.1|  ATP-dependent Zn protease [Erythrobacter s...   245    1e-63 
ref|ZP_01307911.1|  cell division protein FtsH [Oceanobacter s...   245    1e-63 
ref|YP_932891.1|  probable cell division protein FtsH [Azoarcu...   245    1e-63  Gene info
ref|ZP_02007621.1|  ATP-dependent metalloprotease FtsH [Ralsto...   245    1e-63 
ref|YP_545277.1|  ATP-dependent metalloprotease FtsH [Methylob...   244    2e-63  Gene info
ref|YP_476117.1|  cell division protein FtsH [Synechococcus sp...   244    2e-63  Gene info
emb|CAA68141.1|  chloroplast FtsH protease [Arabidopsis thaliana]   244    2e-63  UniGene info
ref|YP_391082.1|  ATP-dependent metalloprotease FtsH [Thiomicr...   244    2e-63  Gene info
ref|NP_212923.1|  cell division protein (ftsH) [Borrelia burgd...   244    2e-63  Gene info
ref|YP_523267.1|  ATP-dependent metalloprotease FtsH [Rhodofer...   244    2e-63  Gene info
ref|ZP_01925721.1|  ATP-dependent metalloprotease FtsH [Victiv...   244    2e-63 
ref|ZP_01570534.1|  ATP-dependent metalloprotease FtsH [Burkho...   244    3e-63 
ref|XP_001690889.1|  membrane AAA-metalloprotease [Chlamydomon...   244    3e-63  Gene info
ref|XP_001611654.1|  ATP-dependent metalloprotease FtsH family...   244    3e-63  Gene info
ref|NP_564563.1|  FTSH1 (FtsH protease 1); ATP-dependent pepti...   244    3e-63  UniGene infoGene info
ref|XP_001615314.1|  ATP-dependent metalloprotease, putative [...   244    3e-63  Gene info
ref|ZP_00979420.1|  COG0465: ATP-dependent Zn proteases [Burkh...   244    3e-63 
ref|YP_464984.1|  FtsH-2 peptidase. Metallo peptidase. MEROPS ...   244    3e-63  Gene info
ref|YP_303508.1|  Peptidase M41, FtsH [Ehrlichia canis str. Ja...   244    3e-63  Gene info
ref|NP_871234.1|  hypothetical protein WGLp231 [Wigglesworthia...   244    3e-63  Gene info
gb|EDP78845.1|  ATP-dependent metalloprotease FtsH [Anaeromyxobac   244    3e-63 
ref|NP_440330.1|  cell division protein; FtsH [Synechocystis s...   244    3e-63  Gene info
ref|YP_001278646.1|  ATP-dependent metalloprotease FtsH [Rosei...   244    3e-63  Gene info
ref|ZP_00519307.1|  Peptidase M41, FtsH [Crocosphaera watsonii...   244    3e-63 
ref|YP_001516758.1|  ATP-dependent metalloprotease FtsH-like p...   244    3e-63  Gene info
ref|NP_053937.1|  ORF25 [Porphyra purpurea] >sp|P51327|FTSH_PO...   244    3e-63  Gene info
ref|YP_389903.1|  ATP-dependent metalloprotease FtsH [Desulfov...   244    3e-63  Gene info
ref|ZP_01624495.1|  cell division protein [Lyngbya sp. PCC 810...   244    3e-63 
ref|YP_623786.1|  ATP-dependent metalloprotease FtsH [Burkhold...   244    3e-63  Gene info
ref|YP_266025.1|  metalloprotease FtsH [Candidatus Pelagibacte...   244    3e-63  Gene info
ref|ZP_01264229.1|  metalloprotease FtsH [Candidatus Pelagibac...   244    3e-63 
ref|YP_372278.1|  Peptidase M41, FtsH [Burkholderia sp. 383] >...   244    4e-63  Gene info
ref|YP_982834.1|  ATP-dependent metalloprotease FtsH [Polaromo...   243    4e-63  Gene info
ref|YP_001328288.1|  ATP-dependent metalloprotease FtsH [Sinor...   243    4e-63  Gene info
ref|YP_001545795.1|  ATP-dependent metalloprotease FtsH [Herpe...   243    4e-63  Gene info
ref|YP_163394.1|  ATP-dependent Zn protease [Zymomonas mobilis...   243    4e-63  Gene info
ref|YP_001519206.1|  ATP-dependent metalloprotease FtsH-like p...   243    5e-63  Gene info
ref|ZP_02000243.1|  ATP-dependent metalloprotease FtsH [Beggia...   243    5e-63 
ref|YP_001293616.1|  cell division protein [Rhodomonas salina]...   243    5e-63  Gene info
ref|YP_001567865.1|  ATP-dependent metalloprotease FtsH [Petro...   243    5e-63 
ref|NP_879861.1|  cell division protein [Bordetella pertussis ...   243    6e-63  Gene info
emb|CAJ48542.1|  cell division protein [Bordetella avium 197N]      243    6e-63 
ref|NP_884325.1|  cell division protein [Bordetella parapertus...   243    6e-63  Gene info
ref|NP_888005.1|  cell division protein [Bordetella bronchisep...   243    6e-63  Gene info
ref|YP_537009.1|  hypothetical chloroplast protein 25 [Porphyr...   243    6e-63  Gene info
ref|YP_001430856.1|  ATP-dependent metalloprotease FtsH [Rosei...   243    7e-63  Gene info
ref|YP_877423.1|  cell division protein ftsH [Clostridium novy...   243    7e-63  Gene info
ref|NP_924863.1|  cell division protein [Gloeobacter violaceus...   243    7e-63  Gene info
ref|YP_877130.1|  ATP-dependent metalloprotease FtsH [Clostrid...   243    7e-63  Gene info
ref|ZP_01554140.1|  ATP-dependent metalloprotease FtsH [Burkho...   243    7e-63 
ref|YP_495359.1|  ATP-dependent metalloprotease FtsH [Novosphi...   243    7e-63  Gene info
ref|ZP_01189487.1|  Peptidase M41, FtsH [Halothermothrix oreni...   243    8e-63 
ref|ZP_00544760.1|  Peptidase M41, FtsH [Ehrlichia chaffeensis...   243    8e-63 
ref|ZP_01553179.1|  ATP-dependent metalloprotease FtsH [Burkho...   243    8e-63 
ref|NP_442160.1|  cell division protein; FtsH [Synechocystis s...   243    8e-63  Gene info
ref|YP_775762.1|  ATP-dependent metalloprotease FtsH [Burkhold...   243    8e-63  Gene info
ref|YP_001518882.1|  ATP-dependent metalloprotease FtsH-like p...   242    9e-63  Gene info
ref|NP_386841.1|  PROBABLE METALLOPROTEASE TRANSMEMBRANE PROTE...   242    9e-63  Gene info
ref|YP_180706.1|  cell division protein FtsH [Ehrlichia rumina...   242    9e-63  Gene info
ref|ZP_01618923.1|  cell division protein [Lyngbya sp. PCC 810...   242    1e-62 
ref|YP_001392879.1|  ATP-dependent metalloprotease FtsH [Clost...   242    1e-62  Gene info
ref|ZP_01113205.1|  cell division protein FtsH [Reinekea sp. M...   242    1e-62 
gb|EDP73698.1|  cell division protein FtsH [Hydrogenivirga sp. 12   242    1e-62 
ref|ZP_01502471.1|  ATP-dependent metalloprotease FtsH [Burkho...   242    1e-62 
ref|YP_001020465.1|  Vesicle-fusing ATPase [Methylibium petrol...   242    1e-62  Gene info
ref|YP_001517549.1|  ATP-dependent metalloprotease FtsH-like p...   242    1e-62  Gene info
ref|YP_073228.1|  cell division protein [Borrelia garinii PBi]...   242    1e-62  Gene info
ref|NP_283785.1|  ATP-dependent zinc metallopeptidase [Neisser...   242    1e-62  Gene info
emb|CAO90156.1|  ftsH3 [Microcystis aeruginosa PCC 7806]            242    1e-62 
ref|ZP_01545730.1|  metalloprotease (cell division protein) Ft...   242    1e-62 
gb|EDN74693.1|  M41 family endopeptidase FtsH [Mannheimia haemoly   242    1e-62 
gb|AAG48697.1|AF323912_1  matrix AAA protease MAP-1 [Neurospora c   242    1e-62 
emb|CAO87315.1|  unnamed protein product [Microcystis aeruginosa    242    1e-62 
ref|YP_001515937.1|  ATP-dependent metalloprotease FtsH-like p...   242    1e-62  Gene info
ref|ZP_01942762.1|  ATP-dependent metalloprotease FtsH [Lister...   242    1e-62 
ref|YP_012841.1|  ATP-dependent metalloprotease FtsH [Listeria...   242    1e-62  Gene info
ref|NP_463751.1|  hypothetical protein lmo0220 [Listeria monoc...   242    1e-62  Gene info
ref|ZP_00234819.1|  ATP-dependent metalloprotease FtsH [Lister...   242    1e-62 
ref|ZP_01926200.1|  ATP-dependent metalloprotease FtsH [Lister...   242    1e-62 
ref|XP_956756.1|  hypothetical protein ( (AF323912) matrix AAA...   242    1e-62  Gene info
ref|ZP_01731928.1|  cell division protein; FtsH [Cyanothece sp...   242    1e-62 
ref|ZP_01915356.1|  cell division protein [Limnobacter sp. MED...   241    2e-62 
ref|YP_062948.1|  cell division protein [Leifsonia xyli subsp....   241    2e-62  Gene info
gb|AAQ93011.1|  FtsH-like protein precursor [Solanum lycopersicum   241    2e-62  UniGene infoGene info
ref|ZP_01728766.1|  cell division protein; FtsH [Cyanothece sp...   241    2e-62 
sp|O32617|FTSH_HELFE  Cell division protease ftsH homolog >emb...   241    2e-62 
ref|YP_116604.1|  putative cell division protein [Nocardia far...   241    2e-62  Gene info
ref|YP_001550133.1|  cell division protein FtsH2 [Prochlorococ...   241    2e-62  Gene info
ref|NP_469597.1|  ftsH [Listeria innocua Clip11262] >emb|CAC95...   241    2e-62  Gene info
ref|YP_001515656.1|  ATP-dependent metalloprotease FtsH-like p...   241    2e-62  Gene info
ref|YP_291488.1|  peptidase M41, FtsH [Prochlorococcus marinus...   241    2e-62  Gene info
ref|YP_989640.1|  ATP-dependent metalloprotease, FtsH family [...   241    2e-62  Gene info
ref|YP_848384.1|  cell division ATP-dependent metalloprotease ...   241    2e-62  Gene info
ref|ZP_00629793.1|  Peptidase M41, FtsH [Paracoccus denitrific...   241    2e-62  Gene info
ref|NP_966965.1|  cell division protein FtsH [Wolbachia endosy...   241    2e-62  Gene info
ref|YP_001174140.1|  cell division protein FtsH [Pseudomonas s...   241    2e-62  Gene info
ref|ZP_01040540.1|  ATP-dependent Zn protease [Erythrobacter s...   241    2e-62 
ref|YP_001014788.1|  FtsH ATP-dependent protease-like protein ...   241    2e-62  Gene info
ref|YP_616645.1|  ATP-dependent metalloprotease FtsH [Sphingop...   241    2e-62  Gene info
ref|ZP_01472060.1|  hypothetical protein RS9916_29734 [Synecho...   241    2e-62 
ref|NP_356910.2|  metalloprotease [Agrobacterium tumefaciens s...   241    2e-62  Gene info
ref|YP_752823.1|  ATP-dependent metalloprotease FtsH [Syntroph...   241    2e-62  Gene info
ref|YP_704351.1|  cell division protein FtsH [Rhodococcus sp. ...   241    2e-62  Gene info
ref|ZP_00049541.2|  COG0465: ATP-dependent Zn proteases [Magne...   241    2e-62 
ref|XP_628150.1|  predicted AFG1 ATpase family AAA ATpase [Cry...   241    3e-62  Gene info
dbj|BAF62897.1|  putative ftsh [uncultured bacterium]               241    3e-62 
ref|XP_952288.1|  mitochondrial respiratory chain complexes as...   241    3e-62  Gene info
ref|YP_001516459.1|  ATP-dependent metalloprotease FtsH-like p...   241    3e-62  Gene info
ref|YP_627119.1|  cell division protein [Helicobacter pylori H...   241    3e-62  Gene info
ref|NP_207860.1|  cell division protein (ftsH) [Helicobacter p...   241    3e-62  Gene info
ref|NP_680922.1|  cell division protein [Thermosynechococcus e...   241    3e-62  Gene info
ref|YP_903401.1|  ATP-dependent metalloprotease FtsH [Candidat...   241    3e-62  Gene info
ref|YP_974836.1|  putative ATP-dependent zinc metallopeptidase...   241    3e-62  Gene info
ref|YP_589143.1|  FtsH peptidase. Metallo peptidase. MEROPS fa...   241    3e-62  Gene info
ref|YP_207538.1|  FtsH [Neisseria gonorrhoeae FA 1090] >gb|AAW...   241    3e-62  Gene info
ref|NP_273840.1|  cell division protein FtsH [Neisseria mening...   241    3e-62  Gene info
ref|NP_969465.1|  membrane bound zinc metallopeptidase [Bdello...   241    3e-62  Gene info
ref|ZP_01662360.1|  Vesicle-fusing ATPase [Ralstonia pickettii...   240    3e-62 
ref|YP_001091673.1|  cell division protein FtsH3 [Prochlorococ...   240    3e-62  Gene info
ref|YP_664938.1|  membrane bound zinc metallopeptidase [Helico...   240    3e-62  Gene info
ref|YP_432529.1|  ATP-dependent Zn protease [Hahella chejuensi...   240    3e-62  Gene info
ref|YP_723047.1|  ATP-dependent metalloprotease FtsH [Trichode...   240    4e-62  Gene info
ref|YP_742807.1|  FtsH peptidase. Metallo peptidase. MEROPS fa...   240    4e-62  Gene info
ref|YP_343897.1|  Peptidase M41, FtsH [Nitrosococcus oceani AT...   240    4e-62  Gene info
ref|YP_960613.1|  ATP-dependent metalloprotease FtsH [Marinoba...   240    4e-62  Gene info
ref|YP_001094959.1|  ATP-dependent metalloprotease FtsH [Shewa...   240    4e-62  Gene info
ref|YP_985775.1|  ATP-dependent metalloprotease FtsH [Acidovor...   240    4e-62  Gene info
ref|YP_001522044.1|  ATP-dependent metalloprotease FtsH-like p...   240    4e-62  Gene info
ref|ZP_00111391.1|  COG0465: ATP-dependent Zn proteases [Nosto...   240    4e-62 
ref|YP_001090472.1|  cell division protein FtsH2 [Prochlorococ...   240    4e-62  Gene info
ref|YP_321094.1|  Peptidase M41, FtsH [Anabaena variabilis ATC...   240    4e-62  Gene info
ref|YP_001256006.1|  cell division protein [Clostridium botuli...   240    4e-62  Gene info
ref|ZP_02091228.1|  hypothetical protein FAEPRAM212_01499 [Fae...   240    4e-62 
ref|ZP_01893530.1|  ATP-dependent Zn protease [Marinobacter al...   240    4e-62 
ref|ZP_01390413.1|  ATP-dependent metalloprotease FtsH [Geobac...   240    4e-62 
ref|YP_001369769.1|  ATP-dependent metalloprotease FtsH [Ochro...   240    4e-62  Gene info
ref|NP_897393.1|  FtsH ATP-dependent protease homolog [Synecho...   240    4e-62  Gene info
emb|CAL50397.1|  FtsH-like protein Pftf precursor (ISS) [Ostreoco   240    4e-62 
ref|YP_730623.1|  metalloprotease, ATP-dependent, FtsH family ...   240    4e-62  Gene info
ref|YP_470941.1|  cell division metalloproteinase protein [Rhi...   240    5e-62  Gene info
ref|YP_956149.1|  ATP-dependent metalloprotease FtsH [Mycobact...   240    5e-62  Gene info
ref|YP_001372994.1|  ATP-dependent metalloprotease FtsH [Ochro...   240    5e-62  Gene info
ref|XP_001024476.1|  ATP-dependent metalloprotease FtsH family...   240    5e-62  Gene info
ref|ZP_00372641.1|  cell division protein FtsH [Wolbachia endo...   240    5e-62 
ref|NP_485304.1|  cell division protein [Nostoc sp. PCC 7120] ...   240    5e-62  Gene info
sp|Q39444|FTSH_CAPAN  Cell division protease ftsH homolog, chl...   240    5e-62 
ref|ZP_00134553.2|  COG0465: ATP-dependent Zn proteases [Actin...   240    5e-62 
ref|NP_223075.1|  ATP-DEPENDENT ZINC METALLOPEPTIDASE [Helicob...   239    6e-62  Gene info
ref|NP_780916.1|  cell division protein ftsH [Clostridium teta...   239    6e-62  Gene info
ref|YP_048813.1|  cell division protein [Erwinia carotovora su...   239    6e-62  Gene info
ref|NP_440797.1|  cell division protein; FtsH [Synechocystis s...   239    6e-62  Gene info
ref|YP_675704.1|  ATP-dependent metalloprotease FtsH [Mesorhiz...   239    6e-62  Gene info
ref|YP_001132686.1|  ATP-dependent metalloprotease FtsH [Mycob...   239    7e-62  Gene info
ref|ZP_01593574.1|  ATP-dependent metalloprotease FtsH [Geobac...   239    7e-62 
emb|CAO87142.1|  unnamed protein product [Microcystis aeruginosa    239    7e-62 
ref|YP_171310.1|  ATP-dependent Zn protease [Synechococcus elo...   239    7e-62  Gene info
ref|YP_871964.1|  Mername-AA223 peptidase. Metallo peptidase. ...   239    7e-62  Gene info
ref|YP_769543.1|  putative cell division protein FtsH [Rhizobi...   239    7e-62  Gene info
ref|YP_829652.1|  ATP-dependent metalloprotease FtsH [Arthroba...   239    7e-62  Gene info
ref|NP_906852.1|  ZINC METALLOPEPTIDASE [Wolinella succinogene...   239    7e-62  Gene info
ref|YP_749674.1|  ATP-dependent metalloprotease FtsH [Shewanel...   239    7e-62  Gene info
ref|NP_875313.1|  Cell division protein FtsH [Prochlorococcus ...   239    7e-62  Gene info
ref|YP_001008642.1|  cell division protein FtsH2 [Prochlorococ...   239    7e-62  Gene info
ref|YP_641930.1|  ATP-dependent metalloprotease FtsH [Mycobact...   239    7e-62  Gene info
ref|YP_575124.1|  ATP-dependent metalloprotease FtsH [Chromoha...   239    8e-62  Gene info
ref|YP_692042.1|  cell division protein FtsH [Alcanivorax bork...   239    8e-62  Gene info
gb|AAC32257.1|  cell division protein [Mycobacterium smegmatis]     239    8e-62 
ref|ZP_01631626.1|  cell division protein [Nodularia spumigena...   239    8e-62 
ref|YP_001483451.1|  cell division protein FtsH2 [Prochlorococ...   239    8e-62  Gene info
ref|ZP_01613969.1|  cell division protease ftsH, ATP-dependent...   239    8e-62 
ref|NP_349798.1|  ATP-dependent Zn protease, FTSH [Clostridium...   239    8e-62  Gene info
ref|YP_171925.1|  ATP-dependent Zn protease [Synechococcus elo...   239    8e-62  Gene info
ref|YP_001523444.1|  FtsH peptidase [Azorhizobium caulinodans ...   239    9e-62  Gene info
ref|NP_925524.1|  cell division protein [Gloeobacter violaceus...   239    9e-62  Gene info
ref|YP_197983.1|  ATP-dependent Zn protease, HflB [Wolbachia e...   239    1e-61  Gene info
ref|YP_001231481.1|  ATP-dependent metalloprotease FtsH [Geoba...   239    1e-61  Gene info
ref|YP_001184359.1|  ATP-dependent metalloprotease FtsH [Shewa...   239    1e-61  Gene info
ref|YP_962467.1|  ATP-dependent metalloprotease FtsH [Shewanel...   239    1e-61  Gene info
ref|YP_001051595.1|  ATP-dependent metalloprotease FtsH [Shewa...   239    1e-61  Gene info
ref|YP_001221584.1|  cell division protein, membrane-bound ATP...   239    1e-61  Gene info
ref|YP_159756.1|  cell division protein [Azoarcus sp. EbN1] >e...   239    1e-61  Gene info
ref|NP_301282.1|  putative integral membrane peptidase [Mycoba...   239    1e-61  Gene info
ref|NP_931699.1|  cell division protein [Photorhabdus luminesc...   239    1e-61  Gene info
ref|ZP_02061703.1|  ATP-dependent metallopeptidase HflB [Ricke...   239    1e-61 
ref|ZP_01309191.1|  hypothetical protein CburR_01001791 [Coxiella   239    1e-61 
ref|YP_323693.1|  Peptidase M41, FtsH [Anabaena variabilis ATC...   239    1e-61  Gene info
ref|NP_820341.1|  ATP-dependent metalloprotease FtsH [Coxiella...   239    1e-61  Gene info
ref|NP_487682.1|  cell division protein [Nostoc sp. PCC 7120] ...   239    1e-61  Gene info
ref|YP_384844.1|  Peptidase M41, FtsH [Geobacter metallireduce...   239    1e-61  Gene info
ref|ZP_01075695.1|  cell division protein FtsH [Marinomonas sp...   239    1e-61 
ref|ZP_01897942.1|  ATP-dependent Zn protease [Moritella sp. P...   239    1e-61 
ref|ZP_01632566.1|  Peptidase M41, FtsH [Nodularia spumigena C...   239    1e-61 
ref|YP_755427.1|  ATP-dependent metalloprotease FtsH [Maricaul...   239    1e-61  Gene info
ref|YP_335233.1|  FtsH-2 protease [Burkholderia pseudomallei 1...   239    1e-61  Gene info
ref|YP_396726.1|  ATP-dependent metalloprotease FtsH [Prochlor...   239    1e-61  Gene info
ref|YP_459091.1|  ATP-dependent Zn protease [Erythrobacter lit...   239    1e-61  Gene info
ref|XP_001202193.1|  PREDICTED: similar to Spastic paraplegia ...   239    1e-61  UniGene infoGene info
ref|YP_901917.1|  ATP-dependent metalloprotease FtsH [Pelobact...   239    1e-61  Gene info
ref|YP_299385.1|  Peptidase M41, FtsH [Ralstonia eutropha JMP1...   239    1e-61  Gene info
sp|Q9CD58|FTSH_MYCLE  Cell division protease ftsH homolog >emb...   239    1e-61 
ref|NP_926087.1|  cell division protein [Gloeobacter violaceus...   239    1e-61  Gene info
ref|YP_314891.1|  peptidase M41, FtsH [Thiobacillus denitrific...   238    1e-61  Gene info
ref|YP_001204872.1|  Cell division protein ftsH homolog (ATP-d...   238    1e-61  Gene info
ref|ZP_01707920.1|  ATP-dependent metalloprotease FtsH [Shewan...   238    1e-61 
ref|YP_181136.1|  ATP-dependent metalloprotease FtsH [Dehaloco...   238    1e-61  Gene info
ref|ZP_01679007.1|  cell division protease FtsH [Vibrio choler...   238    1e-61 
ref|NP_894211.1|  cell division protein FtsH3 [Prochlorococcus...   238    1e-61  Gene info
ref|ZP_01314579.1|  hypothetical protein Wendoof_01000606 [Wol...   238    1e-61 
ref|NP_347240.1|  ATP-dependent zinc metallopeptidase FtsH (ce...   238    1e-61  Gene info
ref|YP_290951.1|  peptidase M41, FtsH [Thermobifida fusca YX] ...   238    1e-61  Gene info
ref|ZP_01112391.1|  cell division protein FtsH [Alteromonas ma...   238    1e-61 
ref|YP_001356873.1|  cell division protein FtsH [Nitratiruptor...   238    1e-61  Gene info
ref|YP_001073411.1|  ATP-dependent metalloprotease FtsH [Mycob...   238    1e-61  Gene info
ref|YP_292786.1|  peptidase M41, FtsH [Prochlorococcus marinus...   238    1e-61  Gene info
ref|YP_284170.1|  Peptidase M41, FtsH [Dechloromonas aromatica...   238    1e-61  Gene info
ref|ZP_00731384.1|  COG0465: ATP-dependent Zn proteases [Escheric   238    1e-61 
ref|ZP_00105811.1|  COG0465: ATP-dependent Zn proteases [Nosto...   238    1e-61 
ref|YP_381747.1|  ATP-dependent metalloprotease FtsH [Synechoc...   238    1e-61  Gene info
ref|YP_942253.1|  ATP-dependent metalloprotease FtsH [Psychrom...   238    1e-61  Gene info
ref|ZP_01217139.1|  cell division protein FtsH [Psychromonas s...   238    1e-61 
ref|YP_001014135.1|  cell division protein FtsH2 [Prochlorococ...   238    1e-61  Gene info
ref|YP_001337248.1|  ATP-dependent zinc-metallo protease [Kleb...   238    2e-61  Gene info
ref|ZP_01313208.1|  ATP-dependent metalloprotease FtsH [Desulf...   238    2e-61 
ref|YP_404841.1|  HflB [Shigella dysenteriae Sd197] >gb|ABB633...   238    2e-61  Gene info
ref|ZP_00724697.1|  COG0465: ATP-dependent Zn proteases [Escheric   238    2e-61 
emb|CAM74768.1|  ATP-dependent Zn proteases [Magnetospirillum ...   238    2e-61 
ref|YP_001464653.1|  ATP-dependent metallopeptidase HflB [Esch...   238    2e-61  Gene info
ref|NP_289752.1|  degrades sigma32, integral membrane peptidas...   238    2e-61  Gene info
ref|NP_417645.1|  protease, ATP-dependent zinc-metallo [Escher...   238    2e-61  Gene info
ref|NP_104893.1|  metalloprotease (cell division protein) FtsH...   238    2e-61  Gene info
ref|YP_001322274.1|  ATP-dependent metalloprotease FtsH [Alkal...   238    2e-61  Gene info
ref|YP_724043.1|  ATP-dependent metalloprotease FtsH [Trichode...   238    2e-61  Gene info
ref|YP_339394.1|  cell division protease [Pseudoalteromonas ha...   238    2e-61  Gene info
ref|ZP_00833030.1|  COG0465: ATP-dependent Zn proteases [Yersi...   238    2e-61 
ref|ZP_01080262.1|  FtsH ATP-dependent protease-like protein [...   238    2e-61 
ref|YP_439494.1|  ATP-dependent metalloprotease, FtsH family [...   238    2e-61  Gene info
ref|YP_222356.1|  FtsH, cell division protein FtsH [Brucella a...   238    2e-61  Gene info
ref|YP_001062570.1|  ATP-dependent metalloprotease FtsH [Burkh...   238    2e-61  Gene info
ref|YP_111127.1|  FtsH-2 protease [Burkholderia pseudomallei K...   238    2e-61  Gene info
ref|YP_218221.1|  ATP-dependent zinc-metallo protease [Salmone...   238    2e-61  Gene info
ref|NP_457675.1|  cell division protein [Salmonella enterica s...   238    2e-61  Gene info
ref|ZP_00894885.1|  hypothetical protein Bpse110_02002919 [Bur...   238    2e-61 
ref|NP_623928.1|  ATP-dependent Zn protease [Thermoanaerobacte...   238    2e-61  Gene info
ref|ZP_01538964.1|  ATP-dependent metalloprotease FtsH [Shewan...   238    2e-61 
ref|YP_409531.1|  HflB [Shigella boydii Sb227] >gb|ABB67703.1|...   238    2e-61  Gene info
ref|NP_045094.1|  cell division protein [Cyanidium caldarium] ...   238    2e-61  Gene info
ref|YP_307472.1|  ATP-dependent metalloprotease FtsH [Dehaloco...   238    2e-61  Gene info
ref|YP_001439616.1|  hypothetical protein ESA_03569 [Enterobac...   238    2e-61  Gene info
ref|ZP_00723226.1|  COG0465: ATP-dependent Zn proteases [Escheric   238    2e-61 
ref|YP_344552.1|  Peptidase M41, FtsH [Nitrosococcus oceani AT...   238    2e-61  Gene info
ref|YP_001550730.1|  FtsH ATP-dependent protease-like protein ...   238    2e-61  Gene info
ref|YP_001456066.1|  hypothetical protein CKO_04579 [Citrobact...   238    2e-61  Gene info
ref|YP_001218996.1|  cell division protein FtsH [Candidatus Ve...   238    2e-61  Gene info
ref|YP_001417970.1|  ATP-dependent metalloprotease FtsH [Xanth...   238    2e-61  Gene info
ref|YP_890326.1|  cell division protein [Mycobacterium smegmat...   238    2e-61  Gene info
ref|YP_001241240.1|  Cell division protein ftsH (ATP-dependent...   238    2e-61  Gene info
ref|ZP_00439678.1|  COG0465: ATP-dependent Zn proteases [Burkh...   238    2e-61 
ref|YP_105706.1|  ATP-dependent metalloprotease, FtsH family [...   238    2e-61  Gene info
ref|ZP_01770072.1|  ATP-dependent metalloprotease FtsH [Burkho...   238    2e-61 
ref|NP_952859.1|  cell division protein FtsH [Geobacter sulfur...   238    2e-61  Gene info
ref|YP_747222.1|  ATP-dependent metalloprotease FtsH [Nitrosom...   238    2e-61  Gene info
ref|NP_422020.1|  cell division protein FtsH [Caulobacter cres...   238    2e-61  Gene info
ref|ZP_01168144.1|  cell division protein FtsH [Oceanospirillu...   238    2e-61 
ref|ZP_02037644.1|  hypothetical protein BACCAP_03262 [Bactero...   238    2e-61 
ref|YP_001213833.1|  ATP-dependent metalloprotease FtsH [Dehal...   238    2e-61  Gene info
ref|ZP_01697921.1|  ATP-dependent metalloprotease FtsH [Escher...   238    3e-61 
ref|YP_464705.1|  FtsH peptidase. Metallo peptidase. MEROPS fa...   238    3e-61  Gene info
ref|YP_001551192.1|  cell division protein FtsH3 [Prochlorococ...   238    3e-61  Gene info
ref|ZP_01947353.1|  cell division protease FtsH [Coxiella burneti   237    3e-61 
ref|YP_001424787.1|  ATP-dependent metallopeptidase HflB [Coxi...   237    3e-61  Gene info
ref|YP_723280.1|  ATP-dependent metalloprotease FtsH [Trichode...   237    3e-61  Gene info
ref|NP_253439.1|  cell division protein FtsH [Pseudomonas aeru...   237    3e-61  Gene info
ref|YP_733156.1|  ATP-dependent metalloprotease FtsH [Shewanel...   237    3e-61  Gene info
ref|NP_716822.1|  cell division protein FtsH [Shewanella oneid...   237    3e-61  Gene info
ref|YP_737140.1|  ATP-dependent metalloprotease FtsH [Shewanel...   237    3e-61  Gene info
ref|YP_868664.1|  ATP-dependent metalloprotease FtsH [Shewanel...   237    3e-61  Gene info
ref|ZP_00371947.1|  cell division protein FtsH [Campylobacter ...   237    3e-61 
ref|XP_726364.1|  hypothetical protein PY05838 [Plasmodium yoe...   237    3e-61  Gene info
gb|EDP62232.1|  Peptidase M41, FtsH [alpha proteobacterium BAL199   237    3e-61 
ref|YP_001373430.1|  ATP-dependent metalloprotease FtsH [Bacil...   237    3e-61  Gene info
gb|ABV27311.1|  cell division protein FtsH [Candidatus Chlorac...   237    3e-61 
ref|YP_154225.1|  cell division protein [Anaplasma marginale s...   237    3e-61  Gene info
ref|NP_218127.1|  MEMBRANE-BOUND PROTEASE FTSH (CELL DIVISION ...   237    3e-61  Gene info
ref|YP_001291719.1|  RNA polymerase sigma factor [Haemophilus ...   237    3e-61  Gene info
ref|ZP_01788498.1|  hypothetical protein CGSHi3655_08671 [Haem...   237    3e-61 
ref|ZP_01785218.1|  hypothetical protein CGSHi22121_08373 [Hae...   237    3e-61 
ref|ZP_01449516.1|  Membrane ATP-dependent Zn protease [alpha ...   237    3e-61 
ref|NP_539260.1|  CELL DIVISION PROTEIN FTSH [Brucella meliten...   237    3e-61  Gene info
ref|NP_439486.1|  cell division protein [Haemophilus influenza...   237    3e-61  GeoGene info
ref|ZP_00415874.1|  Peptidase M41, FtsH [Azotobacter vinelandi...   237    3e-61 
ref|ZP_00157303.2|  COG0465: ATP-dependent Zn proteases [Haemo...   237    3e-61 
ref|ZP_01646086.1|  ATP-dependent metalloprotease FtsH [Stenot...   237    3e-61 
ref|ZP_00822813.1|  COG0465: ATP-dependent Zn proteases [Yersi...   237    3e-61 
ref|YP_032708.1|  Cell division protein ftsH [Bartonella quint...   237    3e-61  Gene info
ref|YP_921673.1|  ATP-dependent metalloprotease FtsH [Nocardio...   237    3e-61  Gene info
ref|YP_001307246.1|  ATP-dependent metalloprotease FtsH [Clost...   237    3e-61  Gene info
ref|YP_001259545.1|  cell division protein FtsH [Brucella ovis...   237    3e-61  Gene info
ref|ZP_01103388.1|  cell division protein FtsH [gamma proteoba...   237    3e-61 
ref|YP_454051.1|  cell division protein [Sodalis glossinidius ...   237    3e-61  Gene info
ref|YP_001350793.1|  cell division protein FtsH [Pseudomonas a...   237    3e-61  Gene info
gb|AAB66377.1|  FtsH [Helicobacter pylori]                          237    3e-61 
ref|YP_001233510.1|  ATP-dependent metalloprotease FtsH [Acidi...   237    3e-61  Gene info
ref|YP_001003336.1|  ATP-dependent metalloprotease FtsH [Halor...   237    3e-61  Gene info
ref|NP_338259.1|  cell division protein FtsH [Mycobacterium tu...   237    4e-61  Gene info
ref|YP_001406077.1|  putative Cell division protease FtsH-like...   237    4e-61  Gene info
ref|NP_681523.1|  cell division protein [Thermosynechococcus e...   237    4e-61  Gene info
ref|NP_860353.1|  membrane bound zinc metallopeptidase [Helico...   237    4e-61  Gene info
ref|YP_001476719.1|  ATP-dependent metalloprotease FtsH [Serra...   237    4e-61  Gene info
ref|ZP_01716886.1|  ATP-dependent metalloprotease FtsH [Pseudo...   237    4e-61 
ref|YP_001178320.1|  ATP-dependent metalloprotease FtsH [Enter...   237    4e-61  Gene info
ref|ZP_01983623.1|  ATP-dependent metallopeptidase HflB [Vibri...   237    4e-61 
ref|YP_203862.1|  cell division protein FtsH [Vibrio fischeri ...   237    4e-61  Gene info
ref|YP_001264985.1|  ATP-dependent metalloprotease FtsH [Sphin...   237    4e-61  Gene info
ref|ZP_01173367.1|  Cell division protein ftsH [Bacillus sp. N...   237    4e-61 
ref|YP_128829.1|  putative cell division protein FtsH [Photoba...   237    4e-61  Gene info
ref|NP_840613.1|  hflB; ATP-dependent zinc metallopeptidase (c...   237    4e-61  Gene info
ref|YP_001269888.1|  ATP-dependent metalloprotease FtsH [Pseud...   237    4e-61  Gene info
ref|ZP_00829556.1|  COG0465: ATP-dependent Zn proteases [Yersi...   237    4e-61 
ref|ZP_00924458.1|  COG0465: ATP-dependent Zn proteases [Escheric   237    4e-61 
ref|NP_873906.1|  cell division protein, FtsH [Haemophilus duc...   237    4e-61  Gene info
ref|YP_001004798.1|  cell division protein [Yersinia enterocol...   237    4e-61  Gene info
ref|NP_746826.1|  cell division protein FtsH [Pseudomonas puti...   237    4e-61  Gene info
ref|YP_001228449.1|  Cell division protein FtsH [Synechococcus...   237    5e-61  Gene info
ref|YP_001530924.1|  ATP-dependent metalloprotease FtsH [Candi...   237    5e-61  Gene info
ref|YP_001210114.1|  ATP-dependent protease FtsH [Dichelobacte...   237    5e-61  Gene info
ref|YP_001017923.1|  cell division protein FtsH3 [Prochlorococ...   236    5e-61  Gene info
ref|ZP_01129457.1|  cell division protein [marine actinobacter...   236    5e-61 
ref|ZP_01617601.1|  cell division protein FtsH [marine gamma p...   236    5e-61 
gb|EDO69940.1|  ATP-dependent metalloprotease FtsH [Dehalococcoid   236    5e-61 
ref|YP_179247.1|  cell division protein FtsH [Campylobacter je...   236    5e-61  Gene info
ref|ZP_00632965.1|  Peptidase M41, FtsH [Paracoccus denitrific...   236    5e-61  Gene info
ref|ZP_01467769.1|  Peptidase M41, FtsH [Synechococcus sp. BL1...   236    5e-61 
ref|ZP_02060516.1|  ATP-dependent metalloprotease FtsH [Hydrog...   236    5e-61 
ref|YP_589061.1|  ATP-dependent metalloprotease FtsH [Baumanni...   236    5e-61  Gene info
ref|ZP_01085549.1|  FtsH ATP-dependent protease-like protein [...   236    5e-61 
ref|ZP_00825692.1|  COG0465: ATP-dependent Zn proteases [Yersi...   236    5e-61 
ref|NP_406961.1|  cell division protein [Yersinia pestis CO92]...   236    5e-61  Gene info
ref|YP_377069.1|  Peptidase M41, FtsH [Synechococcus sp. CC990...   236    5e-61  Gene info
ref|YP_400015.1|  ATP-dependent metalloprotease FtsH [Synechoc...   236    5e-61  Gene info
ref|YP_034175.1|  Cell division protein ftsH [Bartonella hense...   236    5e-61  Gene info
ref|ZP_01068935.1|  cell division protein FtsH [Campylobacter ...   236    5e-61 
ref|ZP_01071133.1|  putative Cell division protein FtsH homolo...   236    5e-61 
ref|NP_668019.1|  integral membrane peptidase, cell division p...   236    5e-61  Gene info
ref|YP_001397772.1|  cell division protein FtsH [Campylobacter...   236    6e-61  Gene info
ref|YP_171256.1|  ATP-dependent Zn protease [Synechococcus elo...   236    6e-61  Gene info
ref|YP_001000794.1|  cell division protein FtsH [Campylobacter...   236    6e-61  Gene info
ref|ZP_01641916.1|  ATP-dependent metalloprotease FtsH [Pseudo...   236    6e-61 
ref|XP_001347874.1|  hypothetical protein PF11_0203 [Plasmodiu...   236    6e-61  Gene info
ref|ZP_00369487.1|  cell division protein FtsH [Campylobacter ...   236    6e-61 
ref|YP_170263.1|  ATP-dependent metalloprotease [Francisella t...   236    6e-61  Gene info
ref|YP_356418.1|  ATP-dependent zinc protease/ cell division p...   236    6e-61  Gene info
ref|ZP_01128224.1|  cell division protein FtsH [Nitrococcus mo...   236    6e-61 
ref|YP_001173790.1|  cell division protein FtsH [Pseudomonas s...   236    6e-61  Gene info
ref|ZP_01623933.1|  ATP-dependent Zn protease [Lyngbya sp. PCC...   236    6e-61 
ref|YP_699726.1|  ATP-dependent metalloprotease FtsH [Clostrid...   236    6e-61  Gene info
ref|YP_276318.1|  ATP-dependent metalloprotease FtsH [Pseudomo...   236    6e-61  Gene info
ref|ZP_01017521.1|  metalloprotease [Parvularcula bermudensis ...   236    6e-61 
ref|YP_001131017.1|  ATP-dependent metalloprotease FtsH [Prost...   236    6e-61  Gene info
ref|YP_926831.1|  Vesicle-fusing ATPase [Shewanella amazonensi...   236    7e-61  Gene info
ref|ZP_00367141.1|  cell division protein FtsH [Campylobacter ...   236    7e-61 
ref|ZP_00953315.1|  FtsH, cell division protein FtsH [Oceanica...   236    7e-61 
ref|ZP_01080898.1|  cell division protein [Synechococcus sp. R...   236    7e-61 
ref|NP_282264.1|  membrane bound zinc metallopeptidase [Campyl...   236    7e-61  Gene info
gb|EDN36018.1|  ATP-dependent metalloprotease [Francisella tul...   236    7e-61 
ref|YP_422569.1|  ATP-dependent Zn protease [Magnetospirillum ...   236    7e-61  Gene info
ref|NP_896400.1|  cell division protein FtsH2 [Synechococcus s...   236    7e-61  Gene info
ref|YP_063571.1|  ftsH protease homolog [Gracilaria tenuistipi...   236    8e-61  Gene info
ref|ZP_01123479.1|  cell division protein FtsH2 [Synechococcus...   236    8e-61 
ref|YP_001413397.1|  ATP-dependent metalloprotease FtsH [Parvi...   236    8e-61  Gene info
ref|YP_697158.1|  ATP-dependent metalloprotease FtsH [Clostrid...   236    8e-61  Gene info
ref|NP_563386.1|  probable cell-division protein [Clostridium ...   236    8e-61  Gene info
ref|ZP_00155036.2|  COG0465: ATP-dependent Zn proteases [Haemo...   236    8e-61 
ref|ZP_00419599.1|  Peptidase M41, FtsH [Azotobacter vinelandi...   236    8e-61 
ref|ZP_01775770.1|  ATP-dependent metalloprotease FtsH [Geobac...   236    8e-61 
ref|YP_400331.1|  ATP-dependent metalloprotease FtsH [Synechoc...   236    8e-61  Gene info
ref|YP_170949.1|  ATP-dependent Zn protease [Synechococcus elo...   236    8e-61  Gene info
ref|YP_001502919.1|  ATP-dependent metalloprotease FtsH [Shewa...   236    8e-61  Gene info
ref|ZP_01861670.1|  FtsH [Bacillus sp. SG-1] >gb|EDL63263.1| F...   236    8e-61 
ref|YP_322747.1|  Peptidase M41, FtsH [Anabaena variabilis ATC...   236    8e-61  Gene info
ref|ZP_01262843.1|  cell division protein FtsH [Vibrio alginol...   236    9e-61 
ref|ZP_00696372.1|  COG0465: ATP-dependent Zn proteases [Shigella   236    9e-61 
ref|XP_001200814.1|  PREDICTED: similar to paraplegin, partial...   236    9e-61  Gene info
ref|NP_245375.1|  FtsH [Pasteurella multocida subsp. multocida...   236    9e-61  Gene info
ref|ZP_01993085.1|  ATP-dependent metallopeptidase HflB [Vibri...   236    9e-61 
ref|ZP_01791848.1|  hypothetical protein CGSHiHH_09525 [Haemop...   236    9e-61 
ref|YP_001379524.1|  ATP-dependent metalloprotease FtsH [Anaer...   236    9e-61  Gene info
ref|YP_001102670.1|  putative cell division protein [Saccharop...   236    9e-61  Gene info
ref|NP_892861.1|  FtsH ATP-dependent protease homolog [Prochlo...   236    9e-61  Gene info
ref|YP_001242667.1|  Cell division protein FtsH [Bradyrhizobiu...   236    9e-61  Gene info
ref|YP_001475128.1|  Microtubule-severing ATPase [Shewanella s...   236    9e-61  Gene info
ref|YP_945966.1|  putative cell division protein (ftsH) [Arthr...   236    9e-61  Gene info
ref|NP_778321.1|  cell division protein [Xylella fastidiosa Te...   236    9e-61  Gene info
ref|YP_001485313.1|  M41 family endopeptidase FtsH [Bacillus p...   236    9e-61  Gene info
ref|NP_297386.1|  cell division protein [Xylella fastidiosa 9a...   236    9e-61  Gene info
ref|ZP_00652216.1|  Peptidase M41, FtsH [Xylella fastidiosa Di...   236    9e-61 
ref|NP_698676.1|  cell division protein FtsH [Brucella suis 13...   236    1e-60  Gene info
ref|YP_001252315.1|  cell division protein FtsH [Legionella pn...   236    1e-60  Gene info
ref|YP_001224939.1|  Cell division protein FtsH [Synechococcus...   236    1e-60  Gene info
ref|ZP_00990313.1|  cell division protein FtsH [Vibrio splendi...   236    1e-60 
ref|ZP_01236334.1|  putative cell division protein FtsH [Vibri...   236    1e-60 
ref|ZP_01124111.1|  hypothetical protein WH7805_02887 [Synecho...   236    1e-60 
ref|YP_004010.1|  cell division protein ftsH [Thermus thermoph...   235    1e-60  Gene info
ref|YP_143669.1|  cell division protein FtsH [Thermus thermoph...   235    1e-60  Gene info
ref|YP_073955.1|  cell division protein [Symbiobacterium therm...   235    1e-60  Gene info
ref|ZP_01043986.1|  Membrane ATP-dependent Zn protease [Idioma...   235    1e-60 
ref|NP_829967.1|  Cell division protein ftsH [Bacillus cereus ...   235    1e-60  Gene info
ref|ZP_01159141.1|  putative cell division protein FtsH [Photo...   235    1e-60 
ref|YP_292024.1|  peptidase M41, FtsH [Prochlorococcus marinus...   235    1e-60  Gene info
ref|YP_001203324.1|  Cell division protein FtsH; ATP-dependent...   235    1e-60  Gene info
ref|YP_001224078.1|  Cell division protein FtsH [Synechococcus...   235    1e-60  Gene info
ref|ZP_01550967.1|  ATP-dependent metalloprotease FtsH [Stappi...   235    1e-60 
ref|YP_096792.1|  cell division protein FtsH [Legionella pneum...   235    1e-60  Gene info
emb|CAJ73922.1|  strongly similar to cell division protein Fts...   235    1e-60 
ref|ZP_01697835.1|  ATP-dependent metalloprotease FtsH [Bacill...   235    1e-60 
ref|YP_394182.1|  Peptidase M41, FtsH [Thiomicrospira denitrif...   235    1e-60  Gene info
ref|YP_001393584.1|  FtsH1 [Clostridium kluyveri DSM 555] >gb|...   235    1e-60  Gene info
ref|NP_874649.1|  Cell division protein FtsH [Prochlorococcus ...   235    1e-60  Gene info
gb|EDN37472.1|  ATP-dependent metallopeptidase HflB [Francisel...   235    1e-60 
ref|YP_898314.1|  ATP-dependent metalloprotease [Francisella t...   235    1e-60  Gene info
ref|YP_514115.1|  ATP-dependent metalloprotease [Francisella t...   235    1e-60  Gene info
ref|ZP_01135142.1|  cell division protease ftsH, ATP-dependent...   235    1e-60 
ref|ZP_00240843.1|  cell division protein FtsH [Bacillus cereu...   235    1e-60 
gb|EDO74543.1|  ATP-dependent metalloprotease FtsH [Methylobac...   235    1e-60 
ref|ZP_01735866.1|  ATP-dependent Zn protease [Marinobacter sp...   235    1e-60 
gb|EDO66740.1|  hypothetical protein FTAG_00969 [Francisella t...   235    1e-60 
ref|YP_001494181.1|  cell division protein ftsH [Rickettsia ri...   235    1e-60  Gene info
ref|NP_842633.1|  cell division protein FtsH [Bacillus anthrac...   235    1e-60  Gene info
ref|ZP_01980331.1|  cell division protein FtsH [Vibrio cholera...   235    1e-60 
ref|YP_001122321.1|  ATP-dependent metallopeptidase HflB [Fran...   235    1e-60  Gene info
ref|NP_230286.1|  cell division protein FtsH [Vibrio cholerae ...   235    1e-60  Gene info
ref|ZP_01226891.1|  ATP-dependent metalloprotease involved in ...   235    1e-60 
gb|AAC44563.1|  HpFtsH                                              235    1e-60 
ref|ZP_00512447.1|  Peptidase M41, FtsH [Chlorobium limicola D...   235    1e-60 
ref|NP_760579.1|  ATP-dependent Zn protease [Vibrio vulnificus...   235    2e-60  Gene info
ref|NP_935508.1|  ATP-dependent Zn protease [Vibrio vulnificus...   235    2e-60  Gene info
ref|YP_528192.1|  cell division protein FtsH [Saccharophagus d...   235    2e-60  Gene info
ref|NP_794250.1|  cell division protein FtsH [Pseudomonas syri...   235    2e-60  Gene info
ref|YP_763875.1|  M41 family endopeptidase FtsH/HflB [Francise...   235    2e-60  Gene info
ref|NP_976391.1|  cell division protein FtsH [Bacillus cereus ...   235    2e-60  Gene info
ref|NP_488976.1|  cell division protein [Nostoc sp. PCC 7120] ...   235    2e-60  Gene info
ref|NP_946477.1|  metalloprotease (cell division protein) FtsH...   235    2e-60  Gene info
ref|ZP_02018579.1|  ATP-dependent metalloprotease FtsH [Methyl...   235    2e-60 
ref|ZP_01815282.1|  cell division protein FtsH [Vibrionales ba...   235    2e-60 
ref|YP_001489396.1|  cell division protein FtsH [Arcobacter bu...   235    2e-60  Gene info
ref|XP_393770.3|  PREDICTED: similar to CG2658-PA, isoform A [Api   235    2e-60  UniGene infoGene info
ref|YP_485437.1|  ATP-dependent metalloprotease FtsH [Rhodopse...   235    2e-60  Gene info
ref|ZP_02090239.1|  hypothetical protein FAEPRAM212_00478 [Fae...   234    2e-60 
ref|ZP_01477501.1|  hypothetical protein VchoM_02003374 [Vibri...   234    2e-60 
ref|YP_237255.1|  Peptidase M41, FtsH [Pseudomonas syringae pv...   234    2e-60  Gene info
ref|YP_001010574.1|  cell division protein FtsH2 [Prochlorococ...   234    2e-60  Gene info
ref|NP_488816.1|  cell division protein [Nostoc sp. PCC 7120] ...   234    2e-60  Gene info
ref|YP_001088333.1|  cell division protein [Clostridium diffic...   234    2e-60  Gene info
ref|YP_378044.1|  Peptidase M41, FtsH [Synechococcus sp. CC990...   234    2e-60  Gene info
ref|NP_964299.1|  cell division protein FtsH-like protein [Lac...   234    2e-60  Gene info
ref|YP_001011155.1|  FtsH ATP-dependent protease-like protein ...   234    2e-60  Gene info
ref|YP_322954.1|  Peptidase M41, FtsH [Anabaena variabilis ATC...   234    2e-60  Gene info
ref|YP_907698.1|  membrane-bound protease FtsH [Mycobacterium ...   234    2e-60  Gene info
ref|ZP_01386079.1|  ATP-dependent metalloprotease FtsH [Chloro...   234    2e-60 
ref|ZP_01626423.1|  ATP-dependent metalloprotease FtsH [marine...   234    2e-60 
ref|YP_001339886.1|  ATP-dependent metalloprotease FtsH [Marin...   234    2e-60  Gene info
ref|NP_782989.1|  cell division protein ftsH [Clostridium teta...   234    2e-60  Gene info
ref|ZP_01469374.1|  Peptidase M41, FtsH [Synechococcus sp. BL1...   234    2e-60 
ref|ZP_01877034.1|  probable cell division protein FtsH [Lenti...   234    2e-60 
ref|ZP_00108866.1|  COG0465: ATP-dependent Zn proteases [Nosto...   234    2e-60 
ref|ZP_00796838.1|  COG0465: ATP-dependent Zn proteases [Yersinia   234    2e-60 
ref|YP_783598.1|  ATP-dependent metalloprotease FtsH [Rhodopse...   234    2e-60  Gene info
ref|YP_378707.1|  Peptidase M41, FtsH [Chlorobium chlorochroma...   234    2e-60  Gene info
ref|YP_001124194.1|  Cell-division protein and general stress ...   234    2e-60  Gene info
ref|YP_814122.1|  ATP-dependent Zn protease [Lactobacillus gas...   234    2e-60  Gene info
ref|ZP_01454960.1|  ATP-dependent metalloprotease FtsH [Thermo...   234    2e-60 
ref|NP_892346.1|  cell division protein FtsH2 [Prochlorococcus...   234    2e-60  Gene info
ref|YP_562011.1|  ATP-dependent metalloprotease FtsH [Shewanel...   234    2e-60  Gene info
ref|YP_505717.1|  ATP-dependent metalloprotease FtsH [Anaplasm...   234    2e-60  Gene info
ref|ZP_00778498.1|  Peptidase M41, FtsH [Thermoanaerobacter et...   234    2e-60 
ref|ZP_00208042.1|  COG0465: ATP-dependent Zn proteases [Magne...   234    2e-60 
ref|ZP_01870652.1|  cell division protein FtsH [Vibrio shiloni...   234    2e-60 
ref|YP_411183.1|  ATP-dependent metalloprotease FtsH [Nitrosos...   234    3e-60  Gene info
ref|YP_001009197.1|  FtsH ATP-dependent protease-like protein ...   234    3e-60  Gene info
dbj|BAC00090.1|  ATP-dependent Zn proteases [Corynebacterium g...   234    3e-60  Gene info
ref|ZP_01185728.1|  Peptidase M41, FtsH [Bacillus weihenstepha...   234    3e-60 
ref|ZP_00588331.1|  Peptidase M41, FtsH [Pelodictyon phaeoclat...   234    3e-60 
ref|YP_397247.1|  ATP-dependent metalloprotease FtsH [Prochlor...   234    3e-60  Gene info
ref|YP_246155.1|  ATP-dependent metalloprotease FtsH [Ricketts...   234    3e-60  Gene info
ref|YP_342332.1|  Peptidase M41, FtsH [Nitrosococcus oceani AT...   234    3e-60  Gene info
ref|YP_980636.1|  ATP-dependent metalloprotease FtsH [Polaromo...   234    3e-60  Gene info
ref|YP_380632.1|  ATP-dependent metalloprotease FtsH [Synechoc...   234    3e-60  Gene info
ref|YP_088156.1|  HflB protein [Mannheimia succiniciproducens ...   234    3e-60  Gene info
ref|YP_001446576.1|  hypothetical protein VIBHAR_03404 [Vibrio...   234    3e-60  Gene info
emb|CAA73318.1|  ATPase [Arabidopsis thaliana]                      234    3e-60  UniGene info
ref|NP_713999.1|  cell division protein ftsH [Leptospira inter...   234    3e-60  Gene info
ref|YP_718935.1|  cell division protein [Haemophilus somnus 12...   234    3e-60  Gene info
ref|ZP_00132138.2|  COG0465: ATP-dependent Zn proteases [Haemophi   234    3e-60 
ref|YP_001484038.1|  ATP-dependent metalloprotease FtsH [Proch...   234    3e-60  Gene info
ref|YP_864369.1|  ATP-dependent metalloprotease FtsH [Magnetoc...   234    3e-60  Gene info
ref|YP_606519.1|  ATP-dependent metalloprotease FtsH [Pseudomo...   234    4e-60  Gene info
ref|YP_571261.1|  ATP-dependent metalloprotease FtsH [Rhodopse...   234    4e-60  Gene info
ref|YP_001227658.1|  Cell division protein FtsH [Synechococcus...   234    4e-60  Gene info
ref|YP_001511990.1|  ATP-dependent metalloprotease FtsH [Alkal...   234    4e-60  Gene info
ref|NP_798842.1|  cell division protein FtsH [Vibrio parahaemo...   234    4e-60  Gene info
ref|YP_001504670.1|  ATP-dependent metalloprotease FtsH [Frank...   234    4e-60  Gene info
ref|YP_066833.1|  cell division protein FtsH [Desulfotalea psy...   234    4e-60  Gene info
ref|YP_145915.1|  cell-division protein and general stress pro...   233    4e-60  Gene info
ref|YP_375619.1|  Peptidase M41, FtsH [Pelodictyon luteolum DS...   233    4e-60  Gene info
ref|YP_483389.1|  ATP-dependent metalloprotease FtsH [Frankia ...   233    4e-60  Gene info
ref|YP_001255825.1|  cell division protein [Clostridium botuli...   233    4e-60  Gene info
ref|YP_801775.1|  ATP-dependent Zn protease [Leptospira borgpe...   233    4e-60  Gene info
ref|NP_601892.1|  cell division protein [Corynebacterium gluta...   233    4e-60  Gene info
ref|YP_426186.1|  Peptidase M41, FtsH [Rhodospirillum rubrum A...   233    4e-60  Gene info
ref|YP_054977.1|  putative cell division protein FtsH [Propion...   233    5e-60  Gene info
ref|XP_001354546.1|  GA15413-PA [Drosophila pseudoobscura] >gb...   233    5e-60  Gene info
ref|ZP_01451859.1|  ATP-dependent metalloprotease FtsH [Maripr...   233    5e-60 
ref|ZP_01744206.1|  ATP-dependent metalloprotease FtsH [Sagitt...   233    5e-60 
ref|YP_716715.1|  Cell division protein FtsH (ATP-dependent zi...   233    5e-60  Gene info
ref|YP_445932.1|  cell division protein FtsH [Salinibacter rub...   233    5e-60  Gene info
ref|NP_894509.1|  FtsH ATP-dependent protease homolog [Prochlo...   233    5e-60  Gene info
gb|EDP58640.1|  cell division protein FtsH [Vibrio campbellii AND   233    5e-60 
ref|YP_173610.1|  cell-division protein FtsH [Bacillus clausii...   233    5e-60  Gene info
ref|ZP_00603445.1|  Peptidase M41, FtsH [Enterococcus faecium ...   233    5e-60 
ref|YP_001392688.1|  ATP-dependent metalloprotease FtsH [Clost...   233    5e-60  Gene info
ref|YP_001492913.1|  cell division protein ftsH [Rickettsia ak...   233    5e-60  Gene info
gb|AAR37490.1|  cell division protein FtsH [uncultured marine bac   233    5e-60 
ref|NP_359705.1|  cell division protein ftsH [Rickettsia conor...   233    5e-60  Gene info
ref|YP_001498932.1|  ATP-dependent metalloprotease FtsH [Ricke...   233    6e-60  Gene info
ref|ZP_00142454.1|  cell division protein ftsH [Rickettsia sib...   233    6e-60 
ref|YP_797048.1|  ATP-dependent Zn protease [Leptospira borgpe...   233    6e-60  Gene info
ref|ZP_01084721.1|  cell division protein [Synechococcus sp. W...   233    6e-60 
ref|YP_001017554.1|  FtsH ATP-dependent protease-like protein ...   233    6e-60  Gene info
ref|YP_001091027.1|  FtsH ATP-dependent protease-like protein ...   233    6e-60  Gene info
ref|NP_661201.1|  cell division protein FtsH [Chlorobium tepid...   233    6e-60  Gene info
ref|YP_001139513.1|  hypothetical protein cgR_2597 [Corynebact...   233    6e-60  Gene info
ref|YP_192087.1|  Cell division protein FtsH [Gluconobacter ox...   233    6e-60  Gene info
ref|YP_802796.1|  ATP-dependent protease [Buchnera aphidicola ...   233    7e-60  Gene info
ref|YP_758892.1|  ATP-dependent metalloprotease FtsH [Hyphomon...   233    7e-60  Gene info
emb|CAK32582.1|  putative ATP-dependent Zn protease [uncultured o   233    7e-60 
ref|YP_168308.1|  ATP-dependent metalloprotease FtsH [Siliciba...   233    7e-60  Gene info
gb|EDP67788.1|  cell division protein FtsH [Carnobacterium sp. AT   233    7e-60 
ref|YP_001109936.1|  ATP-dependent metalloprotease FtsH [Burkh...   233    7e-60  Gene info
ref|XP_001228934.1|  hypothetical protein CHGG_02418 [Chaetomi...   233    7e-60  Gene info
ref|ZP_01421254.1|  ATP-dependent metalloprotease FtsH [Caulob...   233    8e-60 
ref|YP_001491779.1|  50S ribosomal protein L9 [Rickettsia cana...   233    8e-60  Gene info
ref|YP_363496.1|  cell division protein FtsH (ATP-dependent zi...   233    8e-60  Gene info
ref|YP_001228010.1|  Cell division protein FtsH [Synechococcus...   233    8e-60  Gene info
ref|YP_879822.1|  ATP-dependent metallopeptidase HflB [Mycobac...   233    8e-60  Gene info
ref|NP_959382.1|  FtsH [Mycobacterium avium subsp. paratubercu...   233    8e-60  Gene info
ref|ZP_01015574.1|  ATP-dependent metalloprotease FtsH [Rhodob...   233    8e-60 
ref|XP_001697103.1|  membrane AAA-metalloprotease [Chlamydomon...   233    8e-60  Gene info
ref|ZP_01629475.1|  Peptidase M41, FtsH [Nodularia spumigena C...   233    8e-60 
ref|ZP_01444825.1|  ATP-dependent metalloprotease FtsH [Roseov...   233    8e-60 
ref|XP_001415621.1|  AAA-metalloprotease FtsH, chloroplast pre...   233    8e-60  Gene info
ref|ZP_01439705.1|  metalloprotease (cell division protein) Ft...   233    8e-60 
ref|ZP_01857530.1|  cell division protein FtsH [Planctomyces m...   233    8e-60 
ref|YP_744931.1|  cell division protein ftsH [Granulibacter be...   233    8e-60  Gene info
ref|ZP_01730605.1|  cell division protein; FtsH [Cyanothece sp...   232    9e-60 
ref|YP_534584.1|  ATP-dependent metalloprotease FtsH [Rhodopse...   232    9e-60  Gene info
ref|NP_682622.1|  cell division protein [Thermosynechococcus e...   232    9e-60  Gene info
ref|YP_001234557.1|  ATP-dependent metalloprotease FtsH [Acidi...   232    9e-60  Gene info
ref|ZP_01904150.1|  ATP-dependent metalloprotease FtsH [Roseob...   232    9e-60 
ref|ZP_01951270.1|  cell division protein FtsH [Vibrio cholera...   232    1e-59 
ref|NP_773786.1|  metalloprotease [Bradyrhizobium japonicum US...   232    1e-59  Gene info
ref|YP_910908.1|  ATP-dependent metalloprotease FtsH [Chlorobi...   232    1e-59  Gene info
ref|YP_377485.1|  Peptidase M41, FtsH [Synechococcus sp. CC990...   232    1e-59  Gene info
ref|ZP_01409268.1|  hypothetical protein SpneT_02000208 [Strep...   232    1e-59 
ref|NP_814059.1|  cell division protein FtsH [Enterococcus fae...   232    1e-59  Gene info
ref|ZP_00956379.1|  ATP-dependent metalloprotease FtsH [Sulfit...   232    1e-59 
ref|ZP_00963206.1|  ATP-dependent metalloprotease FtsH [Sulfit...   232    1e-59 
ref|YP_201588.1|  cell division protein [Xanthomonas oryzae pv...   232    1e-59  Gene info
ref|ZP_00516086.1|  Peptidase M41, FtsH [Crocosphaera watsonii...   232    1e-59 
ref|YP_277616.1|  FtsH [Candidatus Blochmannia pennsylvanicus ...   232    1e-59  Gene info
ref|ZP_01817845.1|  peptidyl-tRNA hydrolase [Streptococcus pne...   232    1e-59 
ref|ZP_01823043.1|  cell division protein FtsH [Streptococcus ...   232    1e-59 
ref|ZP_01820332.1|  peptidyl-tRNA hydrolase [Streptococcus pne...   232    1e-59 
ref|NP_825843.1|  cell division protein FtsH [Streptomyces ave...   232    1e-59  Gene info
ref|NP_357606.1|  Cell-division protein / general stress prote...   232    1e-59  Gene info
ref|ZP_01973110.1|  cell division protein FtsH [Vibrio cholera...   232    1e-59 
ref|NP_642063.1|  cell division protein [Xanthomonas axonopodi...   232    1e-59  Gene info
ref|NP_344566.1|  cell division protein FtsH [Streptococcus pn...   232    1e-59  Gene info
ref|NP_220437.1|  CELL DIVISION PROTEIN FTSH (ftsH) [Rickettsi...   232    1e-59  Gene info
ref|YP_807705.1|  ATP-dependent Zn protease [Lactobacillus cas...   232    1e-59  Gene info
ref|YP_828272.1|  ATP-dependent metalloprotease FtsH [Solibact...   232    1e-59  Gene info
ref|YP_578695.1|  ATP-dependent metalloprotease FtsH [Nitrobac...   232    1e-59  Gene info
ref|ZP_01848455.1|  ATP-dependent metalloprotease FtsH [Methyl...   232    1e-59 
ref|YP_729587.1|  cell division protein FtsH [Synechococcus sp...   232    1e-59  Gene info
ref|ZP_01725399.1|  cell division protein [Bacillus sp. B14905...   232    1e-59 
emb|CAL07986.1|  FtsH protease, chloroplast precursor [Platanus x   232    1e-59 
ref|YP_001140878.1|  Cell division protease ftsH [Aeromonas sa...   232    1e-59  Gene info
ref|NP_878407.1|  cell division protein FtsH [Candidatus Bloch...   232    1e-59  Gene info
ref|YP_857801.1|  ATP-dependent metallopeptidase HflB [Aeromon...   232    1e-59  Gene info
ref|YP_356648.1|  cell division protein [Pelobacter carbinolic...   231    1e-59  Gene info
ref|YP_346504.1|  Peptidase M41, FtsH [Pseudomonas fluorescens...   231    2e-59  Gene info
ref|ZP_01303541.1|  ATP-dependent metalloprotease FtsH [Sphing...   231    2e-59 
ref|YP_067055.1|  cell division protein FtsH [Rickettsia typhi...   231    2e-59  Gene info
ref|YP_257971.1|  ATP-dependent metalloprotease FtsH [Pseudomo...   231    2e-59  Gene info
ref|ZP_00518065.1|  Peptidase M41, FtsH [Crocosphaera watsonii...   231    2e-59 
ref|YP_538563.1|  ATP-dependent metalloprotease FtsH [Ricketts...   231    2e-59  Gene info
emb|CAL55447.1|  FTSH_MEDSA Cell division protein ftsH homolog...   231    2e-59 
ref|YP_319315.1|  peptidase M41, FtsH [Nitrobacter winogradsky...   231    2e-59  Gene info
ref|NP_971084.1|  cell division protein FtsH [Treponema dentic...   231    2e-59  Gene info
ref|NP_739152.1|  putative cell division protein FtsH [Coryneb...   231    2e-59  Gene info
ref|ZP_00379835.1|  COG0465: ATP-dependent Zn proteases [Brevibac   231    2e-59 
ref|XP_677920.1|  hypothetical protein PB000162.00.0 [Plasmodi...   231    2e-59  Gene info
ref|YP_909272.1|  hypothetical protein BAD_0409 [Bifidobacteri...   231    2e-59  Gene info
ref|ZP_00999828.1|  ATP-dependent metalloprotease FtsH [Oceani...   231    2e-59 
ref|ZP_01004007.1|  ATP-dependent metalloprotease FtsH [Loktan...   231    2e-59 
ref|YP_001567919.1|  ATP-dependent metalloprotease FtsH [Petro...   231    2e-59 
ref|NP_691000.1|  cell division protein [Oceanobacillus iheyen...   231    2e-59  Gene info
ref|YP_001360291.1|  ATP-dependent metalloprotease FtsH [Kineo...   231    2e-59  Gene info
ref|NP_001058321.1|  Os06g0669400 [Oryza sativa (japonica cult...   231    2e-59  UniGene infoGene info
ref|YP_270126.1|  ATP-dependent metalloprotease FtsH [Colwelli...   231    2e-59  Gene info
ref|ZP_01045359.1|  peptidase M41, FtsH [Nitrobacter sp. Nb-31...   231    2e-59 
ref|NP_568311.2|  ATFTSH6/FTSH6 (FtsH protease 6); ATP-depende...   231    2e-59  UniGene infoGene info
emb|CAB89335.1|  FtsH-like protein Pftf precursor-like [Arabidops   231    2e-59 
ref|ZP_01472937.1|  cell division protein FtsH2 [Synechococcus...   231    2e-59 
dbj|BAE71245.1|  putative zinc dependent protease [Trifolium prat   231    2e-59 
ref|YP_547577.1|  ATP-dependent metalloprotease FtsH [Polaromo...   231    3e-59  Gene info
ref|ZP_01624206.1|  cell division protein; FtsH [Lyngbya sp. P...   231    3e-59 
ref|ZP_01220482.1|  putative cell division protein FtsH [Photo...   231    3e-59 
ref|YP_451830.1|  cell division protein [Xanthomonas oryzae pv...   231    3e-59  Gene info
ref|ZP_01879827.1|  ATP-dependent metalloprotease FtsH [Roseov...   231    3e-59 
ref|YP_001225412.1|  Cell division protein FtsH [Synechococcus...   231    3e-59  Gene info
ref|ZP_01124582.1|  Peptidase M41, FtsH [Synechococcus sp. WH ...   231    3e-59 
ref|NP_387950.1|  cell-division protein and general stress pro...   231    3e-59  Gene info
ref|NP_849040.1|  cell division protein ftsH homolog [Cyanidio...   231    3e-59  Gene info
dbj|BAD45446.1|  putative FtsH-like protein Pftf precursor [Or...   231    3e-59 
ref|ZP_01155453.1|  ATP-dependent metalloprotease FtsH [Oceani...   231    3e-59 
ref|ZP_01057712.1|  ATP-dependent metalloprotease FtsH [Roseob...   231    3e-59 
ref|YP_001243943.1|  ATP-dependent metalloprotease FtsH [Therm...   231    3e-59  Gene info
ref|NP_228390.1|  cell division protein FtsH [Thermotoga marit...   231    3e-59  Gene info
ref|XP_001419590.1|  predicted protein [Ostreococcus lucimarin...   231    3e-59  Gene info
dbj|BAE71226.1|  putative zinc dependent protease [Trifolium prat   231    3e-59 
emb|CAA09935.1|  chloroplast protease [Capsicum annuum]             231    3e-59 
ref|YP_001344753.1|  ATP-dependent metalloprotease FtsH [Actin...   231    3e-59  Gene info
ref|YP_605645.1|  ATP-dependent metalloprotease FtsH [Deinococ...   231    3e-59  Gene info
dbj|BAD45447.1|  putative chloroplast protease [Oryza sativa (...   231    3e-59 
ref|YP_001409683.1|  ATP-dependent metalloprotease FtsH [Fervi...   231    3e-59  Gene info
ref|YP_988506.1|  ATP-dependent metallopeptidase HflB [Bartone...   231    3e-59  Gene info
ref|YP_001018381.1|  cell division protein FtsH2 [Prochlorococ...   230    4e-59  Gene info
ref|ZP_00540047.1|  Peptidase M41, FtsH [Exiguobacterium sibir...   230    4e-59 
ref|YP_155364.1|  Membrane ATP-dependent Zn protease [Idiomari...   230    4e-59  Gene info
ref|YP_730039.1|  cell division protein FtsH3 [Synechococcus s...   230    4e-59  Gene info
ref|NP_765827.1|  cell-division protein [Staphylococcus epider...   230    4e-59  Gene info
ref|ZP_00958817.1|  ATP-dependent metalloprotease FtsH [Roseov...   230    4e-59 
ref|NP_940333.1|  Cell division protein [Corynebacterium dipht...   230    4e-59  Gene info
ref|YP_077355.1|  cell-division protein and general stress pro...   230    4e-59  Gene info
ref|NP_285613.1|  cell division protein FtsH [Deinococcus radi...   230    4e-59  Gene info
ref|YP_001419749.1|  FtsH [Bacillus amyloliquefaciens FZB42] >...   230    4e-59  Gene info
ref|YP_001532458.1|  ATP-dependent metalloprotease FtsH [Dinor...   230    4e-59  Gene info
emb|CAA19646.1|  EG:100G10.7 [Drosophila melanogaster]              230    5e-59 
ref|NP_570017.1|  CG2658-PA, isoform A [Drosophila melanogaste...   230    5e-59  UniGene infoGene info
ref|ZP_01469651.1|  Peptidase M41, FtsH [Synechococcus sp. BL1...   230    5e-59 
ref|YP_001451358.1|  Cell division protein ftsH-like protein [...   230    5e-59  Gene info
ref|ZP_01749336.1|  ATP-dependent metalloprotease FtsH [Roseob...   230    5e-59 
ref|ZP_01037799.1|  ATP-dependent metalloprotease FtsH [Roseov...   230    5e-59 
ref|NP_637083.1|  cell division protein [Xanthomonas campestri...   229    6e-59  Gene info
ref|YP_001243535.1|  Cell division protein [Bradyrhizobium sp....   229    6e-59  Gene info
ref|YP_007639.1|  probable cell division protein FtsH [Candida...   229    6e-59  Gene info
ref|ZP_01741361.1|  FtsH [Rhodobacterales bacterium HTCC2150] ...   229    6e-59 
ref|YP_396210.1|  ATP-dependent zinc metalloendopeptidase FtsH...   229    6e-59  Gene info
ref|NP_777959.1|  Cell division protein [Buchnera aphidicola s...   229    6e-59  Gene info
ref|YP_001189095.1|  ATP-dependent metalloprotease FtsH [Pseud...   229    7e-59  Gene info
ref|ZP_01771121.1|  Hypothetical protein COLAER_00094 [Collins...   229    7e-59 
ref|ZP_00994137.1|  putative cell division protein FtsH [Janib...   229    7e-59 
ref|YP_614355.1|  ATP-dependent metalloprotease FtsH [Siliciba...   229    7e-59  Gene info
ref|ZP_01772666.1|  Hypothetical protein COLAER_01680 [Collins...   229    8e-59 
ref|YP_001496885.1|  ATP-dependent metalloprotease FtsH [Ricke...   229    8e-59  Gene info
ref|YP_302335.1|  ATP-dependent Zn metallopeptidase [Staphyloc...   229    8e-59  Gene info
gb|ABN05909.1|  Peptidase S26A, signal peptidase I; AAA ATPase...   229    8e-59 
ref|NP_895625.1|  cell division protein FtsH2 [Prochlorococcus...   229    8e-59  Gene info
ref|NP_219202.1|  cell division protein (ftsH) [Treponema pall...   229    9e-59  Gene info
ref|ZP_01390455.1|  ATP-dependent metalloprotease FtsH [Geobac...   229    9e-59 
gb|AAD17230.1|  FtsH-like protein Pftf precursor [Nicotiana tabac   229    9e-59  UniGene info
ref|YP_353740.1|  FtsH [Rhodobacter sphaeroides 2.4.1] >ref|YP...   229    9e-59  Gene info
ref|YP_001471155.1|  ATP-dependent metalloprotease FtsH [Therm...   229    9e-59  Gene info
ref|NP_787716.1|  cell division protein FtsH [Tropheryma whipp...   229    1e-58  Gene info
ref|YP_808077.1|  ATP-dependent Zn protease [Lactococcus lacti...   229    1e-58  Gene info
ref|YP_697892.1|  ATP-dependent metalloprotease FtsH [Clostrid...   229    1e-58  Gene info
ref|NP_789115.1|  FtsH-like cell division protein [Tropheryma ...   229    1e-58  Gene info
ref|YP_001031385.1|  putative cell division protein [Lactococc...   229    1e-58  Gene info
ref|ZP_01752966.1|  ATP-dependent metalloprotease FtsH [Roseob...   229    1e-58 
ref|ZP_01739366.1|  ftsH; cell division protein [Marinobacter ...   229    1e-58 
ref|ZP_01573745.1|  ATP-dependent metalloprotease FtsH [Burkho...   229    1e-58 
ref|YP_001090082.1|  cell division protein [Clostridium diffic...   229    1e-58  Gene info
ref|ZP_02042576.1|  hypothetical protein RUMGNA_03379 [Ruminoc...   229    1e-58 
ref|YP_001166777.1|  ATP-dependent metalloprotease FtsH [Rhodo...   229    1e-58  Gene info
ref|NP_266177.1|  FtsH [Lactococcus lactis subsp. lactis Il140...   228    1e-58  Gene info
ref|YP_523666.1|  ATP-dependent metalloprotease FtsH [Rhodofer...   228    1e-58  Gene info
ref|YP_388007.1|  ATP-dependent metalloprotease FtsH [Desulfov...   228    1e-58  Gene info
ref|YP_695032.1|  ATP-dependent metalloprotease FtsH [Clostrid...   228    2e-58  Gene info
emb|CAN73350.1|  hypothetical protein [Vitis vinifera]              228    2e-58 
ref|YP_001267776.1|  ATP-dependent metalloprotease FtsH [Pseud...   228    2e-58  Gene info
ref|NP_866771.1|  cell division protein FtsH [Rhodopirellula b...   228    2e-58  Gene info
ref|NP_561514.1|  cell division protein [Clostridium perfringe...   228    2e-58  Gene info
gb|ABH09265.1|  cell division protein [Paulinella chromatophora]    228    2e-58 
ref|NP_627610.1|  cell division protein ftsH homolog [Streptom...   228    2e-58  Gene info
sp|P94304|FTSH_BACPF  Cell division protease ftsH homolog >gb|...   228    2e-58 
ref|ZP_01966105.1|  hypothetical protein RUMOBE_03857 [Ruminoc...   228    2e-58 
ref|YP_682387.1|  cell division protein FtsH [Roseobacter deni...   228    2e-58  Gene info
ref|ZP_02078374.1|  hypothetical protein EUBDOL_02194 [Eubacte...   228    2e-58 
ref|ZP_01503096.1|  ATP-dependent metalloprotease FtsH [Burkho...   228    2e-58 
ref|ZP_01727604.1|  cell division protein; FtsH [Cyanothece sp...   228    2e-58 
ref|ZP_02027298.1|  hypothetical protein EUBVEN_02568 [Eubacte...   228    2e-58 
ref|NP_371035.1|  cell-division protein [Staphylococcus aureus...   228    2e-58  Gene info
ref|YP_185443.1|  cell division protein FtsH, putative [Staphy...   228    2e-58  Gene info
ref|YP_415959.1|  cell division protein [Staphylococcus aureus...   228    2e-58  Gene info
ref|ZP_01224057.1|  ATP-dependent metalloprotease FtsH [marine...   228    2e-58 
ref|YP_254415.1|  cell-division protein [Staphylococcus haemol...   228    2e-58  Gene info
ref|NP_440525.1|  cell division protein; FtsH [Synechocystis s...   228    3e-58  Gene info
emb|CAF99704.1|  unnamed protein product [Tetraodon nigroviridis]   228    3e-58 
ref|YP_632532.1|  ATP-dependent metalloprotease FtsH [Myxococc...   228    3e-58  Gene info
ref|ZP_00592538.1|  Peptidase M41, FtsH [Prosthecochloris aest...   228    3e-58 
gb|EDP75070.1|  tryptophan synthase subunit beta [Hydrogenivir...   227    3e-58 
emb|CAN80115.1|  hypothetical protein [Vitis vinifera]              227    3e-58 
ref|NP_563766.3|  FTSH8 (FtsH protease 8); ATP-dependent pepti...   227    3e-58  UniGene infoGene info
ref|ZP_01465746.1|  cell division protein FtsH [Stigmatella au...   227    3e-58 
emb|CAO89717.1|  unnamed protein product [Microcystis aeruginosa    227    3e-58 
gb|AAF24819.1|AC007592_12  F12K11.22 [Arabidopsis thaliana]         227    3e-58 
gb|EDK87669.1|  M41 family endopeptidase FtsH [Fusobacterium n...   227    4e-58 
ref|YP_892493.1|  putative Cell division protein FtsH homolog ...   227    4e-58  Gene info
ref|NP_240951.1|  cell-division protein (ATP-dependent Zn meta...   227    4e-58  Gene info


----------------------
Alignements 2 à 2 (15)
----------------------

>ref|ZP_01122231.1|  putative transmembrane AAA-metalloprotease FtsH [Robiginitalea 
biformata HTCC2501]
 gb|EAR14222.1|  putative transmembrane AAA-metalloprotease FtsH [Robiginitalea 
biformata HTCC2501]
Length=696

 Score =  380 bits (977),  Expect = 2e-104, Method: Composition-based stats.
 Identities = 190/213 (89%), Positives = 207/213 (97%), Gaps = 0/213 (0%)

Query  1    MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEM  60
            MFVGVGASRVRDLFKQAK+KSP+IIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEM
Sbjct  268  MFVGVGASRVRDLFKQAKDKSPAIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEM  327

Query  61   DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPDLNERREIFKVHLKPLKTTK  120
            DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPD+ ER+EIF+VHL+P+KT +
Sbjct  328  DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPDIRERKEIFEVHLRPIKTAE  387

Query  121  TLDVEFLSKQTPGFSGADIANVCNEAALIAARKNKKSVGKQDFLDAVDRIVGGLEKKNKI  180
            TLD++FL++QTPGFSGADIANVCNEAALIAARK +K+V KQDFLDAVDRIVGGLEKKNKI
Sbjct  388  TLDLDFLARQTPGFSGADIANVCNEAALIAARKERKAVTKQDFLDAVDRIVGGLEKKNKI  447

Query  181  VTQEEKKTIAFHEAGHAIVSWLLEHAAPLVKVT  213
            +T EEKKTIA+HEAGHA VSW+LEHAAPLVKVT
Sbjct  448  ITPEEKKTIAYHEAGHATVSWMLEHAAPLVKVT  480


>ref|ZP_01107151.1|  putative transmembrane AAA-metalloprotease FtsH [Flavobacteriales 
bacterium HTCC2170]
 gb|EAR00684.1|  putative transmembrane AAA-metalloprotease FtsH [Flavobacteriales 
bacterium HTCC2170]
Length=669

 Score =  377 bits (969),  Expect = 2e-103, Method: Composition-based stats.
 Identities = 189/213 (88%), Positives = 205/213 (96%), Gaps = 0/213 (0%)

Query  1    MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEM  60
            MFVGVGASRVRDLFKQAK+KSP+IIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEM
Sbjct  268  MFVGVGASRVRDLFKQAKDKSPAIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEM  327

Query  61   DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPDLNERREIFKVHLKPLKTTK  120
            DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPD+ ER+EIF+VHL+P+KT +
Sbjct  328  DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPDIRERKEIFEVHLRPIKTAE  387

Query  121  TLDVEFLSKQTPGFSGADIANVCNEAALIAARKNKKSVGKQDFLDAVDRIVGGLEKKNKI  180
            TLD++FL++QTPGFSGADIANVCNEAALIAARK KK+V KQDFLDAVDRIVGGLEKKNKI
Sbjct  388  TLDLDFLARQTPGFSGADIANVCNEAALIAARKEKKAVSKQDFLDAVDRIVGGLEKKNKI  447

Query  181  VTQEEKKTIAFHEAGHAIVSWLLEHAAPLVKVT  213
            +T  EKKTIA+HEAGHA  SW+LEHAAPLVKVT
Sbjct  448  ITAGEKKTIAYHEAGHATTSWMLEHAAPLVKVT  480


>ref|ZP_01050223.1|  putative transmembrane AAA-metalloprotease FtsH [Cellulophaga 
sp. MED134]
 gb|EAQ39238.1|  putative transmembrane AAA-metalloprotease FtsH [Dokdonia donghaensis 
MED134]
Length=651

 Score =  376 bits (965),  Expect = 6e-103, Method: Composition-based stats.
 Identities = 189/214 (88%), Positives = 205/214 (95%), Gaps = 1/214 (0%)

Query  1    MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEM  60
            MFVGVGASRVRDLFKQAKEKSP+IIFIDEIDAIGRARGKNNF+G NDERENTLNQLLTEM
Sbjct  271  MFVGVGASRVRDLFKQAKEKSPAIIFIDEIDAIGRARGKNNFSGGNDERENTLNQLLTEM  330

Query  61   DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPDLNERREIFKVHLKPLKTT-  119
            DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPD+ ER+EIF+VHL+PLK   
Sbjct  331  DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPDVRERKEIFEVHLRPLKKVD  390

Query  120  KTLDVEFLSKQTPGFSGADIANVCNEAALIAARKNKKSVGKQDFLDAVDRIVGGLEKKNK  179
            + LDV+FL+KQTPGFSGADIAN+CNEAALIAARK+KK+VGKQDFLDAVDRIVGGLEKKNK
Sbjct  391  EELDVDFLAKQTPGFSGADIANMCNEAALIAARKSKKAVGKQDFLDAVDRIVGGLEKKNK  450

Query  180  IVTQEEKKTIAFHEAGHAIVSWLLEHAAPLVKVT  213
            I+T +EK+ IAFHEAGHA VSW+LEHAAPLVKVT
Sbjct  451  IITPDEKRAIAFHEAGHATVSWMLEHAAPLVKVT  484


>gb|EDP72069.1|  putative transmembrane AAA-metalloprotease FtsH [Flavobacteriales 
bacterium ALC-1]
Length=647

 Score =  374 bits (960),  Expect = 2e-102, Method: Composition-based stats.
 Identities = 186/213 (87%), Positives = 202/213 (94%), Gaps = 0/213 (0%)

Query  1    MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEM  60
            MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGKN  +GSNDERENTLNQLLTEM
Sbjct  268  MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGKNAMSGSNDERENTLNQLLTEM  327

Query  61   DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPDLNERREIFKVHLKPLKTTK  120
            DGFGTN+NVIVLAATNRAD+LDKALMRAGRFDRQIYVDLPD+ ER+EIF+VHL+PLK  +
Sbjct  328  DGFGTNSNVIVLAATNRADILDKALMRAGRFDRQIYVDLPDVRERKEIFEVHLRPLKKEE  387

Query  121  TLDVEFLSKQTPGFSGADIANVCNEAALIAARKNKKSVGKQDFLDAVDRIVGGLEKKNKI  180
            TLD++FL+KQTPGFSGADIANVCNEAALIAARK KK+V KQDFLDAVDRIVGGLEKKNKI
Sbjct  388  TLDIDFLAKQTPGFSGADIANVCNEAALIAARKGKKAVNKQDFLDAVDRIVGGLEKKNKI  447

Query  181  VTQEEKKTIAFHEAGHAIVSWLLEHAAPLVKVT  213
            +T  EK+ +AFHEAGHA VSW+LEHAAPLVKVT
Sbjct  448  ITPGEKRAVAFHEAGHATVSWMLEHAAPLVKVT  480


>ref|ZP_01734498.1|  putative transmembrane AAA-metalloprotease FtsH [Flavobacteria 
bacterium BAL38]
 gb|EAZ95140.1|  putative transmembrane AAA-metalloprotease FtsH [Flavobacteria 
bacterium BAL38]
Length=639

 Score =  373 bits (958),  Expect = 4e-102, Method: Composition-based stats.
 Identities = 188/213 (88%), Positives = 202/213 (94%), Gaps = 0/213 (0%)

Query  1    MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEM  60
            MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDA+GRARGKNN TG+NDERENTLNQLLTEM
Sbjct  261  MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAVGRARGKNNMTGANDERENTLNQLLTEM  320

Query  61   DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPDLNERREIFKVHLKPLKTTK  120
            DGFGTN+NVIVLAATNRADVLDKAL+RAGRFDRQIYVDLPD+ ER+EIF+VHLKPLK ++
Sbjct  321  DGFGTNSNVIVLAATNRADVLDKALLRAGRFDRQIYVDLPDIRERKEIFEVHLKPLKKSE  380

Query  121  TLDVEFLSKQTPGFSGADIANVCNEAALIAARKNKKSVGKQDFLDAVDRIVGGLEKKNKI  180
             LD EFL+KQTPGFSGADIANVCNEAALIAARK+KK+V KQDFLDAVDRIVGGLEKKNKI
Sbjct  381  ELDTEFLAKQTPGFSGADIANVCNEAALIAARKDKKAVDKQDFLDAVDRIVGGLEKKNKI  440

Query  181  VTQEEKKTIAFHEAGHAIVSWLLEHAAPLVKVT  213
            VT  EK+ IA HEAGHA VSW+LEHAAPLVKVT
Sbjct  441  VTPAEKRAIAIHEAGHATVSWMLEHAAPLVKVT  473


>ref|ZP_01890010.1|  putative transmembrane AAA-metalloprotease FtsH [unidentified 
eubacterium SCB49]
 gb|EDM45206.1|  putative transmembrane AAA-metalloprotease FtsH [unidentified 
eubacterium SCB49]
Length=654

 Score =  373 bits (958),  Expect = 4e-102, Method: Composition-based stats.
 Identities = 187/213 (87%), Positives = 200/213 (93%), Gaps = 0/213 (0%)

Query  1    MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEM  60
            MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGK+N +GSNDERENTLNQLLTEM
Sbjct  275  MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGKSNMSGSNDERENTLNQLLTEM  334

Query  61   DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPDLNERREIFKVHLKPLKTTK  120
            DGFGT TNVIV+AATNRADVLDKALMRAGRFDRQIYVDLPD+ ER+EIF+VHL+P+K  +
Sbjct  335  DGFGTGTNVIVIAATNRADVLDKALMRAGRFDRQIYVDLPDVRERKEIFEVHLRPIKKEE  394

Query  121  TLDVEFLSKQTPGFSGADIANVCNEAALIAARKNKKSVGKQDFLDAVDRIVGGLEKKNKI  180
             LD +FLSKQTPGFSGADIANVCNEAALIAARK KK+V KQDFLDAVDRIVGGLEKKNKI
Sbjct  395  GLDTDFLSKQTPGFSGADIANVCNEAALIAARKEKKAVSKQDFLDAVDRIVGGLEKKNKI  454

Query  181  VTQEEKKTIAFHEAGHAIVSWLLEHAAPLVKVT  213
            VT  EKK IA+HEAGHA VSW+LEHAAPLVKVT
Sbjct  455  VTPSEKKAIAYHEAGHATVSWMLEHAAPLVKVT  487


>ref|ZP_00951422.1|  putative transmembrane AAA-metalloprotease FtsH [Croceibacter 
atlanticus HTCC2559]
 gb|EAP85945.1|  putative transmembrane AAA-metalloprotease FtsH [Croceibacter 
atlanticus HTCC2559]
Length=691

 Score =  372 bits (955),  Expect = 8e-102, Method: Composition-based stats.
 Identities = 189/214 (88%), Positives = 204/214 (95%), Gaps = 1/214 (0%)

Query  1    MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEM  60
            MFVGVGASRVRDLFKQAK+KSP+IIFIDEIDAIGRARGKNN +GSNDERENTLNQLLTEM
Sbjct  277  MFVGVGASRVRDLFKQAKDKSPAIIFIDEIDAIGRARGKNNMSGSNDERENTLNQLLTEM  336

Query  61   DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPDLNERREIFKVHLKPL-KTT  119
            DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPD+ ER+EIF+VHL+PL K  
Sbjct  337  DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPDVRERKEIFEVHLRPLKKVA  396

Query  120  KTLDVEFLSKQTPGFSGADIANVCNEAALIAARKNKKSVGKQDFLDAVDRIVGGLEKKNK  179
            + LDV+FL+KQTPGFSGADIANVCNEAALIAARK  K+VGKQDFLDAVDRIVGGLEKKNK
Sbjct  397  EELDVDFLAKQTPGFSGADIANVCNEAALIAARKGNKAVGKQDFLDAVDRIVGGLEKKNK  456

Query  180  IVTQEEKKTIAFHEAGHAIVSWLLEHAAPLVKVT  213
            I+T++EKK IAFHEAGHA VSW+LEHAAPLVKVT
Sbjct  457  IITKDEKKAIAFHEAGHATVSWMLEHAAPLVKVT  490


>ref|YP_862717.1| Gene info cell division protease FtsH [Gramella forsetii KT0803]
 emb|CAL67650.1| Gene info cell division protease FtsH [Gramella forsetii KT0803]
Length=686

 GENE ID: 4650914 ftsH | cell division protease FtsH [Gramella forsetii KT0803]
(10 or fewer PubMed links)

 Score =  371 bits (953),  Expect = 1e-101, Method: Composition-based stats.
 Identities = 192/214 (89%), Positives = 201/214 (93%), Gaps = 1/214 (0%)

Query  1    MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEM  60
            MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGK+NF+GSNDERENTLNQLLTEM
Sbjct  269  MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGKSNFSGSNDERENTLNQLLTEM  328

Query  61   DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPDLNERREIFKVHLKPL-KTT  119
            DGFGTNTNVIV+AATNRADVLDKALMRAGRFDRQIYVDLPDLNER+EIF VHLKPL K  
Sbjct  329  DGFGTNTNVIVIAATNRADVLDKALMRAGRFDRQIYVDLPDLNERKEIFDVHLKPLKKVA  388

Query  120  KTLDVEFLSKQTPGFSGADIANVCNEAALIAARKNKKSVGKQDFLDAVDRIVGGLEKKNK  179
              LD +FL+KQTPGFSGADIANVCNEAALIAARK  K+VGKQDFLDAVDRIVGGLEKKNK
Sbjct  389  DELDTDFLAKQTPGFSGADIANVCNEAALIAARKGNKAVGKQDFLDAVDRIVGGLEKKNK  448

Query  180  IVTQEEKKTIAFHEAGHAIVSWLLEHAAPLVKVT  213
            I+T  EKK IAFHEAGHA VSW+LEHAAPLVKVT
Sbjct  449  IITPSEKKAIAFHEAGHATVSWMLEHAAPLVKVT  482


>ref|ZP_01059097.1|  putative transmembrane AAA-metalloprotease FtsH [Flavobacterium 
sp. MED217]
 gb|EAQ50929.1|  putative transmembrane AAA-metalloprotease FtsH [Leeuwenhoekiella 
blandensis MED217]
Length=657

 Score =  369 bits (947),  Expect = 7e-101, Method: Composition-based stats.
 Identities = 186/214 (86%), Positives = 201/214 (93%), Gaps = 1/214 (0%)

Query  1    MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEM  60
            MFVGVGASRVRDLFKQAKEKSP+IIFIDEIDAIGRARGK NF+GSNDERENTLNQLLTEM
Sbjct  272  MFVGVGASRVRDLFKQAKEKSPAIIFIDEIDAIGRARGKANFSGSNDERENTLNQLLTEM  331

Query  61   DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPDLNERREIFKVHLKPL-KTT  119
            DGFGTNTNVIVLAATNRADVLD ALMRAGRFDRQIYVDLPD+ ER+EIF+VHL+PL K  
Sbjct  332  DGFGTNTNVIVLAATNRADVLDTALMRAGRFDRQIYVDLPDVRERKEIFEVHLRPLKKVA  391

Query  120  KTLDVEFLSKQTPGFSGADIANVCNEAALIAARKNKKSVGKQDFLDAVDRIVGGLEKKNK  179
            + LD EF++KQTPGFSGADIANVCNEAALIAAR+ K +VG+QDFLDAVDRIVGGLEKKNK
Sbjct  392  EELDTEFMAKQTPGFSGADIANVCNEAALIAARQGKAAVGRQDFLDAVDRIVGGLEKKNK  451

Query  180  IVTQEEKKTIAFHEAGHAIVSWLLEHAAPLVKVT  213
            I+T EEK+ IAFHEAGHA VSW+LEHAAPLVKVT
Sbjct  452  IITPEEKRAIAFHEAGHATVSWMLEHAAPLVKVT  485


>ref|ZP_01203187.1|  AAA-metalloprotease FtsH [Flavobacteria bacterium BBFL7]
 gb|EAS18683.1|  AAA-metalloprotease FtsH [Flavobacteria bacterium BBFL7]
Length=673

 Score =  369 bits (946),  Expect = 9e-101, Method: Composition-based stats.
 Identities = 186/214 (86%), Positives = 199/214 (92%), Gaps = 1/214 (0%)

Query  1    MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEM  60
            MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGK+NF+GSNDERENTLNQLLTEM
Sbjct  278  MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGKSNFSGSNDERENTLNQLLTEM  337

Query  61   DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPDLNERREIFKVHLKPLKTTK  120
            DGFGTNTNVIVLAATNRAD+LDKALMRAGRFDRQIYVDLPD+ ER EIF+VHL+PLK   
Sbjct  338  DGFGTNTNVIVLAATNRADILDKALMRAGRFDRQIYVDLPDVKEREEIFEVHLRPLKKVD  397

Query  121  T-LDVEFLSKQTPGFSGADIANVCNEAALIAARKNKKSVGKQDFLDAVDRIVGGLEKKNK  179
              LD  FL+KQTPGFSGADIANVCNEAALIAARK KK+V KQDFLDAVDRIVGGLEKKNK
Sbjct  398  NELDTSFLAKQTPGFSGADIANVCNEAALIAARKGKKAVDKQDFLDAVDRIVGGLEKKNK  457

Query  180  IVTQEEKKTIAFHEAGHAIVSWLLEHAAPLVKVT  213
            ++T  EKKTIA+HEAGHA VSW+ EHAAPL+KVT
Sbjct  458  LITPSEKKTIAYHEAGHATVSWMTEHAAPLIKVT  491


>ref|YP_001295524.1| Gene info Cell division protein FtsH [Flavobacterium psychrophilum JIP02/86]
 emb|CAL42708.1| Gene info Cell division protein FtsH [Flavobacterium psychrophilum JIP02/86]
Length=643

 GENE ID: 5299541 ftsH | Cell division protein FtsH
[Flavobacterium psychrophilum JIP02/86]

 Score =  366 bits (940),  Expect = 5e-100, Method: Composition-based stats.
 Identities = 181/213 (84%), Positives = 194/213 (91%), Gaps = 0/213 (0%)

Query  1    MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEM  60
            MFVGVGASRVRDLFKQAK+KSPSIIFIDEIDA+GRARGK N +G NDERENTLNQLLTEM
Sbjct  262  MFVGVGASRVRDLFKQAKDKSPSIIFIDEIDAVGRARGKGNMSGGNDERENTLNQLLTEM  321

Query  61   DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPDLNERREIFKVHLKPLKTTK  120
            DGFGTN+NVIV+AATNRADVLDKALMRAGRFDRQIYVDLP++ ER EIF VHL PLK  +
Sbjct  322  DGFGTNSNVIVIAATNRADVLDKALMRAGRFDRQIYVDLPNITERAEIFAVHLAPLKKVE  381

Query  121  TLDVEFLSKQTPGFSGADIANVCNEAALIAARKNKKSVGKQDFLDAVDRIVGGLEKKNKI  180
             LD EFL+K TPGFSGADIANVCNEAALIAAR NK +V KQDFLDAVDRIVGGLEKKNKI
Sbjct  382  NLDTEFLAKHTPGFSGADIANVCNEAALIAARNNKTAVDKQDFLDAVDRIVGGLEKKNKI  441

Query  181  VTQEEKKTIAFHEAGHAIVSWLLEHAAPLVKVT  213
            +T EEKK IA HEAGHA VSW+LEHAAPL+KVT
Sbjct  442  ITPEEKKAIAIHEAGHATVSWMLEHAAPLIKVT  474


>ref|YP_001194946.1| Gene info ATP-dependent metalloprotease FtsH [Flavobacterium johnsoniae 
UW101]
 gb|ABQ05627.1| Gene info ATP-dependent metalloprotease FtsH [Flavobacterium johnsoniae 
UW101]
Length=641

 GENE ID: 5093495 Fjoh_2600 | ATP-dependent metalloprotease FtsH
[Flavobacterium johnsoniae UW101]

 Score =  360 bits (925),  Expect = 2e-98, Method: Composition-based stats.
 Identities = 180/213 (84%), Positives = 198/213 (92%), Gaps = 0/213 (0%)

Query  1    MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEM  60
            MFVGVGASRVRDLFKQAKEKSP+IIFIDEIDA+GRARGK+N +G NDERENTLNQLLTEM
Sbjct  264  MFVGVGASRVRDLFKQAKEKSPAIIFIDEIDAVGRARGKSNMSGGNDERENTLNQLLTEM  323

Query  61   DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPDLNERREIFKVHLKPLKTTK  120
            DGFGTN+NVIVLAATNRADVLDKALMRAGRFDRQI+VDLPD+ ER EIFKVHL P+K  +
Sbjct  324  DGFGTNSNVIVLAATNRADVLDKALMRAGRFDRQIFVDLPDIRERAEIFKVHLAPIKKVE  383

Query  121  TLDVEFLSKQTPGFSGADIANVCNEAALIAARKNKKSVGKQDFLDAVDRIVGGLEKKNKI  180
             LD++FL+KQTPGFSGADIANVCNEAALIAAR NK +V KQDFLDAVDRI+GGLEKKNKI
Sbjct  384  GLDLDFLAKQTPGFSGADIANVCNEAALIAARNNKPAVDKQDFLDAVDRIIGGLEKKNKI  443

Query  181  VTQEEKKTIAFHEAGHAIVSWLLEHAAPLVKVT  213
            +T EEK+ IA HEAGHA VSW+LEHAAPL+KVT
Sbjct  444  ITPEEKRAIAIHEAGHATVSWMLEHAAPLIKVT  476


>ref|ZP_01252640.1|  putative transmembrane AAA-metalloprotease FtsH [Psychroflexus 
torquis ATCC 700755]
 gb|EAS72509.1|  putative transmembrane AAA-metalloprotease FtsH [Psychroflexus 
torquis ATCC 700755]
Length=699

 Score =  356 bits (913),  Expect = 5e-97, Method: Composition-based stats.
 Identities = 183/214 (85%), Positives = 199/214 (92%), Gaps = 1/214 (0%)

Query  1    MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEM  60
            MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGR+RGK   +GSNDERENTLNQLLTEM
Sbjct  273  MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRSRGKGGMSGSNDERENTLNQLLTEM  332

Query  61   DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPDLNERREIFKVHLKPLKTTK  120
            DGFGTNTNVIV+AATNRADVLDKALMRAGRFDRQIYVDLPD+ ER EIF+VHLKPLK  +
Sbjct  333  DGFGTNTNVIVIAATNRADVLDKALMRAGRFDRQIYVDLPDVKEREEIFEVHLKPLKKAE  392

Query  121  T-LDVEFLSKQTPGFSGADIANVCNEAALIAARKNKKSVGKQDFLDAVDRIVGGLEKKNK  179
              LD  FL+KQTPGFSGADIAN+CNEAALIAAR N K+VGKQDFLDAVDRIVGGLEKKNK
Sbjct  393  NELDTMFLAKQTPGFSGADIANLCNEAALIAARNNSKAVGKQDFLDAVDRIVGGLEKKNK  452

Query  180  IVTQEEKKTIAFHEAGHAIVSWLLEHAAPLVKVT  213
            I++++EKK IAFHEAGHA VSW+LE+A+PLVKVT
Sbjct  453  IMSKDEKKAIAFHEAGHATVSWMLEYASPLVKVT  486


>ref|ZP_01054196.1|  putative transmembrane AAA-metalloprotease FtsH [Tenacibaculum 
sp. MED152]
 gb|EAQ40945.1|  putative transmembrane AAA-metalloprotease FtsH [Polaribacter 
dokdonensis MED152]
Length=657

 Score =  354 bits (909),  Expect = 2e-96, Method: Composition-based stats.
 Identities = 178/213 (83%), Positives = 196/213 (92%), Gaps = 0/213 (0%)

Query  1    MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEM  60
            MFVGVGASRVRDLFKQA++KSPSIIFIDEIDAIGRARGKN+ TG NDERENTLNQLLTEM
Sbjct  267  MFVGVGASRVRDLFKQAQQKSPSIIFIDEIDAIGRARGKNSMTGGNDERENTLNQLLTEM  326

Query  61   DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPDLNERREIFKVHLKPLKTTK  120
            DGFGT+TNVIV+AATNRADVLDKALMRAGRFDRQIYVDLPD+ ER+EIF+VH+KPLK   
Sbjct  327  DGFGTDTNVIVIAATNRADVLDKALMRAGRFDRQIYVDLPDIRERQEIFEVHIKPLKLAD  386

Query  121  TLDVEFLSKQTPGFSGADIANVCNEAALIAARKNKKSVGKQDFLDAVDRIVGGLEKKNKI  180
             +DVEFL++QTPGFSGADIAN+CNEAALIAAR  KK++  Q FLDAVDRIVGGLEKK K 
Sbjct  387  DVDVEFLAQQTPGFSGADIANMCNEAALIAARNGKKAIHHQAFLDAVDRIVGGLEKKKKR  446

Query  181  VTQEEKKTIAFHEAGHAIVSWLLEHAAPLVKVT  213
            +T +EKK IAFHEAGHA VSW+LEHAAPLVKVT
Sbjct  447  ITPKEKKVIAFHEAGHATVSWMLEHAAPLVKVT  479


>ref|NP_904399.1| Gene info cell division protein FtsH, putative [Porphyromonas gingivalis 
W83]
 gb|AAQ65298.1| Gene info cell division protein FtsH, putative [Porphyromonas gingivalis 
W83]
Length=673

 GENE ID: 2551512 PG0047 | cell division protein FtsH, putative
[Porphyromonas gingivalis W83] (10 or fewer PubMed links)

 Score =  353 bits (906),  Expect = 4e-96, Method: Composition-based stats.
 Identities = 175/214 (81%), Positives = 198/214 (92%), Gaps = 2/214 (0%)

Query  1    MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGK-NNFTGSNDERENTLNQLLTE  59
            MFVGVGASRVRDLF+QAKEK+P IIFIDEIDA+GRARGK NNF+G NDERENTLNQLLTE
Sbjct  265  MFVGVGASRVRDLFRQAKEKAPCIIFIDEIDAVGRARGKGNNFSG-NDERENTLNQLLTE  323

Query  60   MDGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPDLNERREIFKVHLKPLKTT  119
            MDGFG+N+ VI+LAATNRADVLD AL+RAGRFDRQIYVDLPDLN+R+EIF VHLKPLKT 
Sbjct  324  MDGFGSNSGVIILAATNRADVLDSALLRAGRFDRQIYVDLPDLNDRKEIFLVHLKPLKTD  383

Query  120  KTLDVEFLSKQTPGFSGADIANVCNEAALIAARKNKKSVGKQDFLDAVDRIVGGLEKKNK  179
            K++DVEFLS+QTPGFSGADIANVCNEAALIAAR NK  V K+DF++AVDRIVGGLEKKNK
Sbjct  384  KSVDVEFLSRQTPGFSGADIANVCNEAALIAARSNKNFVDKEDFMNAVDRIVGGLEKKNK  443

Query  180  IVTQEEKKTIAFHEAGHAIVSWLLEHAAPLVKVT  213
            I T+EE+++IA HEAGHA +SW+L +A PLVKVT
Sbjct  444  ITTEEERRSIAIHEAGHATISWMLRYANPLVKVT  477

ORF finding

--------------------------------------------------------
Sens Direct, Cadres 1, 2 et 3, code bacterien, codon ATG
--------------------------------------------------------

>ORF number 1 in reading frame 1 on the direct strand extends from base 385 to base 819.
ATGAGTGCTTTGTCCAAGACATCAGCACGGTTAGTGGCTGCAAGAACTATAACGTTAGTG
TTAGTTCCAAAACCATCCATTTCTGTAAGCAACTGGTTCAATGTATTTTCTCGCTCATCG
TTGGATCCAGTAAAATTATTTTTTCCCCTTGCTCGACCAATTGCATCGATCTCATCAATA
AAAATAATGGAGGGTGATTTTTCTTTGGCTTGTTTGAATAAATCTCTAACCCTGGATGCA
CCAACTCCTACAAACATTTCGACAAAATCAGAGCCAGATAGAGAGAAAAAAGGAACTTTG
GCTTCACCTGCTACTGCTTTAGCCAACAGTGTTTTACCCGTTCCAGGTGATCCTACAAGC
AACGCTCCTTTTGGAATTTTTCCACCCAAAACGGTATATTTTTTTGGATTTTTAAGGAAA
TCTACAATTTCCTGA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
MSALSKTSARLVAARTITLVLVPKPSISVSNWFNVFSRSSLDPVKLFFPLARPIASISSI
KIMEGDFSLACLNKSLTLDAPTPTNISTKSEPDREKKGTLASPATALANSVLPVPGDPTS
NAPFGIFPPKTVYFFGFLRKSTIS*

>ORF number 1 in reading frame 2 on the direct strand extends from base 71 to base 316.
ATGCAATGGTTTTCTTTTCCTCCTGAGTCACAATTTTATTTTTCTTTTCAAGACCTCCTA
CAATTCGGTCTACTGCATCAAGAAAATCCTGCTTACCCACAGACTTTTTGTTTTTTCTTG
CTGCTATCAGCGCAGCTTCATTACATACATTGGCAATATCAGCTCCAGAAAAACCCGGTG
TTTGTTTGGACAGAAATTCCACGTCTAGTGTTTTTGTGGTTTTTAGGGGCTTTAGGTGAA
CCTTGA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
MQWFSFPPESQFYFSFQDLLQFGLLHQENPAYPQTFCFFLLLSAQLHYIHWQYQLQKNPV
FVWTEIPRLVFLWFLGALGEP*

>ORF number 1 in reading frame 3 on the direct strand extends from base 54 to base 278.
ATGACCCGCCTCATGGAATGCAATGGTTTTCTTTTCCTCCTGAGTCACAATTTTATTTTT
CTTTTCAAGACCTCCTACAATTCGGTCTACTGCATCAAGAAAATCCTGCTTACCCACAGA
CTTTTTGTTTTTTCTTGCTGCTATCAGCGCAGCTTCATTACATACATTGGCAATATCAGC
TCCAGAAAAACCCGGTGTTTGTTTGGACAGAAATTCCACGTCTAG

>Translation of ORF number 1 in reading frame 3 on the direct strand.
MTRLMECNGFLFLLSHNFIFLFKTSYNSVYCIKKILLTHRLFVFSCCYQRSFITYIGNIS
SRKTRCLFGQKFHV*

----------------------------------------------------------
Sens indirect, Cadres 1, 2 et 3, code bacterien, codon ATG
----------------------------------------------------------

>ORF number 1 in reading frame 1 on the reverse strand extends from base 310 to base 948.
ATGTTTGTAGGAGTTGGTGCATCCAGGGTTAGAGATTTATTCAAACAAGCCAAAGAAAAA
TCACCCTCCATTATTTTTATTGATGAGATCGATGCAATTGGTCGAGCAAGGGGAAAAAAT
AATTTTACTGGATCCAACGATGAGCGAGAAAATACATTGAACCAGTTGCTTACAGAAATG
GATGGTTTTGGAACTAACACTAACGTTATAGTTCTTGCAGCCACTAACCGTGCTGATGTC
TTGGACAAAGCACTCATGCGTGCAGGTCGATTCGATAGACAGATATACGTAGACCTGCCT
GATTTAAATGAAAGACGTGAAATTTTCAAGGTTCACCTAAAGCCCCTAAAAACCACAAAA
ACACTAGACGTGGAATTTCTGTCCAAACAAACACCGGGTTTTTCTGGAGCTGATATTGCC
AATGTATGTAATGAAGCTGCGCTGATAGCAGCAAGAAAAAACAAAAAGTCTGTGGGTAAG
CAGGATTTTCTTGATGCAGTAGACCGAATTGTAGGAGGTCTTGAAAAGAAAAATAAAATT
GTGACTCAGGAGGAAAAGAAAACCATTGCATTCCATGAGGCGGGTCATGCGATCGTTAGT
TGGTTACTGGAACATGCAGCTCCTTTGGTAAAAGTAACG

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
MFVGVGASRVRDLFKQAKEKSPSIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEM
DGFGTNTNVIVLAATNRADVLDKALMRAGRFDRQIYVDLPDLNERREIFKVHLKPLKTTK
TLDVEFLSKQTPGFSGADIANVCNEAALIAARKNKKSVGKQDFLDAVDRIVGGLEKKNKI
VTQEEKKTIAFHEAGHAIVSWLLEHAAPLVKVT

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

-------------------------------------------------
Sens Indirect, any codon, frame 1, code bacterien
-------------------------------------------------

>ORF number 1 in reading frame 1 on the reverse strand extends from base 1 to base 948.
GGAGGGGCCGGAGGACCGGGTGGTCAAATATTTAATATCGGTAAATCTAAAGCAAAACTC
TTTGATCAAAATACCGAAGTTAAAACAACCTTCAAAGACGTAGCCGGTTTAGAGGGTGCC
AAGGAAGAAATTCAGGAAATTGTAGATTTCCTTAAAAATCCAAAAAAATATACCGTTTTG
GGTGGAAAAATTCCAAAAGGAGCGTTGCTTGTAGGATCACCTGGAACGGGTAAAACACTG
TTGGCTAAAGCAGTAGCAGGTGAAGCCAAAGTTCCTTTTTTCTCTCTATCTGGCTCTGAT
TTTGTCGAAATGTTTGTAGGAGTTGGTGCATCCAGGGTTAGAGATTTATTCAAACAAGCC
AAAGAAAAATCACCCTCCATTATTTTTATTGATGAGATCGATGCAATTGGTCGAGCAAGG
GGAAAAAATAATTTTACTGGATCCAACGATGAGCGAGAAAATACATTGAACCAGTTGCTT
ACAGAAATGGATGGTTTTGGAACTAACACTAACGTTATAGTTCTTGCAGCCACTAACCGT
GCTGATGTCTTGGACAAAGCACTCATGCGTGCAGGTCGATTCGATAGACAGATATACGTA
GACCTGCCTGATTTAAATGAAAGACGTGAAATTTTCAAGGTTCACCTAAAGCCCCTAAAA
ACCACAAAAACACTAGACGTGGAATTTCTGTCCAAACAAACACCGGGTTTTTCTGGAGCT
GATATTGCCAATGTATGTAATGAAGCTGCGCTGATAGCAGCAAGAAAAAACAAAAAGTCT
GTGGGTAAGCAGGATTTTCTTGATGCAGTAGACCGAATTGTAGGAGGTCTTGAAAAGAAA
AATAAAATTGTGACTCAGGAGGAAAAGAAAACCATTGCATTCCATGAGGCGGGTCATGCG
ATCGTTAGTTGGTTACTGGAACATGCAGCTCCTTTGGTAAAAGTAACG

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
GGAGGPGGQIFNIGKSKAKLFDQNTEVKTTFKDVAGLEGAKEEIQEIVDFLKNPKKYTVL
GGKIPKGALLVGSPGTGKTLLAKAVAGEAKVPFFSLSGSDFVEMFVGVGASRVRDLFKQA
KEKSPSIIFIDEIDAIGRARGKNNFTGSNDERENTLNQLLTEMDGFGTNTNVIVLAATNR
ADVLDKALMRAGRFDRQIYVDLPDLNERREIFKVHLKPLKTTKTLDVEFLSKQTPGFSGA
DIANVCNEAALIAARKNKKSVGKQDFLDAVDRIVGGLEKKNKIVTQEEKKTIAFHEAGHA
IVSWLLEHAAPLVKVT