GOS 991010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091118858011
Annotathon code: GOS_991010
Sample :
  • GPS :24°10'29n; 84°20'40w
  • Caribbean Sea: Gulf of Mexico - USA
  • Coastal Sea (-2m, 26.4°C, 0.1-0.8 microns)
Authors
Team : BSB06CIIT
Username : Mariya
Annotated on : 2009-06-02 19:08:47
  • Bashir Mariya

Synopsis

  • Taxonomy: Cyanophage P-SSM2 (NCBI info)
    Rank: species - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 268746
    Kingdom: - Phylum: - Class: - Order: Caudovirales
    Viruses; dsDNA viruses, no RNA stage; Caudovirales; Myoviridae; T4-like viruses;

Genomic Sequence

>JCVI_READ_1091118858011 GOS_991010 Genomic DNA
CTTACGCATGGCATTTCTAAAAACAATACTCTTATCTCAAATTGTCAAAGACAACAGCGAGATTTGGAAAGTGAAATTCAAACACTTACCGAACAACTTG
AAAACAGAAATACTGAGCATAACAAGTTAGAAAAGTTCAAGTCAACCTTACAGGAGACCTATGAGTCCTTAGCAACCCACAACCAGACAATCAAATACTA
CAACTTTACTTACGAACTACTAAAAGATGGTGGAGTTAAGACTAAAATCATCAAGAAGTATCTACCACTGATAAATCAGCAAGTAAACCGTTATCTACAG
ATGATGGATTTTTACATAAACTTTACTCTTGATGAGGAGTTTAACGAAACCATTGAATCCCCAATACATGAGGATTTTTCATACAGTTCCTTTAGTGAAG
GAGAGAAACAACGAATCGACTTAGCACTTCTCTTTACATGGAGGGAAGTTGCTAAGTTTAAAAATTCAGTAGCAACTAACTTGATGATACTTGATGAGGT
ATTTGATAGTTCATTAGATGCTACAGGAACTGAAGAATTTTTAAAGATAATTAGATATGTTATTAAGGATGCAAACATCTTTATCATATCTCATAAGAGT
GGATTAGAAGACAAGTTTGAAGATCACATTCGATTTGAAAAACATAAAGGATTTAGTAGGATTATCTCATGATTGGAATTGTTGGTAATGGCTTTGTTGG
TAATGCAGTTTACCAGAACTTTAGAGACAAGACACCGTGTAAAGTCTACGACACGGATAAGAATAGATCACTCAATACACTGAGTGAAGTAATAGAACAG
GATTTTATATTTGTATGTTTACCTACTCCCATG

Translation

[301 - 669/833]   direct strand


Annotator commentaries

The sequence that was annotated was found out to be non coding because no known domains were available in the concerning databases. The sequence was further annotated on the basis of its maximum homology which is with Prochlorococcus_phage_P-SSM2_gi_61806019.


ORF finding

PROTOCOL


SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'universal' genetic code

SMS ORFinder / reverse strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'universal' genetic code



RESULTS ANALYSIS


Although the ORF suite presented results that showed a coding fragment on the 1 frame on direct but it is assumed to be non coding because of unavailabilty of domains on the corresponding databases. The forward was selected because it comprised of the longest open reading frame.

RAW RESULTS

a)forward strand

>ORF number 1 in reading frame 1 on the direct strand extends from base 301 to base 672.
ATGATGGATTTTTACATAAACTTTACTCTTGATGAGGAGTTTAACGAAACCATTGAATCC
CCAATACATGAGGATTTTTCATACAGTTCCTTTAGTGAAGGAGAGAAACAACGAATCGAC
TTAGCACTTCTCTTTACATGGAGGGAAGTTGCTAAGTTTAAAAATTCAGTAGCAACTAAC
TTGATGATACTTGATGAGGTATTTGATAGTTCATTAGATGCTACAGGAACTGAAGAATTT
TTAAAGATAATTAGATATGTTATTAAGGATGCAAACATCTTTATCATATCTCATAAGAGT
GGATTAGAAGACAAGTTTGAAGATCACATTCGATTTGAAAAACATAAAGGATTTAGTAGG
ATTATCTCATGA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
MMDFYINFTLDEEFNETIESPIHEDFSYSSFSEGEKQRIDLALLFTWREVAKFKNSVATN
LMILDEVFDSSLDATGTEEFLKIIRYVIKDANIFIISHKSGLEDKFEDHIRFEKHKGFSR
IIS*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.


----------------------------------------------------------------------------------------------------------

b) reverse strand

>ORF number 1 in reading frame 1 on the reverse strand extends from base 247 to base 522.
ATGATAAAGATGTTTGCATCCTTAATAACATATCTAATTATCTTTAAAAATTCTTCAGTT
CCTGTAGCATCTAATGAACTATCAAATACCTCATCAAGTATCATCAAGTTAGTTGCTACT
GAATTTTTAAACTTAGCAACTTCCCTCCATGTAAAGAGAAGTGCTAAGTCGATTCGTTGT
TTCTCTCCTTCACTAAAGGAACTGTATGAAAAATCCTCATGTATTGGGGATTCAATGGTT
TCGTTAAACTCCTCATCAAGAGTAAAGTTTATGTAA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
MIKMFASLITYLIIFKNSSVPVASNELSNTSSSIIKLVATEFLNLATSLHVKRSAKSIRC
FSPSLKELYEKSSCIGDSMVSLNSSSRVKFM*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.



Multiple Alignement

PROTOCOL


PROTOCOL

A)Multiple Alignment Of both INGROUP AND OUTGROUP sequences

using Muscle Default parameters without curation (CLUSTALW format)

B)Multiple Alignment Of both INGROUP AND OUTGROUP sequences

after curation (Gblock Result)



RESULTS ANALYSIS


I align the selected sequences and got good alignment.





RAW RESULTS

CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


gi|1580793      -------MLKFKRVSAENYMSIGS--VSIDLDNQGLVLIEGINDTNETFQSNGSGKSTLL
gi|5853293      -------MITFKKIRWKNFLSTGNVFTEIDITKTKTNLIVG---------DNGAGKSTIL
gi|6180601      -------MIIFQKIRWKNFLSTGNQFTEVDFQQNATNLIIG---------TNGTGKSTVL
gi|6180632      -------MIVFETIAWKNFLSTGDQWTDIQLDDAGATLIVG---------SNGAGKSTML
gi|3863994      -----M-DISFHWVKYQNIMSVGAKAVRVTLDEHKKTLVTG---------TNGAGKSTFI
gi|1092900      MIEIKKKQLGFIRVRYKNIMSVGDDPIDMSLNKYAKTLCTG---------KNGAGKSTML
gi|3765152      MIDIKKKQLDFIRVRYKNIMSVGDEPIDLTLNEYAKTLCTG---------KNGAGKSTML
gi|3362062      -----MAKLNFKTLRYQNIMSVGAEPVEIQLDGFKKTLITG---------VNGAGKSTMI
gi|1573113      -----MAKLNFKTLRYQNIMSVGAEPVEIQLDGFKKTLITG---------VNGAGKSTMI
gi|4777919      -----MKKLEILRVKYKNTLSVGQQPIEIFLNRCHKSLVTG---------KNGDGKSTFI
gi|1616225      -----MKTFKLKKVTYKNIMSVGQQPITIQLDKVQKTLVTG---------KNGAGKSTFL
gi|1163262      -----MKNFKLNRVRYQNIMSVGGNPIDIQLDKVQKTLITG---------RNGGGKSTML
gi|2288613      -----MKNFKLNRVRYQNIMSVGGNPIDIQLDKVQKTLITG---------RNGGGKSTML
gi|9632641      -----MKNFKLNRVKYKNIMSVGQNGIDIQLDKVQKTLITG---------RNGGGKSTML
gi|215895|      ------------------------------------------------------------
                                                                            

gi|1580793      STVTYALYGATPSGLKADAVINKQAKKNMSVILEFEKDGVPYRIERYRKHSKHKNTTRFF
gi|5853293      DALTFSLFGKPFRKINKPMLVNSINEKDCITEIEFSIGKNEFKVIRGIKPSIFEIYC---
gi|6180601      DALTFSLFNKPFRKINKGQLANSTNEKDCLVEVEFSINNKEYIVKRGIKPNLFLIIV---
gi|6180632      DALCFALFNKPFRKISKSQLVNSINEKGTKVQVTFSIGRDEYRVFRAIKPNIFELYK---
gi|3863994      EALTFLLYGKAFRDVTKAQLVNSQNKKGLHVEGELSVGKDRYHIERGIKPNILKITK---
gi|1092900      EAIYFALFGKPFRDITKNQLLNENTGKNLLVELWLEYEEKIYHITRGIKPNKFSITC---
gi|3765152      EAIYFALFGKPFRDITKNQLINENTGKNMLVELWLEYEEKVYHITRGIKPNKFAITC---
gi|3362062      EALCFVLFGKPFRSIKKGQLINSVNKKKLLVEVWFELDGKEFYIKRGQKPEVFEVHR---
gi|1573113      EALCFVLFGKPFRSIKKGQLINSVHKKKLLVEVWFELDGKEFYIKRGQKPEVFEVHR---
gi|4777919      EALTFGIFGRPFRDIKKGQLINSMNKKDQLVEVDIRFNGSLFEVRRGQKPTIFEIKR---
gi|1616225      EAVTFALFGKPFRDVKKGQLINSSNKKDLLVELWMEYDGKEYYIKRGQKPNVFEISC---
gi|1163262      EAITFGLFGKPFRDVKKGQLINSTNKKELLVELWMEYDEKKYYIKRGQKPNVFEITI---
gi|2288613      EAITFGLFGKPFRDVKKGQLINSTNKKELLVELWMEYDEKKYYIKRGQKPNVFEITV---
gi|9632641      EAITFGLFGKPFRDVKKGQLINSTNKKELLVELWMEYDEKKYYIKRGQKPNVFEITV---
gi|215895|      ------------------------------------------------------------
                                                                            

gi|1580793      QGTNDITQKSVADTDKKIQD-VFGIDYLTYANSIMYGQGNVEIFATATDKGKKQILENLA
gi|5853293      NEKLWNQESTLVDQQKNFEQNVLKMNYKSFTQIVVLGSSTFVPFMRLPVAQRREIIEDIL
gi|6180601      DGTPMHKEADDRVMQKMLEENILKVNYKSFTQIVILGSTNFVPFMQLSGSNRREVIEDLL
gi|6180632      NNKLVDQDAATKDTQKYLEQSILKLNFKSFTQVVILGSSTFVPFMQLTAPNRREVIEDLL
gi|3863994      NGEPLKEVASATEYQSYFETELLGISYDSFKQIIVLGTAGYKPFMELPAGKRRELVEDLL
gi|1092900      DGVAIDAAASVKDFQSYFEE-MIGMNSTSFKQIVVLGTAGYTPFMQLKAPERRKLVEDLL
gi|3765152      DGAQVDAAASIKDFQAYFEE-MIGMNATSFKQIVVLGTAGYTPFMQLKAPERRKLVEDLL
gi|3362062      DGQKIDESASTKDFQEYFEG-IIGMNLASFKQIVVLGTAGYVPFMSLPAAGRRKLVEDLL
gi|1573113      DGQKIDESASTKDFQEYFEG-IIGMNLASFKQIVVLGTAGYVPFMSLPAAGRRKLVEDLL
gi|4777919      DGVPLDESASAKDFQEYFEQ-LIGLNYNSFKQIIVLGTAGYTPFMALTAPNRRKLVEDLL
gi|1616225      DGERLDESASSKDFQAEFEQ-LIGMSYASFKQIVVLGTAGYTPFMGLSTPARRKLVEDLL
gi|1163262      NGTRLNESASSKDFQAEFEQ-LIGMSYASFKQIVVLGTAGYTPFMGLSTPARRKLVEDLL
gi|2288613      NGTRLNESASSKDFQAEFEQ-LIGMSYASFKQIVVLGTAGYTPFMGLSTPARRKLVEDLL
gi|9632641      NGTRLNESASSKDFQAEFEQ-LIGMSYASFKQIVVLGTAGYTPFMGLSTPARRKLVEDLL
gi|215895|      ------------------------------------------------------------
                                                                            

gi|1580793      DIGVYRYAQDVAKERAQKALALAEELNRQYIAKTYEKDGLTQSYNSALQQYENTEKLIQQ
gi|5853293      DIQVFSVMNILLKDKI-------RENNEEIKGIDYQLDLLKEKIDLQKNYLLEIDKKQKA
gi|6180601      DIRIFSAMNSLIKDKI-------RGQKDEIKTLDLSKDNIKDKVEMQTNFINELESQGKQ
gi|6180632      DIKIFSHMNTILKDRYKVAYQQSKDCSNLLSIAEERLKSQEKLIKSLREVNSVRRQEKED
gi|3863994      DVSVIGDMDKINKGII-------KEKKGELDLLRVKLTSAESEQQTAEASIAAQQKQTDN
gi|1092900      EVSVLAQMDKINKTRI-------KELNQDITSVDMEINHINSQLKTYQDHQNNSNASNAA
gi|3765152      EVSVLAQMDKLNKARI-------KELNQEIASVDVTINHINTQLKTYHDHQNNSNASNDA
gi|3362062      DIATLGEMDKLNKAYV-------REITQNIQMQEMKANHVQQQINTHKKYIEDASKASAE
gi|1573113      DIATLGEMDKLNKAYV-------REITQNIQMQEMKANHVQQQINTHKKYIEDASKASAE
gi|4777919      EITVLADMDKLNKTAI-------RELNTAQSLCDQRIQHLNIQIKTHQDHDEKQKRLSGD
gi|1616225      EVSVLADMDKLNKSLI-------RETNSQIQVIDVKQDSITQQIKIYNDNEERQRKLSGE
gi|1163262      EVGTLAEMDKLNKALI-------RELNSQNQVLDVKKDSIIQQIKIYNDNVERQKKLTGD
gi|2288613      EVGTLAEMDKLNKALI-------RELNSQNQVLDVKKDSIIQQIKIYNDNVERQKKLTGD
gi|9632641      EVGTLAEMDKLNKALI-------RELNSQNQVLDVKKDSIIQQIKIYNDNVERQKKLTGD
gi|215895|      ------------------------------------------------------------
                                                                            

gi|1580793      KESELANAELAIKQSEKNLSEGRALREPELEKLREQMAQLTSPADVREID-VEVETQYSN
gi|5853293      DIDKKNE------KITELLNEELNHHN-LINETNVKIEELNEE------I-KKYSSSSDK
gi|6180601      IIDEKRS------KIDTLLCEAEDYVM-QNEQLSDDVIDLTRE------Q-ENVTGAKGK
gi|6180632      KVVQNKA------LIESIEQDQSQRKD-ELSVLDKQLIDT--------------ESHQYI
gi|3863994      MIAMFTT------NFRALVDQAKAFKE-SAAKNQNELDSLVEPVYLEQDDSQEVEDKRDN
gi|1092900      AISDHQA------VYDTAREKAKEIKS-AIDLLTTQITEFVMP-----------DSPASD
gi|3765152      AVADHQA------VFEEARDKAKQIKS-IIDSLTEQLTNFEMP-----------ESPAND
gi|3362062      NLQRLQN------MYDKEVESAKAFKA-EETRLTDELLAVVMP-----------EDPSAA
gi|1573113      NLQRLQN------MYEKEVESAKAFKA-EETRLTDELLAVVMP-----------EDPSAA
gi|4777919      NLIRLNK------MYDEQVAIVNANKD-KAIAHSEKINAIISP-----------PDLTTE
gi|1616225      NAARLQL------MYDELVKEARTAKA-SIESLTDELLNVIVD-----------DDPSDS
gi|1163262      NLTRLQN------MYDDLAKEARTLKS-EIEEANERLVNIVLD-----------EDPTDA
gi|2288613      NLTRLQN------MYDDLAKEARTLKS-EIEEANERLVNIVLD-----------EDPTDA
gi|9632641      NLTRLQN------MYDDLAKEARTLKS-EIEEANERLVNIVLD-----------EDPTDA
gi|215895|      ------------------------------------------------------------
                                                                            

gi|1580793      VS-RLSSAKTQNDTAIEKLKKEL-------------------------------------
gi|5853293      LK-KLNTFLIKLSSKMQTCQKEH-------------------------------------
gi|6180601      LK-KLNTLKGKMSNKVATLTKEH-------------------------------------
gi|6180632      LS-DLKSKTADLKSEMKRVSKEM-------------------------------------
gi|3863994      LNSQIDELESSHKEELDEIQSKIAMLRLDQPHDCALVHDEMMLEESKPTQEDLIAKTAAV
gi|1092900      LG-KFTMARAKAAAQHEQFSGIA-------------------------------------
gi|3765152      LG-KFTMARAKAAAQKEQFAGIA-------------------------------------
gi|3362062      LA-KINTAIAQIGAQIQNFDRVI-------------------------------------
gi|1573113      LA-KINTAIAQIGAQIQNFDRVI-------------------------------------
gi|4777919      IG-RIQRDLAVHDQKCHQYDKVL-------------------------------------
gi|1616225      MS-DLSNKGFAIKNDMATFTKVV-------------------------------------
gi|1163262      FN-KIGQEAVLIKSKIDSYNKVI-------------------------------------
gi|2288613      FN-KIGQEAFLIKSKIDSYNKVI-------------------------------------
gi|9632641      FN-KIGQEAFLIKSKIDSYNKVI-------------------------------------
gi|215895|      ------------------------------------------------------------
                                                                            

gi|1580793      --------------------------------------------EDVKTNTNCYLCGAL-
gi|5853293      --------------------------------------------EFFEKNQVCPTCTQD-
gi|6180601      --------------------------------------------KFFTEHTVCPTCTQN-
gi|6180632      --------------------------------------------KFLKSHDTCPTCTQT-
gi|3863994      VIPNEPVYVEASEPTVVNVREELKLANQLKMAFELDKRQLVGRREFFEKGGECPTCGTDC
gi|1092900      --------------------------------------------HMHEDGGTCPTCMQQ-
gi|3765152      --------------------------------------------HMHEDGGVCPTCMQQ-
gi|3362062      --------------------------------------------HMHEKGGICPTCTQP-
gi|1573113      --------------------------------------------HMHEKGGICPTCTQP-
gi|4777919      --------------------------------------------HLYNTGGVCPTCIQP-
gi|1616225      --------------------------------------------KLYETGGHCPTCMQG-
gi|1163262      --------------------------------------------NMYHEGGLCPTCLSQ-
gi|2288613      --------------------------------------------NMYHEGGLCPTCLSQ-
gi|9632641      --------------------------------------------NMYHEGGLCPTCLSQ-
gi|215895|      ------------------------------------------------------------
                                                                            

gi|1580793      ---------------------LSPQHREQEIQRIQREIADKEAFIEKLNSALAVYSPLLE
gi|5853293      ---------------------LSDQFREDKISSGKSKLDEMTLGYNDL------------
gi|6180601      ---------------------IEEEFRVNRITDAQTKAKELQTGYREL------------
gi|6180632      ---------------------ISTEFKEGKIESLTTSGVDYAKKLKKE------------
gi|3863994      SNHSHDRIAEIDNEIASFDVKISEQDQI--ISGLTAQEQQYETDLKTY------------
gi|1092900      ---------------------FDDPEL---LVKLRDKMSQIQGQLDKA------------
gi|3765152      ---------------------FDDPDL---LTKLHDKMSVIQGQLDKA------------
gi|3362062      ---------------------IIQGND----QAVREQKAQAEHKLSLI------------
gi|1573113      ---------------------IIQGND----QAVREQKAQAEHKLSLI------------
gi|4777919      ---------------------LSN-PQL--VGQIKARRDAEDTAAHTL------------
gi|1616225      ---------------------LEEHGNI--LTKIKDKNFELQKSLDKI------------
gi|1163262      ---------------------LSSGDKV--VSKIKDKVSECTHSFEQL------------
gi|2288613      ---------------------LSSGDKV--VSKIKDKVSECTHSFEQL------------
gi|9632641      ---------------------LSSGDKV--VSKIKDKVSECTHSFEQL------------
gi|215895|      ------------------------------------------------------------
                                                                            

gi|1580793      QARAKQEEARKAIQEHTNIYHKLNG---------------EMNVLYHEIDTLENTLNTSI
gi|5853293      ------MEAIGEEEKRFCKWDEISS---------------SITENNNKISQCNYAIKSIR
gi|6180601      ------EDAIQKEEEREHQFTKLTK---------------EITELNNGISKNHTLISGCN
gi|6180632      ------QKAIEDVVSILDEANMLSM---------------KAHELRTEISTFDRDLVRLD
gi|3863994      ------RATVDENERKRREYEKQTNDYAYQCRMISEHHEAEIRRIDREIEEMRLNHATQV
gi|1092900      ------DIRINELNQKMIEFNEATV---------------NFRDLQNKLNNEKQSIALYV
gi|3765152      ------DDRIEELNQQMVEYNEATV---------------RFRDVQTQLNNEKQSISLYV
gi|3362062      ------DEKRVEYAEKANSFQTAQT---------------KVLEIKRAIESQRANLTASV
gi|1573113      ------DEKRVEYAEKANSFQTAQT---------------KVLEIKRAIELQRANLTASV
gi|4777919      ------TASLNSAQDDQRLYLSAVN---------------QIRALQSEQAQFKSAAVAAV
gi|1616225      ------NEQYQELKLIKDQVAEQRN---------------KALAIKSQIATHKQQAITAV
gi|1163262      ------STHRDNLKVLVDEYRDNIK---------------TQQTLANDIRNKKQSLITTV
gi|2288613      ------STHRDNLKVLVDEYRDNIK---------------TQQSLANDIRNKKQSLITTV
gi|9632641      ------STHRDNLKVLVDEYRDNIK---------------TQQSLANDIRNKKQSLIAAV
gi|215895|      ------------------------------------------------------------
                                                                            

gi|1580793      -----------------------------NNRDSIKDMLARLQEIPKPQ-----------
gi|5853293      -----------------------------KSIDDVEKEIKELESGGGDKK----------
gi|6180601      -----------------------------RQVRDLESEIQRLTDQHANRN----------
gi|6180632      -----------------------------SENLSIEKELSNLVAAPKIE-----------
gi|3863994      IEYDRNMRTLEDEKRWAIDSFKDNKAELEDRLSQLEDEVERLKSERVAKHNLDVAQYKAN
gi|1092900      -----------------------------NQAKAAKAAIERLQDERT-------------
gi|3765152      -----------------------------NQAKAAKAAIERLQAARP-------------
gi|3362062      -----------------------------GRAKQIQKAIQELQKERV-------------
gi|1573113      -----------------------------GRAKQIQKAMQELQKERV-------------
gi|4777919      -----------------------------GQAKKIKALIEEASKEYV-------------
gi|1616225      -----------------------------EKAKKVKVLIDQAAAEFV-------------
gi|1163262      -----------------------------DKAKKVKAAIEKASSEFI-------------
gi|2288613      -----------------------------DKAKKVKAAIEKASSEFI-------------
gi|9632641      -----------------------------DKAKKVKAAIEKASSEFI-------------
gi|215895|      ------------------------------------------------------------
                                                                            

gi|1580793      -------------------YDYDKDREIEDEL-----------------NKINQLKLDAE
gi|5853293      -------------------EAYTKLETLVANK-----------------KDLSFQLSESK
gi|6180601      -------------------TEQEKLAEFNQNL-----------------QEVFKKLADKK
gi|6180632      -------------------KEEHVLKTLVDDFE---------------DTKIDCGKVAQK
gi|3863994      VEALKASIATGTESYETTADNARNLKKQIDDLKATEYDRSQVDAAIQRANELKEEIAKIV
gi|1092900      -------------------DYTSEIDQLGNNL-----------------RLKISAKSDLE
gi|3765152      -------------------DYTGEITKLNDEL-----------------VAKINTKSEIE
gi|3362062      -------------------DNSEELAKLEHEL-----------------VEITNEKSKLV
gi|1573113      -------------------DNSEELAKLEHEL-----------------VEITNEKSKLV
gi|4777919      -------------------DNSQQIQALQDDL-----------------NAEYTNKADMV
gi|1616225      -------------------SNAEEIAALQAEL-----------------DKIVSTKSSLV
gi|1163262      -------------------DHADEIALLQEEL-----------------DKIVKTKTNLV
gi|2288613      -------------------DHADEIALLQEEL-----------------DKIVKTKTNLV
gi|9632641      -------------------DHADEIALLQEEL-----------------DKIVKTKTNLV
gi|215895|      ------------------------------------------------------------
                                                                            

gi|1580793      EEASQYKTIAQEIFSNKGIRSEVLDL-VTPFLNERANHYLSTLSGSDIEINFSTQTEKAD
gi|5853293      KDK-DMLSVASGLLKDNGIKTRIIKK-YLPIMNKLINHYLQGM---DFYVNF--------
gi|6180601      EEV-MYHDFAYSLLKDDGVKTKIIKK-YLPLINQQVNRFLQMM---DFYINF--------
gi|6180632      IDE-YHT--VRSLLQDSGIKSRIIKK-YVPIFNQLINKYLHSM---DFFVNF--------
gi|3863994      LEL-HHRSIVADMLKDNGVKAHIVKR-YIPVFNKKINEYLKAL---GADYVF--------
gi|1092900      KEK-HRRSLIADLLKDSGIKAVIMAR-YIPYFNNRISHYLDIM---DADFGF--------
gi|3765152      REK-HQRSMISDLLKDSGIKAVIMAR-YIPYFNNRIAHYLEIM---EADFGF--------
gi|3362062      LEK-YHRGFVTEMLKDSGVKASIVKK-YIPYFNDRIAYYLDIM---EADYIF--------
gi|1573113      LEK-YHRGFVTEMLKDSGVKASIVKK-YIPYFNDRIAYYLDIM---EADYIF--------
gi|4777919      MDK-YRRGCITEMLRTLVLKAQLYRNTFLCSINTSMNTCRLWV---LIMYS---------
gi|1616225      MEK-YHRGILTEMLKDTGIKGSIIKK-YIPIFNKQINSYLKIM---EADYVF--------
gi|1163262      MEK-YHRGILTDMLKDSGIKGAIIKK-YIPLFNKQINHYLKIM---EADYVF--------
gi|2288613      MEK-YHRGILTDMLKDSGIKGAIIKK-YIPLFNKQINHYLKIM---EADYVF--------
gi|9632641      MEK-YHRGILTDMLKDSGIKGAIIKK-YIPLFNKQINHYLKIM---EADYVF--------
gi|215895|      ------------------------------------------------------------
                                                                            

gi|1580793      GSLADKFDLEVVNGSGGN--TYQANSEGEKKRIDLAISFAIQDLVQSKANIAVNLGLYDE
gi|5853293      -TLDENFE-ETIKSRFRDQFSYASFSEGEKARIDIALLLTWRSIAKLKNSVDTNLLILDE
gi|6180601      -KLDEEFS-ETIESPIHEKFSYASFSEGEKMRIDLALLFTWREVARVKNSVNTNLLIMDE
gi|6180632      -TLDEEFN-EEIKSRFRDDFCYASFSEGEKQKIDLALLFTWREVARMKNSAATNLLILDE
gi|3863994      -ALDEGFN-ESIKSRGREDFCYASFSEGEKARINLSLLFTWRDVSSMISGVNINLLCMDE
gi|1092900      -TLDSEFK-EVIKSSGRSTFSYNSFSQGEKARIDMAVMFAWRDLASEVSGVDVNALFMDE
gi|3765152      -TLDAEFK-EVIKSAGRSTFSYNSFSQGEKARIDMAVMFAWRDLASEVSGVDVNALFMDE
gi|3362062      -TLDEEFN-ETIKSRGRESFSYTSFSQGEKARIDLAMLFTWRDVAGKVSGTNISLLVLDE
gi|1573113      -TLDEEFN-ETIKSRGRESFSYTSFSQGEKARIDLAMLFTWRDVAGKVSGTNISLLVLDE
gi|4777919      -RLNQEFG-ESIKSRGREDFSYASFSQGEKARIDIALLFTWRKIASAVTGVNISTLILDE
gi|1616225      -TLDEEFN-ETIKSRGREDFSYASFSQGEKARIDIALLFTWRDIASRVSGVNISTLILDE
gi|1163262      -TLDEEFN-ETIKSRGREDFSYASFSQGEKARIDIALLFTWRDIAEKVSGVKISCLFLDE
gi|2288613      -TLDEEFN-ETIKSRGREDFSYASFSQGEKARIDIALLFTWRDIAEKVSGVKINTLILDE
gi|9632641      -TLDEEFN-ETIKSRGREDFSYASFSEGEKARIDIALLFTWRDIASIVSGVSISTLILDE
gi|215895|      --------------------------------IDIALLFTWRDIASIVSGVSISTLILDE
                                                *:::: :: ..:     .   .    **

gi|1580793      CFDG-LDAIGCENVIKILKERQKNISSIFVITHS-ENLKPLFENVITMKKVQGRSYLEES
gi|5853293      IFDGSLDQQGGSDLGWILRSFDDN-ISVFVISHK-EQMNDKYDRTFNVEKIKNYSVVRET
gi|6180601      IFDSSLDGFGTDEFLKIIRFVIKD-ANVFVISHK-AELQDKFESVIRFEKIKGFSRMVV-
gi|6180632      VFDSSLDADSTNALLSILGTLGNN-TNIFVISHKGDILIEKFHRTLRFEKINDFSKLVDD
gi|3863994      VFDGSCDEMGIVGINKMLDSM-KS--NIIVISHRKDAMDDSFNRHIRMHKQGRFTTMVEN
gi|1092900      VFDGPSDDDAQRSVFSIIENM-KA--NVFIISHG-EHDPQKFDRHIVMSKLGRTSVMNEV
gi|3765152      VFDGPSDTDAQGAVFSIIDKM-KA--NVLIISHG-DHDPQNFDRHVKMSKLGRTSVMEEV
gi|3362062      IYDGATDVQGVKALDSIIDKL-DD--NVYIISHR-DHNPDDFSRHLKMVKRGRFTEMNVN
gi|1573113      IYDGATDVQGVKALDSIIDKL-DD--NVYIISHR-DHNPDDFSRHLKMVKRGRFTEMNVN
gi|4777919      VADGATDAEGVKAIQQILNSI-PD-LNCFIISHR-DHNPDDYGQHLKMRKVGRFSVLETI
gi|1616225      VFDSATDAEGVKSIATILNSL-ED-TNVFIISHR-DHDPQAYGQHLQMKKVGRFTVME--
gi|1163262      VYDGAFDAEGIKNVAKILDGL-KD-TNFFIISHK-DHDPQEYGQHIQMEKVGRFSLAKIS
gi|2288613      VFDSATDVEGVKAISTILDSL-KN-TNVFVISHR-DHDPQAYGQHLQMKKVGRFTVMV--
gi|9632641      VFDGSFDAEGIKGVANIINSM-KN-TNVFIISHK-DHDPQEYGQHLQMKKVGRFTVMV--
gi|215895|      VFDGSFDAEGIKGVANIINSM-KN-TNVFIISHK-DHDPQEYGQHLQMKKVGRFTVMV--
                  *.  *  .   .  ::        .  :*:*        :   . . *    :     

gi|1580793      K----
gi|5853293      ISKLD
gi|6180601      -----
gi|6180632      L----
gi|3863994      VR---
gi|1092900      IFDVL
gi|3765152      IFNVL
gi|3362062      I----
gi|1573113      I----
gi|4777919      SNA--
gi|1616225      -----
gi|1163262      -----
gi|2288613      -----
gi|9632641      -----
gi|215895|      -----
                     

*************************************************************************************************

Gblocks 0.91b Results
Processed file: input.fasta
Number of sequences: 15
Alignment assumed to be: Protein
New number of positions: 59 (selected positions are underlined in blue) 

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
gi|158079343|re  -------MLKFKRVSAENYMSIGS--VSIDLDNQGLVLIEGINDTNETFQSNGSGKSTLL
gi|58532930|ref  -------MITFKKIRWKNFLSTGNVFTEIDITKTKTNLIVG---------DNGAGKSTIL
gi|61806019|ref  -------MIIFQKIRWKNFLSTGNQFTEVDFQQNATNLIIG---------TNGTGKSTVL
gi|61806323|ref  -------MIVFETIAWKNFLSTGDQWTDIQLDDAGATLIVG---------SNGAGKSTML
gi|38639947|ref  -----M-DISFHWVKYQNIMSVGAKAVRVTLDEHKKTLVTG---------TNGAGKSTFI
gi|109290030|re  MIEIKKKQLGFIRVRYKNIMSVGDDPIDMSLNKYAKTLCTG---------KNGAGKSTML
gi|37651524|ref  MIDIKKKQLDFIRVRYKNIMSVGDEPIDLTLNEYAKTLCTG---------KNGAGKSTML
gi|33620623|ref  -----MAKLNFKTLRYQNIMSVGAEPVEIQLDGFKKTLITG---------VNGAGKSTMI
gi|157311335|re  -----MAKLNFKTLRYQNIMSVGAEPVEIQLDGFKKTLITG---------VNGAGKSTMI
gi|47779194|gb|  -----MKKLEILRVKYKNTLSVGQQPIEIFLNRCHKSLVTG---------KNGDGKSTFI
gi|161622553|re  -----MKTFKLKKVTYKNIMSVGQQPITIQLDKVQKTLVTG---------KNGAGKSTFL
gi|116326277|re  -----MKNFKLNRVRYQNIMSVGGNPIDIQLDKVQKTLITG---------RNGGGKSTML
gi|228861369|re  -----MKNFKLNRVRYQNIMSVGGNPIDIQLDKVQKTLITG---------RNGGGKSTML
gi|9632641|ref|  -----MKNFKLNRVKYKNIMSVGQNGIDIQLDKVQKTLITG---------RNGGGKSTML
gi|215895|gb|AA  ------------------------------------------------------------
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
gi|158079343|re  STVTYALYGATPSGLKADAVINKQAKKNMSVILEFEKDGVPYRIERYRKHSKHKNTTRFF
gi|58532930|ref  DALTFSLFGKPFRKINKPMLVNSINEKDCITEIEFSIGKNEFKVIRGIKPSIFEIYC---
gi|61806019|ref  DALTFSLFNKPFRKINKGQLANSTNEKDCLVEVEFSINNKEYIVKRGIKPNLFLIIV---
gi|61806323|ref  DALCFALFNKPFRKISKSQLVNSINEKGTKVQVTFSIGRDEYRVFRAIKPNIFELYK---
gi|38639947|ref  EALTFLLYGKAFRDVTKAQLVNSQNKKGLHVEGELSVGKDRYHIERGIKPNILKITK---
gi|109290030|re  EAIYFALFGKPFRDITKNQLLNENTGKNLLVELWLEYEEKIYHITRGIKPNKFSITC---
gi|37651524|ref  EAIYFALFGKPFRDITKNQLINENTGKNMLVELWLEYEEKVYHITRGIKPNKFAITC---
gi|33620623|ref  EALCFVLFGKPFRSIKKGQLINSVNKKKLLVEVWFELDGKEFYIKRGQKPEVFEVHR---
gi|157311335|re  EALCFVLFGKPFRSIKKGQLINSVHKKKLLVEVWFELDGKEFYIKRGQKPEVFEVHR---
gi|47779194|gb|  EALTFGIFGRPFRDIKKGQLINSMNKKDQLVEVDIRFNGSLFEVRRGQKPTIFEIKR---
gi|161622553|re  EAVTFALFGKPFRDVKKGQLINSSNKKDLLVELWMEYDGKEYYIKRGQKPNVFEISC---
gi|116326277|re  EAITFGLFGKPFRDVKKGQLINSTNKKELLVELWMEYDEKKYYIKRGQKPNVFEITI---
gi|228861369|re  EAITFGLFGKPFRDVKKGQLINSTNKKELLVELWMEYDEKKYYIKRGQKPNVFEITV---
gi|9632641|ref|  EAITFGLFGKPFRDVKKGQLINSTNKKELLVELWMEYDEKKYYIKRGQKPNVFEITV---
gi|215895|gb|AA  ------------------------------------------------------------
                                                                             


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
gi|158079343|re  QGTNDITQKSVADTDKKIQD-VFGIDYLTYANSIMYGQGNVEIFATATDKGKKQILENLA
gi|58532930|ref  NEKLWNQESTLVDQQKNFEQNVLKMNYKSFTQIVVLGSSTFVPFMRLPVAQRREIIEDIL
gi|61806019|ref  DGTPMHKEADDRVMQKMLEENILKVNYKSFTQIVILGSTNFVPFMQLSGSNRREVIEDLL
gi|61806323|ref  NNKLVDQDAATKDTQKYLEQSILKLNFKSFTQVVILGSSTFVPFMQLTAPNRREVIEDLL
gi|38639947|ref  NGEPLKEVASATEYQSYFETELLGISYDSFKQIIVLGTAGYKPFMELPAGKRRELVEDLL
gi|109290030|re  DGVAIDAAASVKDFQSYFEE-MIGMNSTSFKQIVVLGTAGYTPFMQLKAPERRKLVEDLL
gi|37651524|ref  DGAQVDAAASIKDFQAYFEE-MIGMNATSFKQIVVLGTAGYTPFMQLKAPERRKLVEDLL
gi|33620623|ref  DGQKIDESASTKDFQEYFEG-IIGMNLASFKQIVVLGTAGYVPFMSLPAAGRRKLVEDLL
gi|157311335|re  DGQKIDESASTKDFQEYFEG-IIGMNLASFKQIVVLGTAGYVPFMSLPAAGRRKLVEDLL
gi|47779194|gb|  DGVPLDESASAKDFQEYFEQ-LIGLNYNSFKQIIVLGTAGYTPFMALTAPNRRKLVEDLL
gi|161622553|re  DGERLDESASSKDFQAEFEQ-LIGMSYASFKQIVVLGTAGYTPFMGLSTPARRKLVEDLL
gi|116326277|re  NGTRLNESASSKDFQAEFEQ-LIGMSYASFKQIVVLGTAGYTPFMGLSTPARRKLVEDLL
gi|228861369|re  NGTRLNESASSKDFQAEFEQ-LIGMSYASFKQIVVLGTAGYTPFMGLSTPARRKLVEDLL
gi|9632641|ref|  NGTRLNESASSKDFQAEFEQ-LIGMSYASFKQIVVLGTAGYTPFMGLSTPARRKLVEDLL
gi|215895|gb|AA  ------------------------------------------------------------
                                                                             


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
gi|158079343|re  DIGVYRYAQDVAKERAQKALALAEELNRQYIAKTYEKDGLTQSYNSALQQYENTEKLIQQ
gi|58532930|ref  DIQVFSVMNILLKDKI-------RENNEEIKGIDYQLDLLKEKIDLQKNYLLEIDKKQKA
gi|61806019|ref  DIRIFSAMNSLIKDKI-------RGQKDEIKTLDLSKDNIKDKVEMQTNFINELESQGKQ
gi|61806323|ref  DIKIFSHMNTILKDRYKVAYQQSKDCSNLLSIAEERLKSQEKLIKSLREVNSVRRQEKED
gi|38639947|ref  DVSVIGDMDKINKGII-------KEKKGELDLLRVKLTSAESEQQTAEASIAAQQKQTDN
gi|109290030|re  EVSVLAQMDKINKTRI-------KELNQDITSVDMEINHINSQLKTYQDHQNNSNASNAA
gi|37651524|ref  EVSVLAQMDKLNKARI-------KELNQEIASVDVTINHINTQLKTYHDHQNNSNASNDA
gi|33620623|ref  DIATLGEMDKLNKAYV-------REITQNIQMQEMKANHVQQQINTHKKYIEDASKASAE
gi|157311335|re  DIATLGEMDKLNKAYV-------REITQNIQMQEMKANHVQQQINTHKKYIEDASKASAE
gi|47779194|gb|  EITVLADMDKLNKTAI-------RELNTAQSLCDQRIQHLNIQIKTHQDHDEKQKRLSGD
gi|161622553|re  EVSVLADMDKLNKSLI-------RETNSQIQVIDVKQDSITQQIKIYNDNEERQRKLSGE
gi|116326277|re  EVGTLAEMDKLNKALI-------RELNSQNQVLDVKKDSIIQQIKIYNDNVERQKKLTGD
gi|228861369|re  EVGTLAEMDKLNKALI-------RELNSQNQVLDVKKDSIIQQIKIYNDNVERQKKLTGD
gi|9632641|ref|  EVGTLAEMDKLNKALI-------RELNSQNQVLDVKKDSIIQQIKIYNDNVERQKKLTGD
gi|215895|gb|AA  ------------------------------------------------------------
                                                                             


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
gi|158079343|re  KESELANAELAIKQSEKNLSEGRALREPELEKLREQMAQLTSPADVREID-VEVETQYSN
gi|58532930|ref  DIDKKNE------KITELLNEELNHHN-LINETNVKIEELNEE------I-KKYSSSSDK
gi|61806019|ref  IIDEKRS------KIDTLLCEAEDYVM-QNEQLSDDVIDLTRE------Q-ENVTGAKGK
gi|61806323|ref  KVVQNKA------LIESIEQDQSQRKD-ELSVLDKQLIDT--------------ESHQYI
gi|38639947|ref  MIAMFTT------NFRALVDQAKAFKE-SAAKNQNELDSLVEPVYLEQDDSQEVEDKRDN
gi|109290030|re  AISDHQA------VYDTAREKAKEIKS-AIDLLTTQITEFVMP-----------DSPASD
gi|37651524|ref  AVADHQA------VFEEARDKAKQIKS-IIDSLTEQLTNFEMP-----------ESPAND
gi|33620623|ref  NLQRLQN------MYDKEVESAKAFKA-EETRLTDELLAVVMP-----------EDPSAA
gi|157311335|re  NLQRLQN------MYEKEVESAKAFKA-EETRLTDELLAVVMP-----------EDPSAA
gi|47779194|gb|  NLIRLNK------MYDEQVAIVNANKD-KAIAHSEKINAIISP-----------PDLTTE
gi|161622553|re  NAARLQL------MYDELVKEARTAKA-SIESLTDELLNVIVD-----------DDPSDS
gi|116326277|re  NLTRLQN------MYDDLAKEARTLKS-EIEEANERLVNIVLD-----------EDPTDA
gi|228861369|re  NLTRLQN------MYDDLAKEARTLKS-EIEEANERLVNIVLD-----------EDPTDA
gi|9632641|ref|  NLTRLQN------MYDDLAKEARTLKS-EIEEANERLVNIVLD-----------EDPTDA
gi|215895|gb|AA  ------------------------------------------------------------
                                                                             


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
gi|158079343|re  VS-RLSSAKTQNDTAIEKLKKEL-------------------------------------
gi|58532930|ref  LK-KLNTFLIKLSSKMQTCQKEH-------------------------------------
gi|61806019|ref  LK-KLNTLKGKMSNKVATLTKEH-------------------------------------
gi|61806323|ref  LS-DLKSKTADLKSEMKRVSKEM-------------------------------------
gi|38639947|ref  LNSQIDELESSHKEELDEIQSKIAMLRLDQPHDCALVHDEMMLEESKPTQEDLIAKTAAV
gi|109290030|re  LG-KFTMARAKAAAQHEQFSGIA-------------------------------------
gi|37651524|ref  LG-KFTMARAKAAAQKEQFAGIA-------------------------------------
gi|33620623|ref  LA-KINTAIAQIGAQIQNFDRVI-------------------------------------
gi|157311335|re  LA-KINTAIAQIGAQIQNFDRVI-------------------------------------
gi|47779194|gb|  IG-RIQRDLAVHDQKCHQYDKVL-------------------------------------
gi|161622553|re  MS-DLSNKGFAIKNDMATFTKVV-------------------------------------
gi|116326277|re  FN-KIGQEAVLIKSKIDSYNKVI-------------------------------------
gi|228861369|re  FN-KIGQEAFLIKSKIDSYNKVI-------------------------------------
gi|9632641|ref|  FN-KIGQEAFLIKSKIDSYNKVI-------------------------------------
gi|215895|gb|AA  ------------------------------------------------------------
                                                                             


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
gi|158079343|re  --------------------------------------------EDVKTNTNCYLCGAL-
gi|58532930|ref  --------------------------------------------EFFEKNQVCPTCTQD-
gi|61806019|ref  --------------------------------------------KFFTEHTVCPTCTQN-
gi|61806323|ref  --------------------------------------------KFLKSHDTCPTCTQT-
gi|38639947|ref  VIPNEPVYVEASEPTVVNVREELKLANQLKMAFELDKRQLVGRREFFEKGGECPTCGTDC
gi|109290030|re  --------------------------------------------HMHEDGGTCPTCMQQ-
gi|37651524|ref  --------------------------------------------HMHEDGGVCPTCMQQ-
gi|33620623|ref  --------------------------------------------HMHEKGGICPTCTQP-
gi|157311335|re  --------------------------------------------HMHEKGGICPTCTQP-
gi|47779194|gb|  --------------------------------------------HLYNTGGVCPTCIQP-
gi|161622553|re  --------------------------------------------KLYETGGHCPTCMQG-
gi|116326277|re  --------------------------------------------NMYHEGGLCPTCLSQ-
gi|228861369|re  --------------------------------------------NMYHEGGLCPTCLSQ-
gi|9632641|ref|  --------------------------------------------NMYHEGGLCPTCLSQ-
gi|215895|gb|AA  ------------------------------------------------------------
                                                                             


                        430       440       450       460       470       480
                 =========+=========+=========+=========+=========+=========+
gi|158079343|re  ---------------------LSPQHREQEIQRIQREIADKEAFIEKLNSALAVYSPLLE
gi|58532930|ref  ---------------------LSDQFREDKISSGKSKLDEMTLGYNDL------------
gi|61806019|ref  ---------------------IEEEFRVNRITDAQTKAKELQTGYREL------------
gi|61806323|ref  ---------------------ISTEFKEGKIESLTTSGVDYAKKLKKE------------
gi|38639947|ref  SNHSHDRIAEIDNEIASFDVKISEQDQI--ISGLTAQEQQYETDLKTY------------
gi|109290030|re  ---------------------FDDPEL---LVKLRDKMSQIQGQLDKA------------
gi|37651524|ref  ---------------------FDDPDL---LTKLHDKMSVIQGQLDKA------------
gi|33620623|ref  ---------------------IIQGND----QAVREQKAQAEHKLSLI------------
gi|157311335|re  ---------------------IIQGND----QAVREQKAQAEHKLSLI------------
gi|47779194|gb|  ---------------------LSN-PQL--VGQIKARRDAEDTAAHTL------------
gi|161622553|re  ---------------------LEEHGNI--LTKIKDKNFELQKSLDKI------------
gi|116326277|re  ---------------------LSSGDKV--VSKIKDKVSECTHSFEQL------------
gi|228861369|re  ---------------------LSSGDKV--VSKIKDKVSECTHSFEQL------------
gi|9632641|ref|  ---------------------LSSGDKV--VSKIKDKVSECTHSFEQL------------
gi|215895|gb|AA  ------------------------------------------------------------
                                                                             


                        490       500       510       520       530       540
                 =========+=========+=========+=========+=========+=========+
gi|158079343|re  QARAKQEEARKAIQEHTNIYHKLNG---------------EMNVLYHEIDTLENTLNTSI
gi|58532930|ref  ------MEAIGEEEKRFCKWDEISS---------------SITENNNKISQCNYAIKSIR
gi|61806019|ref  ------EDAIQKEEEREHQFTKLTK---------------EITELNNGISKNHTLISGCN
gi|61806323|ref  ------QKAIEDVVSILDEANMLSM---------------KAHELRTEISTFDRDLVRLD
gi|38639947|ref  ------RATVDENERKRREYEKQTNDYAYQCRMISEHHEAEIRRIDREIEEMRLNHATQV
gi|109290030|re  ------DIRINELNQKMIEFNEATV---------------NFRDLQNKLNNEKQSIALYV
gi|37651524|ref  ------DDRIEELNQQMVEYNEATV---------------RFRDVQTQLNNEKQSISLYV
gi|33620623|ref  ------DEKRVEYAEKANSFQTAQT---------------KVLEIKRAIESQRANLTASV
gi|157311335|re  ------DEKRVEYAEKANSFQTAQT---------------KVLEIKRAIELQRANLTASV
gi|47779194|gb|  ------TASLNSAQDDQRLYLSAVN---------------QIRALQSEQAQFKSAAVAAV
gi|161622553|re  ------NEQYQELKLIKDQVAEQRN---------------KALAIKSQIATHKQQAITAV
gi|116326277|re  ------STHRDNLKVLVDEYRDNIK---------------TQQTLANDIRNKKQSLITTV
gi|228861369|re  ------STHRDNLKVLVDEYRDNIK---------------TQQSLANDIRNKKQSLITTV
gi|9632641|ref|  ------STHRDNLKVLVDEYRDNIK---------------TQQSLANDIRNKKQSLIAAV
gi|215895|gb|AA  ------------------------------------------------------------
                                                                             


                        550       560       570       580       590       600
                 =========+=========+=========+=========+=========+=========+
gi|158079343|re  -----------------------------NNRDSIKDMLARLQEIPKPQ-----------
gi|58532930|ref  -----------------------------KSIDDVEKEIKELESGGGDKK----------
gi|61806019|ref  -----------------------------RQVRDLESEIQRLTDQHANRN----------
gi|61806323|ref  -----------------------------SENLSIEKELSNLVAAPKIE-----------
gi|38639947|ref  IEYDRNMRTLEDEKRWAIDSFKDNKAELEDRLSQLEDEVERLKSERVAKHNLDVAQYKAN
gi|109290030|re  -----------------------------NQAKAAKAAIERLQDERT-------------
gi|37651524|ref  -----------------------------NQAKAAKAAIERLQAARP-------------
gi|33620623|ref  -----------------------------GRAKQIQKAIQELQKERV-------------
gi|157311335|re  -----------------------------GRAKQIQKAMQELQKERV-------------
gi|47779194|gb|  -----------------------------GQAKKIKALIEEASKEYV-------------
gi|161622553|re  -----------------------------EKAKKVKVLIDQAAAEFV-------------
gi|116326277|re  -----------------------------DKAKKVKAAIEKASSEFI-------------
gi|228861369|re  -----------------------------DKAKKVKAAIEKASSEFI-------------
gi|9632641|ref|  -----------------------------DKAKKVKAAIEKASSEFI-------------
gi|215895|gb|AA  ------------------------------------------------------------
                                                                             


                        610       620       630       640       650       660
                 =========+=========+=========+=========+=========+=========+
gi|158079343|re  -------------------YDYDKDREIEDEL-----------------NKINQLKLDAE
gi|58532930|ref  -------------------EAYTKLETLVANK-----------------KDLSFQLSESK
gi|61806019|ref  -------------------TEQEKLAEFNQNL-----------------QEVFKKLADKK
gi|61806323|ref  -------------------KEEHVLKTLVDDFE---------------DTKIDCGKVAQK
gi|38639947|ref  VEALKASIATGTESYETTADNARNLKKQIDDLKATEYDRSQVDAAIQRANELKEEIAKIV
gi|109290030|re  -------------------DYTSEIDQLGNNL-----------------RLKISAKSDLE
gi|37651524|ref  -------------------DYTGEITKLNDEL-----------------VAKINTKSEIE
gi|33620623|ref  -------------------DNSEELAKLEHEL-----------------VEITNEKSKLV
gi|157311335|re  -------------------DNSEELAKLEHEL-----------------VEITNEKSKLV
gi|47779194|gb|  -------------------DNSQQIQALQDDL-----------------NAEYTNKADMV
gi|161622553|re  -------------------SNAEEIAALQAEL-----------------DKIVSTKSSLV
gi|116326277|re  -------------------DHADEIALLQEEL-----------------DKIVKTKTNLV
gi|228861369|re  -------------------DHADEIALLQEEL-----------------DKIVKTKTNLV
gi|9632641|ref|  -------------------DHADEIALLQEEL-----------------DKIVKTKTNLV
gi|215895|gb|AA  ------------------------------------------------------------
                                                                             


                        670       680       690       700       710       720
                 =========+=========+=========+=========+=========+=========+
gi|158079343|re  EEASQYKTIAQEIFSNKGIRSEVLDL-VTPFLNERANHYLSTLSGSDIEINFSTQTEKAD
gi|58532930|ref  KDK-DMLSVASGLLKDNGIKTRIIKK-YLPIMNKLINHYLQGM---DFYVNF--------
gi|61806019|ref  EEV-MYHDFAYSLLKDDGVKTKIIKK-YLPLINQQVNRFLQMM---DFYINF--------
gi|61806323|ref  IDE-YHT--VRSLLQDSGIKSRIIKK-YVPIFNQLINKYLHSM---DFFVNF--------
gi|38639947|ref  LEL-HHRSIVADMLKDNGVKAHIVKR-YIPVFNKKINEYLKAL---GADYVF--------
gi|109290030|re  KEK-HRRSLIADLLKDSGIKAVIMAR-YIPYFNNRISHYLDIM---DADFGF--------
gi|37651524|ref  REK-HQRSMISDLLKDSGIKAVIMAR-YIPYFNNRIAHYLEIM---EADFGF--------
gi|33620623|ref  LEK-YHRGFVTEMLKDSGVKASIVKK-YIPYFNDRIAYYLDIM---EADYIF--------
gi|157311335|re  LEK-YHRGFVTEMLKDSGVKASIVKK-YIPYFNDRIAYYLDIM---EADYIF--------
gi|47779194|gb|  MDK-YRRGCITEMLRTLVLKAQLYRNTFLCSINTSMNTCRLWV---LIMYS---------
gi|161622553|re  MEK-YHRGILTEMLKDTGIKGSIIKK-YIPIFNKQINSYLKIM---EADYVF--------
gi|116326277|re  MEK-YHRGILTDMLKDSGIKGAIIKK-YIPLFNKQINHYLKIM---EADYVF--------
gi|228861369|re  MEK-YHRGILTDMLKDSGIKGAIIKK-YIPLFNKQINHYLKIM---EADYVF--------
gi|9632641|ref|  MEK-YHRGILTDMLKDSGIKGAIIKK-YIPLFNKQINHYLKIM---EADYVF--------
gi|215895|gb|AA  ------------------------------------------------------------
                                                                             


                        730       740       750       760       770       780
                 =========+=========+=========+=========+=========+=========+
gi|158079343|re  GSLADKFDLEVVNGSGGN--TYQANSEGEKKRIDLAISFAIQDLVQSKANIAVNLGLYDE
gi|58532930|ref  -TLDENFE-ETIKSRFRDQFSYASFSEGEKARIDIALLLTWRSIAKLKNSVDTNLLILDE
gi|61806019|ref  -KLDEEFS-ETIESPIHEKFSYASFSEGEKMRIDLALLFTWREVARVKNSVNTNLLIMDE
gi|61806323|ref  -TLDEEFN-EEIKSRFRDDFCYASFSEGEKQKIDLALLFTWREVARMKNSAATNLLILDE
gi|38639947|ref  -ALDEGFN-ESIKSRGREDFCYASFSEGEKARINLSLLFTWRDVSSMISGVNINLLCMDE
gi|109290030|re  -TLDSEFK-EVIKSSGRSTFSYNSFSQGEKARIDMAVMFAWRDLASEVSGVDVNALFMDE
gi|37651524|ref  -TLDAEFK-EVIKSAGRSTFSYNSFSQGEKARIDMAVMFAWRDLASEVSGVDVNALFMDE
gi|33620623|ref  -TLDEEFN-ETIKSRGRESFSYTSFSQGEKARIDLAMLFTWRDVAGKVSGTNISLLVLDE
gi|157311335|re  -TLDEEFN-ETIKSRGRESFSYTSFSQGEKARIDLAMLFTWRDVAGKVSGTNISLLVLDE
gi|47779194|gb|  -RLNQEFG-ESIKSRGREDFSYASFSQGEKARIDIALLFTWRKIASAVTGVNISTLILDE
gi|161622553|re  -TLDEEFN-ETIKSRGREDFSYASFSQGEKARIDIALLFTWRDIASRVSGVNISTLILDE
gi|116326277|re  -TLDEEFN-ETIKSRGREDFSYASFSQGEKARIDIALLFTWRDIAEKVSGVKISCLFLDE
gi|228861369|re  -TLDEEFN-ETIKSRGREDFSYASFSQGEKARIDIALLFTWRDIAEKVSGVKINTLILDE
gi|9632641|ref|  -TLDEEFN-ETIKSRGREDFSYASFSEGEKARIDIALLFTWRDIASIVSGVSISTLILDE
gi|215895|gb|AA  --------------------------------IDIALLFTWRDIASIVSGVSISTLILDE
                                                 ############################


                        790       800       810       820       830       840
                 =========+=========+=========+=========+=========+=========+
gi|158079343|re  CFDG-LDAIGCENVIKILKERQKNISSIFVITHS-ENLKPLFENVITMKKVQGRSYLEES
gi|58532930|ref  IFDGSLDQQGGSDLGWILRSFDDN-ISVFVISHK-EQMNDKYDRTFNVEKIKNYSVVRET
gi|61806019|ref  IFDSSLDGFGTDEFLKIIRFVIKD-ANVFVISHK-AELQDKFESVIRFEKIKGFSRMVV-
gi|61806323|ref  VFDSSLDADSTNALLSILGTLGNN-TNIFVISHKGDILIEKFHRTLRFEKINDFSKLVDD
gi|38639947|ref  VFDGSCDEMGIVGINKMLDSM-KS--NIIVISHRKDAMDDSFNRHIRMHKQGRFTTMVEN
gi|109290030|re  VFDGPSDDDAQRSVFSIIENM-KA--NVFIISHG-EHDPQKFDRHIVMSKLGRTSVMNEV
gi|37651524|ref  VFDGPSDTDAQGAVFSIIDKM-KA--NVLIISHG-DHDPQNFDRHVKMSKLGRTSVMEEV
gi|33620623|ref  IYDGATDVQGVKALDSIIDKL-DD--NVYIISHR-DHNPDDFSRHLKMVKRGRFTEMNVN
gi|157311335|re  IYDGATDVQGVKALDSIIDKL-DD--NVYIISHR-DHNPDDFSRHLKMVKRGRFTEMNVN
gi|47779194|gb|  VADGATDAEGVKAIQQILNSI-PD-LNCFIISHR-DHNPDDYGQHLKMRKVGRFSVLETI
gi|161622553|re  VFDSATDAEGVKSIATILNSL-ED-TNVFIISHR-DHDPQAYGQHLQMKKVGRFTVME--
gi|116326277|re  VYDGAFDAEGIKNVAKILDGL-KD-TNFFIISHK-DHDPQEYGQHIQMEKVGRFSLAKIS
gi|228861369|re  VFDSATDVEGVKAISTILDSL-KN-TNVFVISHR-DHDPQAYGQHLQMKKVGRFTVMV--
gi|9632641|ref|  VFDGSFDAEGIKGVANIINSM-KN-TNVFIISHK-DHDPQEYGQHLQMKKVGRFTVMV--
gi|215895|gb|AA  VFDGSFDAEGIKGVANIINSM-KN-TNVFIISHK-DHDPQEYGQHLQMKKVGRFTVMV--
                 ####  ############                 ###############          


                 
                 =====
gi|158079343|re  K----
gi|58532930|ref  ISKLD
gi|61806019|ref  -----
gi|61806323|ref  L----
gi|38639947|ref  VR---
gi|109290030|re  IFDVL
gi|37651524|ref  IFNVL
gi|33620623|ref  I----
gi|157311335|re  I----
gi|47779194|gb|  SNA--
gi|161622553|re  -----
gi|116326277|re  -----
gi|228861369|re  -----
gi|9632641|ref|  -----
gi|215895|gb|AA  -----
                      





Parameters used
Minimum Number Of Sequences For A Conserved Position: 8
Minimum Number Of Sequences For A Flanking Position: 13
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes

Flank positions of the 3 selected block(s)
Flanks: [753  784]  [787  798]  [816  830]  

New number of positions in input.fasta-gb:  59  (6% of the original 845 positions)





Protein Domains

PROTOCOL

interpro/default parameters


RESULTS ANALYSIS


All the assigned data bases in order to check domains were explored but no hits were found. The annotation is proceeded only because the Blast results were some what satisfactory.

RAW RESULTS

Sequence_1	D49BAE51DC756F72	123	superfamily	SSF52540	P-loop containing nucleoside triphosphate hydrolases	23	117	1.3e-09	T	22-May-2009	NULL	NULL	
Sequence_1	D49BAE51DC756F72	123	Gene3D	G3DSA:3.40.50.300	no description	26	121	0.00026	T	22-May-2009	NULL	NULL	

Phylogeny

PROTOCOL


a)Phylogeny.fr / PhyML method / no bootstrap / default substitution model

b) Phylogeny.fr / BioNJ method / no bootstrap / default substitution model



RESULTS ANALYSIS


>gi|61806019|ref|YP_214379.1| T4-like endonuclease [Prochlorococcus phage P-SSM2]

>gi|61806323|ref|YP_214682.1| gp46 [Prochlorococcus phage P-SSM4]

>gi|58532930|ref|YP_195153.1| recombination protein gp46 [Synechococcus phage S-PM2]

>gi|9632641|ref|NP_049669.1| gp46 recombination endonuclease subunit [Enterobacteria phage T4]

>gi|116326277|ref|YP_802997.1| gp46 recombination endonuclease subunit [Enterobacteria phage RB32]

>gi|161622553|ref|YP_001595183.1| gp46 recombination endonuclease subunit [Enterobacteria phage JS98]

>gi|228861369|ref|YP_002854390.1| gp46 recombination endonuclease subunit [Enterobacteria phage RB14]

>gi|33620623|ref|NP_891605.1| recombination endonuclease subunit [Enterobacteria phage RB49]

>gi|157311335|ref|YP_001469378.1| endonuclease subunit [Enterobacteria phage Phi1]

>gi|38639947|ref|NP_943902.1| gp46 recombination endonuclease subunit [Aeromonas phage Aeh1]

>gi|47779194|gb|AAT38480.1| gp46 [Acinetobacter phage 133]

>gi|109290030|ref|YP_656279.1| gp46 recombination protein subunit [Aeromonas phage 25]

>gi|37651524|ref|NP_932398.1| endonuclease subunit [Aeromonas phage 44RR2.8t]

>gi|158079343|ref|YP_001504156.1| putative exonuclease [Enterococcus phage phiEF24C]

>gi|215895|gb|AAA32516.1| exonuclease (g46)


In my tree there were two ingroups, my query sequence Prochlorococcus_phage_P-SSM2_gi_61806019 belongs to one of the ingroup. Other species in that group are Synechococcus_phage_S-PM2_gi_58532930 and Prochlorococcus_phage_P-SSM4_gi_61806323.





RAW RESULTS

  ----0.2--
 
 +-------------------------------------------gi_158079343_ref_YP_001504156.1_putative_exonuclease_Enterococcu
 |
 |                                                 +-----gi_109290030_ref_YP_656279.1_gp46_recombination_protein_subunit
 |                          +----------------------+
 |                          |                      +-gi_37651524_ref_NP_932398.1_endonuclease_subunit_Aeromonas_phage
 |                          |
 |                          |
 |                  +-------+             +gi_33620623_ref_NP_891605.1_recombination_endonuclease_subunit_E
 |                  |       |  +----------+
 |                  |       |  |          +gi_157311335_ref_YP_001469378.1_endonuclease_subunit_Enterobacte
 |                  |       |  |
 |                  |       +--+      +-----gi_47779194_gb_AAT38480.1_gp46_Acinetobacter_phage_133
 |                  |          |      |
 |                  |          |      |     +-------gi_116326277_ref_YP_802997.1_gp46_recombination_endonuclease_sub
 |                  |          |      |     |
 |                  |          +------+   +-+  +gi_9632641_ref_NP_049669.1_gp46_recombination_endonuclease_subun
 |        +---------+                 |   | |  |
 |        |         |                 |   | +--+
 |        |         |                 +---+    +gi_215895_gb_AAA32516.1_exonuclease_g46
 |        |         |                     |
 |        |         |                     | +-gi_161622553_ref_YP_001595183.1_gp46_recombination_endonuclease
 |        |         |                     +-+
 +--------+         |                       +----gi_228861369_ref_YP_002854390.1_gp46_recombination_endonuclease
          |         |
          |         +-----------------gi_38639947_ref_NP_943902.1_gp46_recombination_endonuclease_subu
          |
          |
          |      +--------------------gi_58532930_ref_YP_195153.1_recombination_protein_gp46_Synechoco
          +------+
                 |    +-----------gi_61806019_ref_YP_214379.1_T4-like_endonuclease_Prochlorococcus
                 +----+
                      +-----------gi_61806323_ref_YP_214682.1_gp46_Prochlorococcus_phage_P-SSM4

***********************************************************************************************************************

                                                                                                     ------0.2-----
 
                +---------------------------------Synechococcus_phage_S-PM2_gi_58532930
                |
      +---------+       +-------------------Prochlorococcus_phage_P-SSM2_gi_61806019
      |         +-------+
      |                 +------------------Prochlorococcus_phage_P-SSM4_gi_61806323
      |
      |
      |               +--------------------------Aeromonas_phage_Aeh1_gi_38639947
 +----+               |
 |    |               |                                  +Enterobacteria_phage_RB49_gi_33620623
 |    |               |                 +----------------+
 |    |               |                 |                +Enterobacteria_phage_Phi1_gi_157311335
 |    |               |                 |
 |    |               |           +-----+         +---------Acinetobacter_phage_133_gi_47779194
 |    +---------------+           |     |         |
 |                    |           |     |         |         +-----------Enterobacteria_phage_RB32_gi_116326277
 |                    |           |     |         |         |
 |                    |           |     +---------+     +---+
 |                    |           |               |     |   |    +Enterobacteria_phage_T4_gi_9632641
 |                    |           |               |     |   +----+
 |                    |           |               +-----+        +Enterobacteria_phage_T4_gi_215895
 |                    +-----------+                     |
 |                                |                     |   +-Enterobacteria_phage_JS98_gi_161622553
 |                                |                     +---+
 |                                |                         +------Enterobacteria_phage_RB14_gi_228861369
 |                                |
 |                                |
 |                                |                                     +-------Aeromonas_phage_25_gi_109290030
 |                                +-------------------------------------+
 |                                                                      +-Aeromonas_phage_44RR2.8t_gi_37651524
 |
 +------------------------------------------------------------------------------Enterococcus_phage_phiEF24C_gi_158079343

Taxonomy report

PROTOCOL


BLAST p against NR Default parameters other then "100 max hits" taxanomy report


RESULTS ANALYSIS


According to taxonmy report the best hit was ref|YP_214379.1| T4-like endonuclease [Prochlorococcus phage] so i would use this as a query sequence for multiple sequence alignment.

RAW RESULTS

root
. Myoviridae                   [viruses]
. . T4-like viruses              [viruses]
. . . unclassified T4-like viruses [viruses]
. . . . BLAST p against NR Default parameters other then "100 max hits" taxanomy report --------------------------  204 2 hits [viruses]                T4-like endonuclease [Prochlorococcus phage P-SSM2] >gi|613
. . . . Prochlorococcus phage P-SSM4 ..........................  153 2 hits [viruses]                gp46 [Prochlorococcus phage P-SSM4] >gi|61563867|gb|AAX4692
. . . . Synechococcus phage S-PM2 .............................  135 2 hits [viruses]                recombination protein gp46 [Synechococcus phage S-PM2] >gi|
. . . . Enterobacteria phage RB32 .............................  114 2 hits [viruses]                gp46 recombination endonuclease subunit [Enterobacteria pha
. . . . Enterobacteria phage RB51 .............................  114 2 hits [viruses]                gp46 recombination endonuclease subunit [Enterobacteria pha
. . . . Enterobacteria phage JS98 .............................  112 2 hits [viruses]                gp46 recombination endonuclease subunit [Enterobacteria pha
. . . . Enterobacteria phage RB14 .............................  112 2 hits [viruses]                gp46 recombination endonuclease subunit [Enterobacteria pha
. . . . Enterobacteria phage RB49 .............................  106 2 hits [viruses]                recombination endonuclease subunit [Enterobacteria phage RB
. . . . Enterobacteria phage Phi1 .............................  106 2 hits [viruses]                endonuclease subunit [Enterobacteria phage Phi1] >gi|149380
. . . . Enterobacteria phage RB69 .............................  104 4 hits [viruses]                endonuclease subunit [Enterobacteria phage RB69] >gi|116241
. . . . Enterobacteria phage RB43 .............................   95 2 hits [viruses]                gp46 recombination endonuclease subunit [Enterobacteria pha
. . . . Aeromonas phage 25 ....................................   90 3 hits [viruses]                gp46 recombination protein subunit [Aeromonas phage 25] >gi
. . . . Aeromonas phage 44RR2.8t ..............................   86 2 hits [viruses]                endonuclease subunit [Aeromonas phage 44RR2.8t] >gi|6639184
. . . . Aeromonas phage 31 ....................................   86 2 hits [viruses]                endonuclease subunit [Aeromonas phage 44RR2.8t] >gi|6639184
. . . Enterobacteria phage T4 ---------------------------------  117 6 hits [viruses]                gp46 recombination endonuclease subunit [Enterobacteria pha
. . . Vibrio phage KVP40 ......................................  112 2 hits [viruses]                recombination endonuclease subunit [Vibrio phage KVP40] >gi
. . . Aeromonas phage Aeh1 ....................................  104 2 hits [viruses]                gp46 recombination endonuclease subunit [Aeromonas phage Ae
. . . Acinetobacter phage 133 .................................   98 1 hit  [viruses]                gp46 [Acinetobacter phage 133]
. . . Aeromonas phage 65 ......................................   88 1 hit  [viruses]                gp46 recombination endonuclease subunit [Aeromonas phage 65]
. . Synechococcus phage syn9 ----------------------------------  165 2 hits [viruses]                recombination endonuclease [Synechococcus phage syn9] >gi|7
. . Enterococcus phage phiEF24C ...............................   70 2 hits [viruses]                putative exonuclease [Enterococcus phage phiEF24C] >gi|1578
. . Lactobacillus phage Lb338-1 ...............................   68 2 hits [viruses]                putative exonuclease [Lactobacillus phage Lb338-1] >gi|2259
. . Staphylococcus phage K ....................................   64 2 hits [viruses]                putative exonuclease [Staphylococcus phage K] >gi|66394958|
. . Staphylococcus phage G1 ...................................   64 2 hits [viruses]                putative exonuclease [Staphylococcus phage K] >gi|66394958|
. . Staphylococcus phage 812 ..................................   64 1 hit  [viruses]                putative exonuclease [Staphylococcus phage K] >gi|66394958|
. . Staphylococcus phage Twort ................................   62 2 hits [viruses]                ORF009 [Staphylococcus phage Twort] >gi|62637194|gb|AAX9230
. . Listeria phage P100 .......................................   60 1 hit  [viruses]                gp47 [Listeria bacteriophage P100]
. . Listeria phage A511 .......................................   60 2 hits [viruses]                gp115 [Listeria phage A511] >gi|66733078|gb|AAY52896.1| gp1
. . Lactobacillus phage LP65 ..................................   57 2 hits [viruses]                hypothetical protein LP65_gp070 [Lactobacillus phage LP65] 
. . Bacillus phage SPO1 .......................................   45 2 hits [viruses]                gp21.9 [Bacillus phage SPO1] >gi|209871264|gb|ACI91020.1| g
. Ureaplasma urealyticum serovar 2 str. ATCC 27814 ------------   47 2 hits [mycoplasmas]            chromosome segregation SMC protein homolg [Ureaplasma ureal
. Ureaplasma urealyticum serovar 8 str. ATCC 27618 ............   47 2 hits [mycoplasmas]            chromosome partition protein smc [Ureaplasma urealyticum se
. Xanthobacter autotrophicus Py2 ..............................   47 2 hits [a-proteobacteria]       ABC transporter related [Xanthobacter autotrophicus Py2] >g
. Ureaplasma urealyticum serovar 9 str. ATCC 33175 ............   46 2 hits [mycoplasmas]            p115 protein [Ureaplasma urealyticum serovar 9 str. ATCC 33
. Ureaplasma urealyticum serovar 13 str. ATCC 33698 ...........   46 2 hits [mycoplasmas]            p115 protein [Ureaplasma urealyticum serovar 13 str. ATCC 3
. Ureaplasma urealyticum serovar 12 str. ATCC 33696 ...........   46 2 hits [mycoplasmas]            p115 protein [Ureaplasma urealyticum serovar 12 str. ATCC 3
. Ureaplasma urealyticum serovar 4 str. ATCC 27816 ............   46 2 hits [mycoplasmas]            p115 protein [Ureaplasma urealyticum serovar 12 str. ATCC 3
. Ureaplasma urealyticum serovar 10 str. ATCC 33699 ...........   46 2 hits [mycoplasmas]            p115 protein [Ureaplasma urealyticum serovar 12 str. ATCC 3
. Ureaplasma urealyticum serovar 5 str. ATCC 27817 ............   46 2 hits [mycoplasmas]            p115 protein [Ureaplasma urealyticum serovar 5 str. ATCC 27
. Ureaplasma urealyticum serovar 7 str. ATCC 27819 ............   46 2 hits [mycoplasmas]            p115 protein [Ureaplasma urealyticum serovar 5 str. ATCC 27
. Ureaplasma urealyticum serovar 11 str. ATCC 33695 ...........   46 2 hits [mycoplasmas]            p115 protein [Ureaplasma urealyticum serovar 5 str. ATCC 27
. Ureaplasma parvum serovar 3 str. ATCC 700970 ................   46 2 hits [mycoplasmas]            p115 protein [Ureaplasma parvum serovar 3 str. ATCC 700970]
. Ureaplasma parvum serovar 3 str. ATCC 27815 .................   46 2 hits [mycoplasmas]            p115 protein [Ureaplasma parvum serovar 3 str. ATCC 700970]
. Ureaplasma parvum serovar 1 str. ATCC 27813 .................   46 2 hits [mycoplasmas]            p115 protein [Ureaplasma parvum serovar 3 str. ATCC 700970]
. Ureaplasma parvum serovar 14 str. ATCC 33697 ................   46 2 hits [mycoplasmas]            p115 protein [Ureaplasma parvum serovar 3 str. ATCC 700970]
. Ureaplasma parvum serovar 6 str. ATCC 27818 .................   46 2 hits [mycoplasmas]            p115 protein [Ureaplasma parvum serovar 3 str. ATCC 700970]
. Ureaplasma urealyticum ......................................   46 1 hit  [mycoplasmas]            p115 protein [Ureaplasma parvum serovar 3 str. ATCC 700970]
. Synechococcus sp. JA-2-3B'a(2-13) ...........................   45 2 hits [cyanobacteria]          exonuclease SbcC [Synechococcus sp. JA-2-3B'a(2-13)] >gi|86
. Chloroflexus aggregans DSM 9485 .............................   44 2 hits [GNS bacteria]           SMC domain protein [Chloroflexus aggregans DSM 9485] >gi|21
. Chloroflexus aurantiacus J-10-fl ............................   44 2 hits [GNS bacteria]           SMC domain-containing protein [Chloroflexus aurantiacus J-1
. Chloroflexus sp. Y-400-fl ...................................   44 2 hits [GNS bacteria]           SMC domain-containing protein [Chloroflexus aurantiacus J-1
. Methanobrevibacter smithii ATCC 35061 .......................   43 2 hits [euryarchaeotes]         purine NTPase involved in DNA repair, Rad50 [Methanobreviba
. Bacillus halodurans C-125 ...................................   43 2 hits [firmicutes]             ABC transporter ATP-binding protein [Bacillus halodurans C-
. Anabaena variabilis ATCC 29413 ..............................   43 2 hits [cyanobacteria]          exonuclease SbcC [Anabaena variabilis ATCC 29413] >gi|75701
. Mycoplasma genitalium G37 ...................................   43 2 hits [mycoplasmas]            chromosome segregation protein SMC [Mycoplasma genitalium G
. Mycoplasma genitalium .......................................   43 1 hit  [mycoplasmas]            chromosome segregation protein SMC [Mycoplasma genitalium G
. synthetic Mycoplasma genitalium JCVI-1.0 ....................   43 1 hit  [other sequences]        chromosome segregation protein SMC [Mycoplasma genitalium G
. Nostoc sp. PCC 7120 .........................................   43 2 hits [cyanobacteria]          hypothetical protein alr3988 [Nostoc sp. PCC 7120] >gi|1713
. Thermotoga maritima .........................................   43 6 hits [thermotogales]          Chain A, Smc Head Domain From Thermotoga Maritima >gi|13096
. Chloroherpeton thalassium ATCC 35110 ........................   43 2 hits [green sulfur bacteria]  SMC domain protein [Chloroherpeton thalassium ATCC 35110] >
. Chryseobacterium gleum ATCC 35910 ...........................   43 2 hits [CFB group bacteria]     possible Vitamin B12-transporting ATPase [Chryseobacterium 
. Pseudomonas entomophila L48 .................................   42 3 hits [g-proteobacteria]       hemin importer ATP-binding subunit [Pseudomonas entomophila
. Cyanothece sp. CCY 0110 .....................................   42 2 hits [cyanobacteria]          ABC transporter related protein [Cyanothece sp. CCY0110] >g
. Marinitoga piezophila KA3 ...................................   41 2 hits [thermotogales]          chromosome segregation protein SMC [Marinitoga piezophila K
. Thermotoga petrophila RKU-1 .................................   41 2 hits [thermotogales]          chromosome segregation protein SMC [Thermotoga petrophila R
. Thermotoga maritima MSB8 ....................................   41 2 hits [thermotogales]          chromosome segregation SMC protein, putative [Thermotoga ma
. Thermotoga sp. RQ2 ..........................................   41 2 hits [thermotogales]          chromosome segregation protein SMC [Thermotoga sp. RQ2] >gi
. Prochlorococcus marinus str. MIT 9301 .......................   41 2 hits [cyanobacteria]          hypothetical protein P9301_14231 [Prochlorococcus marinus s
. Herpetosiphon aurantiacus ATCC 23779 ........................   41 2 hits [GNS bacteria]           SMC domain-containing protein [Herpetosiphon aurantiacus AT
. Methanobrevibacter smithii DSM 2375 .........................   41 2 hits [euryarchaeotes]         hypothetical protein METSMIALI_00254 [Methanobrevibacter sm
. Methanobrevibacter smithii DSM 2374 .........................   41 2 hits [euryarchaeotes]         hypothetical protein METSMIF1_01492 [Methanobrevibacter smi
. Lactobacillus crispatus JV-V01 ..............................   41 2 hits [firmicutes]             ABC superfamily ATP binding cassette transporter, ABC prote
. Nitrobacter hamburgensis X14 ................................   41 4 hits [a-proteobacteria]       ABC transporter related [Nitrobacter hamburgensis X14] >gi|
. Nostoc punctiforme PCC 73102 ................................   40 2 hits [cyanobacteria]          exonuclease SbcC [Nostoc punctiforme PCC 73102] >gi|1864644
. Escherichia coli LF82 .......................................   40 1 hit  [enterobacteria]         putative exonuclease [Escherichia coli]
. Helicobacter cinaedi CCUG 18818 .............................   40 1 hit  [e-proteobacteria]       DNA repair protein RecN [Helicobacter cinaedi CCUG 18818]
. Lactobacillus brevis ATCC 367 ...............................   40 3 hits [firmicutes]             cobalt transporter ATP-binding subunit [Lactobacillus brevi
. Listeria monocytogenes Finland 1988 .........................   40 1 hit  [firmicutes]             hypothetical protein LmonF1_13116 [Listeria monocytogenes F
. Eubacterium biforme DSM 3989 ................................   40 2 hits [firmicutes]             hypothetical protein EUBIFOR_01872 [Eubacterium biforme DSM
. Yersinia pestis Angola ......................................   40 2 hits [enterobacteria]         RecF/RecN/SMC domain-containing protein [Yersinia pestis An
. Yersinia pestis KIM .........................................   40 4 hits [enterobacteria]         putative exonuclease [Yersinia pestis KIM] >gi|40787957|ref
. Yersinia pestis biovar Microtus str. 91001 ..................   40 2 hits [enterobacteria]         putative exonuclease [Yersinia pestis KIM] >gi|40787957|ref
. Yersinia pestis .............................................   40 2 hits [enterobacteria]         putative exonuclease [Yersinia pestis KIM] >gi|40787957|ref
. Nitratiruptor sp. SB155-2 ...................................   40 2 hits [e-proteobacteria]       DNA repair protein RecN [Nitratiruptor sp. SB155-2] >gi|151
. Burkholderia oklahomensis C6786 .............................   40 1 hit  [b-proteobacteria]       ABC transporter, ATP-binding protein [Burkholderia oklahome
. Yersinia pestis CO92 ........................................   40 2 hits [enterobacteria]         putative exonuclease subunit 2 [Yersinia pestis CO92] >gi|1
. Yersinia pestis Antiqua .....................................   40 2 hits [enterobacteria]         putative exonuclease subunit 2 [Yersinia pestis CO92] >gi|1
. Yersinia pestis Nepal516 ....................................   40 4 hits [enterobacteria]         putative exonuclease subunit 2 [Yersinia pestis CO92] >gi|1
. Yersinia pestis Pestoides F .................................   40 2 hits [enterobacteria]         putative exonuclease subunit 2 [Yersinia pestis CO92] >gi|1
. Yersinia pestis CA88-4125 ...................................   40 2 hits [enterobacteria]         putative exonuclease subunit 2 [Yersinia pestis CO92] >gi|1
. Yersinia pestis FV-1 ........................................   40 1 hit  [enterobacteria]         putative exonuclease subunit 2 [Yersinia pestis CO92] >gi|1
. Yersinia pestis Pestoides A .................................   40 2 hits [enterobacteria]         putative exonuclease subunit 2 [Yersinia pestis CO92] >gi|1
. Yersinia pestis biovar Orientalis str. PEXU2 ................   40 2 hits [enterobacteria]         putative exonuclease subunit 2 [Yersinia pestis CO92] >gi|1
. Yersinia pestis biovar Orientalis str. India 195 ............   40 2 hits [enterobacteria]         putative exonuclease subunit 2 [Yersinia pestis CO92] >gi|1
. Listeria monocytogenes str. 1/2a F6854 ......................   40 2 hits [firmicutes]             ABC transporter, ATP-binding/permease protein [Listeria mon
. Lactobacillus acidophilus NCFM ..............................   40 2 hits [firmicutes]             cobalt transporter ATP-binding subunit [Lactobacillus acido
. Lactobacillus acidophilus ATCC 4796 .........................   40 2 hits [firmicutes]             cobalt transporter ATP-binding subunit [Lactobacillus acido
. Lactobacillus acidophilus ...................................   40 1 hit  [firmicutes]             cobalt transporter ATP-binding subunit [Lactobacillus acido
. Salmonella enterica subsp. enterica serovar Typhi str. CT18 .   40 2 hits [enterobacteria]         hypothetical protein HCM2.0125c [Salmonella enterica subsp.
. Listeria monocytogenes EGD-e ................................   40 2 hits [firmicutes]             hypothetical protein lmo1132 [Listeria monocytogenes EGD-e]
. Listeria monocytogenes FSL R2-561 ...........................   40 1 hit  [firmicutes]             hypothetical protein lmo1132 [Listeria monocytogenes EGD-e]
. Helicobacter pullorum MIT 98-5489 ...........................   40 1 hit  [e-proteobacteria]       multidrug resistance protein MsbA [Helicobacter pullorum MI
. Listeria innocua Clip11262 ..................................   40 1 hit  [firmicutes]             hypothetical protein lin1098 [Listeria innocua Clip11262] >
. Listeria innocua ............................................   40 1 hit  [firmicutes]             hypothetical protein lin1098 [Listeria innocua Clip11262] >
. Yersinia pestis biovar Orientalis str. F1991016 .............   40 2 hits [enterobacteria]         RecF/RecN/SMC domain protein [Yersinia pestis biovar Orient
. Yersinia pestis biovar Orientalis str. IP275 ................   40 2 hits [enterobacteria]         RecF/RecN/SMC domain protein [Yersinia pestis biovar Orient
. Yersinia pestis biovar Antiqua str. E1979001 ................   40 2 hits [enterobacteria]         RecF/RecN/SMC domain protein [Yersinia pestis biovar Orient
. Yersinia pestis biovar Antiqua str. B42003004 ...............   40 2 hits [enterobacteria]         RecF/RecN/SMC domain protein [Yersinia pestis biovar Orient
. Yersinia pestis biovar Antiqua str. UG05-0454 ...............   40 2 hits [enterobacteria]         RecF/RecN/SMC domain protein [Yersinia pestis biovar Orient
. Yersinia pestis biovar Orientalis str. MG05-1020 ............   40 2 hits [enterobacteria]         RecF/RecN/SMC domain protein [Yersinia pestis biovar Orient
. Listeria monocytogenes str. 4b F2365 ........................   40 2 hits [firmicutes]             ABC transporter, ATP-binding/permease protein [Listeria mon
. Listeria monocytogenes str. 4b H7858 ........................   39 2 hits [firmicutes]             ABC transporter, ATP-binding/permease protein [Listeria mon
. Bradyrhizobium sp. ORS278 ...................................   39 2 hits [a-proteobacteria]       putative ABC transporter (fused ATP-binding and permease co
. Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365 ....   39 3 hits [firmicutes]             cobalt transporter ATP-binding subunit [Lactobacillus delbr
. Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842 ......   39 3 hits [firmicutes]             cobalt transporter ATP-binding subunit [Lactobacillus delbr
. Vibrio sp. Ex25 .............................................   39 2 hits [g-proteobacteria]       ABC transporter, ATP-binding protein, putative [Vibrio sp. 
. Paracoccus denitrificans PD1222 .............................   39 2 hits [a-proteobacteria]       ABC transporter related [Paracoccus denitrificans PD1222] >
. Abiotrophia defectiva ATCC 49176 ............................   39 2 hits [firmicutes]             hypothetical protein GCWU000182_02751 [Abiotrophia defectiv
. Rhodopseudomonas palustris TIE-1 ............................   39 2 hits [a-proteobacteria]       ABC transporter domain protein [Rhodopseudomonas palustris 
. Anaerocellum thermophilum DSM 6725 ..........................   39 2 hits [firmicutes]             chromosome segregation protein SMC [Anaerocellum thermophil
. Shewanella piezotolerans WP3 ................................   38 2 hits [g-proteobacteria]       ABC-type uncharacterized transport system, permease and ATP
. Staphylococcus hominis SK119 ................................   38 2 hits [firmicutes]             cobalt import ATP-binding protein CbiO 1 [Staphylococcus ho
. Listeria monocytogenes Clip81459 ............................   38 2 hits [firmicutes]             ABC transporter, ATP-binding protein [Listeria monocytogene
. Bradyrhizobium sp. BTAi1 ....................................   38 2 hits [a-proteobacteria]       putative ABC transporter (fused ATP-binding and permease co
. Listeria monocytogenes HCC23 ................................   38 2 hits [firmicutes]             ABC transporter, ATP-binding/permease protein [Listeria mon
. Alteromonas macleodii 'Deep ecotype' ........................   38 2 hits [g-proteobacteria]       ABC transporter, ATP-binding protein [Alteromonas macleodii
. Mycoplasma gallisepticum R ..................................   38 2 hits [mycoplasmas]            Smc-like [Mycoplasma gallisepticum R] >gi|31541218|gb|AAP56
. Bradyrhizobium japonicum USDA 110 ...........................   38 2 hits [a-proteobacteria]       ATP-binding protein [Bradyrhizobium japonicum USDA 110] >gi
. Mycoplasma pneumoniae M129 ..................................   38 2 hits [mycoplasmas]            SMC family chromosome/DNA binding/protecting protein [Mycop
. Mycoplasma pneumoniae .......................................   38 1 hit  [mycoplasmas]            SMC family chromosome/DNA binding/protecting protein [Mycop
. Arcobacter butzleri RM4018 ..................................   38 2 hits [e-proteobacteria]       DNA repair protein RecN [Arcobacter butzleri RM4018] >gi|15

--------------------------------------------------------------------------------

root
. dsDNA viruses, no RNA stage  [viruses]
. . Caudovirales                 [viruses]
. . . Myoviridae                   [viruses]
. . . . T4-like viruses              [viruses]
. . . . . unclassified T4-like viruses [viruses]
. . . . . . Prochlorococcus phage P-SSM2 ----------------------  330 2 hits [viruses]                T4-like endonuclease [Prochlorococcus phage P-SSM2] >gi|613
. . . . . . Prochlorococcus phage P-SSM4 ......................  199 2 hits [viruses]                gp46 [Prochlorococcus phage P-SSM4] >gi|61563867|gb|AAX4692
. . . . . . Synechococcus phage S-PM2 .........................  191 2 hits [viruses]                recombination protein gp46 [Synechococcus phage S-PM2] >gi|
. . . . . . Enterobacteria phage RB32 .........................  157 2 hits [viruses]                gp46 recombination endonuclease subunit [Enterobacteria pha
. . . . . . Enterobacteria phage RB51 .........................  155 2 hits [viruses]                gp46 recombination endonuclease subunit [Enterobacteria pha
. . . . . . Enterobacteria phage RB14 .........................  151 2 hits [viruses]                gp46 recombination endonuclease subunit [Enterobacteria pha
. . . . . . Enterobacteria phage JS98 .........................  150 2 hits [viruses]                gp46 recombination endonuclease subunit [Enterobacteria pha
. . . . . . Enterobacteria phage RB49 .........................  143 2 hits [viruses]                recombination endonuclease subunit [Enterobacteria phage RB
. . . . . . Enterobacteria phage RB69 .........................  143 4 hits [viruses]                endonuclease subunit [Enterobacteria phage RB69] >gi|116241
. . . . . . Enterobacteria phage Phi1 .........................  142 2 hits [viruses]                endonuclease subunit [Enterobacteria phage Phi1] >gi|149380
. . . . . . Enterobacteria phage RB43 .........................  130 2 hits [viruses]                gp46 recombination endonuclease subunit [Enterobacteria pha
. . . . . . Aeromonas phage 25 ................................  126 3 hits [viruses]                gp46 recombination protein subunit [Aeromonas phage 25] >gi
. . . . . . Aeromonas phage 44RR2.8t ..........................  117 2 hits [viruses]                endonuclease subunit [Aeromonas phage 44RR2.8t] >gi|6639184
. . . . . . Aeromonas phage 31 ................................  117 2 hits [viruses]                endonuclease subunit [Aeromonas phage 44RR2.8t] >gi|6639184
. . . . . Enterobacteria phage T4 -----------------------------  156 6 hits [viruses]                gp46 recombination endonuclease subunit [Enterobacteria pha
. . . . . Vibrio phage KVP40 ..................................  155 2 hits [viruses]                recombination endonuclease subunit [Vibrio phage KVP40] >gi
. . . . . Aeromonas phage Aeh1 ................................  139 2 hits [viruses]                gp46 recombination endonuclease subunit [Aeromonas phage Ae
. . . . . Aeromonas phage 65 ..................................  126 1 hit  [viruses]                gp46 recombination endonuclease subunit [Aeromonas phage 65]
. . . . . Acinetobacter phage 133 .............................   98 1 hit  [viruses]                gp46 [Acinetobacter phage 133]
. . . . Synechococcus phage syn9 ------------------------------  214 2 hits [viruses]                recombination endonuclease [Synechococcus phage syn9] >gi|7
. . . . Enterococcus phage phiEF24C ...........................   88 2 hits [viruses]                putative exonuclease [Enterococcus phage phiEF24C] >gi|1578
. . . . Staphylococcus phage K ................................   85 2 hits [viruses]                putative exonuclease [Staphylococcus phage K] >gi|66394958|
. . . . Staphylococcus phage G1 ...............................   85 2 hits [viruses]                putative exonuclease [Staphylococcus phage K] >gi|66394958|
. . . . Staphylococcus phage 812 ..............................   85 1 hit  [viruses]                putative exonuclease [Staphylococcus phage K] >gi|66394958|
. . . . Staphylococcus phage Twort ............................   82 2 hits [viruses]                ORF009 [Staphylococcus phage Twort] >gi|62637194|gb|AAX9230
. . . . Listeria phage A511 ...................................   82 2 hits [viruses]                gp115 [Listeria phage A511] >gi|66733078|gb|AAY52896.1| gp1
. . . . Listeria phage P100 ...................................   82 1 hit  [viruses]                gp47 [Listeria bacteriophage P100]
. . . . Lactobacillus phage Lb338-1 ...........................   79 2 hits [viruses]                putative exonuclease [Lactobacillus phage Lb338-1] >gi|2259
. . . . Lactobacillus phage LP65 ..............................   78 2 hits [viruses]                hypothetical protein LP65_gp070 [Lactobacillus phage LP65] 
. . . . Bacillus phage SPO1 ...................................   68 2 hits [viruses]                gp21.9 [Bacillus phage SPO1] >gi|209871264|gb|ACI91020.1| g
. . . Enterobacteria phage T5 ---------------------------------   45 5 hits [viruses]                probable exonuclease subunit 2 [Bacteriophage T5]
. . . Enterobacteria phage EPS7 ...............................   45 2 hits [viruses]                probable exonuclease subunit 2 [Enterobacteria phage EPS7] 
. . Acanthamoeba polyphaga mimivirus --------------------------   55 3 hits [viruses]                putative DNA repair protein [Acanthamoeba polyphaga mimivir
. Caldicellulosiruptor saccharolyticus DSM 8903 ---------------   67 2 hits [firmicutes]             SMC domain-containing protein [Caldicellulosiruptor sacchar
. Chloroherpeton thalassium ATCC 35110 ........................   63 2 hits [green sulfur bacteria]  SMC domain protein [Chloroherpeton thalassium ATCC 35110] >
. Anabaena variabilis ATCC 29413 ..............................   61 2 hits [cyanobacteria]          exonuclease SbcC [Anabaena variabilis ATCC 29413] >gi|75701
. Nostoc sp. PCC 7120 .........................................   60 2 hits [cyanobacteria]          hypothetical protein alr3988 [Nostoc sp. PCC 7120] >gi|1713
. Campylobacter jejuni subsp. jejuni 81116 ....................   59 2 hits [e-proteobacteria]       DNA repair protein RecN [Campylobacter jejuni subsp. jejuni
. Dehalococcoides sp. CBDB1 ...................................   59 2 hits [GNS bacteria]           putative exonuclease SbcC [Dehalococcoides sp. CBDB1] >gi|7
. Chloroflexus aggregans DSM 9485 .............................   58 2 hits [GNS bacteria]           SMC domain protein [Chloroflexus aggregans DSM 9485] >gi|21
. Dehalococcoides ethenogenes 195 .............................   58 2 hits [GNS bacteria]           exonuclease SbcC, putative [Dehalococcoides ethenogenes 195
. Campylobacter jejuni subsp. jejuni 260.94 ...................   57 2 hits [e-proteobacteria]       DNA repair protein RecN [Campylobacter jejuni subsp. jejuni
. Campylobacter jejuni subsp. jejuni HB93-13 ..................   57 2 hits [e-proteobacteria]       DNA repair protein recN [Campylobacter jejuni subsp. jejuni
. Campylobacter jejuni subsp. jejuni 81-176 ...................   57 3 hits [e-proteobacteria]       DNA repair protein recN [Campylobacter jejuni subsp. jejuni
. Campylobacter jejuni subsp. jejuni CG8421 ...................   56 2 hits [e-proteobacteria]       putative DNA repair protein [Campylobacter jejuni subsp. je
. Campylobacter jejuni RM1221 .................................   56 2 hits [e-proteobacteria]       DNA repair protein RecN [Campylobacter jejuni RM1221] >gi|5
. Campylobacter jejuni subsp. jejuni NCTC 11168 ...............   56 2 hits [e-proteobacteria]       putative DNA repair protein [Campylobacter jejuni subsp. je
. Campylobacter jejuni ........................................   56 1 hit  [e-proteobacteria]       putative DNA repair protein [Campylobacter jejuni subsp. je
. Dehalococcoides sp. BAV1 ....................................   56 2 hits [GNS bacteria]           SMC domain-containing protein [Dehalococcoides sp. BAV1] >g
. Campylobacter jejuni subsp. jejuni 84-25 ....................   56 2 hits [e-proteobacteria]       DNA repair protein RecN [Campylobacter jejuni subsp. jejuni
. Campylobacter jejuni subsp. jejuni CF93-6 ...................   56 2 hits [e-proteobacteria]       DNA repair protein RecN [Campylobacter jejuni subsp. jejuni
. Dehalococcoides sp. VS ......................................   55 2 hits [GNS bacteria]           SMC domain protein [Dehalococcoides sp. VS] >gi|157404176|g
. Campylobacter jejuni subsp. doylei 269.97 ...................   54 2 hits [e-proteobacteria]       DNA repair protein RecN [Campylobacter jejuni subsp. doylei
. Methanococcus aeolicus Nankai-3 .............................   53 2 hits [euryarchaeotes]         SMC domain-containing protein [Methanococcus aeolicus Nanka
. Chloroflexus aurantiacus J-10-fl ............................   53 2 hits [GNS bacteria]           SMC domain-containing protein [Chloroflexus aurantiacus J-1
. Chloroflexus sp. Y-400-fl ...................................   53 2 hits [GNS bacteria]           SMC domain-containing protein [Chloroflexus aurantiacus J-1
. Thermococcus barophilus MP ..................................   52 2 hits [euryarchaeotes]         hypothetical protein TERMP_1189 [Thermococcus barophilus MP
. Roseiflexus sp. RS-1 ........................................   51 2 hits [GNS bacteria]           SMC domain-containing protein [Roseiflexus sp. RS-1] >gi|14
. Marinitoga piezophila KA3 ...................................   50 2 hits [thermotogales]          chromosome segregation protein SMC [Marinitoga piezophila K
. Thermotoga petrophila RKU-1 .................................   50 2 hits [thermotogales]          chromosome segregation protein SMC [Thermotoga petrophila R
. Thermotoga sp. RQ2 ..........................................   50 2 hits [thermotogales]          chromosome segregation protein SMC [Thermotoga sp. RQ2] >gi
. Herpetosiphon aurantiacus ATCC 23779 ........................   50 2 hits [GNS bacteria]           SMC domain-containing protein [Herpetosiphon aurantiacus AT
. Thermotoga maritima MSB8 ....................................   50 2 hits [thermotogales]          chromosome segregation SMC protein, putative [Thermotoga ma
. Escherichia coli LF82 .......................................   50 1 hit  [enterobacteria]         putative exonuclease [Escherichia coli]
. Synechococcus sp. JA-2-3B'a(2-13) ...........................   49 2 hits [cyanobacteria]          RecF/RecN/SMC domain-containing protein [Synechococcus sp. 
. Helicobacter winghamensis ATCC BAA-430 ......................   48 2 hits [e-proteobacteria]       DNA repair protein-ATPase [Helicobacter winghamensis ATCC B
. Roseiflexus castenholzii DSM 13941 ..........................   48 2 hits [GNS bacteria]           SMC domain-containing protein [Roseiflexus castenholzii DSM
. Rhodothermus marinus DSM 4252 ...............................   48 2 hits [CFB group bacteria]     ATPase involved in DNA repair [Rhodothermus marinus DSM 425
. Methanocaldococcus jannaschii DSM 2661 ......................   47 4 hits [euryarchaeotes]         purine NTPase [Methanocaldococcus jannaschii DSM 2661] >gi|
. Methanocaldococcus jannaschii ...............................   47 2 hits [euryarchaeotes]         purine NTPase [Methanocaldococcus jannaschii DSM 2661] >gi|
. Anaerocellum thermophilum DSM 6725 ..........................   46 2 hits [firmicutes]             chromosome segregation protein SMC [Anaerocellum thermophil
. Mycoplasma mobile 163K ......................................   45 2 hits [mycoplasmas]            segregation of chromosomes protein [Mycoplasma mobile 163K]
. Thermotoga maritima .........................................   45 6 hits [thermotogales]          Chain A, Smc Head Domain From Thermotoga Maritima >gi|13096
. Synechococcus sp. JA-3-3Ab ..................................   45 2 hits [cyanobacteria]          RecF/RecN/SMC domain-containing protein [Synechococcus sp. 
. Salmonella enterica subsp. enterica serovar Typhi str. CT18 .   45 2 hits [enterobacteria]         hypothetical protein HCM2.0125c [Salmonella enterica subsp.
. Halorhabdus utahensis DSM 12940 .............................   45 2 hits [euryarchaeotes]         hypothetical protein HutaDRAFT_10630 [Halorhabdus utahensis
. Drosophila simulans .........................................   45 2 hits [flies]                  GD21899 [Drosophila simulans] >gi|194191678|gb|EDX05254.1| 
. Fusobacterium nucleatum subsp. vincentii ATCC 49256 .........   45 2 hits [fusobacteria]           Chromosome partition protein smc [Fusobacterium nucleatum s
. Spirosoma linguale DSM 74 ...................................   44 2 hits [CFB group bacteria]     ATPase involved in DNA repair [Spirosoma linguale DSM 74] >
. Thermotoga neapolitana DSM 4359 .............................   44 2 hits [thermotogales]          Condensin subunit Smc [Thermotoga neapolitana DSM 4359] >gi
. Yersinia pestis Angola ......................................   44 2 hits [enterobacteria]         RecF/RecN/SMC domain-containing protein [Yersinia pestis An
. Yersinia pestis biovar Orientalis str. F1991016 .............   44 2 hits [enterobacteria]         RecF/RecN/SMC domain protein [Yersinia pestis biovar Orient
. Yersinia pestis biovar Orientalis str. IP275 ................   44 2 hits [enterobacteria]         RecF/RecN/SMC domain protein [Yersinia pestis biovar Orient
. Yersinia pestis biovar Antiqua str. E1979001 ................   44 2 hits [enterobacteria]         RecF/RecN/SMC domain protein [Yersinia pestis biovar Orient
. Yersinia pestis biovar Antiqua str. B42003004 ...............   44 2 hits [enterobacteria]         RecF/RecN/SMC domain protein [Yersinia pestis biovar Orient
. Yersinia pestis biovar Antiqua str. UG05-0454 ...............   44 2 hits [enterobacteria]         RecF/RecN/SMC domain protein [Yersinia pestis biovar Orient
. Yersinia pestis biovar Orientalis str. MG05-1020 ............   44 2 hits [enterobacteria]         RecF/RecN/SMC domain protein [Yersinia pestis biovar Orient
. Yersinia pestis KIM .........................................   44 4 hits [enterobacteria]         RecF/RecN/SMC domain protein [Yersinia pestis biovar Orient
. Yersinia pestis biovar Microtus str. 91001 ..................   44 2 hits [enterobacteria]         putative exonuclease [Yersinia pestis KIM] >gi|40787957|ref
. Yersinia pestis .............................................   44 2 hits [enterobacteria]         putative exonuclease [Yersinia pestis KIM] >gi|40787957|ref
. Yersinia pestis CO92 ........................................   44 2 hits [enterobacteria]         putative exonuclease subunit 2 [Yersinia pestis CO92] >gi|1
. Yersinia pestis Antiqua .....................................   44 2 hits [enterobacteria]         putative exonuclease subunit 2 [Yersinia pestis CO92] >gi|1
. Yersinia pestis Nepal516 ....................................   44 4 hits [enterobacteria]         putative exonuclease subunit 2 [Yersinia pestis CO92] >gi|1
. Yersinia pestis Pestoides F .................................   44 2 hits [enterobacteria]         putative exonuclease subunit 2 [Yersinia pestis CO92] >gi|1
. Yersinia pestis CA88-4125 ...................................   44 2 hits [enterobacteria]         putative exonuclease subunit 2 [Yersinia pestis CO92] >gi|1
. Yersinia pestis FV-1 ........................................   44 1 hit  [enterobacteria]         putative exonuclease subunit 2 [Yersinia pestis CO92] >gi|1
. Yersinia pestis Pestoides A .................................   44 2 hits [enterobacteria]         putative exonuclease subunit 2 [Yersinia pestis CO92] >gi|1
. Yersinia pestis biovar Orientalis str. PEXU2 ................   44 2 hits [enterobacteria]         putative exonuclease subunit 2 [Yersinia pestis CO92] >gi|1
. Yersinia pestis biovar Orientalis str. India 195 ............   44 2 hits [enterobacteria]         putative exonuclease subunit 2 [Yersinia pestis CO92] >gi|1
. Sulfurospirillum deleyianum DSM 6946 ........................   44 2 hits [e-proteobacteria]       RecF/RecN/SMC N-terminal domain-containing protein [Sulfuro
. Fusobacterium sp. 4_1_13 ....................................   44 2 hits [fusobacteria]           chromosome partition protein smc [Fusobacterium sp. 4_1_13]
. Ureaplasma urealyticum serovar 8 str. ATCC 27618 ............   44 2 hits [mycoplasmas]            chromosome partition protein smc [Ureaplasma urealyticum se
. Ureaplasma urealyticum serovar 2 str. ATCC 27814 ............   44 2 hits [mycoplasmas]            chromosome segregation SMC protein homolg [Ureaplasma ureal
. Ureaplasma urealyticum serovar 9 str. ATCC 33175 ............   44 2 hits [mycoplasmas]            p115 protein [Ureaplasma urealyticum serovar 9 str. ATCC 33
. Ureaplasma urealyticum serovar 12 str. ATCC 33696 ...........   44 2 hits [mycoplasmas]            p115 protein [Ureaplasma urealyticum serovar 12 str. ATCC 3
. Ureaplasma urealyticum serovar 4 str. ATCC 27816 ............   44 2 hits [mycoplasmas]            p115 protein [Ureaplasma urealyticum serovar 12 str. ATCC 3
. Ureaplasma urealyticum serovar 10 str. ATCC 33699 ...........   44 2 hits [mycoplasmas]            p115 protein [Ureaplasma urealyticum serovar 12 str. ATCC 3
. Ureaplasma urealyticum serovar 5 str. ATCC 27817 ............   44 2 hits [mycoplasmas]            p115 protein [Ureaplasma urealyticum serovar 5 str. ATCC 27
. Ureaplasma urealyticum serovar 7 str. ATCC 27819 ............   44 2 hits [mycoplasmas]            p115 protein [Ureaplasma urealyticum serovar 5 str. ATCC 27
. Ureaplasma urealyticum serovar 11 str. ATCC 33695 ...........   44 2 hits [mycoplasmas]            p115 protein [Ureaplasma urealyticum serovar 5 str. ATCC 27
. Ureaplasma urealyticum serovar 13 str. ATCC 33698 ...........   44 2 hits [mycoplasmas]            p115 protein [Ureaplasma urealyticum serovar 13 str. ATCC 3
. Gibberella zeae PH-1 ........................................   44 2 hits [ascomycetes]            hypothetical protein FG06489.1 [Gibberella zeae PH-1]
. Candidatus Kuenenia stuttgartiensis .........................   43 1 hit  [planctomycetes]         similar to structural maintenance of chromosome (smc) seggr
. Plasmodium berghei str. ANKA ................................   43 1 hit  [apicomplexans]          ABC transporter [Plasmodium berghei strain ANKA] >gi|565008
. Plasmodium berghei ..........................................   43 1 hit  [apicomplexans]          ABC transporter [Plasmodium berghei strain ANKA] >gi|565008
. Methanothermobacter thermautotrophicus str. Delta H .........   43 3 hits [euryarchaeotes]         intracellular protein transport protein [Methanothermobacte
. Clostridium perfringens NCTC 8239 ...........................   43 2 hits [firmicutes]             ABC transporter, permease/ATP-binding protein [Clostridium 
. Clostridium perfringens B str. ATCC 3626 ....................   43 2 hits [firmicutes]             ABC transporter, permease/ATP-binding protein [Clostridium 
. Clostridium perfringens E str. JGS1987 ......................   43 2 hits [firmicutes]             ABC transporter, permease/ATP-binding protein [Clostridium 
. Clostridium perfringens CPE str. F4969 ......................   43 2 hits [firmicutes]             ABC transporter, permease/ATP-binding protein [Clostridium 
. Clostridium perfringens D str. JGS1721 ......................   43 2 hits [firmicutes]             ABC transporter, permease/ATP-binding protein [Clostridium 
. Methanococcus vannielii SB ..................................   43 2 hits [euryarchaeotes]         SMC domain-containing protein [Methanococcus vannielii SB] 
. Clostridium perfringens SM101 ...............................   43 2 hits [firmicutes]             ABC transporter, ATP-binding/permease protein [Clostridium 

BLAST

PROTOCOL


Blast p/default parameters

blastx/default parameters


RESULTS ANALYSIS


after doing the blastp the best hit was ref|YP_214379.1| T4-like endonuclease [Prochlorococcus phage ... 204 2e-51.

Score _ 204 bits (519), Expect _ 2e-51, Method: Compositional matrix adjust.

Identities _ 97/122 (79%), Positives _ 111/122 (90%), Gaps _ 0/122 (0%)


after doing the blastx the best hit was ref|YP_214379.1| T4-like endonuclease [Prochlorococcus phage ... 330 7e-89

Score _ 330 bits (847), Expect _ 7e-89

Identities _ 163/222 (73%), Positives _ 188/222 (84%), Gaps _ 0/222 (0%)

Frame _ +1


BLAST RESULTS WERE SOME WHAT SATISFACTORY HENCE THE ANNOTATION WAS FURTHER PROCEEDED IN ORDER TO CONFIRM CODING OR NON CODING.



RAW RESULTS

Sequences producing significant alignments:                       (Bits)  Value

ref|YP_214379.1|  T4-like endonuclease [Prochlorococcus phage ...   204    2e-51 
ref|YP_717818.1|  recombination endonuclease [Synechococcus ph...   165    1e-39 
ref|YP_214682.1|  gp46 [Prochlorococcus phage P-SSM4] >gb|AAX4...   153    4e-36 
ref|YP_195153.1|  recombination protein gp46 [Synechococcus ph...   135    1e-30 
ref|NP_049669.1|  gp46 recombination endonuclease subunit [Ent...   117    4e-25 
ref|YP_802997.1|  gp46 recombination endonuclease subunit [Ent...   114    3e-24 
ref|YP_002854013.1|  gp46 recombination endonuclease subunit [...   114    3e-24 
ref|YP_001595183.1|  gp46 recombination endonuclease subunit [...   112    8e-24 
ref|NP_899322.1|  recombination endonuclease subunit [Vibrio p...   112    1e-23 
ref|YP_002854390.1|  gp46 recombination endonuclease subunit [...   112    1e-23 
ref|NP_891605.1|  recombination endonuclease subunit [Enteroba...   106    7e-22 
ref|YP_001469378.1|  endonuclease subunit [Enterobacteria phag...   106    7e-22 
ref|NP_861753.1|  endonuclease subunit [Enterobacteria phage R...   104    2e-21 
ref|NP_943902.1|  gp46 recombination endonuclease subunit [Aer...   104    2e-21 
gb|AAC39308.1|  DNase subunit [Bacteriophage RB69]                  104    2e-21
gb|AAT38480.1|  gp46 [Acinetobacter phage 133]                     98.2    2e-19
ref|YP_239031.1|  gp46 recombination endonuclease subunit [Ent...  95.5    1e-18 
ref|YP_656279.1|  gp46 recombination protein subunit [Aeromona...  90.5    4e-17 
gb|AAR90909.1|  gp46 recombination endonuclease subunit [Aerom...  88.2    2e-16
ref|NP_932398.1|  endonuclease subunit [Aeromonas phage 44RR2....  86.3    9e-16 
ref|YP_001504156.1|  putative exonuclease [Enterococcus phage ...  70.9    4e-11 
gb|AAA32516.1|  exonuclease (g46)                                  68.9    1e-10
ref|YP_002790820.1|  putative exonuclease [Lactobacillus phage...  68.9    1e-10 
ref|YP_024504.1|  putative exonuclease [Staphylococcus phage K...  64.7    3e-09 
ref|YP_238589.1|  ORF009 [Staphylococcus phage Twort] >gb|AAX9...  62.4    1e-08 
gb|AAY53350.1|  gp47 [Listeria bacteriophage P100]                 60.8    3e-08
ref|YP_001468495.1|  gp115 [Listeria phage A511] >gb|AAY52896....  60.8    4e-08 
ref|YP_164705.1|  hypothetical protein LP65_gp070 [Lactobacill...  57.8    3e-07 
gb|AAP68679.1|  gp46 recombination endonuclease subunit [Aerom...  52.4    1e-05
ref|ZP_03771330.1|  chromosome segregation SMC protein homolg ...  47.8    3e-04
ref|ZP_03772241.1|  chromosome partition protein smc [Ureaplas...  47.4    4e-04
ref|YP_001419244.1|  ABC transporter related [Xanthobacter aut...  47.4    4e-04 
ref|ZP_03079741.1|  p115 protein [Ureaplasma urealyticum serov...  46.6    7e-04
ref|ZP_02931893.1|  p115 protein [Ureaplasma urealyticum serov...  46.6    7e-04
ref|ZP_03004177.1|  p115 protein [Ureaplasma urealyticum serov...  46.6    7e-04
ref|ZP_02964597.1|  p115 protein [Ureaplasma urealyticum serov...  46.6    7e-04
ref|NP_077971.1|  p115 protein [Ureaplasma parvum serovar 3 st...  46.6    8e-04 
ref|YP_002300391.1|  gp21.9 [Bacillus phage SPO1] >gb|ACI91020...  45.8    0.001 
ref|YP_477347.1|  exonuclease SbcC [Synechococcus sp. JA-2-3B'...  45.1    0.002 
ref|YP_002464247.1|  SMC domain protein [Chloroflexus aggregan...  44.7    0.002 
ref|YP_001635843.1|  SMC domain-containing protein [Chloroflex...  44.3    0.004 
ref|YP_001272693.1|  purine NTPase involved in DNA repair, Rad...  43.9    0.005 
ref|NP_244840.1|  ABC transporter ATP-binding protein [Bacillu...  43.5    0.005 
ref|YP_322226.1|  exonuclease SbcC [Anabaena variabilis ATCC 2...  43.5    0.006 
ref|NP_072965.1|  chromosome segregation protein SMC [Mycoplas...  43.5    0.006 
ref|NP_488028.1|  hypothetical protein alr3988 [Nostoc sp. PCC...  43.5    0.006 
pdb|1E69|A  Chain A, Smc Head Domain From Thermotoga Maritima ...  43.5    0.007 
ref|YP_001996621.1|  SMC domain protein [Chloroherpeton thalas...  43.1    0.008 
ref|ZP_03849943.1|  possible Vitamin B12-transporting ATPase [...  43.1    0.008
ref|YP_610164.1|  hemin importer ATP-binding subunit [Pseudomo...  42.4    0.014 
ref|ZP_01730755.1|  ABC transporter related protein [Cyanothec...  42.4    0.015
ref|YP_002615324.1|  chromosome segregation protein SMC [Marin...  42.0    0.017 
ref|YP_001245153.1|  chromosome segregation protein SMC [Therm...  42.0    0.017 
ref|NP_228987.1|  chromosome segregation SMC protein, putative...  42.0    0.019 
ref|YP_001739655.1|  chromosome segregation protein SMC [Therm...  41.6    0.023 
ref|YP_001091647.1|  hypothetical protein P9301_14231 [Prochlo...  41.2    0.027 
ref|YP_001545944.1|  SMC domain-containing protein [Herpetosip...  41.2    0.027 
ref|ZP_03607157.1|  hypothetical protein METSMIALI_00254 [Meth...  41.2    0.028
ref|ZP_03705036.1|  hypothetical protein METSMIF1_01492 [Metha...  41.2    0.029
ref|ZP_03997140.1|  ABC superfamily ATP binding cassette trans...  41.2    0.034
ref|YP_579123.1|  ABC transporter related [Nitrobacter hamburg...  41.2    0.034 
ref|YP_001865205.1|  exonuclease SbcC [Nostoc punctiforme PCC ...  40.8    0.035 
ref|YP_002519372.1|  putative exonuclease [Escherichia coli]       40.8    0.036 
ref|ZP_03657887.1|  DNA repair protein RecN [Helicobacter cina...  40.8    0.038
ref|YP_795768.1|  cobalt transporter ATP-binding subunit [Lact...  40.8    0.041 
ref|ZP_03668897.1|  hypothetical protein LmonF1_13116 [Listeri...  40.4    0.048
ref|ZP_03489284.1|  hypothetical protein EUBIFOR_01872 [Eubact...  40.4    0.049
ref|YP_001604554.1|  RecF/RecN/SMC domain-containing protein [...  40.4    0.050 
ref|NP_857792.1|  putative exonuclease [Yersinia pestis KIM] >...  40.4    0.050 
ref|YP_001356242.1|  DNA repair protein RecN [Nitratiruptor sp...  40.4    0.050 
ref|ZP_02361542.1|  ABC transporter, ATP-binding protein [Burk...  40.4    0.051
ref|NP_395379.1|  putative exonuclease subunit 2 [Yersinia pes...  40.4    0.053 
ref|ZP_00232586.1|  ABC transporter, ATP-binding/permease prot...  40.4    0.053
ref|YP_193242.1|  cobalt transporter ATP-binding subunit [Lact...  40.4    0.054 
ref|NP_569597.1|  hypothetical protein HCM2.0125c [Salmonella ...  40.4    0.056 
ref|NP_464657.1|  hypothetical protein lmo1132 [Listeria monoc...  40.4    0.059 
ref|ZP_03659970.1|  multidrug resistance protein MsbA [Helicob...  40.0    0.061
ref|NP_470435.1|  hypothetical protein lin1098 [Listeria innoc...  40.0    0.062 
ref|ZP_02224275.1|  RecF/RecN/SMC domain protein [Yersinia pes...  40.0    0.065
ref|YP_013737.1|  ABC transporter, ATP-binding/permease protei...  40.0    0.076 
ref|ZP_00229724.1|  ABC transporter, ATP-binding/permease prot...  39.7    0.077
ref|YP_001202450.1|  putative ABC transporter (fused ATP-bindi...  39.3    0.10  
ref|YP_812473.1|  cobalt transporter ATP-binding subunit [Lact...  39.3    0.11  
ref|YP_618550.1|  cobalt transporter ATP-binding subunit [Lact...  39.3    0.11  
ref|YP_002074861.1|  ABC transporter, ATP-binding protein, put...  39.3    0.11  
ref|YP_914090.1|  ABC transporter related [Paracoccus denitrif...  39.3    0.12  
ref|ZP_04453432.1|  hypothetical protein GCWU000182_02751 [Abi...  39.3    0.12 
ref|YP_001991620.1|  ABC transporter domain protein [Rhodopseu...  39.3    0.12  
ref|YP_571653.1|  ABC transporter related [Nitrobacter hamburg...  39.3    0.13  
ref|YP_002573042.1|  chromosome segregation protein SMC [Anaer...  39.3    0.13  
ref|YP_002314159.1|  ABC-type uncharacterized transport system...  38.9    0.13  
ref|ZP_04059307.1|  cobalt import ATP-binding protein CbiO 1 [...  38.9    0.15 
ref|YP_002757838.1|  ABC transporter, ATP-binding protein [Lis...  38.9    0.15  
ref|YP_001236435.1|  putative ABC transporter (fused ATP-bindi...  38.9    0.16  
ref|YP_002350480.1|  ABC transporter, ATP-binding/permease pro...  38.5    0.17  
ref|YP_002128067.1|  ABC transporter, ATP-binding protein [Alt...  38.5    0.17  
ref|NP_852952.1|  Smc-like [Mycoplasma gallisepticum R] >gb|AA...  38.5    0.19  
ref|NP_767157.1|  ATP-binding protein [Bradyrhizobium japonicu...  38.5    0.19  
ref|NP_110114.1|  SMC family chromosome/DNA binding/protecting...  38.5    0.19  
ref|YP_001490877.1|  DNA repair protein RecN [Arcobacter butzl...  38.5    0.21  

>ref|YP_214379.1|  T4-like endonuclease [Prochlorococcus phage P-SSM2]
 gb|AAX44525.1|  T4-like endonuclease [Cyanophage P-SSM2]
Length=570

 GENE ID: 3294387 46 | gp46 [Prochlorococcus phage P-SSM2]
(10 or fewer PubMed links)

 Score =  204 bits (519),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/122 (79%), Positives = 111/122 (90%), Gaps = 0/122 (0%)

Query  1    MMDFYINFTLDEEFNETIESPIHEDFSYSSFSEGEKQRIDLALLFTWREVAKFKNSVATN  60
            MMDFYINF LDEEF+ETIESPIHE FSY+SFSEGEK RIDLALLFTWREVA+ KNSV TN
Sbjct  448  MMDFYINFKLDEEFSETIESPIHEKFSYASFSEGEKMRIDLALLFTWREVARVKNSVNTN  507

Query  61   LMILDEVFDSSLDATGTEEFLKIIRYVIKDANIFIISHKSGLEDKFEDHIRFEKHKGFSR  120
            L+I+DE+FDSSLD  GT+EFLKIIR+VIKDAN+F+ISHK+ L+DKFE  IRFEK KGFSR
Sbjct  508  LLIMDEIFDSSLDGFGTDEFLKIIRFVIKDANVFVISHKAELQDKFESVIRFEKIKGFSR  567

Query  121  II  122
            ++
Sbjct  568  MV  569


>ref|YP_717818.1|  recombination endonuclease [Synechococcus phage syn9]
 gb|ABA47119.1|  recombination endonuclease [Synechococcus cyanophage syn9]
Length=573

 GENE ID: 4239149 46 | T4 gp46-like [Synechococcus phage syn9]
(10 or fewer PubMed links)

 Score =  165 bits (417),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/121 (67%), Positives = 98/121 (80%), Gaps = 1/121 (0%)

Query  2    MDFYINFTLDEEFNETIESPIHEDFSYSSFSEGEKQRIDLALLFTWREVAKFKNSVATNL  61
            MDFY+NFTLDEEFNE I+S   ++FSY+SFSEGEKQ+IDLALLFTWREVA+ KNSVATNL
Sbjct  449  MDFYVNFTLDEEFNEVIKSRFRDEFSYASFSEGEKQKIDLALLFTWREVARMKNSVATNL  508

Query  62   MILDEVFDSSLDATGTEEFLKIIRYVIKDANIFIISHKSG-LEDKFEDHIRFEKHKGFSR  120
            +ILDEVFDSSLD  GT E LKI+R +  + N+F+ISHK   L DKF   ++FEK   FSR
Sbjct  509  LILDEVFDSSLDTEGTNELLKILRSLGNETNVFVISHKGEILVDKFLRTLKFEKVNDFSR  568

Query  121  I  121
            +
Sbjct  569  M  569


>ref|YP_214682.1|  gp46 [Prochlorococcus phage P-SSM4]
 gb|AAX46922.1|  gp46 [Cyanophage P-SSM4]
Length=572

 GENE ID: 3294637 46 | endonuclease subunit [Prochlorococcus phage P-SSM4]
(10 or fewer PubMed links)

 Score =  153 bits (387),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 94/122 (77%), Gaps = 1/122 (0%)

Query  2    MDFYINFTLDEEFNETIESPIHEDFSYSSFSEGEKQRIDLALLFTWREVAKFKNSVATNL  61
            MDF++NFTLDEEFNE I+S   +DF Y+SFSEGEKQ+IDLALLFTWREVA+ KNS ATNL
Sbjct  448  MDFFVNFTLDEEFNEEIKSRFRDDFCYASFSEGEKQKIDLALLFTWREVARMKNSAATNL  507

Query  62   MILDEVFDSSLDATGTEEFLKIIRYVIKDANIFIISHKSG-LEDKFEDHIRFEKHKGFSR  120
            +ILDEVFDSSLDA  T   L I+  +  + NIF+ISHK   L +KF   +RFEK   FS+
Sbjct  508  LILDEVFDSSLDADSTNALLSILGTLGNNTNIFVISHKGDILIEKFHRTLRFEKINDFSK  567

Query  121  II  122
            ++
Sbjct  568  LV  569


>ref|YP_195153.1|  recombination protein gp46 [Synechococcus phage S-PM2]
 emb|CAF34183.1|  recombination protein gp46 [Cyanophage phage S-PM2]
Length=576

 GENE ID: 3260448 46 | endonuclease subunit [Synechococcus phage S-PM2]
(10 or fewer PubMed links)

 Score =  135 bits (340),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 85/120 (70%), Gaps = 0/120 (0%)

Query  2    MDFYINFTLDEEFNETIESPIHEDFSYSSFSEGEKQRIDLALLFTWREVAKFKNSVATNL  61
            MDFY+NFTLDE F ETI+S   + FSY+SFSEGEK RID+ALL TWR +AK KNSV TNL
Sbjct  449  MDFYVNFTLDENFEETIKSRFRDQFSYASFSEGEKARIDIALLLTWRSIAKLKNSVDTNL  508

Query  62   MILDEVFDSSLDATGTEEFLKIIRYVIKDANIFIISHKSGLEDKFEDHIRFEKHKGFSRI  121
            +ILDE+FD SLD  G  +   I+R    + ++F+ISHK  + DK++     EK K +S +
Sbjct  509  LILDEIFDGSLDQQGGSDLGWILRSFDDNISVFVISHKEQMNDKYDRTFNVEKIKNYSVV  568


>ref|NP_049669.1|  gp46 recombination endonuclease subunit [Enterobacteria phage 
T4]
 sp|P04522.2|EXO2_BPT4  RecName: Full=Exonuclease subunit 2; AltName: Full=Protein Gp46
 gb|AAD42472.1|AF158101_59  gp46 recombination endonuclease subunit [Enterobacteria phage 
T4]
 gb|AAC05392.1|  exonuclease g46 (gtg start codon) [Enterobacteria phage T4]
 emb|CAA25945.1|  unnamed protein product [Enterobacteria phage T4]
Length=560

 GENE ID: 1258822 46 | gp46/gp47 subunit required for recombination and host-DNA
degradation [Enterobacteria phage T4] (10 or fewer PubMed links)

 Score =  117 bits (292),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 81/115 (70%), Gaps = 1/115 (0%)

Query  8    FTLDEEFNETIESPIHEDFSYSSFSEGEKQRIDLALLFTWREVAKFKNSVATNLMILDEV  67
            FTLDEEFNETI+S   EDFSY+SFSEGEK RID+ALLFTWR++A   + V+ + +ILDEV
Sbjct  447  FTLDEEFNETIKSRGREDFSYASFSEGEKARIDIALLFTWRDIASIVSGVSISTLILDEV  506

Query  68   FDSSLDATGTEEFLKIIRYVIKDANIFIISHKSGLEDKFEDHIRFEKHKGFSRII  122
            FD S DA G +    II   +K+ N+FIISHK     ++  H++ +K   F+ ++
Sbjct  507  FDGSFDAEGIKGVANIINS-MKNTNVFIISHKDHDPQEYGQHLQMKKVGRFTVMV  560


>ref|YP_802997.1|  gp46 recombination endonuclease subunit [Enterobacteria phage 
RB32]
 gb|ABI94879.1|  gp46 recombination endonuclease subunit [Bacteriophage RB32]
Length=562

 GENE ID: 4405613 46 | endonuclease subunit [Enterobacteria phage RB32]

 Score =  114 bits (285),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/112 (53%), Positives = 78/112 (69%), Gaps = 1/112 (0%)

Query  8    FTLDEEFNETIESPIHEDFSYSSFSEGEKQRIDLALLFTWREVAKFKNSVATNLMILDEV  67
            FTLDEEFNETI+S   EDFSY+SFS+GEK RID+ALLFTWR++A+  + V  + + LDEV
Sbjct  447  FTLDEEFNETIKSRGREDFSYASFSQGEKARIDIALLFTWRDIAEKVSGVKISCLFLDEV  506

Query  68   FDSSLDATGTEEFLKIIRYVIKDANIFIISHKSGLEDKFEDHIRFEKHKGFS  119
            +D + DA G +   KI+   +KD N FIISHK     ++  HI+ EK   FS
Sbjct  507  YDGAFDAEGIKNVAKILDG-LKDTNFFIISHKDHDPQEYGQHIQMEKVGRFS  557


>ref|YP_002854013.1|  gp46 recombination endonuclease subunit [Enterobacteria phage 
RB51]
 gb|ACP30976.1|  gp46 recombination endonuclease subunit [Enterobacteria phage 
RB51]
Length=562

 GENE ID: 7803566 46 | gp46 recombination endonuclease subunit
[Enterobacteria phage RB51]

 Score =  114 bits (285),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/112 (53%), Positives = 77/112 (68%), Gaps = 1/112 (0%)

Query  8    FTLDEEFNETIESPIHEDFSYSSFSEGEKQRIDLALLFTWREVAKFKNSVATNLMILDEV  67
            FTLDEEFNETI+S   EDFSY+SFS+GEK RID+ALLFTWR++A+  + V  + + LDEV
Sbjct  447  FTLDEEFNETIKSRGREDFSYASFSQGEKARIDIALLFTWRDIAEKVSGVKISCLFLDEV  506

Query  68   FDSSLDATGTEEFLKIIRYVIKDANIFIISHKSGLEDKFEDHIRFEKHKGFS  119
            +D + DA G +   KI+   +KD N FIISHK      +  HI+ EK   FS
Sbjct  507  YDGAFDAEGIKNVAKILDG-LKDTNFFIISHKDHDPQDYGQHIKMEKVGRFS  557


>ref|YP_001595183.1|  gp46 recombination endonuclease subunit [Enterobacteria phage 
JS98]
 gb|AAU29245.1|  gp46 recombination endonuclease subunit [Enterobacteria phage 
JS98]
Length=560

 GENE ID: 5783834 46 | endonuclease subunit [Enterobacteria phage JS98]
(10 or fewer PubMed links)

 Score =  112 bits (281),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/112 (50%), Positives = 78/112 (69%), Gaps = 1/112 (0%)

Query  8    FTLDEEFNETIESPIHEDFSYSSFSEGEKQRIDLALLFTWREVAKFKNSVATNLMILDEV  67
            FTLDEEFNETI+S   EDFSY+SFS+GEK RID+ALLFTWR++A   + V  + +ILDEV
Sbjct  447  FTLDEEFNETIKSRGREDFSYASFSQGEKARIDIALLFTWRDIASRVSGVNISTLILDEV  506

Query  68   FDSSLDATGTEEFLKIIRYVIKDANIFIISHKSGLEDKFEDHIRFEKHKGFS  119
            FDS+ DA G +    I+   ++D N+FIISH+      +  H++ +K   F+
Sbjct  507  FDSATDAEGVKSIATILNS-LEDTNVFIISHRDHDPQAYGQHLQMKKVGRFT  557


>ref|NP_899322.1|  recombination endonuclease subunit [Vibrio phage KVP40]
 gb|AAQ64145.1|  recombination endonuclease subunit [Bacteriophage KVP40]
Length=745

 GENE ID: 2545832 46 | recombination endonuclease subunit [Vibrio phage KVP40]
(10 or fewer PubMed links)

 Score =  112 bits (280),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/120 (50%), Positives = 82/120 (68%), Gaps = 3/120 (2%)

Query  2    MDFYINFTLDEEFNETIESPIHEDFSYSSFSEGEKQRIDLALLFTWREVAKFKNSVATNL  61
            M+   NF LDEEFNETI+S   +DFSY+SFS+GE+ RIDLALLF +R++   +    TNL
Sbjct  625  MNANYNFVLDEEFNETIKSRGRDDFSYTSFSQGERCRIDLALLFAFRDLVSARTGSMTNL  684

Query  62   MILDEVFDSSLDATGTEEFLKIIRYVIKDANIFIISHKSGLEDK-FEDHIRFEKHKGFSR  120
            ++LDEVFDS+ D+ G +   +I+   IKD N+FIISH    E   F+ HI+F K   F+R
Sbjct  685  LVLDEVFDSAADSDGVDSINQILSS-IKD-NVFIISHSEKHEQSMFDKHIKFAKKGNFTR  742


>ref|YP_002854390.1|  gp46 recombination endonuclease subunit [Enterobacteria phage 
RB14]
 gb|ACP30698.1|  gp46 recombination endonuclease subunit [Enterobacteria phage 
RB14]
Length=560

 GENE ID: 7803773 46 | gp46 recombination endonuclease subunit
[Enterobacteria phage RB14]

 Score =  112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/115 (48%), Positives = 80/115 (69%), Gaps = 1/115 (0%)

Query  8    FTLDEEFNETIESPIHEDFSYSSFSEGEKQRIDLALLFTWREVAKFKNSVATNLMILDEV  67
            FTLDEEFNETI+S   EDFSY+SFS+GEK RID+ALLFTWR++A+  + V  N +ILDEV
Sbjct  447  FTLDEEFNETIKSRGREDFSYASFSQGEKARIDIALLFTWRDIAEKVSGVKINTLILDEV  506

Query  68   FDSSLDATGTEEFLKIIRYVIKDANIFIISHKSGLEDKFEDHIRFEKHKGFSRII  122
            FDS+ D  G +    I+   +K+ N+F+ISH+      +  H++ +K   F+ ++
Sbjct  507  FDSATDVEGVKAISTILDS-LKNTNVFVISHRDHDPQAYGQHLQMKKVGRFTVMV  560


>ref|NP_891605.1|  recombination endonuclease subunit [Enterobacteria phage RB49]
 gb|AAL87829.2|AF410869_1  recombination endonuclease subunit [Enterobacteria phage RB49]
Length=560

 GENE ID: 1725534 46 | Gp46 [Enterobacteria phage RB49]
(10 or fewer PubMed links)

 Score =  106 bits (265),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 75/114 (65%), Gaps = 2/114 (1%)

Query  8    FTLDEEFNETIESPIHEDFSYSSFSEGEKQRIDLALLFTWREVAKFKNSVATNLMILDEV  67
            FTLDEEFNETI+S   E FSY+SFS+GEK RIDLA+LFTWR+VA   +    +L++LDE+
Sbjct  445  FTLDEEFNETIKSRGRESFSYTSFSQGEKARIDLAMLFTWRDVAGKVSGTNISLLVLDEI  504

Query  68   FDSSLDATGTEEFLKIIRYVIKDANIFIISHKSGLEDKFEDHIRFEKHKGFSRI  121
            +D + D  G +    II  +  D N++IISH+    D F  H++  K   F+ +
Sbjct  505  YDGATDVQGVKALDSIIDKL--DDNVYIISHRDHNPDDFSRHLKMVKRGRFTEM  556


>ref|YP_001469378.1|  endonuclease subunit [Enterobacteria phage Phi1]
 gb|ABR24544.1|  gp46 recombination endonuclease subunit [Enterobacteria phage 
Phi1]
Length=560

 GENE ID: 5602140 46 | endonuclease subunit [Enterobacteria phage Phi1]

 Score =  106 bits (264),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 75/114 (65%), Gaps = 2/114 (1%)

Query  8    FTLDEEFNETIESPIHEDFSYSSFSEGEKQRIDLALLFTWREVAKFKNSVATNLMILDEV  67
            FTLDEEFNETI+S   E FSY+SFS+GEK RIDLA+LFTWR+VA   +    +L++LDE+
Sbjct  445  FTLDEEFNETIKSRGRESFSYTSFSQGEKARIDLAMLFTWRDVAGKVSGTNISLLVLDEI  504

Query  68   FDSSLDATGTEEFLKIIRYVIKDANIFIISHKSGLEDKFEDHIRFEKHKGFSRI  121
            +D + D  G +    II  +  D N++IISH+    D F  H++  K   F+ +
Sbjct  505  YDGATDVQGVKALDSIIDKL--DDNVYIISHRDHNPDDFSRHLKMVKRGRFTEM  556

---------------------------------------------------------------------------------

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|YP_214379.1|  T4-like endonuclease [Prochlorococcus phage ...   330    7e-89 
ref|YP_717818.1|  recombination endonuclease [Synechococcus ph...   214    1e-53 
ref|YP_214682.1|  gp46 [Prochlorococcus phage P-SSM4] >gb|AAX4...   199    3e-49 
ref|YP_195153.1|  recombination protein gp46 [Synechococcus ph...   191    7e-47 
ref|YP_802997.1|  gp46 recombination endonuclease subunit [Ent...   157    1e-36 
ref|NP_049669.1|  gp46 recombination endonuclease subunit [Ent...   156    2e-36 
ref|YP_002854013.1|  gp46 recombination endonuclease subunit [...   155    6e-36 
ref|NP_899322.1|  recombination endonuclease subunit [Vibrio p...   155    6e-36 
ref|YP_002854390.1|  gp46 recombination endonuclease subunit [...   151    6e-35 
ref|YP_001595183.1|  gp46 recombination endonuclease subunit [...   150    1e-34 
ref|NP_891605.1|  recombination endonuclease subunit [Enteroba...   143    2e-32 
ref|NP_861753.1|  endonuclease subunit [Enterobacteria phage R...   143    2e-32 
gb|AAC39308.1|  DNase subunit [Bacteriophage RB69]                  143    2e-32
ref|YP_001469378.1|  endonuclease subunit [Enterobacteria phag...   142    4e-32 
ref|NP_943902.1|  gp46 recombination endonuclease subunit [Aer...   139    2e-31 
ref|YP_239031.1|  gp46 recombination endonuclease subunit [Ent...   130    2e-28 
ref|YP_656279.1|  gp46 recombination protein subunit [Aeromona...   126    3e-27 
gb|AAR90909.1|  gp46 recombination endonuclease subunit [Aerom...   126    3e-27
ref|NP_932398.1|  endonuclease subunit [Aeromonas phage 44RR2....   117    2e-24 
gb|AAT38480.1|  gp46 [Acinetobacter phage 133]                     99.0    5e-19
ref|YP_001504156.1|  putative exonuclease [Enterococcus phage ...  88.2    8e-16 
ref|YP_024504.1|  putative exonuclease [Staphylococcus phage K...  85.9    4e-15 
ref|YP_238589.1|  ORF009 [Staphylococcus phage Twort] >gb|AAX9...  82.8    3e-14 
ref|YP_001468495.1|  gp115 [Listeria phage A511] >gb|AAY52896....  82.4    5e-14 
gb|AAY53350.1|  gp47 [Listeria bacteriophage P100]                 82.4    5e-14
ref|YP_002790820.1|  putative exonuclease [Lactobacillus phage...  79.7    3e-13 
ref|YP_164705.1|  hypothetical protein LP65_gp070 [Lactobacill...  79.0    5e-13 
gb|AAA32516.1|  exonuclease (g46)                                  69.7    3e-10
ref|YP_002300391.1|  gp21.9 [Bacillus phage SPO1] >gb|ACI91020...  68.6    7e-10 
ref|YP_001180375.1|  SMC domain-containing protein [Caldicellu...  67.0    2e-09 
ref|YP_001996621.1|  SMC domain protein [Chloroherpeton thalas...  63.5    2e-08 
ref|YP_322226.1|  exonuclease SbcC [Anabaena variabilis ATCC 2...  61.2    1e-07 
ref|NP_488028.1|  hypothetical protein alr3988 [Nostoc sp. PCC...  60.5    2e-07 
ref|YP_001482177.1|  DNA repair protein RecN [Campylobacter je...  59.7    3e-07 
ref|YP_307629.1|  putative exonuclease SbcC [Dehalococcoides s...  59.7    3e-07 
ref|YP_002464247.1|  SMC domain protein [Chloroflexus aggregan...  58.9    5e-07 
ref|YP_181293.1|  exonuclease SbcC, putative [Dehalococcoides ...  58.5    7e-07 
ref|ZP_01069994.1|  DNA repair protein RecN [Campylobacter jej...  57.8    1e-06
ref|ZP_01071610.1|  DNA repair protein recN [Campylobacter jej...  57.8    1e-06
ref|ZP_03222263.1|  putative DNA repair protein [Campylobacter...  56.6    3e-06
ref|YP_178756.1|  DNA repair protein RecN [Campylobacter jejun...  56.6    3e-06 
ref|YP_002344071.1|  putative DNA repair protein [Campylobacte...  56.6    3e-06 
ref|YP_001213988.1|  SMC domain-containing protein [Dehalococc...  56.6    3e-06 
ref|ZP_01100284.1|  DNA repair protein RecN [Campylobacter jej...  56.6    3e-06
ref|ZP_01068106.1|  DNA repair protein RecN [Campylobacter jej...  56.6    3e-06
ref|ZP_02203818.1|  SMC domain protein [Dehalococcoides sp. VS...  55.1    8e-06
ref|YP_142909.1|  putative DNA repair protein [Acanthamoeba po...  55.1    8e-06 
ref|YP_001398400.1|  DNA repair protein RecN [Campylobacter je...  54.3    1e-05 
ref|YP_001324906.1|  SMC domain-containing protein [Methanococ...  53.9    2e-05 
gb|AAP68679.1|  gp46 recombination endonuclease subunit [Aerom...  53.9    2e-05
ref|YP_001635843.1|  SMC domain-containing protein [Chloroflex...  53.5    2e-05 
ref|YP_002580494.1|  hypothetical protein TERMP_1189 [Thermoco...  52.4    5e-05 
ref|YP_001275264.1|  SMC domain-containing protein [Roseiflexu...  51.6    9e-05 
ref|YP_002615324.1|  chromosome segregation protein SMC [Marin...  50.8    1e-04 
ref|YP_001245153.1|  chromosome segregation protein SMC [Therm...  50.8    1e-04 
ref|YP_001739655.1|  chromosome segregation protein SMC [Therm...  50.4    2e-04 
ref|YP_001545944.1|  SMC domain-containing protein [Herpetosip...  50.4    2e-04 
ref|NP_228987.1|  chromosome segregation SMC protein, putative...  50.4    2e-04 
ref|YP_002519372.1|  putative exonuclease [Escherichia coli]       50.1    2e-04 
ref|YP_478182.1|  RecF/RecN/SMC domain-containing protein [Syn...  49.7    3e-04 
ref|ZP_04583238.1|  DNA repair protein-ATPase [Helicobacter wi...  48.9    6e-04
ref|YP_001434143.1|  SMC domain-containing protein [Roseiflexu...  48.9    6e-04 
ref|ZP_04424976.1|  ATPase involved in DNA repair [Rhodothermu...  48.1    0.001
ref|NP_248322.1|  purine NTPase [Methanocaldococcus jannaschii...  47.4    0.002 
ref|YP_002573042.1|  chromosome segregation protein SMC [Anaer...  46.2    0.004 
gb|AAU05265.1|  probable exonuclease subunit 2 [Bacteriophage T5]  45.8    0.005
gb|AAX12056.1|  probable exonuclease subunit 2 [Bacteriophage T5]  45.8    0.005
ref|YP_016107.1|  segregation of chromosomes protein [Mycoplas...  45.8    0.005 
pdb|1E69|A  Chain A, Smc Head Domain From Thermotoga Maritima ...  45.8    0.005 
ref|YP_006956.1|  putative recombination endonuclease, subunit...  45.8    0.005 
ref|YP_475902.1|  RecF/RecN/SMC domain-containing protein [Syn...  45.4    0.006 
ref|NP_569597.1|  hypothetical protein HCM2.0125c [Salmonella ...  45.4    0.006 
ref|ZP_03870200.1|  hypothetical protein HutaDRAFT_10630 [Halo...  45.1    0.008
ref|XP_002079669.1|  GD21899 [Drosophila simulans] >gb|EDX0525...  45.1    0.008 
ref|YP_001837064.1|  probable exonuclease subunit 2 [Enterobac...  45.1    0.008 
ref|ZP_00144638.1|  Chromosome partition protein smc [Fusobact...  45.1    0.008
ref|ZP_04491707.1|  ATPase involved in DNA repair [Spirosoma l...  44.7    0.010
ref|YP_002534936.1|  Condensin subunit Smc [Thermotoga neapoli...  44.7    0.010 
ref|YP_001604554.1|  RecF/RecN/SMC domain-containing protein [...  44.7    0.010 
ref|ZP_02224275.1|  RecF/RecN/SMC domain protein [Yersinia pes...  44.7    0.010
ref|NP_857792.1|  putative exonuclease [Yersinia pestis KIM] >...  44.7    0.010 
ref|NP_395379.1|  putative exonuclease subunit 2 [Yersinia pes...  44.7    0.010 
ref|ZP_04422114.1|  RecF/RecN/SMC N-terminal domain-containing...  44.3    0.014
ref|ZP_04572533.1|  chromosome partition protein smc [Fusobact...  44.3    0.014
ref|ZP_03772241.1|  chromosome partition protein smc [Ureaplas...  44.3    0.014
ref|ZP_03771330.1|  chromosome segregation SMC protein homolg ...  44.3    0.014
ref|ZP_03079741.1|  p115 protein [Ureaplasma urealyticum serov...  44.3    0.014
ref|ZP_03004177.1|  p115 protein [Ureaplasma urealyticum serov...  44.3    0.014
ref|ZP_02964597.1|  p115 protein [Ureaplasma urealyticum serov...  44.3    0.014
ref|ZP_02931893.1|  p115 protein [Ureaplasma urealyticum serov...  44.3    0.014
ref|XP_386665.1|  hypothetical protein FG06489.1 [Gibberella z...  44.3    0.014 
emb|CAJ72472.1|  similar to structural maintenance of chromoso...  43.9    0.018
ref|XP_680016.1|  ABC transporter [Plasmodium berghei strain A...  43.9    0.018 
ref|NP_275683.1|  intracellular protein transport protein [Met...  43.9    0.018 
ref|XP_391759.1|  hypothetical protein FG11583.1 [Gibberella z...  43.9    0.018 
ref|ZP_02643195.1|  ABC transporter, permease/ATP-binding prot...  43.5    0.023
ref|ZP_02636203.1|  ABC transporter, permease/ATP-binding prot...  43.5    0.023
ref|ZP_02632594.1|  ABC transporter, permease/ATP-binding prot...  43.5    0.023
ref|YP_001323170.1|  SMC domain-containing protein [Methanococ...  43.5    0.023 
ref|YP_697551.1|  ABC transporter, ATP-binding/permease protei...  43.5    0.023 

>ref|YP_214379.1|  T4-like endonuclease [Prochlorococcus phage P-SSM2]
 gb|AAX44525.1|  T4-like endonuclease [Cyanophage P-SSM2]
Length=570

 GENE ID: 3294387 46 | gp46 [Prochlorococcus phage P-SSM2]
(10 or fewer PubMed links)

 Score =  330 bits (847),  Expect = 7e-89
 Identities = 163/222 (73%), Positives = 188/222 (84%), Gaps = 0/222 (0%)
 Frame = +1

Query  1    LTHGISKNNTLISNCQRQQRDLESEIQTLTEQLENRNTEHNKLEKFKSTLQETYESLATH  180
            L +GISKN+TLIS C RQ RDLESEIQ LT+Q  NRNTE  KL +F   LQE ++ LA  
Sbjct  348  LNNGISKNHTLISGCNRQVRDLESEIQRLTDQHANRNTEQEKLAEFNQNLQEVFKKLADK  407

Query  181  NQTIKYYNFTYELLKDGGVKTKIIKKYLPLINQQVNRYLQMMDFYINFTLDEEFNETIES  360
             + + Y++F Y LLKD GVKTKIIKKYLPLINQQVNR+LQMMDFYINF LDEEF+ETIES
Sbjct  408  KEEVMYHDFAYSLLKDDGVKTKIIKKYLPLINQQVNRFLQMMDFYINFKLDEEFSETIES  467

Query  361  PIHEDFSYSSFSEGEKQRIDLALLFTWREVAKFKNSVATNLMILDEVFDSSLDATGTEEF  540
            PIHE FSY+SFSEGEK RIDLALLFTWREVA+ KNSV TNL+I+DE+FDSSLD  GT+EF
Sbjct  468  PIHEKFSYASFSEGEKMRIDLALLFTWREVARVKNSVNTNLLIMDEIFDSSLDGFGTDEF  527

Query  541  LKIIRYVIKDANIFIISHKSGLEDKFEDHIRFEKHKGFSRII  666
            LKIIR+VIKDAN+F+ISHK+ L+DKFE  IRFEK KGFSR++
Sbjct  528  LKIIRFVIKDANVFVISHKAELQDKFESVIRFEKIKGFSRMV  569


>ref|YP_717818.1|  recombination endonuclease [Synechococcus phage syn9]
 gb|ABA47119.1|  recombination endonuclease [Synechococcus cyanophage syn9]
Length=573

 GENE ID: 4239149 46 | T4 gp46-like [Synechococcus phage syn9]
(10 or fewer PubMed links)

 Score =  214 bits (544),  Expect = 1e-53
 Identities = 112/201 (55%), Positives = 141/201 (70%), Gaps = 1/201 (0%)
 Frame = +1

Query  64   LESEIQTLTEQLENRNTEHNKLEKFKSTLQETYESLATHNQTIKYYNFTYELLKDGGVKT  243
            ++ EI  L     N + E   L + K    +T E  A  ++ +  Y     LLKD GVK 
Sbjct  369  IQDEIIKLKVDTPNIDKETVYLSEVKDEYTKTKEDCAGISKKLDEYQVVSNLLKDSGVKR  428

Query  244  KIIKKYLPLINQQVNRYLQMMDFYINFTLDEEFNETIESPIHEDFSYSSFSEGEKQRIDL  423
            +IIKKY+P+ NQ +N+YLQ MDFY+NFTLDEEFNE I+S   ++FSY+SFSEGEKQ+IDL
Sbjct  429  QIIKKYIPVFNQLINKYLQSMDFYVNFTLDEEFNEVIKSRFRDEFSYASFSEGEKQKIDL  488

Query  424  ALLFTWREVAKFKNSVATNLMILDEVFDSSLDATGTEEFLKIIRYVIKDANIFIISHKSG  603
            ALLFTWREVA+ KNSVATNL+ILDEVFDSSLD  GT E LKI+R +  + N+F+ISHK  
Sbjct  489  ALLFTWREVARMKNSVATNLLILDEVFDSSLDTEGTNELLKILRSLGNETNVFVISHKGE  548

Query  604  -LEDKFEDHIRFEKHKGFSRI  663
             L DKF   ++FEK   FSR+
Sbjct  549  ILVDKFLRTLKFEKVNDFSRM  569


>ref|YP_214682.1|  gp46 [Prochlorococcus phage P-SSM4]
 gb|AAX46922.1|  gp46 [Cyanophage P-SSM4]
Length=572

 GENE ID: 3294637 46 | endonuclease subunit [Prochlorococcus phage P-SSM4]
(10 or fewer PubMed links)

 Score =  199 bits (506),  Expect = 3e-49
 Identities = 108/220 (49%), Positives = 143/220 (65%), Gaps = 7/220 (3%)
 Frame = +1

Query  28   TLISNCQRQQRDLESEIQTLTEQLENR------NTEHNKLEKFKSTLQETYESLATHNQT  189
            T IS   R    L+SE  ++ ++L N         E + L+      ++T        Q 
Sbjct  350  TEISTFDRDLVRLDSENLSIEKELSNLVAAPKIEKEEHVLKTLVDDFEDTKIDCGKVAQK  409

Query  190  IKYYNFTYELLKDGGVKTKIIKKYLPLINQQVNRYLQMMDFYINFTLDEEFNETIESPIH  369
            I  Y+    LL+D G+K++IIKKY+P+ NQ +N+YL  MDF++NFTLDEEFNE I+S   
Sbjct  410  IDEYHTVRSLLQDSGIKSRIIKKYVPIFNQLINKYLHSMDFFVNFTLDEEFNEEIKSRFR  469

Query  370  EDFSYSSFSEGEKQRIDLALLFTWREVAKFKNSVATNLMILDEVFDSSLDATGTEEFLKI  549
            +DF Y+SFSEGEKQ+IDLALLFTWREVA+ KNS ATNL+ILDEVFDSSLDA  T   L I
Sbjct  470  DDFCYASFSEGEKQKIDLALLFTWREVARMKNSAATNLLILDEVFDSSLDADSTNALLSI  529

Query  550  IRYVIKDANIFIISHKSG-LEDKFEDHIRFEKHKGFSRII  666
            +  +  + NIF+ISHK   L +KF   +RFEK   FS+++
Sbjct  530  LGTLGNNTNIFVISHKGDILIEKFHRTLRFEKINDFSKLV  569


>ref|YP_195153.1|  recombination protein gp46 [Synechococcus phage S-PM2]
 emb|CAF34183.1|  recombination protein gp46 [Cyanophage phage S-PM2]
Length=576

 GENE ID: 3260448 46 | endonuclease subunit [Synechococcus phage S-PM2]
(10 or fewer PubMed links)

 Score =  191 bits (485),  Expect = 7e-47
 Identities = 100/226 (44%), Positives = 141/226 (62%), Gaps = 7/226 (3%)
 Frame = +1

Query  1    LTHGISKNNTLISNC-------QRQQRDLESEIQTLTEQLENRNTEHNKLEKFKSTLQET  159
            ++  I++NN  IS C       ++   D+E EI+ L     ++   + KLE   +  ++ 
Sbjct  341  ISSSITENNNKISQCNYAIKSIRKSIDDVEKEIKELESGGGDKKEAYTKLETLVANKKDL  400

Query  160  YESLATHNQTIKYYNFTYELLKDGGVKTKIIKKYLPLINQQVNRYLQMMDFYINFTLDEE  339
               L+   +     +    LLKD G+KT+IIKKYLP++N+ +N YLQ MDFY+NFTLDE 
Sbjct  401  SFQLSESKKDKDMLSVASGLLKDNGIKTRIIKKYLPIMNKLINHYLQGMDFYVNFTLDEN  460

Query  340  FNETIESPIHEDFSYSSFSEGEKQRIDLALLFTWREVAKFKNSVATNLMILDEVFDSSLD  519
            F ETI+S   + FSY+SFSEGEK RID+ALL TWR +AK KNSV TNL+ILDE+FD SLD
Sbjct  461  FEETIKSRFRDQFSYASFSEGEKARIDIALLLTWRSIAKLKNSVDTNLLILDEIFDGSLD  520

Query  520  ATGTEEFLKIIRYVIKDANIFIISHKSGLEDKFEDHIRFEKHKGFS  657
              G  +   I+R    + ++F+ISHK  + DK++     EK K +S
Sbjct  521  QQGGSDLGWILRSFDDNISVFVISHKEQMNDKYDRTFNVEKIKNYS  566


>ref|YP_802997.1|  gp46 recombination endonuclease subunit [Enterobacteria phage 
RB32]
 gb|ABI94879.1|  gp46 recombination endonuclease subunit [Bacteriophage RB32]
Length=562

 GENE ID: 4405613 46 | endonuclease subunit [Enterobacteria phage RB32]

 Score =  157 bits (396),  Expect = 1e-36
 Identities = 96/246 (39%), Positives = 136/246 (55%), Gaps = 29/246 (11%)
 Frame = +1

Query  4    THGISKNNTLISNCQ---RQQRDLESEIQTLTEQLENRN----TEHNKLEKFKSTLQETY  162
            TH   + +T   N +    + RD     QTL   + N+     T  +K +K K+ +++  
Sbjct  313  THSFEQLSTHRDNLKVLVDEYRDNIKTQQTLANDIRNKKQSLITTVDKAKKVKAAIEKAS  372

Query  163  ESLATHNQTI--------------------KYYN-FTYELLKDGGVKTKIIKKYLPLINQ  279
                 H   I                    KY+     ++LKD G+K  IIKKY+PL N+
Sbjct  373  SEFIDHADEIALLQEELDKIVKTKTNLVMEKYHRGILTDMLKDSGIKGAIIKKYIPLFNK  432

Query  280  QVNRYLQMMDFYINFTLDEEFNETIESPIHEDFSYSSFSEGEKQRIDLALLFTWREVAKF  459
            Q+N YL++M+    FTLDEEFNETI+S   EDFSY+SFS+GEK RID+ALLFTWR++A+ 
Sbjct  433  QINHYLKIMEADYVFTLDEEFNETIKSRGREDFSYASFSQGEKARIDIALLFTWRDIAEK  492

Query  460  KNSVATNLMILDEVFDSSLDATGTEEFLKIIRYVIKDANIFIISHKSGLEDKFEDHIRFE  639
             + V  + + LDEV+D + DA G +   KI+   +KD N FIISHK     ++  HI+ E
Sbjct  493  VSGVKISCLFLDEVYDGAFDAEGIKNVAKILD-GLKDTNFFIISHKDHDPQEYGQHIQME  551

Query  640  KHKGFS  657
            K   FS
Sbjct  552  KVGRFS  557


>ref|NP_049669.1|  gp46 recombination endonuclease subunit [Enterobacteria phage 
T4]
 sp|P04522.2|EXO2_BPT4  RecName: Full=Exonuclease subunit 2; AltName: Full=Protein Gp46
 gb|AAD42472.1|AF158101_59  gp46 recombination endonuclease subunit [Enterobacteria phage 
T4]
 gb|AAC05392.1|  exonuclease g46 (gtg start codon) [Enterobacteria phage T4]
 emb|CAA25945.1|  unnamed protein product [Enterobacteria phage T4]
Length=560

 GENE ID: 1258822 46 | gp46/gp47 subunit required for recombination and host-DNA
degradation [Enterobacteria phage T4] (10 or fewer PubMed links)

 Score =  156 bits (395),  Expect = 2e-36
 Identities = 91/225 (40%), Positives = 132/225 (58%), Gaps = 15/225 (6%)
 Frame = +1

Query  34   ISNCQRQQRDLESEIQTLTEQLENRNTEHNKLEKFKST----------LQETYESLATHN  183
            I   Q    D+ ++ Q+L   ++        +EK  S           LQE  + +    
Sbjct  337  IKTQQSLANDIRNKKQSLIAAVDKAKKVKAAIEKASSEFIDHADEIALLQEELDKIVKTK  396

Query  184  QTI---KYYN-FTYELLKDGGVKTKIIKKYLPLINQQVNRYLQMMDFYINFTLDEEFNET  351
              +   KY+     ++LKD G+K  IIKKY+PL N+Q+N YL++M+    FTLDEEFNET
Sbjct  397  TNLVMEKYHRGILTDMLKDSGIKGAIIKKYIPLFNKQINHYLKIMEADYVFTLDEEFNET  456

Query  352  IESPIHEDFSYSSFSEGEKQRIDLALLFTWREVAKFKNSVATNLMILDEVFDSSLDATGT  531
            I+S   EDFSY+SFSEGEK RID+ALLFTWR++A   + V+ + +ILDEVFD S DA G 
Sbjct  457  IKSRGREDFSYASFSEGEKARIDIALLFTWRDIASIVSGVSISTLILDEVFDGSFDAEGI  516

Query  532  EEFLKIIRYVIKDANIFIISHKSGLEDKFEDHIRFEKHKGFSRII  666
            +    II   +K+ N+FIISHK     ++  H++ +K   F+ ++
Sbjct  517  KGVANIIN-SMKNTNVFIISHKDHDPQEYGQHLQMKKVGRFTVMV  560


>ref|YP_002854013.1|  gp46 recombination endonuclease subunit [Enterobacteria phage 
RB51]
 gb|ACP30976.1|  gp46 recombination endonuclease subunit [Enterobacteria phage 
RB51]
Length=562

 GENE ID: 7803566 46 | gp46 recombination endonuclease subunit
[Enterobacteria phage RB51]

 Score =  155 bits (391),  Expect = 6e-36
 Identities = 95/246 (38%), Positives = 135/246 (54%), Gaps = 29/246 (11%)
 Frame = +1

Query  4    THGISKNNTLISNCQ---RQQRDLESEIQTLTEQLENRN----TEHNKLEKFKSTLQETY  162
            TH   + +T   N +    + RD     Q+L   + N+     T  +K +K K+ +++  
Sbjct  313  THSFEQLSTHRDNLKVLVDEYRDNIKTQQSLANDIRNKKQSLITTVDKAKKVKAAIEKAS  372

Query  163  ESLATHNQTI--------------------KYYN-FTYELLKDGGVKTKIIKKYLPLINQ  279
                 H   I                    KY+     ++LKD G+K  IIKKY+PL N+
Sbjct  373  SEFIDHADEIALLQEELDKIVKTKTNLVMEKYHRGILTDMLKDSGIKGAIIKKYIPLFNK  432

Query  280  QVNRYLQMMDFYINFTLDEEFNETIESPIHEDFSYSSFSEGEKQRIDLALLFTWREVAKF  459
            Q+N YL++M+    FTLDEEFNETI+S   EDFSY+SFS+GEK RID+ALLFTWR++A+ 
Sbjct  433  QINHYLKIMEADYVFTLDEEFNETIKSRGREDFSYASFSQGEKARIDIALLFTWRDIAEK  492

Query  460  KNSVATNLMILDEVFDSSLDATGTEEFLKIIRYVIKDANIFIISHKSGLEDKFEDHIRFE  639
             + V  + + LDEV+D + DA G +   KI+   +KD N FIISHK      +  HI+ E
Sbjct  493  VSGVKISCLFLDEVYDGAFDAEGIKNVAKILD-GLKDTNFFIISHKDHDPQDYGQHIKME  551

Query  640  KHKGFS  657
            K   FS
Sbjct  552  KVGRFS  557


>ref|NP_899322.1|  recombination endonuclease subunit [Vibrio phage KVP40]
 gb|AAQ64145.1|  recombination endonuclease subunit [Bacteriophage KVP40]
Length=745

 GENE ID: 2545832 46 | recombination endonuclease subunit [Vibrio phage KVP40]
(10 or fewer PubMed links)

 Score =  155 bits (391),  Expect = 6e-36
 Identities = 89/227 (39%), Positives = 137/227 (60%), Gaps = 9/227 (3%)
 Frame = +1

Query  1    LTHGISKNNTLISNCQRQQRDLESEIQTLTEQLENRNTEH------NKLEKFKSTLQETY  162
            LT  I K    ++     +++L S+I T+   + +   +       + ++K  + +++  
Sbjct  518  LTENIGKYQADLAKILADEKNLTSKIATVESDIADVKAKAATEDRTDLIKKLTAEVRDVK  577

Query  163  ESLATHNQTIKYYNFTYELLKDGGVKTKIIKKYLPLINQQVNRYLQMMDFYINFTLDEEF  342
            + L T  QT         LLKD GVK+ I+++Y+P+IN+ +N YL+ M+   NF LDEEF
Sbjct  578  KGLQTDMQTKHCRTIVGTLLKDDGVKSMIVRQYIPMINKYINDYLKTMNANYNFVLDEEF  637

Query  343  NETIESPIHEDFSYSSFSEGEKQRIDLALLFTWREVAKFKNSVATNLMILDEVFDSSLDA  522
            NETI+S   +DFSY+SFS+GE+ RIDLALLF +R++   +    TNL++LDEVFDS+ D+
Sbjct  638  NETIKSRGRDDFSYTSFSQGERCRIDLALLFAFRDLVSARTGSMTNLLVLDEVFDSAADS  697

Query  523  TGTEEFLKIIRYVIKDANIFIISHKSGLEDK-FEDHIRFEKHKGFSR  660
             G +   +I+   IKD N+FIISH    E   F+ HI+F K   F+R
Sbjct  698  DGVDSINQILS-SIKD-NVFIISHSEKHEQSMFDKHIKFAKKGNFTR  742


>ref|YP_002854390.1|  gp46 recombination endonuclease subunit [Enterobacteria phage 
RB14]
 gb|ACP30698.1|  gp46 recombination endonuclease subunit [Enterobacteria phage 
RB14]
Length=560

 GENE ID: 7803773 46 | gp46 recombination endonuclease subunit
[Enterobacteria phage RB14]

 Score =  151 bits (382),  Expect = 6e-35
 Identities = 91/249 (36%), Positives = 138/249 (55%), Gaps = 29/249 (11%)
 Frame = +1

Query  4    THGISKNNTLISNCQ---RQQRDLESEIQTLTEQLENRN----TEHNKLEKFKSTLQETY  162
            TH   + +T   N +    + RD     Q+L   + N+     T  +K +K K+ +++  
Sbjct  313  THSFEQLSTHRDNLKVLVDEYRDNIKTQQSLANDIRNKKQSLITTVDKAKKVKAAIEKAS  372

Query  163  ESLATHNQTI--------------------KYYN-FTYELLKDGGVKTKIIKKYLPLINQ  279
                 H   I                    KY+     ++LKD G+K  IIKKY+PL N+
Sbjct  373  SEFIDHADEIALLQEELDKIVKTKTNLVMEKYHRGILTDMLKDSGIKGAIIKKYIPLFNK  432

Query  280  QVNRYLQMMDFYINFTLDEEFNETIESPIHEDFSYSSFSEGEKQRIDLALLFTWREVAKF  459
            Q+N YL++M+    FTLDEEFNETI+S   EDFSY+SFS+GEK RID+ALLFTWR++A+ 
Sbjct  433  QINHYLKIMEADYVFTLDEEFNETIKSRGREDFSYASFSQGEKARIDIALLFTWRDIAEK  492

Query  460  KNSVATNLMILDEVFDSSLDATGTEEFLKIIRYVIKDANIFIISHKSGLEDKFEDHIRFE  639
             + V  N +ILDEVFDS+ D  G +    I+   +K+ N+F+ISH+      +  H++ +
Sbjct  493  VSGVKINTLILDEVFDSATDVEGVKAISTILD-SLKNTNVFVISHRDHDPQAYGQHLQMK  551

Query  640  KHKGFSRII  666
            K   F+ ++
Sbjct  552  KVGRFTVMV  560


>ref|YP_001595183.1|  gp46 recombination endonuclease subunit [Enterobacteria phage 
JS98]
 gb|AAU29245.1|  gp46 recombination endonuclease subunit [Enterobacteria phage 
JS98]
Length=560

 GENE ID: 5783834 46 | endonuclease subunit [Enterobacteria phage JS98]
(10 or fewer PubMed links)

 Score =  150 bits (380),  Expect = 1e-34
 Identities = 74/143 (51%), Positives = 103/143 (72%), Gaps = 1/143 (0%)
 Frame = +1

Query  214  ELLKDGGVKTKIIKKYLPLINQQVNRYLQMMDFYINFTLDEEFNETIESPIHEDFSYSSF  393
            E+LKD G+K  IIKKY+P+ N+Q+N YL++M+    FTLDEEFNETI+S   EDFSY+SF
Sbjct  411  EMLKDTGIKGSIIKKYIPIFNKQINSYLKIMEADYVFTLDEEFNETIKSRGREDFSYASF  470

Query  394  SEGEKQRIDLALLFTWREVAKFKNSVATNLMILDEVFDSSLDATGTEEFLKIIRYVIKDA  573
            S+GEK RID+ALLFTWR++A   + V  + +ILDEVFDS+ DA G +    I+   ++D 
Sbjct  471  SQGEKARIDIALLFTWRDIASRVSGVNISTLILDEVFDSATDAEGVKSIATILN-SLEDT  529

Query  574  NIFIISHKSGLEDKFEDHIRFEK  642
            N+FIISH+      +  H++ +K
Sbjct  530  NVFIISHRDHDPQAYGQHLQMKK  552


>ref|NP_891605.1|  recombination endonuclease subunit [Enterobacteria phage RB49]
 gb|AAL87829.2|AF410869_1  recombination endonuclease subunit [Enterobacteria phage RB49]
Length=560

 GENE ID: 1725534 46 | Gp46 [Enterobacteria phage RB49]
(10 or fewer PubMed links)

 Score =  143 bits (361),  Expect = 2e-32
 Identities = 81/203 (39%), Positives = 118/203 (58%), Gaps = 7/203 (3%)
 Frame = +1

Query  58   RDLESEIQTLTEQLENRNTEHNKLEKFKSTLQETYESLATHNQTIKYYN-FTYELLKDGG  234
            + ++  IQ L ++  + + E  KLE     +      L       KY+  F  E+LKD G
Sbjct  360  KQIQKAIQELQKERVDNSEELAKLEHELVEITNEKSKLVLE----KYHRGFVTEMLKDSG  415

Query  235  VKTKIIKKYLPLINQQVNRYLQMMDFYINFTLDEEFNETIESPIHEDFSYSSFSEGEKQR  414
            VK  I+KKY+P  N ++  YL +M+    FTLDEEFNETI+S   E FSY+SFS+GEK R
Sbjct  416  VKASIVKKYIPYFNDRIAYYLDIMEADYIFTLDEEFNETIKSRGRESFSYTSFSQGEKAR  475

Query  415  IDLALLFTWREVAKFKNSVATNLMILDEVFDSSLDATGTEEFLKIIRYVIKDANIFIISH  594
            IDLA+LFTWR+VA   +    +L++LDE++D + D  G +    II  +  D N++IISH
Sbjct  476  IDLAMLFTWRDVAGKVSGTNISLLVLDEIYDGATDVQGVKALDSIIDKL--DDNVYIISH  533

Query  595  KSGLEDKFEDHIRFEKHKGFSRI  663
            +    D F  H++  K   F+ +
Sbjct  534  RDHNPDDFSRHLKMVKRGRFTEM  556


>ref|NP_861753.1|  endonuclease subunit [Enterobacteria phage RB69]
 sp|O64299.2|EXO2_BPR69  RecName: Full=Exonuclease subunit 2; AltName: Full=Protein Gp46
 gb|AAP75965.1|  gp46 recombination endonuclease subunit [Enterobacteria phage 
RB69]
Length=562

 GENE ID: 1494179 46 | gp46 subunit required for recombination and host-DNA
degradation [Enterobacteria phage RB69] (10 or fewer PubMed links)

 Score =  143 bits (361),  Expect = 2e-32
 Identities = 81/219 (36%), Positives = 128/219 (58%), Gaps = 25/219 (11%)
 Frame = +1

Query  49   RQQRDLESEIQTLTEQLENRNTEHNKLEKFKSTLQETYESLATHNQTI------------  192
            + ++DL S+I+T  + +       +K +K K+ +++       H   I            
Sbjct  338  KTKQDLASDIRTKKQAMI---ATIDKAKKVKAAIEQASAEFIDHADEIALLQKELDKIIK  394

Query  193  --------KYYN-FTYELLKDGGVKTKIIKKYLPLINQQVNRYLQMMDFYINFTLDEEFN  345
                    KY+     ++LKD G+K  IIKKY+PL N+Q+N YL++M+    F++DEEFN
Sbjct  395  TKSDIVLEKYHRGIITDMLKDSGIKGAIIKKYVPLFNKQINHYLKIMEADYVFSIDEEFN  454

Query  346  ETIESPIHEDFSYSSFSEGEKQRIDLALLFTWREVAKFKNSVATNLMILDEVFDSSLDAT  525
            E+I+S   E+FSY+SFS+GEK RID+ALLFTWR++A+  + V  N +I+DEV DS+ D+ 
Sbjct  455  ESIKSRGREEFSYASFSQGEKARIDIALLFTWRDIAEKVSGVRINTLIMDEVMDSATDSE  514

Query  526  GTEEFLKIIRYVIKDANIFIISHKSGLEDKFEDHIRFEK  642
            G +    I+   + DAN+FIISH+      +  H++  K
Sbjct  515  GIKAISTILN-SLTDANVFIISHRDHDPQAYGQHLQMSK  552