ORF FA16560

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : AACY01160023.1
Annotathon code: ORF_FA16560
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : BioCell 2006
Username : Sangoku
Annotated on : 2008-03-19 18:52:37
  • DENDOOVEN arnaud
  • LISON leslie

Synopsis

Genomic Sequence

>AACY01160023.1 ORF_FA16560 genomic DNA
CTCTGGCTCTGGCTGGTTCTCTGCGGCTCTCCCGGGCTCTCCCTGGCTCTTTGGCTCTCTCTGCCTCTCCCTGGCTCTCTTGGGCCCTTCCGGCTCTCTC
TGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTTTGGGGGTTTTCGGGCTCTTGCG
GGCTCCGGCTGGCTTTCTCTGGCTCCCTCTGGGTCCCTCTGGCTCTCTGTGGCTCTGGCTCTCTCTGGCTCCCTGGTTCTCTCTGGCTCTCTCTGGTCCT
CTTTGGCTCCCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTTTGGCCCTCTCTGGGTTTCTCTGGCTCTCGCTGGTTCCCTCCGGCTCT
CTCTGGGTCTCTCTGGCGCTCTCTGGTCCTCTCTGGCTCCCTTTGGTTCTCCCTGGCTTGCTTTGGCCCTCTCTGGTTCTCCCTGGCTTTCTCTGGCTCT
CTCTGGCTCTCGCCAGCTCTTGCTGGTGGCCTCTGGTTCTGTTTGGCTCTCTCTGGCTCTCCCTGGCTCTCTCTGGCTCTCTCTGGTTCCTTCGGGCCCT
CTTTTGTTGTCTCCGGGTCTCTCTGGCTCTCTCTGGCTCTCTCCGGCTCTTTCTGGCTCCGTGGCTGCATCTCTTTGTGTGACGCAGTCGAGAAGCTTAG
CCGGGATTTCGCCCACAGGTAAACCTGAGGACACATATGGCGCACGGCGAAGCCCGGCCATTGCCAGTGCACATGGAATCTTGTCCACCAAATAAGCGTG
TGGATGACTTACCTTATTCGTGAGA

Translation

[ - /825]   indirect strand


Phylogeny


Annotator commentaries

Notre séquence possède beaucoup d'element répétés. Nous nous sommes donc posés la question de savoir si une partie de cette séquence codait pour une protéine ou si c'etait une séquence non-codante. Nous avons donc fait une recherche d'ORF mais les résultats n'ont pas été vraiment concluant. en effet, aucun ORF ne commmence par un codon d'initiation tout en finissant par un codon STOP. les ORF pourrait donc ne pas être complet mais codant quand meme pour une partir d'une protéine. Nous avons donc choisi l'ORF le plus long est avons réalisé un BlastP contre nr et swissprot (2 bases de données protéiques). les résultats obtenus indiquent que la séquence en acides-aminés est relativement apparentées à certaines séquences présentes chez différents organismes mais ces organismes sont tous trés différents et les alignements 2 à 2 nous montrent une répétition récurrentes des acides aminés E, S et P. Ces résultats ne nous permettent donc pas d'emettre une hypothèse plausible sur l'origine de cette séquence.

Nous avons ensuite réalisé un BlastX de notre séquence afin de comparer tout les ORF possible aux banques de données protéiques Swissprot et nr afin de rechercher si une partie de la séquence codait réelement pour une protéine. Les résultats que nous avons obtenus ont également révélés une similarité avec des séquences présentes chez des organismes trés différents.Les alignement 2 à 2 ont montrés que les séquences présentes une répétition de la chaine d'acides aminés Q R E P. Ces répétitions récurrentes laissent penser que la séquences nucléotidique ne code pas pour une protéine. Elle serait plutot une séquence non-codante constitué de répétitions d'une même chaine de nucléotides: CTCTCTCTGG, une séquence décamérique ou un nucléotide peut changer de temps en temps du sans doute à une mutation ponctuelle.

Pour appuyer cette hypothèse d'une séquence non-codante, nous avons réalisés la recherche Interpro de chaque ORF c'est à dire la recherche de domaines protéiques. Pour la plupart, nous n'avons obtenus aucun résultat. Seul les ORF du brin direct avec anycodon ont révélés un domaine transmembranaire potentiel et un peptide signal ce que l'on retrouve chez la plupart des protéines. De plus, ces domaines ne possédaient pas de numero IPR. Nous n'avons donc pas retenus ces résultats.

Nous pouvons donc conclure avec le fait que notre séquence nucléotidique est certainement une séquence non-codante composées d'une chaine nucléotidique répétée. C'est peut être une séquence de promoteur, d'enhancer ou télomérique.

Multiple Alignement


BLAST

BlastX contre nr

Sequences producing significant alignments:                        (Bits)  Value

gi|5669894|gb|AAD46501.1|AF148805_6  ORF73 [Human herpesvirus 8]    114    7e-24
gi|76631357|ref|XP_869550.1|  PREDICTED: similar to Protein KI...   104    4e-21  Gene info
gi|2246532|gb|AAB62657.1|  ORF 73 [Human herpesvirus 8]             103    7e-21
gi|61742810|ref|NP_080359.2|  RIKEN cDNA 3110050K21 [Mus musculus   102    2e-20  UniGene infoGene info
gi|109502725|ref|XP_001072035.1|  PREDICTED: similar to RIKEN cDN   102    2e-20  Gene info
gi|109501760|ref|XP_224295.4|  PREDICTED: similar to RIKEN cDNA 3   102    2e-20  Gene info
gi|23612612|ref|NP_704173.1|  hypothetical protein [Plasmodium...   101    4e-20  GeoGene info
gi|111226965|ref|XP_645129.2|  hypothetical protein DDBDRAFT_0...   101    5e-20  Gene info
gi|42733645|gb|AAS38609.1|  hypothetical protein [Dictyostelium d   101    5e-20
gi|730888|sp|Q06666|T2_MOUSE  Octapeptide-repeat protein T2 >g...   100    8e-20  Gene info
gi|73989294|ref|XP_542572.2|  PREDICTED: similar to Protein KIAA0  98.2    4e-19  UniGene infoGene info
gi|18846043|ref|NP_572129.1|  ORF 73; extensive acidic domains...  98.2    4e-19  Gene info
gi|66803232|ref|XP_635459.1|  hypothetical protein DDBDRAFT_02...  97.8    5e-19  Gene info
gi|113415920|ref|XP_001128737.1|  PREDICTED: similar to gamma-...  97.1    9e-19  Gene info
gi|116008442|ref|NP_055885.3|  zinc finger CCCH-type containing 1  96.7    1e-18  Gene info
gi|30908950|gb|AAP37483.1|  hypothetical protein [Homo sapiens]    96.7    1e-18  UniGene infoGene info
gi|55959779|emb|CAI16506.1|  KIAA0853 [Homo sapiens]               96.7    1e-18  Gene info
gi|68052314|sp|Q5T200|ZC313_HUMAN  Zinc finger CCCH domain-con...  96.7    1e-18  Gene info
gi|52545594|emb|CAB66679.2|  hypothetical protein [Homo sapiens]   96.7    1e-18  UniGene infoGene info
gi|21732311|emb|CAD38544.1|  hypothetical protein [Homo sapiens]   96.7    1e-18  UniGene infoGene info
gi|109464874|ref|XP_001073300.1|  PREDICTED: hypothetical protein  96.3    2e-18  Gene info
gi|11610622|gb|AAG38961.1|AF255385_1  GABA-A epsilon subunit spli  95.5    3e-18  UniGene infoGene info
gi|12831207|ref|NP_075579.1|  gamma-aminobutyric acid  A recep...  95.5    3e-18  UniGene infoGene info
gi|109120663|ref|XP_001097211.1|  PREDICTED: zinc finger CCCH-typ  95.1    3e-18  Gene info
gi|118368975|ref|XP_001017693.1|  hypothetical protein TTHERM_...  94.0    8e-18  Gene info
gi|39597156|emb|CAE59383.1|  Hypothetical protein CBG02739 [Caeno  94.0    8e-18
gi|16329644|ref|NP_440372.1|  hypothetical protein slr1753 [Sy...  94.0    8e-18  Gene info
gi|118419244|gb|ABK87663.1|  conserved hypothetical protein [B...  93.6    1e-17
gi|91089453|ref|XP_968002.1|  PREDICTED: similar to CG32580-PA [T  93.6    1e-17  UniGene infoGene info
gi|54038076|gb|AAH84352.1|  LOC495149 protein [Xenopus laevis]     93.6    1e-17  UniGene infoGene info
gi|24580684|ref|NP_608540.1|  CG2839-PA [Drosophila melanogast...  92.4    2e-17  UniGene infoGene info
gi|114145509|ref|NP_059065.2|  gamma-aminobutyric acid (GABA-A...  92.0    3e-17  Gene info
gi|113416398|ref|XP_001131587.1|  PREDICTED: similar to gamma-...  92.0    3e-17  Gene info
gi|47226837|emb|CAG06679.1|  unnamed protein product [Tetraodon n  91.3    5e-17
gi|118196855|gb|AAI13390.1|  RBM25 protein [Homo sapiens] >gi|...  90.9    6e-17  Gene info
gi|114653782|ref|XP_510044.2|  PREDICTED: hypothetical protein is  90.9    6e-17  Gene info
gi|109084214|ref|XP_001086291.1|  PREDICTED: similar to RNA bi...  90.9    6e-17  Gene info
gi|55741709|ref|NP_067062.1|  RNA binding motif protein 25 [Ho...  90.9    6e-17  UniGene infoGene info
gi|13539605|emb|CAC35733.1|  cyclophilin-RNA interacting protein   90.9    6e-17
gi|76628323|ref|XP_884898.1|  PREDICTED: similar to RNA bindin...  90.9    6e-17  Gene info
gi|76628321|ref|XP_884874.1|  PREDICTED: similar to RNA bindin...  90.9    6e-17  Gene info
gi|73963505|ref|XP_867651.1|  PREDICTED: similar to RNA bindin...  90.9    6e-17  UniGene infoGene info
gi|73963515|ref|XP_867697.1|  PREDICTED: similar to RNA bindin...  90.9    6e-17  UniGene infoGene info
gi|73963519|ref|XP_867717.1|  PREDICTED: similar to RNA bindin...  90.9    6e-17  UniGene infoGene info
gi|4050087|gb|AAC97961.1|  S164 [Homo sapiens]                     90.9    6e-17  Gene info
gi|68068009|sp|P49756|RBM25_HUMAN  Probable RNA-binding protei...  90.9    6e-17
gi|68368938|ref|XP_692815.1|  PREDICTED: similar to Datf1_predict  89.7    1e-16  Gene info
gi|15292565|gb|AAK93551.1|  SD07741p [Drosophila melanogaster]     89.4    2e-16  UniGene info
gi|7861746|gb|AAF70384.1|AF189263_1  GABA-A receptor epsilon-like  89.4    2e-16  UniGene infoGene info
gi|7861753|gb|AAF70385.1|  GABA-A receptor epsilon-like subunit [  89.4    2e-16  Gene info
gi|115462723|ref|NP_001054961.1|  Os05g0225800 [Oryza sativa (...  88.6    3e-16  Gene info
gi|39582287|emb|CAE64238.1|  Hypothetical protein CBG08875 [Caeno  88.6    3e-16
gi|115462725|ref|NP_001054962.1|  Os05g0226000 [Oryza sativa (...  88.2    4e-16  Gene info
gi|66827947|ref|XP_647328.1|  hypothetical protein DDBDRAFT_01...  88.2    4e-16  Gene info
gi|118084869|ref|XP_417045.2|  PREDICTED: similar to KIAA0853 pro  87.8    5e-16  Gene info
gi|68448493|ref|NP_001020337.1|  hypothetical protein LOC55324...  87.8    5e-16  UniGene infoGene info
gi|111218572|ref|XP_001134472.1|  PHD Zn finger-containing pro...  87.4    7e-16  Gene info
gi|82942713|ref|XP_905005.1|  PREDICTED: RNA binding motif pro...  87.4    7e-16  UniGene infoGene info
gi|82942733|ref|XP_905069.1|  PREDICTED: RNA binding motif pro...  87.4    7e-16  UniGene infoGene info
gi|47125144|gb|AAH70605.1|  LOC431817 protein [Xenopus laevis]     87.4    7e-16  UniGene infoGene info
gi|9858781|gb|AAG01128.1|AF273333_13  BAC19.13 [Lycopersicon escu  87.4    7e-16
gi|82942731|ref|XP_905062.1|  PREDICTED: RNA binding motif pro...  87.4    7e-16  UniGene infoGene info
gi|82942723|ref|XP_905037.1|  PREDICTED: RNA binding motif pro...  87.4    7e-16  UniGene infoGene info
gi|82942715|ref|XP_905011.1|  PREDICTED: RNA binding motif pro...  87.4    7e-16  UniGene infoGene info
gi|71413651|ref|XP_808957.1|  trans-sialidase [Trypanosoma cru...  87.4    7e-16  Gene info
gi|118124449|ref|XP_001235161.1|  PREDICTED: similar to trans-...  86.7    1e-15  Gene info
gi|76628327|ref|XP_884942.1|  PREDICTED: similar to RNA bindin...  86.7    1e-15  Gene info
gi|109479623|ref|XP_001055193.1|  PREDICTED: similar to RNA bi...  86.3    2e-15  Gene info
gi|76261366|ref|ZP_00768979.1|  Pseudouridine synthase, Rsu [C...  86.3    2e-15
gi|85104285|ref|XP_961717.1|  hypothetical protein [Neurospora...  86.3    2e-15  Gene info
gi|16198129|gb|AAL13867.1|  LD33732p [Drosophila melanogaster]     85.9    2e-15  UniGene info
gi|78706600|ref|NP_001027103.1|  CG7971-PD, isoform D [Drosoph...  85.9    2e-15  UniGene infoGene info
gi|24655488|ref|NP_647642.2|  CG7971-PA, isoform A [Drosophila...  85.9    2e-15  UniGene infoGene info
gi|24655483|ref|NP_728652.1|  CG7971-PC, isoform C [Drosophila...  85.9    2e-15  UniGene infoGene info
gi|111307761|gb|AAI21193.1|  Unknown (protein for IMAGE:4960177)   85.5    3e-15
gi|26347067|dbj|BAC37182.1|  unnamed protein product [Mus musculu  85.5    3e-15  UniGene infoGene info
gi|3808062|dbj|BAA34056.1|  PV100 [Cucurbita maxima]               85.5    3e-15
gi|71650897|ref|XP_814137.1|  hypothetical protein [Trypanosom...  85.5    3e-15  Gene info
gi|114599974|ref|XP_001162337.1|  PREDICTED: splicing factor, ...  85.1    3e-15  Gene info
gi|114599972|ref|XP_517732.2|  PREDICTED: hypothetical protein is  85.1    3e-15  Gene info
gi|109077420|ref|XP_001087835.1|  PREDICTED: similar to splici...  85.1    3e-15  Gene info
gi|109077422|ref|XP_001087960.1|  PREDICTED: similar to splici...  85.1    3e-15  Gene info
gi|67968786|dbj|BAE00750.1|  unnamed protein product [Macaca fasc  85.1    3e-15  UniGene info
gi|90022595|ref|YP_528422.1|  Periplasmic protein TonB links i...  85.1    3e-15  Gene info
gi|116089325|ref|NP_001070667.1|  splicing factor, arginine/se...  84.7    5e-15  Gene info
gi|15889177|ref|NP_354858.1|  hypothetical protein AGR_C_3445 ...  84.7    5e-15  Gene info
gi|21040255|ref|NP_631907.1|  splicing factor, arginine/serine...  84.7    5e-15  UniGene infoGene info
gi|111226944|ref|XP_645574.2|  hypothetical protein DDBDRAFT_0...  84.0    8e-15  Gene info
gi|28829018|gb|AAO51593.1|  similar to Plasmodium falciparum (...  84.0    8e-15
gi|71417943|ref|XP_810705.1|  hypothetical protein [Trypanosom...  84.0    8e-15  Gene info
gi|109094975|ref|XP_001117433.1|  PREDICTED: hypothetical protein  83.6    1e-14  Gene info
gi|7549210|gb|AAF63787.1|AF142406_1  200 kDa antigen p200 [Babesi  83.6    1e-14
gi|10438851|dbj|BAB15362.1|  unnamed protein product [Homo sapien  83.6    1e-14  UniGene infoGene info
gi|118091663|ref|XP_421170.2|  PREDICTED: hypothetical protein [G  82.8    2e-14  Gene info
gi|109475298|ref|XP_001071028.1|  PREDICTED: hypothetical protein  82.8    2e-14  Gene info
gi|17221648|dbj|BAB78478.1|  preproMP73 [Cucurbita maxima]         82.8    2e-14
gi|109139384|ref|XP_001119507.1|  PREDICTED: hypothetical protein  82.4    2e-14  Gene info
gi|94390895|ref|XP_990867.1|  PREDICTED: hypothetical protein [Mu  82.4    2e-14  Gene info
gi|76628329|ref|XP_884973.1|  PREDICTED: similar to RNA bindin...  82.4    2e-14  Gene info
gi|76628331|ref|XP_884993.1|  PREDICTED: similar to RNA bindin...  82.4    2e-14  Gene info

Alignments

>gi|5669894|gb|AAD46501.1|AF148805_6  ORF73 [Human herpesvirus 8]
Length=1129

 Score =  114 bits (284),  Expect = 7e-24
 Identities = 61/194 (31%), Positives = 106/194 (54%), Gaps = 7/194 (3%)
 Frame = -1

Query  570  RARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPE  391
            ++ + Q+EP +    QQE  +    Q++P +    Q +P + +  QR P+     QREP+
Sbjct  428  QSSQQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQREPQQREPQQREPQ  487

Query  390  GTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEKA  211
                 QR P++ +  QREP++    QREP++    QREP  QREP+ Q  +  Q+EP++ 
Sbjct  488  QREPQQREPQQREPQQREPQQREPQQREPQQREPQQREP-QQREPQQQEPQ--QQEPQQQ  544

Query  210  SRSPQEP--ENPQRARESQREPERARESQREPERARESQREP--EGPKRARERQREPKSQ  43
                QEP  + PQ+    Q+EP++    Q+EP++    Q+EP  + P++  E+Q++ + Q
Sbjct  545  EPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQ  604

Query  42   GEPGRAAENQPEPE  1
             E  +  + Q E +
Sbjct  605  DEQQQDEQQQDEQQ  618


 Score =  112 bits (281),  Expect = 2e-23
 Identities = 60/199 (30%), Positives = 106/199 (53%), Gaps = 6/199 (3%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    Q+EP +    QQE  +    Q++P +    Q +P + +  QR P+     QR
Sbjct  435  EPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQREPQQREPQQREPQQREPQQR  494

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQ--REPEPQRARGTQR  226
            EP+     QR P++ +  QREP++    QREP++    Q+EP  Q  ++ EPQ+    Q+
Sbjct  495  EPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQQEPQQQEPQQQEPQQQEPQQQ  554

Query  225  EPEKASRSPQEP--ENPQRARESQREPERARESQREPERARESQR--EPEGPKRARERQR  58
            EP++     QEP  + PQ+    Q+EP++    Q+EP++  E Q+  + +  ++  E+Q+
Sbjct  555  EPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQDEQQQDEQQQ  614

Query  57   EPKSQGEPGRAAENQPEPE  1
            + + Q E  +  + Q E E
Sbjct  615  DEQQQDEQQQDEQQQDEQE  633


 Score =  110 bits (275),  Expect = 8e-23
 Identities = 61/194 (31%), Positives = 102/194 (52%), Gaps = 8/194 (4%)
 Frame = -1

Query  561  ESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGTS  382
            E   + N+T   Q    +    Q++P +    Q +P + +  Q+ P+     Q+EP+   
Sbjct  416  EDGGDGNKTLSIQSSQQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQRE  475

Query  381  ESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREP---EPQRARGTQREPEKA  211
              QR P++ +  QREP++    QREP++    QREP  QREP   EPQ+    QREP++ 
Sbjct  476  PQQREPQQREPQQREPQQREPQQREPQQREPQQREP-QQREPQQREPQQREPQQREPQQQ  534

Query  210  SRSPQEP--ENPQRARESQREPERARESQREPERARESQREP--EGPKRARERQREPKSQ  43
                QEP  + PQ+    Q+EP++    Q+EP++    Q+EP  + P++   +Q+EP+ Q
Sbjct  535  EPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQ  594

Query  42   GEPGRAAENQPEPE  1
             E  +  + Q E +
Sbjct  595  DEQQQDEQQQDEQQ  608


 Score =  108 bits (271),  Expect = 2e-22
 Identities = 58/199 (29%), Positives = 106/199 (53%), Gaps = 6/199 (3%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    Q+EP +    QQE  +    QR+P +    Q +P + +  QR P+     QR
Sbjct  445  EPQQQEPQQQEPQQQEPQQQEPQQQEPQQREPQQREPQQREPQQREPQQREPQQREPQQR  504

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQ--REPEPQRARGTQR  226
            EP+     QR P++ +  QREP++    Q+EP++    Q+EP  Q  ++ EPQ+    Q+
Sbjct  505  EPQQREPQQREPQQREPQQREPQQREPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQ  564

Query  225  EPEKASRSPQEP--ENPQRARESQREPERARESQREPERARESQR--EPEGPKRARERQR  58
            EP++     QEP  + PQ+    Q+EP++  E Q++ ++  E Q+  + +  ++  E+Q+
Sbjct  565  EPQQQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQ  624

Query  57   EPKSQGEPGRAAENQPEPE  1
            + + Q E  +  E Q + +
Sbjct  625  DEQQQDEQEQQDEQQQDEQ  643


 Score =  108 bits (269),  Expect = 4e-22
 Identities = 61/200 (30%), Positives = 108/200 (54%), Gaps = 9/200 (4%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            + E   + + E +   G++    ++ + Q++P +    Q +P + +  Q+ P+     Q+
Sbjct  405  DDEEEDKKEDEEDGGDGNKTLSIQSSQQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQ  464

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREP---EPQRARGTQ  229
            EP+     QR P++ +  QREP++    QREP++    QREP  QREP   EPQ+    Q
Sbjct  465  EPQQQEPQQREPQQREPQQREPQQREPQQREPQQREPQQREP-QQREPQQREPQQREPQQ  523

Query  228  REPEKASRSPQEP--ENPQRARESQREPERARESQREPERARESQREP--EGPKRARERQ  61
            REP++     QEP  + PQ+    Q+EP++    Q+EP++    Q+EP  + P++   +Q
Sbjct  524  REPQQREPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQ  583

Query  60   REPKSQGEPGRAAENQPEPE  1
            +EP+ Q EP +  E Q + +
Sbjct  584  QEPQQQ-EPQQQDEQQQDEQ  602


 Score =  105 bits (261),  Expect = 3e-21
 Identities = 53/201 (26%), Positives = 107/201 (53%), Gaps = 8/201 (3%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    Q+EP +    Q+E  +    QR+P +    Q +P + +  QR P+     QR
Sbjct  460  EPQQQEPQQQEPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQR  519

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQ--REPEPQRARGTQR  226
            EP+     QR P++ +  Q+EP++    Q+EP++    Q+EP  Q  ++ EPQ+    Q+
Sbjct  520  EPQQREPQQREPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQ  579

Query  225  EPEKASRSPQEP------ENPQRARESQREPERARESQREPERARESQREPEGPKRARER  64
            EP++     QEP      +  ++ ++ Q++ E+ ++ Q++ E+ ++ Q++ E  ++  ++
Sbjct  580  EPQQQEPQQQEPQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQEQQDEQQ  639

Query  63   QREPKSQGEPGRAAENQPEPE  1
            Q E + Q E  +  E + + E
Sbjct  640  QDEQQQQDEQEQQEEQEQQEE  660


 Score =  103 bits (257),  Expect = 9e-21
 Identities = 51/196 (26%), Positives = 105/196 (53%), Gaps = 3/196 (1%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    QREP +    Q+E  +    QR+P +    Q +P + +  QR P+     QR
Sbjct  470  EPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQR  529

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQ--REPEPQRARGTQR  226
            EP+     Q+ P++ +  Q+EP++    Q+EP++    Q+EP  Q  ++ EPQ+    Q+
Sbjct  530  EPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQ  589

Query  225  EPEKASRSPQ-EPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPK  49
            EP++     Q E +  ++ ++ Q++ E+ ++ Q++ E+ ++ Q + +  ++  ++Q++ +
Sbjct  590  EPQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQ  649

Query  48   SQGEPGRAAENQPEPE  1
             Q E     E Q + E
Sbjct  650  EQQEEQEQQEEQQQDE  665


 Score =  100 bits (248),  Expect = 1e-19
 Identities = 47/193 (24%), Positives = 100/193 (51%), Gaps = 0/193 (0%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    QREP +    Q+E  +    QR+P +    Q +P + +  Q+ P+     Q+
Sbjct  490  EPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQQEPQQQEPQQQEPQQQ  549

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            EP+     Q+ P++ +  Q+EP++    Q+EP++    Q+EP  Q E +    +  +++ 
Sbjct  550  EPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQDEQQQ  609

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
            ++  +  Q+ +  Q+  + Q E E+  E Q++ ++ ++ Q + E  ++  E+Q++ + Q 
Sbjct  610  DEQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQQQDEQQQD  669

Query  39   EPGRAAENQPEPE  1
            E  +  + Q E E
Sbjct  670  EQQQDEQQQDEQE  682


 Score = 98.6 bits (244),  Expect = 3e-19
 Identities = 47/193 (24%), Positives = 101/193 (52%), Gaps = 1/193 (0%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    QREP +    Q+E  +    QR+P +    Q +P + +  QR P+     Q+
Sbjct  480  EPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQQEPQQQ  539

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            EP+     Q+ P++ +  Q+EP++    Q+EP++    Q+EP  Q+EP+ Q  +    + 
Sbjct  540  EPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEP-QQQEPQQQEPQQQDEQQ  598

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
            +   +  ++ ++ Q+  E Q++ ++  E Q++ +  ++ Q++ E  ++  + Q+E + Q 
Sbjct  599  QDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQ  658

Query  39   EPGRAAENQPEPE  1
            E  +  E Q + +
Sbjct  659  EEQQQDEQQQDEQ  671


 Score = 92.4 bits (228),  Expect = 2e-17
 Identities = 41/193 (21%), Positives = 99/193 (51%), Gaps = 0/193 (0%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    QREP +    Q+E  +    QR+P +    Q +P + +  Q+ P+     Q+
Sbjct  500  EPQQREPQQREPQQREPQQREPQQREPQQREPQQQEPQQQEPQQQEPQQQEPQQQEPQQQ  559

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            EP+     Q+ P++ +  Q+EP++    Q+EP++  E Q++   Q E +    +  +++ 
Sbjct  560  EPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQDEQQQDEQQQDEQQQ  619

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
            ++  +  Q+ +  ++  E Q++ ++ ++ Q + E   + + + +  ++  E+Q++ + Q 
Sbjct  620  DEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQQQDEQQQDEQQQDEQQQD  679

Query  39   EPGRAAENQPEPE  1
            E  +  E Q + +
Sbjct  680  EQEQQDEQQQDEQ  692


 Score = 90.1 bits (222),  Expect = 1e-16
 Identities = 45/205 (21%), Positives = 103/205 (50%), Gaps = 12/205 (5%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    QREP +    Q+E  +    Q++P +    Q +P + +  Q+ P+     Q+
Sbjct  510  EPQQREPQQREPQQREPQQREPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQ  569

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQ------------REP  256
            EP+     Q+ P++ +  Q+EP++  E Q++ ++  E Q++   Q            ++ 
Sbjct  570  EPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQ  629

Query  255  EPQRARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKR  76
            + Q  +  Q++ E+  +  QE +  Q  +E Q++ E+ ++ Q++ E+ ++ Q + +  ++
Sbjct  630  DEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQQQDEQQQDEQQQDEQQQDEQEQQDEQQQ  689

Query  75   ARERQREPKSQGEPGRAAENQPEPE  1
              ++Q++ + Q E     E Q + E
Sbjct  690  DEQQQQDEQEQQEEQEQQEEQEQQE  714


 Score = 89.7 bits (221),  Expect = 1e-16
 Identities = 45/193 (23%), Positives = 101/193 (52%), Gaps = 2/193 (1%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    Q+EP +    QQE  +    Q++P +    Q +P + +  Q+ P+     Q+
Sbjct  530  EPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQ  589

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            EP+   E Q++ ++  E Q++ ++  E Q++ ++  E Q++   Q++ + Q  +  Q++ 
Sbjct  590  EPQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQ--QQQD  647

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
            E+  +  QE +  Q+  E Q++ ++  E Q++ +  ++ Q++ E  ++  + Q+E + Q 
Sbjct  648  EQEQQEEQEQQEEQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQ  707

Query  39   EPGRAAENQPEPE  1
            E     E Q + E
Sbjct  708  EEQEQQEEQEQQE  720


 Score = 89.0 bits (219),  Expect = 2e-16
 Identities = 40/193 (20%), Positives = 100/193 (51%), Gaps = 0/193 (0%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    QREP +    Q+E  +    Q++P +    Q +P + +  Q+ P+     Q+
Sbjct  505  EPQQREPQQREPQQREPQQREPQQREPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQ  564

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            EP+     Q+ P++ +  Q+EP++    Q++ ++  E Q++   Q E +    +  +++ 
Sbjct  565  EPQQQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQ  624

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
            ++  +  QE ++ Q+  E Q++ E+ ++ ++E +  ++   + +  ++  E+Q++ + Q 
Sbjct  625  DEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQQQDEQQQDEQQQDEQQQDEQEQQ  684

Query  39   EPGRAAENQPEPE  1
            +  +  E Q + E
Sbjct  685  DEQQQDEQQQQDE  697


 Score = 85.9 bits (211),  Expect = 2e-15
 Identities = 55/199 (27%), Positives = 98/199 (49%), Gaps = 10/199 (5%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            + E   E   E +     +++     E   +     E   +    + ++   +   E ++
Sbjct  353  DEEDDEEDDEEDDEEDDEEEDEEEDEEEDEEEDEEEEEDEEDDDDEDNEDEEDDEEEDKK  412

Query  399  EPE--GTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQ--REPEPQRARGT  232
            E E  G   ++    ++ + Q+EP++    Q+EP++    Q+EP  Q  ++ EPQ+    
Sbjct  413  EDEEDGGDGNKTLSIQSSQQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQ  472

Query  231  QREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPE--GPKRARERQR  58
            QREP++  R PQ+ E PQ+    QREP++    QREP++    QREP+   P++   +QR
Sbjct  473  QREPQQ--REPQQRE-PQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQR  529

Query  57   EPKSQGEPGRAAENQPEPE  1
            EP+ Q EP +    Q EP+
Sbjct  530  EPQQQ-EPQQQEPQQQEPQ  547


 Score = 85.9 bits (211),  Expect = 2e-15
 Identities = 41/191 (21%), Positives = 101/191 (52%), Gaps = 1/191 (0%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    Q+EP +    QQE  +    Q++P +    Q +P + +  Q+ P+  +E Q+
Sbjct  535  EPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQ-QEPQQ  593

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            + E   + Q+  E+ ++ Q++ E+ ++ Q++ ++ ++ Q +   Q++ E Q+    +++ 
Sbjct  594  QDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQE  653

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
            E+  +  Q+ +  Q+  + Q E ++  + Q++ ++  E Q++ E  ++  + Q+E + Q 
Sbjct  654  EQEQQEEQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQEQQ  713

Query  39   EPGRAAENQPE  7
            E     E Q +
Sbjct  714  EEQEQQEEQEQ  724


 Score = 83.6 bits (205),  Expect = 1e-14
 Identities = 43/193 (22%), Positives = 102/193 (52%), Gaps = 5/193 (2%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    Q+EP +    QQE  +    Q++P +    Q +P + +  Q+ P+   E Q+
Sbjct  540  EPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQ  599

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            + +   E Q++ E+ ++ Q++ E+ ++ Q++ ++ ++ +++   Q++ + Q  +  Q + 
Sbjct  600  DEQQQDEQQQD-EQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQ  658

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
            E+  +  Q+ +  Q+  + Q E E+  E Q++ ++ ++ Q + E     +E+Q E + Q 
Sbjct  659  EEQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQE----EQEQQEEQEQQE  714

Query  39   EPGRAAENQPEPE  1
            E  +  E + E E
Sbjct  715  EQEQQEEQEQELE  727


 Score = 83.2 bits (204),  Expect = 1e-14
 Identities = 43/191 (22%), Positives = 96/191 (50%), Gaps = 4/191 (2%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    Q+EP +    QQE  +    Q++P +    Q +P + +  Q+  +   E Q+
Sbjct  545  EPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQ  604

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            + +   E Q++ ++  E Q++ ++  E +++ ++ ++ Q++   Q + E Q  +  Q++ 
Sbjct  605  DEQQQDEQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQQQD  664

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
            E+     Q+ E  Q  +E Q E ++  + Q++ +  +E Q + E     +E+Q E + Q 
Sbjct  665  EQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQE----EQEQQEEQEQQE  720

Query  39   EPGRAAENQPE  7
            E  +  E Q +
Sbjct  721  EQEQELEEQEQ  731


 Score = 79.3 bits (194),  Expect = 2e-13
 Identities = 37/179 (20%), Positives = 91/179 (50%), Gaps = 0/179 (0%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    Q+EP +    QQE  +    Q++P +  E Q    +    Q+  +   E Q+
Sbjct  560  EPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQDEQQQDEQQQDEQQQ  619

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            + +   E Q++ +  ++ Q++ E+ ++ ++E +  +E Q E     + + ++ +  Q++ 
Sbjct  620  DEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQQQDEQQQDEQQQDEQQQD  679

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQ  43
            E+  +  Q+ +  Q+  E +++ E+ ++ ++E +  +E Q E E     +E++ E + Q
Sbjct  680  EQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQEQQEEQEQQEEQEQELEEQEQELEEQEQ  738


 Score = 77.4 bits (189),  Expect = 7e-13
 Identities = 52/215 (24%), Positives = 97/215 (45%), Gaps = 35/215 (16%)
 Frame = -3

Query  697  SFSTASHKEMQPRSQKEPERARESQRDpettkegpkepERARESQGEPERAKQNQRPPAR  518
            + S  S ++ Q   Q+EP++    Q++P+  +   +EP++    Q EP++ +  QR P +
Sbjct  424  TLSIQSSQQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQREPQQREPQQ  483

Query  517  AGESQREPEKARENQRGPKQArenqrepertrerqrdpeRAGGNQREPEKPREGQREPER  338
                QREP++    QR P+Q                        QREP++    QREP++
Sbjct  484  REPQQREPQQREPQQREPQQREP--------------------QQREPQQREPQQREPQQ  523

Query  337  ARESQREPEGAKEDQrepertreperaratESQRDPEGARESQPEPAR--ARKPPKSQRE  164
                QREP+  +  Q                 Q++P+     Q EP +   ++    Q+E
Sbjct  524  REPQQREPQQQEPQQ-------------QEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQE  570

Query  163  PERARESQREPERARESQREPERAGRAQESQGEAE  59
            P++    Q+EP++    Q+EP++    Q+ + + +
Sbjct  571  PQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQD  605


 Score = 77.0 bits (188),  Expect = 1e-12
 Identities = 39/193 (20%), Positives = 95/193 (49%), Gaps = 1/193 (0%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    Q+EP +    QQE  +    Q++P + +E Q +  + +  Q+  E  ++ Q+
Sbjct  555  EPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEP-QQQEPQQQDEQQQDEQQQDEQQQDEQQ  613

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            + E   + Q+  E+ ++ Q + +  ++ +++ +  +E Q E   Q E +    +  +++ 
Sbjct  614  QDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQQQDEQQQDEQQQ  673

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
            ++  +  QE ++ Q+  E Q++ E+ ++ ++E +  +E Q E E  +   +   E + + 
Sbjct  674  DEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQEQQEEQEQQEEQEQELEEQEQEL  733

Query  39   EPGRAAENQPEPE  1
            E       + E E
Sbjct  734  EEQEQELEEQEQE  746


 Score = 75.5 bits (184),  Expect = 3e-12
 Identities = 43/191 (22%), Positives = 93/191 (48%), Gaps = 0/191 (0%)
 Frame = -2

Query  677  QRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPER  498
            Q     EP++    QREP++    +R P+     QREP +    Q EP+      REP++
Sbjct  459  QEPQQQEPQQQEPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQ  518

Query  497  ARESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREPER  318
                Q EP++ +  Q EP+     Q+ P++    ++EP +    Q+ P++    Q+EP++
Sbjct  519  REPQQREPQQREPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQ  578

Query  317  ARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPE  138
                Q+ P++    Q   + Q  ++ +  +  +++    ++  +   E ++  + Q++ +
Sbjct  579  QEPQQQEPQQQEPQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQEQQDEQ  638

Query  137  RARESQREPER  105
            +  E Q++ E+
Sbjct  639  QQDEQQQQDEQ  649


 Score = 75.5 bits (184),  Expect = 3e-12
 Identities = 41/191 (21%), Positives = 97/191 (50%), Gaps = 3/191 (1%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    Q+EP +    QQE  + +E Q++  + ++ Q +  + +  Q+  E  ++ Q+
Sbjct  565  EPQQQEPQQQEPQQQEPQQQE-PQQQEPQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQ  623

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            + E   + Q   +  ++ +++ +  +E Q E ++  E Q++   Q++ E Q+    Q E 
Sbjct  624  QDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQQQD--EQQQDEQQQDEQQQDEQ  681

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
            E+     Q+ +  Q  +E Q E E+  E +++ E+ ++ ++E E  ++ +E + + +   
Sbjct  682  EQQDEQQQDEQQQQDEQEQQEEQEQQEEQEQQEEQEQQEEQEQELEEQEQELEEQEQELE  741

Query  39   EPGRAAENQPE  7
            E  +  E Q +
Sbjct  742  EQEQELEEQEQ  752


 Score = 74.7 bits (182),  Expect = 5e-12
 Identities = 57/220 (25%), Positives = 96/220 (43%), Gaps = 30/220 (13%)
 Frame = -1

Query  573  ERARESQ--REPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            E ++ESQ  ++ N  +  ++E     E +       E   +    +  +   E   E + 
Sbjct  314  EISKESQVDKDDNDNKDDEEEQETDEEDEEDDEEDDEEDDEEDDEEDDEEDDEEDDEEED  373

Query  399  EPEGTSESQRNPERAKESQREP-----ERARESQREPKRTRES----------------Q  283
            E E   E +   E  +E + +      E   + + E K+  E                 Q
Sbjct  374  EEEDEEEDEEEDEEEEEDEEDDDDEDNEDEEDDEEEDKKEDEEDGGDGNKTLSIQSSQQQ  433

Query  282  REPGSQ--REPEPQRARGTQREPEKASRSPQEP--ENPQRARESQREPERARESQREPER  115
            +EP  Q  ++ EPQ+    Q+EP++     QEP  + PQ+    QREP++    QREP++
Sbjct  434  QEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQREPQQREPQQREPQQREPQQ  493

Query  114  ARESQREPE--GPKRARERQREPKSQGEPGRAAENQPEPE  1
                QREP+   P++   +QREP+ Q EP +    Q EP+
Sbjct  494  REPQQREPQQREPQQREPQQREPQ-QREPQQREPQQREPQ  532


 Score = 72.4 bits (176),  Expect = 2e-11
 Identities = 45/192 (23%), Positives = 88/192 (45%), Gaps = 24/192 (12%)
 Frame = -2

Query  677  QRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPER  498
            Q     EP++    Q+EP++    +R P+     QREP +    Q EP+      REP++
Sbjct  449  QEPQQQEPQQQEPQQQEPQQQEPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQ  508

Query  497  ARESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREPER  318
                Q EP++ +  Q EP+  RE Q                   Q+ P++    Q+EP++
Sbjct  509  REPQQREPQQREPQQREPQ-QREPQ-------------------QQEPQQQEPQQQEPQQ  548

Query  317  ARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTP-KEPERARESQREP  141
                Q+ P++    Q   +    +EP+     Q++P       + P ++ E+ ++ Q++ 
Sbjct  549  QEPQQQEPQQQEPQQ---QEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQD  605

Query  140  ERARESQREPER  105
            E+ ++ Q++ E+
Sbjct  606  EQQQDEQQQDEQ  617


 Score = 68.2 bits (165),  Expect = 4e-10
 Identities = 51/192 (26%), Positives = 90/192 (46%), Gaps = 10/192 (5%)
 Frame = -2

Query  659  EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEAT-----SKSWREPERA  495
            E E   E + E E   D++   +   + + +     E   +   T     S+  +EP++ 
Sbjct  380  EDEEEDEEEEEDEEDDDDEDNEDEEDDEEEDKKEDEEDGGDGNKTLSIQSSQQQQEPQQQ  439

Query  494  RESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREPERA  315
               Q EP++ +  Q EP+     Q+ P++    +REP +    QR P++    QREP++ 
Sbjct  440  EPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQREPQQREPQQREPQQREPQQREPQQR  499

Query  314  RGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTP--KEPERARESQREP  141
               QR P++    Q  RE Q  REP+     QR+P       + P  +EP++    Q+EP
Sbjct  500  EPQQREPQQREPQQ--REPQ-QREPQQREPQQREPQQQEPQQQEPQQQEPQQQEPQQQEP  556

Query  140  ERARESQREPER  105
            ++    Q+EP++
Sbjct  557  QQQEPQQQEPQQ  568


 Score = 63.2 bits (152),  Expect = 1e-08
 Identities = 49/201 (24%), Positives = 89/201 (44%), Gaps = 15/201 (7%)
 Frame = -2

Query  671  DAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPE---  501
            D   + E   E   E +   D +   E   + + +     E + + E   K   E +   
Sbjct  361  DEEDDEEDDEEEDEEEDEEEDEEEDEEEEEDEEDDDDEDNEDEEDDEEEDKKEDEEDGGD  420

Query  500  -------RARESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRAR  342
                   ++ + Q EP++ +  Q EP+     Q+ P++    ++EP +    QR P++  
Sbjct  421  GNKTLSIQSSQQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQREPQQRE  480

Query  341  ESQREPERARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTP--KEPE  168
              QREP++    QR P++    Q  RE Q  REP+     QR+P       + P  +EP+
Sbjct  481  PQQREPQQREPQQREPQQREPQQ--REPQ-QREPQQREPQQREPQQREPQQREPQQQEPQ  537

Query  167  RARESQREPERARESQREPER  105
            +    Q+EP++    Q+EP++
Sbjct  538  QQEPQQQEPQQQEPQQQEPQQ  558


 Score = 47.4 bits (111),  Expect = 8e-04
 Identities = 30/188 (15%), Positives = 80/188 (42%), Gaps = 16/188 (8%)
 Frame = -2

Query  677  QRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPER  498
            Q     EP++    Q+EP++  + ++  +   E Q++  +  E Q + +   +  ++ + 
Sbjct  574  QEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQE  633

Query  497  ARESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREPER  318
             ++ Q + E+ +  + E +  +E Q                 E Q+  ++  E Q++ ++
Sbjct  634  QQDEQQQDEQQQQDEQEQQEEQEQQ----------------EEQQQDEQQQDEQQQDEQQ  677

Query  317  ARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPE  138
                ++  E+ ++ Q  ++ Q  +E +  +  Q +     +  +  +E E   +   E E
Sbjct  678  QDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQEQQEEQEQQEEQEQELEEQEQELEEQE  737

Query  137  RARESQRE  114
            +  E Q +
Sbjct  738  QELEEQEQ   745
>gi|2246532|gb|AAB62657.1|  ORF 73 [Human herpesvirus 8]
Length=1089

 Score =  103 bits (258),  Expect = 7e-21
 Identities = 54/194 (27%), Positives = 106/194 (54%), Gaps = 5/194 (2%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    Q+EP +    QQE  +    Q++P + +E   +P + +  Q+ P+     QR
Sbjct  443  EPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEP-QQQEPLQEPQQQEPQQQEPQQREPQQR  501

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            EP+     QR P++ +  QREP++    QREP++    Q+EP  Q   EPQ+    Q+EP
Sbjct  502  EPQQREPQQREPQQREPQQREPQQQEPQQREPQQQEPQQQEPQQQ---EPQQQEPQQQEP  558

Query  219  EKASRSPQEP-ENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQ  43
            ++     QEP +  ++ ++ Q++ E+ ++ Q++ E+ ++ Q++ E  ++  ++Q E + Q
Sbjct  559  QQQEPQQQEPQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQ  618

Query  42   GEPGRAAENQPEPE  1
             E  +  E + + E
Sbjct  619  DEQEQQEEQEQQEE  632


 Score = 99.0 bits (245),  Expect = 2e-19
 Identities = 53/195 (27%), Positives = 102/195 (52%), Gaps = 6/195 (3%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    Q+EP +    QQE  + +E  ++P +    Q +P + +  QR P+     QR
Sbjct  453  EPQQQEPQQQEPQQQEPQQQE-PQQQEPLQEPQQQEPQQQEPQQREPQQREPQQREPQQR  511

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            EP+     QR P++ +  QREP++    Q+EP++    Q+EP  Q   EPQ+    Q+EP
Sbjct  512  EPQQREPQQREPQQQEPQQREPQQQEPQQQEPQQQEPQQQEPQQQ---EPQQQEPQQQEP  568

Query  219  EKASRSPQ--EPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKS  46
            ++     Q  + ++ Q+  E Q++ ++  E Q++ +  ++ Q++ E  ++  + Q+E + 
Sbjct  569  QQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQE  628

Query  45   QGEPGRAAENQPEPE  1
            Q E     E Q + +
Sbjct  629  QQEEQEQQEEQEQEQ  643


 Score = 94.7 bits (234),  Expect = 4e-18
 Identities = 56/198 (28%), Positives = 105/198 (53%), Gaps = 10/198 (5%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            + E   + + E +   G++    ++ + Q++P +    Q +P + +  Q+ P+     Q+
Sbjct  413  DDEEEDKKEDEEDGGDGNKTLSIQSSQQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQ  472

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREP---EPQRARGTQ  229
            EP+   E  + P++ +  Q+EP++    QREP++    QREP  QREP   EPQ+    Q
Sbjct  473  EPQ-QQEPLQEPQQQEPQQQEPQQREPQQREPQQREPQQREP-QQREPQQREPQQQEPQQ  530

Query  228  REPEKASRSPQEP--ENPQRARESQREPERARESQREPERARESQREPEGPKRARERQRE  55
            REP++     QEP  + PQ+    Q+EP++    Q+EP++  E Q++ +   +  E+Q++
Sbjct  531  REPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQ---QQDEQQQD  587

Query  54   PKSQGEPGRAAENQPEPE  1
             + Q E  +  + Q E E
Sbjct  588  EQQQDEQQQDEQQQDEQE  605


 Score = 92.8 bits (229),  Expect = 2e-17
 Identities = 48/179 (26%), Positives = 92/179 (51%), Gaps = 2/179 (1%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    QREP +    Q+E  +    QR+P +    Q +P + +  Q+ P+     Q+
Sbjct  487  EPQQQEPQQREPQQREPQQREPQQREPQQREPQQREPQQQEPQQREPQQQEPQQQEPQQQ  546

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            EP+     Q+ P++ +  Q+EP++  E Q++ ++  E Q++   Q++ E Q+    Q E 
Sbjct  547  EPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQDEQQQD--EQQQDEQQQDEQQQDEQ  604

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQ  43
            E+     Q+ +  Q  +E Q E E+  E +++ E+ +E Q E E     +E++ E + Q
Sbjct  605  EQQDEQQQDEQQQQDEQEQQEEQEQQEEQEQQEEQEQEQQEEQEQELEEQEQELEEQEQ  663


 Score = 91.7 bits (226),  Expect = 4e-17
 Identities = 51/197 (25%), Positives = 99/197 (50%), Gaps = 8/197 (4%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQ----RKPGRTREGQSKPGRTKGSQRGPESAR  412
            EP++    Q+EP +    QQE  +  + Q    ++P +    Q +P + +  QR P+   
Sbjct  458  EPQQQEPQQQEPQQQEPQQQEPLQEPQQQEPQQQEPQQREPQQREPQQREPQQREPQQRE  517

Query  411  ETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGT  232
              QREP+     QR P++ +  Q+EP++    Q+EP++    Q+EP  Q+EP+ Q     
Sbjct  518  PQQREPQQQEPQQREPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEP-QQQEPQQQ---DE  573

Query  231  QREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREP  52
            Q++ E+     Q+ E  Q  ++   + +  +E Q E ++  + Q++ +  +  +E+Q E 
Sbjct  574  QQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQ  633

Query  51   KSQGEPGRAAENQPEPE  1
            + Q E  +  + + E E
Sbjct  634  EQQEEQEQEQQEEQEQE  650


 Score = 91.3 bits (225),  Expect = 5e-17
 Identities = 44/193 (22%), Positives = 99/193 (51%), Gaps = 1/193 (0%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    Q+EP +    QQE  +    QR+P +    Q +P + +  QR P+     Q+
Sbjct  468  EPQQQEPQQQEPLQ-EPQQQEPQQQEPQQREPQQREPQQREPQQREPQQREPQQREPQQQ  526

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            EP+     Q+ P++ +  Q+EP++    Q+EP++    Q+EP  Q E +    +  +++ 
Sbjct  527  EPQQREPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQDEQQQ  586

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
            ++  +  Q+ +  Q+  + Q++ ++  E Q++ E+ ++ ++E +  +  +E Q + + + 
Sbjct  587  DEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQEQQEEQEQEQQEE  646

Query  39   EPGRAAENQPEPE  1
            +     E + E E
Sbjct  647  QEQELEEQEQELE  659


 Score = 90.9 bits (224),  Expect = 6e-17
 Identities = 53/180 (29%), Positives = 98/180 (54%), Gaps = 10/180 (5%)
 Frame = -1

Query  525  QQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGTSESQRNPERAKES  346
            QQE  +    Q++P +    Q +P + +  Q+ P+  +E  +EP+     Q+ P++ +  
Sbjct  441  QQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQ-QEPLQEPQQQEPQQQEPQQREPQ  499

Query  345  QREPERARESQREPKRTRESQREPGSQREP---EPQRARGTQREPEKASRSPQEP--ENP  181
            QREP++    QREP++    QREP  Q+EP   EPQ+    Q+EP++     QEP  + P
Sbjct  500  QREPQQREPQQREPQQREPQQREP-QQQEPQQREPQQQEPQQQEPQQQEPQQQEPQQQEP  558

Query  180  QRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQGEPGRAAENQPEPE  1
            Q+    Q+EP++  E Q++ ++  E Q++ +   +  E+Q++ + Q E  +  E Q + +
Sbjct  559  QQQEPQQQEPQQQDEQQQDEQQQDEQQQDEQ---QQDEQQQDEQQQDEQEQQDEQQQDEQ  615


 Score = 88.2 bits (217),  Expect = 4e-16
 Identities = 46/193 (23%), Positives = 101/193 (52%), Gaps = 6/193 (3%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    Q+EP +    Q+E  +    QR+P +    Q +P + +  QR P+     Q+
Sbjct  482  EPQQQEPQQQEPQQREPQQREPQQREPQQREPQQREPQQREPQQQEPQQREPQQQEPQQQ  541

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            EP+     Q+ P++ +  Q+EP++    Q+EP++  E Q++   Q E +    +  +++ 
Sbjct  542  EPQ-----QQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQDEQQQDEQQQDEQQQ  596

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
            ++  +  QE ++ Q+  E Q++ E+ ++ ++E +  +E Q E E  ++  E+++E + Q 
Sbjct  597  DEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQEQQEEQE-QEQQEEQEQELEEQE  655

Query  39   EPGRAAENQPEPE  1
            +     E + E +
Sbjct  656  QELEEQEQELEEQ  668


 Score = 84.3 bits (207),  Expect = 6e-15
 Identities = 46/193 (23%), Positives = 94/193 (48%), Gaps = 5/193 (2%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    QREP +    Q+E  +    QR+P +    Q +P + +  Q+ P+     Q+
Sbjct  502  EPQQREPQQREPQQREPQQREPQQQEPQQREPQQQEPQQQEPQQQEPQQQEPQQQEPQQQ  561

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            EP+     Q+ P++  E Q++ ++  E Q++ ++  E Q++   Q E E Q  +    + 
Sbjct  562  EPQ-----QQEPQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQ  616

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
            ++  +  QE +  Q  +E Q E E+ ++ ++E E   + Q   E  +   E+++E + Q 
Sbjct  617  QQDEQEQQEEQEQQEEQEQQEEQEQEQQEEQEQELEEQEQELEEQEQELEEQEQELEEQE  676

Query  39   EPGRAAENQPEPE  1
            +     E + E +
Sbjct  677  QELEEQEQELEEQ  689


 Score = 80.5 bits (197),  Expect = 9e-14
 Identities = 53/199 (26%), Positives = 95/199 (47%), Gaps = 11/199 (5%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            + E   E   E +     +++     E   +     E   +    + ++   +   E ++
Sbjct  361  DEEDDEEDDEEDDEEDDEEEDEEEDEEEDEEEDEEEEEDEEDDDDEDNEDEEDDEEEDKK  420

Query  399  EPE--GTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQR  226
            E E  G   ++    ++ + Q+EP++    Q+EP++    Q+EP  Q   EPQ+    Q+
Sbjct  421  EDEEDGGDGNKTLSIQSSQQQQEPQQQEPQQQEPQQQEPQQQEPQQQ---EPQQQEPQQQ  477

Query  225  EP--EKASRSPQEPENPQRARESQREPERARESQREPERARESQREP--EGPKRARERQR  58
            EP  E   + PQ+ E PQ+    QREP++    QREP++    QREP  + P++   +Q+
Sbjct  478  EPLQEPQQQEPQQQE-PQQREPQQREPQQREPQQREPQQREPQQREPQQQEPQQREPQQQ  536

Query  57   EPKSQGEPGRAAENQPEPE  1
            EP+ Q EP +    Q EP+
Sbjct  537  EPQQQ-EPQQQEPQQQEPQ  554


 Score = 79.3 bits (194),  Expect = 2e-13
 Identities = 38/181 (20%), Positives = 90/181 (49%), Gaps = 0/181 (0%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    Q+EP +    QQE  +    Q++P +    Q +P + +  Q+ P+   E Q+
Sbjct  517  EPQQREPQQQEPQQREPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQ  576

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            + +   E Q++ ++  E Q++ ++  E +++ ++ ++ Q++   Q + E Q  +  Q + 
Sbjct  577  DEQQQDEQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQEQQ  636

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
            E+  +  QE +  +   + Q   E+ +E + + +   E ++E E  ++  E Q +   + 
Sbjct  637  EEQEQEQQEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQ  696

Query  39   E  37
            E
Sbjct  697  E  697


 Score = 78.6 bits (192),  Expect = 3e-13
 Identities = 41/179 (22%), Positives = 89/179 (49%), Gaps = 2/179 (1%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    QREP +    QQE  +    Q++P +    Q +P + +  Q+  +   E Q+
Sbjct  522  EPQQQEPQQREPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQ  581

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            + +   E Q++ ++  E Q++ +  ++ Q++ ++ ++ ++E   Q E E Q  +  Q E 
Sbjct  582  DEQQQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQE--QQEEQEQQEEQEQQEEQ  639

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQ  43
            E+  +  QE E  ++ +E + + +   E ++E E   +   E E     +E++ E + Q
Sbjct  640  EQEQQEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ  698


 Score = 73.2 bits (178),  Expect = 1e-11
 Identities = 40/193 (20%), Positives = 89/193 (46%), Gaps = 0/193 (0%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    Q+EP +    QQE  +    Q++P +    Q    +    Q+  +   E Q+
Sbjct  532  EPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQDEQQQDEQQQ  591

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            + +   E Q++ +  ++ Q++ E+ ++ ++E +  +E Q E   Q E E ++    ++E 
Sbjct  592  DEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQEQQEEQEQEQQEEQEQEL  651

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
            E+  +  +E E     +E + E +     ++E E   + Q   E  +   E+++E + Q 
Sbjct  652  EEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQE  711

Query  39   EPGRAAENQPEPE  1
            +     E + E +
Sbjct  712  QELEEQEQELEEQ  724


 Score = 70.9 bits (172),  Expect = 7e-11
 Identities = 41/190 (21%), Positives = 88/190 (46%), Gaps = 11/190 (5%)
 Frame = -2

Query  677  QRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPER  498
            Q++   EP++    Q+EP++    +R P+     QREP +    Q EP+      REP++
Sbjct  476  QQEPLQEPQQQEPQQQEPQQREPQQREPQQREPQQREPQQREPQQREPQQQEPQQREPQQ  535

Query  497  ARESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREPER  318
                Q EP++ +  Q EP+     Q           +  + +E Q+  ++ ++ Q++ E+
Sbjct  536  QEPQQQEPQQQEPQQQEPQQQEPQQ-----------QEPQQQEPQQQDEQQQDEQQQDEQ  584

Query  317  ARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPE  138
             +  Q+  E+ ++ Q   E +   E +     Q+     ++  +  +E E+  E ++E +
Sbjct  585  QQDEQQQDEQQQDEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQEQQEEQEQEQQ  644

Query  137  RARESQREPE  108
              +E + E +
Sbjct  645  EEQEQELEEQ  654


 Score = 68.2 bits (165),  Expect = 4e-10
 Identities = 38/193 (19%), Positives = 91/193 (47%), Gaps = 1/193 (0%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    Q+EP +    QQE  + ++ Q++  + ++ Q +  + +  Q+  E  ++ Q 
Sbjct  547  EPQQQEPQQQEPQQQEPQQQE-PQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQE  605

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            + +   + ++  +  +E Q E E+  E +++ ++ +E Q E   + E + Q     ++E 
Sbjct  606  QQDEQQQDEQQQQDEQEQQEEQEQQEEQEQQEEQEQEQQEEQEQELEEQEQELEEQEQEL  665

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
            E+  +  +E E     +E + E +     ++E E   + Q   E  +   E+++E + Q 
Sbjct  666  EEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQE  725

Query  39   EPGRAAENQPEPE  1
            +     E + E +
Sbjct  726  QELEEQEQELEEQ  738


 Score = 67.4 bits (163),  Expect = 8e-10
 Identities = 56/216 (25%), Positives = 114/216 (52%), Gaps = 7/216 (3%)
 Frame = -3

Query  697  SFSTASHKEMQPRSQKEPERARESQRDpettkegpkepERARESQGEPERAKQNQRP---  527
            + S  S ++ Q   Q+EP++    Q++P+  +   +EP++    Q EP +  Q Q P   
Sbjct  432  TLSIQSSQQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPLQEPQQQEPQQQ  491

Query  526  -PARAGESQREPEKARENQRGPKQArenqrepertrerqrdpeRAGGNQREPEKPREGQR  350
             P +    QREP++    QR P+Q    QREP++   +QR+P++    Q+EP++    Q+
Sbjct  492  EPQQREPQQREPQQREPQQREPQQREPQQREPQQQEPQQREPQQQEPQQQEPQQQEPQQQ  551

Query  349  EPERARESQREP---EGAKEDQrepertreperaratESQRDPEGARESQPEPARARKPP  179
            EP++    Q+EP   E  ++D+++ +  ++ E+ +  + Q + +   + Q E  +  +  
Sbjct  552  EPQQQEPQQQEPQQQEPQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQEQQDEQQ  611

Query  178  KSQREPERARESQREPERARESQREPERAGRAQESQ  71
            + +++ +  +E Q E E+  E +++ E+    QE Q
Sbjct  612  QDEQQQQDEQEQQEEQEQQEEQEQQEEQEQEQQEEQ  647


 Score = 66.2 bits (160),  Expect = 2e-09
 Identities = 47/193 (24%), Positives = 83/193 (43%), Gaps = 24/193 (12%)
 Frame = -2

Query  677  QRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPER  498
            + D   E     E   E ++  D + G +G +    +   + + Q EP+      +EP++
Sbjct  400  EEDDDDEDNEDEEDDEEEDKKEDEEDGGDGNKTLSIQ---SSQQQQEPQQQEPQQQEPQQ  456

Query  497  ARESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREPER  318
                Q EP++ +  Q EP+     Q                   Q+ P++    QREP++
Sbjct  457  QEPQQQEPQQQEPQQQEPQQQEPLQ----------------EPQQQEPQQQEPQQREPQQ  500

Query  317  ARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTP--KEPERARESQRE  144
                QR P++    Q  RE Q  REP+     QR+P       + P  +EP++    Q+E
Sbjct  501  REPQQREPQQREPQQ--REPQ-QREPQQQEPQQREPQQQEPQQQEPQQQEPQQQEPQQQE  557

Query  143  PERARESQREPER  105
            P++    Q+EP++
Sbjct  558  PQQQEPQQQEPQQ  570


 Score = 66.2 bits (160),  Expect = 2e-09
 Identities = 40/193 (20%), Positives = 87/193 (45%), Gaps = 3/193 (1%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    Q+EP +    QQE  +    Q+   +  E Q    +    Q+  +   E Q+
Sbjct  542  EPQQQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQ  601

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            + +   + Q+  E+ ++ ++E +  +E Q E ++  E ++E   Q+E + Q     ++E 
Sbjct  602  DEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQEQQEEQEQE---QQEEQEQELEEQEQEL  658

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
            E+  +  +E E     +E + E +     ++E E   + Q   E  +   E+++E + Q 
Sbjct  659  EEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQE  718

Query  39   EPGRAAENQPEPE  1
            +     E + E +
Sbjct  719  QELEEQEQELEEQ  731


 Score = 65.5 bits (158),  Expect = 3e-09
 Identities = 40/194 (20%), Positives = 86/194 (44%), Gaps = 1/194 (0%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EP++    Q+EP +    QQ+  +  E Q+   +  E Q    +    Q+  +  ++ Q+
Sbjct  552  EPQQQEPQQQEPQQQEPQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQEQQDEQQ  611

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQR-EPEPQRARGTQRE  223
            + E   + ++  +  +E Q E E+  E ++E +  +E + E   Q  E + Q     ++E
Sbjct  612  QDEQQQQDEQEQQEEQEQQEEQEQQEEQEQEQQEEQEQELEEQEQELEEQEQELEEQEQE  671

Query  222  PEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQ  43
             E+  +  +E E     +E + E +     ++E E   + Q   E  +   E+++E + Q
Sbjct  672  LEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQ  731

Query  42   GEPGRAAENQPEPE  1
             +     E + E +
Sbjct  732  EQELEEQEQELEEQ  745


 Score = 63.2 bits (152),  Expect = 1e-08
 Identities = 40/193 (20%), Positives = 79/193 (40%), Gaps = 4/193 (2%)
 Frame = -1

Query  573  ERARESQ--REPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            E ++ESQ  ++ N  +  ++E     E +       E   +    +  +   E   E   
Sbjct  314  EISKESQVDKDDNDNKDDEEEQETDEEDEEDDEEDDEEDDEEDDEEDDEEDDEEDDEEDD  373

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            E +   E +   E  +E + E E   E + +         E   + + +     G     
Sbjct  374  EEDDEEEDEEEDE--EEDEEEDEEEEEDEEDDDDEDNEDEEDDEEEDKKEDEEDGGDGNK  431

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
              + +S Q+ + PQ+    Q+EP++    Q+EP++    Q+EP+  +  +E Q++   Q 
Sbjct  432  TLSIQSSQQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPLQEPQQQEPQQQ  491

Query  39   EPGRAAENQPEPE  1
            EP +    Q EP+
Sbjct  492  EPQQREPQQREPQ  504


 Score = 56.6 bits (135),  Expect = 1e-06
 Identities = 45/205 (21%), Positives = 98/205 (47%), Gaps = 19/205 (9%)
 Frame = -3

Query  655  QKEPERARESQRDpettkegpkepERARESQGEPERAKQNQRPPARAGESQREPEKAREN  476
            +++ E   + + D +   E  ++ E   + + E +    N+    ++ + Q+EP++    
Sbjct  391  EEDEEEEEDEEDDDDEDNEDEEDDEEEDKKEDEEDGGDGNKTLSIQSSQQQQEPQQQEPQ  450

Query  475  QRGPKQArenqrepertrerqrdpeR----AGGNQREPEKPREGQREPERARESQREPEG  308
            Q+ P+Q    Q+EP++   +Q++P++        Q+EP++    QREP++    QREP+ 
Sbjct  451  QQEPQQQEPQQQEPQQQEPQQQEPQQQEPLQEPQQQEPQQQEPQQREPQQREPQQREPQQ  510

Query  307  AKEDQrepertreperaratESQRDPEGARESQPEPAR--ARKPPKSQREPERARESQRE  134
             +  Q                 QR+P+     Q EP +   ++    Q+EP++    Q+E
Sbjct  511  REPQQ-------------REPQQREPQQQEPQQREPQQQEPQQQEPQQQEPQQQEPQQQE  557

Query  133  PERARESQREPERAGRAQESQGEAE  59
            P++    Q+EP++    Q+ + + +
Sbjct  558  PQQQEPQQQEPQQQDEQQQDEQQQD  582
>gi|42733645|gb|AAS38609.1|  hypothetical protein [Dictyostelium discoideum]
Length=895

 Score =  101 bits (251),  Expect = 5e-20
 Identities = 58/193 (30%), Positives = 106/193 (54%), Gaps = 4/193 (2%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            E E+ +E ++E  + +  ++E  + +E +++  R +E + +  + K  QR  E  +E ++
Sbjct  421  EKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEREKEKEKQKEKEKEIQREREKEKEKEK  480

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            E E   E +R  ER +E ++E E   E ++E ++ +E ++E   + E E +  R  +RE 
Sbjct  481  EREKEKEKEREREREREKEKEKEIEIEKEKEKEKEKEKEKEREIEIEIEREIKREIEREK  540

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
            EK      E E  ++ +E ++E E+ +E +RE ER RE +RE E   R RER+RE + + 
Sbjct  541  EKEREKEIEIEK-EKEKEKEKEKEKEKERERERERERERERERE---REREREREKEKER  596

Query  39   EPGRAAENQPEPE  1
            E  +  E + E E
Sbjct  597  EREKEKEKERERE  609


 Score =  101 bits (251),  Expect = 5e-20
 Identities = 60/180 (33%), Positives = 100/180 (55%), Gaps = 4/180 (2%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            E E+ +E ++E  + R  ++E  + +E + +  R +E + +  R K  ++  E  RE ++
Sbjct  439  EKEKEKEKEKEKEKEREKEKEKQKEKEKEIQREREKEKEKEKEREKEKEKEREREREREK  498

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            E E   E ++  E+ KE ++E ER  E + E +  RE +RE   +RE E +  +  ++E 
Sbjct  499  EKEKEIEIEKEKEKEKEKEKEKEREIEIEIEREIKREIEREKEKEREKEIEIEKEKEKEK  558

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPK-RARERQREPKSQ  43
            EK     +E E   R RE +RE ER RE +RE ER +E +RE E  K + RER++E K +
Sbjct  559  EKEKEKEKERE---REREREREREREREREREREREKEKEREREKEKEKEREREKEKKRE  615


 Score = 99.8 bits (247),  Expect = 1e-19
 Identities = 60/198 (30%), Positives = 109/198 (55%), Gaps = 14/198 (7%)
 Frame = -1

Query  573  ERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREP  394
            ++A+E ++E  + +  ++E  + +E +++  + +E +    R K  ++  E  +E QRE 
Sbjct  417  KQAKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKE----REKEKEKQKEKEKEIQRER  472

Query  393  EGTSESQRNPERAKESQREPERARESQR------EPKRTRESQREPGSQREPEPQRARGT  232
            E   E ++  E+ KE +RE ER RE ++      E ++ +E ++E   +RE E +  R  
Sbjct  473  EKEKEKEKEREKEKEKEREREREREKEKEKEIEIEKEKEKEKEKEKEKEREIEIEIEREI  532

Query  231  QREPEKASRSPQEPE-NPQRARESQREPERARESQREPERARESQREPEGPKRARERQRE  55
            +RE E+     +E E   ++ +E ++E E+ +E +RE ER RE +RE E   R RER+RE
Sbjct  533  KREIEREKEKEREKEIEIEKEKEKEKEKEKEKEKERERERERERERERE---RERERERE  589

Query  54   PKSQGEPGRAAENQPEPE  1
             + + E  R  E + E E
Sbjct  590  REKEKEREREKEKEKERE  607


 Score = 97.1 bits (240),  Expect = 9e-19
 Identities = 56/183 (30%), Positives = 101/183 (55%), Gaps = 2/183 (1%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            E E+ +E ++E  + +  ++E  + +E Q++  +  + + +  + K  +R  E  +E +R
Sbjct  433  EKEKEKEKEKEKEKEKEKEKEREKEKEKQKEKEKEIQREREKEKEKEKEREKEKEKERER  492

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            E E   E ++  E  KE ++E E+ +E +RE +   E + +   +RE E +R +  + E 
Sbjct  493  EREREKEKEKEIEIEKEKEKEKEKEKEKEREIEIEIEREIKREIEREKEKEREKEIEIEK  552

Query  219  EKASRSPQEPE-NPQRARESQREPERARESQREPERARESQREPEGPK-RARERQREPKS  46
            EK     +E E   +R RE +RE ER RE +RE ER RE ++E E  K + +ER+RE + 
Sbjct  553  EKEKEKEKEKEKEKEREREREREREREREREREREREREKEKEREREKEKEKEREREKEK  612

Query  45   QGE  37
            + E
Sbjct  613  KRE  615


 Score = 95.1 bits (235),  Expect = 3e-18
 Identities = 54/195 (27%), Positives = 106/195 (54%), Gaps = 4/195 (2%)
 Frame = -1

Query  573  ERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREP  394
            ++ R+ +   +     +Q+ A+ +E +++  + +E + +  + K  ++  E  +E ++E 
Sbjct  399  KKLRKFKDNDDENELEKQKQAKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEREKEK  458

Query  393  EGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEK  214
            E   E ++  +R +E ++E E+ RE ++E +R RE +RE   ++E E ++ +  ++E EK
Sbjct  459  EKQKEKEKEIQREREKEKEKEKEREKEKEKEREREREREKEKEKEIEIEKEKEKEKEKEK  518

Query  213  ASRSPQEPE-NPQRARESQREPERARESQREPERARESQREPEGPK---RARERQREPKS  46
                  E E   +  RE +RE E+ RE + E E+ +E ++E E  K   R RER+RE + 
Sbjct  519  EKEREIEIEIEREIKREIEREKEKEREKEIEIEKEKEKEKEKEKEKEKERERERERERER  578

Query  45   QGEPGRAAENQPEPE  1
            + E  R  E + E E
Sbjct  579  EREREREREREREKE  593


 Score = 93.6 bits (231),  Expect = 1e-17
 Identities = 53/192 (27%), Positives = 105/192 (54%), Gaps = 7/192 (3%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            E E+ +E ++E  + +  ++E+ R RE +++  + RE + +  R +  +R  E  +E + 
Sbjct  447  EKEKEKEREKEKEKQKEKEKEIQREREKEKEKEKEREKEKEKEREREREREKEKEKEIEI  506

Query  399  EPEGTSESQRNPERAKESQ----REPERARESQREPKRTRESQREPGSQREPEPQRARGT  232
            E E   E ++  E+ +E +    RE +R  E ++E +R +E + E   ++E E ++ +  
Sbjct  507  EKEKEKEKEKEKEKEREIEIEIEREIKREIEREKEKEREKEIEIEKEKEKEKEKEKEKEK  566

Query  231  QREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREP  52
            +RE E+     +E E   R RE +RE E+ +E +RE E+ +E +RE E  +  +++++E 
Sbjct  567  ERERERERERERERE---REREREREREKEKEREREKEKEKEREREKEKKRELQKKKQED  623

Query  51   KSQGEPGRAAEN  16
            K   E    AE+
Sbjct  624  KRLEEKKTFAED  635


 Score = 85.9 bits (211),  Expect = 2e-15
 Identities = 51/182 (28%), Positives = 95/182 (52%), Gaps = 8/182 (4%)
 Frame = -1

Query  522  QELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGTSESQRNPERAKESQ  343
            Q+  + R+ +         + K  + K  ++  E  +E ++E E   E ++  E+ KE +
Sbjct  396  QKFKKLRKFKDNDDENELEKQKQAKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKERE  455

Query  342  REPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEKASRSPQEPE-NPQRARE  166
            +E E+ +E ++E +R RE ++E   +RE E ++ R  +RE EK      E E   ++ +E
Sbjct  456  KEKEKQKEKEKEIQREREKEKEKEKEREKEKEKEREREREREKEKEKEIEIEKEKEKEKE  515

Query  165  SQREPER------ARESQREPERARESQREPE-GPKRARERQREPKSQGEPGRAAENQPE  7
             ++E ER       RE +RE ER +E +RE E   ++ +E+++E + + E  R  E + E
Sbjct  516  KEKEKEREIEIEIEREIKREIEREKEKEREKEIEIEKEKEKEKEKEKEKEKERERERERE  575

Query  6    PE  1
             E
Sbjct  576  RE  577


 Score = 80.9 bits (198),  Expect = 7e-14
 Identities = 50/189 (26%), Positives = 95/189 (50%), Gaps = 4/189 (2%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            E E+ RE +RE  + +  + E+ + +E +++  + +E + +    +  +R  E  +E +R
Sbjct  485  EKEKEREREREREKEKEKEIEIEKEKEKEKEKEKEKEREIEIEIEREIKREIEREKEKER  544

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            E E   E ++  E+ KE ++E ER RE +RE +R RE +RE   +RE E +R    +RE 
Sbjct  545  EKEIEIEKEKEKEKEKEKEKEKEREREREREREREREREREREREREKEKER----EREK  600

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
            EK     +E E  +  ++ ++E +R  E +   E     + E     ++R  + E + + 
Sbjct  601  EKEKEREREKEKKRELQKKKQEDKRLEEKKTFAEDFERKRLEKVAEIKSRNDKIEEEFRK  660

Query  39   EPGRAAENQ  13
               R  E +
Sbjct  661  NQQRELEKK  669


 Score = 73.9 bits (180),  Expect = 8e-12
 Identities = 53/191 (27%), Positives = 91/191 (47%), Gaps = 23/191 (12%)
 Frame = -2

Query  677  QRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPER  498
            +++   E E+  E Q+E E+    +R  E  +E +RE  + +E + E E      RE E+
Sbjct  447  EKEKEKEREKEKEKQKEKEKEIQREREKEKEKEKEREKEKEKERERERE------REKEK  500

Query  497  ARESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREPER  318
             +E + E E+ K  + E +  RE +                 E +R  KR  E ++E ER
Sbjct  501  EKEIEIEKEKEKEKEKEKEKEREIE----------------IEIEREIKREIEREKEKER  544

Query  317  ARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGAR-KSPKTPKEPERARESQREP  141
             +  +   E+ +E +  +E +  RE E  R  +R+    R +  +  KE ER RE ++E 
Sbjct  545  EKEIEIEKEKEKEKEKEKEKEKEREREREREREREREREREREREREKEKEREREKEKEK  604

Query  140  ERARESQREPE  108
            ER RE +++ E
Sbjct  605  EREREKEKKRE  615


 Score = 72.4 bits (176),  Expect = 2e-11
 Identities = 48/173 (27%), Positives = 88/173 (50%), Gaps = 7/173 (4%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARA--RESQRKPGRTREGQSKPGRTKGSQRGPESARET  406
            E E+ +E ++E  + R  + E+ R   RE +R+  + RE + +  + K  ++  E  +E 
Sbjct  507  EKEKEKEKEKEKEKEREIEIEIEREIKREIEREKEKEREKEIEIEKEKEKEKEKEKEKEK  566

Query  405  QREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQR  226
            +RE E   E +R  ER +E +RE E+ +E +RE ++ +E +RE   +RE + ++    + 
Sbjct  567  EREREREREREREREREREREREREKEKEREREKEKEKEREREKEKKRELQKKKQEDKRL  626

Query  225  EPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARE  67
            E +K        E+ +R R  +    ++R  + E E  +  QRE E  K   E
Sbjct  627  EEKKTF-----AEDFERKRLEKVAEIKSRNDKIEEEFRKNQQRELEKKKLENE  674


 Score = 64.3 bits (155),  Expect = 6e-09
 Identities = 40/164 (24%), Positives = 79/164 (48%), Gaps = 0/164 (0%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            E ER  E + E    R  ++E  + RE + +  + +E + +  + K  +R  E  RE +R
Sbjct  519  EKEREIEIEIEREIKREIEREKEKEREKEIEIEKEKEKEKEKEKEKEKERERERERERER  578

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            E E   E +R  E+ KE +RE E+ +E +RE ++ RE Q++    +  E ++      E 
Sbjct  579  EREREREREREREKEKEREREKEKEKEREREKEKKRELQKKKQEDKRLEEKKTFAEDFER  638

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPE  88
            ++  +  +      +  E  R+ ++    +++ E    S ++PE
Sbjct  639  KRLEKVAEIKSRNDKIEEEFRKNQQRELEKKKLENETTSIKKPE  682


 Score = 62.4 bits (150),  Expect = 2e-08
 Identities = 38/157 (24%), Positives = 75/157 (47%), Gaps = 0/157 (0%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            E E  RE +RE  + R  + E+ + +E +++  + +E + +  R +  +R  E  RE +R
Sbjct  529  EREIKREIEREKEKEREKEIEIEKEKEKEKEKEKEKEKERERERERERERERERERERER  588

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            E E   E +R  E+ KE +RE E+ RE Q++ +  +  + +     + E +R        
Sbjct  589  EREKEKEREREKEKEKEREREKEKKRELQKKKQEDKRLEEKKTFAEDFERKRLEKVAEIK  648

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERAR  109
             +  +  +E    Q+    +++ E    S ++PE  R
Sbjct  649  SRNDKIEEEFRKNQQRELEKKKLENETTSIKKPELHR  685


 Score = 45.4 bits (106),  Expect = 0.003
 Identities = 18/59 (30%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -1

Query  435  QRGPESARETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQRE  259
            ++  +  +E ++E E   E ++  E+ KE ++E E+ +E +RE +R RE +RE   ++E
Sbjct  196  EKPKQKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEREKEREREREREKEKEKE  254


 Score = 45.1 bits (105),  Expect = 0.004
 Identities = 18/56 (32%), Positives = 35/56 (62%), Gaps = 0/56 (0%)
 Frame = -1

Query  405  QREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRAR  238
            Q+E E   E ++  E+ KE ++E E+ +E ++E ++ RE +RE   +RE E ++ +
Sbjct  200  QKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEREKEREREREREKEKEKEK  255


 Score = 44.3 bits (103),  Expect = 0.007
 Identities = 28/91 (30%), Positives = 46/91 (50%), Gaps = 1/91 (1%)
 Frame = -2

Query  698  KLLDCVTQRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSK  519
            K ++   +++   E E+  E +RE ER  + +R  E  RE +RE  + +E + E E   +
Sbjct  546  KEIEIEKEKEKEKEKEKEKEKEREREREREREREREREREREREREKEKEREREKEKEKE  605

Query  518  SWREPERARESQGEPERAKASQGEPKGARED  426
              RE E+ RE Q + +  K  + E K   ED
Sbjct  606  REREKEKKRELQKKKQEDKRLE-EKKTFAED  635


 Score = 43.1 bits (100),  Expect = 0.015
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 1/60 (1%)
 Frame = -1

Query  282  REPGSQREPEPQRARGTQREPEKASRSPQEPENP-QRARESQREPERARESQREPERARE  106
            RE   Q+E E ++ +  ++E EK     +E E   ++ +E +RE ER RE +RE E+ +E
Sbjct  195  REKPKQKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEREKEREREREREKEKEKE  254


 Score = 43.1 bits (100),  Expect = 0.015
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 3/62 (4%)
 Frame = -1

Query  264  REPEPQRARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEG  85
            RE   Q+ +  ++E EK     +E E   + +E ++E E+ +E +RE ER RE +RE E 
Sbjct  195  REKPKQKEKEKEKEKEKEKEKEKEKE---KEKEKEKEKEKEKEKEREKEREREREREKEK  251

Query  84   PK  79
             K
Sbjct  252  EK  253


 Score = 42.7 bits (99),  Expect = 0.020
 Identities = 22/64 (34%), Positives = 38/64 (59%), Gaps = 4/64 (6%)
 Frame = -1

Query  228  REPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPK  49
            RE  K     +E E  ++ +E ++E E+ +E ++E E+ +E +RE E   R RER+RE +
Sbjct  195  REKPKQKEKEKEKEK-EKEKEKEKEKEKEKEKEKEKEKEKEKEREKE---REREREREKE  250

Query  48   SQGE  37
             + E
Sbjct  251  KEKE  254


 Score = 42.4 bits (98),  Expect = 0.026
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -1

Query  450  RTKGSQRGPESARETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRE  289
            + K  ++  E  +E ++E E   E ++  E+ KE +RE ER RE +RE ++ +E
Sbjct  201  KEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEREKEREREREREKEKEKE  254


 Score = 41.6 bits (96),  Expect = 0.044
 Identities = 21/67 (31%), Positives = 40/67 (59%), Gaps = 6/67 (8%)
 Frame = -1

Query  414  RETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARG  235
            RE  ++ E   E ++  E+ KE ++E E+ +E ++E ++ +E +RE    +E E +R R 
Sbjct  195  REKPKQKE--KEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKERE----KERERERERE  248

Query  234  TQREPEK  214
             ++E EK
Sbjct  249  KEKEKEK  255


 Score = 39.7 bits (91),  Expect = 0.17
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = -3

Query  679  HKEMQPRSQKEPERARESQRDpettkegpkepERARESQGEPERAKQNQRPPARAGESQR  500
            H+E   + +KE E+ +E +++ E  KE  KE E+ +E + E ER K+ +R   R  E ++
Sbjct  194  HREKPKQKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEREKEREREREREKEKEK  253

Query  499  EPEKARENQRGPK  461
            E  K + +Q   K
Sbjct  254  EKIKHKTHQDNHK  266


 Score = 38.9 bits (89),  Expect = 0.29
 Identities = 25/102 (24%), Positives = 45/102 (44%), Gaps = 27/102 (26%)
 Frame = -3

Query  373  EKPREGQREPERARESQREPEGAKEDQrepertreperaratESQRDPEGARESQPEPAR  194
            EKP++ ++E E+ +E ++E E  KE                 E +++ E  +E + E   
Sbjct  196  EKPKQKEKEKEKEKEKEKEKEKEKEK----------------EKEKEKEKEKEKEKE---  236

Query  193  ARKPPKSQREPERARESQREPERARESQREPERAGRAQESQG  68
                    RE ER RE +RE E+ +E  +        +++ G
Sbjct  237  --------REKEREREREREKEKEKEKIKHKTHQDNHKDNDG  270


 Score = 37.0 bits (84),  Expect = 1.1
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 0/79 (0%)
 Frame = -2

Query  677  QRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPER  498
            +++   E ER  E +RE ER  + +R  E  +E +RE  + +E + E E   K   + ++
Sbjct  561  EKEKEKEREREREREREREREREREREREREKEKEREREKEKEKEREREKEKKRELQKKK  620

Query  497  ARESQGEPERAKASQGEPK  441
              + + E ++  A   E K
Sbjct  621  QEDKRLEEKKTFAEDFERK  639
>gi|39597156|emb|CAE59383.1|  Hypothetical protein CBG02739 [Caenorhabditis briggsae]
Length=197

 Score = 94.0 bits (232),  Expect = 8e-18
 Identities = 60/154 (38%), Positives = 83/154 (53%), Gaps = 4/154 (2%)
 Frame = -1

Query  453  GRTKGSQRGPESARETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREP  274
            G+ +  +R  E  RE +RE E   E +R  ER +E +RE ER RE +RE +R RE +RE 
Sbjct  11   GKFRARERERERERERERERERERERERERERERERERERERERERERERERERERERER  70

Query  273  GSQREPEPQRAR---GTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARES  103
              +RE E +R R      RE E+     +E EN         E ER RE +RE ER RE 
Sbjct  71   ERERERETERERERXXXXREREREREREKERENAAGETHRDTETERERERERERERERER  130

Query  102  QREPEGPKRARERQREPKSQGEPGRAAENQPEPE  1
            +RE E  +R RER+RE ++ G   + + N+   E
Sbjct  131  ERERE-RERERERERERENGGRKYKDSINEVSVE  163


 Score = 88.2 bits (217),  Expect = 4e-16
 Identities = 57/148 (38%), Positives = 78/148 (52%), Gaps = 9/148 (6%)
 Frame = -1

Query  510  RARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGTSESQRNPERAKESQREPE  331
            RARE +R+  R RE      R +  +R  E  RE +RE E   E +R  ER +E +RE E
Sbjct  14   RARERERERERERE------RERERERERERERERERERERERERERERERERERERERE  67

Query  330  RARESQREPKRTRESQREPGSQREPEPQRARGTQREPEKASRSPQEPENPQRARESQREP  151
            R RE +RE +  RE +R    +   E +R R  ++E E A+         +R RE +RE 
Sbjct  68   RERERERERETERERERXXXXR---EREREREREKERENAAGETHRDTETERERERERER  124

Query  150  ERARESQREPERARESQREPEGPKRARE  67
            ER RE +RE ER RE +RE E     R+
Sbjct  125  ERERERERERERERERERERERENGGRK  152


 Score = 86.3 bits (212),  Expect = 2e-15
 Identities = 64/167 (38%), Positives = 83/167 (49%), Gaps = 31/167 (18%)
 Frame = -1

Query  570  RARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPE  391
            RARE +RE  R R  ++E  R RE +R+  R RE           +R  E  RE +RE E
Sbjct  14   RARERERERERERERERERERERERERERERERE----------RERERERERERERERE  63

Query  390  GTSESQRNPERAKESQREPER---ARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
               E +R  ER +E++RE ER    RE +RE +R +E +   G     E  R   T+RE 
Sbjct  64   RERERERERERERETERERERXXXXREREREREREKERENAAG-----ETHRDTETERER  118

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPK  79
            E             R RE +RE ER RE +RE ER RE +RE  G K
Sbjct  119  E-------------RERERERERERERERERERERERERERENGGRK  152


 Score = 79.3 bits (194),  Expect = 2e-13
 Identities = 53/144 (36%), Positives = 74/144 (51%), Gaps = 6/144 (4%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            E ER RE +RE  R R  ++E  R RE +R+  R RE + +  R +  +R  E  RET+R
Sbjct  21   ERERERERERERERERERERERERERERERERERERERERERERERERERERERERETER  80

Query  399  EPE---GTSESQRNPERAKESQR---EPERARESQREPKRTRESQREPGSQREPEPQRAR  238
            E E      E +R  ER KE +    E  R  E++RE +R RE +RE   +RE E +R R
Sbjct  81   ERERXXXXREREREREREKERENAAGETHRDTETERERERERERERERERERERERERER  140

Query  237  GTQREPEKASRSPQEPENPQRARE  166
              +RE E   R  ++  N     E
Sbjct  141  ERERERENGGRKYKDSINEVSVEE  164


 Score = 71.2 bits (173),  Expect = 5e-11
 Identities = 51/144 (35%), Positives = 71/144 (49%), Gaps = 0/144 (0%)
 Frame = -2

Query  674  RDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERA  495
            R+   E ER  E +RE ER  + +R  E  RE +RE  R RE + E E   +  RE ER 
Sbjct  16   RERERERERERERERERERERERERERERERERERERERERERERERERERERERERERE  75

Query  494  RESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREPERA  315
            RE++ E ER    +   +    ++       E+ R+    RE +R  +R RE +RE ER 
Sbjct  76   RETERERERXXXXREREREREREKERENAAGETHRDTETERERERERERERERERERERE  135

Query  314  RGSQRGPERARENQGARESQSHRE  243
            R  +R  ER REN G +   S  E
Sbjct  136  RERERERERERENGGRKYKDSINE  159


 Score = 70.5 bits (171),  Expect = 9e-11
 Identities = 46/135 (34%), Positives = 70/135 (51%), Gaps = 8/135 (5%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQ-RGPESARETQ  403
            E ER RE +RE  R R  ++E  R RE +R+  R RE +++  R +    R  E  RE +
Sbjct  39   ERERERERERERERERERERERERERERERERERERERETERERERXXXXRERERERERE  98

Query  402  REPEGTS-------ESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQR  244
            +E E  +       E++R  ER +E +RE ER RE +RE +R RE +RE G ++  +   
Sbjct  99   KERENAAGETHRDTETERERERERERERERERERERERERERERERERENGGRKYKDSIN  158

Query  243  ARGTQREPEKASRSP  199
                +   E+  R P
Sbjct  159  EVSVEELAERLWRRP  173


 Score = 68.9 bits (167),  Expect = 3e-10
 Identities = 47/141 (33%), Positives = 69/141 (48%), Gaps = 0/141 (0%)
 Frame = -2

Query  665  ATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARES  486
            A E ER  E +RE ER  + +R  E  RE +RE  R RE + E E   +  RE ER RE 
Sbjct  15   ARERERERERERERERERERERERERERERERERERERERERERERERERERERERERER  74

Query  485  QGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREPERARGS  306
            + E ER +      +    ++   +    +  E  R  ET+R  +R RE +RE ER R  
Sbjct  75   ERETERERERXXXXREREREREREKERENAAGETHRDTETERERERERERERERERERER  134

Query  305  QRGPERARENQGARESQSHRE  243
            +R  ER RE +     + +++
Sbjct  135  ERERERERERERENGGRKYKD  155


 Score = 68.2 bits (165),  Expect = 4e-10
 Identities = 49/139 (35%), Positives = 67/139 (48%), Gaps = 2/139 (1%)
 Frame = -2

Query  650  RAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQGEPE  471
            RA E +RE ER  + +R  E  RE +RE  R RE + E E   +  RE ER RE + E E
Sbjct  14   RARERERERERERERERERERERERERERERERERERERERERERERERERERERERERE  73

Query  470  RAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREPERARGSQRGPE  291
            R + ++ E +     +         +     A ET R  +  RE +RE ER R  +R  E
Sbjct  74   RERETERERERXXXXREREREREREKERENAAGETHRDTETERERERERERERERER--E  131

Query  290  RARENQGARESQSHREPEG  234
            R RE +  RE +  RE  G
Sbjct  132  RERERERERERERERENGG  150


 Score = 39.3 bits (90),  Expect = 0.22
 Identities = 32/90 (35%), Positives = 42/90 (46%), Gaps = 8/90 (8%)
 Frame = -2

Query  680  TQRDAATEPERAGESQREPERPGDNKRGPEGTRESQRE---PGRA-RESQTE---PEATS  522
            T RD  TE ER  E +RE ER  + +R  E  RE +RE    GR  ++S  E    E   
Sbjct  108  THRDTETERERERERERERERERERERERERERERERERENGGRKYKDSINEVSVEELAE  167

Query  521  KSWREPERARESQGEPERAKASQGEPKGAR  432
            + WR P     + G  E  + +  E KG R
Sbjct  168  RLWRRPSYKLMASGRRENVE-TVWETKGRR  196


>gi|16329644|ref|NP_440372.1| Gene info hypothetical protein slr1753 [Synechocystis sp. PCC 6803]
 gi|1652128|dbj|BAA17052.1| Gene info slr1753 [Synechocystis sp. PCC 6803]
Length=1749

 Score = 94.0 bits (232),  Expect = 8e-18
 Identities = 64/193 (33%), Positives = 89/193 (46%), Gaps = 2/193 (1%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             EPE   E + EP      + E     E + +P    E + +P      +  PE   E + 
Sbjct  1018  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1077

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
             EPE   E +  PE   E + EPE   E + EP+   E + EP  + EPEP+     + EP
Sbjct  1078  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1137

Query  219   EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
             E       EPE P+   E + EPE   E + EPE   E + EPE P+   E + EP+ + 
Sbjct  1138  EPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE-PEPEPEPEPEPEPEP  1195

Query  39    EPGRAAENQPEPE  1
             EP    E +PEPE
Sbjct  1196  EPEPEPEPEPEPE  1208


 Score = 94.0 bits (232),  Expect = 8e-18
 Identities = 64/193 (33%), Positives = 89/193 (46%), Gaps = 2/193 (1%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             EPE   E + EP      + E     E + +P    E + +P      +  PE   E + 
Sbjct  1020  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1079

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
             EPE   E +  PE   E + EPE   E + EP+   E + EP  + EPEP+     + EP
Sbjct  1080  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1139

Query  219   EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
             E       EPE P+   E + EPE   E + EPE   E + EPE P+   E + EP+ + 
Sbjct  1140  EPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE-PEPEPEPEPEPEPEP  1197

Query  39    EPGRAAENQPEPE  1
             EP    E +PEPE
Sbjct  1198  EPEPEPEPEPEPE  1210


 Score = 94.0 bits (232),  Expect = 8e-18
 Identities = 64/193 (33%), Positives = 89/193 (46%), Gaps = 2/193 (1%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             EPE   E + EP      + E     E + +P    E + +P      +  PE   E + 
Sbjct  1022  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1081

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
             EPE   E +  PE   E + EPE   E + EP+   E + EP  + EPEP+     + EP
Sbjct  1082  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1141

Query  219   EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
             E       EPE P+   E + EPE   E + EPE   E + EPE P+   E + EP+ + 
Sbjct  1142  EPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE-PEPEPEPEPEPEPEP  1199

Query  39    EPGRAAENQPEPE  1
             EP    E +PEPE
Sbjct  1200  EPEPEPEPEPEPE  1212


 Score = 94.0 bits (232),  Expect = 8e-18
 Identities = 64/193 (33%), Positives = 89/193 (46%), Gaps = 2/193 (1%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             EPE   E + EP      + E     E + +P    E + +P      +  PE   E + 
Sbjct  1024  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1083

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
             EPE   E +  PE   E + EPE   E + EP+   E + EP  + EPEP+     + EP
Sbjct  1084  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1143

Query  219   EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
             E       EPE P+   E + EPE   E + EPE   E + EPE P+   E + EP+ + 
Sbjct  1144  EPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE-PEPEPEPEPEPEPEP  1201

Query  39    EPGRAAENQPEPE  1
             EP    E +PEPE
Sbjct  1202  EPEPEPEPEPEPE  1214


 Score = 94.0 bits (232),  Expect = 8e-18
 Identities = 64/193 (33%), Positives = 89/193 (46%), Gaps = 2/193 (1%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             EPE   E + EP      + E     E + +P    E + +P      +  PE   E + 
Sbjct  1026  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1085

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
             EPE   E +  PE   E + EPE   E + EP+   E + EP  + EPEP+     + EP
Sbjct  1086  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1145

Query  219   EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
             E       EPE P+   E + EPE   E + EPE   E + EPE P+   E + EP+ + 
Sbjct  1146  EPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE-PEPEPEPEPEPEPEP  1203

Query  39    EPGRAAENQPEPE  1
             EP    E +PEPE
Sbjct  1204  EPEPEPEPEPEPE  1216


 Score = 94.0 bits (232),  Expect = 8e-18
 Identities = 64/193 (33%), Positives = 89/193 (46%), Gaps = 2/193 (1%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             EPE   E + EP      + E     E + +P    E + +P      +  PE   E + 
Sbjct  1028  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1087

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
             EPE   E +  PE   E + EPE   E + EP+   E + EP  + EPEP+     + EP
Sbjct  1088  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1147

Query  219   EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
             E       EPE P+   E + EPE   E + EPE   E + EPE P+   E + EP+ + 
Sbjct  1148  EPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE-PEPEPEPEPEPEPEP  1205

Query  39    EPGRAAENQPEPE  1
             EP    E +PEPE
Sbjct  1206  EPEPEPEPEPEPE  1218


 Score = 94.0 bits (232),  Expect = 8e-18
 Identities = 64/193 (33%), Positives = 89/193 (46%), Gaps = 2/193 (1%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             EPE   E + EP      + E     E + +P    E + +P      +  PE   E + 
Sbjct  1030  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1089

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
             EPE   E +  PE   E + EPE   E + EP+   E + EP  + EPEP+     + EP
Sbjct  1090  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1149

Query  219   EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
             E       EPE P+   E + EPE   E + EPE   E + EPE P+   E + EP+ + 
Sbjct  1150  EPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE-PEPEPEPEPEPEPEP  1207

Query  39    EPGRAAENQPEPE  1
             EP    E +PEPE
Sbjct  1208  EPEPEPEPEPEPE  1220


 Score = 94.0 bits (232),  Expect = 8e-18
 Identities = 64/193 (33%), Positives = 89/193 (46%), Gaps = 2/193 (1%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             EPE   E + EP      + E     E + +P    E + +P      +  PE   E + 
Sbjct  1032  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1091

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
             EPE   E +  PE   E + EPE   E + EP+   E + EP  + EPEP+     + EP
Sbjct  1092  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1151

Query  219   EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
             E       EPE P+   E + EPE   E + EPE   E + EPE P+   E + EP+ + 
Sbjct  1152  EPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE-PEPEPEPEPEPEPEP  1209

Query  39    EPGRAAENQPEPE  1
             EP    E +PEPE
Sbjct  1210  EPEPEPEPEPEPE  1222


 Score = 94.0 bits (232),  Expect = 8e-18
 Identities = 64/193 (33%), Positives = 89/193 (46%), Gaps = 2/193 (1%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             EPE   E + EP      + E     E + +P    E + +P      +  PE   E + 
Sbjct  1034  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1093

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
             EPE   E +  PE   E + EPE   E + EP+   E + EP  + EPEP+     + EP
Sbjct  1094  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1153

Query  219   EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
             E       EPE P+   E + EPE   E + EPE   E + EPE P+   E + EP+ + 
Sbjct  1154  EPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE-PEPEPEPEPEPEPEP  1211

Query  39    EPGRAAENQPEPE  1
             EP    E +PEPE
Sbjct  1212  EPEPEPEPEPEPE  1224


 Score = 94.0 bits (232),  Expect = 8e-18
 Identities = 64/193 (33%), Positives = 89/193 (46%), Gaps = 2/193 (1%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             EPE   E + EP      + E     E + +P    E + +P      +  PE   E + 
Sbjct  1036  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1095

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
             EPE   E +  PE   E + EPE   E + EP+   E + EP  + EPEP+     + EP
Sbjct  1096  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1155

Query  219   EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
             E       EPE P+   E + EPE   E + EPE   E + EPE P+   E + EP+ + 
Sbjct  1156  EPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE-PEPEPEPEPEPEPEP  1213

Query  39    EPGRAAENQPEPE  1
             EP    E +PEPE
Sbjct  1214  EPEPEPEPEPEPE  1226


 Score = 87.4 bits (215),  Expect = 7e-16
 Identities = 56/159 (35%), Positives = 77/159 (48%), Gaps = 2/159 (1%)
 Frame = -1

Query  477   TREGQSKPGRTKGSQRGPESARETQREPEGTSESQRNPERAKESQREPERARESQREPKR  298
             T E + +P      +  PE   E + EPE   E +  PE   E + EPE   E + EP+ 
Sbjct  1016  TTEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1075

Query  297   TRESQREPGSQREPEPQRARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPE  118
               E + EP  + EPEP+     + EPE       EPE P+   E + EPE   E + EPE
Sbjct  1076  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPE  1134

Query  117   RARESQREPEGPKRARERQREPKSQGEPGRAAENQPEPE  1
                E + EPE P+   E + EP+ + EP    E +PEPE
Sbjct  1135  PEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPE  1172


 Score = 79.3 bits (194),  Expect = 2e-13
 Identities = 54/166 (32%), Positives = 74/166 (44%), Gaps = 1/166 (0%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             EPE   E + EP      + E     E + +P    E + +P      +  PE   E + 
Sbjct  1064  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1123

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
             EPE   E +  PE   E + EPE   E + EP+   E + EP  + EPEP+     + EP
Sbjct  1124  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1183

Query  219   EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGP  82
             E       EPE P+   E + EPE   E + EPE   E + EPE P
Sbjct  1184  EPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPELP  1228


 Score = 79.0 bits (193),  Expect = 3e-13
 Identities = 56/182 (30%), Positives = 76/182 (41%), Gaps = 1/182 (0%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             EPE   E + EP      + E     E + +P    E + +P      +  PE   E + 
Sbjct  1056  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1115

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
             EPE   E +  PE   E + EPE   E + EP+   E + EP  + EPEP+     + EP
Sbjct  1116  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1175

Query  219   EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
             E       EPE P+   E + EPE   E + EPE   E + EPE           P    
Sbjct  1176  EPEPEPEPEPE-PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPELPTPSIPV  1234

Query  39    EP  34
             EP
Sbjct  1235  EP  1236


 Score = 70.1 bits (170),  Expect = 1e-10
 Identities = 64/213 (30%), Positives = 89/213 (41%), Gaps = 7/213 (3%)
 Frame = -2

Query  734   VSSG----LPVGEIPAKLLDCVTQRDAATEPERAGESQREPERPGDNKRGPEGTRESQRE  567
             +SSG    +P+G  P      +      TEPE   E + EPE   + +  PE   E + E
Sbjct  989   ISSGDDNTVPIGTPPIFDTFTLDNITITTEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE  1048

Query  566   PGRARESQTEPEATSKSWREPERARESQGEPERAKASQGEPKGAREDQraperpresrre  387
             P    E + EPE   +   EPE   E + EPE     + EP+   E +  PE   E   E
Sbjct  1049  PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE  1108

Query  386   pararETQRGPKRARESQREPERARGSQRGPERARENQGARESQSHREPEGPRGSQRKPA  207
             P    E +  P+   E + EPE     +  PE   E +   E +   EPE     + +P 
Sbjct  1109  PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP-  1167

Query  206   GARKSPKTPKEPERARESQREPERARESQREPE  108
                  P+   EPE   E + EPE   E + EPE
Sbjct  1168  --EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE  1198


 Score = 56.6 bits (135),  Expect = 1e-06
 Identities = 39/131 (29%), Positives = 55/131 (41%), Gaps = 0/131 (0%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             EPE   E + EP      + E     E + +P    E + +P      +  PE   E + 
Sbjct  1114  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1173

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
             EPE   E +  PE   E + EPE   E + EP+   E + EP  + EPEP+    T   P
Sbjct  1174  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPELPTPSIP  1233

Query  219   EKASRSPQEPE  187
              +   SP   E
Sbjct  1234  VEPPTSPDVEE  1244


 Score = 41.6 bits (96),  Expect = 0.044
 Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 0/79 (0%)
 Frame = -2

Query  659   EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  480
             EPE   E + EPE   + +  PE   E + EP    E + EPE   +   EPE   E + 
Sbjct  1122  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1181

Query  479   EPERAKASQGEPKGAREDQ  423
             EPE     + EP+   E +
Sbjct  1182  EPEPEPEPEPEPEPEPEPE  1200


 Score = 41.6 bits (96),  Expect = 0.044
 Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 0/79 (0%)
 Frame = -2

Query  659   EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  480
             EPE   E + EPE   + +  PE   E + EP    E + EPE   +   EPE   E + 
Sbjct  1124  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1183

Query  479   EPERAKASQGEPKGAREDQ  423
             EPE     + EP+   E +
Sbjct  1184  EPEPEPEPEPEPEPEPEPE  1202


 Score = 41.6 bits (96),  Expect = 0.044
 Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 0/79 (0%)
 Frame = -2

Query  659   EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  480
             EPE   E + EPE   + +  PE   E + EP    E + EPE   +   EPE   E + 
Sbjct  1126  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1185

Query  479   EPERAKASQGEPKGAREDQ  423
             EPE     + EP+   E +
Sbjct  1186  EPEPEPEPEPEPEPEPEPE  1204


 Score = 41.6 bits (96),  Expect = 0.044
 Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 0/79 (0%)
 Frame = -2

Query  659   EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  480
             EPE   E + EPE   + +  PE   E + EP    E + EPE   +   EPE   E + 
Sbjct  1128  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1187

Query  479   EPERAKASQGEPKGAREDQ  423
             EPE     + EP+   E +
Sbjct  1188  EPEPEPEPEPEPEPEPEPE  1206


 Score = 41.6 bits (96),  Expect = 0.044
 Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 0/79 (0%)
 Frame = -2

Query  659   EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  480
             EPE   E + EPE   + +  PE   E + EP    E + EPE   +   EPE   E + 
Sbjct  1130  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1189

Query  479   EPERAKASQGEPKGAREDQ  423
             EPE     + EP+   E +
Sbjct  1190  EPEPEPEPEPEPEPEPEPE  1208


 Score = 41.6 bits (96),  Expect = 0.044
 Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 0/79 (0%)
 Frame = -2

Query  659   EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  480
             EPE   E + EPE   + +  PE   E + EP    E + EPE   +   EPE   E + 
Sbjct  1132  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1191

Query  479   EPERAKASQGEPKGAREDQ  423
             EPE     + EP+   E +
Sbjct  1192  EPEPEPEPEPEPEPEPEPE  1210


 Score = 41.6 bits (96),  Expect = 0.044
 Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 0/79 (0%)
 Frame = -2

Query  659   EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  480
             EPE   E + EPE   + +  PE   E + EP    E + EPE   +   EPE   E + 
Sbjct  1134  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1193

Query  479   EPERAKASQGEPKGAREDQ  423
             EPE     + EP+   E +
Sbjct  1194  EPEPEPEPEPEPEPEPEPE  1212


 Score = 41.6 bits (96),  Expect = 0.044
 Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 0/79 (0%)
 Frame = -2

Query  659   EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  480
             EPE   E + EPE   + +  PE   E + EP    E + EPE   +   EPE   E + 
Sbjct  1136  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1195

Query  479   EPERAKASQGEPKGAREDQ  423
             EPE     + EP+   E +
Sbjct  1196  EPEPEPEPEPEPEPEPEPE  1214


 Score = 41.6 bits (96),  Expect = 0.044
 Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 0/79 (0%)
 Frame = -2

Query  659   EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  480
             EPE   E + EPE   + +  PE   E + EP    E + EPE   +   EPE   E + 
Sbjct  1138  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1197

Query  479   EPERAKASQGEPKGAREDQ  423
             EPE     + EP+   E +
Sbjct  1198  EPEPEPEPEPEPEPEPEPE  1216


 Score = 41.6 bits (96),  Expect = 0.044
 Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 0/79 (0%)
 Frame = -2

Query  659   EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  480
             EPE   E + EPE   + +  PE   E + EP    E + EPE   +   EPE   E + 
Sbjct  1140  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1199

Query  479   EPERAKASQGEPKGAREDQ  423
             EPE     + EP+   E +
Sbjct  1200  EPEPEPEPEPEPEPEPEPE  1218


 Score = 41.6 bits (96),  Expect = 0.044
 Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 0/79 (0%)
 Frame = -2

Query  659   EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  480
             EPE   E + EPE   + +  PE   E + EP    E + EPE   +   EPE   E + 
Sbjct  1142  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1201

Query  479   EPERAKASQGEPKGAREDQ  423
             EPE     + EP+   E +
Sbjct  1202  EPEPEPEPEPEPEPEPEPE  1220


 Score = 41.6 bits (96),  Expect = 0.044
 Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 0/79 (0%)
 Frame = -2

Query  659   EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  480
             EPE   E + EPE   + +  PE   E + EP    E + EPE   +   EPE   E + 
Sbjct  1144  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1203

Query  479   EPERAKASQGEPKGAREDQ  423
             EPE     + EP+   E +
Sbjct  1204  EPEPEPEPEPEPEPEPEPE  1222


 Score = 41.6 bits (96),  Expect = 0.044
 Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 0/79 (0%)
 Frame = -2

Query  659   EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  480
             EPE   E + EPE   + +  PE   E + EP    E + EPE   +   EPE   E + 
Sbjct  1146  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1205

Query  479   EPERAKASQGEPKGAREDQ  423
             EPE     + EP+   E +
Sbjct  1206  EPEPEPEPEPEPEPEPEPE  1224


 Score = 41.6 bits (96),  Expect = 0.044
 Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 0/79 (0%)
 Frame = -2

Query  659   EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  480
             EPE   E + EPE   + +  PE   E + EP    E + EPE   +   EPE   E + 
Sbjct  1148  EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP  1207

Query  479   EPERAKASQGEPKGAREDQ  423
             EPE     + EP+   E +
Sbjct  1208  EPEPEPEPEPEPEPEPEPE  1226


>gi|118419244|gb|ABK87663.1|  conserved hypothetical protein [Bacillus thuringiensis str. Al 
Hakam]
Length=3588

 Score = 93.6 bits (231),  Expect = 1e-17
 Identities = 56/199 (28%), Positives = 99/199 (49%), Gaps = 6/199 (3%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             +PE  +E + +P   +  + +    +E + KP   +E + KP   K  +  PE  +E + 
Sbjct  3281  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3340

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPE-----PQRARG  235
             +PE   E +  PE  KE + +PE  +E + +P+  +E + +P   +EPE     P+    
Sbjct  3341  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3400

Query  234   TQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPE-GPKRARERQR  58
                +P++    P++P+ P+   E  +EPE   E  +EPE   E  +EPE  P+  +E + 
Sbjct  3401  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3460

Query  57    EPKSQGEPGRAAENQPEPE  1
             +P+   EP    E+  EPE
Sbjct  3461  KPEDPKEPEVKPEDPKEPE  3479


 Score = 91.3 bits (225),  Expect = 5e-17
 Identities = 58/199 (29%), Positives = 97/199 (48%), Gaps = 12/199 (6%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             EPE   E  +EP      + +    +E + KP   +E + KP   K  +  PE  +E + 
Sbjct  3277  EPEVKPEDPKEP------EVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3330

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPE-----PQRARG  235
             +PE   E +  PE  KE + +PE  +E + +P+  +E + +P   +EPE     P+    
Sbjct  3331  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3390

Query  234   TQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPE-GPKRARERQR  58
                +P++    P++P+ P+   E  +EPE   E  +EPE   E  +EPE  P+  +E + 
Sbjct  3391  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3450

Query  57    EPKSQGEPGRAAENQPEPE  1
             +P+   EP    E+  EPE
Sbjct  3451  KPEDPKEPEVKPEDPKEPE  3469


 Score = 89.7 bits (221),  Expect = 1e-16
 Identities = 57/199 (28%), Positives = 99/199 (49%), Gaps = 6/199 (3%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             +PE  +E + +P   +  + +    +E + KP   +E + KP   K  +  PE  +E + 
Sbjct  3291  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3350

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPE--PQRARGTQR  226
             +PE   E +  PE  KE + +PE  +E + +P+  +E + +P   +EPE  P+  +  + 
Sbjct  3351  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3410

Query  225   EPEKASRSPQEPENPQRAR---ESQREPERARESQREPERARESQREPE-GPKRARERQR  58
             +PE       +PE+P+      E  +EPE   E  +EPE   E  +EPE  P+  +E + 
Sbjct  3411  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3470

Query  57    EPKSQGEPGRAAENQPEPE  1
             +P+   EP    E+  EPE
Sbjct  3471  KPEDPKEPEVKPEDPKEPE  3489


 Score = 89.7 bits (221),  Expect = 1e-16
 Identities = 57/199 (28%), Positives = 99/199 (49%), Gaps = 6/199 (3%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             +PE  +E + +P   +  + +    +E + KP   +E + KP   K  +  PE  +E + 
Sbjct  3301  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3360

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPE--PQRARGTQR  226
             +PE   E +  PE  KE + +PE  +E + +P+  +E + +P   +EPE  P+  +  + 
Sbjct  3361  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3420

Query  225   EPEKASRSPQEPENPQRAR---ESQREPERARESQREPERARESQREPE-GPKRARERQR  58
             +PE       +PE+P+      E  +EPE   E  +EPE   E  +EPE  P+  +E + 
Sbjct  3421  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3480

Query  57    EPKSQGEPGRAAENQPEPE  1
             +P+   EP    E+  EPE
Sbjct  3481  KPEDPKEPEVKPEDPKEPE  3499


 Score = 89.7 bits (221),  Expect = 1e-16
 Identities = 57/199 (28%), Positives = 99/199 (49%), Gaps = 6/199 (3%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             +PE  +E + +P   +  + +    +E + KP   +E + KP   K  +  PE  +E + 
Sbjct  3311  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3370

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPE--PQRARGTQR  226
             +PE   E +  PE  KE + +PE  +E + +P+  +E + +P   +EPE  P+  +  + 
Sbjct  3371  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3430

Query  225   EPEKASRSPQEPENPQRAR---ESQREPERARESQREPERARESQREPE-GPKRARERQR  58
             +PE       +PE+P+      E  +EPE   E  +EPE   E  +EPE  P+  +E + 
Sbjct  3431  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3490

Query  57    EPKSQGEPGRAAENQPEPE  1
             +P+   EP    E+  EPE
Sbjct  3491  KPEDPKEPEVKPEDPKEPE  3509


 Score = 89.7 bits (221),  Expect = 1e-16
 Identities = 57/199 (28%), Positives = 99/199 (49%), Gaps = 6/199 (3%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             +PE  +E + +P   +  + +    +E + KP   +E + KP   K  +  PE  +E + 
Sbjct  3321  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3380

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPE--PQRARGTQR  226
             +PE   E +  PE  KE + +PE  +E + +P+  +E + +P   +EPE  P+  +  + 
Sbjct  3381  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3440

Query  225   EPEKASRSPQEPENPQRAR---ESQREPERARESQREPERARESQREPE-GPKRARERQR  58
             +PE       +PE+P+      E  +EPE   E  +EPE   E  +EPE  P+  +E + 
Sbjct  3441  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3500

Query  57    EPKSQGEPGRAAENQPEPE  1
             +P+   EP    E+  EPE
Sbjct  3501  KPEDPKEPEVKPEDPKEPE  3519


 Score = 89.7 bits (221),  Expect = 1e-16
 Identities = 57/199 (28%), Positives = 99/199 (49%), Gaps = 6/199 (3%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             +PE  +E + +P   +  + +    +E + KP   +E + KP   K  +  PE  +E + 
Sbjct  3331  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3390

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPE--PQRARGTQR  226
             +PE   E +  PE  KE + +PE  +E + +P+  +E + +P   +EPE  P+  +  + 
Sbjct  3391  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3450

Query  225   EPEKASRSPQEPENPQRAR---ESQREPERARESQREPERARESQREPE-GPKRARERQR  58
             +PE       +PE+P+      E  +EPE   E  +EPE   E  +EPE  P+  +E + 
Sbjct  3451  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3510

Query  57    EPKSQGEPGRAAENQPEPE  1
             +P+   EP    E+  EPE
Sbjct  3511  KPEDPKEPEVKPEDPKEPE  3529


 Score = 82.0 bits (201),  Expect = 3e-14
 Identities = 48/179 (26%), Positives = 92/179 (51%), Gaps = 5/179 (2%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             +PE  +E + +P   +  + +    +E + KP   +E + KP   K  +  PE  +E + 
Sbjct  3361  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3420

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPE--PQRARGTQR  226
             +PE   E +  PE  KE + +PE  +E + +P+  +E + +P   +EPE  P+  +  + 
Sbjct  3421  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3480

Query  225   EPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPK  49
             +PE       +PE+P+   E + +PE  +E + +PE  +E + +PE PK    +  +P+
Sbjct  3481  KPEDPKEPEVKPEDPK---EPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKLEKPE  3536


 Score = 79.7 bits (195),  Expect = 1e-13
 Identities = 51/183 (27%), Positives = 95/183 (51%), Gaps = 4/183 (2%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             +PE  +E + +P   +  + +    +E + KP   +E + KP   K  +  PE  +E + 
Sbjct  3371  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3430

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
             +PE   E +  PE  KE + +PE  +E + +P+  +E + +P   +EPE +      +EP
Sbjct  3431  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE--DPKEP  3488

Query  219   EKASRSPQEPE-NPQRARESQREPERARESQREPERARESQREPEGPK-RARERQREPKS  46
             E     P+EPE  P+  +E + +PE  +E + +PE  +E + + E P+ R  +  +EP+ 
Sbjct  3489  EVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKLEKPEVRLEKLIKEPQV  3548

Query  45    QGE  37
             + E
Sbjct  3549  KVE  3551


 Score = 76.3 bits (186),  Expect = 2e-12
 Identities = 55/197 (27%), Positives = 98/197 (49%), Gaps = 5/197 (2%)
 Frame = -2

Query  683   VTQRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREP  504
             +  ++   +PE   E + +PE P + +  PE  +E + +P   +E + +PE   +   +P
Sbjct  3273  IKPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKP  3332

Query  503   ERARESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREP  324
             E  +E + +PE  K  + +P+  +E +  PE P+E   +P   +E +  P+  +E + +P
Sbjct  3333  EDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKP  3392

Query  323   ERARGSQRGPERARENQGARESQSHRE--PEGPRGSQRKPAGARK---SPKTPKEPERAR  159
             E  +  +  PE  +E +   E     E  PE P+  + KP   ++    P+ PKEPE   
Sbjct  3393  EDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKP  3452

Query  158   ESQREPERARESQREPE  108
             E  +EPE   E  +EPE
Sbjct  3453  EDPKEPEVKPEDPKEPE  3469


 Score = 60.1 bits (144),  Expect = 1e-07
 Identities = 52/184 (28%), Positives = 70/184 (38%), Gaps = 41/184 (22%)
 Frame = -2

Query  659   EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  480
             EPE   E  +EPE   ++ + PE   E  +EP    E   EPE   +  +EPE   E   
Sbjct  3387  EPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPK  3446

Query  479   EPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREPERARGSQR  300
             EPE       EP+   ED                     + P+   E  +EPE      +
Sbjct  3447  EPEVKPEDPKEPEVKPED--------------------PKEPEVKPEDPKEPEVKPEDPK  3486

Query  299   GPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQ  120
              PE               +PE P+  + K       P+ PKEPE   E  +EPE   E  
Sbjct  3487  EPE--------------VKPEDPKEPEVK-------PEDPKEPEVKPEDPKEPEVKPEDP  3525

Query  119   REPE  108
             +EPE
Sbjct  3526  KEPE  3529


 Score = 58.2 bits (139),  Expect = 5e-07
 Identities = 42/157 (26%), Positives = 76/157 (48%), Gaps = 7/157 (4%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             +PE  +E + +P   +  + +    +E + KP   +E + KP   K  +  PE  +E + 
Sbjct  3401  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEV  3460

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQR--EPEPQRARGTQR  226
             +PE   E +  PE  KE + +PE  +E + +P+  +E + +P   +  E +P+      +
Sbjct  3461  KPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPE----DPK  3516

Query  225   EPEKASRSPQEPENPQRARESQREPERARESQREPER  115
             EPE     P+EPE      E + E +  +E Q + ER
Sbjct  3517  EPEVKPEDPKEPEVKLEKPEVRLE-KLIKEPQVKVER  3552


 Score = 51.6 bits (122),  Expect = 4e-05
 Identities = 30/91 (32%), Positives = 47/91 (51%), Gaps = 4/91 (4%)
 Frame = -1

Query  270   SQREPEPQRARGTQREPEKASRSPQEPE-NPQRARESQREPERARESQREPERARESQRE  94
             S +  EP+      +EPE     P+EPE  P+  +E + +PE  +E + +PE  +E + +
Sbjct  3272  SIKPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVK  3331

Query  93    PEGPKRARERQREPKSQGEPGRAAENQPEPE  1
             PE PK    +  +PK   EP    E+  EPE
Sbjct  3332  PEDPKEPEVKPEDPK---EPEVKPEDPKEPE  3359


 Score = 50.1 bits (118),  Expect = 1e-04
 Identities = 42/179 (23%), Positives = 72/179 (40%), Gaps = 45/179 (25%)
 Frame = -2

Query  674   RDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERA  495
             ++   +PE   E + +PE P + +  PE  +E + +P   +E + +PE   +   +PE  
Sbjct  3396  KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP  3455

Query  494   RESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREPERA  315
             +E + +PE  K  + +P+  +E                        P+   E  +EPE  
Sbjct  3456  KEPEVKPEDPKEPEVKPEDPKE------------------------PEVKPEDPKEPEVK  3491

Query  314   RGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPE  138
                 + PE               +PE P+  + K       P+ PKEPE   E  +EPE
Sbjct  3492  PEDPKEPE--------------VKPEDPKEPEVK-------PEDPKEPEVKPEDPKEPE  3529


 Score = 40.4 bits (93),  Expect = 0.099
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 3/67 (4%)
 Frame = -1

Query  201   PQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQGEPGRAA  22
             P EP    + +E + +PE  +E + +PE  +E + +PE PK    +  +PK   EP    
Sbjct  3266  PLEPTVSIKPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPK---EPEVKP  3322

Query  21    ENQPEPE  1
             E+  EPE
Sbjct  3323  EDPKEPE  3329
>gi|47226837|emb|CAG06679.1|  unnamed protein product [Tetraodon nigroviridis]
Length=933

 Score = 91.3 bits (225),  Expect = 5e-17
 Identities = 66/203 (32%), Positives = 100/203 (49%), Gaps = 20/203 (9%)
 Frame = -1

Query  579  EPERARESQREPNRTR--GHQQELARARESQ-------------RKPGRTREGQSKPGRT  445
            E +R  E  R+ +  R  GH +   R R  Q             R  GR+ + + +  R 
Sbjct  453  ESDRRGEPSRDSSYDRRGGHGERDRRDRVKQYFYVFLYFPASPSRYQGRSEDSEREERR-  511

Query  444  KGSQRGPESARETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQ  265
                R  + A E + +     E +R+ ER KE +R+ ER RE +RE +R R  +RE   +
Sbjct  512  --EDRRTDRAEERREDRTRERERERDREREKEKERDREREREKEREAERERARERERERE  569

Query  264  REPEPQRARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEG  85
            RE E +R R  +RE  +  R  +E E  +R RE ++E ER RE +RE +R RE QRE E 
Sbjct  570  REREREREREREREEREREREEREREREERERE-RKERERERERERE-QRERERQREWEE  627

Query  84   PKRARERQREPKSQGEPGRAAEN  16
             +R RE +R+ +      R+  +
Sbjct  628  RERGREERRDRREDSRDERSVRD  650


 Score = 81.3 bits (199),  Expect = 5e-14
 Identities = 55/171 (32%), Positives = 87/171 (50%), Gaps = 15/171 (8%)
 Frame = -1

Query  570  RARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPE  391
            R+ +S+RE  R     ++    R  +R+  RTRE +    R +  +R  E  R+ +RE E
Sbjct  501  RSEDSEREERR-----EDRRTDRAEERREDRTRERE----RERDREREKEKERDRERERE  551

Query  390  GTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEKA  211
               E++R  ERA+E +RE ER RE +RE +R RE +     +RE E +     ++E E+ 
Sbjct  552  KEREAER--ERAREREREREREREREREREREREEREREREEREREREERERERKERERE  609

Query  210  SRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQR  58
                +E E  QR RE QRE E     + E    RE  R+    + +R+ ++
Sbjct  610  ----REREREQRERERQREWEERERGREERRDRREDSRDERSVRDSRDDRK  656


 Score = 77.8 bits (190),  Expect = 6e-13
 Identities = 60/184 (32%), Positives = 91/184 (49%), Gaps = 5/184 (2%)
 Frame = -1

Query  564  RESQREPNRT-RGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEG  388
            RE +RE  RT R  ++   R RE +R+  R RE + +  R +  ++  E+ RE  RE E 
Sbjct  507  REERREDRRTDRAEERREDRTRERERERDREREKEKERDREREREKEREAERERARERER  566

Query  387  TSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEKAS  208
              E +R  ER +E +RE ER RE + E +R RE +     +RE E +R R  QRE E+  
Sbjct  567  ERERERERERERERERE-ERERE-REEREREREERERERKERERERERER-EQRERER-Q  622

Query  207  RSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQGEPGR  28
            R  +E E  +  R  +RE  R   S R+    R+ +R     ++    +  P  +  P  
Sbjct  623  REWEERERGREERRDRREDSRDERSVRDSRDDRKMRRVFIYDRKRMRVESSPSPRTTPKT  682

Query  27   AAEN  16
            AA +
Sbjct  683  AARD  686


 Score = 75.1 bits (183),  Expect = 4e-12
 Identities = 64/206 (31%), Positives = 90/206 (43%), Gaps = 27/206 (13%)
 Frame = -1

Query  567  ARESQREPNRTRGHQQELARARESQRKPGRTR---EGQSKPGRTKGSQR----GPESARE  409
            +R S              A  R S R   R R   + + +P R     R    G    R+
Sbjct  420  SRSSTARDRSVERSNDRSATERSSDRGSDRDRYESDRRGEPSRDSSYDRRGGHGERDRRD  479

Query  408  TQRE--------PEGTSESQ-RNPERAKESQREPERA-RESQREPKRTRESQREPGSQRE  259
              ++        P   S  Q R+ +  +E +RE  R  R  +R   RTRE +RE   +RE
Sbjct  480  RVKQYFYVFLYFPASPSRYQGRSEDSEREERREDRRTDRAEERREDRTRERERERDRERE  539

Query  258  PEPQRARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPK  79
             E +R R  +RE E+ +         +RARE +RE ER RE +RE ER RE   E E  +
Sbjct  540  KEKERDREREREKEREAER-------ERARERERERERERERERERERERE---ERERER  589

Query  78   RARERQREPKSQGEPGRAAENQPEPE  1
              RER+RE + +    R  E + E E
Sbjct  590  EEREREREERERERKERERERERERE  615


 Score = 68.9 bits (167),  Expect = 3e-10
 Identities = 55/178 (30%), Positives = 78/178 (43%), Gaps = 8/178 (4%)
 Frame = -1

Query  573  ERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREP  394
            +R RE +RE +R R  ++E  R RE +++    RE + +  R +  +R  E  RE +RE 
Sbjct  525  DRTRERERERDREREKEKERDREREREKE----REAERERARERERERERERERERERER  580

Query  393  EGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEK  214
            E     +   ER +E +      +E +RE +R RE QRE   QRE E +R RG  RE  +
Sbjct  581  EREEREREREEREREREERERERKERERERERERE-QRERERQREWE-ERERG--REERR  636

Query  213  ASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
              R     E   R     R+  R     R+  R   S      PK A        S G
Sbjct  637  DRREDSRDERSVRDSRDDRKMRRVFIYDRKRMRVESSPSPRTTPKTAARDLSPADSDG  694


 Score = 57.4 bits (137),  Expect = 8e-07
 Identities = 56/176 (31%), Positives = 82/176 (46%), Gaps = 19/176 (10%)
 Frame = -2

Query  677  QRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPER  498
            + D   E ER  + +RE E+  D +R  E  RE++RE  R RE + E        RE ER
Sbjct  523  REDRTRERERERDREREKEKERDREREREKEREAERERARERERERE--------RERER  574

Query  497  ARESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQRE-PE  321
             RE + E E  +  + E +  RE++         R+E  R RE +R  +R RE QRE  E
Sbjct  575  EREREREREEREREREEREREREER------ERERKERERERERER-EQRERERQREWEE  627

Query  320  RARGSQRGPER---ARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERA  162
            R RG +   +R   +R+ +  R+S+  R+        RK      SP     P+ A
Sbjct  628  RERGREERRDRREDSRDERSVRDSRDDRKMRRVFIYDRKRMRVESSPSPRTTPKTA  683


 Score = 55.8 bits (133),  Expect = 2e-06
 Identities = 50/183 (27%), Positives = 75/183 (40%), Gaps = 42/183 (22%)
 Frame = -2

Query  650  RAGESQREPERPGDN-----KRGPEGTRESQREPGRARESQTEPEATSKSWREPERARES  486
            R+ +S+RE  R         +R  + TRE +RE  R RE + E        R+ ER RE 
Sbjct  501  RSEDSEREERREDRRTDRAEERREDRTRERERERDREREKEKE--------RDREREREK  552

Query  485  QGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREPERARGS  306
            + E ER +A + E +  RE                          R RE +RE ER    
Sbjct  553  EREAERERARERERERERE--------------------------REREREREREREERE  586

Query  305  QRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARE  126
            +   ER RE +     +  RE E  R  +++    R+  +  +E ER RE +R+      
Sbjct  587  REREEREREREERERERKEREREREREREQR---ERERQREWEERERGREERRDRREDSR  643

Query  125  SQR  117
             +R
Sbjct  644  DER  646


 Score = 53.9 bits (128),  Expect = 9e-06
 Identities = 53/176 (30%), Positives = 82/176 (46%), Gaps = 12/176 (6%)
 Frame = -2

Query  680  TQRDAATEPERAGESQ-REPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREP  504
            ++R+   E  R   ++ R  +R  + +R  +  RE ++E  R RE + E EA      E 
Sbjct  505  SEREERREDRRTDRAEERREDRTRERERERDREREKEKERDREREREKEREA------ER  558

Query  503  ERARESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARE-SQRE  327
            ERARE + E ER +  + E +  RE++      RE  RE       +R  +R RE  QRE
Sbjct  559  ERAREREREREREREREREREREREEREREREEREREREERERERKEREREREREREQRE  618

Query  326  PERAR---GSQRGPERARE-NQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEP  171
             ER R     +RG E  R+  + +R+ +S R+    R  +R     RK  +    P
Sbjct  619  RERQREWEERERGREERRDRREDSRDERSVRDSRDDRKMRRVFIYDRKRMRVESSP  674


 Score = 50.4 bits (119),  Expect = 1e-04
 Identities = 45/197 (22%), Positives = 79/197 (40%), Gaps = 9/197 (4%)
 Frame = -1

Query  576  PERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQ--  403
            P R   S    +  + H     R R S     R+  G +    +    R P ++ E    
Sbjct  164  PRRRSTSSHSGSSAQRHSTSPRRRRSSSPPYHRSVAGSASSPLSSRRSRSPLTSHEASSP  223

Query  402  -REPEGTSESQRNPERAKESQREPER---ARESQREPKRTRESQREPGSQREPEPQRARG  235
             R  + +S S R+    +  + E ER   A+E + + +    S+RE  S R+     +  
Sbjct  224  HRRSDRSSPSHRHSRGRERFRGERERSPPAQERRHDRRDETRSKREKDSIRDDRDYDSEL  283

Query  234  TQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRA---RER  64
                  +  R  +E  + + ARE  RE  R     R+ + +RES+ +    + +   RER
Sbjct  284  LSSRDTRGERDTRESRDRRDARERGRETTRDSRDSRDAKDSRESRTDTRSSRESLGSRER  343

Query  63   QREPKSQGEPGRAAENQ  13
            +RE   + +  R  E +
Sbjct  344  ERERDREKDRERDKERE  360


 Score = 48.9 bits (115),  Expect = 3e-04
 Identities = 49/211 (23%), Positives = 80/211 (37%), Gaps = 31/211 (14%)
 Frame = -1

Query  573  ERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREP  394
            +  R  +R+  R++  +  +   R+   +   +R+ + +  R     R    ARE  RE 
Sbjct  254  QERRHDRRDETRSKREKDSIRDDRDYDSELLSSRDTRGE--RDTRESRDRRDARERGRET  311

Query  393  EGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARG-TQREPE  217
               S   R+ + ++ES+ +   +RES    +R RE  RE   +R+ E +R R  TQR+ +
Sbjct  312  TRDSRDSRDAKDSRESRTDTRSSRESLGSRERERERDREKDRERDKERERDRSDTQRKED  371

Query  216  KASR-------------SPQEPENPQRARESQR--------------EPERARESQREPE  118
             A                    E   R R S R              E   +    R  E
Sbjct  372  TAQEDRSYGRGHGREDTKTDRAEKNGRVRGSNRNSRGSQVEGGHDVWESRSSTARDRSVE  431

Query  117  RARESQREPEGPKRARERQR-EPKSQGEPGR  28
            R+ +         R  +R R E   +GEP R
Sbjct  432  RSNDRSATERSSDRGSDRDRYESDRRGEPSR  462


 Score = 48.5 bits (114),  Expect = 4e-04
 Identities = 49/210 (23%), Positives = 80/210 (38%), Gaps = 35/210 (16%)
 Frame = -1

Query  576  PERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQRE  397
            P ++  S +  + T+G        + S   P       SK G +K  ++GP +       
Sbjct  48   PRKSSRSPKHKSGTKGVGSGKKEKKGSVSSPASEATKSSKGGHSK--KKGPRTPSPPPPV  105

Query  396  P-------EGTSESQRNPERAKESQREPE---RARESQREPKRTRESQREPGSQREPEPQ  247
            P       +      +N E+++E Q++ +   R  E  +E K  R S   P  +R P P+
Sbjct  106  PLDIPVVGKKHKNKHKNKEKSEEKQKDGKDRGRDTEKHKEKKEKRSSPSPPRHRRSPTPR  165

Query  246  RARGTQREPEKASRSPQEP------------------ENPQRARESQREPERARES---Q  130
            R   +      A R    P                   +P  +R S R P  + E+    
Sbjct  166  RRSTSSHSGSSAQRHSTSPRRRRSSSPPYHRSVAGSASSPLSSRRS-RSPLTSHEASSPH  224

Query  129  REPERARESQREPEGPKRAR-ERQREPKSQ  43
            R  +R+  S R   G +R R ER+R P +Q
Sbjct  225  RRSDRSSPSHRHSRGRERFRGERERSPPAQ  254


 Score = 39.3 bits (90),  Expect = 0.22
 Identities = 47/188 (25%), Positives = 75/188 (39%), Gaps = 18/188 (9%)
 Frame = -2

Query  677  QRDAATEPER--AGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREP  504
            +RD     +R  A E  RE  R   + R  + +RES+ +   +RES    E   +  RE 
Sbjct  292  ERDTRESRDRRDARERGRETTRDSRDSRDAKDSRESRTDTRSSRESLGSRERERERDREK  351

Query  503  ERARESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREP  324
            +R R+ + E +R+   + E   A+ED+         R       +T R  K         
Sbjct  352  DRERDKERERDRSDTQRKEDT-AQEDR------SYGRGHGREDTKTDRAEKNG-------  397

Query  323  ERARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERAR-ESQR  147
             R RGS R    ++   G    +S       R  +R    +     + +  +R R ES R
Sbjct  398  -RVRGSNRNSRGSQVEGGHDVWESRSSTARDRSVERSNDRSATERSSDRGSDRDRYESDR  456

Query  146  EPERARES  123
              E +R+S
Sbjct  457  RGEPSRDS  464
----------------------------------------------------------------------------------------

BlastX contre swissprot

Sequences producing significant alignments:                        (Bits)  Value

gi|730888|sp|Q06666|T2_MOUSE  Octapeptide-repeat protein T2         100    6e-21  Gene info
gi|68052314|sp|Q5T200|ZC313_HUMAN  Zinc finger CCCH domain-contai  96.7    8e-20  Gene info
gi|68068009|sp|P49756|RBM25_HUMAN  Probable RNA-binding protei...  90.9    5e-18
gi|37537968|sp|Q8WXA9|SFR12_HUMAN  Splicing factor, arginine/s...  84.7    3e-16  Gene info
gi|37537951|sp|Q8BZX4|SFR12_MOUSE  Splicing factor, arginine/s...  80.1    8e-15  Gene info
gi|37537914|sp|Q9JKL7|SFR12_RAT  Splicing factor, arginine/ser...  79.7    1e-14  Gene info
gi|112674|sp|P13813|110KD_PLAKN  110 kDa antigen (PK110)           74.3    4e-13
gi|266334|sp|Q01042|IE68_SHV21  Immediate-early protein            73.6    8e-13
gi|116242677|sp|P12036|NFH_HUMAN  Neurofilament triplet H prot...  72.0    2e-12
gi|108861895|sp|Q8H0U8|RH42_ARATH  DEAD-box ATP-dependent RNA hel  71.6    3e-12  Gene info
gi|83288394|sp|Q9JM99|PRG4_MOUSE  Proteoglycan-4 precursor (Lu...  71.6    3e-12  Gene info
gi|114152161|sp|Q8BTI8|SRRM2_MOUSE  Serine/arginine repetitive ma  71.2    4e-12  Gene info
gi|586120|sp|Q07283|TRHY_HUMAN  Trichohyalin                       70.9    5e-12  Gene info
gi|74721253|sp|Q9UQ35|SRRM2_HUMAN  Serine/arginine repetitive ...  70.5    6e-12  Gene info
gi|46397348|sp|Q9UKV3|ACINU_HUMAN  Apoptotic chromatin condens...  70.1    8e-12  Gene info
gi|6685537|sp|Q14152|IF3A_HUMAN  Eukaryotic translation initia...  68.6    2e-11  Gene info
gi|29428261|sp|Q9JIX8|ACINU_MOUSE  Apoptotic chromatin condens...  68.2    3e-11  Gene info
gi|52782720|sp|Q6RHR9|MAGI1_MOUSE  Membrane-associated guanyla...  67.4    5e-11  Gene info
gi|44888974|sp|P33438|GLT_DROME  Glutactin precursor               66.6    9e-11  Gene info
gi|52782748|sp|Q96QZ7|MAGI1_HUMAN  Membrane-associated guanyla...  65.1    3e-10  Gene info
gi|23822112|sp|Q9P2E9|RRBP1_HUMAN  Ribosome-binding protein 1 ...  64.7    4e-10  Gene info
gi|8134672|sp|Q05519|SFR11_HUMAN  Splicing factor arginine/ser...  63.9    6e-10  Gene info
gi|81865018|sp|Q792G6|GNAS3_RAT  Neuroendocrine secretory prot...  63.5    8e-10  Gene info
gi|42559826|sp|Q8IWN7|RP1L1_HUMAN  Retinitis pigmentosa 1-like 1   63.5    8e-10  Gene info
gi|81821025|sp|Q5NZS1|IF2_AZOSE  Translation initiation factor IF  62.4    2e-09  Gene info
gi|85540609|sp|Q86TD4|SRCA_HUMAN  Sarcalumenin precursor           62.0    2e-09  Gene info
gi|20981726|sp|Q08170|SFRS4_HUMAN  Splicing factor, arginine/s...  61.6    3e-09  Gene info
gi|586121|sp|P37709|TRHY_RABIT  Trichohyalin                       61.6    3e-09
gi|1706205|sp|P13919|CVCB_PEA  Convicilin precursor                61.2    4e-09
gi|84027766|sp|Q5VTR2|BRE1A_HUMAN  Ubiquitin-protein ligase BR...  60.8    5e-09  Gene info
gi|81820181|sp|Q5LWL4|IF2_SILPO  Translation initiation factor IF  60.5    7e-09
gi|23822106|sp|Q99PL5|RRBP1_MOUSE  Ribosome-binding protein 1 (Ri  60.1    9e-09  Gene info
gi|57015295|sp|P24788|CD2L1_MOUSE  PITSLRE serine/threonine-pr...  60.1    9e-09  Gene info
gi|34978359|sp|P21127|CD2L1_HUMAN  PITSLRE serine/threonine-pr...  60.1    9e-09  Gene info
gi|82583720|sp|O01761|UNC89_CAEEL  Muscle M-line assembly prot...  59.7    1e-08  Gene info
gi|46397733|sp|Q8SX83|SPEN_DROME  Protein split ends               59.7    1e-08  Gene info
gi|82197874|sp|Q5ZLS3|BRE1A_CHICK  Ubiquitin-protein ligase BR...  59.3    1e-08  Gene info
gi|116248091|sp|Q9Z0F1|GNAS3_MOUSE  Neuroendocrine secretory p...  58.9    2e-08  Gene info
gi|76363581|sp|Q5UPJ3|YL116_MIMIV  Uncharacterized protein L116    58.5    3e-08  Gene info
gi|1170022|sp|P08568|GRPA_RAT  Submandibular gland secretory G...  58.5    3e-08  Gene info
gi|90110075|sp|Q9H2D6|TARA_HUMAN  TRIO and F-actin-binding pro...  58.2    3e-08
gi|134091|sp|P09406|RU17_XENLA  U1 small nuclear ribonucleopro...  58.2    3e-08  Gene info
gi|81889252|sp|Q5NCR9|CCD55_MOUSE  Coiled-coil domain-containing   57.4    6e-08  Gene info
gi|121629|sp|P08462|GRPB_RAT  Submandibular gland secretory Gl...  57.4    6e-08  Gene info
gi|6686051|sp|O00294|TULP1_HUMAN  Tubby-related protein 1 (Tubby-  57.4    6e-08  Gene info
gi|1709261|sp|P54938|NFM_RABIT  Neurofilament triplet M protei...  57.4    6e-08
gi|110287981|sp|Q5HZG4|TAF3_MOUSE  Transcription initiation fa...  57.0    7e-08  Gene info
gi|1705706|sp|P54282|CAC1A_RAT  Voltage-dependent P/Q-type cal...  57.0    7e-08  Gene info
gi|24212083|sp|Q9PU36|PCLO_CHICK  Protein piccolo (Aczonin)        57.0    7e-08  Gene info
gi|109819857|sp|Q568R1|CCD55_BRARE  Coiled-coil domain-containing  56.6    1e-07  Gene info
gi|94707710|sp|Q3SX41|CROP_BOVIN  Cisplatin resistance-associated  56.6    1e-07  Gene info
gi|62899846|sp|Q69ZA1|CD2L5_MOUSE  Cell division cycle 2-like ...  56.6    1e-07  Gene info
gi|82083007|sp|Q5ZMJ9|SRRM1_CHICK  Serine/arginine repetitive mat  56.6    1e-07  Gene info
gi|1708493|sp|P53352|INCE_CHICK  Inner centromere protein          56.6    1e-07  Gene info
gi|75041640|sp|Q5R8W6|CROP_PONPY  Cisplatin resistance-associa...  56.6    1e-07
gi|74706023|sp|O95467|GNAS3_HUMAN  Neuroendocrine secretory pr...  56.6    1e-07  Gene info
gi|74632637|sp|Q6C1V6|CWC25_YARLI  Pre-mRNA splicing factor CWC25  56.2    1e-07
gi|2498277|sp|Q28092|CYLC2_BOVIN  Cylicin-2 (Cylicin II) (Multipl  56.2    1e-07  Gene info
gi|57012993|sp|O25249|PGBA_HELPY  Plasminogen-binding protein pgb  56.2    1e-07
gi|81862464|sp|Q5SUF2|CROP_MOUSE  Cisplatin resistance-associated  55.8    2e-07  Gene info
gi|66774048|sp|Q14004|CD2L5_HUMAN  Cell division cycle 2-like ...  55.8    2e-07  Geo
gi|47117902|sp|Q92617|K0220_HUMAN  Protein KIAA0220                55.8    2e-07  Gene info
gi|13638469|sp|P17133|RU17_DROME  U1 small nuclear ribonucleop...  55.8    2e-07  Gene info
gi|81824031|sp|Q62KK9|IF2_BURMA  Translation initiation factor IF  55.5    2e-07
gi|81824731|sp|Q63TP8|IF2_BURPS  Translation initiation factor...  55.5    2e-07
gi|50400866|sp|Q6KCD5|NPBL_MOUSE  Nipped-B-like protein (Delangin  55.5    2e-07  Gene info
gi|81903634|sp|Q9CR92|CCD96_MOUSE  Coiled-coil domain-containing   55.1    3e-07  Gene info
gi|81882280|sp|Q52KI8|SRRM1_MOUSE  Serine/arginine repetitive ...  55.1    3e-07  Gene info
gi|34922255|sp|Q9UQ88|CD2L2_HUMAN  PITSLRE serine/threonine-pr...  55.1    3e-07  Gene info
gi|13635663|sp|P08621|RU17_HUMAN  U1 small nuclear ribonucleop...  55.1    3e-07  Gene info
gi|74950752|sp|Q4U9M9|104K_THEAN  104 kDa microneme-rhoptry antig  54.7    4e-07
gi|75041862|sp|Q5RAA7|FIP1_PONPY  Pre-mRNA 3'-end-processing fact  54.7    4e-07
gi|81883542|sp|Q5U317|FIP1_RAT  Pre-mRNA 3'-end-processing factor  54.7    4e-07  Gene info
gi|50400865|sp|Q6KC79|NIPBL_HUMAN  Nipped-B-like protein (Delangi  54.7    4e-07  Gene info
gi|74749365|sp|Q6UN15|FIP1_HUMAN  Pre-mRNA 3'-end-processing f...  54.7    4e-07  Gene info
gi|20141631|sp|P18583|SON_HUMAN  SON protein (SON3) (Negative ...  54.7    4e-07  Gene info
gi|20139953|sp|Q9QX47|SON_MOUSE  SON protein                       54.7    4e-07  Gene info
gi|81881579|sp|Q9D824|FIP1_MOUSE  Pre-mRNA 3'-end-processing fact  54.7    4e-07  Gene info
gi|85542185|sp|Q3SWT4|IWS1_RAT  IWS1 homolog (IWS1-like protein)   54.3    5e-07  Gene info
gi|20978758|sp|Q8VE97|SFRS4_MOUSE  Splicing factor, arginine/seri  54.3    5e-07  Gene info
gi|1709583|sp|Q06084|PARC_TRYBB  Procyclic form-specific polyp...  54.3    5e-07
gi|6686292|sp|P23116|IF3A_MOUSE  Eukaryotic translation initia...  54.3    5e-07  Gene info
gi|93141281|sp|Q9NQS7|INCE_HUMAN  Inner centromere protein         53.9    6e-07
gi|117940094|sp|Q1RMR2|RU17_BOVIN  U1 small nuclear ribonucleo...  53.9    6e-07
gi|17366808|sp|Q9GQN5|ATRX_DROME  Transcriptional regulator AT...  53.9    6e-07  Gene info
gi|12231019|sp|P26358|DNMT1_HUMAN  DNA (cytosine-5)-methyltran...  53.9    6e-07  Gene info
gi|75319077|sp|P93008|RH21_ARATH  DEAD-box ATP-dependent RNA heli  53.5    8e-07  Gene info
gi|82234425|sp|Q66II8|RU17_XENTR  U1 small nuclear ribonucleop...  53.5    8e-07  Gene info
gi|74634333|sp|Q6C8C5|CWC22_YARLI  Pre-mRNA-splicing factor CWC22  53.5    8e-07
gi|39931244|sp|Q7VYR2|IF2_BORPE  Translation initiation factor IF  53.5    8e-07
gi|549681|sp|P35732|YKF4_YEAST  Uncharacterized protein YKL054C    53.5    8e-07  Gene info
gi|84027767|sp|Q5DTM8|BRE1A_MOUSE  Ubiquitin-protein ligase BR...  53.5    8e-07  Gene info
gi|586122|sp|P22793|TRHY_SHEEP  Trichohyalin                       53.5    8e-07
gi|74662716|sp|Q7SBU6|VID21_NEUCR  Chromatin modification-related  53.5    8e-07
gi|20981728|sp|Q13247|SFRS6_HUMAN  Splicing factor, arginine/s...  53.1    1e-06  Gene info
gi|267027|sp|Q01406|SRC8_CHICK  Src substrate protein p85 (p80) (  53.1    1e-06  Gene info
gi|129627|sp|P08469|PAR1_TRYBB  Procyclic form-specific polype...  53.1    1e-06
gi|47117348|sp|Q7M3Y3|TNNI_CHLNI  Troponin I (TnI)                 52.8    1e-06
gi|23822071|sp|Q28298|RRBP1_CANFA  Ribosome-binding protein 1 (18  52.8    1e-06  Gene info
gi|74662807|sp|Q7SH33|PRP5_NEUCR  Pre-mRNA-processing ATP-depende  52.8    1e-06

>gi|730888|sp|Q06666|T2_MOUSE Gene info Octapeptide-repeat protein T2
Length=185

 Score =  100 bits (249),  Expect = 6e-21
 Identities = 69/185 (37%), Positives = 102/185 (55%), Gaps = 14/185 (7%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            E +R RES+R+  R    Q+E  R RE++R+ GR R  +++  R    QRG    RE QR
Sbjct  10   ESQRVRESERQRGREAERQRERQRGREAERQRGRERGREAE--REAERQRG----RERQR  63

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
               G +E QR  ER +E +R   R RE++R+  R RE++R+ G + E E +R R  QRE 
Sbjct  64   -GRGEAERQRGRERGREVERH-RRGREAERQRGREREAERQRGREAEREAERQRERQRER  121

Query  219  EKASRSPQEPENPQRARESQREPERARESQR-EPERARESQREPEGPKRARERQREPKSQ  43
            ++   + +     QR RE++R+  R  E QR E +R RE + E EG  R   ++ E   Q
Sbjct  122  QRGREAER-----QRGREAERQRGREAEKQRGERQRGREVEAEAEGRGRGMRQEAEATEQ  176

Query  42   GEPGR  28
            G+  R
Sbjct  177  GQGQR  181


 Score = 98.2 bits (243),  Expect = 3e-20
 Identities = 66/162 (40%), Positives = 95/162 (58%), Gaps = 5/162 (3%)
 Frame = -1

Query  483  GRTREGQSKPGRTKGSQRGPESARETQREPEGTSESQRNPERAKESQREPERARESQREP  304
            GR RE +S+  R    QRG E+ R+ +R+    +E QR  ER +E++RE ER R  +R+ 
Sbjct  4    GREREAESQRVRESERQRGREAERQRERQRGREAERQRGRERGREAEREAERQRGRERQR  63

Query  303  KRTRESQREPGSQREPEPQRARGTQREPEKASRSPQEPENPQRARESQREPERARESQRE  124
             R  E++R+ G +R  E +R R   RE E+     +E E  QR RE++RE ER RE QRE
Sbjct  64   GR-GEAERQRGRERGREVERHR-RGREAERQRGREREAER-QRGREAEREAERQRERQRE  120

Query  123  PERARESQREPEGPKRARERQRE-PKSQGEPGRAAENQPEPE  1
             +R RE++R+  G +  R+R RE  K +GE  R  E + E E
Sbjct  121  RQRGREAERQ-RGREAERQRGREAEKQRGERQRGREVEAEAE  161


 Score = 72.4 bits (176),  Expect = 2e-12
 Identities = 51/139 (36%), Positives = 77/139 (55%), Gaps = 24/139 (17%)
 Frame = -1

Query  363  ERAKESQREPERARES----------QREPKRTRESQREPG------SQREPEPQRARGT  232
            +R +E + E +R RES          QRE +R RE++R+ G      ++RE E QR R  
Sbjct  2    QRGREREAESQRVRESERQRGREAERQRERQRGREAERQRGRERGREAEREAERQRGRER  61

Query  231  QR-----EPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPK-RAR  70
            QR     E ++     +E E  +R RE++R  +R RE + E +R RE++RE E  + R R
Sbjct  62   QRGRGEAERQRGRERGREVERHRRGREAER--QRGREREAERQRGREAEREAERQRERQR  119

Query  69   ERQREPKSQGEPGRAAENQ  13
            ERQR  +++ + GR AE Q
Sbjct  120  ERQRGREAERQRGREAERQ  138


 Score = 64.3 bits (155),  Expect = 5e-10
 Identities = 53/167 (31%), Positives = 79/167 (47%), Gaps = 35/167 (20%)
 Frame = -2

Query  605  KRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQGEPERAKASQGEPKGARED  426
            +RG E   ESQ    R RES+ +    ++  RE +R RE++ +  R +  + E +     
Sbjct  2    QRGREREAESQ----RVRESERQRGREAERQRERQRGREAERQRGRERGREAEREA----  53

Query  425  QraperpresrrepararETQRGPKRARESQREPERARGSQRGPERARENQGARESQSHR  246
                              E QRG +R R  + E ER RG +RG E  R  +G       R
Sbjct  54   ------------------ERQRGRERQR-GRGEAERQRGRERGREVERHRRG-------R  87

Query  245  EPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQREPER  105
            E E  RG +R+ A  ++  +  +E ER RE QRE +R RE++R+  R
Sbjct  88   EAERQRGRERE-AERQRGREAEREAERQRERQRERQRGREAERQRGR  133


 Score = 62.8 bits (151),  Expect = 1e-09
 Identities = 57/198 (28%), Positives = 89/198 (44%), Gaps = 31/198 (15%)
 Frame = -2

Query  680  TQRDAATEPERAGESQREPERP----GDNKRGPEGTRESQREPGRARESQTEPEATSKSW  513
            +QR   +E +R  E++R+ ER      + +RG E  RE++RE  R R  + +     +  
Sbjct  11   SQRVRESERQRGREAERQRERQRGREAERQRGRERGREAEREAERQRGRERQ---RGRGE  67

Query  512  REPERARESQGEPER-AKASQGEPKGAREDQraperpresrrepararETQRGPKRARES  336
             E +R RE   E ER  +  + E +  RE +                 E QRG +  RE+
Sbjct  68   AERQRGRERGREVERHRRGREAERQRGRERE----------------AERQRGREAEREA  111

Query  335  QREPERARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPE-RAR  159
            +R+ ER R  QRG E  R+     E Q  RE E  RG +      ++  +   E E R R
Sbjct  112  ERQRERQRERQRGREAERQRGREAERQRGREAEKQRGER------QRGREVEAEAEGRGR  165

Query  158  ESQREPERARESQREPER  105
              ++E E   + Q + +R
Sbjct  166  GMRQEAEATEQGQGQRQR  183


 Score = 53.1 bits (126),  Expect = 1e-06
 Identities = 48/151 (31%), Positives = 64/151 (42%), Gaps = 35/151 (23%)
 Frame = -2

Query  365  QRGPKRARESQ--REPERARG----------------SQRGPERARENQGARESQSHREP  240
            QRG +R  ESQ  RE ER RG                 QRG ER RE +   E Q  RE 
Sbjct  2    QRGREREAESQRVRESERQRGREAERQRERQRGREAERQRGRERGREAEREAERQRGRER  61

Query  239  EGPRGSQRKPAGARKSPKTPK-----------------EPERARESQREPERARESQREP  111
            +  RG   +  G  +  +  +                 E +R RE++RE ER RE QRE 
Sbjct  62   QRGRGEAERQRGRERGREVERHRRGREAERQRGREREAERQRGREAEREAERQRERQRER  121

Query  110  ERAresrkgprepgrgresqRARESPGEPQR  18
            +R RE+ +        +  + A +  GE QR
Sbjct  122  QRGREAERQRGREAERQRGREAEKQRGERQR  152


>gi|68052314|sp|Q5T200|ZC313_HUMAN Gene info Zinc finger CCCH domain-containing protein 13
Length=1668

 Score = 96.7 bits (239),  Expect = 8e-20
 Identities = 63/188 (33%), Positives = 94/188 (50%), Gaps = 10/188 (5%)
 Frame = -1

Query  573  ERARESQRE-------PNRTRGHQQELAR-ARESQRKPGRTREGQSKPGRTKGSQRGPES  418
            ER R   RE       P R +G   EL R  R  +R+  R  + + +  R +  +R  E 
Sbjct  628  ERDRRDNRERDQRPSSPIRHQGRNDELERDERREERRVDRVDDRRDERARERDRER--ER  685

Query  417  ARETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRAR  238
             RE +RE E   + +R  ER  E +R  ER RE ++E  R R+  R+   +RE E +R R
Sbjct  686  DRERERERERERDREREKERELERERAREREREREKERDRERDRDRDHDRERERERERDR  745

Query  237  GTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQR  58
              +RE E+  R  +     +R RE +RE ERARE  +E ER R+ + + +G    RE++ 
Sbjct  746  EKEREREREERERERERERERERERERERERARERDKERERQRDWEDKDKGRDDRREKRE  805

Query  57   EPKSQGEP  34
            E +    P
Sbjct  806  EIREDRNP  813


 Score = 95.9 bits (237),  Expect = 1e-19
 Identities = 73/193 (37%), Positives = 99/193 (51%), Gaps = 19/193 (9%)
 Frame = -1

Query  576  PERARESQREPNRTRGHQQELARAR-ESQRKPGRTREGQ-SKPGRTKGSQRGPESARETQ  403
            PER R  +R+ NR +       R   E  R+  R R+ + S P R +G  R  E  R+ +
Sbjct  603  PERDRYPERD-NRDQARDSSFERRHGERDRRDNRERDQRPSSPIRHQG--RNDELERDER  659

Query  402  REPEGTSE-SQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQR  226
            RE         R  ERA+E  RE ER RE +RE +R R+ +RE   +RE E +RAR  +R
Sbjct  660  REERRVDRVDDRRDERARERDRERERDRERERERERERDRERE--KERELERERARERER  717

Query  225  EPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKS  46
            E EK           +R RE  R+ +  RE +RE ER RE +RE E  +R RER+RE + 
Sbjct  718  EREK-----------ERDRERDRDRDHDRERERERERDREKEREREREERERERERERER  766

Query  45   QGEPGRAAENQPE  7
            + E  R  E   E
Sbjct  767  ERERERERERARE  779


 Score = 87.4 bits (215),  Expect = 5e-17
 Identities = 64/191 (33%), Positives = 98/191 (51%), Gaps = 15/191 (7%)
 Frame = -1

Query  573  ERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREP  394
            ERARE  RE  R R  ++E  R R+ +R+  + RE + +  R +  +R  E  RE  R+ 
Sbjct  674  ERARERDRERERDRERERERERERDRERE--KERELERERAREREREREKERDRERDRDR  731

Query  393  EGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEK  214
            +   E +R  ER +E +RE ER  E +RE +R RE +RE    RE E +RAR   +E E+
Sbjct  732  DHDRERERERERDREKERERER-EERERERERERERERE----RERERERARERDKERER  786

Query  213  ASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQGEP  34
                 ++ E+  + R+ +RE    RE  RE    R+   E +  KR R  +  P  +  P
Sbjct  787  ----QRDWEDKDKGRDDRRE---KREEIREDRNPRDGHDERKSKKRYR-NEGSPSPRQSP  838

Query  33   GRAAENQPEPE  1
             R  E+ P+ +
Sbjct  839  KRRREHSPDSD  849


 Score = 70.1 bits (170),  Expect = 8e-12
 Identities = 64/241 (26%), Positives = 97/241 (40%), Gaps = 66/241 (27%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            E ER RE +RE  R R  ++E  R  E +R   R RE + +  R +   R  +  RE +R
Sbjct  682  ERERDRERERERERERDREREKERELERERAREREREREKERDRERDRDRDHDRERERER  741

Query  399  EPEGTSESQRN-PERAKESQREPERARESQREPKRTRESQREPGSQREPEPQ-RARGTQR  226
            E +   E +R   ER +E +RE ER RE +RE +R RE  +E   QR+ E + + R  +R
Sbjct  742  ERDREKEREREREERERERERERERERERERERERARERDKERERQRDWEDKDKGRDDRR  801

Query  225  EPEKASR----------------------SPQEPENPQRARESQREPE------------  148
            E  +  R                      SP   ++P+R RE   + +            
Sbjct  802  EKREEIREDRNPRDGHDERKSKKRYRNEGSPSPRQSPKRRREHSPDSDAYNSGDDKNEKH  861

Query  147  --------------------------RARESQREPERARESQREPEGPKRAR----ERQR  58
                                      R +E  R+PER   S+R  E   + +    ++QR
Sbjct  862  RLLSQVVRPQESRSLSPSHLTEDRQGRWKEEDRKPERKESSRRYEEQELKEKVSSVDKQR  921

Query  57   E  55
            E
Sbjct  922  E  922


 Score = 67.8 bits (164),  Expect = 4e-11
 Identities = 63/209 (30%), Positives = 96/209 (45%), Gaps = 28/209 (13%)
 Frame = -1

Query  576  PERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGS-----QRGPESAR  412
            PE +R   R   R    + E+   R   R   R+     + GR++G      ++G   +R
Sbjct  523  PEESRSYGRNHLREESSRTEI---RNESRNESRSEIRNDRMGRSRGRVPELPEKGSRGSR  579

Query  411  ETQREPEGTSESQRN--------PERAKESQREP-ERARES---QREPKRTRESQREPGS  268
             +Q +   ++ +  +        PER +  +R+  ++AR+S   +R  +R R   RE   
Sbjct  580  GSQIDSHSSNSNYHDSWETRSSYPERDRYPERDNRDQARDSSFERRHGERDRRDNRER-D  638

Query  267  QREPEPQRARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPE  88
            QR   P R +G   E E+  R     E  +  R   R  ERARE  RE ER RE +RE E
Sbjct  639  QRPSSPIRHQGRNDELERDERR----EERRVDRVDDRRDERARERDRERERDRERERERE  694

Query  87   GPKRARERQREPKSQGEPGRAAENQPEPE  1
               R R+R+RE + + E  RA E + E E
Sbjct  695  ---RERDREREKERELERERARERERERE  720


 Score = 62.4 bits (150),  Expect = 2e-09
 Identities = 57/189 (30%), Positives = 86/189 (45%), Gaps = 28/189 (14%)
 Frame = -2

Query  674  RDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERA  495
            R+   E ER  E +RE ER  D +R  E  RE +RE  R RE + E E   +  R+ +  
Sbjct  677  RERDRERERDRERERERERERDREREKE--RELERERAREREREREKERDRERDRDRDHD  734

Query  494  RESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREPERA  315
            RE + E ER +  + E +  RE++                 E +R  +R RE +RE ER 
Sbjct  735  RERERERERDREKERERE--REER-----------------ERERERERERERERERERE  775

Query  314  RGSQRGPERARE------NQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARES  153
            R  +R  ER R+      ++G  + +  RE      + R     RKS K  +  E +   
Sbjct  776  RARERDKERERQRDWEDKDKGRDDRREKREEIREDRNPRDGHDERKSKKRYRN-EGSPSP  834

Query  152  QREPERARE  126
            ++ P+R RE
Sbjct  835  RQSPKRRRE  843


 Score = 61.2 bits (147),  Expect = 4e-09
 Identities = 48/163 (29%), Positives = 67/163 (41%), Gaps = 50/163 (30%)
 Frame = -3

Query  583  ERARESQGEPERAKQNQRPPARAGESQREPEKARENQRGPKQArenqrepertrerqrdp  404
            ERARE   E ER ++ +R   R  + +RE E+  E +R                      
Sbjct  674  ERARERDRERERDRERERERERERDREREKERELERER----------------------  711

Query  403  eRAGGNQREPEKPREGQREPERARESQREPEGAKEDQrepertreperaratESQRDPEG  224
                  +RE E+ +E  RE +R R+  RE E                        R+ E 
Sbjct  712  ----AREREREREKERDRERDRDRDHDRERE------------------------RERER  743

Query  223  ARESQPEPARARKPPKSQREPERARESQREPERARESQREPER  95
             RE + E  R  +  + +RE ER RE +RE ERARE  +E ER
Sbjct  744  DREKEREREREERERERERERERERERERERERARERDKERER  786


 Score = 58.2 bits (139),  Expect = 3e-08
 Identities = 57/203 (28%), Positives = 89/203 (43%), Gaps = 22/203 (10%)
 Frame = -2

Query  701  AKLLDCVTQRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATS  522
            A+  D   +RD   E ER  E  RE E+  + +R     RE +RE  R RE   + +   
Sbjct  676  ARERDRERERDRERERERERERDREREKERELERERAREREREREKERDRERDRDRDHDR  735

Query  521  KSWREPERARESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRAR  342
            +  RE ER RE + E ER +  + E +  RE +                RE +R  +RAR
Sbjct  736  ERERERERDREKEREREREERER-ERERERERE----------------RERERERERAR  778

Query  341  ESQREPERAR---GSQRGPERARE-NQGARESQSHREPEGPRGSQRKPAGARKSPKTPKE  174
            E  +E ER R      +G +  RE  +  RE ++ R+    R S+++      SP   + 
Sbjct  779  ERDKERERQRDWEDKDKGRDDRREKREEIREDRNPRDGHDERKSKKRYRN-EGSPSPRQS  837

Query  173  PERARESQREPERARESQREPER  105
            P+R RE   + +       + E+
Sbjct  838  PKRRREHSPDSDAYNSGDDKNEK  860


 Score = 54.3 bits (129),  Expect = 5e-07
 Identities = 60/227 (26%), Positives = 89/227 (39%), Gaps = 43/227 (18%)
 Frame = -2

Query  677  QRDAATEPERAGESQREPERPGDNKRGPEGTRESQRE---------PGRARESQTEPEAT  525
            +R+ A E ER  E +R+ ER  D     E  RE +R+           R RE + E E  
Sbjct  708  ERERAREREREREKERDRERDRDRDHDRERERERERDREKEREREREERERERERERERE  767

Query  524  SKSWREPERARESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRA  345
             +  RE ERARE   E ER +  + + KG R+D+R         R P    + ++  KR 
Sbjct  768  RERERERERARERDKERERQRDWEDKDKG-RDDRREKREEIREDRNPRDGHDERKSKKRY  826

Query  344  RES-----QREPERARGSQRGPERARENQGARESQSHRE---------------------  243
            R       ++ P+R R  +  P+    N G  +++ HR                      
Sbjct  827  RNEGSPSPRQSPKRRR--EHSPDSDAYNSGDDKNEKHRLLSQVVRPQESRSLSPSHLTED  884

Query  242  -----PEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQR  117
                  E  R  +RK +  R   +  KE   + + QRE     ES R
Sbjct  885  RQGRWKEEDRKPERKESSRRYEEQELKEKVSSVDKQREQTEILESSR  931


 Score = 46.2 bits (108),  Expect = 1e-04
 Identities = 59/219 (26%), Positives = 88/219 (40%), Gaps = 34/219 (15%)
 Frame = -1

Query  573   ERARESQREPNRT-RGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQRE  397
             ++ R S    NR+ R H     R   S       R G  + GR +    G    RE  + 
Sbjct  1185  DQKRSSSLGSNRSNRSHTSGRLR---SPSNDSAHRSGDDQSGRKRVLHSGSRD-REKTKS  1240

Query  396   PEGTSESQRN--------PERAKESQREPERARESQRE-PKRTRESQREPGS--------  268
              E T E +          P R+  S R+  R+  S+R  P+  R+     GS        
Sbjct  1241  LEITGERKSRIDQLKRGEPSRSTSSDRQDSRSHSSRRSSPESDRQVHSRSGSFDSRDRLQ  1300

Query  267   -------QREPEPQRARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERAR  109
                     RE E +R    QRE ++ +     P N  R R  +RE ER R+ +R+ +R R
Sbjct  1301  ERDRYEHDRERERERRDTRQREWDRDA-DKDWPRNRDRDRLRERERERERDKRRDLDRER  1359

Query  108   ESQREPEGPKRARERQRE---PKSQGEPGRAAENQPEPE  1
             E +   +  +R R+R R+     SQ E  +  E + E E
Sbjct  1360  E-RLISDSVERDRDRDRDRTFESSQIESVKRCEAKLEGE  1397


 Score = 43.9 bits (102),  Expect = 6e-04
 Identities = 42/156 (26%), Positives = 74/156 (47%), Gaps = 15/156 (9%)
 Frame = -1

Query  462  SKPGRTKGSQRGPESARETQR-EPEGTSESQ-RNPERAKESQREPERARES--QREPKRT  295
            S P R +   R     RE  R + E TS+S  R  ER ++++ + +R ++S  +RE ++ 
Sbjct  380  SSPQRKQSPPRHRSPMREKGRHDHERTSQSHDRRHERREDTRGKRDREKDSREEREYEQD  439

Query  294  RESQREPGSQREPEPQRARGTQREPEKASRSPQEPENPQRARESQ--REPERARESQREP  121
            + S R+    REP   R R   R+    +R  +E  + +  R+S+  R+  R  +  R+P
Sbjct  440  QSSSRDHRDDREPRDGRDRRDARD----TRDRRELRDSRDMRDSREMRDYSRDTKESRDP  495

Query  120  ERARESQ-----REPEGPKRARERQREPKSQGEPGR  28
              +R ++     R+ EG    R+    P+     GR
Sbjct  496  RDSRSTRDAHDYRDREGRDTHRKEDTYPEESRSYGR  531


 Score = 38.1 bits (87),  Expect = 0.036
 Identities = 31/144 (21%), Positives = 61/144 (42%), Gaps = 5/144 (3%)
 Frame = -1

Query  444  KGSQRGPESARETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQ  265
            K  Q   E   E   + E + E  R+      S R+  ++ + +  PK +  S+++  + 
Sbjct  179  KLEQENMEKREEIIIKKEVSPEVVRSKLSPSPSLRKSSKSPKRKSSPKSSSASKKDRKTS  238

Query  264  REPEP----QRARGTQREPEKASRSPQEPEN-PQRARESQREPERARESQREPERARESQ  100
                P    QR   T +  +K  R+P  P   P+     ++  E+ +   R  E+ R+ +
Sbjct  239  AVSSPLLDQQRNSKTNQSKKKGPRTPSPPPPIPEDIALGKKYKEKYKVKDRIEEKTRDGK  298

Query  99   REPEGPKRARERQREPKSQGEPGR  28
                  +R RE++ +P+S    G+
Sbjct  299  DRGRDFERQREKRDKPRSTSPAGQ  322


>gi|68068009|sp|P49756|RBM25_HUMAN  Probable RNA-binding protein 25 (RNA-binding motif protein 25) 
(RNA-binding region-containing protein 7) (Protein S164)
Length=784

 Score = 90.9 bits (224),  Expect = 5e-18
 Identities = 61/182 (33%), Positives = 97/182 (53%), Gaps = 11/182 (6%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            E ER RE +RE  R R  ++E  R RE +++  R RE      RTK   R  +  R+  R
Sbjct  252  ERERERERERE-RREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDR  310

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            + E +S+  ++  R++E  R+ ER RE +RE +R RE +RE   +RE E +R R  +++ 
Sbjct  311  DRERSSDRNKDRSRSREKSRDREREREREREREREREREREREREREREREREREREKDK  370

Query  219  EKASRSPQEPENPQRARESQ-REPERARESQ------REPERARESQREPEGPKRARERQ  61
            ++     +E    +R  E + RE E A + +      RE ++ RE ++E E   R  ER+
Sbjct  371  KRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIRERKKTREYEKEAE---REEERR  427

Query  60   RE  55
            RE
Sbjct  428  RE  429


 Score = 84.3 bits (207),  Expect = 4e-16
 Identities = 56/174 (32%), Positives = 93/174 (53%), Gaps = 14/174 (8%)
 Frame = -1

Query  522  QELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGTSESQRNPERAKESQ  343
            +E+++ R++ +K     +G+ +  R +  +   E  RE +RE E     +R  ER +E +
Sbjct  220  REISKFRDTHKKL-EEEKGKKEKERQEIEKERRERERERERERE-----RRERERERERE  273

Query  342  REPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEKASRSPQEPENPQRARES  163
            RE E+ +E +RE +R R+  R     R+ + +R R   RE     RS    ++  R+RE 
Sbjct  274  REREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRE-----RSSDRNKDRSRSREK  328

Query  162  QREPERARESQREPERARESQREPEGPKRARERQREPKSQGEPGRAAENQPEPE  1
             R+ ER RE +RE ER RE +RE E   R RER+RE + + E  +  + + + E
Sbjct  329  SRDRERERERERERERERERERERE---REREREREREREREKDKKRDREEDEE  379


 Score = 84.0 bits (206),  Expect = 6e-16
 Identities = 66/236 (27%), Positives = 100/236 (42%), Gaps = 47/236 (19%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            E ER RE ++E  R R  +++  R R  +R   R RE      R + S R  + +R   R
Sbjct  269  EREREREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRS--R  326

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            E     E +R  ER +E +RE ER RE +RE +R RE +RE   +R+ E       +R  
Sbjct  327  EKSRDREREREREREREREREREREREREREREREREREREKDKKRDREEDEEDAYER--  384

Query  219  EKASRSPQEPENPQRAR-----------------ESQREPERARESQRE-----------  124
             K  R  +E E   + R                 E++RE ER RE  +E           
Sbjct  385  RKLERKLREKEAAYQERLKNWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDY  444

Query  123  ---------------PERARESQREPEGPKRARERQREPKSQGEPGRAAENQPEPE  1
                            +R R+ ++E E  +R R+R++E   +      AE  P+P+
Sbjct  445  DDDRDDPKYYRGSALQKRLRDREKEMEADERDRKREKEELEEIRQRLLAEGHPDPD  500


 Score = 78.6 bits (192),  Expect = 2e-14
 Identities = 55/177 (31%), Positives = 87/177 (49%), Gaps = 16/177 (9%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            E +  +E +R+       ++E  R RE +R+  R RE + +  R K  +R  E  RE  R
Sbjct  234  EEKGKKEKERQEIEKERRERERERERERERRE-REREREREREREKEKER--ERERERDR  290

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            + + T E  R  +R +E  R+ +R R S R   R+R  ++    +RE E +R R  +RE 
Sbjct  291  DRDRTKERDR--DRDRERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERER  348

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPK  49
            E+           +R RE +RE ER RE +++ +R RE   E    +R  ER+   K
Sbjct  349  ER-----------EREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREK  394


 Score = 76.3 bits (186),  Expect = 1e-13
 Identities = 53/194 (27%), Positives = 91/194 (46%), Gaps = 13/194 (6%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            E +   + +RE  R R  ++E  R RE +R+  R RE + +  R +   R  +  +E  R
Sbjct  242  ERQEIEKERRERERERERERE-RREREREREREREREKEKERERERERDRDRDRTKERDR  300

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            + +   +  R+ ER+ +  ++  R+RE  R+ +R RE +RE   +RE E +R R  +RE 
Sbjct  301  DRDRERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERER  360

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQ---REPK  49
            E+           +R ++ +R+ E   E   E  +     RE E   + R +    RE K
Sbjct  361  ER---------EREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIRERK  411

Query  48   SQGEPGRAAENQPE  7
               E  + AE + E
Sbjct  412  KTREYEKEAEREEE  425


 Score = 63.2 bits (152),  Expect = 1e-09
 Identities = 52/193 (26%), Positives = 84/193 (43%), Gaps = 22/193 (11%)
 Frame = -2

Query  677  QRDAATEPERAGES-QREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPE  501
            +R+   E ER  E  +RE ER  + +R  E  RE +RE  R R+   E +      R+ +
Sbjct  250  RRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRDRDRERDRD  309

Query  500  RARESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREPE  321
            R RE   +  + ++   E    R                    E +R  +R RE +RE E
Sbjct  310  RDRERSSDRNKDRSRSREKSRDR--------------------ERERERERERERERERE  349

Query  320  RARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQ-RE  144
            R R  +R  ER RE +  ++ +  RE +     +R+    +   K     ER +  + RE
Sbjct  350  REREREREREREREREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIRE  409

Query  143  PERARESQREPER  105
             ++ RE ++E ER
Sbjct  410  RKKTREYEKEAER  422


 Score = 63.2 bits (152),  Expect = 1e-09
 Identities = 61/217 (28%), Positives = 93/217 (42%), Gaps = 56/217 (25%)
 Frame = -3

Query  676  KEMQPRSQKEPERARESQRDpettkegpkepERARESQGEPERAKQNQRPPARAGESQRE  497
            +E +   +KE ER RE +RD    ++  +  ER R+   E +R +  +R   R  +  R 
Sbjct  270  REREREREKEKERERERERD----RDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRS  325

Query  496  PEKARENQRGPKQArenqrepertrerqrdpeRAGGNQREPEKPREGQREPERARESQRE  317
             EK+R+ +R                            +RE E+ RE +RE ER RE +RE
Sbjct  326  REKSRDRER----------------------------ERERERERERERERERERERERE  357

Query  316  PEGAKEDQrepertreperaratESQRDPEGARESQPEPA-RARKPPKSQREPERARESQ  140
             E  +E                 E ++D +  RE   E A   RK  +  RE E A + +
Sbjct  358  RERERE----------------REREKDKKRDREEDEEDAYERRKLERKLREKEAAYQER  401

Query  139  ------REPERARESQREPER-AGRAQESQGEAERAK  50
                  RE ++ RE ++E ER   R +E   EA+R K
Sbjct  402  LKNWEIRERKKTREYEKEAEREEERRREMAKEAKRLK  438


 Score = 59.3 bits (142),  Expect = 1e-08
 Identities = 58/251 (23%), Positives = 92/251 (36%), Gaps = 61/251 (24%)
 Frame = -1

Query  573  ERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQ------------R  430
            ER RE +RE  R R  ++E  R RE +R+  R RE   K  R +  +            R
Sbjct  333  EREREREREREREREREREREREREREREREREREKDKKRDREEDEEDAYERRKLERKLR  392

Query  429  GPESARETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEP  250
              E+A + + +     E ++  E  KE++RE ER RE  +E KR +E   +    R+ +P
Sbjct  393  EKEAAYQERLKNWEIRERKKTREYEKEAEREEERRREMAKEAKRLKEFLEDYDDDRD-DP  451

Query  249  QRARGT--------------------QREPEKAS--------------------------  208
            +  RG+                    +RE E+                            
Sbjct  452  KYYRGSALQKRLRDREKEMEADERDRKREKEELEEIRQRLLAEGHPDPDAELQRMEQEAE  511

Query  207  --RSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQGEP  34
              R PQ  + P+   E + + E+  + +   E   E +++P      R     P      
Sbjct  512  RRRQPQIKQEPESEEEEEEKQEKEEKREEPMEEEEEPEQKPCLKPTLRPISSAPSVSSAS  571

Query  33   GRAAENQPEPE  1
            G A  N P  E
Sbjct  572  GNATPNTPGDE  582


 Score = 57.8 bits (138),  Expect = 4e-08
 Identities = 44/144 (30%), Positives = 69/144 (47%), Gaps = 7/144 (4%)
 Frame = -1

Query  411  ETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQRE-PEPQRARG  235
            E +R+      S+      K  + + ++ +E Q   K  RE +RE   +RE  E +R R 
Sbjct  212  EDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERERERERERRERERERE  271

Query  234  TQREPEKASRSPQEPENPQ-RARESQREPERARESQREPERARESQREPEGPK-----RA  73
             +RE EK     +E E  + R R  +R+ +R RE  R+ +R R S R  +  +     R 
Sbjct  272  REREREKEKERERERERDRDRDRTKERDRDRDRERDRDRDRERSSDRNKDRSRSREKSRD  331

Query  72   RERQREPKSQGEPGRAAENQPEPE  1
            RER+RE + + E  R  E + E E
Sbjct  332  RERERERERERERERERERERERE  355


 Score = 52.0 bits (123),  Expect = 2e-06
 Identities = 54/238 (22%), Positives = 93/238 (39%), Gaps = 50/238 (21%)
 Frame = -2

Query  677  QRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPER  498
            +RD   + ER+ +  ++  R  +  R  E  RE +RE  R RE + E E   +  RE ER
Sbjct  305  ERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERERER  364

Query  497  ARESQGEPERAKASQG------------EPKGAREDQraperpresrrepararETQRGP  354
             RE   + +R +  +             E + A +++      RE ++     +E +R  
Sbjct  365  EREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIRERKKTREYEKEAEREE  424

Query  353  KRARESQRE-----------------PERARGSQRGP--------------ERARENQGA  267
            +R RE  +E                 P+  RGS                  +R RE +  
Sbjct  425  ERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSALQKRLRDREKEMEADERDRKREKEEL  484

Query  266  RE------SQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQREP  111
             E      ++ H +P+       + A  R+ P+  +EPE + E + E +   E + EP
Sbjct  485  EEIRQRLLAEGHPDPDAELQRMEQEAERRRQPQIKQEPE-SEEEEEEKQEKEEKREEP  541


 Score = 47.0 bits (110),  Expect = 8e-05
 Identities = 47/198 (23%), Positives = 84/198 (42%), Gaps = 25/198 (12%)
 Frame = -1

Query  561  ESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREP----  394
            E++R     +G  + L R   S+     ++E  S P R K  ++  +  R     P    
Sbjct  140  ETKRRDQMIKGAIEVLIREYSSELN-APSQESDSHP-RKKKKEKKEDIFRRFPVAPLIPY  197

Query  393  -----EGTSESQRNPERAKESQREPERARESQR---EPKRTRESQREPGSQREPEPQRAR  238
                 E  +  +   ++     RE  + R++ +   E K  +E +R+   +   E +R R
Sbjct  198  PLITKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEKERQEIEKERRERERER  257

Query  237  GTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPK---RARE  67
              +RE  +  R        +R RE +RE E+ RE +RE +R R+  +E +  +   R R+
Sbjct  258  ERERERRERER--------EREREREREKEKERERERERDRDRDRTKERDRDRDRERDRD  309

Query  66   RQREPKSQGEPGRAAENQ  13
            R RE  S     R+   +
Sbjct  310  RDRERSSDRNKDRSRSRE  327


 Score = 31.2 bits (69),  Expect = 4.4
 Identities = 23/119 (19%), Positives = 48/119 (40%), Gaps = 10/119 (8%)
 Frame = -1

Query  327  ARESQREPKRTRESQREPGSQREP----------EPQRARGTQREPEKASRSPQEPENPQ  178
            ++ES   P++ ++ ++E   +R P            +     + E +K     +E    +
Sbjct  167  SQESDSHPRKKKKEKKEDIFRRFPVAPLIPYPLITKEDINAIEMEEDKRDLISREISKFR  226

Query  177  RARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQGEPGRAAENQPEPE  1
               +   E +  +E +R+       +RE E  +    R+RE + + E  R  E + E E
Sbjct  227  DTHKKLEEEKGKKEKERQEIEKERRERERERERERERREREREREREREREKEKERERE  285


>gi|37537968|sp|Q8WXA9|SFR12_HUMAN Gene info Splicing factor, arginine/serine-rich 12 (Serine-arginine-rich-splicing 
regulatory protein 86) (SRrp86) (Splicing regulatory 
protein 508) (SRrp508)
Length=508

 Score = 84.7 bits (208),  Expect = 3e-16
 Identities = 49/194 (25%), Positives = 98/194 (50%), Gaps = 13/194 (6%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EPE  + ++R+  R+R H +  +++R S +   R +  QSK  R++   R     ++ +R
Sbjct  178  EPESGKSNERKGGRSRSHTR--SKSRSSSKSHSRRKRSQSKH-RSRSHNRSRSRQKDRRR  234

Query  399  EPEGTSESQRNPERAKESQREP---------ERARESQREPKRTRESQREPGSQREPEPQ  247
                  +  ++ ER K   R           E+ +E +R  ++ RE +RE   +RE E +
Sbjct  235  SKSPHKKRSKSRERRKSRSRSHSRDKRKDTREKIKEKERVKEKDREKEREREKEREKEKE  294

Query  246  RARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARE  67
            R +   R+ E+  +  ++ +   R RE ++E E+ R+ ++E E+ +E +RE +  K   E
Sbjct  295  RGKNKDRDKER-EKDREKDKEKDREREREKEHEKDRDKEKEKEQDKEKEREKDRSKEIDE  353

Query  66   RQREPKSQGEPGRA  25
            ++++ K    P R+
Sbjct  354  KRKKDKKSRTPPRS  367


 Score = 80.1 bits (196),  Expect = 8e-15
 Identities = 51/202 (25%), Positives = 95/202 (47%), Gaps = 19/202 (9%)
 Frame = -1

Query  570  RARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRT-------------KGSQR  430
            +++   R  NR+R  Q++  R++   +K  ++RE +    R+             K  +R
Sbjct  214  QSKHRSRSHNRSRSRQKDRRRSKSPHKKRSKSRERRKSRSRSHSRDKRKDTREKIKEKER  273

Query  429  GPESARETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEP  250
              E  RE +RE E   E ++   + K+  +E E+ RE  +E  R RE ++E    R+ E 
Sbjct  274  VKEKDREKEREREKEREKEKERGKNKDRDKEREKDREKDKEKDREREREKEHEKDRDKEK  333

Query  249  QRARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRAR  70
            ++ +  ++E EK  RS +  E  ++ ++S+  P     S+R    +RE +R     +R+R
Sbjct  334  EKEQDKEKEREK-DRSKEIDEKRKKDKKSRTPPRSYNASRRSRSSSRERRR-----RRSR  387

Query  69   ERQREPKSQGEPGRAAENQPEP  4
               R P++     R +   P P
Sbjct  388  SSSRSPRTSKTIKRKSSRSPSP  409


 Score = 73.9 bits (180),  Expect = 6e-13
 Identities = 50/197 (25%), Positives = 94/197 (47%), Gaps = 30/197 (15%)
 Frame = -1

Query  573  ERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREP  394
            +R++  +R  +R+R H ++    R+  R+  + +E   +  R K  +R  E  +E +R  
Sbjct  241  KRSKSRERRKSRSRSHSRD---KRKDTREKIKEKERVKEKDREKEREREKEREKEKERGK  297

Query  393  EGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRAR--GTQREP  220
                + +R  +R K+ +++ ER RE + E  R +E ++E   ++E E  R++    +R+ 
Sbjct  298  NKDRDKEREKDREKDKEKDREREREKEHEKDRDKEKEKEQDKEKEREKDRSKEIDEKRKK  357

Query  219  EKASRSPQEPENP-------------QRARESQREPERA----RESQREP--------ER  115
            +K SR+P    N              +R+R S R P  +    R+S R P        ++
Sbjct  358  DKKSRTPPRSYNASRRSRSSSRERRRRRSRSSSRSPRTSKTIKRKSSRSPSPRSRNKKDK  417

Query  114  ARESQREPEGPKRARER  64
             RE +R+    +R RER
Sbjct  418  KREKERDHISERRERER  434


 Score = 70.9 bits (172),  Expect = 5e-12
 Identities = 52/189 (27%), Positives = 93/189 (49%), Gaps = 20/189 (10%)
 Frame = -1

Query  513  ARARESQRKPGRTREGQS------KPGRTKGSQR-GPESARETQREPEGTSES--QRNPE  361
            A A+E +    R RE QS      +P   K ++R G  S   T+ +   +S+S  +R   
Sbjct  154  AAAKELEEVMKRVREAQSFISAAIEPESGKSNERKGGRSRSHTRSKSRSSSKSHSRRKRS  213

Query  360  RAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEKASRSPQEPENP  181
            ++K   R   R+R  Q++ +R++   ++    RE    R+R   R+  K +R  ++ +  
Sbjct  214  QSKHRSRSHNRSRSRQKDRRRSKSPHKKRSKSRERRKSRSRSHSRDKRKDTR--EKIKEK  271

Query  180  QRARESQREPERARESQREPERAR------ESQREPEGPK---RARERQREPKSQGEPGR  28
            +R +E  RE ER RE +RE E+ R      + +RE +  K   + RER+RE + + +  +
Sbjct  272  ERVKEKDREKEREREKEREKEKERGKNKDRDKEREKDREKDKEKDREREREKEHEKDRDK  331

Query  27   AAENQPEPE  1
              E + + E
Sbjct  332  EKEKEQDKE  340


 Score = 63.5 bits (153),  Expect = 8e-10
 Identities = 49/199 (24%), Positives = 85/199 (42%), Gaps = 30/199 (15%)
 Frame = -1

Query  579  EPERARESQREPNRTRG----HQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESAR  412
            E ER RE +RE  + RG      +E  + RE  ++  R RE + +  + +  ++  E  +
Sbjct  280  EKEREREKEREKEKERGKNKDRDKEREKDREKDKEKDREREREKEHEKDRDKEKEKEQDK  339

Query  411  ETQREPEGTSESQRNPERAKESQREPE------RARESQREPKR--TRESQREPGSQREP  256
            E +RE + + E     ++ K+S+  P       R+R S RE +R  +R S R P      
Sbjct  340  EKEREKDRSKEIDEKRKKDKKSRTPPRSYNASRRSRSSSRERRRRRSRSSSRSP------  393

Query  255  EPQRARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPK-  79
               R   T +     S SP+      + RE +R+    R  +      R+S  + +G + 
Sbjct  394  ---RTSKTIKRKSSRSPSPRSRNKKDKKREKERDHISERRERERSTSMRKSSNDRDGKEK  450

Query  78   --------RARERQREPKS  46
                    + +E  +EP S
Sbjct  451  LEKNSTSLKEKEHNKEPDS  469


 Score = 60.1 bits (144),  Expect = 9e-09
 Identities = 47/194 (24%), Positives = 87/194 (44%), Gaps = 26/194 (13%)
 Frame = -2

Query  683  VTQRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREP  504
            + +++   E +R  E +RE ER  + +RG    R+ +RE  R ++ +          ++ 
Sbjct  268  IKEKERVKEKDREKEREREKEREKEKERGKNKDRDKEREKDREKDKE----------KDR  317

Query  503  ERARESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREP  324
            ER RE + E +R K  + E    +E +              R++E     K+ ++S+  P
Sbjct  318  EREREKEHEKDRDKEKEKEQDKEKERE------------KDRSKEIDEKRKKDKKSRTPP  365

Query  323  ERARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQRE  144
                 S+R    +RE +  R   S R P   +  +RK +    SP++  + ++ RE +R+
Sbjct  366  RSYNASRRSRSSSRERRRRRSRSSSRSPRTSKTIKRK-SSRSPSPRSRNKKDKKREKERD  424

Query  143  PERARESQREPERA  102
                R   RE ER+
Sbjct  425  HISER---RERERS  435


 Score = 54.7 bits (130),  Expect = 4e-07
 Identities = 53/196 (27%), Positives = 86/196 (43%), Gaps = 11/196 (5%)
 Frame = -2

Query  683  VTQRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREP  504
            +T + AA E E   +  RE +        PE  + ++R+ GR+R S T  ++ S S    
Sbjct  150  MTPQAAAKELEEVMKRVREAQSFISAAIEPESGKSNERKGGRSR-SHTRSKSRSSSKSHS  208

Query  503  ERARESQGEPERA-KASQGEPKGAREDQraperpresrrepararETQRGPKR--ARESQ  333
             R R       R+   S+   K  R  +   ++  +SR        +    KR   RE  
Sbjct  209  RRKRSQSKHRSRSHNRSRSRQKDRRRSKSPHKKRSKSRERRKSRSRSHSRDKRKDTREKI  268

Query  332  REPERARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARES  153
            +E ER +   R  ER RE +  RE +  R     R  +R+     K  +  KE +R RE 
Sbjct  269  KEKERVKEKDREKEREREKE--REKEKERGKNKDRDKERE-----KDREKDKEKDRERER  321

Query  152  QREPERARESQREPER  105
            ++E E+ R+ ++E E+
Sbjct  322  EKEHEKDRDKEKEKEQ  337


>gi|37537951|sp|Q8BZX4|SFR12_MOUSE Gene info Splicing factor, arginine/serine-rich 12 (Serine-arginine-rich-splicing 
regulatory protein 86) (SRrp86)
Length=494

 Score = 80.1 bits (196),  Expect = 8e-15
 Identities = 47/186 (25%), Positives = 93/186 (50%), Gaps = 15/186 (8%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            EPE  + ++R+  R+R H +  +++R S +   R +  QSK        R     R   R
Sbjct  181  EPESGKSNERKGGRSRSHTR--SKSRSSSKSHSRRKRSQSK-------HRSRSHNRSRSR  231

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKR-TRESQREPGSQREPEPQRARGTQRE  223
            + +       + +R+K  +R   R+R   R+ ++ TRE  +E   ++E E +R R   RE
Sbjct  232  QKDRRRSKSPHKKRSKSRERRKSRSRSRSRDKRKDTREKVKERVKEKEREKEREREKDRE  291

Query  222  PEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQ  43
             +K     +  +N  + RE +++ E+ R+ ++E E+ ++ +RE +  K   E++++ K  
Sbjct  292  KDK-----ERGKNKDKDREKEKDHEKERDKEKEKEQDKDKEREKDRSKETDEKRKKEKKS  346

Query  42   GEPGRA  25
              P R+
Sbjct  347  RTPPRS  352


 Score = 78.6 bits (192),  Expect = 2e-14
 Identities = 46/188 (24%), Positives = 90/188 (47%), Gaps = 12/188 (6%)
 Frame = -1

Query  570  RARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGS-------QRGPESAR  412
            +++   R  NR+R  Q++  R++   +K  ++RE +    R++         ++  E  +
Sbjct  217  QSKHRSRSHNRSRSRQKDRRRSKSPHKKRSKSRERRKSRSRSRSRDKRKDTREKVKERVK  276

Query  411  ETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGT  232
            E +RE E   E  R  ++ +   ++ +R +E   E +R +E ++E    +E E  R++ T
Sbjct  277  EKEREKEREREKDREKDKERGKNKDKDREKEKDHEKERDKEKEKEQDKDKEREKDRSKET  336

Query  231  --QREPEKASRSPQEPENPQRARES---QREPERARESQREPERARESQREPEGPKRARE  67
              +R+ EK SR+P    N  R   S   +R   R+R S R P  ++  +R+       R 
Sbjct  337  DEKRKKEKKSRTPPRSYNASRRSRSTSRERRRRRSRSSSRSPRTSKTVKRKSSRSPSPRG  396

Query  66   RQREPKSQ  43
            R ++ K +
Sbjct  397  RNKKEKKR  404


 Score = 58.5 bits (140),  Expect = 3e-08
 Identities = 49/207 (23%), Positives = 89/207 (42%), Gaps = 31/207 (14%)
 Frame = -2

Query  674  RDAATEPERAGESQREPERPGDNKRG--PEGTRESQREPGRARESQTEPEATSKSWREPE  501
            ++   E ER  E +RE +R  D +RG   +  RE +++  + R+ + E E      RE +
Sbjct  272  KERVKEKEREKEREREKDREKDKERGKNKDKDREKEKDHEKERDKEKEKEQDKDKEREKD  331

Query  500  RARESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREPE  321
            R++E+  + ++ K S+  P+     +             +R+   +R  +R+R S R P 
Sbjct  332  RSKETDEKRKKEKKSRTPPRSYNASR------------RSRSTSRERRRRRSRSSSRSPR  379

Query  320  RARGSQRGPERARENQGARESQSHREPEGPRGSQR----------KPAGAR-------KS  192
             ++  +R   R+   +G  + +  RE E    S R          K +G R       KS
Sbjct  380  TSKTVKRKSSRSPSPRGRNKKEKKREKERDHISDRRERERSTSTKKSSGDRDGKEKVEKS  439

Query  191  PKTPKEPERARESQREPERARESQREP  111
                KE E ++ES     +A + +  P
Sbjct  440  TTPVKEKEHSKESDATVSKAADEKGSP  466


 Score = 52.8 bits (125),  Expect = 1e-06
 Identities = 49/216 (22%), Positives = 97/216 (44%), Gaps = 23/216 (10%)
 Frame = -2

Query  683  VTQRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRAR-ESQTEPEATSKSW--  513
            +T + AA E E   +  RE +        PE  + ++R+ GR+R  ++++  ++SKS   
Sbjct  153  MTPQAAAKELEEVMKRVREAQSFISAAIEPESGKSNERKGGRSRSHTRSKSRSSSKSHSR  212

Query  512  ----------REPERARESQGEPERAKASQGEPKGARE-------DQraperpresrrep  384
                      R   R+R  Q +  R+K+   +   +RE        +   +R     +  
Sbjct  213  RKRSQSKHRSRSHNRSRSRQKDRRRSKSPHKKRSKSRERRKSRSRSRSRDKRKDTREKVK  272

Query  383  ararETQRGPKRARESQREPERARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAG  204
             R +E +R  +R RE  RE ++ RG  +  +R +E    +E    +E E  +  +R+   
Sbjct  273  ERVKEKEREKEREREKDREKDKERGKNKDKDREKEKDHEKERDKEKEKEQDKDKEREKDR  332

Query  203  ARKSPKTPKEPERAR---ESQREPERARESQREPER  105
            ++++ +  K+ +++R    S     R+R + RE  R
Sbjct  333  SKETDEKRKKEKKSRTPPRSYNASRRSRSTSRERRR  368


 Score = 52.8 bits (125),  Expect = 1e-06
 Identities = 37/151 (24%), Positives = 66/151 (43%), Gaps = 16/151 (10%)
 Frame = -1

Query  423  ESARETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRES-----QREPGSQRE  259
            E   +  RE +    +   PE  K ++R+  R+R   R   R+        +R     R 
Sbjct  163  EEVMKRVREAQSFISAAIEPESGKSNERKGGRSRSHTRSKSRSSSKSHSRRKRSQSKHRS  222

Query  258  PEPQRARGTQREPEKASRSPQEPENPQRARESQREPERARESQRE-----PERARESQRE  94
                R+R  Q++  + S+SP +  +  R R   R   R+R+ +++      ER +E +RE
Sbjct  223  RSHNRSRSRQKD-RRRSKSPHKKRSKSRERRKSRSRSRSRDKRKDTREKVKERVKEKERE  281

Query  93   PEGPKRARERQREPKSQGEPGRAAENQPEPE  1
             E     RER+++ +   E G+  +   E E
Sbjct  282  KE-----REREKDREKDKERGKNKDKDREKE  307


>gi|37537914|sp|Q9JKL7|SFR12_RAT Gene info Splicing factor, arginine/serine-rich 12 (Serine-arginine-rich-splicing 
regulatory protein 86) (SRrp86) (SR-related protein 
of 86 kDa)
Length=494

 Score = 79.7 bits (195),  Expect = 1e-14
 Identities = 43/188 (22%), Positives = 92/188 (48%), Gaps = 12/188 (6%)
 Frame = -1

Query  570  RARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESA--------  415
            +++   R  NR+R  Q++ AR++   +K  ++RE +    R++   +  ++         
Sbjct  217  QSKHRSRSHNRSRSRQKDRARSKSPHKKRSKSRERRKSRSRSRSRDKRKDTREKVKERVK  276

Query  414  -RETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRAR  238
             RE ++E E   E +++ ER K   ++ E+ ++ ++E  + +E +++   +RE +  +  
Sbjct  277  EREREKEKEREKEREKDKERGKNKDKDREKEKDHEKERDKEKEKEQDKDKEREKDRSKEA  336

Query  237  GTQREPEKASRSPQEPENPQRARES---QREPERARESQREPERARESQREPEGPKRARE  67
              +R+ EK SR+P    N  R   S   +R   R+R S R P  ++  +R+       R 
Sbjct  337  DEKRKKEKKSRTPPRSYNSSRRSRSASRERRRRRSRSSSRSPRTSKTIKRKSSRSPSPRG  396

Query  66   RQREPKSQ  43
            R ++ K +
Sbjct  397  RNKKEKKR  404


 Score = 73.6 bits (179),  Expect = 8e-13
 Identities = 49/199 (24%), Positives = 96/199 (48%), Gaps = 23/199 (11%)
 Frame = -1

Query  567  ARESQREPNRTRGHQQELARARE------SQRKPGRTR-----------EGQSKPGRTKG  439
            A+E +    R R  Q  ++ A E      ++RK GR+R           +  S+  R++ 
Sbjct  159  AKELEEVMKRVREAQSFISAAIEPESGKSNERKGGRSRSHTRSKSRSSSKSHSRRKRSQS  218

Query  438  SQRGPESARETQREPEGTSESQRNPERAKESQREPERARESQREPKR-TRESQREPGSQR  262
              R     R   R+ +       + +R+K  +R   R+R   R+ ++ TRE  +E   +R
Sbjct  219  KHRSRSHNRSRSRQKDRARSKSPHKKRSKSRERRKSRSRSRSRDKRKDTREKVKERVKER  278

Query  261  EPEPQRARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGP  82
            E E ++ R  +RE +K     +  +N  + RE +++ E+ R+ ++E E+ ++ +RE +  
Sbjct  279  EREKEKEREKEREKDK-----ERGKNKDKDREKEKDHEKERDKEKEKEQDKDKEREKDRS  333

Query  81   KRARERQREPKSQGEPGRA  25
            K A E++++ K    P R+
Sbjct  334  KEADEKRKKEKKSRTPPRS  352


 Score = 73.6 bits (179),  Expect = 8e-13
 Identities = 49/201 (24%), Positives = 93/201 (46%), Gaps = 22/201 (10%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARE---SQRKPGRTREGQSKPGRTKGSQR------G  427
            EPE  + ++R+  R+R H +  +R+     S+RK  +++       R++  Q+       
Sbjct  181  EPESGKSNERKGGRSRSHTRSKSRSSSKSHSRRKRSQSKHRSRSHNRSRSRQKDRARSKS  240

Query  426  PESARETQREPEGTSESQRNPERAKESQRE-PERARESQREPKRTRESQREPGSQREPEP  250
            P   R   RE   +    R+ ++ K+++ +  ER +E +RE ++ RE +RE   +R    
Sbjct  241  PHKKRSKSRERRKSRSRSRSRDKRKDTREKVKERVKEREREKEKEREKEREKDKERGKNK  300

Query  249  QRARGTQREPEKASRSPQEPENPQRARESQREPERARES---------QREPERARESQR  97
             + R  +++ EK     +E E   + ++ +RE +R++E+          R P R+  S R
Sbjct  301  DKDREKEKDHEKERDKEKEKE---QDKDKEREKDRSKEADEKRKKEKKSRTPPRSYNSSR  357

Query  96   EPEGPKRARERQREPKSQGEP  34
                  R R R+R   S   P
Sbjct  358  RSRSASRERRRRRSRSSSRSP  378


 Score = 60.1 bits (144),  Expect = 9e-09
 Identities = 44/193 (22%), Positives = 87/193 (45%), Gaps = 17/193 (8%)
 Frame = -2

Query  674  RDAATEPERAGESQREPERPGDNKRG--PEGTRESQREPGRARESQTEPEATSKSWREPE  501
            ++   E ER  E +RE ER  D +RG   +  RE +++  + R+ + E E      RE +
Sbjct  272  KERVKEREREKEKEREKEREKDKERGKNKDKDREKEKDHEKERDKEKEKEQDKDKEREKD  331

Query  500  RARESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREPE  321
            R++E+  + ++ K S+  P+     +             +R+   +R  +R+R S R P 
Sbjct  332  RSKEADEKRKKEKKSRTPPRSYNSSR------------RSRSASRERRRRRSRSSSRSPR  379

Query  320  RARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREP  141
             ++  +R   R+   +G  + +  RE E    S R+    R+   + K+    R+ + + 
Sbjct  380  TSKTIKRKSSRSPSPRGRNKKEKKREKERDHISDRR---ERERSTSTKKSSSDRDGKEKV  436

Query  140  ERARESQREPERA  102
            E+     +E E +
Sbjct  437  EKTNTPVKEKEHS  449


 Score = 50.1 bits (118),  Expect = 9e-06
 Identities = 35/150 (23%), Positives = 67/150 (44%), Gaps = 12/150 (8%)
 Frame = -1

Query  423  ESARETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRE---SQREPGSQREPE  253
            E   +  RE +    +   PE  K ++R+  R+R   R   R+     S+R+    +   
Sbjct  163  EEVMKRVREAQSFISAAIEPESGKSNERKGGRSRSHTRSKSRSSSKSHSRRKRSQSKHRS  222

Query  252  PQRARGTQREPEKA-SRSPQEPENPQRARESQREPERARESQREP-----ERARESQREP  91
                R   R+ ++A S+SP +  +  R R   R   R+R+ +++      ER +E +RE 
Sbjct  223  RSHNRSRSRQKDRARSKSPHKKRSKSRERRKSRSRSRSRDKRKDTREKVKERVKEREREK  282

Query  90   EGPKRARERQREPKSQGEPGRAAENQPEPE  1
            E   + RE++RE   +    +  + + E +
Sbjct  283  E---KEREKEREKDKERGKNKDKDREKEKD  309


>gi|112674|sp|P13813|110KD_PLAKN  110 kDa antigen (PK110)
Length=296

 Score = 74.3 bits (181),  Expect = 4e-13
 Identities = 58/161 (36%), Positives = 93/161 (57%), Gaps = 24/161 (14%)
 Frame = -1

Query  426  PESARETQR--EPEGTSESQR--NPERAKESQR--EPERARESQR--EPKRTRESQR--E  277
            PE   ETQ   EPE T E+Q+   PE+ +E+Q   EPE+  E+Q+  EP++T E+Q+  E
Sbjct  140  PEQIEETQNTVEPEQTEETQKTVEPEQTEETQNTVEPEQIEETQKTVEPEQTEEAQKTVE  199

Query  276  P----GSQREPEPQRARGTQR--EPEKASRSPQEPENPQRARESQR--EPERARESQR--  127
            P     +Q+  EP++   TQ+  EPE+   + Q+   P++  E+Q+  EPE+  E+Q+  
Sbjct  200  PEQTEETQKTVEPEQTEETQKTVEPEQTEET-QKTVEPEQTEETQKTVEPEQTEETQKTV  258

Query  126  EPERARESQREPEGPKRARERQREPKSQGEPGRAAENQPEP  4
            EPE+  E+Q+  E P++  E Q     + EP +  +N  EP
Sbjct  259  EPEQTEETQKTVE-PEQTEETQN--TVEPEPTQETQNTVEP  296


 Score = 67.8 bits (164),  Expect = 4e-11
 Identities = 55/159 (34%), Positives = 90/159 (56%), Gaps = 24/159 (15%)
 Frame = -1

Query  411  ETQR--EPEGTSESQRN--PERAKESQR--EPERARESQR--EPKRTRESQR--EP----  274
            ETQ+  EPE   E+Q    PE+ +E+Q+  EPE+  E+Q   EP++  E+Q+  EP    
Sbjct  133  ETQKTVEPEQIEETQNTVEPEQTEETQKTVEPEQTEETQNTVEPEQIEETQKTVEPEQTE  192

Query  273  GSQREPEPQRARGTQR--EPEKASRSPQEPENPQRARESQR--EPERARESQR--EPERA  112
             +Q+  EP++   TQ+  EPE+   + Q+   P++  E+Q+  EPE+  E+Q+  EPE+ 
Sbjct  193  EAQKTVEPEQTEETQKTVEPEQTEET-QKTVEPEQTEETQKTVEPEQTEETQKTVEPEQT  251

Query  111  RESQREPEGPKRARERQR--EPKSQGEPGRAAENQPEPE  1
             E+Q+  E P++  E Q+  EP+   E     E +P  E
Sbjct  252  EETQKTVE-PEQTEETQKTVEPEQTEETQNTVEPEPTQE  289


 Score = 65.1 bits (157),  Expect = 3e-10
 Identities = 58/182 (31%), Positives = 96/182 (52%), Gaps = 43/182 (23%)
 Frame = -1

Query  579  EPERARESQR--EPNRTRGHQQELARARESQRKPGRTREGQS--KPGRTKGSQRG--PES  418
            EPE+  E+Q   EP +T   Q+ +        +P +T E Q+  +P + + +Q+   PE 
Sbjct  139  EPEQIEETQNTVEPEQTEETQKTV--------EPEQTEETQNTVEPEQIEETQKTVEPEQ  190

Query  417  ARETQR--EPEGTSESQRN--PERAKESQR--EPERARESQR--EPKRTRESQREPGSQR  262
              E Q+  EPE T E+Q+   PE+ +E+Q+  EPE+  E+Q+  EP++T E      +Q+
Sbjct  191  TEEAQKTVEPEQTEETQKTVEPEQTEETQKTVEPEQTEETQKTVEPEQTEE------TQK  244

Query  261  EPEPQRARGTQREPEKASRSPQEPENPQRARESQR--EPERARESQR--EPERARESQRE  94
              EP++   TQ+  E           P++  E+Q+  EPE+  E+Q   EPE  +E+Q  
Sbjct  245  TVEPEQTEETQKTVE-----------PEQTEETQKTVEPEQTEETQNTVEPEPTQETQNT  293

Query  93   PE  88
             E
Sbjct  294  VE  295


 Score = 59.3 bits (142),  Expect = 1e-08
 Identities = 47/143 (32%), Positives = 80/143 (55%), Gaps = 22/143 (15%)
 Frame = -1

Query  387  TSESQRN--PERAKESQR--EPERARESQR--EPKRTRESQREPGSQREPEPQRARGTQR  226
            T E+Q+   PE+ +E+Q   EPE+  E+Q+  EP++T E+Q         EP++   TQ+
Sbjct  131  TEETQKTVEPEQIEETQNTVEPEQTEETQKTVEPEQTEETQNTV------EPEQIEETQK  184

Query  225  --EPEKASRSPQEPENPQRARESQR--EPERARESQR--EPERARESQREPEGPKRARER  64
              EPE+   + Q+   P++  E+Q+  EPE+  E+Q+  EPE+  E+Q+  E P++  E 
Sbjct  185  TVEPEQTEEA-QKTVEPEQTEETQKTVEPEQTEETQKTVEPEQTEETQKTVE-PEQTEET  242

Query  63   QR--EPKSQGEPGRAAENQPEPE  1
            Q+  EP+   E  +  E +   E
Sbjct  243  QKTVEPEQTEETQKTVEPEQTEE  265


 Score = 57.8 bits (138),  Expect = 4e-08
 Identities = 49/138 (35%), Positives = 78/138 (56%), Gaps = 22/138 (15%)
 Frame = -1

Query  579  EPERARESQR--EPNRTRGHQQ--ELARARESQR--KPGRTREGQS--KPGRTKGSQRG-  427
            EPE+  E+Q   EP +    Q+  E  +  E+Q+  +P +T E Q   +P +T+ +Q+  
Sbjct  163  EPEQTEETQNTVEPEQIEETQKTVEPEQTEEAQKTVEPEQTEETQKTVEPEQTEETQKTV  222

Query  426  -PESARETQR--EPEGTSESQRN--PERAKESQR--EPERARESQR--EPKRTRESQREP  274
             PE   ETQ+  EPE T E+Q+   PE+ +E+Q+  EPE+  E+Q+  EP++T E+Q   
Sbjct  223  EPEQTEETQKTVEPEQTEETQKTVEPEQTEETQKTVEPEQTEETQKTVEPEQTEETQ---  279

Query  273  GSQREPEPQRARGTQREP  220
             +  EPEP +      EP
Sbjct  280  -NTVEPEPTQETQNTVEP  296


 Score = 52.8 bits (125),  Expect = 1e-06
 Identities = 43/139 (30%), Positives = 75/139 (53%), Gaps = 20/139 (14%)
 Frame = -1

Query  381  ESQRNPERAKESQR--EPERARESQR--EPKRTRESQREPGSQREPEPQRARGTQR--EP  220
            E  ++    +E+Q+  EPE+  E+Q   EP++T E+Q+        EP++   TQ   EP
Sbjct  123  EKVKHIVETEETQKTVEPEQIEETQNTVEPEQTEETQKTV------EPEQTEETQNTVEP  176

Query  219  EKASRSPQEPENPQRARESQR--EPERARESQR--EPERARESQREPEGPKRARERQR--  58
            E+   + Q+   P++  E+Q+  EPE+  E+Q+  EPE+  E+Q+  E P++  E Q+  
Sbjct  177  EQIEET-QKTVEPEQTEEAQKTVEPEQTEETQKTVEPEQTEETQKTVE-PEQTEETQKTV  234

Query  57   EPKSQGEPGRAAENQPEPE  1
            EP+   E  +  E +   E
Sbjct  235  EPEQTEETQKTVEPEQTEE  253


 Score = 43.1 bits (100),  Expect = 0.001
 Identities = 47/151 (31%), Positives = 74/151 (49%), Gaps = 36/151 (23%)
 Frame = -2

Query  659  EPERAGESQR--EPERPGDNKR--GPEGTRESQR--EPGRARESQ--TEPEATSKSWR--  510
            EPE+  E+Q   EPE+  + ++   PE T E+Q+  EP +  E+Q   EPE T ++ +  
Sbjct  163  EPEQTEETQNTVEPEQIEETQKTVEPEQTEEAQKTVEPEQTEETQKTVEPEQTEETQKTV  222

Query  509  EPERARESQG--EPERAKASQG--EPKGAREDQraperpresrrepararETQRGPKRAR  342
            EPE+  E+Q   EPE+ + +Q   EP+   E Q+  E                  P++  
Sbjct  223  EPEQTEETQKTVEPEQTEETQKTVEPEQTEETQKTVE------------------PEQTE  264

Query  341  ESQR--EPERARGSQR--GPERARENQGARE  261
            E+Q+  EPE+   +Q    PE  +E Q   E
Sbjct  265  ETQKTVEPEQTEETQNTVEPEPTQETQNTVE  295


 Score = 43.1 bits (100),  Expect = 0.001
 Identities = 34/101 (33%), Positives = 56/101 (55%), Gaps = 14/101 (13%)
 Frame = -2

Query  683  VTQRDAATEPERAGESQR--EPERPGDNKR--GPEGTRESQR--EPGRARESQ--TEPEA  528
            + +     EPE+  E+Q+  EPE+  + ++   PE T E+Q+  EP +  E+Q   EPE 
Sbjct  179  IEETQKTVEPEQTEEAQKTVEPEQTEETQKTVEPEQTEETQKTVEPEQTEETQKTVEPEQ  238

Query  527  TSKSWR--EPERARESQG--EPERAKASQG--EPKGAREDQ  423
            T ++ +  EPE+  E+Q   EPE+ + +Q   EP+   E Q
Sbjct  239  TEETQKTVEPEQTEETQKTVEPEQTEETQKTVEPEQTEETQ  279


>gi|266334|sp|Q01042|IE68_SHV21  Immediate-early protein
Length=407

 Score = 73.6 bits (179),  Expect = 8e-13
 Identities = 47/188 (25%), Positives = 78/188 (41%), Gaps = 6/188 (3%)
 Frame = -1

Query  570  RARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPE  391
            R  + Q + +    HQQ+ A   E QR+     EG+ +  R +  + G     E   E E
Sbjct  38   RKLKPQGDDDINTTHQQQAA-LTEEQRREEVEEEGEERERRGEEEREG-----EGGEEGE  91

Query  390  GTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEKA  211
            G  E++      KE++ E     E + E +   E++ E     E E +     + E E+A
Sbjct  92   GREEAEEEEAEEKEAEEEEAEEAEEEAEEEEAEEAEAEEEEAEEEEAEEEEAEEAEEEEA  151

Query  210  SRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQGEPG  31
              + +E E  +   E++ E E A E++ E E   E   E E  + A E   E + + E  
Sbjct  152  EEAEEEAEEEEAEEEAEEEAEEAEEAEEEAEEEAEEAEEAEEAEEAEEEAEEAEEEAEEA  211

Query  30   RAAENQPE  7
                 + E
Sbjct  212  EEEAEEAE  219


>gi|116242677|sp|P12036|NFH_HUMAN  Neurofilament triplet H protein (200 kDa neurofilament protein) 
(Neurofilament heavy polypeptide) (NF-H)
Length=1026

 Score = 72.0 bits (175),  Expect = 2e-12
 Identities = 47/203 (23%), Positives = 96/203 (47%), Gaps = 17/203 (8%)
 Frame = -1

Query  567  ARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEG  388
            A+E  + P   +  ++  +  +E  + P   +    +  ++    + PE A+   +E   
Sbjct  588  AKEEAKSPAEAKSPEKAKSPVKEEAKSPAEAKSPVKEEAKSPAEVKSPEKAKSPTKEEAK  647

Query  387  TSESQRNPERAKESQRE----PERARESQREPKRTRESQREPGSQREPEPQRARGTQRE-  223
            + E  ++PE+AK  ++E    PE+A+   +   ++ E  + P       P++A+   +E 
Sbjct  648  SPEEAKSPEKAKSPEKEEAKSPEKAKSPVKAEAKSPEKAKSPVKAEAKSPEKAKSPVKEE  707

Query  222  ---PEKASRSP--QEPENPQRA----RESQREPERARESQREPERARESQREPEGPKRAR  70
               PEKA +SP  +E ++P++A    +E  + PE+A+   +E  ++ E  + PE  K   
Sbjct  708  AKSPEKA-KSPVKEEAKSPEKAKSPVKEEAKTPEKAKSPVKEEAKSPEKAKSPEKAKTLD  766

Query  69   ERQREPK--SQGEPGRAAENQPE  7
             +  E K  ++ E    A+  PE
Sbjct  767  VKSPEAKTPAKEEARSPADKFPE  789


 Score = 69.7 bits (169),  Expect = 1e-11
 Identities = 46/214 (21%), Positives = 96/214 (44%), Gaps = 25/214 (11%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRT--KGSQRGPESARET  406
            E  ++ E  + P + +  ++E A++ E  + P +      +  ++  K   + PE A+  
Sbjct  644  EEAKSPEEAKSPEKAKSPEKEEAKSPEKAKSPVKAEAKSPEKAKSPVKAEAKSPEKAKSP  703

Query  405  QREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQR  226
             +E   + E  ++P   KE  + PE+A+   +E  +T E  + P  +    P++A+  ++
Sbjct  704  VKEEAKSPEKAKSP--VKEEAKSPEKAKSPVKEEAKTPEKAKSPVKEEAKSPEKAKSPEK  761

Query  225  -------EPEKASRSPQEPENP---------QRARESQREPERAR----ESQREPERARE  106
                    PE  + + +E  +P            +E  + PE+A+    E  + PE+   
Sbjct  762  AKTLDVKSPEAKTPAKEEARSPADKFPEKAKSPVKEEVKSPEKAKSPLKEDAKAPEKEIP  821

Query  105  SQREPEGPKRARERQREPKSQGEPGRAAENQPEP  4
             + E + P +  E+ +E K + EP + AE +  P
Sbjct  822  KKEEVKSPVKEEEKPQEVKVK-EPPKKAEEEKAP  854


 Score = 67.4 bits (163),  Expect = 5e-11
 Identities = 42/199 (21%), Positives = 93/199 (46%), Gaps = 20/199 (10%)
 Frame = -1

Query  564  RESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGT  385
            +E  + P   +  ++  + A+E  + P   +  + +  ++    + PE A+   +E   +
Sbjct  535  KEEAKSPAEVKSPEKAKSPAKEEAKSPPEAKSPEKEEAKSPAEVKSPEKAKSPAKEEAKS  594

Query  384  SESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEKASR  205
                ++PE+AK   +E  ++    + P   +E  + P   + PE  +A+   +E  K   
Sbjct  595  PAEAKSPEKAKSPVKEEAKSPAEAKSP--VKEEAKSPAEVKSPE--KAKSPTKEEAK---  647

Query  204  SPQEPENPQRARESQRE----PERARE----SQREPERARES-QREPEGPKRA----RER  64
            SP+E ++P++A+  ++E    PE+A+       + PE+A+   + E + P++A    +E 
Sbjct  648  SPEEAKSPEKAKSPEKEEAKSPEKAKSPVKAEAKSPEKAKSPVKAEAKSPEKAKSPVKEE  707

Query  63   QREPKSQGEPGRAAENQPE  7
             + P+    P +     PE
Sbjct  708  AKSPEKAKSPVKEEAKSPE  726


 Score = 67.4 bits (163),  Expect = 5e-11
 Identities = 46/203 (22%), Positives = 95/203 (46%), Gaps = 18/203 (8%)
 Frame = -1

Query  567  ARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEG  388
            A+E  + P   +  ++E A++    + P + +    +  ++    + PE A+   +E   
Sbjct  554  AKEEAKSPPEAKSPEKEEAKSPAEVKSPEKAKSPAKEEAKSPAEAKSPEKAKSPVKEEAK  613

Query  387  TSESQRNP--ERAKESQ--REPERARESQREPKRTRESQREPGSQREPEPQRARGTQ--R  226
            +    ++P  E AK     + PE+A+   +E  ++ E  + P   + PE + A+  +  +
Sbjct  614  SPAEAKSPVKEEAKSPAEVKSPEKAKSPTKEEAKSPEEAKSPEKAKSPEKEEAKSPEKAK  673

Query  225  EPEKA-SRSPQEPENPQRARESQREPERA----RESQREPERA----RESQREPEGPKR-  76
             P KA ++SP++ ++P +A    + PE+A    +E  + PE+A    +E  + PE  K  
Sbjct  674  SPVKAEAKSPEKAKSPVKA--EAKSPEKAKSPVKEEAKSPEKAKSPVKEEAKSPEKAKSP  731

Query  75   ARERQREPKSQGEPGRAAENQPE  7
             +E  + P+    P +     PE
Sbjct  732  VKEEAKTPEKAKSPVKEEAKSPE  754


 Score = 65.9 bits (159),  Expect = 2e-10
 Identities = 42/198 (21%), Positives = 91/198 (45%), Gaps = 22/198 (11%)
 Frame = -1

Query  564  RESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGT  385
            +E  + P   +  ++  + A+E  + P   +  +      K   + P  A+   +E   +
Sbjct  569  KEEAKSPAEVKSPEKAKSPAKEEAKSPAEAKSPEKAKSPVKEEAKSPAEAKSPVKEEAKS  628

Query  384  SESQRNPERAK----------ESQREPERARESQREPKRTRESQREPGSQREPEPQRARG  235
                ++PE+AK          E  + PE+A+  ++E  ++ E  + P       P++A  
Sbjct  629  PAEVKSPEKAKSPTKEEAKSPEEAKSPEKAKSPEKEEAKSPEKAKSPVKAEAKSPEKA--  686

Query  234  TQREPEKA-SRSPQEPENPQRARESQREPERA----RESQREPERARES-QREPEGPKRA  73
              + P KA ++SP++ ++P   +E  + PE+A    +E  + PE+A+   + E + P++A
Sbjct  687  --KSPVKAEAKSPEKAKSP--VKEEAKSPEKAKSPVKEEAKSPEKAKSPVKEEAKTPEKA  742

Query  72   RERQREPKSQGEPGRAAE  19
            +   +E     E  ++ E
Sbjct  743  KSPVKEEAKSPEKAKSPE  760


 Score = 63.9 bits (154),  Expect = 6e-10
 Identities = 38/206 (18%), Positives = 90/206 (43%), Gaps = 15/206 (7%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQEL---ARARESQRKPGRTREGQSKPGRTKGSQRGPESARE  409
            E E   E  + P        E    +  +E  + P   +  + +  ++    + PE A+ 
Sbjct  493  EAEGGEEETKSPPAEEAASPEKEAKSPVKEEAKSPAEAKSPEKEEAKSPAEVKSPEKAKS  552

Query  408  TQREPEGTSESQRNPERAKESQ----REPERARESQREPKRTRESQREPGSQREPEPQRA  241
              +E   +    ++PE+ +       + PE+A+   +E  ++    + P   + P  + A
Sbjct  553  PAKEEAKSPPEAKSPEKEEAKSPAEVKSPEKAKSPAKEEAKSPAEAKSPEKAKSPVKEEA  612

Query  240  RG---TQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQR-EPEGPKRA  73
            +     +   ++ ++SP E ++P++A+   +E  ++ E  + PE+A+  ++ E + P++A
Sbjct  613  KSPAEAKSPVKEEAKSPAEVKSPEKAKSPTKEEAKSPEEAKSPEKAKSPEKEEAKSPEKA  672

Query  72   RE----RQREPKSQGEPGRAAENQPE  7
            +       + P+    P +A    PE
Sbjct  673  KSPVKAEAKSPEKAKSPVKAEAKSPE  698


 Score = 62.4 bits (150),  Expect = 2e-09
 Identities = 45/190 (23%), Positives = 89/190 (46%), Gaps = 22/190 (11%)
 Frame = -1

Query  576  PERAR----ESQREPNRTRGHQQELARARESQRKPGR----TREGQSKPGRTKGSQRGPE  421
            PE+A+    E  + P   +   +E A++    + P +    T+E    P   K  ++   
Sbjct  601  PEKAKSPVKEEAKSPAEAKSPVKEEAKSPAEVKSPEKAKSPTKEEAKSPEEAKSPEKAKS  660

Query  420  SARETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRA  241
              +E  + P    E  ++P +A+   + PE+A+   +   ++ E  + P  +    P++A
Sbjct  661  PEKEEAKSP----EKAKSPVKAE--AKSPEKAKSPVKAEAKSPEKAKSPVKEEAKSPEKA  714

Query  240  RGTQRE----PEKASRSP--QEPENPQRARESQREPERARESQREPERARE-SQREPEGP  82
            +   +E    PEKA +SP  +E + P++A+   +E  ++ E  + PE+A+    + PE  
Sbjct  715  KSPVKEEAKSPEKA-KSPVKEEAKTPEKAKSPVKEEAKSPEKAKSPEKAKTLDVKSPEAK  773

Query  81   KRARERQREP  52
              A+E  R P
Sbjct  774  TPAKEEARSP  783


 Score = 59.7 bits (143),  Expect = 1e-08
 Identities = 38/191 (19%), Positives = 78/191 (40%), Gaps = 24/191 (12%)
 Frame = -1

Query  501  ESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGTSESQRNPERAKESQREPERAR  322
            E + K  +  EG+ + G  +    G E   ++    E  S  +      KE  + P  A+
Sbjct  472  EEEEKEAKEEEGKEEEGGEEEEAEGGEEETKSPPAEEAASPEKEAKSPVKEEAKSPAEAK  531

Query  321  ESQREPKRTRESQREPGSQREPEPQRARGTQ--REPEKA-SRSPQEPENPQRARESQREP  151
              ++E  ++    + P   + P  + A+     + PEK  ++SP E ++P++A+   +E 
Sbjct  532  SPEKEEAKSPAEVKSPEKAKSPAKEEAKSPPEAKSPEKEEAKSPAEVKSPEKAKSPAKEE  591

Query  150  ERARESQREPERAR---------------------ESQREPEGPKRARERQREPKSQGEP  34
             ++    + PE+A+                     +S  E + P++A+   +E     E 
Sbjct  592  AKSPAEAKSPEKAKSPVKEEAKSPAEAKSPVKEEAKSPAEVKSPEKAKSPTKEEAKSPEE  651

Query  33   GRAAENQPEPE  1
             ++ E    PE
Sbjct  652  AKSPEKAKSPE  662


 Score = 54.7 bits (130),  Expect = 4e-07
 Identities = 48/205 (23%), Positives = 94/205 (45%), Gaps = 26/205 (12%)
 Frame = -1

Query  576  PERARE----SQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARE  409
            PE+A+       + P + +   +E A++ E  + P   +E    P + K   +  E A+ 
Sbjct  683  PEKAKSPVKAEAKSPEKAKSPVKEEAKSPEKAKSP--VKEEAKSPEKAKSPVK--EEAKT  738

Query  408  TQREPEGTSESQRNPERAKESQREPERARE-SQREPKRTRESQREPGSQREPEPQRARGT  232
             ++      E  ++PE+AK     PE+A+    + P+    ++ E  S  +  P++A+  
Sbjct  739  PEKAKSPVKEEAKSPEKAK----SPEKAKTLDVKSPEAKTPAKEEARSPADKFPEKAKSP  794

Query  231  QREPEKASRSPQEPENPQRARESQREPER---ARESQREPERARESQRE---PEGPKRAR  70
             +E  K   SP++ ++P   +E  + PE+    +E  + P +  E  +E    E PK+A 
Sbjct  795  VKEEVK---SPEKAKSP--LKEDAKAPEKEIPKKEEVKSPVKEEEKPQEVKVKEPPKKAE  849

Query  69   ERQ--REPKSQGEPGRAAENQPEPE  1
            E +    PK++ +     E  P+ E
Sbjct  850  EEKAPATPKTEEKKDSKKEEAPKKE  874


 Score = 50.8 bits (120),  Expect = 5e-06
 Identities = 35/140 (25%), Positives = 64/140 (45%), Gaps = 11/140 (7%)
 Frame = -1

Query  423  ESARETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQR  244
            +S +ET    E T E+Q   E  +E ++E +   E  +E +   E + E G +    P  
Sbjct  449  KSEKETVIVEEQTEETQVTEEVTEEEEKEAKE--EEGKEEEGGEEEEAEGGEEETKSPPA  506

Query  243  ARGTQREPEKASRSP--QEPENPQRARESQREPERARESQREPERAR-----ESQREPEG  85
                   PEK ++SP  +E ++P  A+  ++E  ++    + PE+A+     E++  PE 
Sbjct  507  EEAAS--PEKEAKSPVKEEAKSPAEAKSPEKEEAKSPAEVKSPEKAKSPAKEEAKSPPEA  564

Query  84   PKRARERQREPKSQGEPGRA  25
                +E  + P     P +A
Sbjct  565  KSPEKEEAKSPAEVKSPEKA  584


 Score = 49.3 bits (116),  Expect = 2e-05
 Identities = 39/197 (19%), Positives = 77/197 (39%), Gaps = 6/197 (3%)
 Frame = -2

Query  674  RDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERA  495
            ++ A  P  A    +E  +     + PE  +   +E  ++ E    PE      +E  ++
Sbjct  609  KEEAKSPAEAKSPVKEEAKSPAEVKSPEKAKSPTKEEAKSPEEAKSPEKAKSPEKEEAKS  668

Query  494  RESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREPERA  315
             E    P +A+A   E   +     A    +        A+  ++     +E  + PE+A
Sbjct  669  PEKAKSPVKAEAKSPEKAKSPVKAEAKSPEKAKSPVKEEAKSPEKAKSPVKEEAKSPEKA  728

Query  314  RGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSP--KTPKEPERARESQREP  141
            +   +   +  E   +   +  + PE  +  ++      KSP  KTP + E    + + P
Sbjct  729  KSPVKEEAKTPEKAKSPVKEEAKSPEKAKSPEKAKTLDVKSPEAKTPAKEEARSPADKFP  788

Query  140  ERA----RESQREPERA  102
            E+A    +E  + PE+A
Sbjct  789  EKAKSPVKEEVKSPEKA  805


 Score = 47.4 bits (111),  Expect = 6e-05
 Identities = 31/149 (20%), Positives = 65/149 (43%), Gaps = 9/149 (6%)
 Frame = -1

Query  423  ESARETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQ-  247
            E   ETQ   E T E ++  +  +  + E     E++   + T+    E  +  E E + 
Sbjct  459  EQTEETQVTEEVTEEEEKEAKEEEGKEEEGGEEEEAEGGEEETKSPPAEEAASPEKEAKS  518

Query  246  ------RARGTQREPEKA-SRSPQEPENPQRARESQREPERARESQREPERAR-ESQREP  91
                  ++    + PEK  ++SP E ++P++A+   +E  ++    + PE+   +S  E 
Sbjct  519  PVKEEAKSPAEAKSPEKEEAKSPAEVKSPEKAKSPAKEEAKSPPEAKSPEKEEAKSPAEV  578

Query  90   EGPKRARERQREPKSQGEPGRAAENQPEP  4
            + P++A+   +E        ++ E    P
Sbjct  579  KSPEKAKSPAKEEAKSPAEAKSPEKAKSP  607


 Score = 47.4 bits (111),  Expect = 6e-05
 Identities = 49/223 (21%), Positives = 96/223 (43%), Gaps = 33/223 (14%)
 Frame = -2

Query  674  RDAATEPERAGESQREPERPGDNKRGPEGTR----ESQREPGRARESQTEPEATSKSWRE  507
            ++ A  P  A   ++E  +     + PE  +    E  + P  A+  + E   +    + 
Sbjct  521  KEEAKSPAEAKSPEKEEAKSPAEVKSPEKAKSPAKEEAKSPPEAKSPEKEEAKSPAEVKS  580

Query  506  PERARESQGE----------PERAKA-------SQGEPKG-AREDQraperpresrrepa  381
            PE+A+    E          PE+AK+       S  E K   +E+ ++P   +   +  +
Sbjct  581  PEKAKSPAKEEAKSPAEAKSPEKAKSPVKEEAKSPAEAKSPVKEEAKSPAEVKSPEKAKS  640

Query  380  rarETQRGPKRARESQREPERARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGA  201
              +E  + P+ A+  ++     +   + PE+A+    A E++S  + + P  ++ K    
Sbjct  641  PTKEEAKSPEEAKSPEKAKSPEKEEAKSPEKAKSPVKA-EAKSPEKAKSPVKAEAKSPEK  699

Query  200  RKSP--KTPKEPERA----RESQREPERA----RESQREPERA  102
             KSP  +  K PE+A    +E  + PE+A    +E  + PE+A
Sbjct  700  AKSPVKEEAKSPEKAKSPVKEEAKSPEKAKSPVKEEAKTPEKA  742


 Score = 47.4 bits (111),  Expect = 6e-05
 Identities = 31/190 (16%), Positives = 86/190 (45%), Gaps = 12/190 (6%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             EP +  E ++ P   +  +++ ++  E+ +K     + + K  +    ++  ES  E ++
Sbjct  843   EPPKKAEEEKAPATPKTEEKKDSKKEEAPKKEAPKPKVEEK--KEPAVEKPKESKVEAKK  900

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
             E     +    PE+   ++ E    +E  +  ++T  +++EP   +  EP       +  
Sbjct  901   EEAEDKKKVPTPEKEAPAKVE---VKEDAKPKEKTEVAKKEPDDAKAKEP------SKPA  951

Query  219   EKASRSPQEPE-NPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQ  43
             EK   +P++ +   ++A++ + +P+   +++ + +   +   +P+  K  +    + K  
Sbjct  952   EKKEAAPEKKDTKEEKAKKPEEKPKTEAKAKEDDKTLSKEPSKPKAEKAEKSSSTDQKDS  1011

Query  42    GEPGRAAENQ  13
               P +A E++
Sbjct  1012  KPPEKATEDK  1021


 Score = 47.0 bits (110),  Expect = 8e-05
 Identities = 38/193 (19%), Positives = 77/193 (39%), Gaps = 33/193 (17%)
 Frame = -2

Query  665  ATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARES  486
            A  PE+A    +E  +     + P   +E  + P   +  +     T +  + PE A+  
Sbjct  598  AKSPEKAKSPVKEEAKSPAEAKSP--VKEEAKSPAEVKSPEKAKSPTKEEAKSPEEAKS-  654

Query  485  QGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREPERARGS  306
               PE+AK+ + E   +                     E  + P +A    + PE+A+  
Sbjct  655  ---PEKAKSPEKEEAKS--------------------PEKAKSPVKA--EAKSPEKAKSP  689

Query  305  QRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTP-----KEPERARESQREP  141
             +   ++ E   +   +  + PE  +   ++ A + +  K+P     K PE+A+   +E 
Sbjct  690  VKAEAKSPEKAKSPVKEEAKSPEKAKSPVKEEAKSPEKAKSPVKEEAKTPEKAKSPVKEE  749

Query  140  ERARESQREPERA  102
             ++ E  + PE+A
Sbjct  750  AKSPEKAKSPEKA  762


>gi|108861895|sp|Q8H0U8|RH42_ARATH Gene info DEAD-box ATP-dependent RNA helicase 42
Length=1166

 Score = 71.6 bits (174),  Expect = 3e-12
 Identities = 48/186 (25%), Positives = 81/186 (43%), Gaps = 12/186 (6%)
 Frame = -1

Query  564  RESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGT  385
            R+  R   R +    E  R ++ ++K  ++ + +    R    +R     +E +R     
Sbjct  27   RDRDRSNERKKDKGSEKRREKDRRKKRVKSSDSEDDYDRDDDEEREKRKEKERERRRRDK  86

Query  384  SESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEKASR  205
               +R  ER K S  E +   E +R+ +R  E +R     RE E  R +  +R+ E+  R
Sbjct  87   DRVKRRSERRKSSDSEDDVEEEDERDKRRVNEKER---GHREHERDRGKDRKRDREREER  143

Query  204  SPQEPENPQRARESQREPERARESQREPERARESQR----EPEGPKRARERQREPKSQGE  37
              +E     R RE  RE       +RE ER +E +R    + E  +R RE++R  +   E
Sbjct  144  KDKE-----REREKDRERREREREEREKERVKERERREREDGERDRREREKERGSRRNRE  198

Query  36   PGRAAE  19
              R+ E
Sbjct  199  RERSRE  204


 Score = 70.9 bits (172),  Expect = 5e-12
 Identities = 52/185 (28%), Positives = 84/185 (45%), Gaps = 15/185 (8%)
 Frame = -1

Query  549  EPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGTSESQR  370
            E ++ R    ++       +K  R R+  ++  + KGS++  E  R  +R     SE   
Sbjct  4    EKSKYRSEDLDVVEEEADLKKSRRDRDRSNERKKDKGSEKRREKDRRKKRVKSSDSEDDY  63

Query  369  N----PERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEKASRS  202
            +     ER K  ++E ER R  +   KR  E ++   S+ + E +  R  +R  EK  R 
Sbjct  64   DRDDDEEREKRKEKERERRRRDKDRVKRRSERRKSSDSEDDVEEEDERDKRRVNEK-ERG  122

Query  201  PQEPENPQ-------RARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQ  43
             +E E  +       R RE +++ ER RE  RE    RE +RE    +R +ER+R  +  
Sbjct  123  HREHERDRGKDRKRDREREERKDKEREREKDRE---RREREREEREKERVKERERRERED  179

Query  42   GEPGR  28
            GE  R
Sbjct  180  GERDR  184


 Score = 70.9 bits (172),  Expect = 5e-12
 Identities = 53/194 (27%), Positives = 89/194 (45%), Gaps = 15/194 (7%)
 Frame = -1

Query  573  ERARESQREPNRTRGHQQELARARESQRKPGRTREGQSK--PGRTKGSQRGPESARETQR  400
            +R + S  E +  R   +E  + +E +R+  R  + + K    R K S    +   E +R
Sbjct  52   KRVKSSDSEDDYDRDDDEEREKRKEKERERRRRDKDRVKRRSERRKSSDSEDDVEEEDER  111

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
            +    +E +R   R  E  R  +R R+ +RE ++ +E +RE   +R    +  R  +R  
Sbjct  112  DKRRVNEKERG-HREHERDRGKDRKRDREREERKDKEREREKDRERREREREEREKERVK  170

Query  219  EKASRSPQEPENPQRARESQREPERARESQREPERARE----------SQREPEGPKRAR  70
            E+  R  ++ E  +R RE +R   R RE +R  E   E           +R  EG +R +
Sbjct  171  ERERREREDGERDRREREKERGSRRNRERERSREVGNEESDDDVKRDLKRRRKEGGER-K  229

Query  69   ERQREPKSQGEPGR  28
            E++RE KS G   R
Sbjct  230  EKERE-KSVGRSSR  242


 Score = 59.3 bits (142),  Expect = 1e-08
 Identities = 50/201 (24%), Positives = 83/201 (41%), Gaps = 19/201 (9%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            + ER RE  RE       ++E  R +E +R   R RE   +  R +  +RG    RE +R
Sbjct  145  DKEREREKDRERREREREEREKERVKERER---REREDGERDRREREKERGSRRNRERER  201

Query  399  EPE-GTSESQRNPER-----------AKESQREPERARESQREPKRTRESQREPGSQREP  256
              E G  ES  + +R            KE +RE    R S+ E    R+S  + G ++E 
Sbjct  202  SREVGNEESDDDVKRDLKRRRKEGGERKEKEREKSVGRSSRHEDSPKRKSVEDNGEKKE-  260

Query  255  EPQRARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKR  76
              ++ R  + E E+  +  +E E  +R  +  +E +R +E      +      EP+  K 
Sbjct  261  --KKTREEELEDEQ-KKLDEEVEKRRRRVQEWQELKRKKEEAESESKGDADGNEPKAGKA  317

Query  75   ARERQREPKSQGEPGRAAENQ  13
                      +G P   +E +
Sbjct  318  WTLEGESDDEEGHPEEKSETE  338


 Score = 58.9 bits (141),  Expect = 2e-08
 Identities = 50/198 (25%), Positives = 88/198 (44%), Gaps = 20/198 (10%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            + +  RE ++E  R R  + +    R S+R+     E   +    +  +R  E  R   R
Sbjct  66   DDDEEREKRKEKERERRRRDKDRVKRRSERRKSSDSEDDVEEEDERDKRRVNEKERG-HR  124

Query  399  EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPG-----SQREPEPQRARG  235
            E E      R  +R +E +++ ER RE  RE +     +RE        +RE E      
Sbjct  125  EHERDRGKDRKRDREREERKDKEREREKDRERREREREEREKERVKERERREREDGERDR  184

Query  234  TQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQRE  55
             +RE E+ SR  +E E   R+RE   E     ES  + +R  + +R+  G ++ +ER++ 
Sbjct  185  REREKERGSRRNRERE---RSREVGNE-----ESDDDVKRDLKRRRKEGGERKEKEREK-  235

Query  54   PKSQGEPGRAAENQPEPE  1
                   GR++ ++  P+
Sbjct  236  -----SVGRSSRHEDSPK  248


 Score = 55.8 bits (133),  Expect = 2e-07
 Identities = 52/181 (28%), Positives = 80/181 (44%), Gaps = 25/181 (13%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            E E  R+ +R   + RGH       RE +R  G+ R    K  R +  ++  E  RE  R
Sbjct  106  EEEDERDKRRVNEKERGH-------REHERDRGKDR----KRDREREERKDKEREREKDR  154

Query  399  EPEGTSESQRNPER-AKESQREPERARESQREPKR-TRESQREPGSQREPEPQRARGTQR  226
            E       +R  ER  +E +R  ER R  + + +R  RE ++E GS+R  E +R+R    
Sbjct  155  E-------RREREREEREKERVKERERREREDGERDRREREKERGSRRNRERERSREVGN  207

Query  225  EPE----KASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQR  58
            E      K     +  E  +R +E +RE    R S+ E    R+S  +    K  + R+ 
Sbjct  208  EESDDDVKRDLKRRRKEGGER-KEKEREKSVGRSSRHEDSPKRKSVEDNGEKKEKKTREE  266

Query  57   E  55
            E
Sbjct  267  E  267


 Score = 55.1 bits (131),  Expect = 3e-07
 Identities = 34/138 (24%), Positives = 60/138 (43%), Gaps = 9/138 (6%)
 Frame = -1

Query  399  EPEGTSESQRNPERAKESQREP--ERARESQREPKRTRESQREPGSQREPEPQRARGTQR  226
            E     +S+R+ +R+ E +++   E+ RE  R  KR + S  E    R+ + +R +  ++
Sbjct  18   EEADLKKSRRDRDRSNERKKDKGSEKRREKDRRKKRVKSSDSEDDYDRDDDEEREKRKEK  77

Query  225  EPEKASRSPQEPENPQRARES-------QREPERARESQREPERARESQREPEGPKRARE  67
            E E+  R     +     R+S       + E ER +    E ER         G  R R+
Sbjct  78   ERERRRRDKDRVKRRSERRKSSDSEDDVEEEDERDKRRVNEKERGHREHERDRGKDRKRD  137

Query  66   RQREPKSQGEPGRAAENQ  13
            R+RE +   E  R  + +
Sbjct  138  REREERKDKEREREKDRE  155


 Score = 39.7 bits (91),  Expect = 0.012
 Identities = 30/152 (19%), Positives = 61/152 (40%), Gaps = 9/152 (5%)
 Frame = -1

Query  579  EPERARESQREPN--------RTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGP  424
            E ER+RE   E +        + R  +    + +E ++  GR+   +  P R      G 
Sbjct  198  ERERSREVGNEESDDDVKRDLKRRRKEGGERKEKEREKSVGRSSRHEDSPKRKSVEDNG-  256

Query  423  ESARETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQR  244
            E   +  RE E   E ++  E  ++ +R  +  +E +R+ +      +      EP+  +
Sbjct  257  EKKEKKTREEELEDEQKKLDEEVEKRRRRVQEWQELKRKKEEAESESKGDADGNEPKAGK  316

Query  243  ARGTQREPEKASRSPQEPENPQRARESQREPE  148
            A   + E +     P+E    +   + + +PE
Sbjct  317  AWTLEGESDDEEGHPEEKSETEMDVDEETKPE  348


 Score = 37.7 bits (86),  Expect = 0.047
 Identities = 47/214 (21%), Positives = 82/214 (38%), Gaps = 24/214 (11%)
 Frame = -2

Query  677  QRDAATEPERAGESQREPERPGDNKRGPEGTRE-------SQREPGRARESQTEPEATSK  519
            +RD   E  +  E +RE +R    +   E  +E        +RE G     + E E  S+
Sbjct  135  KRDREREERKDKEREREKDRERREREREEREKERVKERERREREDGERDRREREKERGSR  194

Query  518  SWREPERARESQGEP---------ERAKASQGEPKGAREDQraperpresrrepararET  366
              RE ER+RE   E          +R +   GE K    ++      R       ++ E 
Sbjct  195  RNRERERSREVGNEESDDDVKRDLKRRRKEGGERKEKEREKSVGRSSRHEDSPKRKSVED  254

Query  365  --QRGPKRARESQREPERARGSQRGPERARENQGARE-----SQSHREPEGPRGSQRKPA  207
              ++  K+ RE + E E+ +  +   +R R  Q  +E      ++  E +G        A
Sbjct  255  NGEKKEKKTREEELEDEQKKLDEEVEKRRRRVQEWQELKRKKEEAESESKGDADGNEPKA  314

Query  206  GARKSPKTPKEPERAR-ESQREPERARESQREPE  108
            G   + +   + E    E + E E   + + +PE
Sbjct  315  GKAWTLEGESDDEEGHPEEKSETEMDVDEETKPE  348


>gi|83288394|sp|Q9JM99|PRG4_MOUSE Gene info Proteoglycan-4 precursor (Lubricin) (Megakaryocyte-stimulating 
factor) (Superficial zone proteoglycan) [Contains: Proteoglycan-4 
C-terminal part]
Length=1054

 Score = 71.6 bits (174),  Expect = 3e-12
 Identities = 57/209 (27%), Positives = 90/209 (43%), Gaps = 23/209 (11%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRK-PGRTREGQSKPGRTKGSQ----RGPESA  415
            EPE     + EP   +       +   +  K PG T   + +P  TK  +    + PES 
Sbjct  389  EPEPTTPKEPEPTTPKEPPPTTKKPEPTTPKEPGPTTPKEPEPTTTKEPEPTTTKEPEST  448

Query  414  RETQREPEGTSESQRNPERAKESQ----REPERARESQ------REPKRTRESQREPGSQ  265
              T++EPE T+  +  P   KE +    +EPE     +      +EP+ T   + EP + 
Sbjct  449  --TRKEPEPTTPKEPEPTTPKEPEPTTLKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTP  506

Query  264  REPEPQRARGTQREPEKASRSPQEPENPQRAR-ESQREPERARESQREPERARES-QREP  91
            +EPEP     T +EPE  +    EP  P+     + +EPE     + EP   +E     P
Sbjct  507  KEPEPT----TPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKKPEPTTPKEPVPTTP  562

Query  90   EGPKRARERQREPKSQGEPGRAAENQPEP  4
            + P+    ++ EP +  EP      +PEP
Sbjct  563  KEPEPTTPKEPEPTTPKEPEPTTRKEPEP  591


 Score = 69.3 bits (168),  Expect = 1e-11
 Identities = 59/206 (28%), Positives = 93/206 (45%), Gaps = 25/206 (12%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQ-RKPGRTREGQSKPGRTKGSQRGPESARE--  409
            EPE    + +EP  T   + E    +E +   P        KP  T   + GP + +E  
Sbjct  373  EPEPT--TPKEPEPTTPKEPEPTTPKEPEPTTPKEPPPTTKKPEPTTPKEPGPTTPKEPE  430

Query  408  --TQREPEGTSESQRNPERAKESQREPERARESQ----REPKRTRESQREPGSQREPEPQ  247
              T +EPE T+  +  PE     + EP   +E +    +EP+ T   + EP + +EPEP 
Sbjct  431  PTTTKEPEPTTTKE--PESTTRKEPEPTTPKEPEPTTPKEPEPTTLKEPEPTTPKEPEPT  488

Query  246  RARGTQREPEKASRSPQEPENPQRARESQ----REPERARESQREPERARESQ-REPEGP  82
                T +EPE  +  P+EPE P   +E +    +EPE     + EP   +E +   P+ P
Sbjct  489  ----TPKEPEPTT--PKEPE-PTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEP  541

Query  81   KRARERQREPKSQGEPGRAAENQPEP  4
            +    ++ EP +  EP      +PEP
Sbjct  542  EPTTPKKPEPTTPKEPVPTTPKEPEP  567


 Score = 68.9 bits (167),  Expect = 2e-11
 Identities = 51/193 (26%), Positives = 85/193 (44%), Gaps = 14/193 (7%)
 Frame = -1

Query  552  REPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGTSESQ  373
            +EP  T   + E    +E +  P  T+E +S   +        E    T +EPE T+  +
Sbjct  419  KEPGPTTPKEPEPTTTKEPE--PTTTKEPESTTRKEPEPTTPKEPEPTTPKEPEPTTLKE  476

Query  372  RNPERAKESQ----REPERARESQREPKRTRESQREPGSQREPEPQRAR----GTQREPE  217
              P   KE +    +EPE    + +EP+ T   + EP + +EPEP   +     T +EPE
Sbjct  477  PEPTTPKEPEPTTPKEPEPT--TPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPE  534

Query  216  KASRSPQEPENPQRAR-ESQREPERARESQREPERARESQ-REPEGPKRARERQREPKSQ  43
              +    EP  P++    + +EP      + EP   +E +   P+ P+    ++ EP + 
Sbjct  535  PTTPKEPEPTTPKKPEPTTPKEPVPTTPKEPEPTTPKEPEPTTPKEPEPTTRKEPEPTTP  594

Query  42   GEPGRAAENQPEP  4
             EP      +PEP
Sbjct  595  KEPEPTTPKEPEP  607


 Score = 58.2 bits (139),  Expect = 3e-08
 Identities = 49/206 (23%), Positives = 88/206 (42%), Gaps = 20/206 (9%)
 Frame = -1

Query  564  RESQREPNRTRGHQQELARARESQR--KPGRTREGQSKPGRTKGSQRGPESAR--ETQRE  397
            ++S     +T   ++  +  + S +  +P  T    S P  TK      + ++     +E
Sbjct  291  KQSSASKKKTTSVKETRSAEKTSDKDVEPTSTTPKNSAPTTTKKPVTTTKESKFLPLPQE  350

Query  396  PEGTSESQ-----RNPERAKESQREPERARESQ----REPKRTRESQREPGSQREPEPQR  244
            PE T+  +     + PE     + EP   +E +    +EP+ T   + EP + +EP P  
Sbjct  351  PEPTTAKEPPPTTKKPEPTTRKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPPPTT  410

Query  243  ARGTQREP-EKASRSPQEPENPQRARESQ----REPERARESQREPERARESQ-REPEGP  82
             +     P E    +P+EPE P   +E +    +EPE     + EP   +E +   P+ P
Sbjct  411  KKPEPTTPKEPGPTTPKEPE-PTTTKEPEPTTTKEPESTTRKEPEPTTPKEPEPTTPKEP  469

Query  81   KRARERQREPKSQGEPGRAAENQPEP  4
            +    ++ EP +  EP      +PEP
Sbjct  470  EPTTLKEPEPTTPKEPEPTTPKEPEP  495


 Score = 57.0 bits (136),  Expect = 7e-08
 Identities = 48/187 (25%), Positives = 78/187 (41%), Gaps = 24/187 (12%)
 Frame = -1

Query  546  PNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGTSESQRN  367
            PN     +  LA  +E+  +   T+E  +   ++  S++   S +ET R  E TS+    
Sbjct  263  PNSETSKEASLASNKETTVE---TKETTATNKQSSASKKKTTSVKET-RSAEKTSDKDVE  318

Query  366  PERAKESQREPERARESQREPKRTR----ESQREPGSQREPEPQRARGTQREPEKASRSP  199
            P         P   ++     K ++      + EP + +EP P     T ++PE  +R  
Sbjct  319  PTSTTPKNSAPTTTKKPVTTTKESKFLPLPQEPEPTTAKEPPP-----TTKKPEPTTRKE  373

Query  198  QEPENPQRARESQREPERARESQREPERARESQREPEGPKRA--RERQREPKSQGEPGRA  25
             EP  P       +EPE    + +EPE     + EP  PK      ++ EP +  EPG  
Sbjct  374  PEPTTP-------KEPEPT--TPKEPEPTTPKEPEPTTPKEPPPTTKKPEPTTPKEPGPT  424

Query  24   AENQPEP  4
               +PEP
Sbjct  425  TPKEPEP  431


 Score = 51.2 bits (121),  Expect = 4e-06
 Identities = 48/221 (21%), Positives = 95/221 (42%), Gaps = 37/221 (16%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARE--SQRKPGRTREGQSKPGRTKGSQRGPESARE-  409
            EPE     + EP   +  +    +  E  + ++P  T   + +P   K  +  P + +E 
Sbjct  500  EPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKKPE--PTTPKEP  557

Query  408  ---TQREPEGTSESQRNPERAKE----SQREPERARESQREPKRTRESQREPGSQREPEP  250
               T +EPE T+  +  P   KE    +++EPE    + +EP+ T   + EP + ++PEP
Sbjct  558  VPTTPKEPEPTTPKEPEPTTPKEPEPTTRKEPEPT--TPKEPEPTTPKEPEPTTPKKPEP  615

Query  249  QR--------------------ARGTQREPEKASRSPQEPENPQRARESQREPERARESQ  130
                                  A   Q +PE+ + + ++ ++ +   + Q+ P +A +  
Sbjct  616  TTTSPKTTTLKATTLAPKVTAPAEEIQNKPEETTPASEDSDDSKTTLKPQK-PTKAPKPT  674

Query  129  REPERARESQREPEGPKRARERQREPKSQGEPGRAAENQPE  7
            ++P +A +     + PK    + R+PK+   P +     PE
Sbjct  675  KKPTKAPKKPTSTKKPK--TPKTRKPKTTPSPLKTTSATPE  713


 Score = 50.4 bits (119),  Expect = 7e-06
 Identities = 46/194 (23%), Positives = 79/194 (40%), Gaps = 13/194 (6%)
 Frame = -2

Query  662  TEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQ  483
            T P+    + ++PE     + GP   +E +    +  E  T  E  S + +EPE     +
Sbjct  401  TTPKEPPPTTKKPEPTTPKEPGPTTPKEPEPTTTKEPEPTTTKEPESTTRKEPEPTTPKE  460

Query  482  GEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREPERARGSQ  303
             EP   K  + EP   +E +    +  E          T + P+    + +EPE     +
Sbjct  461  PEPTTPK--EPEPTTLKEPEPTTPKEPEPTTPKEPEPTTPKEPEPT--TPKEPEPTTPKE  516

Query  302  RGPERARENQGAR----ESQSHREPEGPRGSQRKPAGARKS-PKTPKEPERARESQREPE  138
              P   +E +       E  + +EPE     + +P   ++  P TPKEPE     + EP 
Sbjct  517  PEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKKPEPTTPKEPVPTTPKEPEPTTPKEPEPT  576

Query  137  RARE----SQREPE  108
              +E    +++EPE
Sbjct  577  TPKEPEPTTRKEPE  590


 Score = 38.5 bits (88),  Expect = 0.027
 Identities = 45/193 (23%), Positives = 80/193 (41%), Gaps = 28/193 (14%)
 Frame = -2

Query  659  EPERAGESQREPERPGD----NKRGPEGTRESQREPGRARESQTEPEATSKSWREPERAR  492
            EPE     + EP  P +      + PE T   + EP   +E    PE T++  +EPE   
Sbjct  540  EPEPTTPKKPEPTTPKEPVPTTPKEPEPTTPKEPEPTTPKE----PEPTTR--KEPEPTT  593

Query  491  ESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQREPERAR  312
              + EP   K  + EP   ++ +     P+ +  +          P  A E Q +PE   
Sbjct  594  PKEPEPTTPK--EPEPTTPKKPEPTTTSPKTTTLKATTLAPKVTAP--AEEIQNKPE---  646

Query  311  GSQRGPERARENQGARESQSHREPEGPRGS---QRKPAGARKSPKTPKEPE--RARESQR  147
                  E    ++ + +S++  +P+ P  +    +KP  A K P + K+P+  + R+ + 
Sbjct  647  ------ETTPASEDSDDSKTTLKPQKPTKAPKPTKKPTKAPKKPTSTKKPKTPKTRKPKT  700

Query  146  EPERARESQREPE  108
             P   + +   PE
Sbjct  701  TPSPLKTTSATPE  713


>gi|114152161|sp|Q8BTI8|SRRM2_MOUSE Gene info Serine/arginine repetitive matrix protein 2
Length=2703

 Score = 71.2 bits (173),  Expect = 4e-12
 Identities = 56/198 (28%), Positives = 71/198 (35%), Gaps = 12/198 (6%)
 Frame = -1

Query  576  PERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRG--PESARETQ  403
            P+R   S+    + RG  +   R R   R P      +S+    +G  R   P   R   
Sbjct  534  PQRPGWSRSRNTQRRGRSRSARRGRSHSRSPATRGRSRSRTPARRGRSRSRTPARRRSRS  593

Query  402  REPEGTSESQRNP-ERAKESQREPERARESQREP----KRTRESQREPGSQREPEPQRAR  238
            R P       R P  R +   R P R R   R P     R+R   R  G  R   P R  
Sbjct  594  RTPARRRSRSRTPARRGRSRSRTPTRRRSRTRSPVRRRSRSRSQARRSGRSRSRTPARRS  653

Query  237  GTQREPEKASRSPQEPENPQR--ARESQREP-ERARESQREPERARESQREPEGPKRARE  67
            G  R    A R       P R  AR   R P  R R   R P R R   R     +R R 
Sbjct  654  GRSRSRTPARRGRSRSRTPARRSARSRSRTPARRGRSRSRTPARRRSRSRSL--VRRGRS  711

Query  66   RQREPKSQGEPGRAAENQ  13
              R P+ +G  G ++E +
Sbjct  712  HSRTPQRRGRSGSSSERK  729


 Score = 64.3 bits (155),  Expect = 5e-10
 Identities = 53/181 (29%), Positives = 67/181 (37%), Gaps = 4/181 (2%)
 Frame = -1

Query  570  RARESQREP-NRTRGHQQELARARESQRKPGRTREGQSKPGRT-KGSQRGPESARETQRE  397
            R R   R P  R R   +  AR R   R P R R     P R  +   R P   R   R 
Sbjct  567  RGRSRSRTPARRGRSRSRTPARRRSRSRTPARRRSRSRTPARRGRSRSRTPTRRRSRTRS  626

Query  396  PEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPE  217
            P       R+  R     R    AR S R   RT  ++R     R P  + AR   R P 
Sbjct  627  PVRRRSRSRSQARRSGRSRSRTPARRSGRSRSRT-PARRGRSRSRTPARRSARSRSRTPA  685

Query  216  KASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQGE  37
            +  RS       +R+R S+    R R   R P+R   S    E   ++R  QR  +S   
Sbjct  686  RRGRSRSRTPARRRSR-SRSLVRRGRSHSRTPQRRGRSGSSSERKNKSRTSQRRSRSNSS  744

Query  36   P  34
            P
Sbjct  745  P  745


 Score = 62.4 bits (150),  Expect = 2e-09
 Identities = 62/209 (29%), Positives = 80/209 (38%), Gaps = 39/209 (18%)
 Frame = -1

Query  573  ERARESQREPNRTRGHQQELA----RARESQR--------KPGRTREGQSKPG-------  451
            +R R   R P + RGH +  +    R+R +QR        + GR+R  Q +PG       
Sbjct  488  KRGRSRSRTPTK-RGHSRSRSPQWRRSRSAQRWGKSRSPQRRGRSRSPQ-RPGWSRSRNT  545

Query  450  RTKGSQRGPESARETQREP--EGTSESQRNPERAKESQREPERARESQREPKRTRESQRE  277
            + +G  R     R   R P   G S S+    R +   R P R R   R P R R   R 
Sbjct  546  QRRGRSRSARRGRSHSRSPATRGRSRSRTPARRGRSRSRTPARRRSRSRTPARRRSRSRT  605

Query  276  P---GSQREPEPQRARGTQREP-EKASRSPQEPENPQRARESQREPER------ARESQR  127
            P   G  R   P R R   R P  + SRS  +      AR S R   R       R   R
Sbjct  606  PARRGRSRSRTPTRRRSRTRSPVRRRSRSRSQ------ARRSGRSRSRTPARRSGRSRSR  659

Query  126  EPERARESQREPEGPKRARERQREPKSQG  40
             P R   S+      + AR R R P  +G
Sbjct  660  TPARRGRSRSRTPARRSARSRSRTPARRG  688


 Score = 59.3 bits (142),  Expect = 1e-08
 Identities = 60/202 (29%), Positives = 83/202 (41%), Gaps = 25/202 (12%)
 Frame = -1

Query  576   PERARESQREPNRTR-GHQQELA-RARESQRKPGRTREGQSK----PGRTKGSQRGPESA  415
             PE   +S+  P  +R G   E+  + R  QR    T          P       R   S+
Sbjct  1539  PEVDSKSRHSPRLSRSGSSPEMKDKPRVLQRAQSGTDSSPEHKIPAPRALPRHSRSGSSS  1598

Query  414   RETQREPEGTSESQRNPERAKESQREPERARESQREPK-RTRESQREPGSQREPEPQRAR  238
             +E    PEG+S S+ +PE A +S R   R   S  EPK ++R   R   S+  PE  R  
Sbjct  1599  KERGPSPEGSSSSESSPEHAPKS-RTARRGSRSSIEPKTKSRTPPRRRSSRSSPELTRKA  1657

Query  237   GTQREPEKASRSPQ-EPENPQRARE----SQREP-ERARESQRE-----------PERAR  109
                R    AS SP+     P R R     S  EP E++R S+R              R R
Sbjct  1658  RVSRRSRSASSSPEIRSRTPPRRRRSPSVSSPEPTEKSRSSRRRRSVSSPRTKTTSRRGR  1717

Query  108   ESQREPEGPKRARERQREPKSQ  43
                 +P G +R+R R R  K++
Sbjct  1718  SPSPKPRGLQRSRSRSRREKTR  1739


 Score = 56.2 bits (134),  Expect = 1e-07
 Identities = 53/220 (24%), Positives = 88/220 (40%), Gaps = 31/220 (14%)
 Frame = -1

Query  576   PERARES-----QREPNRTRGHQQELARARESQR-KPGRTREGQSKPGRT----KGSQRG  427
             PER  +S     +R  + +   Q+ LAR    QR + G ++E   KP  +      S   
Sbjct  1459  PERNNKSVTPQRERSGSESSVEQKNLARTSPGQRSRSGSSQELDGKPSASPQERSESDSS  1518

Query  426   PESARETQREPEGTSESQRNPERAKESQREPERAR-----ESQREPKRTRESQREPGSQR  262
             P+S  +T+      S S  +PE   +S+  P  +R     E + +P+  + +Q    S  
Sbjct  1519  PDSKPKTRTPLRQRSHSGSSPEVDSKSRHSPRLSRSGSSPEMKDKPRVLQRAQSGTDSSP  1578

Query  261   EPEPQRARGTQREPEKASRSPQEPENPQRARESQREPERARESQ----------------  130
             E +    R   R     S S +   +P+ +  S+  PE A +S+                
Sbjct  1579  EHKIPAPRALPRHSRSGSSSKERGPSPEGSSSSESSPEHAPKSRTARRGSRSSIEPKTKS  1638

Query  129   REPERARESQREPEGPKRARERQREPKSQGEPGRAAENQP  10
             R P R R S+  PE  ++AR  +R   +   P   +   P
Sbjct  1639  RTPPRRRSSRSSPELTRKARVSRRSRSASSSPEIRSRTPP  1678


 Score = 55.1 bits (131),  Expect = 3e-07
 Identities = 50/208 (24%), Positives = 81/208 (38%), Gaps = 20/208 (9%)
 Frame = -1

Query  570  RARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARE------  409
            R+R   R  +RTR   +  +R+R   R+ GR+R     P R  G  R    AR       
Sbjct  613  RSRTPTRRRSRTRSPVRRRSRSRSQARRSGRSRS--RTPARRSGRSRSRTPARRGRSRSR  670

Query  408  TQREPEGTSESQRNPERAKESQREPERARESQRE-PKRTRESQREPGSQ-REPEPQRARG  235
            T       S S+    R +   R P R R   R   +R R   R P  + R       + 
Sbjct  671  TPARRSARSRSRTPARRGRSRSRTPARRRSRSRSLVRRGRSHSRTPQRRGRSGSSSERKN  730

Query  234  TQREPEKASRSPQEPE------NPQRARESQREPERARESQREPERA----RESQREPEG  85
              R  ++ SRS   PE      + +R+R       +A+  +R    +    ++  + P  
Sbjct  731  KSRTSQRRSRSNSSPEMKKSHVSSRRSRSLSSPRSKAKSLRRSLSGSSPCPKQKSQTPTR  790

Query  84   PKRARERQREPKSQGEPGRAAENQPEPE  1
              R+     + KS+  P ++  N P+P+
Sbjct  791  RSRSGSSPPKQKSKTPPRQSRSNSPQPK  818


 Score = 52.8 bits (125),  Expect = 1e-06
 Identities = 57/195 (29%), Positives = 82/195 (42%), Gaps = 27/195 (13%)
 Frame = -1

Query  573   ERARE-SQREPNRTR------GHQQELARARESQRKPGRTREGQSKPGRTKGSQRGP---  424
             +R+R  S+RE  RT       G  Q  +R R  QR   R+R  + + G +    R P   
Sbjct  1727  QRSRSRSRREKTRTTRRRDRSGSSQSTSRRR--QRSRSRSRVTRRRRGGSGYHSRSPTRQ  1784

Query  423   ESARETQREPEGTSESQRNPERAKESQREP-----ERARESQREPKRTRE-----SQREP  274
             ES+R + R   G S +     +   S+  P      R+R S    +R+R      S+R  
Sbjct  1785  ESSRTSSRRRRGRSRTPLTSRKRSRSRTSPAPWKRSRSRASPATHRRSRSITPLISRRRS  1844

Query  273   GSQREP-EPQRARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQR  97
              S+  P   +R+R   R   + SRS   P + +R+R       R R   R P R R   R
Sbjct  1845  RSRTSPVSRRRSRSVNR---RRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTRRRSRSR  1901

Query  96    EPEGPKRARERQREP  52
              P   +R R R R P
Sbjct  1902  TPPVTRR-RSRSRTP  1915


 Score = 50.4 bits (119),  Expect = 7e-06
 Identities = 66/251 (26%), Positives = 85/251 (33%), Gaps = 51/251 (20%)
 Frame = -2

Query  710  EIPAKLLDCVTQRDAATEPERAGESQREPERPGDN-------------KRGPEGTRESQR  570
            E+PA     V Q D +  P  A  S +EP  P                ++ P+ T     
Sbjct  360  ELPAPTPLLVEQHDDSPRPLAAIPSSQEPVNPSSEASPTRGCSPPKSPEKPPQSTSSESC  419

Query  569  EPGR-----ARESQTEPEATSKSWREPERARESQGEPERAKASQGEPKGAREDQraperp  405
             P       +R + + PE+  K    P   RE    P     S G  K  +     P   
Sbjct  420  PPSPQPTKVSRHASSSPESL-KPTPAPGSRREISSSPTSKNRSHGRAKRDKSHSHTPSHR  478

Query  404  resrreparar-------ETQRGPKRARESQ-------------REPERARGSQRGPER-  288
                R PA  R        T+RG  R+R  Q             R P+R RG  R P+R 
Sbjct  479  AGRSRSPATKRGRSRSRTPTKRGHSRSRSPQWRRSRSAQRWGKSRSPQR-RGRSRSPQRP  537

Query  287  ----ARENQ------GARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPE  138
                +R  Q       AR  +SH      RG  R    AR+     + P R R   R P 
Sbjct  538  GWSRSRNTQRRGRSRSARRGRSHSRSPATRGRSRSRTPARRGRSRSRTPARRRSRSRTPA  597

Query  137  RARESQREPER  105
            R R   R P R
Sbjct  598  RRRSRSRTPAR  608


 Score = 45.8 bits (107),  Expect = 2e-04
 Identities = 52/214 (24%), Positives = 82/214 (38%), Gaps = 34/214 (15%)
 Frame = -1

Query  570  RARESQREPNRTRGHQQELAR-ARESQRKP---GRTREGQSKPGRTKGSQR------GPE  421
            R R   R P R R   + L R  R   R P   GR+     +  +++ SQR       PE
Sbjct  687  RGRSRSRTPARRRSRSRSLVRRGRSHSRTPQRRGRSGSSSERKNKSRTSQRRSRSNSSPE  746

Query  420  ------SARETQR--EPEGTSESQR------NPERAKESQREPERARESQREPKRTRESQ  283
                  S+R ++    P   ++S R      +P   ++SQ    R+R     PK+  ++ 
Sbjct  747  MKKSHVSSRRSRSLSSPRSKAKSLRRSLSGSSPCPKQKSQTPTRRSRSGSSPPKQKSKTP  806

Query  282  REPGSQREPEPQRARGTQREPEKAS--RSPQEPENPQRARESQREPERARESQREPERAR  109
                    P+P+   GT   P   +  ++ +    PQR   S+  P+   +S R P R  
Sbjct  807  PRQSRSNSPQPKVKSGTPPRPGSVTNMQADECTATPQRQSHSESSPDGEVKS-RTPSRQS  865

Query  108  ESQREPEGPKRARERQREPKSQGEPGRAAENQPE  7
             S   P        RQ        P R++  QP+
Sbjct  866  CSGSSPRVKSSTPPRQ-------SPSRSSSPQPK  892


 Score = 45.8 bits (107),  Expect = 2e-04
 Identities = 46/200 (23%), Positives = 70/200 (35%), Gaps = 20/200 (10%)
 Frame = -1

Query  573   ERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREP  394
             E++R S+R  +       E      SQ+         S P      QR P   R +   P
Sbjct  1330  EQSRSSRRSSSELSPEVVEKVGLFSSQKV--------SSPVLETVQQRTPSRERSSSASP  1381

Query  393   EGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPE-PQRARGT-----  232
             E      R P R   S   P   R+    P R   S   PG +  P+ P R R       
Sbjct  1382  ELKDGLPRTPSRRSRSGSSPG-LRDGSGTPSRHSLSGSSPGMKDTPQTPSRGRSECDSSP  1440

Query  231   -----QREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARE  67
                   + P   S SP  PE   ++   QRE   +  S  +   AR S  +      ++E
Sbjct  1441  EPKALPQTPRARSHSPSSPERNNKSVTPQRERSGSESSVEQKNLARTSPGQRSRSGSSQE  1500

Query  66    RQREPKSQGEPGRAAENQPE  7
                +P +  +    +++ P+
Sbjct  1501  LDGKPSASPQERSESDSSPD  1520


 Score = 42.4 bits (98),  Expect = 0.002
 Identities = 45/193 (23%), Positives = 77/193 (39%), Gaps = 22/193 (11%)
 Frame = -2

Query  668   AATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARE-SQTEPEATSKSWREPERAR  492
             + +  E  G+    P+   ++   P+ ++   R P R R  S + PE  SKS   P  +R
Sbjct  1495  SGSSQELDGKPSASPQERSESDSSPD-SKPKTRTPLRQRSHSGSSPEVDSKSRHSPRLSR  1553

Query  491   -----ESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQRE  327
                  E + +P   + +Q     + E +            P       R    ++E    
Sbjct  1554  SGSSPEMKDKPRVLQRAQSGTDSSPEHK---------IPAPRALPRHSRSGSSSKERGPS  1604

Query  326   PERARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQR  147
             PE +  S+  PE A +++ AR  +  R    P+   R P   R S  +P+   +AR S+ 
Sbjct  1605  PEGSSSSESSPEHAPKSRTAR--RGSRSSIEPKTKSRTPPRRRSSRSSPELTRKARVSR-  1661

Query  146   EPERARESQREPE  108
                R+R +   PE
Sbjct  1662  ---RSRSASSSPE  1671


 Score = 40.4 bits (93),  Expect = 0.007
 Identities = 34/166 (20%), Positives = 65/166 (39%), Gaps = 4/166 (2%)
 Frame = -1

Query  501  ESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGTSESQRNPERAKESQREPERAR  322
            + QR+    ++   +P +     R   S+R    + +   + +    R++ S    ER +
Sbjct  152  DPQRRAREAKQIAPEPPKPYSLVRETSSSRSPTPKQKKKKKKKDRGRRSESSSPRRERKK  211

Query  321  ESQREPKRTRESQREPGSQREPEPQRARGTQREPEKASRSPQEPENPQRARESQREPERA  142
             S+++  R+ ES+ +    R P P+  R ++ +  K SRS        ++R + R     
Sbjct  212  SSKKKKHRS-ESESKKRKHRSPTPKSKRKSKDKKRKRSRSTTP---APKSRRAHRSTSAD  267

Query  141  RESQREPERARESQREPEGPKRARERQREPKSQGEPGRAAENQPEP  4
              S  +  R+R      +    A   Q  P + G  G       EP
Sbjct  268  SASSSDTSRSRSRSAAAKIHTTALTGQSPPLASGHQGEGDAPSVEP  313


 Score = 37.7 bits (86),  Expect = 0.047
 Identities = 43/198 (21%), Positives = 70/198 (35%), Gaps = 15/198 (7%)
 Frame = -2

Query  662   TEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQ  483
             + PER  +S         ++   E    ++  PG+   S +  E   K    P+   ES 
Sbjct  1457  SSPERNNKSVTPQRERSGSESSVEQKNLARTSPGQRSRSGSSQELDGKPSASPQERSESD  1516

Query  482   GEPE-----RAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQ----R  330
               P+     R    Q    G+  +  +  R          + E +  P+  + +Q     
Sbjct  1517  SSPDSKPKTRTPLRQRSHSGSSPEVDSKSRHSPRLSRSGSSPEMKDKPRVLQRAQSGTDS  1576

Query  329   EPERARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERA----  162
              PE    + R   R     G+   +    PEG   S+  P  A KS +T +   R+    
Sbjct  1577  SPEHKIPAPRALPR-HSRSGSSSKERGPSPEGSSSSESSPEHAPKS-RTARRGSRSSIEP  1634

Query  161   RESQREPERARESQREPE  108
             +   R P R R S+  PE
Sbjct  1635  KTKSRTPPRRRSSRSSPE  1652


 Score = 36.6 bits (83),  Expect = 0.10
 Identities = 41/166 (24%), Positives = 56/166 (33%), Gaps = 12/166 (7%)
 Frame = -2

Query  575   QREPGRARESQTEPEATSKSWREPER---------ARESQGEPERAKASQGEPKGAREDQ  423
             QR P R R S   PE      R P R          R+  G P R   S   P G ++  
Sbjct  1368  QRTPSRERSSSASPELKDGLPRTPSRRSRSGSSPGLRDGSGTPSRHSLSGSSP-GMKDTP  1426

Query  422   raperpresrrepararETQRGPKRARESQREPERARGSQRGPERARENQGARESQSHRE  243
             + P R R         +   + P+    S   PER   S   P+R R    +   Q +  
Sbjct  1427  QTPSRGRSECDSSPEPKALPQTPRARSHSPSSPERNNKSVT-PQRERSGSESSVEQKNLA  1485

Query  242   PEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQREPER  105
                P    R  +      K    P+   ES   P+ ++   R P R
Sbjct  1486  RTSPGQRSRSGSSQELDGKPSASPQERSESDSSPD-SKPKTRTPLR  1530


 Score = 35.8 bits (81),  Expect = 0.18
 Identities = 37/162 (22%), Positives = 60/162 (37%), Gaps = 31/162 (19%)
 Frame = -1

Query  426  PESARETQREPEGTSESQRNPERAKESQREPERARESQRE------PKRTRESQREPGSQ  265
            P +A  + +EP   S S+ +P R     + PE+  +S         P+ T+ S+    S 
Sbjct  378  PLAAIPSSQEPVNPS-SEASPTRGCSPPKSPEKPPQSTSSESCPPSPQPTKVSRHASSSP  436

Query  264  REPEPQRARGTQREPE-----------KASRSPQEPENP------------QRARESQRE  154
               +P  A G++RE             +A R       P            +R R   R 
Sbjct  437  ESLKPTPAPGSRREISSSPTSKNRSHGRAKRDKSHSHTPSHRAGRSRSPATKRGRSRSRT  496

Query  153  P-ERARESQREPERARESQREPEGPKRARERQREPKSQGEPG  31
            P +R     R P+  R    +  G  R+ +R+   +S   PG
Sbjct  497  PTKRGHSRSRSPQWRRSRSAQRWGKSRSPQRRGRSRSPQRPG  538


 Score = 35.0 bits (79),  Expect = 0.30
 Identities = 43/175 (24%), Positives = 58/175 (33%), Gaps = 17/175 (9%)
 Frame = -1

Query  576   PERARESQREPNRTRGHQQEL--------ARARESQRKPGRTREGQSKPGRTKGSQRGPE  421
             P R R   R P  TR   +          +R+R S     R+R   S   R +   R   
Sbjct  1893  PTRRRSRSRTPPVTRRRSRSRTPPVTRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTSP  1952

Query  420   SARETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREP----GSQREPE  253
               R   R        +R+  R   + R   R+R      KR+R   R P       R   
Sbjct  1953  VTRRRSRSRTSPVTRRRSRSRTPPAIRRRSRSRTPLLPRKRSRS--RSPLAIRRRSRSRT  2010

Query  252   PQRARGTQ---REPEKASRSPQEPENPQRARESQREPERARESQREPERARESQR  97
             P+ ARG +   R P    R      +  R+R +     R     R P  A  S R
Sbjct  2011  PRAARGKRSLTRSPPAIRRRSASGSSSDRSRSATPPATRNHSGSRTPPVALSSSR  2065


 Score = 35.0 bits (79),  Expect = 0.30
 Identities = 31/155 (20%), Positives = 53/155 (34%), Gaps = 16/155 (10%)
 Frame = -1

Query  444   KGSQRGPESARETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQ  265
             +G  + P  A+  +R    +S S  +   +  S      +  S      +  S     S 
Sbjct  2546  EGRPQEPTPAKRKRRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSP  2605

Query  264   REPEPQRARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEG  85
              +P PQ        P+ AS  P++P   +R   S R+P  +    R    +   +R+P  
Sbjct  2606  AKPGPQAL------PKPAS--PKKPPPGERGSRSPRKPIDSLRDSRSLSYSPVERRQPSP  2657

Query  84    PKRARERQREPK--------SQGEPGRAAENQPEP  4
                 R+ Q   +            PG   +  P P
Sbjct  2658  QPSPRDLQSSERVSWRGQRGDSHSPGHKRKETPSP  2692


 Score = 33.5 bits (75),  Expect = 0.88
 Identities = 38/183 (20%), Positives = 58/183 (31%), Gaps = 12/183 (6%)
 Frame = -1

Query  549   EPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGTSESQR  370
             EP  + G QQ    A     K  R+    S    +  S     S+  +       SE   
Sbjct  2462  EPPASTGAQQPSTLAALQPAKERRSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSDSEGSS  2521

Query  369   NPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEKASRSPQEP  190
              P        +PE A +    P    +     G  +EP P  A+  +R    +S S    
Sbjct  2522  LPA-------QPEVALKRVPSPTPVPKEAIREGRPQEPTP--AKRKRRSSSSSSSSSSSS  2572

Query  189   ENPQRARESQREPERARESQREPERARESQREPEGP-KRARERQREPKS--QGEPGRAAE  19
              +   +  S      +  S      +  S   P  P  +A  +   PK    GE G  + 
Sbjct  2573  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPAKPGPQALPKPASPKKPPPGERGSRSP  2632

Query  18    NQP  10
              +P
Sbjct  2633  RKP  2635


 Score = 33.5 bits (75),  Expect = 0.88
 Identities = 34/157 (21%), Positives = 56/157 (35%), Gaps = 20/157 (12%)
 Frame = -1

Query  531   GHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGTSESQRN-PERA  355
             G  QE   A+  +R    +    S    +  S     S+  +      +S S  + P  A
Sbjct  2547  GRPQEPTPAKRKRRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPA  2606

Query  354   KE---------SQREPERARESQREPKRTRESQRE-------PGSQREPEPQRARGTQRE  223
             K          S ++P       R P++  +S R+       P  +R+P PQ +    + 
Sbjct  2607  KPGPQALPKPASPKKPPPGERGSRSPRKPIDSLRDSRSLSYSPVERRQPSPQPSPRDLQS  2666

Query  222   PEKASRSPQ--EPENPQRARESQREPERAR-ESQREP  121
              E+ S   Q  +  +P   R+    P   R  S R P
Sbjct  2667  SERVSWRGQRGDSHSPGHKRKETPSPRSNRHRSSRSP  2703


 Score = 30.8 bits (68),  Expect = 5.7
 Identities = 38/181 (20%), Positives = 57/181 (31%), Gaps = 10/181 (5%)
 Frame = -1

Query  516   LARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREP-EGTSESQ-----RNPERA  355
             L+   +SQ +P +     +      G Q  PE    +   P E + ES        P   
Sbjct  1240  LSALDQSQSQPSKAAGTPAVASCWSGPQVSPEHKELSHSPPRENSFESSLEFKNSGPVSE  1299

Query  354   KESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEKASR----SPQEPE  187
               +   PE   E         E+      + +    R   ++  PE   +    S Q+  
Sbjct  1300  VNTGFSPEVKEELNGSFLNQTEADPSVDMKEQSRSSRRSSSELSPEVVEKVGLFSSQKVS  1359

Query  186   NPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQGEPGRAAENQPE  7
             +P      QR P R R S   PE      R P    R+          G P R + +   
Sbjct  1360  SPVLETVQQRTPSRERSSSASPELKDGLPRTPSRRSRSGSSPGLRDGSGTPSRHSLSGSS  1419

Query  6     P  4
             P
Sbjct  1420  P  1420


>gi|586120|sp|Q07283|TRHY_HUMAN Gene info Trichohyalin
Length=1898

 Score = 70.9 bits (172),  Expect = 5e-12
 Identities = 57/205 (27%), Positives = 89/205 (43%), Gaps = 17/205 (8%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQ------QELARARE--SQRKPGRTREGQSKPGRTKGSQRGP  424
            E E  R  + +    +GH+      +E  R RE    R+ GR  + Q +  R     +  
Sbjct  182  EREERRAEEEQLQSCKGHETEEFPDEEQLRRRELLELRRKGREEKQQQRRERQDRVFQEE  241

Query  423  ESA----RETQREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREP  256
            E      RET    E     +  P+R +E Q E E+ R+ +R+  R    + E   QR  
Sbjct  242  EEKEWRKRETVLRKEEEKLQEEEPQRQRELQEEEEQLRKLERQELRRERQEEEQQQQRLR  301

Query  255  EPQRARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQ--REPEGP  82
              Q+ R   R+ E+  R  QE    Q+ R  Q+E  R ++ +RE E  RE Q  RE E  
Sbjct  302  REQQLR---RKQEEERREQQEERREQQERREQQEERREQQLRREQEERREQQLRREQEEE  358

Query  81   KRARERQREPKSQGEPGRAAENQPE  7
            +R ++ +RE + +    +    Q E
Sbjct  359  RREQQLRREQEEERREQQLRREQEE  383


 Score = 68.6 bits (166),  Expect = 2e-11
 Identities = 51/190 (26%), Positives = 91/190 (47%), Gaps = 5/190 (2%)
 Frame = -1

Query  573  ERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREP  394
            E  +  + EP R R  Q+E  + R+ +R+  R RE Q +  + +  +R  +  R  Q E 
Sbjct  256  EEEKLQEEEPQRQRELQEEEEQLRKLERQELR-RERQEEEQQQQRLRR-EQQLRRKQEEE  313

Query  393  EGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEK  214
                + +R  ++ +  Q+E  R ++ +RE +  RE Q     + E   Q+ R  Q E  +
Sbjct  314  RREQQEERREQQERREQQEERREQQLRREQEERREQQLRREQEEERREQQLRREQEEERR  373

Query  213  ASRSPQEPENPQRARESQREPERARESQ--REPERARESQ-REPEGPKRARERQREPKSQ  43
              +  +E E  +R ++ +RE +  RE Q  RE +  RE Q R  +  +R ++ +RE + +
Sbjct  374  EQQLRREQEEERREQQLRREQQLRREQQLRREQQLRREQQLRREQQLRREQQLRREQQLR  433

Query  42   GEPGRAAENQ  13
             E     E Q
Sbjct  434  REQQLRREQQ  443


 Score = 67.8 bits (164),  Expect = 4e-11
 Identities = 50/196 (25%), Positives = 92/196 (46%), Gaps = 4/196 (2%)
 Frame = -1

Query  579   EPERARESQREPNRTRGH--QQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARET  406
             EPE+ R  +RE         QQE  +    +R+  R +E + +  +    Q+  E     
Sbjct  994   EPEKRRRQEREKKYREEEELQQEEEQLLREEREKRRRQEWERQYRKKDELQQEEEQLLRE  1053

Query  405   QREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQR  226
             +RE     E +R     +E Q+E E+    +RE +R +E +R+   + E + +  +  + 
Sbjct  1054  EREKRRLQERERQYREEEELQQEEEQLLGEERETRRRQELERQYRKEEELQQEEEQLLRE  1113

Query  225   EPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKS  46
             EPEK  R  +E    +   E Q+E E+    +RE  R +E +R+    +  + ++R+ + 
Sbjct  1114  EPEKRRRQERE-RQCREEEELQQEEEQLLREEREKRRRQELERQYREEEELQRQKRKQRY  1172

Query  45    QGEPGRA-AENQPEPE  1
             + E  R+  + Q EPE
Sbjct  1173  RDEDQRSDLKWQWEPE  1188


 Score = 61.6 bits (148),  Expect = 3e-09
 Identities = 45/190 (23%), Positives = 84/190 (44%), Gaps = 4/190 (2%)
 Frame = -1

Query  564  RESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGT  385
            R+ +    R    ++E  RA E Q +  +  E +  P   +  +R     R   RE +  
Sbjct  169  RDEELWRQRQEWQEREERRAEEEQLQSCKGHETEEFPDEEQLRRRELLELRRKGREEKQQ  228

Query  384  SESQRNPERAKESQREPERARESQREPKRTRESQREPGSQRE--PEPQRARGTQREPEKA  211
               +R     +E + +  R RE+    +  +  + EP  QRE   E ++ R  +R+  + 
Sbjct  229  QRRERQDRVFQEEEEKEWRKRETVLRKEEEKLQEEEPQRQRELQEEEEQLRKLERQELRR  288

Query  210  SRSPQEPENPQRARESQ--REPERARESQREPERARESQREPEGPKRARERQREPKSQGE  37
             R  +E +  +  RE Q  R+ E  R  Q+E  R ++ +RE +  +R ++ +RE + + E
Sbjct  289  ERQEEEQQQQRLRREQQLRRKQEEERREQQEERREQQERREQQEERREQQLRREQEERRE  348

Query  36   PGRAAENQPE  7
                 E + E
Sbjct  349  QQLRREQEEE  358


 Score = 60.5 bits (145),  Expect = 7e-09
 Identities = 46/181 (25%), Positives = 87/181 (48%), Gaps = 10/181 (5%)
 Frame = -1

Query  555   QREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGTSES  376
             Q+E  +    ++E  R +E +R+  + ++ Q K  +  G +  PE  R  +RE +   E 
Sbjct  954   QQEEEQLLREEREKRRRQERERQYRKDKKLQQKEEQLLGEE--PEKRRRQEREKKYREEE  1011

Query  375   --QRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEKASRS  202
               Q+  E+    +RE  R +E +R+ ++  E Q+E       E ++ R  +RE +     
Sbjct  1012  ELQQEEEQLLREEREKRRRQEWERQYRKKDELQQEEEQLLREEREKRRLQERERQYREEE  1071

Query  201   PQEPENPQ---RARESQREPERARESQREPERARESQ---REPEGPKRARERQREPKSQG  40
               + E  Q     RE++R  E  R+ ++E E  +E +   RE    +R +ER+R+ + + 
Sbjct  1072  ELQQEEEQLLGEERETRRRQELERQYRKEEELQQEEEQLLREEPEKRRRQERERQCREEE  1131

Query  39    E  37
             E
Sbjct  1132  E  1132


 Score = 59.3 bits (142),  Expect = 1e-08
 Identities = 48/198 (24%), Positives = 91/198 (45%), Gaps = 8/198 (4%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             E  R +E +R+  + +  QQ+  +    + +  R +E + K    +  Q+  E     +R
Sbjct  966   EKRRRQERERQYRKDKKLQQKEEQLLGEEPEKRRRQEREKKYREEEELQQEEEQLLREER  1025

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQRE--PEPQRARGTQR  226
             E     E +R   +  E Q+E E+    +RE +R +E +R+   + E   E ++  G +R
Sbjct  1026  EKRRRQEWERQYRKKDELQQEEEQLLREEREKRRLQERERQYREEEELQQEEEQLLGEER  1085

Query  225   EP---EKASRSPQEPENPQRARES--QREPERARESQREPERARESQREPEGPKRARERQ  61
             E    ++  R  ++ E  Q+  E   + EPE+ R  +RE +   E + + E  +  RE +
Sbjct  1086  ETRRRQELERQYRKEEELQQEEEQLLREEPEKRRRQERERQCREEEELQQEEEQLLRE-E  1144

Query  60    REPKSQGEPGRAAENQPE  7
             RE + + E  R    + E
Sbjct  1145  REKRRRQELERQYREEEE  1162


 Score = 56.2 bits (134),  Expect = 1e-07
 Identities = 51/181 (28%), Positives = 79/181 (43%), Gaps = 13/181 (7%)
 Frame = -1

Query  570  RARESQREPNRTRGH-----QQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARET  406
            R R+ + EP + R       ++ELA   E   K  R  E + +  R +   R  +  +E 
Sbjct  125  RDRQLEEEPGQRRRQKRQEQERELAEGEEQSEKQERL-EQRDRQRRDEELWRQRQEWQE-  182

Query  405  QREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQR  226
             RE     E Q    +  E++  P+  +  +RE    R   RE   Q+  E Q  R  Q 
Sbjct  183  -REERRAEEEQLQSCKGHETEEFPDEEQLRRRELLELRRKGREEKQQQRRERQD-RVFQE  240

Query  225  EPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKS  46
            E EK  R  +     +  +  + EP+R RE Q E E+ R+ +R+    +  RERQ E + 
Sbjct  241  EEEKEWRKRETVLRKEEEKLQEEEPQRQRELQEEEEQLRKLERQ----ELRRERQEEEQQ  296

Query  45   Q  43
            Q
Sbjct  297  Q  297


 Score = 56.2 bits (134),  Expect = 1e-07
 Identities = 55/203 (27%), Positives = 91/203 (44%), Gaps = 23/203 (11%)
 Frame = -1

Query  573  ERARESQREPNRTRGHQQELARARESQRKPGRT--REGQSKPGRTKGSQRGPESAR----  412
            +R  E +R        +QE AR R   R P      E ++   ++K     P++ R    
Sbjct  692  KREHEEERREQELAEEEQEQARERIKSRIPKWQWQLESEADARQSKVLLEAPQAGRAEAP  751

Query  411  -ETQREPEGTSESQ-RNPERAKESQREPERAR--------ESQREPKRTRESQREPGSQR  262
             E + +    SE Q +  ERA   Q+E E+ R        E + E  R R S R P   R
Sbjct  752  QEQEEKRRRESELQWQEEERAHRQQQEEEQRRDFTWQWQAEEKSERGRQRLSARPP--LR  809

Query  261  EPEPQRARGTQREPEKASRSPQEPENPQRAR---ESQREPERARESQ--REPERARESQR  97
            E   ++ R  +R+  +    P+E E  QR R   E ++E +   E +  +  ERA++ Q 
Sbjct  810  EQRERQLRAEERQQREQRFLPEEEEKEQRGRQRREREKELQFLEEEEQLQRRERAQQLQE  869

Query  96   EPEGPKRARERQREPKSQGEPGR  28
            E +G +  +ER+R+ + + +  R
Sbjct  870  EEDGLQEDQERRRQEQRRDQKWR  892


 Score = 55.8 bits (133),  Expect = 2e-07
 Identities = 47/198 (23%), Positives = 86/198 (43%), Gaps = 19/198 (9%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             + ER R+ QR   + R   +E  + R          + Q +  +    +   E  RE +R
Sbjct  877   DQERRRQEQRRDQKWRWQLEEERKRRRHTLYAKPALQEQLRKEQQLLQEEEEELQRE-ER  935

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQRE----------PEP  250
             E     E +R     ++ Q+E E+    +RE +R +E +R+    ++           EP
Sbjct  936   EKRRRQEQERQYREEEQLQQEEEQLLREEREKRRRQERERQYRKDKKLQQKEEQLLGEEP  995

Query  249   QRARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPE------  88
             ++ R  +RE +       + E  Q  RE +RE  R +E +R+  +  E Q+E E      
Sbjct  996   EKRRRQEREKKYREEEELQQEEEQLLRE-EREKRRRQEWERQYRKKDELQQEEEQLLREE  1054

Query  87    -GPKRARERQREPKSQGE  37
                +R +ER+R+ + + E
Sbjct  1055  REKRRLQERERQYREEEE  1072


 Score = 53.9 bits (128),  Expect = 6e-07
 Identities = 51/208 (24%), Positives = 98/208 (47%), Gaps = 15/208 (7%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARA-RESQRKPGRTREGQSKPGRTKGSQRGPESARETQ  403
             +P    + ++E    +  ++EL R  RE +R+  + R+ + +    +  ++     RE +
Sbjct  909   KPALQEQLRKEQQLLQEEEEELQREEREKRRRQEQERQYREEEQLQQEEEQLLREEREKR  968

Query  402   REPEGTSESQRNPE-RAKESQ---REPERARESQREPKRTRESQREPGSQR----EPEPQ  247
             R  E   + +++ + + KE Q    EPE+ R  +RE K   E + +   ++    E E +
Sbjct  969   RRQERERQYRKDKKLQQKEEQLLGEEPEKRRRQEREKKYREEEELQQEEEQLLREEREKR  1028

Query  246   RARGTQREPEKASRSPQEPENPQR-ARESQREPERARESQREPERARESQR---EPEGPK  79
             R +  +R+  K     QE E   R  RE +R  ER R+ + E E  +E ++   E    +
Sbjct  1029  RRQEWERQYRKKDELQQEEEQLLREEREKRRLQERERQYREEEELQQEEEQLLGEERETR  1088

Query  78    RARERQREPKSQGEPGRAAEN--QPEPE  1
             R +E +R+ + + E  +  E   + EPE
Sbjct  1089  RRQELERQYRKEEELQQEEEQLLREEPE  1116


 Score = 51.6 bits (122),  Expect = 3e-06
 Identities = 54/218 (24%), Positives = 86/218 (39%), Gaps = 37/218 (16%)
 Frame = -1

Query  561   ESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGTS  382
             E Q+E  +  G ++E  R +E +R+  +  E Q +  +    +      +E +R+     
Sbjct  1072  ELQQEEEQLLGEERETRRRQELERQYRKEEELQQEEEQLLREEPEKRRRQERERQCREEE  1131

Query  381   ESQRNPERAKESQREPERARESQREPKRTRESQREPGSQR--------------EPEPQR  244
             E Q+  E+    +RE  R +E +R+ +   E QR+   QR              EPE + 
Sbjct  1132  ELQQEEEQLLREEREKRRRQELERQYREEEELQRQKRKQRYRDEDQRSDLKWQWEPEKEN  1191

Query  243   A--------RGTQREP-----------EKASRSPQEPENPQRARESQREPERARESQREP  121
             A        +G + E             ++ +  Q     Q+ R+  RE ER R  Q   
Sbjct  1192  AVRDNKVYCKGRENEQFRQLEDSQVRDRQSQQDLQHLLGEQQERD--REQERRRWQQANR  1249

Query  120   ERARESQREPEGPKRARERQREPKSQGEPGRAAENQPE  7
                 E Q E E  K A+ R R  KSQ E     E + E
Sbjct  1250  HFPEEEQLEREEQKEAKRRDR--KSQEEKQLLREEREE  1285


 Score = 51.2 bits (121),  Expect = 4e-06
 Identities = 43/188 (22%), Positives = 89/188 (47%), Gaps = 16/188 (8%)
 Frame = -1

Query  573   ERARESQREPNRTRGHQQELARARESQRKPGRTR-EGQSKPGRTKGSQRGPESARET---  406
             ERA++ Q E +   G Q++  R R+ QR+  + R + + +  R + +     + +E    
Sbjct  862   ERAQQLQEEED---GLQEDQERRRQEQRRDQKWRWQLEEERKRRRHTLYAKPALQEQLRK  918

Query  405   -----QREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRA  241
                  Q E E     +R   R +E +R+     + Q+E ++    +RE   ++E E Q  
Sbjct  919   EQQLLQEEEEELQREEREKRRRQEQERQYREEEQLQQEEEQLLREEREKRRRQERERQYR  978

Query  240   RGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQ  61
             +  + + ++     +EPE  +R +E +++     E Q+E E+    +RE    +R +E +
Sbjct  979   KDKKLQQKEEQLLGEEPEKRRR-QEREKKYREEEELQQEEEQLLREERE---KRRRQEWE  1034

Query  60    REPKSQGE  37
             R+ + + E
Sbjct  1035  RQYRKKDE  1042


 Score = 48.9 bits (115),  Expect = 2e-05
 Identities = 46/181 (25%), Positives = 80/181 (44%), Gaps = 8/181 (4%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGS---QRGPESARE  409
             E +  RE Q+E  R     QE  +    +R+  R R+   +  R +     +R  +    
Sbjct  1254  EEQLEREEQKEAKRRDRKSQEEKQLLREEREEKRRRQETDRKFREEEQLLQEREEQPLLR  1313

Query  408   TQREPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQ-RARGT  232
              +R+ +   E   + E+ ++   E +R RE +RE K  +E Q+    +RE   Q R R  
Sbjct  1314  QERDRKFREEELLHQEQGRKFLEEEQRLRE-ERERKFLKEEQQLRLEEREQLRQDRDRKF  1372

Query  231   QREPEKASRSPQE---PENPQRARESQREPERARESQREPERARESQREPEGPKRARERQ  61
             + E ++ SR  ++    E  Q+ R  +RE +   E Q+  +      RE E   + RE Q
Sbjct  1373  REEEQQLSRQERDRKFREEEQQVRRQERERKFLEEEQQLRQERHRKFREEEQLLQEREEQ  1432

Query  60    R  58
             +
Sbjct  1433  Q  1433


 Score = 47.8 bits (112),  Expect = 4e-05
 Identities = 43/188 (22%), Positives = 85/188 (45%), Gaps = 6/188 (3%)
 Frame = -1

Query  573   ERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREP  394
             ER R+  +E  + R  ++E  R ++  RK     +  S+  R +  +   +  R  +RE 
Sbjct  1344  ERERKFLKEEQQLRLEEREQLR-QDRDRKFREEEQQLSRQERDRKFREEEQQVRRQERER  1402

Query  393   EGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEK  214
             +   E Q+  +      RE E+  + + E +  R+ +     + E + +R    ++  E+
Sbjct  1403  KFLEEEQQLRQERHRKFREEEQLLQEREEQQLHRQERDRKFLEEEQQLRRQERDRKFREQ  1462

Query  213   ASRSPQEPENPQRARESQ-REPERARESQREPERARESQREPEGPKRARERQREPKSQGE  37
               RS QEPE      E Q    +R R+  +E ++ R  +R   G +R ++R R+ + + +
Sbjct  1463  ELRS-QEPERKFLEEEQQLHRQQRQRKFLQEEQQLRRQER---GQQRRQDRDRKFREEEQ  1518

Query  36    PGRAAENQ  13
               +  E Q
Sbjct  1519  LRQEREEQ  1526


 Score = 47.0 bits (110),  Expect = 8e-05
 Identities = 52/215 (24%), Positives = 91/215 (42%), Gaps = 31/215 (14%)
 Frame = -1

Query  570   RARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPE  391
             +  E Q+E  +    + E  R +E +R+     E Q +  +    +R     +E +R+  
Sbjct  1099  KEEELQQEEEQLLREEPEKRRRQERERQCREEEELQQEEEQLLREEREKRRRQELERQYR  1158

Query  390   GTSESQRNPERAK---ESQR-------EPER------------ARESQREPKRTRESQRE  277
                E QR   + +   E QR       EPE+             RE+++  +      R+
Sbjct  1159  EEEELQRQKRKQRYRDEDQRSDLKWQWEPEKENAVRDNKVYCKGRENEQFRQLEDSQVRD  1218

Query  276   PGSQREPEPQRARGTQREPEKASRSPQE-----PENPQRARESQREPERA-RESQREPER  115
               SQ++ +       +R+ E+  R  Q+     PE  Q  RE Q+E +R  R+SQ E + 
Sbjct  1219  RQSQQDLQHLLGEQQERDREQERRRWQQANRHFPEEEQLEREEQKEAKRRDRKSQEEKQL  1278

Query  114   ARESQREPEGPKRARERQREPKSQGEPGRAAENQP  10
              RE   E E  +R +E  R+ + + +  +  E QP
Sbjct  1279  LRE---EREEKRRRQETDRKFREEEQLLQEREEQP  1310


 Score = 46.6 bits (109),  Expect = 1e-04
 Identities = 47/187 (25%), Positives = 84/187 (44%), Gaps = 23/187 (12%)
 Frame = -1

Query  564   RESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGT  385
             RE Q   +R R  ++E    +E + +  R +E      R +  +   +  R  +RE +  
Sbjct  1612  REQQLRHDRDRKFREEEQLLQEGEEQQLRRQE------RDRKFREEEQQLRRQERERKFL  1665

Query  384   SESQ--RNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEKA  211
              E Q  R  E  ++ + E +  +E+++E  R +E  R+   + +  P+R     R  E+ 
Sbjct  1666  QEEQQLRRQELERKFREEEQLRQETEQEQLRRQERYRKILEEEQLRPEREEQQLRRQER-  1724

Query  210   SRSPQEPENPQRARESQ-----------REPERARESQREPERARESQREPEGPKRARER  64
              R  +E E  ++ RE Q           RE E+ R+ +RE ++ R  QR  +G  R  E 
Sbjct  1725  DRKFREEEQLRQGREEQQLRSQESDRKFREEEQLRQ-EREEQQLRPQQR--DGKYRWEEE  1781

Query  63    QREPKSQ  43
             Q + + Q
Sbjct  1782  QLQLEEQ  1788


 Score = 46.2 bits (108),  Expect = 1e-04
 Identities = 50/199 (25%), Positives = 86/199 (43%), Gaps = 20/199 (10%)
 Frame = -1

Query  573   ERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREP  394
             E  R+ + E    +  +QE  R +E  RK     E Q +P R +   R  E  R+ + E 
Sbjct  1675  ELERKFREEEQLRQETEQEQLRRQERYRKI--LEEEQLRPEREEQQLRRQERDRKFREEE  1732

Query  393   EGTSESQRNPERAKES------------QREPERARESQREPK-RTRESQREPGSQREP-  256
             +     +    R++ES            +RE ++ R  QR+ K R  E Q +   Q +  
Sbjct  1733  QLRQGREEQQLRSQESDRKFREEEQLRQEREEQQLRPQQRDGKYRWEEEQLQLEEQEQRL  1792

Query  255   EPQRARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKR  76
               +R R  + E + A++     E  +  +E +++  + RE +   E  R  Q+E +  ++
Sbjct  1793  RQERDRQYRAEEQFATQEKSRREEQELWQEEEQKRRQERERKLREEHIRRQQKEEQRHRQ  1852

Query  75    ARERQ-REPKSQG---EPG  31
               E Q +E K  G   EPG
Sbjct  1853  VGEIQSQEGKGHGRLLEPG  1871


 Score = 45.8 bits (107),  Expect = 2e-04
 Identities = 44/187 (23%), Positives = 79/187 (42%), Gaps = 17/187 (9%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             EPE+    +      +G + E  R  E  +   R R+ Q       G Q+      E  R
Sbjct  1186  EPEKENAVRDNKVYCKGRENEQFRQLEDSQV--RDRQSQQDLQHLLGEQQ------ERDR  1237

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
             E E     Q N    +E Q E E  +E++R  ++++E ++    +RE + +R    ++  
Sbjct  1238  EQERRRWQQANRHFPEEEQLEREEQKEAKRRDRKSQEEKQLLREEREEKRRRQETDRKFR  1297

Query  219   EKASRSPQEPENPQRARESQRE--------PERARESQREPERARESQREPEGPKRARER  64
             E+     +  E P   +E  R+         E+ R+   E +R RE +RE +  K  ++ 
Sbjct  1298  EEEQLLQEREEQPLLRQERDRKFREEELLHQEQGRKFLEEEQRLRE-ERERKFLKEEQQL  1356

Query  63    QREPKSQ  43
             + E + Q
Sbjct  1357  RLEEREQ  1363


 Score = 43.5 bits (101),  Expect = 8e-04
 Identities = 38/191 (19%), Positives = 73/191 (38%), Gaps = 22/191 (11%)
 Frame = -2

Query  686   CVTQRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWRE  507
             C  + +   E E+    +RE  R  + +R      E QR+  + R    +  +  K   E
Sbjct  1127  CREEEELQQEEEQLLREEREKRRRQELERQYREEEELQRQKRKQRYRDEDQRSDLKWQWE  1186

Query  506   PERARESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRARESQRE  327
             PE+    +      K  + E     ED +                       R R+SQ++
Sbjct  1187  PEKENAVRDNKVYCKGRENEQFRQLEDSQV----------------------RDRQSQQD  1224

Query  326   PERARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQR  147
              +   G Q+  +R +E +  +++  H   E     + +    R+  K+ +E +  RE + 
Sbjct  1225  LQHLLGEQQERDREQERRRWQQANRHFPEEEQLEREEQKEAKRRDRKSQEEKQLLREERE  1284

Query  146   EPERARESQRE  114
             E  R +E+ R+
Sbjct  1285  EKRRRQETDRK  1295


 Score = 43.5 bits (101),  Expect = 8e-04
 Identities = 39/187 (20%), Positives = 91/187 (48%), Gaps = 16/187 (8%)
 Frame = -1

Query  573   ERARESQREPNRTRGHQQELARARESQRKPGRTREG-----QSKPGRTKGSQRGPESARE  409
             ER ++ +++ +R    +++L + RE Q+   + R+      + K  R +  ++  E  ++
Sbjct  1500  ERGQQRRQDRDRKFREEEQLRQEREEQQLSRQERDRKFRLEEQKVRRQEQERKFMEDEQQ  1559

Query  408   TQREPEGTSESQRNPERAKESQ-----REPERARESQREPKRTRESQREPGSQREPEPQR  244
              +R+ EG  + ++   + +E +     RE ++    +R+ K   E  +    +RE + + 
Sbjct  1560  LRRQ-EGQQQLRQEDRKFREDEQLLQEREEQQLHRQERDRKFLEEEPQLRRQEREQQLRH  1618

Query  243   ARGTQ-REPEKASRSPQEPE--NPQRARESQREPERARESQREPERARESQ--REPEGPK  79
              R  + RE E+  +  +E +    +R R+ + E ++ R  +RE +  +E Q  R  E  +
Sbjct  1619  DRDRKFREEEQLLQEGEEQQLRRQERDRKFREEEQQLRRQERERKFLQEEQQLRRQELER  1678

Query  78    RARERQR  58
             + RE ++
Sbjct  1679  KFREEEQ  1685


 Score = 43.1 bits (100),  Expect = 0.001
 Identities = 35/177 (19%), Positives = 80/177 (45%), Gaps = 11/177 (6%)
 Frame = -1

Query  573   ERARESQREPNRTRGHQQELARARESQR--KPGRTREGQSKPGRTKGSQRGPESARETQR  400
             E  ++ ++E +R    +++L + RE Q+  +  R R+   +  + +  +R  +   +  R
Sbjct  1406  EEEQQLRQERHRKFREEEQLLQEREEQQLHRQERDRKFLEEEQQLRRQERDRKFREQELR  1465

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
               E   +     ++    QR+ +  +E Q+  ++ R  QR     R+   +     +RE 
Sbjct  1466  SQEPERKFLEEEQQLHRQQRQRKFLQEEQQLRRQERGQQRRQDRDRKFREEEQLRQEREE  1525

Query  219   EKASRSPQEPENPQRARESQREPERARESQREPERARESQ--REPEGPKRARERQRE  55
             ++ SR        +R R+ + E ++ R  ++E +   + Q  R  EG ++ R+  R+
Sbjct  1526  QQLSRQ-------ERDRKFRLEEQKVRRQEQERKFMEDEQQLRRQEGQQQLRQEDRK  1575


 Score = 42.7 bits (99),  Expect = 0.001
 Identities = 42/198 (21%), Positives = 83/198 (41%), Gaps = 9/198 (4%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             E E+ R+ +    R R  QQ+L      Q++  R +E +      +      +  RE Q+
Sbjct  1204  ENEQFRQLEDSQVRDRQSQQDLQHLLGEQQERDREQERRRWQQANRHFPEEEQLEREEQK  1263

Query  399   EPEGTSESQRNPERAKESQREPERARESQ----REPKRTRESQREPGSQREPEPQRARGT  232
             E +      +  ++    +RE +R R+      RE ++  + + E    R+   ++ R  
Sbjct  1264  EAKRRDRKSQEEKQLLREEREEKRRRQETDRKFREEEQLLQEREEQPLLRQERDRKFREE  1323

Query  231   QREPEKASRSPQEPE---NPQRARESQREPERARESQREPERARESQ--REPEGPKRARE  67
             +   ++  R   E E     +R R+  +E ++ R  +RE  R    +  RE E     +E
Sbjct  1324  ELLHQEQGRKFLEEEQRLREERERKFLKEEQQLRLEEREQLRQDRDRKFREEEQQLSRQE  1383

Query  66    RQREPKSQGEPGRAAENQ  13
             R R+ + + +  R  E +
Sbjct  1384  RDRKFREEEQQVRRQERE  1401


 Score = 42.7 bits (99),  Expect = 0.001
 Identities = 34/189 (17%), Positives = 82/189 (43%), Gaps = 3/189 (1%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
             E ++    QR+    +  QQ   + R  QR+  R R+ + +    +  +    S +E  R
Sbjct  1476  EEQQLHRQQRQRKFLQEEQQLRRQERGQQRRQDRDRKFREEEQLRQEREEQQLSRQERDR  1535

Query  399   EPEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREP  220
             +     +  R  E+ ++   + ++ R  + + +  +E ++    ++  + +  +   R+ 
Sbjct  1536  KFRLEEQKVRRQEQERKFMEDEQQLRRQEGQQQLRQEDRKFREDEQLLQEREEQQLHRQE  1595

Query  219   EKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPKSQG  40
                    +EP+  ++ RE Q   +R R+ + E +  +E +   E   R +ER R+ + + 
Sbjct  1596  RDRKFLEEEPQLRRQEREQQLRHDRDRKFREEEQLLQEGE---EQQLRRQERDRKFREEE  1652

Query  39    EPGRAAENQ  13
             +  R  E +
Sbjct  1653  QQLRRQERE  1661


 Score = 40.8 bits (94),  Expect = 0.005
 Identities = 44/193 (22%), Positives = 81/193 (41%), Gaps = 11/193 (5%)
 Frame = -2

Query  659   EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  480
             E E+    +RE +   D K   +  +    EP + R  + E +   +   + E  +  + 
Sbjct  964   EREKRRRQERERQYRKDKKLQQKEEQLLGEEPEKRRRQEREKKYREEEELQQEEEQLLRE  1023

Query  479   EPERAKASQGEPKGARED--QraperpresrrepararETQRGPKRARESQREPERARGS  306
             E E+ +  + E +  ++D  Q+  E+     RE  R +E +R  +   E Q+E E+  G 
Sbjct  1024  EREKRRRQEWERQYRKKDELQQEEEQLLREEREKRRLQERERQYREEEELQQEEEQLLGE  1083

Query  305   QRGPERARENQ---------GARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARES  153
             +R   R +E +            E Q  RE    R  Q +    R+  +  +E E+    
Sbjct  1084  ERETRRRQELERQYRKEEELQQEEEQLLREEPEKRRRQERERQCREEEELQQEEEQLLRE  1143

Query  152   QREPERARESQRE  114
             +RE  R +E +R+
Sbjct  1144  EREKRRRQELERQ  1156


 Score = 38.5 bits (88),  Expect = 0.027
 Identities = 33/119 (27%), Positives = 54/119 (45%), Gaps = 13/119 (10%)
 Frame = -1

Query  339  EPERAR----ESQREPKRTRESQREPGSQREPEPQRARGTQREPEKASRSPQEPENPQRA  172
            E +RAR    ES  + +RT E QR    + EP   R R  + EP +  R  ++ +  + A
Sbjct  97   EEKRARCDGKESLLQDRRTEEDQR----RFEP---RDRQLEEEPGQRRRQKRQEQERELA  149

Query  171  RESQREPERARESQREPERARES--QREPEGPKRARERQREPKSQGEPGRAAENQPEPE  1
               ++  ++ R  QR+ +R  E   ++  E  +R   R  E + Q   G   E  P+ E
Sbjct  150  EGEEQSEKQERLEQRDRQRRDEELWRQRQEWQEREERRAEEEQLQSCKGHETEEFPDEE  208


 Score = 37.4 bits (85),  Expect = 0.061
 Identities = 36/146 (24%), Positives = 66/146 (45%), Gaps = 14/146 (9%)
 Frame = -1

Query  414  RETQREPEGTSESQRNPE-RAKESQREP-ERARESQREPKRTRESQREPGSQREPEPQRA  241
            +E+  +   T E QR  E R ++ + EP +R R+ ++E +R      E   ++E   QR 
Sbjct  106  KESLLQDRRTEEDQRRFEPRDRQLEEEPGQRRRQKRQEQERELAEGEEQSEKQERLEQRD  165

Query  240  RGTQREPEKASRSPQEPENPQRARESQREPE------RARESQREPERARESQREPEGPK  79
            R  QR  E+  R  QE +     RE +R  E      +  E++  P+  +  +RE    +
Sbjct  166  R--QRRDEELWRQRQEWQE----REERRAEEEQLQSCKGHETEEFPDEEQLRRRELLELR  219

Query  78   RARERQREPKSQGEPGRAAENQPEPE  1
            R    +++ + +    R  + + E E
Sbjct  220  RKGREEKQQQRRERQDRVFQEEEEKE  245


 Score = 35.0 bits (79),  Expect = 0.30
 Identities = 44/200 (22%), Positives = 76/200 (38%), Gaps = 31/200 (15%)
 Frame = -1

Query  573   ERARESQREPNRTRGHQQELARARESQRKPGRTREGQSK------------------PGR  448
             ER +  ++E  R    ++EL R +  QR     +    K                   GR
Sbjct  1144  EREKRRRQELERQYREEEELQRQKRKQRYRDEDQRSDLKWQWEPEKENAVRDNKVYCKGR  1203

Query  447   TKGSQRGPESARETQREPEGT------SESQRNPERAKESQREPERARESQREPKRTRES  286
                  R  E ++   R+ +         + +R+ E  +E +R  +  R    E +  RE 
Sbjct  1204  ENEQFRQLEDSQVRDRQSQQDLQHLLGEQQERDRE--QERRRWQQANRHFPEEEQLEREE  1261

Query  285   QREPGSQREPEPQRARGTQREPEKASRSPQEPENPQRARE---SQREPERARESQREPE-  118
             Q+E   +R+ + Q  +   RE  +  R  QE +   R  E    +RE +     +R+ + 
Sbjct  1262  QKE-AKRRDRKSQEEKQLLREEREEKRRRQETDRKFREEEQLLQEREEQPLLRQERDRKF  1320

Query  117   RARESQREPEGPKRARERQR  58
             R  E   + +G K   E QR
Sbjct  1321  REEELLHQEQGRKFLEEEQR  1340


>gi|74721253|sp|Q9UQ35|SRRM2_HUMAN Gene info Serine/arginine repetitive matrix protein 2 (Serine/arginine-rich 
splicing factor-related nuclear matrix protein of 300 kDa) 
(Ser/Arg-related nuclear matrix protein) (SR-related nuclear 
matrix protein of 300 kDa) (Splicing coactivator subunit 
SRm300) (300 kDa nuclear matrix antigen)
Length=2752

 Score = 70.5 bits (171),  Expect = 6e-12
 Identities = 64/187 (34%), Positives = 81/187 (43%), Gaps = 19/187 (10%)
 Frame = -1

Query  573  ERARESQREPNRTRGHQQELA----RARESQRKPGRTREGQSKPGRTKGSQR-GPESARE  409
            +R R   R P + RGH +  +    R+R +QR  GR+R  Q + GR++  QR G   +R 
Sbjct  491  KRGRSRSRTPTK-RGHSRSRSPQWRRSRSAQRW-GRSRSPQRR-GRSRSPQRPGWSRSRN  547

Query  408  TQREPEGTSESQRNPERAKESQREPE-RARESQREP-KRTRESQREPGSQREPE--PQRA  241
            TQR   G S S R   R +   R P  R R   R P +R R   R P  +R     P R 
Sbjct  548  TQRR--GRSRSAR---RGRSHSRSPATRGRSRSRTPARRGRSRSRTPARRRSRSRTPTRR  602

Query  240  RGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQ  61
            R   R P +  RS      P R R   R P R R   R P R     R     +R R R 
Sbjct  603  RSRSRTPARRGRS--RSRTPARRRSRTRSPVRRRSRSRSPARRSGRSRSRTPARRGRSRS  660

Query  60   REPKSQG  40
            R P  +G
Sbjct  661  RTPARRG  667


 Score = 68.6 bits (166),  Expect = 2e-11
 Identities = 57/190 (30%), Positives = 67/190 (35%), Gaps = 12/190 (6%)
 Frame = -1

Query  570  RARESQREPNRTRGHQQELA---RARESQRKPGRTREGQSKPGRTKGSQRGP-ESARETQ  403
            R R   R P  TRG  +      R R   R P R R     P R +   R P    R   
Sbjct  559  RGRSHSRSP-ATRGRSRSRTPARRGRSRSRTPARRRSRSRTPTRRRSRSRTPARRGRSRS  617

Query  402  REPEGTSESQRNPERAKESQREPER--ARESQREP-KRTRESQREP---GSQREPEPQRA  241
            R P       R+P R +   R P R   R   R P +R R   R P   G  R   P R 
Sbjct  618  RTPARRRSRTRSPVRRRSRSRSPARRSGRSRSRTPARRGRSRSRTPARRGRSRSRTPARR  677

Query  240  RGTQREPEKASRSPQEPENPQRARESQRE-PERARESQREPERARESQREPEGPKRARER  64
             G  R    A R       P+R R   R    R R   R P+R   S    E   ++R  
Sbjct  678  SGRSRSRTPARRGRSRSRTPRRGRSRSRSLVRRGRSHSRTPQRRGRSGSSSERKNKSRTS  737

Query  63   QREPKSQGEP  34
            QR  +S   P
Sbjct  738  QRRSRSNSSP  747


 Score = 63.9 bits (154),  Expect = 6e-10
 Identities = 60/215 (27%), Positives = 86/215 (40%), Gaps = 28/215 (13%)
 Frame = -1

Query  576  PERARESQREPNRTRGHQQELA---RARESQRKPGRTREGQSK-PGRTKGSQRGPESARE  409
            P R R   R P R  G  +      R R   R P R    +S+ P R  G  R    AR 
Sbjct  630  PVRRRSRSRSPARRSGRSRSRTPARRGRSRSRTPARRGRSRSRTPARRSGRSRSRTPARR  689

Query  408  TQ---REPE-GTSESQRNPERAKESQREPER---ARESQREPKRTRESQREPGSQREPEP  250
             +   R P  G S S+    R +   R P+R   +  S     ++R SQR   S   PE 
Sbjct  690  GRSRSRTPRRGRSRSRSLVRRGRSHSRTPQRRGRSGSSSERKNKSRTSQRRSRSNSSPEM  749

Query  249  QRARGTQREPEKASRSPQEPENPQRARESQR------EPERARESQREPERARESQREPE  88
            +++R + R     SRS   P +  ++R S R       P   ++SQ  P R+R    +P+
Sbjct  750  KKSRISSRR----SRSLSSPRSKAKSRLSLRRSLSGSSPCPKQKSQTPPRRSRSGSSQPK  805

Query  87   G-----PKRARERQREPKSQGE--PGRAAENQPEP  4
                  P+R+R     P  Q    P R + +   P
Sbjct  806  AKSRTPPRRSRSSSSPPPKQKSKTPSRQSHSSSSP  840


 Score = 63.2 bits (152),  Expect = 1e-09
 Identities = 49/199 (24%), Positives = 71/199 (35%), Gaps = 15/199 (7%)
 Frame = -1

Query  576  PERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQRE  397
            P+R   S+    + RG  +   R R   R P      +S+    +G  R    AR   R 
Sbjct  537  PQRPGWSRSRNTQRRGRSRSARRGRSHSRSPATRGRSRSRTPARRGRSRSRTPARRRSRS  596

Query  396  PEGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPE  217
               T    R+   A+  +    R+R   R   RTR   R     R P  +  R   R P 
Sbjct  597  RTPTRRRSRSRTPARRGR---SRSRTPARRRSRTRSPVRRRSRSRSPARRSGRSRSRTPA  653

Query  216  KASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQRE------  55
            +  RS +     +R R   R P R     R    AR  +     P+R R R R       
Sbjct  654  RRGRS-RSRTPARRGRSRSRTPARRSGRSRSRTPARRGRSRSRTPRRGRSRSRSLVRRGR  712

Query  54   -----PKSQGEPGRAAENQ  13
                 P+ +G  G ++E +
Sbjct  713  SHSRTPQRRGRSGSSSERK  731


 Score = 62.4 bits (150),  Expect = 2e-09
 Identities = 59/208 (28%), Positives = 77/208 (37%), Gaps = 19/208 (9%)
 Frame = -1

Query  576  PERARESQREPNRTRGHQQELAR-ARESQRKPGRTREGQSKPGRTKGSQRGP--ESARET  406
            P R R   R P R R   +  AR  R   R P R R     P R +   R P   S R  
Sbjct  589  PARRRSRSRTPTRRRSRSRTPARRGRSRSRTPARRRSRTRSPVRRRSRSRSPARRSGRSR  648

Query  405  QREP--EGTSESQRNPERAKESQREPER--ARESQREPKRTRESQ----REPGSQREPEP  250
             R P   G S S+    R +   R P R   R   R P R   S+    R   S+     
Sbjct  649  SRTPARRGRSRSRTPARRGRSRSRTPARRSGRSRSRTPARRGRSRSRTPRRGRSRSRSLV  708

Query  249  QRARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQR------EPE  88
            +R R   R P++  RS    E   ++R SQR       S  E +++R S R       P 
Sbjct  709  RRGRSHSRTPQRRGRSGSSSERKNKSRTSQRRSR--SNSSPEMKKSRISSRRSRSLSSPR  766

Query  87   GPKRARERQREPKSQGEPGRAAENQPEP  4
               ++R   R   S   P    ++Q  P
Sbjct  767  SKAKSRLSLRRSLSGSSPCPKQKSQTPP  794


 Score = 59.3 bits (142),  Expect = 1e-08
 Identities = 53/210 (25%), Positives = 92/210 (43%), Gaps = 26/210 (12%)
 Frame = -1

Query  561   ESQREPNRTRGHQQELARARESQR-KPGRTREGQSKPGRT----KGSQRGPESARETQRE  397
             + +R  + +   Q+ +AR    QR + G ++E   KP  +      S   P+S  +T+  
Sbjct  1513  QRERSGSESSVDQKTVARTPLGQRSRSGSSQELDVKPSASPQERSESDSSPDSKAKTRTP  1572

Query  396   PEGTSESQRNPERAKESQREPERAR-----ESQREPKRTRESQREPGSQREPE-------  253
                 S S  +PE   +S+  P R+R     E + +P+    +Q    S  EP+       
Sbjct  1573  LRQRSRSGSSPEVDSKSRLSPRRSRSGSSPEVKDKPRAAPRAQSGSDSSPEPKAPAPRAL  1632

Query  252   PQRAR------GTQREPEKASRSPQEPENPQRARESQREPERARESQ---REPERARESQ  100
             P+R+R      G    PE +S +   PE+P ++R ++R    + E +   R P R R S+
Sbjct  1633  PRRSRSGSSSKGRGPSPEGSSSTESSPEHPPKSRTARRGSRSSPEPKTKSRTPPRRRSSR  1692

Query  99    REPEGPKRARERQREPKSQGEPGRAAENQP  10
               PE  ++AR  +R   +   P   +   P
Sbjct  1693  SSPELTRKARLSRRSRSASSSPETRSRTPP  1722


 Score = 57.8 bits (138),  Expect = 4e-08
 Identities = 44/160 (27%), Positives = 68/160 (42%), Gaps = 21/160 (13%)
 Frame = -1

Query  486   PGRTREGQSKPGR---------TKGSQRGPESARETQREPEGTSESQ---RNPERAKESQ  343
             P R+R G S  GR         T+ S   P  +R  +R    + E +   R P R + S+
Sbjct  1633  PRRSRSGSSSKGRGPSPEGSSSTESSPEHPPKSRTARRGSRSSPEPKTKSRTPPRRRSSR  1692

Query  342   REPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEKASRSPQEPENPQRARES  163
               PE  R++ R  +R+R +   P ++    P+     +R P  +S  P E     R R S
Sbjct  1693  SSPELTRKA-RLSRRSRSASSSPETRSRTPPRH----RRSPSVSSPEPAEKSRSSRRRRS  1747

Query  162   QREPERARESQREPERARESQREPEGPKRARERQREPKSQ  43
                P     S+    R R    +P G +R+R R R  K++
Sbjct  1748  ASSPRTKTTSR----RGRSPSPKPRGLQRSRSRSRREKTR  1783


 Score = 55.8 bits (133),  Expect = 2e-07
 Identities = 54/218 (24%), Positives = 86/218 (39%), Gaps = 23/218 (10%)
 Frame = -2

Query  707   IPAKLLDCVTQRDAATEPERAGESQREPERPGDNKRGPEGTRES------QREPGRARES  546
             +P +     + +     PE +  ++  PE P  ++    G+R S       R P R R S
Sbjct  1632  LPRRSRSGSSSKGRGPSPEGSSSTESSPEHPPKSRTARRGSRSSPEPKTKSRTPPRRRSS  1691

Query  545   QTEPEATSKSWREPERARESQGEPE---------RAKASQGEPKGAREDQraperpresr  393
             ++ PE T K+ R   R+R +   PE         R   S   P+ A + + +  R   S 
Sbjct  1692  RSSPELTRKA-RLSRRSRSASSSPETRSRTPPRHRRSPSVSSPEPAEKSRSSRRRRSASS  1750

Query  392   repararETQRGPK-RARESQREPERARGSQRGPERARENQGARESQSHREPEG---PRG  225
                       R P  + R  QR   R+R  +    R R+  G+ +S S R        R 
Sbjct  1751  PRTKTTSRRGRSPSPKPRGLQRSRSRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRV  1810

Query  224   SQRKPAGARKSPKTPKEPERARESQREPERARESQREP  111
             ++R+  G+    ++P   E +R S R   R R   R P
Sbjct  1811  TRRRRGGSGYHSRSPARQESSRTSSR---RRRGRSRTP  1845


 Score = 55.1 bits (131),  Expect = 3e-07
 Identities = 50/194 (25%), Positives = 79/194 (40%), Gaps = 12/194 (6%)
 Frame = -1

Query  576   PERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQRE  397
             P+   ES   P+     +  L +   S   P    + +  P R++ S   PE   + +  
Sbjct  1553  PQERSESDSSPDSKAKTRTPLRQRSRSGSSPEVDSKSRLSPRRSR-SGSSPEVKDKPRAA  1611

Query  396   PEGTSESQRNPE-RAKESQREPERARESQ----REPKRTRESQREPGSQREPEPQRAR-G  235
             P   S S  +PE +A   +  P R+R       R P     S  E   +  P+ + AR G
Sbjct  1612  PRAQSGSDSSPEPKAPAPRALPRRSRSGSSSKGRGPSPEGSSSTESSPEHPPKSRTARRG  1671

Query  234   TQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQRE  55
             ++  PE  ++S      P R R S+  PE  R++ R   R+R +   PE   R   R R 
Sbjct  1672  SRSSPEPKTKS----RTPPRRRSSRSSPELTRKA-RLSRRSRSASSSPETRSRTPPRHRR  1726

Query  54    PKSQGEPGRAAENQ  13
               S   P  A +++
Sbjct  1727  SPSVSSPEPAEKSR  1740


 Score = 54.7 bits (130),  Expect = 4e-07
 Identities = 54/191 (28%), Positives = 69/191 (36%), Gaps = 21/191 (10%)
 Frame = -1

Query  558  SQREPNRTRG---HQQELARARESQRKPGR------TREGQSKPGRTKGSQRGPESARET  406
            S+  P R R      ++L ++  S+  P        +R   S P   K +   P S RE 
Sbjct  395  SEASPTRDRSPPKSPEKLPQSSSSESSPPSPQPTKVSRHASSSPESPKPAP-APGSHREI  453

Query  405  QREPEGTSESQRNPERAKESQREPERARESQREP---KRTRESQREP---GSQREPEPQR  244
               P   + S    +R K     P R     R P   KR R   R P   G  R   PQ 
Sbjct  454  SSSPTSKNRSHGRAKRDKSHSHTPSRRMGRSRSPATAKRGRSRSRTPTKRGHSRSRSPQW  513

Query  243  ARGTQREPEKASRSPQ---EPENPQRARESQREPERARESQREPERARESQREPEGPKRA  73
             R    +    SRSPQ      +PQR   S+    + R   R   R R   R P    R 
Sbjct  514  RRSRSAQRWGRSRSPQRRGRSRSPQRPGWSRSRNTQRRGRSRSARRGRSHSRSP--ATRG  571

Query  72   RERQREPKSQG  40
            R R R P  +G
Sbjct  572  RSRSRTPARRG  582


 Score = 54.3 bits (129),  Expect = 5e-07
 Identities = 49/211 (23%), Positives = 73/211 (34%), Gaps = 19/211 (9%)
 Frame = -2

Query  704  PAKLLDCVTQRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEAT  525
            P KL    +   +   P+    S+     P   K  P         PG  RE  + P + 
Sbjct  409  PEKLPQSSSSESSPPSPQPTKVSRHASSSPESPKPAPA--------PGSHREISSSPTSK  460

Query  524  SKSWREPERARESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRGPKRA  345
            ++S    +R +     P R       P  A+  +     P +     +R+ + +R     
Sbjct  461  NRSHGRAKRDKSHSHTPSRRMGRSRSPATAKRGRSRSRTPTKRGHSRSRSPQWRRSRSAQ  520

Query  344  RESQREPERARGSQRGPER-----ARENQ------GARESQSHREPEGPRGSQRKPAGAR  198
            R  +    + RG  R P+R     +R  Q       AR  +SH      RG  R    AR
Sbjct  521  RWGRSRSPQRRGRSRSPQRPGWSRSRNTQRRGRSRSARRGRSHSRSPATRGRSRSRTPAR  580

Query  197  KSPKTPKEPERARESQREPERARESQREPER  105
            +     + P R R   R P R R   R P R
Sbjct  581  RGRSRSRTPARRRSRSRTPTRRRSRSRTPAR  611


 Score = 53.5 bits (127),  Expect = 8e-07
 Identities = 43/190 (22%), Positives = 65/190 (34%), Gaps = 20/190 (10%)
 Frame = -1

Query  576  PERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTK------GSQRGPESA  415
            PE A +    P   +   ++   A      P R+  G   P  T       G    P + 
Sbjct  324  PETATKQPSSPYEDKDKDKKEKSATRPSPSPERSSTGPEPPAPTPLLAERHGGSPQPLAT  383

Query  414  RETQREP-----EGTSESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEP  250
                +EP     E +    R+P ++ E   +   +  S   P+ T+ S+    S   P+P
Sbjct  384  TPLSQEPVNPPSEASPTRDRSPPKSPEKLPQSSSSESSPPSPQPTKVSRHASSSPESPKP  443

Query  249  QRARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRAR  70
              A G+ RE            +P     S    +R +     P R     R P   KR R
Sbjct  444  APAPGSHREIS---------SSPTSKNRSHGRAKRDKSHSHTPSRRMGRSRSPATAKRGR  494

Query  69   ERQREPKSQG  40
             R R P  +G
Sbjct  495  SRSRTPTKRG  504


 Score = 52.8 bits (125),  Expect = 1e-06
 Identities = 55/216 (25%), Positives = 78/216 (36%), Gaps = 30/216 (13%)
 Frame = -1

Query  573  ERARESQREPNRTRGHQQELA-RARESQRKPGRTREGQSKPGRTKGSQRGPESARETQRE  397
            +R+R +   P   R H+   A  A  S     R+R   +K   T  + R P  A   + E
Sbjct  246  KRSRSTTPAPKSRRAHRSTSADSASSSDTSRSRSRSAAAKTHTTALAGRSPSPASGRRGE  305

Query  396  PE------GTSESQR--NPERAKESQREP-ERARESQREPKRTRESQREPGSQREPEPQ-  247
             +      GT+ +QR  +PE A +    P E   + ++E   TR S     S   PEP  
Sbjct  306  GDAPFSEPGTTSTQRPSSPETATKQPSSPYEDKDKDKKEKSATRPSPSPERSSTGPEPPA  365

Query  246  ------RARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEG  85
                     G   +P   +   QEP NP     S+  P R R   + PE+  +S      
Sbjct  366  PTPLLAERHGGSPQPLATTPLSQEPVNP----PSEASPTRDRSPPKSPEKLPQSSSSESS  421

Query  84   P---------KRARERQREPKSQGEPGRAAENQPEP  4
            P         + A      PK    PG   E    P
Sbjct  422  PPSPQPTKVSRHASSSPESPKPAPAPGSHREISSSP  457


 Score = 52.0 bits (123),  Expect = 2e-06
 Identities = 54/195 (27%), Positives = 79/195 (40%), Gaps = 23/195 (11%)
 Frame = -1

Query  573   ERARE-SQREPNRTR------GHQQELARARESQRKPGRTREGQSKPGRTKGSQRGP---  424
             +R+R  S+RE  RT       G  Q  +R R  QR   R+R  + + G +    R P   
Sbjct  1771  QRSRSRSRREKTRTTRRRDRSGSSQSTSRRR--QRSRSRSRVTRRRRGGSGYHSRSPARQ  1828

Query  423   ESARETQREPEGTSESQRNPERAKESQREP-----ERARESQREPKRTRE-----SQREP  274
             ES+R + R   G S +     +   S+  P      R+R S    +R+R      S+R  
Sbjct  1829  ESSRTSSRRRRGRSRTPPTSRKRSRSRTSPAPWKRSRSRASPATHRRSRSRTPLISRRRS  1888

Query  273   GSQREP-EPQRARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQR  97
              S+  P   +R+R       + SRS   P + +R+R       R R   R P   R S+ 
Sbjct  1889  RSRTSPVSRRRSRSRTSVTRRRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTTRRRSRS  1948

Query  96    EPEGPKRARERQREP  52
                   R R R R P
Sbjct  1949  RTPPVTRRRSRSRTP  1963


 Score = 48.9 bits (115),  Expect = 2e-05
 Identities = 44/193 (22%), Positives = 76/193 (39%), Gaps = 17/193 (8%)
 Frame = -1

Query  570  RARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESAR-ETQREP  394
            R+  S    N++R  Q+   R+R +     +     S+  R+  S R    +R   +R  
Sbjct  723  RSGSSSERKNKSRTSQR---RSRSNSSPEMKKSRISSRRSRSLSSPRSKAKSRLSLRRSL  779

Query  393  EGTS-----ESQRNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQ  229
             G+S     +SQ  P R++    +P+   +S+  P+R+R S   P  Q+   P R   + 
Sbjct  780  SGSSPCPKQKSQTPPRRSRSGSSQPKA--KSRTPPRRSRSSSSPPPKQKSKTPSRQSHSS  837

Query  228  REPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREPEGPKRARERQREPK  49
              P    +S   P      R+      +A E    P+R    +  P+   ++R   R   
Sbjct  838  SSPHPKVKSGTPP------RQGSITSPQANEQSVTPQRRSCFESSPDPELKSRTPSRHSC  891

Query  48   SQGEPGRAAENQP  10
            S   P R   + P
Sbjct  892  SGSSPPRVKSSTP  904


 Score = 46.6 bits (109),  Expect = 1e-04
 Identities = 44/183 (24%), Positives = 74/183 (40%), Gaps = 12/183 (6%)
 Frame = -1

Query  546   PNRTRGHQQELARARESQRKP--GRTREGQSKPGRTKGSQRGPESARETQREPEGTSESQ  373
             P R R   +     +   R P   R+R G S+    K S   P+   E+   P+  ++++
Sbjct  1512  PQRERSGSESSVDQKTVARTPLGQRSRSGSSQELDVKPSA-SPQERSESDSSPDSKAKTR  1570

Query  372   RNPERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEKASRSPQE  193
                 +   S   PE   +S+  P+R+R      GS  E +  + R   R    +  SP E
Sbjct  1571  TPLRQRSRSGSSPEVDSKSRLSPRRSRS-----GSSPEVK-DKPRAAPRAQSGSDSSP-E  1623

Query  192   PENPQRARESQREPERARESQR--EPERARESQREPEGPKRARERQREPKSQGEPGRAAE  19
             P+ P      +R    +    R   PE +  ++  PE P ++R  +R  +S  EP   + 
Sbjct  1624  PKAPAPRALPRRSRSGSSSKGRGPSPEGSSSTESSPEHPPKSRTARRGSRSSPEPKTKSR  1683

Query  18    NQP  10
               P
Sbjct  1684  TPP  1686


 Score = 45.4 bits (106),  Expect = 2e-04
 Identities = 40/213 (18%), Positives = 74/213 (34%), Gaps = 22/213 (10%)
 Frame = -1

Query  579  EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQR  400
            +P+R     ++P         L R   S R P   ++ + K  + +G +    S R  ++
Sbjct  152  DPQRRAREAKQPAPEPPKPYSLVRESSSSRSP-TPKQKKKKKKKDRGRRSESSSPRRERK  210

Query  399  EPEGTSESQRNPERAKESQREP---ERARESQREPKRTRESQREPGSQREPEPQRARGTQ  229
            +     + +   E  K   R P    + +   ++ KR+R +   P S+R      A    
Sbjct  211  KSSKKKKHRSESESKKRKHRSPTPKSKRKSKDKKRKRSRSTTPAPKSRRAHRSTSADSAS  270

Query  228  REPEKASRS---------------PQEPENPQRARESQREPERARESQREPERARESQRE  94
                  SRS                  P + +R        E    S + P     + ++
Sbjct  271  SSDTSRSRSRSAAAKTHTTALAGRSPSPASGRRGEGDAPFSEPGTTSTQRPSSPETATKQ  330

Query  93   PEGPKRARERQREPKSQGEPGRAAENQ---PEP  4
            P  P   +++ ++ KS   P  + E     PEP
Sbjct  331  PSSPYEDKDKDKKEKSATRPSPSPERSSTGPEP  363


 Score = 43.1 bits (100),  Expect = 0.001
 Identities = 49/202 (24%), Positives = 80/202 (39%), Gaps = 36/202 (17%)
 Frame = -2

Query  683   VTQRDAATEP----ERAGESQR-------EPERPGDNKRGPEGTRESQREPGRARESQTE  537
             V Q+  A  P     R+G SQ         P+   ++   P+   +++    +   S + 
Sbjct  1523  VDQKTVARTPLGQRSRSGSSQELDVKPSASPQERSESDSSPDSKAKTRTPLRQRSRSGSS  1582

Query  536   PEATSKSWREPERARESQGEPERAKASQGEPKGAREDQraperpresrrepararETQRG  357
             PE  SKS   P R+R S   PE     + +P+ A   Q                 ++   
Sbjct  1583  PEVDSKSRLSPRRSR-SGSSPE----VKDKPRAAPRAQ--------------SGSDSSPE  1623

Query  356   PKRARESQREPERARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPK---  186
             PK A   +  P R+R       R    +G+  ++S   PE P  S+    G+R SP+   
Sbjct  1624  PK-APAPRALPRRSRSGSSSKGRGPSPEGSSSTES--SPEHPPKSRTARRGSRSSPEPKT  1680

Query  185   TPKEPERARESQREPERARESQ  120
               + P R R S+  PE  R+++
Sbjct  1681  KSRTPPRRRSSRSSPELTRKAR  1702


 Score = 38.5 bits (88),  Expect = 0.027
 Identities = 41/162 (25%), Positives = 70/162 (43%), Gaps = 20/162 (12%)
 Frame = -1

Query  501  ESQRKPGRTRE--GQSKPGRTKGSQRGP--ESARETQREPEGTSES-----QRNPERAKE  349
            E    PG   E  GQ +P  T+  Q     E   E  R   G S+S       +P+R   
Sbjct  100  EKDVNPGGKEETPGQ-RPAVTETHQLAELNEKKNERLRAAFGISDSYVDGSSFDPQRRAR  158

Query  348  SQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEKASRSPQEPENPQRAR  169
              ++P        EP +     RE  S R P P++ +  +++ ++  RS       +R +
Sbjct  159  EAKQP------APEPPKPYSLVRESSSSRSPTPKQKK-KKKKKDRGRRSESSSPRRERKK  211

Query  168  ESQREPERAR-ESQREPERA--RESQREPEGPKRARERQREP  52
             S+++  R+  ES++   R+   +S+R+ +  KR R R   P
Sbjct  212  SSKKKKHRSESESKKRKHRSPTPKSKRKSKDKKRKRSRSTTP  253


 Score = 38.5 bits (88),  Expect = 0.027
 Identities = 31/156 (19%), Positives = 54/156 (34%), Gaps = 3/156 (1%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARET--  406
             EP  A+  +R  + +       + +  S      +    S    +  S     S  +   
Sbjct  2597  EPTPAKRKRRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPAKPGP  2656

Query  405   QREPEGTSESQRNP-ERAKESQREPERARESQREPKRTRESQREPGSQREPEPQRARGTQ  229
             Q  P+  S  +  P ER   S R+P  +    R    +   +R P  Q  P  Q++  ++
Sbjct  2657  QALPKPASPKKPPPGERRSRSPRKPIDSLRDSRSLSYSPVERRRPSPQPSPRDQQSSSSE  2716

Query  228   REPEKASRSPQEPENPQRARESQREPERARESQREP  121
             R   +  R      + +R RE+         S R P
Sbjct  2717  RGSRRGQRGDSRSPSHKRRRETPSPRPMRHRSSRSP  2752


 Score = 37.4 bits (85),  Expect = 0.061
 Identities = 41/197 (20%), Positives = 65/197 (32%), Gaps = 20/197 (10%)
 Frame = -1

Query  579   EPERARESQREPNRTRGHQQELARARESQRKPGRTR---EGQSKP-------GRTKGSQR  430
             +P + R S    + +       + +  S    G +    EG S P        R      
Sbjct  2525  QPAKERRSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSDSEGSSLPVQPEVALKRVPSPTP  2584

Query  429   GPESARETQREPEGT-------SESQRNPERAKESQREPERARESQREPKRTRESQREPG  271
              P+ A    R PE T       S S  +   +  S      +  S      +  S     
Sbjct  2585  APKEAVREGRPPEPTPAKRKRRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS  2644

Query  270   SQREPEPQRARGTQREPEKASRSPQEPENPQRARESQREPERARESQREPERARESQREP  91
             S   P P +  G Q  P+ AS  P++P   +R   S R+P  +    R    +   +R P
Sbjct  2645  SSSSPSPAKP-GPQALPKPAS--PKKPPPGERRSRSPRKPIDSLRDSRSLSYSPVERRRP  2701

Query  90    EGPKRARERQREPKSQG  40
                   R++Q     +G
Sbjct  2702  SPQPSPRDQQSSSSERG  2718


 Score = 37.0 bits (84),  Expect = 0.079
 Identities = 44/169 (26%), Positives = 56/169 (33%), Gaps = 19/169 (11%)
 Frame = -1

Query  492   RKPGRTREGQ-SKPGRTKGSQRGPESARETQREPEGTSESQRNPERAKESQREPERARES  316
             R P R R    S P    G  R P S R       G  +    P R   S   P   ++ 
Sbjct  1412  RTPSRERSSSASSPEMKDGLPRTP-SRRSRSGSSPGLRDGSGTPSRHSLSGSSPGM-KDI  1469

Query  315   QREPKRTRESQREPGSQREPEPQRARGTQREPEKASRSPQEPE------NPQRARESQRE  154
              R P R R           PEP+    T   P   SRSP  PE       PQR R     
Sbjct  1470  PRTPFRGRSE-----CDSSPEPKALPQT---PRPRSRSPSSPELNNKCLTPQRERSGSES  1521

Query  153   PERARESQREP--ERARESQREPEGPKRARERQREPKSQGEPGRAAENQ  13
                 +   R P  +R+R    +    K +   Q   +S   P   A+ +
Sbjct  1522  SVDQKTVARTPLGQRSRSGSSQELDVKPSASPQERSESDSSPDSKAKTR  1570


 Score = 34.7 bits (78),  Expect = 0.39
 Identities = 42/165 (25%), Positives = 56/165 (33%), Gaps = 13/165 (7%)
 Frame = -1

Query  570   RARESQREPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPE  391
             R R   R P  TR      +R+R S     R+R   S   R +   R     R   R   
Sbjct  1955  RRRSRSRTPPVTRRR----SRSRTSPITRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRT  2010

Query  390   GTSESQRNPERAKESQREPERARESQREPKRTRESQREP----GSQREPEPQRARGTQ--  229
                  +R+  R   + R   R+R      KR+R   R P       R   P+ ARG +  
Sbjct  2011  SPVTRRRSRSRTPPAIRRRSRSRTPLLPRKRSRS--RSPLAIRRRSRSRTPRTARGKRSL  2068

Query  228   -REPEKASRSPQEPENPQRARESQREPERARESQREPERARESQR  97
              R P    R      +  R+R +     R     R P  A  S R
Sbjct  2069  TRSPPAIRRRSASGSSSDRSRSATPPATRNHSGSRTPPVALNSSR  2113


 Score = 33.9 bits (76),  Expect = 0.67
 Identities = 38/200 (19%), Positives = 60/200 (30%), Gaps = 28/200 (14%)
 Frame = -1

Query  549   EPNRTRGHQQELARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGTSESQR  370
             EP  + G QQ  A A     K  R+    S    +  S     S+  +       SE   
Sbjct  2508  EPPASTGAQQPSALAALQPAKERRSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSDSEGSS  2567

Query  369   NPERA--------------KESQRE-----PERARESQREPKRTRESQREPGSQREPEPQ  247
              P +               KE+ RE     P  A+  +R    +  S     S       
Sbjct  2568  LPVQPEVALKRVPSPTPAPKEAVREGRPPEPTPAKRKRRSSSSSSSSSSSSSSSSSSSSS  2627

Query  246   RARGTQREPEKASRSPQEPENPQRARE---------SQREPERARESQREPERARESQRE  94
              +  +      +S S     +P  A+          S ++P       R P +  +S R+
Sbjct  2628  SSSSSSSSSSSSSSSSSSSSSPSPAKPGPQALPKPASPKKPPPGERRSRSPRKPIDSLRD  2687

Query  93    PEGPKRARERQREPKSQGEP  34
                   +   +R P  Q  P
Sbjct  2688  SRSLSYSPVERRRPSPQPSP  2707
	




-----------------------------------------------------------------------------------------------
BLASTP contre swissprot l'ORF avec ATG,cadre de lecture 2 sur le brin indirect (base 65->82

Sequences producing significant alignments:                        (Bits)  Value

gi|82583720|sp|O01761|UNC89_CAEEL  Muscle M-line assembly prot...  41.6    0.003  Gene info
gi|1705706|sp|P54282|CAC1A_RAT  Voltage-dependent P/Q-type cal...  37.7    0.037  Gene info
gi|112670|sp|P15711|104K_THEPA  104 kDa microneme-rhoptry antigen  36.2    0.11 
gi|6685537|sp|Q14152|IF3A_HUMAN  Eukaryotic translation initia...  35.4    0.17   Gene info
gi|5921693|sp|Q05152|CAC1B_RABIT  Voltage-dependent N-type cal...  35.0    0.21 
gi|1705854|sp|Q00975|CAC1B_HUMAN  Voltage-dependent N-type cal...  35.0    0.22   Gene info
gi|81311015|sp|Q5E7L5|IF2_VIBF1  Translation initiation factor IF  35.0    0.22   Gene info
gi|76363500|sp|Q9L7Q2|ZMPB_STRPN  Zinc metalloprotease zmpB precu  34.7    0.34 
gi|81917793|sp|Q9R0G8|NRK_MOUSE  Nik-related protein kinase (N...  33.9    0.58   Gene info
gi|5921454|sp|P97445|CAC1A_MOUSE  Voltage-dependent P/Q-type c...  33.5    0.70   Gene info
gi|62512118|sp|Q8DQN5|ZMPB_STRR6  Zinc metalloprotease zmpB precu  33.1    0.83   Gene info
gi|61217641|sp|Q9BYE2|TMPSD_HUMAN  Transmembrane protease, ser...  33.1    0.91   Gene info
gi|1170517|sp|P45386|IGA4_HAEIN  Immunoglobulin A1 protease precu  32.0    1.8  
gi|74950752|sp|Q4U9M9|104K_THEAN  104 kDa microneme-rhoptry antig  31.6    2.5  
gi|34098662|sp|Q92576|PHF3_HUMAN  PHD finger protein 3             31.2    3.9    Gene info
gi|50400866|sp|Q6KCD5|NPBL_MOUSE  Nipped-B-like protein (Delangin  31.2    3.9    Gene info
gi|90101372|sp|Q3IJ53|IF2_PSEHT  Translation initiation factor IF  30.8    4.4    Gene info
gi|73621012|sp|Q8NFN8|GP156_HUMAN  Probable G-protein coupled ...  30.4    6.4    Gene info
gi|20137608|sp|Q9Z330|DNMT1_RAT  DNA (cytosine-5)-methyltransf...  30.0    8.5    Gene info
gi|267150|sp|Q01320|TOP2A_MOUSE  DNA topoisomerase 2-alpha (DNA t  29.6    8.9    Gene info


>gi|82583720|sp|O01761|UNC89_CAEEL Gene info Muscle M-line assembly protein unc-89 (Uncoordinated protein 
89)
Length=8081

 Score = 41.6 bits (96),  Expect = 0.003, Method: Composition-based stats.
 Identities = 35/221 (15%), Positives = 83/221 (37%), Gaps = 12/221 (5%)

Query  41    ESQREPERPGDNKRGPEGTRESQREPGR-ARESQTEPEATSKSWREPERAR-ESQGEPER  98
             + ++ PE+  +    P    +S  +P    ++S+ E ++ +K  + PE++  E    P+ 
Sbjct  1562  KKEKSPEKVEEKPASPTKKEKSPEKPASPTKKSENEVKSPTKKEKSPEKSVVEELKSPKE  1621

Query  99    AKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQRGPER  158
                 + + K     ++     + +  +     + ++ P++  E    P +   S   P +
Sbjct  1622  KSPEKADDKPKSPTKKEKSPEKSATEDVKSPTKKEKSPEKVEEKPTSPTKKESS---PTK  1678

Query  159   ARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARE------  212
               +++    ++  + P+        P    KSP+     E     ++ PE+A E      
Sbjct  1679  KTDDEVKSPTKKEKSPQTVEEKPASPTKKEKSPEKSVVEEVKSPKEKSPEKAEEKPKSPT  1738

Query  213   -SQREPERAresrkgprepgrgresqrARESPGEPQRTSQS  252
               ++ PE++                + A E P  P +   S
Sbjct  1739  KKEKSPEKSAAEEVKSPTKKEKSPEKSAEEKPKSPTKKESS  1779


 Score = 32.7 bits (73),  Expect = 1.2, Method: Composition-based stats.
 Identities = 33/162 (20%), Positives = 63/162 (38%), Gaps = 2/162 (1%)

Query  43    QREPERPGDNKRGPEGTR-ESQREPGRARESQTEPEATSKSWREPERARESQGEPERAKA  101
             + +P  P   ++ PE +  E  + P      + E +  S + +E    + +  E +    
Sbjct  1698  EEKPASPTKKEKSPEKSVVEEVKSPKEKSPEKAEEKPKSPTKKEKSPEKSAAEEVKSPTK  1757

Query  102   SQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQRGPERARE  161
              +  P+ + E++      +ES        E  + P +  +S  + E    S    E+  E
Sbjct  1758  KEKSPEKSAEEKPKSPTKKESSPVKMADDEV-KSPTKKEKSPEKVEEKPASPTKKEKTPE  1816

Query  162   NQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARES  203
                A E +S  + E    S  K  G     K+P++PE   +S
Sbjct  1817  KSAAEELKSPTKKEKSPSSPTKKTGDESKEKSPEKPEEKPKS  1858


 Score = 32.3 bits (72),  Expect = 1.6, Method: Composition-based stats.
 Identities = 33/225 (14%), Positives = 83/225 (36%), Gaps = 10/225 (4%)

Query  32    AATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARE  91
             AA E +   + ++ P  P   ++ P    +   +  + +     P    KS  +PE  + 
Sbjct  1423  AAEEVKSPTKKEKSPSSPTKKEKSPSSPTKKTGDEVKEKSPPKSPTKKEKSPEKPEDVKS  1482

Query  92    SQGEPERAKASQ-----GEPKGAREDQraperpresrreparareTQRGPKRARESQREP  146
                + +   A+       E    + +            E   + + ++ P++  E  + P
Sbjct  1483  PVKKEKSPDATNIVEVSSETTIEKTETTMTTEMTHESEESRTSVKKEKTPEKVDEKPKSP  1542

Query  147   ERARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQRE  206
              +     + PE++   +     +  + PE        P    KSP+ P  P   ++S+ E
Sbjct  1543  TK---KDKSPEKSITEEIKSPVKKEKSPEKVEEKPASPTKKEKSPEKPASP--TKKSENE  1597

Query  207   PERARESQREPERAresrkgprepgrgresqrARESPGEPQRTSQ  251
              +   + ++ PE++        +     ++    +SP + +++ +
Sbjct  1598  VKSPTKKEKSPEKSVVEELKSPKEKSPEKADDKPKSPTKKEKSPE  1642


>gi|1705706|sp|P54282|CAC1A_RAT Gene info Voltage-dependent P/Q-type calcium channel subunit alpha-1A (Voltage-gated 
calcium channel subunit alpha Cav2.1) (Calcium 
channel, L type, alpha-1 polypeptide, isoform 4) (Brain calcium 
channel I) (BI) (RAT brain class A) (RBA-I)
Length=2212

 Score = 37.7 bits (86),  Expect = 0.037, Method: Composition-based stats.
 Identities = 50/183 (27%), Positives = 76/183 (41%), Gaps = 21/183 (11%)

Query  23    LLDCVTQRDAATEPERAGESQREPERPGDNKRGPEGTR----ESQREPGRARESQTEPEA  78
             ++D    R+  T   RA E+ R+  RP ++ R P+  R      +R PGR      E E 
Sbjct  825   VVDPQENRNNNTNKSRAPEALRQTARPRESARDPDARRAWPSSPERAPGREGPYGRESEP  884

Query  79    TSKSWREPERARESQGEPERAKA------------SQGEPKGAREDQraperpresrrep  126
               +    P        +PERAKA            ++GEP+  R  +R  + P +     
Sbjct  885   QQREHAPPREHVPWDADPERAKAGDAPRRHTHRPVAEGEPRRHRARRRPGDEPDDRPERR  944

Query  127   arareTQRGPKRARESQREPERARGSQRGP----ERARENQGARESQSHREP-EGPRGSQ  181
              R R+  R  + A     + ER R  + GP    +R R ++  +ESQ    P  GP  S 
Sbjct  945   PRPRDATRPARAADGEGDDGERKRRHRHGPPAHDDRERRHRRRKESQGSGVPMSGPNLST  1004

Query  182   RKP  184
              +P
Sbjct  1005  TRP  1007


>gi|112670|sp|P15711|104K_THEPA  104 kDa microneme-rhoptry antigen precursor (p104)
Length=924

 Score = 36.2 bits (82),  Expect = 0.11, Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 9/86 (10%)

Query  133  QRGPKRARESQREPERARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPK  192
             +GP +  +S +E ++  GS + P  ARE++ ++     ++P GP+          K P+
Sbjct  531  HKGPSKGSDSSKEGKKP-GSGKKPGPAREHKPSKIPTLSKKPSGPKDP--------KHPR  581

Query  193  TPKEPERARESQREPERARESQREPE  218
             PKEP +++  +      R S + P+
Sbjct  582  DPKEPRKSKSPRTASPTRRPSPKLPQ  607


>gi|6685537|sp|Q14152|IF3A_HUMAN Gene info Eukaryotic translation initiation factor 3 subunit 10 (eIF-3 
theta) (eIF3 p167) (eIF3 p180) (eIF3 p185) (eIF3a)
Length=1382

 Score = 35.4 bits (80),  Expect = 0.17, Method: Composition-based stats.
 Identities = 45/186 (24%), Positives = 66/186 (35%), Gaps = 2/186 (1%)

Query  36    PERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERA-RESQG  94
             P R  E  R   R  D+ R      +  R P R  +        +   R P R   E +G
Sbjct  968   PRRGPEEDRFSRRGADDDRPSWRNTDDDRPPRRIADEDRGNWRHADDDRPPRRGLDEDRG  1027

Query  95    EPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQR  154
                 A   +G  +G  +D+       +  R   R  +  RGP+R  +  R P R     R
Sbjct  1028  SWRTADEDRGPRRGMDDDRGPRRGGADDERSSWRNADDDRGPRRGLDDDRGPRRGMDDDR  1087

Query  155   GPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQ  214
             GP R  ++      +   +  GPR       G  ++    + P R  E  R P R  +  
Sbjct  1088  GPRRGMDDDRG-PRRGMDDDRGPRRGLDDDRGPWRNADDDRIPRRGAEDDRGPWRNMDDD  1146

Query  215   REPERA  220
             R   RA
Sbjct  1147  RLSRRA  1152


 Score = 33.1 bits (74),  Expect = 0.90, Method: Composition-based stats.
 Identities = 42/179 (23%), Positives = 63/179 (35%), Gaps = 1/179 (0%)

Query  43    QREPERPGDNK-RGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQGEPERAKA  101
             +  P R GD++ R P    +  R P R  +    P    +  R   R  +      R   
Sbjct  934   EERPRRLGDDEDREPSLRPDDDRVPRRGMDDDRGPRRGPEEDRFSRRGADDDRPSWRNTD  993

Query  102   SQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQRGPERARE  161
                 P+   ++ R   R  +  R P R  +  RG  R  +  R P R     RGP R   
Sbjct  994   DDRPPRRIADEDRGNWRHADDDRPPRRGLDEDRGSWRTADEDRGPRRGMDDDRGPRRGGA  1053

Query  162   NQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQREPERA  220
             +      ++  +  GPR       G R+     + P R  +  R P R  +  R P R 
Sbjct  1054  DDERSSWRNADDDRGPRRGLDDDRGPRRGMDDDRGPRRGMDDDRGPRRGMDDDRGPRRG  1112


 Score = 30.0 bits (66),  Expect = 7.3, Method: Composition-based stats.
 Identities = 53/183 (28%), Positives = 75/183 (40%), Gaps = 7/183 (3%)

Query  38    RAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQGEPE  97
             R  +  R P R  D+ RGP    +  R P R  +    P       R P R  +    P 
Sbjct  1061  RNADDDRGPRRGLDDDRGPRRGMDDDRGPRRGMDDDRGPRRGMDDDRGPRRGLDDDRGPW  1120

Query  98    RAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPER---ARGSQR  154
             R       P+   ED R P R  +  R   RA +  R P+R  +S+  P R     G  R
Sbjct  1121  RNADDDRIPRRGAEDDRGPWRNMDDDRLSRRADD-DRFPRRGDDSRPGPWRPLVKPGGWR  1179

Query  155   GPERARENQGA--RESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARE  212
               E+ARE      RES+   E E  R  +R      +  +  K+PER R+ +R+ +R   
Sbjct  1180  EKEKAREESWGPPRESRPSEEREWDREKERDRDNQDRE-ENDKDPERERDRERDVDREDR  1238

Query  213   SQR  215
              +R
Sbjct  1239  FRR  1241


>gi|5921693|sp|Q05152|CAC1B_RABIT  Voltage-dependent N-type calcium channel subunit alpha-1B (Voltage-gated 
calcium channel subunit alpha Cav2.2) (Calcium channel, 
L type, alpha-1 polypeptide isoform 5) (Brain calcium 
channel III) (BIII)
Length=2339

 Score = 35.0 bits (79),  Expect = 0.21, Method: Composition-based stats.
 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 12/89 (13%)

Query  142   SQREPERARGSQRGPERAREN--QGARESQSHREPEGPRGSQRKPAGAR----------K  189
             ++REP R R  + GP+  +E    G R  +  R   GPR   R+   +           K
Sbjct  933   AEREPRRHRAHRHGPDPGKEGPASGTRGERRARHRTGPRACPREAESSEEPARRHRARHK  992

Query  190   SPKTPKEPERARESQREPERARESQREPE  218
             +P T +  E+ +E+  +   A E++++ E
Sbjct  993   APPTQETAEKDKEAAEKGGEATEAEKDKE  1021


>gi|1705854|sp|Q00975|CAC1B_HUMAN Gene info Voltage-dependent N-type calcium channel subunit alpha-1B (Voltage-gated 
calcium channel subunit alpha Cav2.2) (Calcium channel, 
L type, alpha-1 polypeptide isoform 5) (Brain calcium 
channel III) (BIII)
Length=2339

 Score = 35.0 bits (79),  Expect = 0.22, Method: Composition-based stats.
 Identities = 47/185 (25%), Positives = 70/185 (37%), Gaps = 39/185 (21%)

Query  51   DNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQGEP--------ERAKAS  102
            D  RGP G        G+AR    E        R   R R+    P        E  KA 
Sbjct  824  DGARGPVG--------GKARPEAAEAPEGVDPPRRHHRHRDKDKTPAAGDQDRAEAPKAE  875

Query  103  QGEPKGAREDQraperpresrreparareT--------------QRGPKRARESQREPER  148
             GEP GARE++  P R             +               R       ++REP R
Sbjct  876  SGEP-GAREERPRPHRSHSKEAAGPPEARSERGRGPGPEGGRRHHRRGSPEEAAEREPRR  934

Query  149  ARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPE  208
             R + R  + ++E  GA+  +  R   GPR      AG R++ ++ +EP R   ++ + +
Sbjct  935  HR-AHRHQDPSKECAGAKGERRARHRGGPR------AGPREA-ESGEEPARRHRARHKAQ  986

Query  209  RARES  213
             A E+
Sbjct  987  PAHEA  991


 Score = 30.4 bits (67),  Expect = 6.7, Method: Composition-based stats.
 Identities = 41/170 (24%), Positives = 61/170 (35%), Gaps = 10/170 (5%)

Query  30   RDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERA  89
            RD A  P          E P          R   ++   A   Q   EA      EP  A
Sbjct  823  RDGARGPVGGKARPEAAEAPEGVDPPRRHHRHRDKDKTPAAGDQDRAEAPKAESGEPG-A  881

Query  90   RESQGEPERAKASQG----EPKGAREDQraperpresrreparareTQRGPKRAR-----  140
            RE +  P R+ + +     E +  R     PE  R   R  +     +R P+R R     
Sbjct  882  REERPRPHRSHSKEAAGPPEARSERGRGPGPEGGRRHHRRGSPEEAAEREPRRHRAHRHQ  941

Query  141  ESQREPERARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKS  190
            +  +E   A+G +R   R     G RE++S  EP     ++ K   A ++
Sbjct  942  DPSKECAGAKGERRARHRGGPRAGPREAESGEEPARRHRARHKAQPAHEA  991


>gi|81311015|sp|Q5E7L5|IF2_VIBF1 Gene info Translation initiation factor IF-2
Length=893

 Score = 35.0 bits (79),  Expect = 0.22, Method: Composition-based stats.
 Identities = 30/144 (20%), Positives = 59/144 (40%), Gaps = 0/144 (0%)

Query  71   ESQTEPEATSKSWREPERARESQGEPERAKASQGEPKGAREDQraperpresrreparar  130
            E Q + +A   + RE E+  + + E +  + ++ E K  RE +   +R    + +    +
Sbjct  117  EEQAKRDAEEAAVRELEQKAQREAEEQAKREAEAEAKAKREAEEKAKRAEADKAKKEMTK  176

Query  131  eTQRGPKRARESQREPERARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKS  190
            + ++  K A E +   E     +   E A+  + AR+     E       Q+K A  + +
Sbjct  177  KNEQAKKEAEELKARQELEATRKAEAEAAKLVEEARKLAEENEARWKEEEQKKSAAEKDA  236

Query  191  PKTPKEPERARESQREPERARESQ  214
                     ARE++   +R  E Q
Sbjct  237  DYHVTTSSHAREAEDAADRKEEQQ  260


>gi|76363500|sp|Q9L7Q2|ZMPB_STRPN  Zinc metalloprotease zmpB precursor
Length=1906

 Score = 34.7 bits (78),  Expect = 0.34, Method: Composition-based stats.
 Identities = 31/90 (34%), Positives = 44/90 (48%), Gaps = 8/90 (8%)

Query  32   AATEPERAG-ESQREPERPGDNKRGPEGTRESQREPGRARESQTEP--EATSKSWREPE-  87
            A  E E+A  E +++PE P + K   E  ++ +  P    E   EP  E  ++S  +P+ 
Sbjct  286  APREDEKAPVEPEKQPEAPEEEKAVEETPKQEESTPDTKAEETVEPKEETVNQSIEQPKV  345

Query  88   --RARESQGEP-ERAKASQ-GEPKGAREDQ  113
               A E Q EP E  K  Q GEP   RED+
Sbjct  346  ETPAVEKQTEPTEEPKVEQAGEPVAPREDE  375


 Score = 33.9 bits (76),  Expect = 0.47, Method: Composition-based stats.
 Identities = 42/187 (22%), Positives = 68/187 (36%), Gaps = 7/187 (3%)

Query  34   TEPERAGESQREPERPGDNKRGPEGTRESQREPGRARE--SQTEPEATSKSWREPERARE  91
            TE     E + E +   D     E  +E   EP    E   + E +   K   +PE    
Sbjct  210  TEESPKEEPKSEVKPTDDTLPKVEEGKEDSAEPAPVEEVGGEVESKPEEKVAVKPESQPS  269

Query  92   SQGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARES--QREPERA  149
             +   E      GEP   RED++AP  P +    P   +  +  PK+   +   +  E  
Sbjct  270  DKPAEESKVEQAGEPVAPREDEKAPVEPEKQPEAPEEEKAVEETPKQEESTPDTKAEETV  329

Query  150  RGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPER  209
               +    ++ E          ++ E     + + AG    P  P+E E+A  +  EPE+
Sbjct  330  EPKEETVNQSIEQPKVETPAVEKQTEPTEEPKVEQAG---EPVAPREDEQAPTAPVEPEK  386

Query  210  ARESQRE  216
              E   E
Sbjct  387  QPEVPEE  393


 Score = 33.9 bits (76),  Expect = 0.55, Method: Composition-based stats.
 Identities = 40/195 (20%), Positives = 75/195 (38%), Gaps = 12/195 (6%)

Query  61   ESQREPGRARESQTEPEATSKSWREPERAR------ESQGEP-ERAKASQGEPKGAREDQ  113
            E+  +PG     + E   T +S    E+AR      E++  P E A  ++  PK   + +
Sbjct  165  ETSAKPGEVTVVEVE---TPQSITNQEQARTENQVVETEEAPKEEAPKTEESPKEEPKSE  221

Query  114  raperpresrreparareTQRGPKRARESQREPERARGSQRGPERARENQGARESQSHR-  172
              P      + E  +    +  P      + E +        PE    ++ A ES+  + 
Sbjct  222  VKPTDDTLPKVEEGKEDSAEPAPVEEVGGEVESKPEEKVAVKPESQPSDKPAEESKVEQA  281

Query  173  -EPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQREPERAresrkgprepg  231
             EP  PR  ++ P    K P+ P+E +   E+ ++ E   +++ E     +     +   
Sbjct  282  GEPVAPREDEKAPVEPEKQPEAPEEEKAVEETPKQEESTPDTKAEETVEPKEETVNQSIE  341

Query  232  rgresqrARESPGEP  246
            + +    A E   EP
Sbjct  342  QPKVETPAVEKQTEP  356


>gi|81917793|sp|Q9R0G8|NRK_MOUSE Gene info Nik-related protein kinase (Nck-interacting kinase-like embryo 
specific kinase) (NIK-like embryo-specific kinase) (NESK)
Length=1455

 Score = 33.9 bits (76),  Expect = 0.58, Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query  137  KRARESQREPERARGSQRGPERARENQGARESQSHRE-PEGPRGSQRKPAGARKSPKTPK  195
            ++ ++  + PE  +G  R PE+ R+ Q A + Q H   PE P    R+P  A    +   
Sbjct  499  EQPKDLDQVPEEFQGQDRAPEQPRQGQAAEQQQIHNPVPEQPPEEDREPEQAEVQEEA-V  557

Query  196  EPERARESQREPE  208
            EP +A    +EPE
Sbjct  558  EPPQAEIEDKEPE  570


>gi|5921454|sp|P97445|CAC1A_MOUSE Gene info Voltage-dependent P/Q-type calcium channel subunit alpha-1A (Voltage-gated 
calcium channel subunit alpha Cav2.1) (Calcium 
channel, L type, alpha-1 polypeptide isoform 4) (Brain calcium 
channel I) (BI)
Length=2164

 Score = 33.5 bits (75),  Expect = 0.70, Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 34/83 (40%), Gaps = 4/83 (4%)

Query  23   LLDCVTQRDAATEPERAGESQREPERPGDNKRGPEGTR----ESQREPGRARESQTEPEA  78
            ++D    R+  T   RA E+ R   RP ++ R P+  R      +R PGR      E E 
Sbjct  777  VVDPQENRNNNTNKSRAPEALRPTARPRESARDPDARRAWPGSPERAPGREGPYGRESEL  836

Query  79   TSKSWREPERARESQGEPERAKA  101
              +    P        + ERAKA
Sbjct  837  QQREHAPPREHAPWDADTERAKA  859


>gi|62512118|sp|Q8DQN5|ZMPB_STRR6 Gene info Zinc metalloprotease zmpB precursor
Length=1876

 Score = 33.1 bits (74),  Expect = 0.83, Method: Composition-based stats.
 Identities = 33/162 (20%), Positives = 67/162 (41%), Gaps = 6/162 (3%)

Query  61   ESQREPGRARESQTE-PEATS--KSWREPERARESQGEP-ERAKASQGEPKGAREDQrap  116
            E+  +PG     + E P++T+  +  R   +  E++  P E A  ++  PK   + +  P
Sbjct  165  ETSAKPGEVTVVEVETPQSTTNQEQARTENQVVETEEAPKEEAPKTEESPKEEPKSEVKP  224

Query  117  erpresrreparareTQRGPKRARESQREPERARGSQRGPERARENQGARESQSHR--EP  174
                  + E  +    +  P      + E +        PE    ++ A ES+  +  EP
Sbjct  225  TDDTLPKVEEGKEDSAEPAPVEEVGGEVESKPEEKVAVKPESQPSDKPAEESKVEQAGEP  284

Query  175  EGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQRE  216
              PR  ++ P      P+ P+E +   E+ ++ E   +++ E
Sbjct  285  VAPRKDEQAPVEPENQPEAPEEEKAVEETPKQEESTPDTKAE  326





------------------------------------------------------------------------------------

BLASTP contre nr de l'ORF avec ATG,cadre de lecture 2 sur le brin indirect (base 65->823)

Sequences producing significant alignments:                        (Bits)  Value

gi|71666455|ref|XP_820186.1|  trans-sialidase [Trypanosoma cru...  53.1    1e-05  Gene info
gi|66359950|ref|XP_627153.1|  sushi-domain containing secreted...  52.8    1e-05  Gene info
gi|22209012|gb|AAC98688.2|  surface antigen PHGST#5 [Trypanosoma   52.0    3e-05
gi|83317505|ref|XP_731189.1|  hypothetical protein PY03200 [Pl...  50.4    8e-05  Gene info
gi|758803|gb|AAB70878.1|  peritrophin-95 precursor [Lucilia cupri  48.9    2e-04
gi|984808|gb|AAA92532.1|  peritrophin-95 precursor                 48.1    4e-04
gi|49478820|ref|YP_038951.1|  conserved hypothetical protein, ...  46.6    0.001  Gene info
gi|52140598|ref|YP_086232.1|  cell surface protein [Bacillus c...  46.2    0.002  Gene info
gi|71413651|ref|XP_808957.1|  trans-sialidase [Trypanosoma cru...  45.4    0.003  Gene info
gi|26342987|dbj|BAC35150.1|  unnamed protein product [Mus musculu  44.3    0.006  UniGene infoGene info
gi|28481366|ref|XP_139295.2|  PREDICTED: similar to caspase re...  44.3    0.006  UniGene infoGene info
gi|27807135|ref|NP_777057.1|  calcium channel, voltage-depende...  43.5    0.009  UniGene infoGene info
gi|118093208|ref|XP_421831.2|  PREDICTED: similar to Inpp5a prote  43.1    0.011
gi|115762736|ref|XP_785240.2|  PREDICTED: similar to WD repeat...  42.7    0.017  Gene info
gi|115964466|ref|XP_001191416.1|  PREDICTED: similar to WD rep...  42.7    0.017  Gene info
gi|47125144|gb|AAH70605.1|  LOC431817 protein [Xenopus laevis]     42.4    0.018  UniGene infoGene info
gi|30022968|ref|NP_834599.1|  Cell surface protein [Bacillus c...  42.0    0.024  Gene info
gi|47206643|emb|CAF91366.1|  unnamed protein product [Tetraodon n  41.6    0.031
gi|83616161|gb|ABC25605.1|  anonymous antigen-2 [Babesia bovis]    41.6    0.036
gi|71980588|ref|NP_001020985.1|  UNCoordinated family member (...  41.6    0.039  UniGene infoGene info
gi|71980604|ref|NP_001020990.1|  UNCoordinated family member (...  41.2    0.044  UniGene infoGene info
gi|1160355|gb|AAB00542.1|  UNC-89                                  41.2    0.047
gi|7511618|pir||T29757  protein UNC-89 - Caenorhabditis elegans    41.2    0.048
gi|71980586|ref|NP_001020984.1|  UNCoordinated family member (...  41.2    0.049  UniGene infoGene info
gi|45935149|gb|AAS79607.1|  hypothetical protein [Ipomoea trifida  40.8    0.058
gi|52144762|ref|YP_082066.1|  possible internalin protein [Bac...  40.8    0.058  Gene info
gi|71666350|ref|XP_820135.1|  trans-sialidase [Trypanosoma cru...  40.8    0.060  Gene info
gi|71406403|ref|XP_805742.1|  hypothetical protein [Trypanosom...  40.4    0.071  Gene info
gi|111307761|gb|AAI21193.1|  Unknown (protein for IMAGE:4960177)   40.4    0.073
gi|16769850|gb|AAL29144.1|  SD04745p [Drosophila melanogaster]     38.5    0.26   UniGene info
gi|71408769|ref|XP_806768.1|  kinetoplast DNA-associated prote...  37.7    0.44   Gene info
gi|161956|gb|AAB97873.1|  surface antigen [Trypanosoma cruzi]      37.7    0.50 
gi|6978579|ref|NP_037050.1|  calcium channel, voltage-dependen...  37.7    0.50   UniGene infoGene info
gi|118093099|ref|XP_421787.2|  PREDICTED: similar to p167 [Gallus  37.4    0.73 
gi|83750916|ref|ZP_00947331.1|  hypothetical protein BbacK_010...  37.0    0.91 
gi|67623325|ref|XP_667945.1|  Sushi domain [Cryptosporidium ho...  37.0    0.91   Gene info
gi|71649745|ref|XP_813586.1|  trans-sialidase [Trypanosoma cru...  36.6    1.1    Gene info
gi|71657429|ref|XP_817230.1|  hypothetical protein [Trypanosom...  36.6    1.1    Gene info
gi|24584968|ref|NP_609877.2|  nucampholin CG12750-PA [Drosophi...  36.6    1.2    UniGene infoGene info
gi|71021185|ref|XP_760823.1|  hypothetical protein UM04676.1 [...  35.8    1.8    Gene info
gi|71648919|ref|XP_813237.1|  trans-sialidase [Trypanosoma cru...  35.8    2.1    Gene info
gi|114633007|ref|XP_001153575.1|  PREDICTED: eukaryotic transl...  35.4    2.2    Gene info
gi|4503509|ref|NP_003741.1|  eukaryotic translation initiation...  35.4    2.3    UniGene infoGene info
gi|89365957|gb|AAI14430.1|  Eukaryotic translation initiation ...  35.4    2.3    UniGene infoGene info
gi|118124449|ref|XP_001235161.1|  PREDICTED: similar to trans-...  35.4    2.4  
gi|161958|gb|AAB97874.1|  surface antigen [Trypanosoma cruzi]      35.4    2.6  
gi|40788877|dbj|BAA09488.2|  KIAA0139 [Homo sapiens]               35.4    2.8    UniGene infoGene info
gi|5921693|sp|Q05152|CAC1B_RABIT  Voltage-dependent N-type cal...  35.0    2.8  
gi|109094975|ref|XP_001117433.1|  PREDICTED: hypothetical protein  34.3    5.7    Gene info
gi|115462723|ref|NP_001054961.1|  Os05g0225800 [Oryza sativa (...  34.3    6.2    Gene info
gi|115462725|ref|NP_001054962.1|  Os05g0226000 [Oryza sativa (...  33.9    6.8    Gene info
gi|73999959|ref|XP_861013.1|  PREDICTED: hypothetical protein XP_  33.5    8.3    Gene info
gi|76625356|ref|XP_601217.2|  PREDICTED: similar to PHD finger pr  33.5    9.0    Gene info
gi|73544167|ref|XP_847978.1|  hypothetical protein LMJ_0280 [L...  33.5    9.4    Gene info


gi|71666455|ref|XP_820186.1| Gene info trans-sialidase [Trypanosoma cruzi strain CL Brener]
 gi|70885521|gb|EAN98335.1| Gene info trans-sialidase, putative [Trypanosoma cruzi]
Length=1133

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 55/214 (25%), Positives = 80/214 (37%), Gaps = 2/214 (0%)

Query  35   EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  94
            EP+ AG    EP+  G     P+       EP  A     EP++      EP+ A     
Sbjct  756  EPKSAGPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPA  815

Query  95   EPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQR  154
            E + A+    EPK A       +       EP  A      PK A     EP+ A     
Sbjct  816  ESKSAEPKPAEPKSAEPKPAESKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPA  875

Query  155  GPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQ  214
             P+ A E + A    +  +P  P+ ++ KPA  + +   P EP+ A     EP+ A    
Sbjct  876  EPKSA-EPKPAESKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKP  934

Query  215  REPERAresrkgprepgrgresqrARE-SPGEPQ  247
             EP  A      P+         ++ E  P EP+
Sbjct  935  AEPNSAEPKPAEPKSAEPKPAEPKSAEPKPAEPK  968


 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 62/247 (25%), Positives = 96/247 (38%), Gaps = 10/247 (4%)

Query  11   SSGLPVGEIPAKLLDCVTQRDAATEPERAGESQREPE----RPGDNKRG-PEGTRESQRE  65
            +S +P G  P+   +  +      EP+ AG    EP+    +P + K   P+       E
Sbjct  742  TSSVPSGGAPSTPAEPKSAGPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAE  801

Query  66   PGRARESQTEPEATSKSWREPERARESQGEPERAKASQGEPKGAREDQraperpresrre  125
            P  A     EP+       EP+ A     EP+ A++   EPK A      P+       E
Sbjct  802  PKPAEPKSAEPKPAESKSAEPKPAEPKSAEPKPAESKSAEPKPAEPKSAEPKPAEPKSAE  861

Query  126  parareTQRGPKRARESQREPERARGSQRGPE----RARENQGARESQSHREPEGPRGSQ  181
            P  A      PK A     EP+ A     GP+    ++ E + A    +  +P  P+ ++
Sbjct  862  PKPAEPKSAEPKPAEPKSAEPKPAESKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAE  921

Query  182  RKPAGARKSPKTPKEPERARESQREPERARESQREPERAresrkgprepgrgresqrARE  241
             KPA  + +   P EP  A     EP+ A     EP+ A      P+         ++ E
Sbjct  922  PKPAEPKSAEPKPAEPNSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAE  981

Query  242  -SPGEPQ  247
              P EP+
Sbjct  982  PKPAEPK  988


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 53/220 (24%), Positives = 82/220 (37%), Gaps = 5/220 (2%)

Query  33    ATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARES  92
             + EP+ A     EP+        P+       EP  A     EP+       EP+ A   
Sbjct  799   SAEPKPAEPKSAEPKPAESKSAEPKPAEPKSAEPKPAESKSAEPKPAEPKSAEPKPAEPK  858

Query  93    QGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGS  152
               EP+ A+    EPK A      P+        P  A      PK A     EP+ A   
Sbjct  859   SAEPKPAEPKSAEPKPAEPKSAEPKPAESKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPK  918

Query  153   QRGPE----RARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPE  208
                P+    ++ E + A  + +  +P  P+ ++ KPA  + +   P EP+ A     EP+
Sbjct  919   SAEPKPAEPKSAEPKPAEPNSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPK  978

Query  209   RARESQREPERAresrkgprepgrgresqrARE-SPGEPQ  247
              A     EP+ A      P+         ++ E  P EP+
Sbjct  979   SAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPK  1018


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 52/223 (23%), Positives = 79/223 (35%), Gaps = 4/223 (1%)

Query  33    ATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARES  92
             + EP+ A     EP+        P+       EP  A     EP+       EP+ A   
Sbjct  819   SAEPKPAEPKSAEPKPAESKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPK  878

Query  93    QGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGS  152
               EP+ A++    PK A      P+       EP  A      PK A     EP+ A  +
Sbjct  879   SAEPKPAESKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPN  938

Query  153   QRGPE----RARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPE  208
                P+    ++ E + A    +  +P  P+ ++ KPA  + +   P EP+ A     EP+
Sbjct  939   SAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPK  998

Query  209   RARESQREPERAresrkgprepgrgresqrARESPGEPQRTSQ  251
              A     EP+ A      P+          A  S        Q
Sbjct  999   SAEPKPAEPKSAEPKPAEPKSAEPKPAEPNAATSSAREGTADQ  1041


>gi|66359950|ref|XP_627153.1| Gene info sushi-domain containing secreted protein [Cryptosporidium parvum 
Iowa II]
 gi|46228572|gb|EAK89442.1| Gene info sushi-domain containing secreted protein; with a signal peptide, 
low complexity region followed by a sushi domain [Cryptosporidium 
parvum]
Length=1006

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 34/189 (17%), Positives = 89/189 (47%), Gaps = 2/189 (1%)

Query  28   TQRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPE  87
            + +   ++PE +   + +P+ P  +++ PE ++  + +PG ++  +T+P  +     +P 
Sbjct  73   SSKSGESKPEESNLDKTKPKEPSPDEKKPEESKSDEAKPGESKSDETKPGESKSDETKPG  132

Query  88   RARESQGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPE  147
             ++  + +P  +K+ + +P  ++ D+  P   +    +P   +  +  P+ A+  + +PE
Sbjct  133  ESKSDEAKPGESKSDETKPGESKSDETKPGESKSDESKPEETKPDETKPEEAKSEEAKPE  192

Query  148  RARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREP  207
              +  ++ PE ++  +   E   H E    +G+  +P        +  + +  +E + E 
Sbjct  193  ETKPDEKNPEESKPEETKPEEAKHDEENSGKGNSTEPKSLESIENS--KDDLKKEDKSED  250

Query  208  ERARESQRE  216
              A+ES  E
Sbjct  251  SSAKESTEE  259


 Score = 37.0 bits (84),  Expect = 0.74, Method: Composition-based stats.
 Identities = 29/192 (15%), Positives = 81/192 (42%), Gaps = 1/192 (0%)

Query  61   ESQREPGRARESQTEPEATSKSWREPERARESQGEPERAKASQGEPKGAREDQraperpr  120
            E  +E   ++  +++PE ++    +P+     + +PE +K+ + +P  ++ D+  P   +
Sbjct  66   EQAKEQSSSKSGESKPEESNLDKTKPKEPSPDEKKPEESKSDEAKPGESKSDETKPGESK  125

Query  121  esrreparareTQRGPKRARESQREPERARGSQRGPERARENQGARESQSHREPEGPRGS  180
                +P  ++  +  P  ++  + +P  ++  +  P  ++ ++   E     E + P  +
Sbjct  126  SDETKPGESKSDEAKPGESKSDETKPGESKSDETKPGESKSDESKPEETKPDETK-PEEA  184

Query  181  QRKPAGARKSPKTPKEPERARESQREPERARESQREPERAresrkgprepgrgresqrAR  240
            + + A   ++    K PE ++  + +PE A+  +    +   +     E     +    +
Sbjct  185  KSEEAKPEETKPDEKNPEESKPEETKPEEAKHDEENSGKGNSTEPKSLESIENSKDDLKK  244

Query  241  ESPGEPQRTSQS  252
            E   E     +S
Sbjct  245  EDKSEDSSAKES  256


>gi|22209012|gb|AAC98688.2|  surface antigen PHGST#5 [Trypanosoma cruzi]
Length=796

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 60/238 (25%), Positives = 90/238 (37%), Gaps = 2/238 (0%)

Query  11   SSGLPVGEIPAKLLDCVTQRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRAR  70
            +S +P G  P+K  +  +      EP+ AG    EP+        P+       EP  A 
Sbjct  462  ASSVPSGGAPSKPAEPKSAEPEPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAG  521

Query  71   ESQTEPEATSKSWREPERARESQGEPERAKASQGEPKGAREDQraperpresrreparar  130
                EP++      EP+ A     EP+ A+    EPK A      P+       EP  A 
Sbjct  522  PKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAE  581

Query  131  eTQRGPKRARESQREPERARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKS  190
                 PK A     EP+ A      P+ A E + A    +  +P  P+ ++ +P   + +
Sbjct  582  PKPTEPKSAEPKPAEPKSAEPEPAEPKSA-EPEPAEPKSAEPKPAEPKSAEPEPTEPKSA  640

Query  191  PKTPKEPERARESQREPERARESQREPERAresrkgprepgrgresqrARE-SPGEPQ  247
               P EP  A     EP+ A     EP+ A      P+  G       + E  P EP+
Sbjct  641  GPKPAEPYSAEPKPAEPKSAEPEPTEPKSAEPEPTEPKSAGPKPAEPYSAEPKPAEPK  698


 Score = 45.1 bits (105),  Expect = 0.003, Method: Composition-based stats.
 Identities = 55/213 (25%), Positives = 79/213 (37%), Gaps = 2/213 (0%)

Query  36   PERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQGE  95
            P  AG  Q +      +     G      EP  A     EP++      EP+ A     E
Sbjct  447  PATAGPQQTDQTTLNASSVPSGGAPSKPAEPKSAEPEPAEPKSAGPKPAEPKSAEPKPAE  506

Query  96   PERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQRG  155
            P+ A+    EPK A      P+       EP  A      PK A     EP+ A      
Sbjct  507  PKSAEPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAE  566

Query  156  PERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQR  215
            P+ A E + A    +  +P  P+ ++ KPA  + +   P EP+ A     EP+ A     
Sbjct  567  PKSA-EPKPAEPKSAEPKPTEPKSAEPKPAEPKSAEPEPAEPKSAEPEPAEPKSAEPKPA  625

Query  216  EPERAresrkgprepgrgresqrARE-SPGEPQ  247
            EP+ A      P+  G       + E  P EP+
Sbjct  626  EPKSAEPEPTEPKSAGPKPAEPYSAEPKPAEPK  658


 Score = 43.1 bits (100),  Expect = 0.012, Method: Composition-based stats.
 Identities = 46/183 (25%), Positives = 69/183 (37%), Gaps = 1/183 (0%)

Query  35   EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  94
            EP+ A     EP+        P+       EP  A     EP++      EP+ A     
Sbjct  526  EPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPT  585

Query  95   EPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQR  154
            EP+ A+    EPK A  +   P+       EP  A      PK A     EP+ A G + 
Sbjct  586  EPKSAEPKPAEPKSAEPEPAEPKSAEPEPAEPKSAEPKPAEPKSAEPEPTEPKSA-GPKP  644

Query  155  GPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQ  214
                + E + A    +  EP  P+ ++ +P   + +   P EP  A     EP+ A  + 
Sbjct  645  AEPYSAEPKPAEPKSAEPEPTEPKSAEPEPTEPKSAGPKPAEPYSAEPKPAEPKSAELNA  704

Query  215  REP  217
              P
Sbjct  705  TTP  707


 Score = 40.8 bits (94),  Expect = 0.065, Method: Composition-based stats.
 Identities = 51/197 (25%), Positives = 75/197 (38%), Gaps = 2/197 (1%)

Query  52   NKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQGEPERAKASQGEPKGARE  111
            N+R    T+ +   P  A   QT+    + S      A     EP+ A+    EPK A  
Sbjct  433  NERVTTNTQPTVPSPATAGPQQTDQTTLNASSVPSGGAPSKPAEPKSAEPEPAEPKSAGP  492

Query  112  DQraperpresrreparareTQRGPKRARESQREPERARGSQRGPERARENQGARESQSH  171
                P+       EP  A      PK A     EP+ A      P+ A E + A    + 
Sbjct  493  KPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPKPAEPKSA-EPKPAEPKSAE  551

Query  172  REPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQREPERAresrkgprepg  231
             EP  P+ ++ KPA  + +   P EP+ A     EP+ A     EP+ A      P+   
Sbjct  552  PEPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPTEPKSAEPKPAEPKSAEPEPAEPKSAE  611

Query  232  rgresqrARE-SPGEPQ  247
                  ++ E  P EP+
Sbjct  612  PEPAEPKSAEPKPAEPK  628


 Score = 39.3 bits (90),  Expect = 0.18, Method: Composition-based stats.
 Identities = 42/183 (22%), Positives = 65/183 (35%), Gaps = 4/183 (2%)

Query  42   SQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQGEPERAKA  101
            +  +P  P     GP+ T ++              +       EPE A      P+ A+ 
Sbjct  438  TNTQPTVPSPATAGPQQTDQTTLNASSVPSGGAPSKPAEPKSAEPEPAEPKSAGPKPAEP  497

Query  102  SQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQRGPE----  157
               EPK A      P+        P  A      PK A     EP+ A      PE    
Sbjct  498  KSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEP  557

Query  158  RARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQREP  217
            ++ E + A    +  +P  P+ ++ KP   + +   P EP+ A     EP+ A     EP
Sbjct  558  KSAEPKPAEPKSAEPKPAEPKSAEPKPTEPKSAEPKPAEPKSAEPEPAEPKSAEPEPAEP  617

Query  218  ERA  220
            + A
Sbjct  618  KSA  620


>gi|83317505|ref|XP_731189.1| Gene info hypothetical protein PY03200 [Plasmodium yoelii yoelii str. 17XNL]
 gi|23491150|gb|EAA22754.1| Gene info hypothetical protein [Plasmodium yoelii yoelii]
Length=542

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 32/124 (25%), Positives = 69/124 (55%), Gaps = 0/124 (0%)

Query  31   DAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERAR  90
            DA  +P  A +++R+P    D KR P  + +++REP  A + + +P +++ + R+     
Sbjct  43   DAKRKPVLATDAKRKPVLATDAKREPASSTDAKREPASATDVKRKPASSTDAKRKSASTT  102

Query  91   ESQGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERAR  150
            +++ EP  A  ++ +P  A + +R      +++R+ A A + +R P  A +++REP  + 
Sbjct  103  DAKREPASATVAKRKPASATDAKRKSASATDAKRKSASAIDAKREPVLATDAKREPASST  162

Query  151  GSQR  154
             ++R
Sbjct  163  DAKR  166


 Score = 43.1 bits (100),  Expect = 0.011, Method: Composition-based stats.
 Identities = 38/157 (24%), Positives = 79/157 (50%), Gaps = 8/157 (5%)

Query  27   VTQRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREP  86
            V+ +  A+E   A + +R+P    D KR P    +++R+P  A +++ EP +++ + REP
Sbjct  19   VSNKSFASELASATDVKRKPASATDAKRKPVLATDAKRKPVLATDAKREPASSTDAKREP  78

Query  87   ERARESQGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREP  146
              A + + +P  +  ++ +     + +R P     ++R+PA A + +R    A +++R+ 
Sbjct  79   ASATDVKRKPASSTDAKRKSASTTDAKREPASATVAKRKPASATDAKRKSASATDAKRKS  138

Query  147  ERARGSQRGPERARENQGARESQSHREPEGPRGSQRK  183
              A  ++R P  A        + + REP     ++RK
Sbjct  139  ASAIDAKREPVLA--------TDAKREPASSTDAKRK  167


>gi|758803|gb|AAB70878.1|  peritrophin-95 precursor [Lucilia cuprina]
Length=480

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 0/76 (0%)

Query  32   AATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARE  91
            A T+PE +  +  EPE+       PE +  +  EP   + ++TEPE T+ +  EPE  + 
Sbjct  367  AKTDPEESTPATTEPEKSTPATTDPEKSTLATTEPEETKPTETEPEKTTPATTEPEETKP  426

Query  92   SQGEPERAKASQGEPK  107
            ++ EPE+   +  EP+
Sbjct  427  TETEPEKTTPATTEPE  442


 Score = 37.7 bits (86),  Expect = 0.44, Method: Composition-based stats.
 Identities = 29/134 (21%), Positives = 59/134 (44%), Gaps = 10/134 (7%)

Query  29   QRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPER  88
            + + A   E A  ++   +     K  PE +  ++ +P  +  + TEPE ++ +  +PE+
Sbjct  334  KNNGACYLETATTTEEPSKESTPAKTDPEESTPAKTDPEESTPATTEPEKSTPATTDPEK  393

Query  89   ARESQGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPER  148
            +  +  EPE  K ++ EP+          +   +  EP   + T+  P++   +  EPE 
Sbjct  394  STLATTEPEETKPTETEPE----------KTTPATTEPEETKPTETEPEKTTPATTEPEP  443

Query  149  ARGSQRGPERAREN  162
               +  G   A +N
Sbjct  444  VETTLDGKNPALDN  457


>gi|984808|gb|AAA92532.1|  peritrophin-95 precursor
Length=456

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 0/76 (0%)

Query  32   AATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARE  91
            A T+PE +  +  EPE+       PE +  +  EP   + ++TEPE T+ +  EPE  + 
Sbjct  343  AKTDPEESTPATTEPEKSTPATTDPEKSTLATTEPEETKPTETEPEKTTPATTEPEETKP  402

Query  92   SQGEPERAKASQGEPK  107
            ++ EPE+   +  EP+
Sbjct  403  TETEPEKTTPATTEPE  418


 Score = 37.4 bits (85),  Expect = 0.71, Method: Composition-based stats.
 Identities = 29/134 (21%), Positives = 59/134 (44%), Gaps = 10/134 (7%)

Query  29   QRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPER  88
            + + A   E A  ++   +     K  PE +  ++ +P  +  + TEPE ++ +  +PE+
Sbjct  310  KNNGACYLETATTTEEPSKESTPAKTDPEESTPAKTDPEESTPATTEPEKSTPATTDPEK  369

Query  89   ARESQGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPER  148
            +  +  EPE  K ++ EP+          +   +  EP   + T+  P++   +  EPE 
Sbjct  370  STLATTEPEETKPTETEPE----------KTTPATTEPEETKPTETEPEKTTPATTEPEP  419

Query  149  ARGSQRGPERAREN  162
               +  G   A +N
Sbjct  420  VETTLDGKNPALDN  433


>gi|49478820|ref|YP_038951.1| Gene info conserved hypothetical protein, possible cell surface anchor 
[Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|49330376|gb|AAT61022.1| Gene info conserved hypothetical protein, possible cell surface anchor 
[Bacillus thuringiensis serovar konkukian str. 97-27]
Length=3471

 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 51/184 (27%), Positives = 72/184 (39%), Gaps = 41/184 (22%)

Query  35    EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  94
             EPE   E  +EPE   ++ + PE   E  +EP    E   EPE   +  +EPE   E   
Sbjct  3270  EPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPK  3329

Query  95    EPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQR  154
             EPE       EP+   ED                           +E + +PE  +  + 
Sbjct  3330  EPEVKPEDPKEPEVKPED--------------------------PKEPEVKPEDPKEPEV  3363

Query  155   GPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQ  214
              PE  +E +         +PE P+  + K       P+ PKEPE   E  +EPE   E  
Sbjct  3364  KPEDPKEPE--------VKPEDPKEPEVK-------PEDPKEPEVKPEDPKEPEVKPEDP  3408

Query  215   REPE  218
             +EPE
Sbjct  3409  KEPE  3412


 Score = 44.3 bits (103),  Expect = 0.005, Method: Composition-based stats.
 Identities = 34/132 (25%), Positives = 68/132 (51%), Gaps = 0/132 (0%)

Query  30    RDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERA  89
             ++   +PE   E + +PE P + +  PE  +E + +P   +E + +PE   +   +PE  
Sbjct  3279  KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP  3338

Query  90    RESQGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERA  149
             +E + +PE  K  + +P+  +E +  PE P+E   +P   +E +  P+  +E + +PE  
Sbjct  3339  KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP  3398

Query  150   RGSQRGPERARE  161
             +  +  PE  +E
Sbjct  3399  KEPEVKPEDPKE  3410


>gi|52140598|ref|YP_086232.1| Gene info cell surface protein [Bacillus cereus E33L]
 gi|51974067|gb|AAU15617.1| Gene info cell surface protein [Bacillus cereus E33L]
Length=3472

 Score = 46.2 bits (108),  Expect = 0.002, Method: Composition-based stats.
 Identities = 51/184 (27%), Positives = 72/184 (39%), Gaps = 41/184 (22%)

Query  35    EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  94
             EPE   E  +EPE   ++ + PE   E  +EP    E   EPE   +  +EPE   E   
Sbjct  3271  EPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPK  3330

Query  95    EPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQR  154
             EPE       EP+   ED                           +E + +PE  +  + 
Sbjct  3331  EPEVKPEDPKEPEVKPED--------------------------PKEPEVKPEDPKEPEV  3364

Query  155   GPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQ  214
              PE  +E +         +PE P+  + K       P+ PKEPE   E  +EPE   E  
Sbjct  3365  KPEDPKEPE--------VKPEDPKEPEVK-------PEDPKEPEVKPEDPKEPEVKPEDP  3409

Query  215   REPE  218
             +EPE
Sbjct  3410  KEPE  3413


 Score = 43.9 bits (102),  Expect = 0.007, Method: Composition-based stats.
 Identities = 34/132 (25%), Positives = 68/132 (51%), Gaps = 0/132 (0%)

Query  30    RDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERA  89
             ++   +PE   E + +PE P + +  PE  +E + +P   +E + +PE   +   +PE  
Sbjct  3280  KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP  3339

Query  90    RESQGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERA  149
             +E + +PE  K  + +P+  +E +  PE P+E   +P   +E +  P+  +E + +PE  
Sbjct  3340  KEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDPKEPEVKPEDP  3399

Query  150   RGSQRGPERARE  161
             +  +  PE  +E
Sbjct  3400  KEPEVKPEDPKE  3411


>gi|71413651|ref|XP_808957.1| Gene info trans-sialidase [Trypanosoma cruzi strain CL Brener]
 gi|70873262|gb|EAN87106.1| Gene info trans-sialidase, putative [Trypanosoma cruzi]
Length=1446

 Score = 45.4 bits (106),  Expect = 0.003, Method: Composition-based stats.
 Identities = 61/238 (25%), Positives = 92/238 (38%), Gaps = 2/238 (0%)

Query  11   SSGLPVGEIPAKLLDCVTQRDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRAR  70
            +S +P G  P+K  +  +      EP+ AG    EP+        P+       EP  A 
Sbjct  742  ASSVPSGGAPSKPAEPKSAEPEPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAG  801

Query  71   ESQTEPEATSKSWREPERARESQGEPERAKASQGEPKGAREDQraperpresrreparar  130
                EP++      EP+ A     EP+ A+    EPK A      P+       EP  A 
Sbjct  802  PKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAE  861

Query  131  eTQRGPKRARESQREPERARGSQRGPERARENQGARESQSHREPEGPRGSQRKPAGARKS  190
                 PK A     EP+ A      P+ A E + A    +  +P  P+ ++ KPA  + +
Sbjct  862  PKPAEPKSAEPEPAEPKSAEPKPAEPKSA-EPEPAEPKSAEPKPAEPKSAEPKPAEPKSA  920

Query  191  PKTPKEPERARESQREPERARESQREPERAresrkgprepgrgresqrARE-SPGEPQ  247
               P EP+ A     EP+ A     EP+ A      P+         ++ E  P EP+
Sbjct  921  EPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPK  978


 Score = 42.7 bits (99),  Expect = 0.016, Method: Composition-based stats.
 Identities = 52/187 (27%), Positives = 74/187 (39%), Gaps = 1/187 (0%)

Query  34    TEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQ  93
             T+P+ AG    EP+  G     P+       EP  A     EP++      EP+ A    
Sbjct  1125  TKPKSAGPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKP  1184

Query  94    GEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQ  153
              EP+ A+    EPK A  +   P+       EP  A      P  A     EP+ A    
Sbjct  1185  AEPKSAEPEPAEPKSAEPEPTEPKSAEPEPTEPKSAEPKPAEPYSAEPEPTEPKSAEPKP  1244

Query  154   RGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARES  213
               P+ A E + A    +  EP  P+ ++ KPA  + +   P EP+ A     EP  A   
Sbjct  1245  AEPKSA-EPEPAEPKSAEPEPAEPKSAEPKPAEPKSAEPEPTEPKSAGPKPAEPYSAEPK  1303

Query  214   QREPERA  220
               EP+ A
Sbjct  1304  PAEPKSA  1310


 Score = 41.2 bits (95),  Expect = 0.045, Method: Composition-based stats.
 Identities = 51/186 (27%), Positives = 72/186 (38%), Gaps = 1/186 (0%)

Query  35    EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  94
             EP+ A     EP+        P+       EP  A     EP++      EP+ A     
Sbjct  886   EPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPKPA  945

Query  95    EPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQR  154
             EP+ A+    EPK A      P+       EP  A      PK A     EP+ A     
Sbjct  946   EPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPA  1005

Query  155   GPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQ  214
              P+ A E + A    +  EP  P+ ++ KPA  + +   P EP+ A     EP+ A    
Sbjct  1006  EPKSA-EPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPEP  1064

Query  215   REPERA  220
              EP+ A
Sbjct  1065  TEPKSA  1070


 Score = 41.2 bits (95),  Expect = 0.051, Method: Composition-based stats.
 Identities = 55/209 (26%), Positives = 73/209 (34%), Gaps = 6/209 (2%)

Query  33    ATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARES  92
             + EPE A     EP+       GP+       EP  A     EPE T      P+ A   
Sbjct  1079  SAEPEPAEPKSAEPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPEPTKPKSAGPKPAEPK  1138

Query  93    QGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGS  152
                P+ A+    EPK A      P+       EP  A     GPK A     EPE A   
Sbjct  1139  SAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPEPAEPK  1198

Query  153   QRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARE  212
                PE            +  EP  P+ ++ KPA    +   P EP+ A     EP+ A  
Sbjct  1199  SAEPEPTEPK------SAEPEPTEPKSAEPKPAEPYSAEPEPTEPKSAEPKPAEPKSAEP  1252

Query  213   SQREPERAresrkgprepgrgresqrARE  241
                EP+ A      P+         ++ E
Sbjct  1253  EPAEPKSAEPEPAEPKSAEPKPAEPKSAE  1281


 Score = 40.0 bits (92),  Expect = 0.10, Method: Composition-based stats.
 Identities = 49/186 (26%), Positives = 72/186 (38%), Gaps = 1/186 (0%)

Query  35    EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  94
             EP+ A     EP+  G     P+       EP  A     EP++      EP+ A     
Sbjct  916   EPKSAEPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPA  975

Query  95    EPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQR  154
             EP+ A+    EPK A      P+       EP  A      PK A     EP+ A     
Sbjct  976   EPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPA  1035

Query  155   GPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQ  214
              P+ A E + A    +  +P  P+ ++ +P   + +   P EP+ A     EP+ A    
Sbjct  1036  EPKSA-EPKPAEPKSAGPKPAEPKSAEPEPTEPKSAGPKPAEPKSAEPEPAEPKSAEPKP  1094

Query  215   REPERA  220
              EP+ A
Sbjct  1095  AEPKSA  1100


 Score = 40.0 bits (92),  Expect = 0.10, Method: Composition-based stats.
 Identities = 50/186 (26%), Positives = 71/186 (38%), Gaps = 1/186 (0%)

Query  35    EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  94
             EP+ A     EP+  G     P+       EP  A     EP++      EP+ A     
Sbjct  1036  EPKSAEPKPAEPKSAGPKPAEPKSAEPEPTEPKSAGPKPAEPKSAEPEPAEPKSAEPKPA  1095

Query  95    EPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQR  154
             EP+ A     EPK A      P+       +P  A      PK A     EP+ A     
Sbjct  1096  EPKSAGPKPAEPKSAEPKPAEPKSAEPEPTKPKSAGPKPAEPKSAGPKPAEPKSAEPKPA  1155

Query  155   GPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQ  214
              P+ A E + A    +  +P  P+ +  KPA  + +   P EP+ A     EP+ A    
Sbjct  1156  EPKSA-EPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPEPAEPKSAEPEPTEPKSAEPEP  1214

Query  215   REPERA  220
              EP+ A
Sbjct  1215  TEPKSA  1220


 Score = 39.7 bits (91),  Expect = 0.12, Method: Composition-based stats.
 Identities = 55/214 (25%), Positives = 82/214 (38%), Gaps = 2/214 (0%)

Query  35    EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  94
             EP+ AG    EP+        P+       EP  A     EP++      EP+ A     
Sbjct  1046  EPKSAGPKPAEPKSAEPEPTEPKSAGPKPAEPKSAEPEPAEPKSAEPKPAEPKSAGPKPA  1105

Query  95    EPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQR  154
             EP+ A+    EPK A  +   P+       EP  A      PK A     EP+ A     
Sbjct  1106  EPKSAEPKPAEPKSAEPEPTKPKSAGPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPA  1165

Query  155   GPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQ  214
              P+ A E + A    +  +P  P+ ++ +PA  + +   P EP+ A     EP+ A    
Sbjct  1166  EPKSA-EPKPAEPKSAGPKPAEPKSAEPEPAEPKSAEPEPTEPKSAEPEPTEPKSAEPKP  1224

Query  215   REPERAresrkgprepgrgresqrARE-SPGEPQ  247
              EP  A      P+         ++ E  P EP+
Sbjct  1225  AEPYSAEPEPTEPKSAEPKPAEPKSAEPEPAEPK  1258


 Score = 38.1 bits (87),  Expect = 0.41, Method: Composition-based stats.
 Identities = 49/192 (25%), Positives = 72/192 (37%), Gaps = 4/192 (2%)

Query  33    ATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARES  92
             + EPE A     EP+        P+        P  A     EPE T      P+ A   
Sbjct  1019  SAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPEPTEPKSAGPKPAEPK  1078

Query  93    QGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGS  152
               EPE A+    EPK A      P+       EP  A      P+  +     P+ A   
Sbjct  1079  SAEPEPAEPKSAEPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPEPTKPKSAGPKPAEPK  1138

Query  153   QRGPE----RARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPE  208
               GP+    ++ E + A    +  +P  P+ ++ KPA  + +   P EP+ A     EP+
Sbjct  1139  SAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPEPAEPK  1198

Query  209   RARESQREPERA  220
              A     EP+ A
Sbjct  1199  SAEPEPTEPKSA  1210


 Score = 37.7 bits (86),  Expect = 0.45, Method: Composition-based stats.
 Identities = 50/175 (28%), Positives = 62/175 (35%), Gaps = 6/175 (3%)

Query  33    ATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARES  92
             + EPE A     EPE        PE T     EP  A     EPE T     EP+ A   
Sbjct  1189  SAEPEPAEPKSAEPEPTEPKSAEPEPTEPKSAEPKPAEPYSAEPEPTEPKSAEPKPAEPK  1248

Query  93    QGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGS  152
               EPE A+    EP+ A      P+       EP        GPK A     EP+ A   
Sbjct  1249  SAEPEPAEPKSAEPEPAEPKSAEPKPAEPKSAEPEPTEPKSAGPKPAEPYSAEPKPAEPK  1308

Query  153   QRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREP  207
                PE            +  EP  P+ +  KPA    +   P EP+ A  +   P
Sbjct  1309  SAEPEPTEPK------SAEPEPTEPKSAGPKPAEPYSAEPKPAEPKSAELNATTP  1357


 Score = 37.7 bits (86),  Expect = 0.54, Method: Composition-based stats.
 Identities = 49/192 (25%), Positives = 72/192 (37%), Gaps = 4/192 (2%)

Query  33    ATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARES  92
             + EPE A     EP+        P+       EP  A      P+       EP+ A   
Sbjct  889   SAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPKPAEPK  948

Query  93    QGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGS  152
               EP+ A+    EPK A      P+       EP  A      PK A     EP+ A   
Sbjct  949   SAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPK  1008

Query  153   QRGPE----RARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPE  208
                P+    ++ E + A    +  +P  P+ ++ KPA  + +   P EP+ A     EP+
Sbjct  1009  SAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPEPTEPK  1068

Query  209   RARESQREPERA  220
              A     EP+ A
Sbjct  1069  SAGPKPAEPKSA  1080


 Score = 37.7 bits (86),  Expect = 0.54, Method: Composition-based stats.
 Identities = 53/218 (24%), Positives = 78/218 (35%), Gaps = 1/218 (0%)

Query  35    EPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQG  94
             EP+ A     EP+        P+       EP  A     EP++      EP+ A     
Sbjct  1156  EPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPEPAEPKSAEPEPTEPKSAEPEPT  1215

Query  95    EPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQR  154
             EP+ A+    EP  A  +   P+       EP  A      PK A     EP+ A     
Sbjct  1216  EPKSAEPKPAEPYSAEPEPTEPKSAEPKPAEPKSAEPEPAEPKSAEPEPAEPKSAEPKPA  1275

Query  155   GPERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQ  214
              P+ A E +      +  +P  P  ++ KPA  + +   P EP+ A     EP+ A    
Sbjct  1276  EPKSA-EPEPTEPKSAGPKPAEPYSAEPKPAEPKSAEPEPTEPKSAEPEPTEPKSAGPKP  1334

Query  215   REPERAresrkgprepgrgresqrARESPGEPQRTSQS  252
              EP  A      P+       +  ARE   +   +  S
Sbjct  1335  AEPYSAEPKPAEPKSAELNATTPSAREGAADQSASVTS  1372


 Score = 36.6 bits (83),  Expect = 1.2, Method: Composition-based stats.
 Identities = 48/185 (25%), Positives = 70/185 (37%), Gaps = 1/185 (0%)

Query  36   PERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQGE  95
            P  AG  Q +      +     G      EP  A     EP++      EP+ A     E
Sbjct  727  PATAGPQQTDQTTLNASSVPSGGAPSKPAEPKSAEPEPAEPKSAGPKPAEPKSAEPKPAE  786

Query  96   PERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQRG  155
            P+ A+    EPK A      P+       EP  A      PK A     EP+ A      
Sbjct  787  PKSAEPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAE  846

Query  156  PERARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQR  215
            P+ A E + A    +  +P  P+ ++ +PA  + +   P EP+ A     EP+ A     
Sbjct  847  PKSA-EPKPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPA  905

Query  216  EPERA  220
            EP+ A
Sbjct  906  EPKSA  910


 Score = 36.6 bits (83),  Expect = 1.2, Method: Composition-based stats.
 Identities = 49/192 (25%), Positives = 71/192 (36%), Gaps = 4/192 (2%)

Query  33    ATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARES  92
             + EP+ A     EP+        P+       EP  A     EP+       EP+ A   
Sbjct  939   SAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPKPAEPK  998

Query  93    QGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGS  152
               EP+ A+    EPK A      PE       EP  A      PK A      P+ A   
Sbjct  999   SAEPKPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPKPAEPKSAGPKPAEPK  1058

Query  153   QRGPE----RARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPE  208
                PE    ++   + A    +  EP  P+ ++ KPA  + +   P EP+ A     EP+
Sbjct  1059  SAEPEPTEPKSAGPKPAEPKSAEPEPAEPKSAEPKPAEPKSAGPKPAEPKSAEPKPAEPK  1118

Query  209   RARESQREPERA  220
              A     +P+ A
Sbjct  1119  SAEPEPTKPKSA  1130


 Score = 35.0 bits (79),  Expect = 2.8, Method: Composition-based stats.
 Identities = 41/221 (18%), Positives = 89/221 (40%), Gaps = 3/221 (1%)

Query  30    RDAATEPERAGESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERA  89
             + A  +P     ++ EP  P      P   + ++ EP   + ++ +P     +  +P   
Sbjct  1048  KSAGPKPAEPKSAEPEPTEPKSAGPKPAEPKSAEPEPAEPKSAEPKPAEPKSAGPKPAEP  1107

Query  90    RESQGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERA  149
             + ++ +P   K+++ EP   +     P  P+ +  +PA  +  +  P   + ++ +P   
Sbjct  1108  KSAEPKPAEPKSAEPEPTKPKSAGPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEP  1167

Query  150   RGSQRGPERAREN--QGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREP  207
             + ++  P   +    + A    +  EP  P+ ++ +P   + +   P EP+ A     EP
Sbjct  1168  KSAEPKPAEPKSAGPKPAEPKSAEPEPAEPKSAEPEPTEPKSAEPEPTEPKSAEPKPAEP  1227

Query  208   ERARESQREPERAresrkgprepgrgresqrARE-SPGEPQ  247
               A     EP+ A      P+         ++ E  P EP+
Sbjct  1228  YSAEPEPTEPKSAEPKPAEPKSAEPEPAEPKSAEPEPAEPK  1268


 Score = 33.5 bits (75),  Expect = 8.4, Method: Composition-based stats.
 Identities = 48/211 (22%), Positives = 75/211 (35%), Gaps = 5/211 (2%)

Query  42   SQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQGEPERAKA  101
            +  +P  P     GP+ T ++              +       EPE A      P+ A+ 
Sbjct  718  TNTQPTVPSPATAGPQQTDQTTLNASSVPSGGAPSKPAEPKSAEPEPAEPKSAGPKPAEP  777

Query  102  SQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGSQRGPE----  157
               EPK A      P+        P  A      PK A     EP+ A      PE    
Sbjct  778  KSAEPKPAEPKSAEPKPAEPKSAGPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEP  837

Query  158  RARENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQREP  217
            ++ E + A    +  +P  P+ ++ KPA  + +   P EP+ A     EP+ A     EP
Sbjct  838  KSAEPKPAEPKSAEPKPAEPKSAEPKPAEPKSAEPEPAEPKSAEPKPAEPKSAEPEPAEP  897

Query  218  ERAresrkgprepgrgresqrARE-SPGEPQ  247
            + A      P+         ++ E  P EP+
Sbjct  898  KSAEPKPAEPKSAEPKPAEPKSAEPKPAEPK  928


>gi|26342987|dbj|BAC35150.1| UniGene infoGene info unnamed protein product [Mus musculus]
Length=1157

 Score = 44.3 bits (103),  Expect = 0.006, Method: Composition-based stats.
 Identities = 36/192 (18%), Positives = 73/192 (38%), Gaps = 1/192 (0%)

Query  62    SQREPGRARESQTEPEATSKSWREPERARESQGEPERAKASQGEPKGAREDQraperpre  121
             SQ++P  +R SQ +P     S     + + SQ  P  ++ASQ +P  ++ +   P     
Sbjct  938   SQKKPSHSRPSQAKPPHLDPSHANLTQGQPSQATPTHSQASQAKPTHSQANSHHPHPSHA  997

Query  122   srreparareTQRGPKRARESQREPERARGSQRGPERARENQGARESQSHREPEGPRGSQ  181
                    +      P+ +      P+ +      P+ +       +S SH +P  P+ SQ
Sbjct  998   KPSHQNPSHANPTHPQSSHAKPSHPQSSHAKPSHPQSSHAKPSHPQS-SHAKPSHPQSSQ  1056

Query  182   RKPAGARKSPKTPKEPERARESQREPERARESQREPERAresrkgprepgrgresqrARE  241
              KP+  + S   P  P+ ++ +   P+ ++     P+ +      P          ++ +
Sbjct  1057  AKPSHPQSSQAKPTHPQSSQANSHHPQASQAKPSHPQSSHAKPSHPHPSHAKPSPSQSTQ  1116

Query  242   SPGEPQRTSQSQ  253
                     SQ +
Sbjct  1117  CKAHKAHQSQPK  1128


 Score = 34.7 bits (78),  Expect = 4.5, Method: Composition-based stats.
 Identities = 41/184 (22%), Positives = 76/184 (41%), Gaps = 7/184 (3%)

Query  35    EPERAGESQREPER--PGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARES  92
             +P  A  +Q +P +  P  ++        SQ        S  +P   + S   P   + S
Sbjct  956   DPSHANLTQGQPSQATPTHSQASQAKPTHSQANSHHPHPSHAKPSHQNPSHANPTHPQSS  1015

Query  93    QGEPERAKASQGEPKGAREDQraperpresrreparareTQRGPKRARESQREPERARGS  152
               +P   ++S  +P   +     P  P+ S  +P+  + +Q  P   + SQ +P   + S
Sbjct  1016  HAKPSHPQSSHAKPSHPQSSHAKPSHPQSSHAKPSHPQSSQAKPSHPQSSQAKPTHPQSS  1075

Query  153   QRGPERARENQGARESQSHREPEGPRGSQRKPAGARKSP--KTPKEPERARESQREPERA  210
             Q     +   Q ++   SH +    + S   P+ A+ SP   T  +  +A +SQ +P + 
Sbjct  1076  Q---ANSHHPQASQAKPSHPQSSHAKPSHPHPSHAKPSPSQSTQCKAHKAHQSQPKPFQP  1132

Query  211   RESQ  214
             R +Q
Sbjct  1133  RPTQ  1136

-------------------------------------------------------------------------------------------------

BlastP contre swissprot de l'ORF avec anycodon,phase de lecture 1 sur le brin direct (1->795)

Sequences producing significant alignments:                        (Bits)  Value

gi|17380567|sp|Q12816|TROP_HUMAN  Trophinin (MAGE-D3 antigen)      31.2    4.1    Gene info

Alignments
>gi|17380567|sp|Q12816|TROP_HUMAN Trophinin (MAGE-D3 antigen)
Length=1387

 Score = 31.2 bits (69),  Expect = 4.1, Method: Composition-based stats.
 Identities = 36/149 (24%), Positives = 60/149 (40%), Gaps = 3/149 (2%)

Query  94    SLALSGPLWLPLALSGSLWLSLALFGPLWVSLALAGSLRLSLGLSGALWSSLAPFGSPWL  153
             S    G +       G+L  S+   G    S++   +L  + G  GA+ ++    G+   
Sbjct  942   STGFGGAMSTSADFGGTLSTSVCFGGSPGTSVSFGSALNTNAGYGGAVSTNTDFGGTLST  1001

Query  154   ALALSGSPWLSLALSGSRQLLLVASGSVWLSLALPGSLWLSLVPSGPLLLSPGLSGSLWL  213
             ++   GSP  S    G+         +V  S +  G++  S   SG  + +PG  G+   
Sbjct  1002  SVCFGGSPSTSAGFGGALNTNASFGCAVSTSASFSGAVSTSACFSGAPITNPGFGGAFST  1061

Query  214   SPALSG--SVAASLCVTQSRSLA-GISPT  239
             S    G  S AA    T S S+  G +P+
Sbjct  1062  SAGFGGALSTAADFGGTPSNSIGFGAAPS  1090

--------------------------------------------------------------------------------------------------------

BlastP contre nr de l'ORF avec anycodon,phase de lecture 1 sur le brin direct (1->795)

Sequences producing significant alignments:                        (Bits)  Value

gi|47202311|emb|CAG14603.1|  unnamed protein product [Tetraodon n  33.9    7.2  

Alignments
>gi|47202311|emb|CAG14603.1|  unnamed protein product [Tetraodon nigroviridis]
Length=199

 Score = 33.9 bits (76),  Expect = 7.2, Method: Composition-based stats.
 Identities = 20/38 (52%), Positives = 20/38 (52%), Gaps = 0/38 (0%)

Query  149  GSPWLALALSGSPWLSLALSGSRQLLLVASGSVWLSLA  186
            G PWL LA  G PWL LA  G   L L   G  WL LA
Sbjct  159  GYPWLPLATPGYPWLPLANPGYPWLPLATPGYPWLPLA  196

ORF finding

ORF finder--> anycodon--> phase de lecture 1,2 et 3-->brin direct

>ORF number 1 in reading frame 1 on the direct strand extends from base 1 to base 795.
CTCTGGCTCTGGCTGGTTCTCTGCGGCTCTCCCGGGCTCTCCCTGGCTCTTTGGCTCTCT
CTGCCTCTCCCTGGCTCTCTTGGGCCCTTCCGGCTCTCTCTGGCTCTCTCTGGCTCTCTC
TGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTTTG
GGGGTTTTCGGGCTCTTGCGGGCTCCGGCTGGCTTTCTCTGGCTCCCTCTGGGTCCCTCT
GGCTCTCTGTGGCTCTGGCTCTCTCTGGCTCCCTGGTTCTCTCTGGCTCTCTCTGGTCCT
CTTTGGCTCCCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTTTGGCCCT
CTCTGGGTTTCTCTGGCTCTCGCTGGTTCCCTCCGGCTCTCTCTGGGTCTCTCTGGCGCT
CTCTGGTCCTCTCTGGCTCCCTTTGGTTCTCCCTGGCTTGCTTTGGCCCTCTCTGGTTCT
CCCTGGCTTTCTCTGGCTCTCTCTGGCTCTCGCCAGCTCTTGCTGGTGGCCTCTGGTTCT
GTTTGGCTCTCTCTGGCTCTCCCTGGCTCTCTCTGGCTCTCTCTGGTTCCTTCGGGCCCT
CTTTTGTTGTCTCCGGGTCTCTCTGGCTCTCTCTGGCTCTCTCCGGCTCTTTCTGGCTCC
GTGGCTGCATCTCTTTGTGTGACGCAGTCGAGAAGCTTAGCCGGGATTTCGCCCACAGGT
AAACCTGAGGACACATATGGCGCACGGCGAAGCCCGGCCATTGCCAGTGCACATGGAATC
TTGTCCACCAAATAA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
LWLWLVLCGSPGLSLALWLSLPLPGSLGPFRLSLALSGSLWLSLALSGSLWLSLALSGSL
GVFGLLRAPAGFLWLPLGPSGSLWLWLSLAPWFSLALSGPLWLPLALSGSLWLSLALFGP
LWVSLALAGSLRLSLGLSGALWSSLAPFGSPWLALALSGSPWLSLALSGSRQLLLVASGS
VWLSLALPGSLWLSLVPSGPLLLSPGLSGSLWLSPALSGSVAASLCVTQSRSLAGISPTG
KPEDTYGARRSPAIASAHGILSTK*

>ORF number 1 in reading frame 2 on the direct strand extends from base 2 to base 682.
TCTGGCTCTGGCTGGTTCTCTGCGGCTCTCCCGGGCTCTCCCTGGCTCTTTGGCTCTCTC
TGCCTCTCCCTGGCTCTCTTGGGCCCTTCCGGCTCTCTCTGGCTCTCTCTGGCTCTCTCT
GGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTTTGG
GGGTTTTCGGGCTCTTGCGGGCTCCGGCTGGCTTTCTCTGGCTCCCTCTGGGTCCCTCTG
GCTCTCTGTGGCTCTGGCTCTCTCTGGCTCCCTGGTTCTCTCTGGCTCTCTCTGGTCCTC
TTTGGCTCCCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTTTGGCCCTC
TCTGGGTTTCTCTGGCTCTCGCTGGTTCCCTCCGGCTCTCTCTGGGTCTCTCTGGCGCTC
TCTGGTCCTCTCTGGCTCCCTTTGGTTCTCCCTGGCTTGCTTTGGCCCTCTCTGGTTCTC
CCTGGCTTTCTCTGGCTCTCTCTGGCTCTCGCCAGCTCTTGCTGGTGGCCTCTGGTTCTG
TTTGGCTCTCTCTGGCTCTCCCTGGCTCTCTCTGGCTCTCTCTGGTTCCTTCGGGCCCTC
TTTTGTTGTCTCCGGGTCTCTCTGGCTCTCTCTGGCTCTCTCCGGCTCTTTCTGGCTCCG
TGGCTGCATCTCTTTGTGTGA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
SGSGWFSAALPGSPWLFGSLCLSLALLGPSGSLWLSLALSGSLWLSLALSGSLWLSLALW
GFSGSCGLRLAFSGSLWVPLALCGSGSLWLPGSLWLSLVLFGSLWLSLALSGSLWLSLAL
SGFLWLSLVPSGSLWVSLALSGPLWLPLVLPGLLWPSLVLPGFLWLSLALASSCWWPLVL
FGSLWLSLALSGSLWFLRALFCCLRVSLALSGSLRLFLAPWLHLFV*

>ORF number 1 in reading frame 3 on the direct strand extends from base 3 to base 722.
CTGGCTCTGGCTGGTTCTCTGCGGCTCTCCCGGGCTCTCCCTGGCTCTTTGGCTCTCTCT
GCCTCTCCCTGGCTCTCTTGGGCCCTTCCGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTG
GCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTTTGGG
GGTTTTCGGGCTCTTGCGGGCTCCGGCTGGCTTTCTCTGGCTCCCTCTGGGTCCCTCTGG
CTCTCTGTGGCTCTGGCTCTCTCTGGCTCCCTGGTTCTCTCTGGCTCTCTCTGGTCCTCT
TTGGCTCCCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTTTGGCCCTCT
CTGGGTTTCTCTGGCTCTCGCTGGTTCCCTCCGGCTCTCTCTGGGTCTCTCTGGCGCTCT
CTGGTCCTCTCTGGCTCCCTTTGGTTCTCCCTGGCTTGCTTTGGCCCTCTCTGGTTCTCC
CTGGCTTTCTCTGGCTCTCTCTGGCTCTCGCCAGCTCTTGCTGGTGGCCTCTGGTTCTGT
TTGGCTCTCTCTGGCTCTCCCTGGCTCTCTCTGGCTCTCTCTGGTTCCTTCGGGCCCTCT
TTTGTTGTCTCCGGGTCTCTCTGGCTCTCTCTGGCTCTCTCCGGCTCTTTCTGGCTCCGT
GGCTGCATCTCTTTGTGTGACGCAGTCGAGAAGCTTAGCCGGGATTTCGCCCACAGGTAA


>Translation of ORF number 1 in reading frame 3 on the direct strand.
LALAGSLRLSRALPGSLALSASPWLSWALPALSGSLWLSLALSGSLWLSLALSGSLWLFG
GFRALAGSGWLSLAPSGSLWLSVALALSGSLVLSGSLWSSLAPSGSLWLSLALSGSLWPS
LGFSGSRWFPPALSGSLWRSLVLSGSLWFSLACFGPLWFSLAFSGSLWLSPALAGGLWFC
LALSGSPWLSLALSGSFGPSFVVSGSLWLSLALSGSFWLRGCISLCDAVEKLSRDFAHR*

Orf finder-->any codon--> phase de lecture 1,2 et 3--> brin indirect

>ORF number 1 in reading frame 1 on the reverse strand extends from base 130 to base 825.
GCTTCTCGACTGCGTCACACAAAGAGATGCAGCCACGGAGCCAGAAAGAGCCGGAGAGAG
CCAGAGAGAGCCAGAGAGACCCGGAGACAACAAAAGAGGGCCCGAAGGAACCAGAGAGAG
CCAGAGAGAGCCAGGGAGAGCCAGAGAGAGCCAAACAGAACCAGAGGCCACCAGCAAGAG
CTGGCGAGAGCCAGAGAGAGCCAGAGAAAGCCAGGGAGAACCAGAGAGGGCCAAAGCAAG
CCAGGGAGAACCAAAGGGAGCCAGAGAGGACCAGAGAGCGCCAGAGAGACCCAGAGAGAG
CCGGAGGGAACCAGCGAGAGCCAGAGAAACCCAGAGAGGGCCAAAGAGAGCCAGAGAGAG
CCAGAGAGAGCCAGAGAGAGCCAGAGGGAGCCAAAGAGGACCAGAGAGAGCCAGAGAGAA
CCAGGGAGCCAGAGAGAGCCAGAGCCACAGAGAGCCAGAGGGACCCAGAGGGAGCCAGAG
AAAGCCAGCCGGAGCCCGCAAGAGCCCGAAAACCCCCAAAGAGCCAGAGAGAGCCAGAGA
GAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGA
GAGCCGGAAGGGCCCAAGAGAGCCAGGGAGAGGCAGAGAGAGCCAAAGAGCCAGGGAGAG
CCCGGGAGAGCCGCAGAGAACCAGCCAGAGCCAGAG

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
ASRLRHTKRCSHGARKSRREPERARETRRQQKRARRNQREPERARESQREPNRTRGHQQE
LARARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGTSESQRNPERAKESQRE
PERARESQREPKRTRESQREPGSQREPEPQRARGTQREPEKASRSPQEPENPQRARESQR
EPERARESQREPERARESQREPEGPKRARERQREPKSQGEPGRAAENQPEPE

>ORF number 1 in reading frame 2 on the reverse strand extends from base 2 to base 823.
CTCACGAATAAGGTAAGTCATCCACACGCTTATTTGGTGGACAAGATTCCATGTGCACTG
GCAATGGCCGGGCTTCGCCGTGCGCCATATGTGTCCTCAGGTTTACCTGTGGGCGAAATC
CCGGCTAAGCTTCTCGACTGCGTCACACAAAGAGATGCAGCCACGGAGCCAGAAAGAGCC
GGAGAGAGCCAGAGAGAGCCAGAGAGACCCGGAGACAACAAAAGAGGGCCCGAAGGAACC
AGAGAGAGCCAGAGAGAGCCAGGGAGAGCCAGAGAGAGCCAAACAGAACCAGAGGCCACC
AGCAAGAGCTGGCGAGAGCCAGAGAGAGCCAGAGAAAGCCAGGGAGAACCAGAGAGGGCC
AAAGCAAGCCAGGGAGAACCAAAGGGAGCCAGAGAGGACCAGAGAGCGCCAGAGAGACCC
AGAGAGAGCCGGAGGGAACCAGCGAGAGCCAGAGAAACCCAGAGAGGGCCAAAGAGAGCC
AGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGGGAGCCAAAGAGGACCAGAGAGAGCC
AGAGAGAACCAGGGAGCCAGAGAGAGCCAGAGCCACAGAGAGCCAGAGGGACCCAGAGGG
AGCCAGAGAAAGCCAGCCGGAGCCCGCAAGAGCCCGAAAACCCCCAAAGAGCCAGAGAGA
GCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGA
GCCAGAGAGAGCCGGAAGGGCCCAAGAGAGCCAGGGAGAGGCAGAGAGAGCCAAAGAGCC
AGGGAGAGCCCGGGAGAGCCGCAGAGAACCAGCCAGAGCCAG

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
LTNKVSHPHAYLVDKIPCALAMAGLRRAPYVSSGLPVGEIPAKLLDCVTQRDAATEPERA
GESQREPERPGDNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQGEPERA
KASQGEPKGAREDQRAPERPRESRREPARARETQRGPKRARESQREPERARGSQRGPERA
RENQGARESQSHREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQREPER
ARESRKGPREPGRGRESQRARESPGEPQRTSQSQ

>ORF number 1 in reading frame 3 on the reverse strand extends from base 18 to base 824.
GTCATCCACACGCTTATTTGGTGGACAAGATTCCATGTGCACTGGCAATGGCCGGGCTTC
GCCGTGCGCCATATGTGTCCTCAGGTTTACCTGTGGGCGAAATCCCGGCTAAGCTTCTCG
ACTGCGTCACACAAAGAGATGCAGCCACGGAGCCAGAAAGAGCCGGAGAGAGCCAGAGAG
AGCCAGAGAGACCCGGAGACAACAAAAGAGGGCCCGAAGGAACCAGAGAGAGCCAGAGAG
AGCCAGGGAGAGCCAGAGAGAGCCAAACAGAACCAGAGGCCACCAGCAAGAGCTGGCGAG
AGCCAGAGAGAGCCAGAGAAAGCCAGGGAGAACCAGAGAGGGCCAAAGCAAGCCAGGGAG
AACCAAAGGGAGCCAGAGAGGACCAGAGAGCGCCAGAGAGACCCAGAGAGAGCCGGAGGG
AACCAGCGAGAGCCAGAGAAACCCAGAGAGGGCCAAAGAGAGCCAGAGAGAGCCAGAGAG
AGCCAGAGAGAGCCAGAGGGAGCCAAAGAGGACCAGAGAGAGCCAGAGAGAACCAGGGAG
CCAGAGAGAGCCAGAGCCACAGAGAGCCAGAGGGACCCAGAGGGAGCCAGAGAAAGCCAG
CCGGAGCCCGCAAGAGCCCGAAAACCCCCAAAGAGCCAGAGAGAGCCAGAGAGAGCCAGA
GAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCGGA
AGGGCCCAAGAGAGCCAGGGAGAGGCAGAGAGAGCCAAAGAGCCAGGGAGAGCCCGGGAG
AGCCGCAGAGAACCAGCCAGAGCCAGA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
VIHTLIWWTRFHVHWQWPGFAVRHMCPQVYLWAKSRLSFSTASHKEMQPRSQKEPERARE
SQRDPETTKEGPKEPERARESQGEPERAKQNQRPPARAGESQREPEKARENQRGPKQARE
NQREPERTRERQRDPERAGGNQREPEKPREGQREPERARESQREPEGAKEDQREPERTRE
PERARATESQRDPEGARESQPEPARARKPPKSQREPERARESQREPERARESQREPERAG
RAQESQGEAERAKEPGRARESRREPARAR

Orf finder--> ATG--> phase de lecture1,2 et 3--> brin indirect

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 65 to base 823.
ATGGCCGGGCTTCGCCGTGCGCCATATGTGTCCTCAGGTTTACCTGTGGGCGAAATCCCG
GCTAAGCTTCTCGACTGCGTCACACAAAGAGATGCAGCCACGGAGCCAGAAAGAGCCGGA
GAGAGCCAGAGAGAGCCAGAGAGACCCGGAGACAACAAAAGAGGGCCCGAAGGAACCAGA
GAGAGCCAGAGAGAGCCAGGGAGAGCCAGAGAGAGCCAAACAGAACCAGAGGCCACCAGC
AAGAGCTGGCGAGAGCCAGAGAGAGCCAGAGAAAGCCAGGGAGAACCAGAGAGGGCCAAA
GCAAGCCAGGGAGAACCAAAGGGAGCCAGAGAGGACCAGAGAGCGCCAGAGAGACCCAGA
GAGAGCCGGAGGGAACCAGCGAGAGCCAGAGAAACCCAGAGAGGGCCAAAGAGAGCCAGA
GAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGGGAGCCAAAGAGGACCAGAGAGAGCCAGA
GAGAACCAGGGAGCCAGAGAGAGCCAGAGCCACAGAGAGCCAGAGGGACCCAGAGGGAGC
CAGAGAAAGCCAGCCGGAGCCCGCAAGAGCCCGAAAACCCCCAAAGAGCCAGAGAGAGCC
AGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCC
AGAGAGAGCCGGAAGGGCCCAAGAGAGCCAGGGAGAGGCAGAGAGAGCCAAAGAGCCAGG
GAGAGCCCGGGAGAGCCGCAGAGAACCAGCCAGAGCCAG

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
MAGLRRAPYVSSGLPVGEIPAKLLDCVTQRDAATEPERAGESQREPERPGDNKRGPEGTR
ESQREPGRARESQTEPEATSKSWREPERARESQGEPERAKASQGEPKGAREDQRAPERPR
ESRREPARARETQRGPKRARESQREPERARGSQRGPERARENQGARESQSHREPEGPRGS
QRKPAGARKSPKTPKEPERARESQREPERARESQREPERARESRKGPREPGRGRESQRAR
ESPGEPQRTSQSQ

>ORF number 1 in reading frame 3 on the reverse strand extends from base 90 to base 824.
ATGTGTCCTCAGGTTTACCTGTGGGCGAAATCCCGGCTAAGCTTCTCGACTGCGTCACAC
AAAGAGATGCAGCCACGGAGCCAGAAAGAGCCGGAGAGAGCCAGAGAGAGCCAGAGAGAC
CCGGAGACAACAAAAGAGGGCCCGAAGGAACCAGAGAGAGCCAGAGAGAGCCAGGGAGAG
CCAGAGAGAGCCAAACAGAACCAGAGGCCACCAGCAAGAGCTGGCGAGAGCCAGAGAGAG
CCAGAGAAAGCCAGGGAGAACCAGAGAGGGCCAAAGCAAGCCAGGGAGAACCAAAGGGAG
CCAGAGAGGACCAGAGAGCGCCAGAGAGACCCAGAGAGAGCCGGAGGGAACCAGCGAGAG
CCAGAGAAACCCAGAGAGGGCCAAAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAG
CCAGAGGGAGCCAAAGAGGACCAGAGAGAGCCAGAGAGAACCAGGGAGCCAGAGAGAGCC
AGAGCCACAGAGAGCCAGAGGGACCCAGAGGGAGCCAGAGAAAGCCAGCCGGAGCCCGCA
AGAGCCCGAAAACCCCCAAAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGA
GAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCGGAAGGGCCCAAGAG
AGCCAGGGAGAGGCAGAGAGAGCCAAAGAGCCAGGGAGAGCCCGGGAGAGCCGCAGAGAA
CCAGCCAGAGCCAGA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
MCPQVYLWAKSRLSFSTASHKEMQPRSQKEPERARESQRDPETTKEGPKEPERARESQGE
PERAKQNQRPPARAGESQREPEKARENQRGPKQARENQREPERTRERQRDPERAGGNQRE
PEKPREGQREPERARESQREPEGAKEDQREPERTREPERARATESQRDPEGARESQPEPA
RARKPPKSQREPERARESQREPERARESQREPERAGRAQESQGEAERAKEPGRARESRRE
PARAR

ORF finder--> ATG --> phase de lecture1,2 et 3--> brin direct

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3


ORF finder--> ATG, CTG, TTG, GTG---> phase de lecture 1, 2 et 3--->brin direct

>ORF number 1 in reading frame 1 on the direct strand extends from base 13 to base 795.
CTGGTTCTCTGCGGCTCTCCCGGGCTCTCCCTGGCTCTTTGGCTCTCTCTGCCTCTCCCT
GGCTCTCTTGGGCCCTTCCGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTG
GCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTTTGGGGGTTTTCGGG
CTCTTGCGGGCTCCGGCTGGCTTTCTCTGGCTCCCTCTGGGTCCCTCTGGCTCTCTGTGG
CTCTGGCTCTCTCTGGCTCCCTGGTTCTCTCTGGCTCTCTCTGGTCCTCTTTGGCTCCCT
CTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTTTGGCCCTCTCTGGGTTTCT
CTGGCTCTCGCTGGTTCCCTCCGGCTCTCTCTGGGTCTCTCTGGCGCTCTCTGGTCCTCT
CTGGCTCCCTTTGGTTCTCCCTGGCTTGCTTTGGCCCTCTCTGGTTCTCCCTGGCTTTCT
CTGGCTCTCTCTGGCTCTCGCCAGCTCTTGCTGGTGGCCTCTGGTTCTGTTTGGCTCTCT
CTGGCTCTCCCTGGCTCTCTCTGGCTCTCTCTGGTTCCTTCGGGCCCTCTTTTGTTGTCT
CCGGGTCTCTCTGGCTCTCTCTGGCTCTCTCCGGCTCTTTCTGGCTCCGTGGCTGCATCT
CTTTGTGTGACGCAGTCGAGAAGCTTAGCCGGGATTTCGCCCACAGGTAAACCTGAGGAC
ACATATGGCGCACGGCGAAGCCCGGCCATTGCCAGTGCACATGGAATCTTGTCCACCAAA
TAA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
LVLCGSPGLSLALWLSLPLPGSLGPFRLSLALSGSLWLSLALSGSLWLSLALSGSLGVFG
LLRAPAGFLWLPLGPSGSLWLWLSLAPWFSLALSGPLWLPLALSGSLWLSLALFGPLWVS
LALAGSLRLSLGLSGALWSSLAPFGSPWLALALSGSPWLSLALSGSRQLLLVASGSVWLS
LALPGSLWLSLVPSGPLLLSPGLSGSLWLSPALSGSVAASLCVTQSRSLAGISPTGKPED
TYGARRSPAIASAHGILSTK*

>ORF number 1 in reading frame 2 on the direct strand extends from base 71 to base 682.
CTGGCTCTCTTGGGCCCTTCCGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTC
TGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTTTGGGGGTTTTCG
GGCTCTTGCGGGCTCCGGCTGGCTTTCTCTGGCTCCCTCTGGGTCCCTCTGGCTCTCTGT
GGCTCTGGCTCTCTCTGGCTCCCTGGTTCTCTCTGGCTCTCTCTGGTCCTCTTTGGCTCC
CTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTTTGGCCCTCTCTGGGTTT
CTCTGGCTCTCGCTGGTTCCCTCCGGCTCTCTCTGGGTCTCTCTGGCGCTCTCTGGTCCT
CTCTGGCTCCCTTTGGTTCTCCCTGGCTTGCTTTGGCCCTCTCTGGTTCTCCCTGGCTTT
CTCTGGCTCTCTCTGGCTCTCGCCAGCTCTTGCTGGTGGCCTCTGGTTCTGTTTGGCTCT
CTCTGGCTCTCCCTGGCTCTCTCTGGCTCTCTCTGGTTCCTTCGGGCCCTCTTTTGTTGT
CTCCGGGTCTCTCTGGCTCTCTCTGGCTCTCTCCGGCTCTTTCTGGCTCCGTGGCTGCAT
CTCTTTGTGTGA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
LALLGPSGSLWLSLALSGSLWLSLALSGSLWLSLALWGFSGSCGLRLAFSGSLWVPLALC
GSGSLWLPGSLWLSLVLFGSLWLSLALSGSLWLSLALSGFLWLSLVPSGSLWVSLALSGP
LWLPLVLPGLLWPSLVLPGFLWLSLALASSCWWPLVLFGSLWLSLALSGSLWFLRALFCC
LRVSLALSGSLRLFLAPWLHLFV*

>ORF number 1 in reading frame 3 on the direct strand extends from base 3 to base 722.
CTGGCTCTGGCTGGTTCTCTGCGGCTCTCCCGGGCTCTCCCTGGCTCTTTGGCTCTCTCT
GCCTCTCCCTGGCTCTCTTGGGCCCTTCCGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTG
GCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTTTGGG
GGTTTTCGGGCTCTTGCGGGCTCCGGCTGGCTTTCTCTGGCTCCCTCTGGGTCCCTCTGG
CTCTCTGTGGCTCTGGCTCTCTCTGGCTCCCTGGTTCTCTCTGGCTCTCTCTGGTCCTCT
TTGGCTCCCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTCTGGCTCTCTTTGGCCCTCT
CTGGGTTTCTCTGGCTCTCGCTGGTTCCCTCCGGCTCTCTCTGGGTCTCTCTGGCGCTCT
CTGGTCCTCTCTGGCTCCCTTTGGTTCTCCCTGGCTTGCTTTGGCCCTCTCTGGTTCTCC
CTGGCTTTCTCTGGCTCTCTCTGGCTCTCGCCAGCTCTTGCTGGTGGCCTCTGGTTCTGT
TTGGCTCTCTCTGGCTCTCCCTGGCTCTCTCTGGCTCTCTCTGGTTCCTTCGGGCCCTCT
TTTGTTGTCTCCGGGTCTCTCTGGCTCTCTCTGGCTCTCTCCGGCTCTTTCTGGCTCCGT
GGCTGCATCTCTTTGTGTGACGCAGTCGAGAAGCTTAGCCGGGATTTCGCCCACAGGTAA


>Translation of ORF number 1 in reading frame 3 on the direct strand.
LALAGSLRLSRALPGSLALSASPWLSWALPALSGSLWLSLALSGSLWLSLALSGSLWLFG
GFRALAGSGWLSLAPSGSLWLSVALALSGSLVLSGSLWSSLAPSGSLWLSLALSGSLWPS
LGFSGSRWFPPALSGSLWRSLVLSGSLWFSLACFGPLWFSLAFSGSLWLSPALAGGLWFC
LALSGSPWLSLALSGSFGPSFVVSGSLWLSLALSGSFWLRGCISLCDAVEKLSRDFAHR*


ORF finder--> ATG, TTG, CTG, TTG--> phase delecture1,2 et 3--> brin indirect

>ORF number 1 in reading frame 1 on the reverse strand extends from base 139 to base 825.
CTGCGTCACACAAAGAGATGCAGCCACGGAGCCAGAAAGAGCCGGAGAGAGCCAGAGAGA
GCCAGAGAGACCCGGAGACAACAAAAGAGGGCCCGAAGGAACCAGAGAGAGCCAGAGAGA
GCCAGGGAGAGCCAGAGAGAGCCAAACAGAACCAGAGGCCACCAGCAAGAGCTGGCGAGA
GCCAGAGAGAGCCAGAGAAAGCCAGGGAGAACCAGAGAGGGCCAAAGCAAGCCAGGGAGA
ACCAAAGGGAGCCAGAGAGGACCAGAGAGCGCCAGAGAGACCCAGAGAGAGCCGGAGGGA
ACCAGCGAGAGCCAGAGAAACCCAGAGAGGGCCAAAGAGAGCCAGAGAGAGCCAGAGAGA
GCCAGAGAGAGCCAGAGGGAGCCAAAGAGGACCAGAGAGAGCCAGAGAGAACCAGGGAGC
CAGAGAGAGCCAGAGCCACAGAGAGCCAGAGGGACCCAGAGGGAGCCAGAGAAAGCCAGC
CGGAGCCCGCAAGAGCCCGAAAACCCCCAAAGAGCCAGAGAGAGCCAGAGAGAGCCAGAG
AGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCGGAA
GGGCCCAAGAGAGCCAGGGAGAGGCAGAGAGAGCCAAAGAGCCAGGGAGAGCCCGGGAGA
GCCGCAGAGAACCAGCCAGAGCCAGAG

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
LRHTKRCSHGARKSRREPERARETRRQQKRARRNQREPERARESQREPNRTRGHQQELAR
ARESQRKPGRTREGQSKPGRTKGSQRGPESARETQREPEGTSESQRNPERAKESQREPER
ARESQREPKRTRESQREPGSQREPEPQRARGTQREPEKASRSPQEPENPQRARESQREPE
RARESQREPERARESQREPEGPKRARERQREPKSQGEPGRAAENQPEPE

>ORF number 1 in reading frame 2 on the reverse strand extends from base 35 to base 823.
TTGGTGGACAAGATTCCATGTGCACTGGCAATGGCCGGGCTTCGCCGTGCGCCATATGTG
TCCTCAGGTTTACCTGTGGGCGAAATCCCGGCTAAGCTTCTCGACTGCGTCACACAAAGA
GATGCAGCCACGGAGCCAGAAAGAGCCGGAGAGAGCCAGAGAGAGCCAGAGAGACCCGGA
GACAACAAAAGAGGGCCCGAAGGAACCAGAGAGAGCCAGAGAGAGCCAGGGAGAGCCAGA
GAGAGCCAAACAGAACCAGAGGCCACCAGCAAGAGCTGGCGAGAGCCAGAGAGAGCCAGA
GAAAGCCAGGGAGAACCAGAGAGGGCCAAAGCAAGCCAGGGAGAACCAAAGGGAGCCAGA
GAGGACCAGAGAGCGCCAGAGAGACCCAGAGAGAGCCGGAGGGAACCAGCGAGAGCCAGA
GAAACCCAGAGAGGGCCAAAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGA
GGGAGCCAAAGAGGACCAGAGAGAGCCAGAGAGAACCAGGGAGCCAGAGAGAGCCAGAGC
CACAGAGAGCCAGAGGGACCCAGAGGGAGCCAGAGAAAGCCAGCCGGAGCCCGCAAGAGC
CCGAAAACCCCCAAAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCC
AGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCGGAAGGGCCCAAGAGAGCCA
GGGAGAGGCAGAGAGAGCCAAAGAGCCAGGGAGAGCCCGGGAGAGCCGCAGAGAACCAGC
CAGAGCCAG

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
LVDKIPCALAMAGLRRAPYVSSGLPVGEIPAKLLDCVTQRDAATEPERAGESQREPERPG
DNKRGPEGTRESQREPGRARESQTEPEATSKSWREPERARESQGEPERAKASQGEPKGAR
EDQRAPERPRESRREPARARETQRGPKRARESQREPERARGSQRGPERARENQGARESQS
HREPEGPRGSQRKPAGARKSPKTPKEPERARESQREPERARESQREPERARESRKGPREP
GRGRESQRARESPGEPQRTSQSQ

>ORF number 1 in reading frame 3 on the reverse strand extends from base 54 to base 824.
GTGCACTGGCAATGGCCGGGCTTCGCCGTGCGCCATATGTGTCCTCAGGTTTACCTGTGG
GCGAAATCCCGGCTAAGCTTCTCGACTGCGTCACACAAAGAGATGCAGCCACGGAGCCAG
AAAGAGCCGGAGAGAGCCAGAGAGAGCCAGAGAGACCCGGAGACAACAAAAGAGGGCCCG
AAGGAACCAGAGAGAGCCAGAGAGAGCCAGGGAGAGCCAGAGAGAGCCAAACAGAACCAG
AGGCCACCAGCAAGAGCTGGCGAGAGCCAGAGAGAGCCAGAGAAAGCCAGGGAGAACCAG
AGAGGGCCAAAGCAAGCCAGGGAGAACCAAAGGGAGCCAGAGAGGACCAGAGAGCGCCAG
AGAGACCCAGAGAGAGCCGGAGGGAACCAGCGAGAGCCAGAGAAACCCAGAGAGGGCCAA
AGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGGGAGCCAAAGAGGACCAG
AGAGAGCCAGAGAGAACCAGGGAGCCAGAGAGAGCCAGAGCCACAGAGAGCCAGAGGGAC
CCAGAGGGAGCCAGAGAAAGCCAGCCGGAGCCCGCAAGAGCCCGAAAACCCCCAAAGAGC
CAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGCCAGAGAGAGC
CAGAGAGAGCCAGAGAGAGCCGGAAGGGCCCAAGAGAGCCAGGGAGAGGCAGAGAGAGCC
AAAGAGCCAGGGAGAGCCCGGGAGAGCCGCAGAGAACCAGCCAGAGCCAGA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
VHWQWPGFAVRHMCPQVYLWAKSRLSFSTASHKEMQPRSQKEPERARESQRDPETTKEGP
KEPERARESQGEPERAKQNQRPPARAGESQREPEKARENQRGPKQARENQREPERTRERQ
RDPERAGGNQREPEKPREGQREPERARESQREPEGAKEDQREPERTREPERARATESQRD
PEGARESQPEPARARKPPKSQREPERARESQREPERARESQREPERAGRAQESQGEAERA
KEPGRARESRREPARAR