GOS 981020

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091140850049
Annotathon code: GOS_981020
Sample :
  • GPS :1°12'58s; 90°25'22w
  • Galapagos Islands: Devil's Crown, Floreana Island - Ecuador
  • Coastal (-2.2m, 25.5°C, 0.1-0.8 microns)
Authors
Team : BSB06CIIT
Username : Faryal
Annotated on : 2009-05-27 18:42:32
  • Azariah Suleman Charles
  • Bashir Maria
  • Tahir Faryal

Synopsis

  • Taxonomy: Drosophila melanogaster (NCBI info)
    Rank: species - Genetic Code: Standard - NCBI Identifier: 7227
    Kingdom: Eukaryota - Phylum: Arthropoda - Class: Insecta - Order: Diptera
    Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila;

Genomic Sequence

>JCVI_READ_1091140850049 GOS_981020 Genomic DNA
CTTGCACGCAACTTTCAGGAAATTGAGCTGTCCAAGGAACAACTGGAAAAAACCGTGATTTCCTTGAAAAAAGCGAAGGAACAAGAAAGAAGGCTGGTTG
AACTGGGATATGCTGTTGCAGAATTCGGTCATGATATTGGGAATGCCAATGGATCAATCCTCAGTTTTTCCACCCTTGTTTTGAAGATGCTTGAAAAGGA
TGTCATTCATCCGATGGATTTAGTCCGCTCGTTGACTTTCATCCGCCGCATCAAACAGTCTTCCGTCAATATTTCAGGACTAACCGGAGACATCGTCGAA
TTTGCCAAAGGCAAAATGGAACTTCATCCTGAACAGTTAAACCTTGAGGATTTCAAGGAACAACTTGATGCCCAACTTGGTTTTATCGGAGAACTCAGAC
TGGAGTATGTGATCGACCCCAAGGATCAGATGCTACCGATTAAAATCGACTGCAGAAAAATTTGCAGGGTGATTGTTAATCTAGTTAAAAATTCGTGGGA
AAAACTCCAGGATGATGAAGATGACGGCTTGATTCAGGTCCGTATGTCAACACTCCACAATAATGACTTCCAGGTTCAGGTTTACGACAATGGTTCTCCG
ATCCCGGATAAGATTGAAAAGAATTTATTTGAGGCGTTCAGAACGGAAGGGAAACAACAAGGAACGGGACTCGGATTGGCCATCTGCAAAAAACTGATTG
ACCTACATAGGGGATTGATCCGAGGGAGAAACTTAAAAAATGGAACTGGTGTTATTTTTGAGATCCTCCTCCCGGATTGTGTTCTGCCATCCCAGACAGC
ACATACAACCCAGGAGACACAATCCGGAAATCAACCAGCTTCCAAATCCGCCGGATCACTGACGAACCTTGCTCCGGTTC

Translation

[187 - 879/880]   direct strand
>GOS_981020 Translation [187-879   direct strand]
MLEKDVIHPMDLVRSLTFIRRIKQSSVNISGLTGDIVEFAKGKMELHPEQLNLEDFKEQLDAQLGFIGELRLEYVIDPKDQMLPIKIDCRKICRVIVNLV
KNSWEKLQDDEDDGLIQVRMSTLHNNDFQVQVYDNGSPIPDKIEKNLFEAFRTEGKQQGTGLGLAICKKLIDLHRGLIRGRNLKNGTGVIFEILLPDCVL
PSQTAHTTQETQSGNQPASKSAGSLTNLAPV

[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

The MSA results are poor even if I used the ORF , using the BLAST X shows that no signifiant Results Founds as I earlier mentioned in my Anaylsis of BLAST so the homology and identities cant be checked from the DNA sequence used in BLASTx


Query sequence show 34% identity with Thiolase which belong to the thiolase family. shows the sequence similarity. This protein is commonly present in many microorganisms. The Protein existence is evidence at transcript level & it is mainly involve in metabolic process and steroids. They play an important role in oxidation reduction.

The moleclar function is of acetyl-CoA C-acyltransferase activity & long-chain-3-hydroxyacyl-CoA dehydrogenase activity.

In technical terms it is a Complete proteome & belong to Organism Drosophila melanogaster (Fruit fly)



ORF finding

PROTOCOL


a)SMS ORFinder / Forward strand / frames 1, 2 & 3 / min 60 AA / "ATG"initiation / 'universal' genetic code

b)SMS ORFinder / reverse strand / frames 1, 2 & 3 / min 60 AA / 'ATG' initiation / 'universal' genetic code



RESULTS ANALYSIS



a) I had ORF on my first reading frame only taking forward strand which show 34% identity with the Thiolase enzyme. And i will continue working on this because this ORF because it is the longest orf. IT has 231 aa sequence & it doesnt contain any Stop codon at the end hence satisfying the conditions of ORF being minimum length of 60 AA b) No ORF found on the Reverse strand

RAW RESULTS

--------------------------------------------------------------------------------------------------------------------

ORF Finder results

(a) Results for 880 residue sequence "GOS_981020 Genomic DNA (Galapagos Islands: Devil's Crown, Floreana Island)" starting "CTTGCACGCA"
>ORF number 1 in reading frame 1 on the direct strand extends from base 187 to base 879.
ATGCTTGAAAAGGATGTCATTCATCCGATGGATTTAGTCCGCTCGTTGACTTTCATCCGC
CGCATCAAACAGTCTTCCGTCAATATTTCAGGACTAACCGGAGACATCGTCGAATTTGCC
AAAGGCAAAATGGAACTTCATCCTGAACAGTTAAACCTTGAGGATTTCAAGGAACAACTT
GATGCCCAACTTGGTTTTATCGGAGAACTCAGACTGGAGTATGTGATCGACCCCAAGGAT
CAGATGCTACCGATTAAAATCGACTGCAGAAAAATTTGCAGGGTGATTGTTAATCTAGTT
AAAAATTCGTGGGAAAAACTCCAGGATGATGAAGATGACGGCTTGATTCAGGTCCGTATG
TCAACACTCCACAATAATGACTTCCAGGTTCAGGTTTACGACAATGGTTCTCCGATCCCG
GATAAGATTGAAAAGAATTTATTTGAGGCGTTCAGAACGGAAGGGAAACAACAAGGAACG
GGACTCGGATTGGCCATCTGCAAAAAACTGATTGACCTACATAGGGGATTGATCCGAGGG
AGAAACTTAAAAAATGGAACTGGTGTTATTTTTGAGATCCTCCTCCCGGATTGTGTTCTG
CCATCCCAGACAGCACATACAACCCAGGAGACACAATCCGGAAATCAACCAGCTTCCAAA
TCCGCCGGATCACTGACGAACCTTGCTCCGGTT

>Translation of ORF number 1 in reading frame 1 on the direct strand.
MLEKDVIHPMDLVRSLTFIRRIKQSSVNISGLTGDIVEFAKGKMELHPEQLNLEDFKEQL
DAQLGFIGELRLEYVIDPKDQMLPIKIDCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRM
STLHNNDFQVQVYDNGSPIPDKIEKNLFEAFRTEGKQQGTGLGLAICKKLIDLHRGLIRG
RNLKNGTGVIFEILLPDCVLPSQTAHTTQETQSGNQPASKSAGSLTNLAPV

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.


-----------------------------------------------------------------------------------------------------------------------

(b)
ORF Finder results
Results for 880 residue sequence "GOS_981020 Genomic DNA (Galapagos Islands: Devil's Crown, Floreana Island)" starting "CTTGCACGCA"
No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOL

A)Multiple Alignment of sequences using Muscle Default parameters without curation (CLUSTALW format)

B)Multiple Alignment of sequences after curation (Gblock Result)


RESULTS ANALYSIS


I used this ORF


>ORF number 1 in reading frame 1 on the direct strand extends from base 187 to base 879.

ATGCTTGAAAAGGATGTCATTCATCCGATGGATTTAGTCCGCTCGTTGACTTTCATCCGC

CGCATCAAACAGTCTTCCGTCAATATTTCAGGACTAACCGGAGACATCGTCGAATTTGCC

AAAGGCAAAATGGAACTTCATCCTGAACAGTTAAACCTTGAGGATTTCAAGGAACAACTT

GATGCCCAACTTGGTTTTATCGGAGAACTCAGACTGGAGTATGTGATCGACCCCAAGGAT

CAGATGCTACCGATTAAAATCGACTGCAGAAAAATTTGCAGGGTGATTGTTAATCTAGTT

AAAAATTCGTGGGAAAAACTCCAGGATGATGAAGATGACGGCTTGATTCAGGTCCGTATG

TCAACACTCCACAATAATGACTTCCAGGTTCAGGTTTACGACAATGGTTCTCCGATCCCG

GATAAGATTGAAAAGAATTTATTTGAGGCGTTCAGAACGGAAGGGAAACAACAAGGAACG

GGACTCGGATTGGCCATCTGCAAAAAACTGATTGACCTACATAGGGGATTGATCCGAGGG

AGAAACTTAAAAAATGGAACTGGTGTTATTTTTGAGATCCTCCTCCCGGATTGTGTTCTG

CCATCCCAGACAGCACATACAACCCAGGAGACACAATCCGGAAATCAACCAGCTTCCAAA

TCCGCCGGATCACTGACGAACCTTGCTCCGGTT


>Translation of ORF number 1 in reading frame 1 on the direct strand.

MLEKDVIHPMDLVRSLTFIRRIKQSSVNISGLTGDIVEFAKGKMELHPEQLNLEDFKEQL

DAQLGFIGELRLEYVIDPKDQMLPIKIDCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRM

STLHNNDFQVQVYDNGSPIPDKIEKNLFEAFRTEGKQQGTGLGLAICKKLIDLHRGLIRG

RNLKNGTGVIFEILLPDCVLPSQTAHTTQETQSGNQPASKSAGSLTNLAPV


I align my query sequence and got good alignment in the start till middle. but later on the alignment wasnt good & showed number of gaps

The sequence starts from 187 and ends 879.

there are gaps starting from gi|2189616 & the Orf region



RAW RESULTS

CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


gi|1624572      ----MHGGCGGEGARRGGSARAPIPLGSTAPTLNTAADRGGRPAVPAAVRPGGRGRPAMS
gi|1486543      ---------------------------MLIWFFSVVPRAGAGLDDPWLTALLLAYPVG--
gi|1710567      ---------------------------------------MTSPLLPGLPRAVARLPLSI-
gi|2221002      -------------MMKDSTEVPEGVYSCKIGHFTIVAHDPSSALMVKLFRKLSTYRTLFS
gi|1702892      MVPERLKQIKGIRILESEDEIPQEGFTCRFGKHTVVANDEESFEIVRLYKRLTVYELLLS
gi|1564411      MVPERLKQIKGIRILESEDEIPQEGFTCRFGKHTVVANDEESFEIVRLYKRLTVYELLLS
gi|1624562      ------------MTAKAEQRTKALQARVQELEARLAHADKTVRALRDVGLALGSTLDL--
gi|2273950      ---------------------------MRELEAQLRNEHKKSALVREVWRAMSSGQEL--
gi|2189616      ------------------------------------------------------------
Translatio      ------------------------------------------------------------
gi|2095277      ------------------------------------------------------------
                                                                            

gi|1624572      LAA-------RLLLAFGLVAI----IATAFVGLTLREASREIIEGGFAERIDAAHAGVRQ
gi|1486543      ----------DLIVLFGVVHI-----------------------------------ALKS
gi|1710567      ----------RSKLSGVLLAIVGLLIAIGSVGLYELGEVNARTEDLVRLQRKVAAFRQIQ
gi|2221002      FFKLACRLSKEEFFRRSLRTVERLFCADEVFFIDTHTSFSSRGESLSLDEIKRKYPKIHI
gi|1702892      LVDSICVHPKEEALRFSLKKVREFLDAEEVYLIEGDASYSSKGEKLSIDEIKKKHPGASV
gi|1564411      LVDSICVHPKEEALRFSLKKVREFLDAEEVYLIEGDASYSSKGEKLSIDEIKKKHPGASV
gi|1624562      ----------DQLLALILNKITELLDADRATLY----LLDEQRQRLLSRIVIGEEARAIE
gi|2273950      ----------DQLLTLIMDKVTQLMEADRSTLY----VLSDDGETLWSKVLQGDEFSEIR
gi|2189616      ------------MIYYIIYKVNEV----------------RRCEENMQDTMQKTNIGI--
Translatio      ------------------------------------------------------------
gi|2095277      ----------MDLLSHQFISY---------------------------------------
                                                                            

gi|1624572      QLAWEADALRDLLPPLCRHDTFVDKAHVELERAKGDPDAMDPGSRIALGRLVPSQAKALR
gi|1486543      DNW--RSALPMHMFSLGLLAFLAGDLGYSSMMMSETYQEGMW------------------
gi|1710567      QDT------------MGQLHNVANVMLAPDERTLETTLRQLSQFGYDLDRLQFVSTDEAE
gi|2221002      REL--KNRLYLVVARERELDEEEDLFCRKFLELAESLNER-WHFKEDIHRMKEALKEHSR
gi|1702892      REW--RNKLHLVVVREGAFDEEEEVLCTKLLEFIGNVSEKLWRLKEEVQKLKKSYEEQLK
gi|1564411      REW--RNKLHLVVVREGAFDEEEEVLCTKLLEFIGNVSEKLWRLKEEVQKLKKSYEEQLK
gi|1624562      LPV--GAGIAGHVAKMGRTVRVKDAYRDRRFQRDWDEVTGYRTRSILAAPMKNHVGRTIG
gi|2273950      LKV--GEGIAGWAAASGELVNIPDAYSDERFQPAVDIKSGYRTRSILCAPMRNSKSEIVG
gi|2189616      --------------------------------FSGLSEEVVEELTKDLERIKF-------
Translatio      ------------------------------------------------------------
gi|2095277      --------------------------------------------------FEPEQADKLC
                                                                            

gi|1624572      LDELSL------------------------------------------------------
gi|1486543      ------------------------------------------------------------
gi|1710567      LYAR--------------------------------------------------------
gi|2221002      LVEIQKEHIKRMRIIYYVSQAMRSVYDPNNLYRVILLSLVSERAFNFDRAVLLKKNDATN
gi|1702892      VSEIQKEHIKKMRIIYYVSQAMRSVYDPNNLYRVILLSLVSERGFNFDRAVLLKKDEGTG
gi|1564411      VSEIQKEHIKKMRIIYYVSQAMRSVYDPNNLYRVILLSLVSERGFNFDRAVLLKKDEGTG
gi|1624562      VIQVLNKH----------------------------------------------------
gi|2273950      VLQVLNKQ----------------------------------------------------
gi|2189616      ------------------------------------------------------------
Translatio      ------------------------------------------------------------
gi|2095277      QLAIVEYY----------------------------------------------------
                                                                            

gi|1624572      -------VAGDGSVLGAEDGARIGTRDKRLAELIQAPG----------------------
gi|1486543      ------------------------------------------------------------
gi|1710567      -------VRHDYDAFIGEVGAVIA------------------------------------
gi|2221002      SLEVVSALGGETRQEHEELKRYLRRRTLRYTDLVQFLREEALTFSFETSFSERLKRRRFY
gi|1702892      SLMVVSAVGGDTLQEHEELKRYLRKRTLRYTDLVQFLREEALTFSFETKFNEKIRGKRFY
gi|1564411      SLMVVSAVGGDTLQEHEELKRYLRKRTLRYTDLVQFLREEALTFSFETKFNEKIRGKRFY
gi|1624562      -------GEGEFSVHDEELLSALATQAAVSID----------------------------
gi|2273950      -------AGGPFTVDDAELLTALASQAGLSVE----------------------------
gi|2189616      -------KKGESIITEHSLSDNLF------------------------------------
Translatio      ------------------------------------------------------------
gi|2095277      -------PEGSLIFEEGEVPDYLY------------------------------------
                                                                            

gi|1624572      --GAPRLRPAKAGGEPSLEVHCALSRHGVTIG-L--VGARRIGPV----LARIGEAYHVR
gi|1486543      ------------------------------------PSSLWIVAYTIFAVAAQLQLTSQA
gi|1710567      ----------LVRSGRLAEAREAQARRAVPLAER--LERMTNELV--------NRAEADM
gi|2221002      YRGHPIFERVVLRKSTVRVSRDILRKMGYEAEDV--LEALRSESFVVFPLLGRWDTLGAV
gi|1702892      YREHPIFERVVLRKSIVRTSRETLEKIRYEIEDV--ISILENDEFIVFPLVGRWDTLGVV
gi|1564411      YREHPIFERVVLRKSIVRTSRETLEKIRYEIEDV--ISILENDEFIVFPLVGRWDTLGVV
gi|1624562      --NSRLFLSVIQKNTQLVETKEQLEHRVSDLKLLFDLESAMGRATTMEDLARAVITEAGR
gi|2273950      --NSKLYHSVVAKNAELMKARDQLEQRSHELNVLYEIEKLMNADLGLGQLLENVLAEAMQ
gi|2189616      ----------FISKGKVEIDKD-LSNPDIPFTQ---LSTLEAGDF--------FGEMGII
Translatio      ------------------------------------------------------------
gi|2095277      ----------LVLTGEVEFSKSTGGDRY----QV--VTVARPNSF--------FGEFGVL
                                                                            

gi|1624572      LTAAREGELAPRSSEAE---VVRVLHFAEIPGLDVVASVPRDPLRQALARLDRAIALT--
gi|1486543      APARQSATDGATTASLN---LLPY--LGIVVGFGLLLAVT--------------------
gi|1710567      LAQVDAGAAGYARSRAL---VLSI--AAGSVVLALLLGYA--------------------
gi|2221002      VVDNKFSERPITDLDLD---VLKL--FSESAGLALENAINYEDLKRKTLDLQRQNELVEK
gi|1702892      VVDNKFSKKEVTDLDLD---VLKL--FSESAGLALENAYNYESLREKTLDLQRQNELVEH
gi|1564411      VVDNKFSKKEVTDLDLD---VLKL--FSESAGLALENAYNYENLRKKTLDLQRQNELVEH
gi|1624562      ACEARAGGMLVDEIEGG---LFLY--FFDLTAFDGGSAPP------------RAPALGEE
gi|2273950      TVGAKAGTIALRDTEAENSNVLEFLTFAGPVATELEHR----------------------
gi|2189616      EDSTRSASVVATE-------DVELMVIPREAFSDMLFAYP--------------------
Translatio      ------------------------------------------------------------
gi|2095277      DGQPRSARAIATLGGAT---LAKI------------------------------------
                                                                            

gi|1624572      --GATVLAIAVAMAVVLARSLSRPLVALARETREVM-----SGAPRRVEGRGGREIADLA
gi|1486543      ------------------------IQNWTRPLGDLI------------------------
gi|1710567      ----------------LSWSLVEPVREMDARLAEIA------------AGQFERRI-DIP
gi|2221002      LKNFSESILESLEAAIITLDRDGRITEWNKKSEVLF-----GYR---KEQVLGKRLKNLP
gi|1702892      LRNFSESILESLETAIITLSKEGRVTEWNKKAEQLF-----GLK---KENVLGRRLKDLP
gi|1564411      LRNFSESILESLETAIITLSKDGRITEWNKKAEQLF-----GLK---KENVLGRRLKDLP
gi|1624562      PEGVVVGAAPRPAVKRIAMRRGEGVVGRAMVNNEAVCFSREGGSRDPDDTLVSPRLAQLV
gi|2273950      -----------------TLPMGEGVLGWSVAHDQPV-----IVNDPRADERHASAFAEEL
gi|2189616      ---------------IIMLNLTKVISSRLRNTNERF------------------------
Translatio      ------------------------------------------------------------
gi|2095277      -------------------SRDNLITILQDAKGQVV------------------------
                                                                            

gi|1624572      AAFNATIDELAAMRKRLA------------------------------------------
gi|1486543      ----IGALALTVIVMVRQ-----------------------------------VVAMREN
gi|1710567      NRDELGALAADLNRMSAE-----------------------------------------L
gi|2221002      GFEEIGAIAESVMEEHEP-VFLNFYKFQEKYFNVRFSPLRNTKTQLLEGVIITIDDVTEL
gi|1702892      DFEEIGSVAESVFENKEP-VFLNFYKFGENYFNIRFSPFRNAKTQLLEGVIITIDDVTEL
gi|1564411      DFEEIGSVAESVFENKEP-VFLNFYKFGERYFNIRFSPFRNAKTQLLEGVIITIDDVTEL
gi|1624562      GAELRTAIAVPLEGEDAV-----PIGSMALYNSRNPHGFSKDDRALLRLVSANASTALRL
gi|2273950      GFMPAHLVCAPLRSGDEVLGGIELIDKVSRDSDADAAGFSEEDLKLVVLIAGQAAKAISL
gi|2189616      ------------------------------------------------------------
Translatio      ------------------------------------------------------------
gi|2095277      -LKLFGYITQQLRNTTNE------------------------------------------
                                                                            

gi|1624572      --------ATERIA-ARREVARQIAHEIKNPLAPIRAAVETLRR-LRQRDDPAFDDYFAE
gi|1486543      VRLATERAAAEHASQIKSEFLANMSHELRTPLNSIINFTRIISTGARGPVTPEQIDY---
gi|1710567      GRLVREVEAANR---NKSAFLANMSHELRTPLNAIIGFSEVLIEQMFGEVNAKQLEY---
gi|2221002      YRYEEERKKKERLS-ILGEMTARVAHEIRNPITIIGGFVKRMRKHIDDPETLK--KY---
gi|1702892      YKYEEERKRRERLS-ILGEMTARVAHEIRNPITIIGGFIMRMKKHLDDPETLK--KY---
gi|1564411      YKYEEERKRRERLS-ILGEMTARVAHEIRNPITIIGGFIMRMKKHLDDPETLK--KY---
gi|1624562      FRSRLEREQSERLT-TIGRLLSGVMHDMRTPLTVISGYVQLMAG-APDAATRE--DH---
gi|2273950      ARSRSARSKQERLA-SIGRMLASVLHDLKTPMTIISGYAQLMAQ-IDDADQRE--AY---
gi|2189616      VELMDEMLKKNRLM-AIGLAASKIIHDIKTPLTVIVLTAQLLENIFPESA-----EF---
Translatio      ----------------------MLEKDVIHPMDLVRSL-----------------TF---
gi|2095277      --YVNQMVHKQKME-LLGEMVNTIVHDFRSPFTGIQLSSSMIRELHPDEETE---EW---
                                       : ::.  *:  :                         

gi|1624572      ATSTVLNEVHRIANIVTEFTQFAR-----LPPPNLTPIDLVAVARGVVTLHAAPASGEAT
gi|1486543      -LNRVRQSGEHLLGLINDILDLSKIEAGRME-LFRESFQIGDLIQSVLATASGLVKE---
gi|1710567      -LRDIHASGHHLLTLINDVLDLSKIEAGRME-LQPSRFHLPELLDNSLTLVRERAAN---
gi|2221002      -VDIITGELSRLEGIVREILEYSK---EEQI-LEFSEFNLNELIKEVYVLFEEKLRE---
gi|1702892      -INIITNELSRLETIVKEILEYSK---ERQV-LEFTEFNLNELIREVYVLFEEKIRK---
gi|1564411      -INIITNELSRLETIVKEILEYSK---ERQV-LEFTEFNLNELIREVYVLFEEKIRK---
gi|1624562      -ARLILKQFDVISAMQREVLEFAR---GERS-ILVRKVYLTKFFGDIEKQLEHELAG---
gi|2273950      -VEQILRQFDLMKGMTQEVLLFAR---GESE-LLVRRIFVNKFMDELLTQLNHALAG---
gi|2189616      -TDNIVKQTKLIDQLVHEILDFAR---GTESPPLIQKVNLDSFLREVSELYSASFKE---
Translatio      -IRRIKQSSVNISGLTGDIVEFAK---GKME-LHPEQLNLEDFKEQLDAQL-GFIGE---
gi|2095277      -CDLISMQIQRMLGMAEEVLEFSR---GSTS-LLLKPVAIEEIIQQFEKLNRVYLHS---
                    :  .   :  :  :.   :.             . :  .                 

gi|1624572      SGARLSSGAGATSGTGAPSPRVELVADPIPEVSADRDQLIQVLTNLVQNGLDAASAI-RR
gi|1486543      KPIELRSE----------------IAPHLPPVYADRTRVRQVLLNLLSNAAKFTDA--GT
gi|1710567      HGLRLTLD----------------VQDGLGDWVADPRKIKQVVVNLLSNAVKFTPAG-GH
gi|2221002      MNIDFFFETD--------------NEDLRV--KADRSRIKQVLINLVQNAIEATGEN-GK
gi|1702892      MNIDFCFETD--------------NEDLRV--EADRTRIKQVLINLVQNAIEATGEN-GK
gi|1564411      MNIDFCFETD--------------NEDLRV--EADRTRIKQVLINLVQNAIEATGEN-GK
gi|1624562      TGVSLSLE-----------------LEDRGTARFDEAKMTRLLHNLVRNAVEAMRPGGGT
gi|2273950      RNIKLTID-----------------PEYRDTAHFDEQKILRVMHNLARNAADAMPEG-GS
gi|2189616      RKIIFVVE-----------------NKVNDCVYFDEGKIRRVLINLIKNALEAIPEA-GE
Translatio      LRLEYVID----------------PKDQMLPIKIDCRKICRVIVNLVKNSWEKLQDD-ED
gi|2095277      SDVELVID----------------IPDGIY-VLADLNKIIRVLQNLVSNAVEAFPNSQGK
                                                  *  .: .:: **  *. .        

gi|1624572      DPRVSVTIGPLPNDRVRIVVRDNGPGVADDMVPRLFEPYATS------KEKGTGLGLAIA
gi|1486543      ITVH----AEGCNGEIVIHVSDTGIGIAPEHLEKIFEAFRQLDNASNRRYEGTGLGLAIC
gi|1710567      VTLRA---RRIDAGTAEIAVIDTGVGIAPEEQAQVFEEFRQAGTDPLRKSEGTGLGLALA
gi|2221002      IKIK----SEDVYNVARVSVWNSGPPIPEELKEKIFSPFFTT------KTQGTGLGLPIC
gi|1702892      IKIT----SEDMYTKVRVSVWNSGPPIPEELKEKIFSPFFTT------KTQGTGLGLSIC
gi|1564411      IKIT----SEDMYTKVRVSVWNSGPPIPEELKEKIFSPFFTT------KTQGTGLGLSIC
gi|1624562      VTIR----AYRDGGDLAICVADTGKGIPKEIQGRLFQSFVTSG-----KRGGTGLGLAIV
gi|2273950      LAIR----TKTKDGSLVFEVEDSGGGIPPELDGRLFDLFSSG------KQGGTGLGLAIV
gi|2189616      IKII----SSVSSGWLQISVIDNGPGVSRKVKEELFQPFVTDG-----KTQGTGLGLAIC
Translatio      DGLIQVRMSTLHNNDFQVQVYDNGSPIPDKIEKNLFEAFRTEG-----KQQGTGLGLAIC
gi|2095277      IIIT----ATTQDNWGVIMVKDNGTGIPKAIQEHLFDAFVTYG-----KQGGTGLGTAIA
                                 . * :.*  :.      :*. :         .  ***** .: 

gi|1624572      QRIV-FEHGGEITYRK-AKKGGAVFEIWLP-IAGPPLLEKPLGDTTVRPRPPDAPRS---
gi|1486543      RRLV-DLHGGRLWVES-AVGVGSTFSFSLPLTAATQSASSPESSQTYEPSGAIPIIVIDD
gi|1710567      RRFV-ELHGGTLRVDS-APGRGSTFAFTLP-----DRTLEPT------------------
gi|2221002      RKIVEDEHGGKIWVEN--TEGGVMFIFEIP--------KTPGKEVRE-------------
gi|1702892      RKIIEDEHGGKIWTEN--RENGVVFIFEIP--------KTPEKR----------------
gi|1564411      RKIIEDEHGGKIWTEN--RENGVVFIFEIP--------KTPEKR----------------
gi|1624562      KKIV-DEHAGTITVAS--SDKGAKFTIRLPQESAPSRSPGTAGGQPQLVSRDGSPATKAG
gi|2273950      KKII-EEHGGDITYRS-VQGQGTCFTIRLPMVRQESPPDFP-------------------
gi|2189616      KKLV-QEHYGRLEYIP-VEPHGSRFDIRIP--------QSTK------------------
Translatio      KKLI-DLHRGLIRGRNLKNGTGVIFEILLP-DCVLPSQTAHTTQETQSGNQPASKSAGSL
gi|2095277      KSIV-EAHGGAIRFES-TAGAGTTFWIRLPLNSGDPNMQSPTLKQVNIG-----------
                . ::   * * :         *  * : :*                              

gi|1624572      ------------------------------------------------------------
gi|1486543      DPAAIEIVRTYLSCDGYSVVAVTDSRHAIAEVRRIKPAAIILDVLMPHRDGWEILADLKA
gi|1710567      ------------------------------------------------------------
gi|2221002      ------------------------------------------------------------
gi|1702892      ------------------------------------------------------------
gi|1564411      ------------------------------------------------------------
gi|1624562      ASVAPVVHEGIPRRRPAGSAPSVTPANERGRRSSSNGSGA--------------------
gi|2273950      ------------------------------------------------------------
gi|2189616      ------------------------------------------------------------
Translatio      TNLAPV------------------------------------------------------
gi|2095277      ------------------------------------------------------------
                                                                            

gi|1624572      ------------------------------------------------------------
gi|1486543      DSELQAIPVALYTIVEQQRLGFHLGASAYLIKPIDEMQLRATVAHLVQKNASIVVIDDDR
gi|1710567      ------------------------------------------------------------
gi|2221002      ------------------------------------------------------------
gi|1702892      ------------------------------------------------------------
gi|1564411      ------------------------------------------------------------
gi|1624562      ------------------------------------------------------------
gi|2273950      ------------------------------------------------------------
gi|2189616      ------------------------------------------------------------
Translatio      ------------------------------------------------------------
gi|2095277      ------------------------------------------------------------
                                                                            

gi|1624572      ------------------------------------------------------------
gi|1486543      NQLEIIATCLNRAGAYQVHTANSGAQGWAEIVRRRPDLIILDLMMPEIDGFTILKRLETD
gi|1710567      ------------------------------------------------------------
gi|2221002      ------------------------------------------------------------
gi|1702892      ------------------------------------------------------------
gi|1564411      ------------------------------------------------------------
gi|1624562      ------------------------------------------------------------
gi|2273950      ------------------------------------------------------------
gi|2189616      ------------------------------------------------------------
Translatio      ------------------------------------------------------------
gi|2095277      ------------------------------------------------------------
                                                                            

gi|1624572      ------------------------------------------------------------
gi|1486543      PHTRHIPVVVLSAKDLTIQERAYLAQRVKALLAKGDTSPEHLLNRVMELLNARNAMDVSA
gi|1710567      ------------------------------------------------------------
gi|2221002      ------------------------------------------------------------
gi|1702892      ------------------------------------------------------------
gi|1564411      ------------------------------------------------------------
gi|1624562      ------------------------------------------------------------
gi|2273950      ------------------------------------------------------------
gi|2189616      ------------------------------------------------------------
Translatio      ------------------------------------------------------------
gi|2095277      ------------------------------------------------------------
                                                                            

gi|1624572      -
gi|1486543      N
gi|1710567      -
gi|2221002      -
gi|1702892      -
gi|1564411      -
gi|1624562      -
gi|2273950      -
gi|2189616      -
Translatio      -
gi|2095277      -
                 

-----------------------------------------------------------------------------------------------------------------------


Gblocks 0.91b Results
Processed file: input.fasta
Number of sequences: 11
Alignment assumed to be: Protein
New number of positions: 67 (selected positions are underlined in blue) 

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
gi|162457275|re  ----MHGGCGGEGARRGGSARAPIPLGSTAPTLNTAADRGGRPAVPAAVRPGGRGRPAMS
gi|148654385|re  ---------------------------MLIWFFSVVPRAGAGLDDPWLTALLLAYPVG--
gi|171056738|re  ---------------------------------------MTSPLLPGLPRAVARLPLSI-
gi|222100206|re  -------------MMKDSTEVPEGVYSCKIGHFTIVAHDPSSALMVKLFRKLSTYRTLFS
gi|170289259|re  MVPERLKQIKGIRILESEDEIPQEGFTCRFGKHTVVANDEESFEIVRLYKRLTVYELLLS
gi|15644111|ref  MVPERLKQIKGIRILESEDEIPQEGFTCRFGKHTVVANDEESFEIVRLYKRLTVYELLLS
gi|162456214|re  ------------MTAKAEQRTKALQARVQELEARLAHADKTVRALRDVGLALGSTLDL--
gi|227395000|re  ---------------------------MRELEAQLRNEHKKSALVREVWRAMSSGQEL--
gi|218961695|re  ------------------------------------------------------------
Translation_of   ------------------------------------------------------------
gi|209527708|re  ------------------------------------------------------------
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
gi|162457275|re  LAA-------RLLLAFGLVAI----IATAFVGLTLREASREIIEGGFAERIDAAHAGVRQ
gi|148654385|re  ----------DLIVLFGVVHI-----------------------------------ALKS
gi|171056738|re  ----------RSKLSGVLLAIVGLLIAIGSVGLYELGEVNARTEDLVRLQRKVAAFRQIQ
gi|222100206|re  FFKLACRLSKEEFFRRSLRTVERLFCADEVFFIDTHTSFSSRGESLSLDEIKRKYPKIHI
gi|170289259|re  LVDSICVHPKEEALRFSLKKVREFLDAEEVYLIEGDASYSSKGEKLSIDEIKKKHPGASV
gi|15644111|ref  LVDSICVHPKEEALRFSLKKVREFLDAEEVYLIEGDASYSSKGEKLSIDEIKKKHPGASV
gi|162456214|re  ----------DQLLALILNKITELLDADRATLY----LLDEQRQRLLSRIVIGEEARAIE
gi|227395000|re  ----------DQLLTLIMDKVTQLMEADRSTLY----VLSDDGETLWSKVLQGDEFSEIR
gi|218961695|re  ------------MIYYIIYKVNEV----------------RRCEENMQDTMQKTNIGI--
Translation_of   ------------------------------------------------------------
gi|209527708|re  ----------MDLLSHQFISY---------------------------------------
                                                                             


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
gi|162457275|re  QLAWEADALRDLLPPLCRHDTFVDKAHVELERAKGDPDAMDPGSRIALGRLVPSQAKALR
gi|148654385|re  DNW--RSALPMHMFSLGLLAFLAGDLGYSSMMMSETYQEGMW------------------
gi|171056738|re  QDT------------MGQLHNVANVMLAPDERTLETTLRQLSQFGYDLDRLQFVSTDEAE
gi|222100206|re  REL--KNRLYLVVARERELDEEEDLFCRKFLELAESLNER-WHFKEDIHRMKEALKEHSR
gi|170289259|re  REW--RNKLHLVVVREGAFDEEEEVLCTKLLEFIGNVSEKLWRLKEEVQKLKKSYEEQLK
gi|15644111|ref  REW--RNKLHLVVVREGAFDEEEEVLCTKLLEFIGNVSEKLWRLKEEVQKLKKSYEEQLK
gi|162456214|re  LPV--GAGIAGHVAKMGRTVRVKDAYRDRRFQRDWDEVTGYRTRSILAAPMKNHVGRTIG
gi|227395000|re  LKV--GEGIAGWAAASGELVNIPDAYSDERFQPAVDIKSGYRTRSILCAPMRNSKSEIVG
gi|218961695|re  --------------------------------FSGLSEEVVEELTKDLERIKF-------
Translation_of   ------------------------------------------------------------
gi|209527708|re  --------------------------------------------------FEPEQADKLC
                                                                             


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
gi|162457275|re  LDELSL------------------------------------------------------
gi|148654385|re  ------------------------------------------------------------
gi|171056738|re  LYAR--------------------------------------------------------
gi|222100206|re  LVEIQKEHIKRMRIIYYVSQAMRSVYDPNNLYRVILLSLVSERAFNFDRAVLLKKNDATN
gi|170289259|re  VSEIQKEHIKKMRIIYYVSQAMRSVYDPNNLYRVILLSLVSERGFNFDRAVLLKKDEGTG
gi|15644111|ref  VSEIQKEHIKKMRIIYYVSQAMRSVYDPNNLYRVILLSLVSERGFNFDRAVLLKKDEGTG
gi|162456214|re  VIQVLNKH----------------------------------------------------
gi|227395000|re  VLQVLNKQ----------------------------------------------------
gi|218961695|re  ------------------------------------------------------------
Translation_of   ------------------------------------------------------------
gi|209527708|re  QLAIVEYY----------------------------------------------------
                                                                             


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
gi|162457275|re  -------VAGDGSVLGAEDGARIGTRDKRLAELIQAPG----------------------
gi|148654385|re  ------------------------------------------------------------
gi|171056738|re  -------VRHDYDAFIGEVGAVIA------------------------------------
gi|222100206|re  SLEVVSALGGETRQEHEELKRYLRRRTLRYTDLVQFLREEALTFSFETSFSERLKRRRFY
gi|170289259|re  SLMVVSAVGGDTLQEHEELKRYLRKRTLRYTDLVQFLREEALTFSFETKFNEKIRGKRFY
gi|15644111|ref  SLMVVSAVGGDTLQEHEELKRYLRKRTLRYTDLVQFLREEALTFSFETKFNEKIRGKRFY
gi|162456214|re  -------GEGEFSVHDEELLSALATQAAVSID----------------------------
gi|227395000|re  -------AGGPFTVDDAELLTALASQAGLSVE----------------------------
gi|218961695|re  -------KKGESIITEHSLSDNLF------------------------------------
Translation_of   ------------------------------------------------------------
gi|209527708|re  -------PEGSLIFEEGEVPDYLY------------------------------------
                                                                             


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
gi|162457275|re  --GAPRLRPAKAGGEPSLEVHCALSRHGVTIG-L--VGARRIGPV----LARIGEAYHVR
gi|148654385|re  ------------------------------------PSSLWIVAYTIFAVAAQLQLTSQA
gi|171056738|re  ----------LVRSGRLAEAREAQARRAVPLAER--LERMTNELV--------NRAEADM
gi|222100206|re  YRGHPIFERVVLRKSTVRVSRDILRKMGYEAEDV--LEALRSESFVVFPLLGRWDTLGAV
gi|170289259|re  YREHPIFERVVLRKSIVRTSRETLEKIRYEIEDV--ISILENDEFIVFPLVGRWDTLGVV
gi|15644111|ref  YREHPIFERVVLRKSIVRTSRETLEKIRYEIEDV--ISILENDEFIVFPLVGRWDTLGVV
gi|162456214|re  --NSRLFLSVIQKNTQLVETKEQLEHRVSDLKLLFDLESAMGRATTMEDLARAVITEAGR
gi|227395000|re  --NSKLYHSVVAKNAELMKARDQLEQRSHELNVLYEIEKLMNADLGLGQLLENVLAEAMQ
gi|218961695|re  ----------FISKGKVEIDKD-LSNPDIPFTQ---LSTLEAGDF--------FGEMGII
Translation_of   ------------------------------------------------------------
gi|209527708|re  ----------LVLTGEVEFSKSTGGDRY----QV--VTVARPNSF--------FGEFGVL
                                                                             


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
gi|162457275|re  LTAAREGELAPRSSEAE---VVRVLHFAEIPGLDVVASVPRDPLRQALARLDRAIALT--
gi|148654385|re  APARQSATDGATTASLN---LLPY--LGIVVGFGLLLAVT--------------------
gi|171056738|re  LAQVDAGAAGYARSRAL---VLSI--AAGSVVLALLLGYA--------------------
gi|222100206|re  VVDNKFSERPITDLDLD---VLKL--FSESAGLALENAINYEDLKRKTLDLQRQNELVEK
gi|170289259|re  VVDNKFSKKEVTDLDLD---VLKL--FSESAGLALENAYNYESLREKTLDLQRQNELVEH
gi|15644111|ref  VVDNKFSKKEVTDLDLD---VLKL--FSESAGLALENAYNYENLRKKTLDLQRQNELVEH
gi|162456214|re  ACEARAGGMLVDEIEGG---LFLY--FFDLTAFDGGSAPP------------RAPALGEE
gi|227395000|re  TVGAKAGTIALRDTEAENSNVLEFLTFAGPVATELEHR----------------------
gi|218961695|re  EDSTRSASVVATE-------DVELMVIPREAFSDMLFAYP--------------------
Translation_of   ------------------------------------------------------------
gi|209527708|re  DGQPRSARAIATLGGAT---LAKI------------------------------------
                                                                             


                        430       440       450       460       470       480
                 =========+=========+=========+=========+=========+=========+
gi|162457275|re  --GATVLAIAVAMAVVLARSLSRPLVALARETREVM-----SGAPRRVEGRGGREIADLA
gi|148654385|re  ------------------------IQNWTRPLGDLI------------------------
gi|171056738|re  ----------------LSWSLVEPVREMDARLAEIA------------AGQFERRI-DIP
gi|222100206|re  LKNFSESILESLEAAIITLDRDGRITEWNKKSEVLF-----GYR---KEQVLGKRLKNLP
gi|170289259|re  LRNFSESILESLETAIITLSKEGRVTEWNKKAEQLF-----GLK---KENVLGRRLKDLP
gi|15644111|ref  LRNFSESILESLETAIITLSKDGRITEWNKKAEQLF-----GLK---KENVLGRRLKDLP
gi|162456214|re  PEGVVVGAAPRPAVKRIAMRRGEGVVGRAMVNNEAVCFSREGGSRDPDDTLVSPRLAQLV
gi|227395000|re  -----------------TLPMGEGVLGWSVAHDQPV-----IVNDPRADERHASAFAEEL
gi|218961695|re  ---------------IIMLNLTKVISSRLRNTNERF------------------------
Translation_of   ------------------------------------------------------------
gi|209527708|re  -------------------SRDNLITILQDAKGQVV------------------------
                                                                             


                        490       500       510       520       530       540
                 =========+=========+=========+=========+=========+=========+
gi|162457275|re  AAFNATIDELAAMRKRLA------------------------------------------
gi|148654385|re  ----IGALALTVIVMVRQ-----------------------------------VVAMREN
gi|171056738|re  NRDELGALAADLNRMSAE-----------------------------------------L
gi|222100206|re  GFEEIGAIAESVMEEHEP-VFLNFYKFQEKYFNVRFSPLRNTKTQLLEGVIITIDDVTEL
gi|170289259|re  DFEEIGSVAESVFENKEP-VFLNFYKFGENYFNIRFSPFRNAKTQLLEGVIITIDDVTEL
gi|15644111|ref  DFEEIGSVAESVFENKEP-VFLNFYKFGERYFNIRFSPFRNAKTQLLEGVIITIDDVTEL
gi|162456214|re  GAELRTAIAVPLEGEDAV-----PIGSMALYNSRNPHGFSKDDRALLRLVSANASTALRL
gi|227395000|re  GFMPAHLVCAPLRSGDEVLGGIELIDKVSRDSDADAAGFSEEDLKLVVLIAGQAAKAISL
gi|218961695|re  ------------------------------------------------------------
Translation_of   ------------------------------------------------------------
gi|209527708|re  -LKLFGYITQQLRNTTNE------------------------------------------
                                                                             


                        550       560       570       580       590       600
                 =========+=========+=========+=========+=========+=========+
gi|162457275|re  --------ATERIA-ARREVARQIAHEIKNPLAPIRAAVETLRR-LRQRDDPAFDDYFAE
gi|148654385|re  VRLATERAAAEHASQIKSEFLANMSHELRTPLNSIINFTRIISTGARGPVTPEQIDY---
gi|171056738|re  GRLVREVEAANR---NKSAFLANMSHELRTPLNAIIGFSEVLIEQMFGEVNAKQLEY---
gi|222100206|re  YRYEEERKKKERLS-ILGEMTARVAHEIRNPITIIGGFVKRMRKHIDDPETLK--KY---
gi|170289259|re  YKYEEERKRRERLS-ILGEMTARVAHEIRNPITIIGGFIMRMKKHLDDPETLK--KY---
gi|15644111|ref  YKYEEERKRRERLS-ILGEMTARVAHEIRNPITIIGGFIMRMKKHLDDPETLK--KY---
gi|162456214|re  FRSRLEREQSERLT-TIGRLLSGVMHDMRTPLTVISGYVQLMAG-APDAATRE--DH---
gi|227395000|re  ARSRSARSKQERLA-SIGRMLASVLHDLKTPMTIISGYAQLMAQ-IDDADQRE--AY---
gi|218961695|re  VELMDEMLKKNRLM-AIGLAASKIIHDIKTPLTVIVLTAQLLENIFPESA-----EF---
Translation_of   ----------------------MLEKDVIHPMDLVRSL-----------------TF---
gi|209527708|re  --YVNQMVHKQKME-LLGEMVNTIVHDFRSPFTGIQLSSSMIRELHPDEETE---EW---
                                          ##########                         


                        610       620       630       640       650       660
                 =========+=========+=========+=========+=========+=========+
gi|162457275|re  ATSTVLNEVHRIANIVTEFTQFAR-----LPPPNLTPIDLVAVARGVVTLHAAPASGEAT
gi|148654385|re  -LNRVRQSGEHLLGLINDILDLSKIEAGRME-LFRESFQIGDLIQSVLATASGLVKE---
gi|171056738|re  -LRDIHASGHHLLTLINDVLDLSKIEAGRME-LQPSRFHLPELLDNSLTLVRERAAN---
gi|222100206|re  -VDIITGELSRLEGIVREILEYSK---EEQI-LEFSEFNLNELIKEVYVLFEEKLRE---
gi|170289259|re  -INIITNELSRLETIVKEILEYSK---ERQV-LEFTEFNLNELIREVYVLFEEKIRK---
gi|15644111|ref  -INIITNELSRLETIVKEILEYSK---ERQV-LEFTEFNLNELIREVYVLFEEKIRK---
gi|162456214|re  -ARLILKQFDVISAMQREVLEFAR---GERS-ILVRKVYLTKFFGDIEKQLEHELAG---
gi|227395000|re  -VEQILRQFDLMKGMTQEVLLFAR---GESE-LLVRRIFVNKFMDELLTQLNHALAG---
gi|218961695|re  -TDNIVKQTKLIDQLVHEILDFAR---GTESPPLIQKVNLDSFLREVSELYSASFKE---
Translation_of   -IRRIKQSSVNISGLTGDIVEFAK---GKME-LHPEQLNLEDFKEQLDAQL-GFIGE---
gi|209527708|re  -CDLISMQIQRMLGMAEEVLEFSR---GSTS-LLLKPVAIEEIIQQFEKLNRVYLHS---
                                                                             


                        670       680       690       700       710       720
                 =========+=========+=========+=========+=========+=========+
gi|162457275|re  SGARLSSGAGATSGTGAPSPRVELVADPIPEVSADRDQLIQVLTNLVQNGLDAASAI-RR
gi|148654385|re  KPIELRSE----------------IAPHLPPVYADRTRVRQVLLNLLSNAAKFTDA--GT
gi|171056738|re  HGLRLTLD----------------VQDGLGDWVADPRKIKQVVVNLLSNAVKFTPAG-GH
gi|222100206|re  MNIDFFFETD--------------NEDLRV--KADRSRIKQVLINLVQNAIEATGEN-GK
gi|170289259|re  MNIDFCFETD--------------NEDLRV--EADRTRIKQVLINLVQNAIEATGEN-GK
gi|15644111|ref  MNIDFCFETD--------------NEDLRV--EADRTRIKQVLINLVQNAIEATGEN-GK
gi|162456214|re  TGVSLSLE-----------------LEDRGTARFDEAKMTRLLHNLVRNAVEAMRPGGGT
gi|227395000|re  RNIKLTID-----------------PEYRDTAHFDEQKILRVMHNLARNAADAMPEG-GS
gi|218961695|re  RKIIFVVE-----------------NKVNDCVYFDEGKIRRVLINLIKNALEAIPEA-GE
Translation_of   LRLEYVID----------------PKDQMLPIKIDCRKICRVIVNLVKNSWEKLQDD-ED
gi|209527708|re  SDVELVID----------------IPDGIY-VLADLNKIIRVLQNLVSNAVEAFPNSQGK
                                                   ###################       






Protein Domains

PROTOCOL

InterPro : Default Parameters at EBI


RESULTS ANALYSIS


According to the INTERPRO results it show that it matches with the family of protein IPR001007 THIOLASE_3 which showed no E value but only start and end codons like NA [38-51]? NA [653-666]?


results :


Seq NAME protein domain name seq from seq ends E value

GOS_981020 THIOLASE_3 38 51 NA

RAW RESULTS

GOS_981020	3E1D579B0851144F	880	SignalPHMM	SignalP	signal-peptide	1	21	NA	?	24-May-2009	NULL	NULL
GOS_981020	3E1D579B0851144F	880	ScanRegExp	PS00022	EGF_1	670	681	NA	?	24-May-2009	IPR013032	EGF-like region, conserved site	
GOS_981020	3E1D579B0851144F	880	ScanRegExp	PS00099	THIOLASE_3	38	51	NA	?	24-May-2009	IPR002155	Thiolase	
GOS_981020	3E1D579B0851144F	880	ScanRegExp	PS00099	THIOLASE_3	653	666	NA	?	24-May-2009	IPR002155	Thiolase	
GOS_981020	3E1D579B0851144F	880	ScanRegExp	PS01208	VWFC_1	225	267	NA	?	24-May-2009	IPR001007	von Willebrand factor, type C	

Phylogeny

PROTOCOL


a)Phylogeny.fr / PhyML method / no bootstrap / default substitution model



RESULTS ANALYSIS



RAW RESULTS

                                                -----0.2---
 
                 +gi_222100206_ref_YP_002534774.1_Sensor_protein_Thermotoga_neapol
                 |
    +------------+ +gi_170289259_ref_YP_001739497.1_PAS/PAC_sensor_signal_transducti
    |            +-+
    |              |
    |              +gi_15644111_ref_NP_229160.1_sensor_histidine_kinase_Thermotoga_m
 +--+
 |  |                                  +--------gi_148654385_ref_YP_001274590.1_integral_membrane_sensor_hybrid
 |  | +--------------------------------+
 |  | |                                +----------------gi_171056738_ref_YP_001789087.1_histidine_kinase_Leptothrix_chol
 |  +-+
 |    +----------------------------------gi_162457275_ref_YP_001619642.1_putative_two-component_sensor_ki
 |
 |
 |           +---------gi_218961695_ref_YP_001741470.1_putative_Histidine_kinase_Candid
 |       +---+
 |       |   +------------------------------------------Translation_of_ORF_number_1_in_reading_frame_1_on_the_direct_str
 |       |
 +-------+                +-------gi_162456214_ref_YP_001618581.1_sensor_histidine_kinase_Sorangiu
         |                |
         |             +--+
         +-------------+  +------------------------gi_227395000_ref_ZP_03878325.1_signal_transduction_histidine_kin
                       |
                       +------------------gi_209527708_ref_ZP_03276205.1_cyclic_nucleotide-binding_protein

Taxonomy report

PROTOCOL

BLASTp VS Swissprot : default NCBI paramters


RESULTS ANALYSIS


According to the taxanomic report the query sequence best matches with the organism is


>ref|ZP_03276205.1| cyclic nucleotide-binding protein gb|EDZ92238.1| Arthrospira maxima CS-328

[cyanobacteria]cyclic nucleotide-binding protein and

the bit score is 90& Best hit is 2 hits

So i will Continue with this in my further step with Multipe sequence alignment

RAW RESULTS

Lineage Report

cellular organisms
. Bacteria           [bacteria]
. . Cyanobacteria      [cyanobacteria]
. . . Oscillatoriales    [cyanobacteria]
. . . . Arthrospira maxima CS-328 -----------------------------------   90  2 hits [cyanobacteria]         cyclic nucleotide-binding protein [Arthrospira maxima CS-32
. . . . Trichodesmium erythraeum IMS101 .............................   67  2 hits [cyanobacteria]         cyclic nucleotide-binding protein [Trichodesmium erythraeum
. . . . Microcoleus chthonoplastes PCC 7420 .........................   66  8 hits [cyanobacteria]         ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like do
. . . Cyanothece sp. CCY 0110 ---------------------------------------   67  2 hits [cyanobacteria]         sensory box histidine kinase/response regulator [Cyanothece
. . . Cyanothece sp. PCC 7425 .......................................   67  2 hits [cyanobacteria]         response regulator receiver sensor hybrid histidine kinase 
. . . Nostoc punctiforme PCC 73102 ..................................   66  2 hits [cyanobacteria]         Chase sensor signal transduction histidine kinase [Nostoc p
. . . Synechococcus sp. PCC 7335 ....................................   66  2 hits [cyanobacteria]         ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like do
. . . 'Nostoc azollae' 0708 .........................................   65  2 hits [cyanobacteria]         response regulator receiver sensor signal transduction hist
. . . Anabaena variabilis ATCC 29413 ................................   65  2 hits [cyanobacteria]         PAS/PAC sensor hybrid histidine kinase [Anabaena variabilis
. . . Acaryochloris marina MBIC11017 ................................   64  4 hits [cyanobacteria]         two-component sensor histidine kinase [Acaryochloris marina
. . . Nostoc sp. PCC 7120 ...........................................   64  2 hits [cyanobacteria]         two-component hybrid sensor and regulator [Nostoc sp. PCC 7
. . . Synechococcus sp. JA-3-3Ab ....................................   64  2 hits [cyanobacteria]         sensor histidine kinase [Synechococcus sp. JA-3-3Ab] >gi|86
. . . Synechococcus sp. PCC 7002 ....................................   64  2 hits [cyanobacteria]         two-component hybrid sensor kinase/response regulator [Syne
. . . Nodularia spumigena CCY 9414 ..................................   63  2 hits [cyanobacteria]         Response Regulator Receiver Signal Transduction Histidine K
. . Roseiflexus sp. RS-1 --------------------------------------------   84  4 hits [GNS bacteria]          integral membrane sensor hybrid histidine kinase [Roseiflex
. . Sorangium cellulosum 'So ce 56' .................................   83  8 hits [d-proteobacteria]      sensor histidine kinase [Sorangium cellulosum 'So ce 56'] >
. . Candidatus Cloacamonas acidaminovorans ..........................   81  2 hits [bacteria]              putative Histidine kinase [Candidatus Cloacamonas acidamino
. . Haliangium ochraceum DSM 14365 ..................................   80  2 hits [d-proteobacteria]      signal transduction histidine kinase, COG0642 [Haliangium o
. . Thermotoga neapolitana DSM 4359 .................................   80  2 hits [thermotogales]         Sensor protein [Thermotoga neapolitana DSM 4359] >gi|221572
. . Leptothrix cholodnii SP-6 .......................................   79  4 hits [b-proteobacteria]      histidine kinase [Leptothrix cholodnii SP-6] >gi|170774183|
. . Thermotoga sp. RQ2 ..............................................   77  2 hits [thermotogales]         PAS/PAC sensor signal transduction histidine kinase [Thermo
. . Thermotoga maritima MSB8 ........................................   77  2 hits [thermotogales]         sensor histidine kinase [Thermotoga maritima MSB8] >gi|4981
. . Thermotoga petrophila RKU-1 .....................................   77  2 hits [thermotogales]         PAS/PAC sensor signal transduction histidine kinase [Thermo
. . Marinitoga piezophila KA3 .......................................   77  2 hits [thermotogales]         PAS/PAC sensor signal transduction histidine kinase [Thermo
. . Labrenzia aggregata IAM 12614 ...................................   77  4 hits [a-proteobacteria]      Signal transduction histidine kinase [Stappia aggregata IAM
. . Leptospira borgpetersenii serovar Hardjo-bovis L550 .............   77  2 hits [spirochetes]           sensor histidine kinase and response regulator of a two com
. . Leptospira borgpetersenii serovar Hardjo-bovis JB197 ............   77  2 hits [spirochetes]           sensor histidine kinase and response regulator of a two com
. . Rhodopseudomonas palustris BisA53 ...............................   76  2 hits [a-proteobacteria]      periplasmic sensor signal transduction histidine kinase [Rh
. . Streptomyces ambofaciens ATCC 23877 .............................   76  1 hit  [high GC Gram+]         putative two-component system sensor kinase [Streptomyces a
. . Oligotropha carboxidovorans OM5 .................................   75  4 hits [a-proteobacteria]      histidine kinase [Oligotropha carboxidovorans OM5] >gi|2098
. . Bradyrhizobium sp. BTAi1 ........................................   75  4 hits [a-proteobacteria]      putative sensor histidine kinase [Bradyrhizobium sp. BTAi1]
. . Clostridium botulinum E3 str. Alaska E43 ........................   75  4 hits [firmicutes]            sensory transduction histidine kinase [Clostridium botulinu
. . Pseudomonas putida ..............................................   75  8 hits [g-proteobacteria]      bZIP histidine kinase TobS [Pseudomonas putida]
. . Roseobacter sp. GAI101 ..........................................   75  4 hits [a-proteobacteria]      sensor histidine kinase [Roseobacter sp. GAI101] >gi|214042
. . Pseudomonas putida F1 ...........................................   75  4 hits [g-proteobacteria]      multi-sensor signal transduction histidine kinase [Pseudomo
. . Carboxydothermus hydrogenoformans Z-2901 ........................   74  2 hits [firmicutes]            sensory box histidine kinase [Carboxydothermus hydrogenofor
. . Alkalilimnicola ehrlichei MLHE-1 ................................   74  4 hits [g-proteobacteria]      periplasmic sensor signal transduction histidine kinase [Al
. . Bradyrhizobium japonicum USDA 110 ...............................   73  2 hits [a-proteobacteria]      two-component hybrid sensor and regulator [Bradyrhizobium j
. . Brevibacillus brevis NBRC 100599 ................................   73  2 hits [firmicutes]            two-component sensor histidine kinase [Brevibacillus brevis
. . Bradyrhizobium sp. ORS278 .......................................   73  6 hits [a-proteobacteria]      putative sensor histidine kinase [Bradyrhizobium sp. ORS278
. . Clostridium botulinum B str. Eklund 17B .........................   73  2 hits [firmicutes]            sensory transduction histidine kinase [Clostridium botulinu
. . Opitutus terrae PB90-1 ..........................................   73  8 hits [verrucomicrobia]       integral membrane sensor signal transduction histidine kina
. . Blautia hansenii DSM 20583 ......................................   73  2 hits [firmicutes]            hypothetical protein BLAHAN_01461 [Blautia hansenii DSM 205
. . Hoeflea phototrophica DFL-43 ....................................   72  2 hits [a-proteobacteria]      putative sensor histidine kinase transmembrane protein [Hoe
. . Anoxybacillus flavithermus WK1 ..................................   72  6 hits [firmicutes]            Signal transduction histidine kinase [Anoxybacillus flavith
. . Prevotella bryantii .............................................   72  1 hit  [CFB group bacteria]    two component regulatory protein [Prevotella bryantii]
. . Legionella pneumophila subsp. pneumophila str. Philadelphia 1 ...   72  8 hits [g-proteobacteria]      response regulator TutC [Legionella pneumophila subsp. pneu
. . Legionella pneumophila ..........................................   72  3 hits [g-proteobacteria]      response regulator TutC [Legionella pneumophila subsp. pneu
. . Legionella pneumophila str. Corby ...............................   72  8 hits [g-proteobacteria]      response regulator TutC [Legionella pneumophila str. Corby]
. . Legionella pneumophila str. Paris ...............................   72  8 hits [g-proteobacteria]      sensor histidine kinase [Legionella pneumophila str. Paris]
. . Chthoniobacter flavus Ellin428 ..................................   72 16 hits [verrucomicrobia]       PAS/PAC sensor hybrid histidine kinase [Chthoniobacter flav
. . Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842 ..........   72  2 hits [firmicutes]            two-component system, sensor histidine kinase [Lactobacillu
. . Bacillus coagulans 36D1 .........................................   72  2 hits [firmicutes]            PAS/PAC sensor signal transduction histidine kinase [Bacill
. . Pseudomonas mendocina ...........................................   72  2 hits [g-proteobacteria]      bZIP histidine kinase [Pseudomonas mendocina]
. . Ruegeria sp. TM1040 .............................................   72  2 hits [a-proteobacteria]      periplasmic sensor signal transduction histidine kinase [Si
. . Lactobacillus sakei subsp. carnosus DSM 15831 ...................   72  2 hits [firmicutes]            sensor histidine kinase [Lactobacillus sakei subsp. carnosu
. . Lactobacillus ultunensis DSM 16047 ..............................   72  2 hits [firmicutes]            sensor histidine kinase [Lactobacillus sakei subsp. carnosu
. . Verrucomicrobium spinosum DSM 4136 ..............................   72  2 hits [verrucomicrobia]       response regulator receiver sensor signal transduction hist
. . Aurantimonas sp. SI85-9A1 .......................................   72  2 hits [a-proteobacteria]      putative sensor histidine kinase [Aurantimonas sp. SI85-9A1
. . Rhodopseudomonas palustris BisB18 ...............................   72  4 hits [a-proteobacteria]      periplasmic sensor signal transduction histidine kinase [Rh
. . bacterium Ellin514 ..............................................   71  2 hits [verrucomicrobia]       cyclic nucleotide-binding protein [bacterium Ellin514] >gi|
. . Mesorhizobium sp. BNC1 ..........................................   71  4 hits [a-proteobacteria]      multi-sensor signal transduction histidine kinase [Mesorhiz
. . Nitrobacter winogradskyi Nb-255 .................................   71  2 hits [a-proteobacteria]      Signal transduction histidine kinase [Nitrobacter winograds
. . Psychroflexus torquis ATCC 700755 ...............................   71  4 hits [CFB group bacteria]    sensory transduction histidine kinase [Psychroflexus torqui
. . Thermobaculum terrenum ATCC BAA-798 .............................   70  2 hits [bacteria]              histidine kinase [Thermobaculum terrenum ATCC BAA-798] >gi|
. . Candidatus Kuenenia stuttgartiensis .............................   70  1 hit  [planctomycetes]        similar to two-component sensor histidine kinase [Candidatu
. . Leptospira interrogans serovar Lai str. 56601 ...................   70  6 hits [spirochetes]           two-component hybrid sensor and regulator [Leptospira inter
. . Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130 ..   70  6 hits [spirochetes]           two-component hybrid sensor and regulator [Leptospira inter
. . Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365 ........   70  2 hits [firmicutes]            Signal transduction histidine kinase [Lactobacillus delbrue
. . Lentisphaera araneosa HTCC2155 ..................................   70  2 hits [bacteria]              sensor protein atoS [Lentisphaera araneosa HTCC2155] >gi|14
. . Flavobacteriales bacterium ALC-1 ................................   70  2 hits [CFB group bacteria]    sensory box sensor histidine kinase [Flavobacteriales bacte
. . Brucella canis ATCC 23365 .......................................   70  2 hits [a-proteobacteria]      autoinducer 1 sensor kinase/phosphatase luxN [Brucella cani
. . Desulfitobacterium hafniense Y51 ................................   70  4 hits [firmicutes]            hypothetical protein DSY4082 [Desulfitobacterium hafniense 
. . Brucella ovis ATCC 25840 ........................................   70  2 hits [a-proteobacteria]      sensor histidine kinase [Brucella ovis ATCC 25840] >gi|1483
. . Rhodopseudomonas palustris TIE-1 ................................   70  6 hits [a-proteobacteria]      integral membrane sensor signal transduction histidine kina
. . Acidovorax citrulli AAC00-1 .....................................   70  2 hits [b-proteobacteria]      PAS/PAC sensor signal transduction histidine kinase [Acidov
. . Rhodopseudomonas palustris CGA009 ...............................   70  6 hits [a-proteobacteria]      sensor histidine kinase [Rhodopseudomonas palustris CGA009]
. . Bacteroides stercoris ATCC 43183 ................................   70  2 hits [CFB group bacteria]    hypothetical protein BACSTE_03467 [Bacteroides stercoris AT
. . Mollicutes bacterium D7 .........................................   70  2 hits [mycoplasmas]           conserved hypothetical protein [Mollicutes bacterium D7] >g
. . Geobacillus kaustophilus HTA426 .................................   70  2 hits [firmicutes]            two-component sensor histidine kinase [Geobacillus kaustoph
. . Clostridium ramosum DSM 1402 ....................................   70  2 hits [firmicutes]            hypothetical protein CLORAM_01237 [Clostridium ramosum DSM 
. . Brucella melitensis 16M .........................................   70  2 hits [a-proteobacteria]      sensory transduction protein kinase [Brucella melitensis 16
. . Brucella suis 1330 ..............................................   70  2 hits [a-proteobacteria]      sensor histidine kinase [Brucella suis 1330] >gi|23347059|g
. . Brucella melitensis ATCC 23457 ..................................   70  2 hits [a-proteobacteria]      integral membrane sensor signal transduction histidine kina
. . Brucella melitensis biovar Abortus 2308 .........................   69  2 hits [a-proteobacteria]      histidine kinase A [Brucella melitensis biovar Abortus 2308
. . Brucella abortus S19 ............................................   69  2 hits [a-proteobacteria]      histidine kinase A [Brucella melitensis biovar Abortus 2308
. . Roseiflexus castenholzii DSM 13941 ..............................   69  2 hits [GNS bacteria]          multi-sensor hybrid histidine kinase [Roseiflexus castenhol
. . Gluconacetobacter diazotrophicus PAl 5 ..........................   69  4 hits [a-proteobacteria]      putative histidine kinase, nitrogen regulation protein ntrB
. . Brucella ceti str. Cudo .........................................   69  2 hits [a-proteobacteria]      sensor histidine kinase [Brucella ceti str. Cudo] >gi|22561
. . Rhizobium etli Brasil 5 .........................................   69  1 hit  [a-proteobacteria]      PAS/PAC sensor signal transduction histidine kinase [Rhizob
. . Alkaliphilus oremlandii OhILAs ..................................   69  2 hits [firmicutes]            integral membrane sensor signal transduction histidine kina
. . Brucella abortus str. 2308 A ....................................   69  1 hit  [a-proteobacteria]      histidine kinase A [Brucella abortus str. 2308 A] >gi|23778
. . Geobacter bemidjiensis Bem ......................................   69  4 hits [d-proteobacteria]      PAS/PAC sensor hybrid histidine kinase [Geobacter bemidjien
. . Fulvimarina pelagi HTCC2506 .....................................   69  2 hits [a-proteobacteria]      two component sensor kinase [Fulvimarina pelagi HTCC2506] >
. . Bacillus cereus AH603 ...........................................   69  2 hits [firmicutes]            hypothetical protein bcere0026_13260 [Bacillus cereus AH603
. . Citrobacter youngae ATCC 29220 ..................................   69  2 hits [enterobacteria]        hypothetical protein CIT292_01680 [Citrobacter youngae ATCC
. . Clostridium botulinum C str. Eklund .............................   69  2 hits [firmicutes]            two-component sensor histidine kinase [Clostridium botulinu
. . Bacillus cereus Rock1-15 ........................................   69  6 hits [firmicutes]            hypothetical protein bcere0018_56770 [Bacillus cereus Rock1
. . Rhizobium leguminosarum bv. trifolii WSM1325 ....................   69  4 hits [a-proteobacteria]      histidine kinase [Rhizobium leguminosarum bv. trifolii WSM1
. . Bacillus cereus 95/8201 .........................................   69  6 hits [firmicutes]            hypothetical protein bcere0016_54890 [Bacillus cereus 95/82
. . Labrenzia alexandrii DFL-11 .....................................   69  4 hits [a-proteobacteria]      ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like do
. . Lactobacillus helveticus DPC 4571 ...............................   68  2 hits [firmicutes]            two-component sensor [Lactobacillus helveticus DPC 4571] >g
. . Petrotoga mobilis SJ95 ..........................................   68  2 hits [thermotogales]         PAS/PAC sensor signal transduction histidine kinase [Petrot
. . Rhizobium etli CFN 42 ...........................................   68  4 hits [a-proteobacteria]      two-component sensor histidine kinase protein [Rhizobium et
. . Anaplasma marginale str. St. Maries .............................   68  2 hits [a-proteobacteria]      nitrogen regulation protein [Anaplasma marginale str. St. M
. . Anaplasma marginale str. Florida ................................   68  2 hits [a-proteobacteria]      nitrogen regulation protein [Anaplasma marginale str. St. M
. . Capnocytophaga sputigena ATCC 33612 .............................   68  2 hits [CFB group bacteria]    two-component system sensor histidine kinase/response regul
. . Vibrio parahaemolyticus 16 ......................................   68  2 hits [g-proteobacteria]      sensor histidine kinase/response regulator fusion protein [
. . Lactobacillus acidophilus NCFM ..................................   68  2 hits [firmicutes]            two-component sensor histidine kinase-like protein [Lactoba
. . Lactobacillus acidophilus ATCC 4796 .............................   68  2 hits [firmicutes]            two-component sensor histidine kinase-like protein [Lactoba
. . Bacillus cereus ATCC 10987 ......................................   68  6 hits [firmicutes]            sensor histidine kinase [Bacillus cereus ATCC 10987] >gi|19
. . Bacillus cereus .................................................   68  4 hits [firmicutes]            sensor histidine kinase [Bacillus cereus ATCC 10987] >gi|19
. . Bacillus cereus AH820 ...........................................   68  6 hits [firmicutes]            sensor histidine kinase [Bacillus cereus ATCC 10987] >gi|19
. . Bacillus cereus R309803 .........................................   68  4 hits [firmicutes]            sensor histidine kinase [Bacillus cereus ATCC 10987] >gi|19
. . Lactobacillus reuteri DSM 20016 .................................   68  2 hits [firmicutes]            integral membrane sensor signal transduction histidine kina
. . Lactobacillus reuteri JCM 1112 ..................................   68  2 hits [firmicutes]            integral membrane sensor signal transduction histidine kina
. . Lactobacillus reuteri MM2-3 .....................................   68  2 hits [firmicutes]            integral membrane sensor signal transduction histidine kina
. . Lactobacillus reuteri MM4-1 .....................................   68  2 hits [firmicutes]            integral membrane sensor signal transduction histidine kina
. . Brucella suis ATCC 23445 ........................................   68  2 hits [a-proteobacteria]      autoinducer 1 sensor kinase/phosphatase luxN [Brucella suis
. . Capnocytophaga ochracea DSM 7271 ................................   68  2 hits [CFB group bacteria]    signal transduction histidine kinase, COG0642 [Capnocytopha
. . Bacillus mycoides DSM 2048 ......................................   68  4 hits [firmicutes]            hypothetical protein bmyco0001_13350 [Bacillus mycoides DSM
. . Denitrovibrio acetiphilus DSM 12809 .............................   68  2 hits [bacteria]              histidine kinase with GAF domain [Denitrovibrio acetiphilus
. . Nitrosococcus oceani ATCC 19707 .................................   68  4 hits [g-proteobacteria]      PAS sensor, signal transduction histidine kinase [Nitrosoco
. . Nitrosococcus oceani AFC27 ......................................   68  4 hits [g-proteobacteria]      PAS sensor, signal transduction histidine kinase [Nitrosoco
. . Bacillus cereus AH1273 ..........................................   68  2 hits [firmicutes]            hypothetical protein bcere0030_14020 [Bacillus cereus AH127
. . Bacillus cereus AH1272 ..........................................   68  2 hits [firmicutes]            hypothetical protein bcere0030_14020 [Bacillus cereus AH127
. . Rhodobacterales bacterium HTCC2654 ..............................   68  2 hits [a-proteobacteria]      Nitrogen regulation protein, NtrB signal transduction histi
. . Kordia algicida OT-1 ............................................   68  2 hits [CFB group bacteria]    periplasmic sensor signal transduction histidine kinase [Ko
. . Methylocella silvestris BL2 .....................................   68  2 hits [a-proteobacteria]      multi-sensor signal transduction histidine kinase [Methyloc
. . Desulfitobacterium hafniense DCB-2 ..............................   68  4 hits [firmicutes]            histidine kinase [Desulfitobacterium hafniense DCB-2] >gi|2
. . Thermotogales bacterium TBF 19.5.1 ..............................   68  2 hits [thermotogales]         multi-sensor signal transduction histidine kinase [Thermoto
. . Geobacter uraniireducens Rf4 ....................................   68  2 hits [d-proteobacteria]      integral membrane sensor signal transduction histidine kina
. . Bacillus thuringiensis serovar tochigiensis BGSC 4Y1 ............   68  6 hits [firmicutes]            hypothetical protein bthur0001_12140 [Bacillus thuringiensi
. . Nitrosomonas eutropha C91 .......................................   68  2 hits [b-proteobacteria]      periplasmic sensor signal transduction histidine kinase [Ni
. . Geobacillus sp. Y412MC61 ........................................   68  2 hits [firmicutes]            multi-sensor signal transduction histidine kinase [Geobacil
. . Geobacillus sp. Y412MC52 ........................................   68  2 hits [firmicutes]            multi-sensor signal transduction histidine kinase [Geobacil
. . Lactobacillus crispatus JV-V01 ..................................   68  2 hits [firmicutes]            sensor histidine kinase [Lactobacillus crispatus JV-V01] >g
. . gamma proteobacterium NOR5-3 ....................................   68  2 hits [g-proteobacteria]      PAS/PAC sensor signal transduction histidine kinase [gamma 
. . Ralstonia metallidurans CH34 ....................................   68  2 hits [b-proteobacteria]      ATP-binding region, ATPase-like protein [Ralstonia metallid
. . Geobacillus thermodenitrificans NG80-2 ..........................   68  2 hits [firmicutes]            two-component sensor histidine kinase [Geobacillus thermode
. . Geobacillus sp. G11MC16 .........................................   68  2 hits [firmicutes]            two-component sensor histidine kinase [Geobacillus thermode
. . Bdellovibrio bacteriovorus HD100 ................................   68  2 hits [d-proteobacteria]      sensory transduction histidine kinase [Bdellovibrio bacteri
. . Lactobacillus hilgardii ATCC 8290 ...............................   67  2 hits [firmicutes]            signal transduction histidine kinase [Lactobacillus hilgard
. . Rhizobium leguminosarum bv. phaseoli ............................   67  1 hit  [a-proteobacteria]      FixL [Rhizobium leguminosarum bv. phaseoli]
. . Syntrophobacter fumaroxidans MPOB ...............................   67  2 hits [d-proteobacteria]      signal transduction histidine kinase, nitrogen specific, Nt
. . Citrobacter koseri ATCC BAA-895 .................................   67  2 hits [enterobacteria]        sensor protein KdpD [Citrobacter koseri ATCC BAA-895] >gi|1
. . Thauera aromatica ...............................................   67  2 hits [b-proteobacteria]      utilizing regulatory protein tutC [Thauera aromatica]
. . Myxococcus xanthus DK 1622 ......................................   67  6 hits [d-proteobacteria]      sensor histidine kinase [Myxococcus xanthus DK 1622] >gi|10
. . Methylophaga thiooxidans DMS010 .................................   67  2 hits [g-proteobacteria]      ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like do
. . Sulfitobacter sp. NAS-14.1 ......................................   67  2 hits [a-proteobacteria]      sensor histidine kinase [Sulfitobacter sp. NAS-14.1] >gi|83
. . Brevundimonas sp. BAL3 ..........................................   67  2 hits [a-proteobacteria]      ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like do
. . Providencia alcalifaciens DSM 30120 .............................   67  2 hits [enterobacteria]        hypothetical protein PROVALCAL_03555 [Providencia alcalifac
. . Oceanicaulis alexandrii HTCC2633 ................................   67  2 hits [a-proteobacteria]      two-component sensor histidine kinase [Oceanicaulis alexand
. . Brucella abortus bv. 1 str. 9-941 ...............................   67  2 hits [a-proteobacteria]      sensor histidine kinase [Brucella abortus bv. 1 str. 9-941]
. . Legionella pneumophila str. Lens ................................   67  8 hits [g-proteobacteria]      sensor histidine kinase [Legionella pneumophila str. Lens] 
. . Lactobacillus brevis subsp. gravesensis ATCC 27305 ..............   67  2 hits [firmicutes]            signal transduction histidine kinase [Lactobacillus brevis 
. . Bacillus weihenstephanensis KBAB4 ...............................   67  2 hits [firmicutes]            PAS/PAC sensor signal transduction histidine kinase [Bacill
. . Bacillus cereus BDRD-ST196 ......................................   67  2 hits [firmicutes]            PAS/PAC sensor signal transduction histidine kinase [Bacill
. . Bacillus cereus AH621 ...........................................   67  2 hits [firmicutes]            PAS/PAC sensor signal transduction histidine kinase [Bacill
. . Faecalibacterium prausnitzii M21/2 ..............................   67  2 hits [firmicutes]            hypothetical protein FAEPRAM212_00016 [Faecalibacterium pra
. . Bacillus cereus G9241 ...........................................   67  4 hits [firmicutes]            sporulation kinase D [Bacillus cereus G9241] >gi|47556775|g
. . Myxococcus xanthus ..............................................   67  2 hits [d-proteobacteria]      histidine kinase [Myxococcus xanthus]
. . Rhizobium leguminosarum bv. viciae 3841 .........................   67  2 hits [a-proteobacteria]      putative transmembrane two-component sensor histidine kinas
. . Bacillus cereus ATCC 4342 .......................................   67  2 hits [firmicutes]            hypothetical protein bcere0010_11950 [Bacillus cereus ATCC 
. . Citrobacter sp. 30_2 ............................................   67  2 hits [enterobacteria]        sensor protein KdpD [Citrobacter sp. 30_2] >gi|226906203|gb
. . Lactobacillus reuteri SD2112 ....................................   67  2 hits [firmicutes]            sensor histidine kinase [Lactobacillus reuteri SD2112] >gi|
. . Lactobacillus reuteri CF48-3A ...................................   67  2 hits [firmicutes]            sensor histidine kinase [Lactobacillus reuteri CF48-3A] >gi
. . Methylococcus capsulatus str. Bath ..............................   67  4 hits [g-proteobacteria]      sensor histidine kinase KdpD [Methylococcus capsulatus str.
. . Holdemania filiformis DSM 12042 .................................   67  2 hits [firmicutes]            hypothetical protein HOLDEFILI_01043 [Holdemania filiformis
. . Flavobacteria bacterium BAL38 ...................................   67  2 hits [CFB group bacteria]    periplasmic sensor signal transduction histidine kinase [Fl
. . Caulobacter sp. K31 .............................................   67  4 hits [a-proteobacteria]      multi-sensor signal transduction histidine kinase [Caulobac
. . Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1 ........   67  4 hits [firmicutes]            hypothetical protein bthur0010_44060 [Bacillus thuringiensi
. . Lactobacillus buchneri ATCC 11577 ...............................   67  2 hits [firmicutes]            signal transduction histidine kinase [Lactobacillus buchner
. . Dechloromonas aromatica RCB .....................................   67  4 hits [b-proteobacteria]      PAS [Dechloromonas aromatica RCB] >gi|71845486|gb|AAZ44982.
. . Rhodopseudomonas palustris HaA2 .................................   67  4 hits [a-proteobacteria]      signal transduction histidine kinase, nitrogen specific, Nt
. . Clostridium sp. M62/1 ...........................................   67  2 hits [firmicutes]            hypothetical protein CLOM621_01438 [Clostridium sp. M62/1] 
. . Thermosipho melanesiensis BI429 .................................   67  2 hits [thermotogales]         multi-sensor signal transduction histidine kinase [Thermosi
. . Bacillus cereus AH676 ...........................................   67  4 hits [firmicutes]            hypothetical protein bcere0027_12290 [Bacillus cereus AH676
. . delta proteobacterium MLMS-1 ....................................   67  4 hits [d-proteobacteria]      Response regulator receiver [delta proteobacterium MLMS-1] 
. . Photorhabdus luminescens subsp. laumondii TTO1 ..................   66  2 hits [enterobacteria]        sensor protein KdpD [Photorhabdus luminescens subsp. laumon
. . Bacillus cereus E33L ............................................   66  4 hits [firmicutes]            sensor histidine kinase [Bacillus cereus E33L] >gi|51974302
. . Bacillus cereus Q1 ..............................................   66  6 hits [firmicutes]            Two component system histidine kinase [Bacillus cereus Q1] 
. . Geobacter metallireducens GS-15 .................................   66  2 hits [d-proteobacteria]      signal transduction histidine kinase, nitrogen specific, Nt
. . Lactobacillus reuteri ...........................................   66  1 hit  [firmicutes]            signal transduction histidine kinase [Lactobacillus reuteri]
. . Deinococcus geothermalis DSM 11300 ..............................   66  2 hits [bacteria]              histidine kinase [Deinococcus geothermalis DSM 11300] >gi|9
. . Oenococcus oeni ATCC BAA-1163 ...................................   66  2 hits [firmicutes]            sensor protein kinase [Oenococcus oeni ATCC BAA-1163] >gi|1
. . Pseudovibrio sp. JE062 ..........................................   66  2 hits [a-proteobacteria]      periplasmic sensor signal transduction histidine kinase [Ps
. . Bacillus thuringiensis serovar konkukian str. 97-27 .............   66  4 hits [firmicutes]            sensor histidine kinase [Bacillus thuringiensis serovar kon
. . Bacillus cereus H3081.97 ........................................   66  4 hits [firmicutes]            sensor histidine kinase [Bacillus thuringiensis serovar kon
. . Bacillus cereus m1293 ...........................................   66  4 hits [firmicutes]            sensor histidine kinase [Bacillus thuringiensis serovar kon
. . Sulfitobacter sp. EE-36 .........................................   66  2 hits [a-proteobacteria]      sensor histidine kinase [Sulfitobacter sp. EE-36] >gi|83847
. . Deinococcus deserti VCD115 ......................................   66  2 hits [bacteria]              putative histidine kinase, classic [Deinococcus deserti VCD
. . Oceanobacillus iheyensis HTE831 .................................   66  2 hits [firmicutes]            two-component sensor histidine kinase [Oceanobacillus iheye
. . Ochrobactrum anthropi ATCC 49188 ................................   66  2 hits [a-proteobacteria]      integral membrane sensor signal transduction histidine kina
. . Bacillus cereus AH187 ...........................................   66  4 hits [firmicutes]            sensor histidine kinase [Bacillus cereus AH187] >gi|2291414
. . Bacillus cereus BDRD-ST26 .......................................   66  4 hits [firmicutes]            sensor histidine kinase [Bacillus cereus AH187] >gi|2291414
. . Lactobacillus reuteri 100-23 ....................................   66  2 hits [firmicutes]            integral membrane sensor signal transduction histidine kina
. . Oenococcus oeni PSU-1 ...........................................   66  2 hits [firmicutes]            Signal transduction histidine kinase [Oenococcus oeni PSU-1
. . Thauera sp. MZ1T ................................................   66  2 hits [b-proteobacteria]      PAS/PAC sensor signal transduction histidine kinase [Thauer
. . Clostridium sporogenes ATCC 15579 ...............................   66  2 hits [firmicutes]            hypothetical protein CLOSPO_00238 [Clostridium sporogenes A
. . Bacillus thuringiensis serovar thuringiensis str. T01001 ........   66  4 hits [firmicutes]            hypothetical protein bthur0003_12080 [Bacillus thuringiensi
. . Bacillus thuringiensis Bt407 ....................................   66  4 hits [firmicutes]            hypothetical protein bthur0003_12080 [Bacillus thuringiensi
. . Escherichia fergusonii ATCC 35469 ...............................   66  2 hits [enterobacteria]        sensor protein KdpD [Escherichia fergusonii ATCC 35469] >gi
. . Bacteroides plebeius DSM 17135 ..................................   66  2 hits [CFB group bacteria]    hypothetical protein BACPLE_03758 [Bacteroides plebeius DSM
. . Bacillus thuringiensis serovar pulsiensis BGSC 4CC1 .............   66  4 hits [firmicutes]            hypothetical protein bthur0012_45310 [Bacillus thuringiensi
. . Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 ..........   66  1 hit  [enterobacteria]        sensor protein (histidine kinase) [Photorhabdus asymbiotica
. . Bacillus selenitireducens MLS10 .................................   66  4 hits [firmicutes]            metal dependent phosphohydrolase [Bacillus selenitireducens
. . Lutiella nitroferrum 2002 .......................................   66  2 hits [b-proteobacteria]      multi-sensor signal transduction histidine kinase [Lutiella
. . Klebsiella pneumoniae 342 .......................................   66  2 hits [enterobacteria]        sensor protein KdpD [Klebsiella pneumoniae 342] >gi|2065651
. . Bacillus cereus m1550 ...........................................   66  2 hits [firmicutes]            hypothetical protein bcere0011_11940 [Bacillus cereus m1550
. . Bacillus cereus ATCC 14579 ......................................   66  4 hits [firmicutes]            sporulation kinase D [Bacillus cereus ATCC 14579] >gi|29895
. . Bacillus cereus BDRD-Cer4 .......................................   66  4 hits [firmicutes]            hypothetical protein bcere0015_12080 [Bacillus cereus BDRD-
. . Vibrio splendidus LGP32 .........................................   66  2 hits [g-proteobacteria]      hypothetical protein VS_1800 [Vibrio splendidus LGP32] >gi|
. . Bacillus thuringiensis serovar huazhongensis BGSC 4BD1 ..........   66  4 hits [firmicutes]            hypothetical protein bthur0011_11630 [Bacillus thuringiensi
. . Bacillus thuringiensis serovar berliner ATCC 10792 ..............   66  4 hits [firmicutes]            hypothetical protein bthur0008_12140 [Bacillus thuringiensi
. . Bacillus thuringiensis serovar sotto str. T04001 ................   66  4 hits [firmicutes]            hypothetical protein bthur0004_12450 [Bacillus thuringiensi
. . Rhizobium leguminosarum bv. trifolii WSM2304 ....................   66  2 hits [a-proteobacteria]      PAS/PAC sensor signal transduction histidine kinase [Rhizob
. . Endoriftia persephone 'Hot96_1+Hot96_2' .........................   66  1 hit  [g-proteobacteria]      multi-sensor signal transduction histidine kinase [Endorift
. . Vibrio sp. MED222 ...............................................   66  2 hits [g-proteobacteria]      hypothetical protein MED222_16191 [Vibrio sp. MED222] >gi|8
. . Rhizobium sp. NGR234 ............................................   66  2 hits [a-proteobacteria]      two component sensor histidine kinase protein [Rhizobium sp
. . Bacillus cereus B4264 ...........................................   66  2 hits [firmicutes]            sensor histidine kinase KinD [Bacillus cereus B4264] >gi|21
. . Bacillus thuringiensis serovar israelensis ATCC 35646 ...........   66  4 hits [firmicutes]            Sporulation kinase D [Bacillus thuringiensis serovar israel
. . Bacillus thuringiensis IBL 4222 .................................   66  4 hits [firmicutes]            hypothetical protein bthur0014_12240 [Bacillus thuringiensi
. . Bacillus cereus BDRD-ST24 .......................................   66  4 hits [firmicutes]            hypothetical protein bcere0012_12010 [Bacillus cereus BDRD-
. . Bacillus pseudomycoides DSM 12442 ...............................   65  4 hits [firmicutes]            hypothetical protein bpmyx0001_13280 [Bacillus pseudomycoid
. . Roseburia inulinivorans DSM 16841 ...............................   65  2 hits [firmicutes]            hypothetical protein ROSEINA2194_00771 [Roseburia inulinivo
. . Anaerostipes caccae DSM 14662 ...................................   65  4 hits [firmicutes]            hypothetical protein ANACAC_01087 [Anaerostipes caccae DSM 
. . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ...............   65  2 hits [enterobacteria]        sensor protein KdpD [Klebsiella pneumoniae subsp. pneumonia
. . Bacillus cereus G9842 ...........................................   65  4 hits [firmicutes]            sensor histidine kinase KinD [Bacillus cereus G9842] >gi|21
. . Bacillus mycoides Rock3-17 ......................................   65  4 hits [firmicutes]            hypothetical protein bmyco0003_12530 [Bacillus mycoides Roc
. . Bacillus mycoides Rock1-4 .......................................   65  4 hits [firmicutes]            hypothetical protein bmyco0003_12530 [Bacillus mycoides Roc
. . Bacillus thuringiensis serovar pakistani str. T13001 ............   65  6 hits [firmicutes]            hypothetical protein bthur0005_12210 [Bacillus thuringiensi
. . Vibrionales bacterium SWAT-3 ....................................   65  2 hits [g-proteobacteria]      nitrogen regulation protein NR(II) [Vibrionales bacterium S
. . Bacillus thuringiensis IBL 200 ..................................   65  4 hits [firmicutes]            hypothetical protein bthur0013_12390 [Bacillus thuringiensi
. . Roseovarius nubinhibens ISM .....................................   65  2 hits [a-proteobacteria]      two-component hybrid sensor and regulator [Roseovarius nubi
. . Hyphomonas neptunium ATCC 15444 .................................   65  2 hits [a-proteobacteria]      sensory box sensor histidine kinase FixL [Hyphomonas neptun
. . Cronobacter sakazakii ATCC BAA-894 ..............................   65  2 hits [enterobacteria]        sensor protein KdpD [Enterobacter sakazakii ATCC BAA-894] >
. . Saccharophagus degradans 2-40 ...................................   65  2 hits [g-proteobacteria]      sensor histidine kinase [Saccharophagus degradans 2-40] >gi
. . Vibrio vulnificus CMCP6 .........................................   65  4 hits [g-proteobacteria]      FOG: CheY-like receiver [Vibrio vulnificus CMCP6] >gi|27358
. . Escherichia coli SE11 ...........................................   65  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli SE11] >gi|209911205|d
. . Bacillus thuringiensis serovar andalousiensis BGSC 4AW1 .........   65  4 hits [firmicutes]            hypothetical protein bthur0009_44240 [Bacillus thuringiensi
. . Vibrio vulnificus YJ016 .........................................   65  4 hits [g-proteobacteria]      hypothetical protein VVA0584 [Vibrio vulnificus YJ016] >gi|
. . Agrobacterium vitis S4 ..........................................   65  2 hits [a-proteobacteria]      two component sensor kinase [Agrobacterium vitis S4] >gi|22
. . Ruminococcus gnavus ATCC 29149 ..................................   65  2 hits [firmicutes]            hypothetical protein RUMGNA_02373 [Ruminococcus gnavus ATCC
. . Bacteroides coprophilus DSM 18228 ...............................   65  2 hits [CFB group bacteria]    hypothetical protein BACCOPRO_02541 [Bacteroides coprophilu
. . Laribacter hongkongensis HLHK9 ..................................   65  2 hits [b-proteobacteria]      Signal transduction histidine kinase [Laribacter hongkongen
. . Nitrobacter hamburgensis X14 ....................................   65  2 hits [a-proteobacteria]      histidine kinase [Nitrobacter hamburgensis X14] >gi|9180205
. . Bacillus cereus Rock4-2 .........................................   65  4 hits [firmicutes]            hypothetical protein bcere0023_45560 [Bacillus cereus Rock4
. . Delftia acidovorans SPH-1 .......................................   65  2 hits [b-proteobacteria]      PAS/PAC sensor signal transduction histidine kinase [Delfti
. . Clostridium phytofermentans ISDg ................................   65  2 hits [firmicutes]            integral membrane sensor signal transduction histidine kina
. . Beijerinckia indica subsp. indica ATCC 9039 .....................   65  2 hits [a-proteobacteria]      integral membrane sensor signal transduction histidine kina
. . Sinorhizobium meliloti 1021 .....................................   65  2 hits [a-proteobacteria]      putative sensor histidine kinase transmembrane protein [Sin
. . Bacillus thuringiensis serovar monterrey BGSC 4AJ1 ..............   65  4 hits [firmicutes]            hypothetical protein bthur0007_11980 [Bacillus thuringiensi
. . Phaeobacter gallaeciensis 2.10 ..................................   65  2 hits [a-proteobacteria]      sensor histidine kinase [Phaeobacter gallaeciensis 2.10] >g
. . Plesiocystis pacifica SIR-1 .....................................   65  8 hits [d-proteobacteria]      Signal transduction histidine kinase [Plesiocystis pacifica
. . Bacillus cereus Rock3-42 ........................................   65  4 hits [firmicutes]            hypothetical protein bthur0012_12420 [Bacillus thuringiensi
. . Bacillus cereus BGSC 6E1 ........................................   65  4 hits [firmicutes]            hypothetical protein bthur0012_12420 [Bacillus thuringiensi
. . Rhizobium etli CIAT 652 .........................................   65  2 hits [a-proteobacteria]      two-component sensor histidine kinase nitrogen regulation p
. . Octadecabacter antarcticus 307 ..................................   65  2 hits [a-proteobacteria]      ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like do
. . Bacillus cereus 172560W .........................................   65  4 hits [firmicutes]            hypothetical protein bcere0005_43340 [Bacillus cereus 17256
. . Corynebacterium matruchotii ATCC 33806 ..........................   65  2 hits [high GC Gram+]         hypothetical protein CORMATOL_03106 [Corynebacterium matruc
. . Escherichia coli APEC O1 ........................................   65  4 hits [enterobacteria]        sensory histidine kinase AtoS [Escherichia coli APEC O1] >g
. . Escherichia coli O127:H6 str. E2348/69 ..........................   65  4 hits [enterobacteria]        sensory histidine kinase AtoS [Escherichia coli APEC O1] >g
. . Escherichia coli S88 ............................................   65  4 hits [enterobacteria]        sensory histidine kinase AtoS [Escherichia coli APEC O1] >g
. . Escherichia coli 536 ............................................   65  2 hits [enterobacteria]        sensory histidine kinase AtoS [Escherichia coli 536] >gi|19
. . Escherichia coli F11 ............................................   65  4 hits [enterobacteria]        sensory histidine kinase AtoS [Escherichia coli 536] >gi|19
. . Pseudoalteromonas tunicata D2 ...................................   65  2 hits [g-proteobacteria]      hypothetical protein PTD2_09494 [Pseudoalteromonas tunicata
. . Escherichia coli UTI89 ..........................................   65  4 hits [enterobacteria]        sensory histidine kinase AtoS [Escherichia coli UTI89] >gi|
. . Xanthobacter autotrophicus Py2 ..................................   65  2 hits [a-proteobacteria]      multi-sensor hybrid histidine kinase [Xanthobacter autotrop
. . Bacillus cereus NVH0597-99 ......................................   65  4 hits [firmicutes]            sensor histidine kinase KinD [Bacillus cereus NVH0597-99] >
. . Bacillus thuringiensis str. Al Hakam ............................   65  4 hits [firmicutes]            sensor histidine kinase; sporulation kinase [Bacillus cereu
. . Bacillus cereus 03BB108 .........................................   65  4 hits [firmicutes]            sensor histidine kinase; sporulation kinase [Bacillus cereu
. . Bacillus cereus 03BB102 .........................................   65  4 hits [firmicutes]            sensor histidine kinase; sporulation kinase [Bacillus cereu
. . Nitrosomonas europaea ATCC 19718 ................................   65  2 hits [b-proteobacteria]      sensory transduction histidine kinase [Nitrosomonas europae
. . Escherichia coli 83972 ..........................................   65  4 hits [enterobacteria]        sensory histidine kinase AtoS [Escherichia coli 83972] >gi|
. . Bacillus cereus W ...............................................   65  4 hits [firmicutes]            sensor histidine kinase KinD [Bacillus cereus W] >gi|195992
. . Desulfomicrobium baculatum DSM 4028 .............................   65  4 hits [d-proteobacteria]      histidine kinase [Desulfomicrobium baculatum DSM 4028] >gi|
. . Shewanella piezotolerans WP3 ....................................   65  2 hits [g-proteobacteria]      PAS domain protein [Shewanella piezotolerans WP3] >gi|21255
. . Bacillus coahuilensis m4-4 ......................................   65  2 hits [firmicutes]            hypothetical protein Bcoam_21676 [Bacillus coahuilensis m4-
. . Dehalococcoides sp. VS ..........................................   65  2 hits [GNS bacteria]          multi-sensor hybrid histidine kinase [Dehalococcoides sp. V
. . Escherichia coli CFT073 .........................................   65  4 hits [enterobacteria]        sensory histidine kinase AtoS [Escherichia coli CFT073] >gi
. . Bacteroides finegoldii DSM 17565 ................................   65  2 hits [CFB group bacteria]    hypothetical protein BACFIN_01849 [Bacteroides finegoldii D
. . Escherichia coli ED1a ...........................................   65  4 hits [enterobacteria]        sensor protein KdpD [Escherichia coli ED1a] >gi|218426063|e
. . Escherichia sp. 3_2_53FAA .......................................   65  4 hits [enterobacteria]        sensor protein KdpD [Escherichia coli UTI89] >gi|237707335|
. . Bacillus thuringiensis serovar kurstaki str. T03a001 ............   65  4 hits [firmicutes]            hypothetical protein bthur0006_12290 [Bacillus thuringiensi
. . Methylobacterium populi BJ001 ...................................   65  4 hits [a-proteobacteria]      PAS/PAC sensor hybrid histidine kinase [Methylobacterium po
. . Bacillus cereus AH1134 ..........................................   65  4 hits [firmicutes]            sensor histidine kinase KinD [Bacillus cereus AH1134] >gi|2
. . uncultured bacterium ............................................   65  1 hit  [bacteria]              putative signal transduction histidine kinase [uncultured b
. . Bacillus cereus F65185 ..........................................   65  4 hits [firmicutes]            hypothetical protein bcere0025_11930 [Bacillus cereus F6518
. . Loktanella vestfoldensis SKA53 ..................................   65  2 hits [a-proteobacteria]      sensory box sensor histidine kianse/response regulator [Lok
. . Salmonella enterica subsp. enterica serovar Typhi str. 404ty ....   65  1 hit  [enterobacteria]        sensor protein KdpD [Salmonella enterica subsp. enterica se
. . Clostridium beijerinckii NCIMB 8052 .............................   65  2 hits [firmicutes]            integral membrane sensor signal transduction histidine kina
. . Clostridium butyricum 5521 ......................................   65  2 hits [firmicutes]            sensor histidine kinase [Clostridium butyricum 5521] >gi|23
. . Clostridium butyricum E4 str. BoNT E BL5262 .....................   65  2 hits [firmicutes]            sensor histidine kinase [Clostridium butyricum 5521] >gi|23
. . Bacillus cereus ATCC 10876 ......................................   65  4 hits [firmicutes]            hypothetical protein bcere0002_11950 [Bacillus cereus ATCC 
. . Acidobacteria bacterium Ellin345 ................................   65  4 hits [bacteria]              periplasmic sensor signal transduction histidine kinase [Ac
. . Blastopirellula marina DSM 3645 .................................   64  2 hits [planctomycetes]        sensor histidine kinase/response regulator [Blastopirellula
. . Thiomicrospira crunogena XCL-2 ..................................   64  2 hits [g-proteobacteria]      periplasmic sensor hybrid histidine kinase [Thiomicrospira 
. . Congregibacter litoralis KT71 ...................................   64  2 hits [g-proteobacteria]      Sensor protein zraS [gamma proteobacterium KT 71] >gi|88701
. . Ruegeria pomeroyi DSS-3 .........................................   64  2 hits [a-proteobacteria]      sensor histidine kinase [Ruegeria pomeroyi DSS-3] >gi|56677
. . Bacillus anthracis str. A2012 ...................................   64  2 hits [firmicutes]            COG0642: Signal transduction histidine kinase [Bacillus ant
. . Bacillus anthracis str. A0488 ...................................   64  4 hits [firmicutes]            COG0642: Signal transduction histidine kinase [Bacillus ant
. . Bacillus anthracis str. A0193 ...................................   64  4 hits [firmicutes]            COG0642: Signal transduction histidine kinase [Bacillus ant
. . Bacillus anthracis str. A0465 ...................................   64  4 hits [firmicutes]            COG0642: Signal transduction histidine kinase [Bacillus ant
. . Bacillus anthracis str. A0389 ...................................   64  4 hits [firmicutes]            COG0642: Signal transduction histidine kinase [Bacillus ant
. . Bacillus anthracis str. A0174 ...................................   64  4 hits [firmicutes]            COG0642: Signal transduction histidine kinase [Bacillus ant
. . Bacillus anthracis Tsiankovskii-I ...............................   64  4 hits [firmicutes]            COG0642: Signal transduction histidine kinase [Bacillus ant
. . Bacillus anthracis str. CDC 684 .................................   64  4 hits [firmicutes]            COG0642: Signal transduction histidine kinase [Bacillus ant
. . Bacillus anthracis str. A0248 ...................................   64  4 hits [firmicutes]            COG0642: Signal transduction histidine kinase [Bacillus ant
. . Bacillus cereus Rock3-44 ........................................   64  4 hits [firmicutes]            hypothetical protein bcere0022_10630 [Bacillus cereus Rock3
. . Nitrobacter sp. Nb-311A .........................................   64  2 hits [a-proteobacteria]      Nitrogen regulation protein ntrB [Nitrobacter sp. Nb-311A] 
. . Bacillus anthracis str. A0442 ...................................   64  4 hits [firmicutes]            sensor histidine kinase KinD [Bacillus anthracis str. A0442
. . Idiomarina loihiensis L2TR ......................................   64  2 hits [g-proteobacteria]      hybrid sensor histidine kinase [Idiomarina loihiensis L2TR]
. . Bacillus anthracis str. Ames ....................................   64  4 hits [firmicutes]            sensor histidine kinase KinD [Bacillus anthracis str. Ames]
. . Bacillus anthracis str. 'Ames Ancestor' .........................   64  4 hits [firmicutes]            sensor histidine kinase KinD [Bacillus anthracis str. Ames]
. . Bacillus anthracis str. Sterne ..................................   64  4 hits [firmicutes]            sensor histidine kinase KinD [Bacillus anthracis str. Ames]
. . Hahella chejuensis KCTC 2396 ....................................   64  2 hits [g-proteobacteria]      Signal transduction histidine kinase regulating C4-dicarbox
. . Stigmatella aurantiaca DW4/3-1 ..................................   64  2 hits [d-proteobacteria]      histidine kinase [Stigmatella aurantiaca DW4/3-1] >gi|11536
. . Magnetococcus sp. MC-1 ..........................................   64  2 hits [proteobacteria]        PAS/PAC sensor signal transduction histidine kinase [Magnet
. . Escherichia coli IAI1 ...........................................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli IAI1] >gi|218694121|r
. . Escherichia coli 55989 ..........................................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli IAI1] >gi|218694121|r
. . Clostridium kluyveri DSM 555 ....................................   64  2 hits [firmicutes]            sensory transduction histidine kinase [Clostridium kluyveri
. . Exiguobacterium sp. AT1b ........................................   64  2 hits [firmicutes]            histidine kinase [Exiguobacterium sp. AT1b] >gi|229467598|g
. . Methylobacterium extorquens PA1 .................................   64  2 hits [a-proteobacteria]      PAS sensor protein [Methylobacterium extorquens PA1] >gi|16
. . Hydrogenivirga sp. 128-5-R1-1 ...................................   64  2 hits [aquificales]           sensory box histidine kinase [Hydrogenivirga sp. 128-5-R1-1
. . Pseudomonas aeruginosa PAO1 .....................................   64  2 hits [g-proteobacteria]      two-component sensor [Pseudomonas aeruginosa PAO1] >gi|1071
. . Pseudomonas aeruginosa PACS2 ....................................   64  1 hit  [g-proteobacteria]      two-component sensor [Pseudomonas aeruginosa PAO1] >gi|1071
. . Pseudomonas aeruginosa LESB58 ...................................   64  2 hits [g-proteobacteria]      two-component sensor [Pseudomonas aeruginosa PAO1] >gi|1071
. . Pseudomonas aeruginosa 2192 .....................................   64  2 hits [g-proteobacteria]      hypothetical protein PA2G_03824 [Pseudomonas aeruginosa 219
. . Bacillus cereus MM3 .............................................   64  2 hits [firmicutes]            hypothetical protein bcere0006_11870 [Bacillus cereus MM3] 
. . Escherichia coli E22 ............................................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli E22] >gi|194429082|re
. . Escherichia coli B171 ...........................................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli E22] >gi|194429082|re
. . Clostridium kluyveri NBRC 12016 .................................   64  2 hits [firmicutes]            hypothetical protein CKR_1992 [Clostridium kluyveri NBRC 12
. . Shigella sonnei Ss046 ...........................................   64  2 hits [enterobacteria]        sensor protein KdpD [Shigella sonnei Ss046] >gi|73854697|gb
. . Salmonella enterica subsp. enterica serovar Typhi str. E98-3139 .   64  1 hit  [enterobacteria]        sensor protein KdpD [Salmonella enterica subsp. enterica se
. . Providencia rettgeri DSM 1131 ...................................   64  2 hits [enterobacteria]        hypothetical protein PROVRETT_03509 [Providencia rettgeri D
. . Rhodopseudomonas palustris BisB5 ................................   64  2 hits [a-proteobacteria]      ATP-binding region, ATPase-like [Rhodopseudomonas palustris
. . Gemmata obscuriglobus UQM 2246 ..................................   64  1 hit  [planctomycetes]        GAF sensor hybrid histidine kinase [Gemmata obscuriglobus U
. . Lactobacillus salivarius UCC118 .................................   64  2 hits [firmicutes]            two component system histidine kinase [Lactobacillus saliva
. . Bacillus cereus AH1271 ..........................................   64  2 hits [firmicutes]            hypothetical protein bcere0028_12070 [Bacillus cereus AH127
. . Escherichia coli ................................................   64  6 hits [enterobacteria]        sensor for high-affinity potassium transport system [Escher
. . Shigella dysenteriae 1012 .......................................   64  2 hits [enterobacteria]        sensor protein KdpD [Shigella dysenteriae 1012] >gi|1944177
. . Escherichia coli O157:H7 EDL933 .................................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli O157:H7 EDL933] >gi|1
. . Escherichia coli O157:H7 str. Sakai .............................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli O157:H7 EDL933] >gi|1
. . Escherichia coli O157:H7 str. EC4113 ............................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli O157:H7 EDL933] >gi|1
. . Escherichia coli O157:H7 str. EC4401 ............................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli O157:H7 EDL933] >gi|1
. . Escherichia coli O157:H7 str. EC4501 ............................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli O157:H7 EDL933] >gi|1
. . Escherichia coli O157:H7 str. EC4486 ............................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli O157:H7 EDL933] >gi|1
. . Escherichia coli O157:H7 str. EC4196 ............................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli O157:H7 EDL933] >gi|1
. . Escherichia coli O157:H7 str. EC4076 ............................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli O157:H7 EDL933] >gi|1
. . Escherichia coli O157:H7 str. EC869 .............................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli O157:H7 EDL933] >gi|1
. . Escherichia coli O157:H7 str. EC508 .............................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli O157:H7 EDL933] >gi|1
. . Escherichia coli O157:H7 str. EC4024 ............................   64  1 hit  [enterobacteria]        sensor protein KdpD [Escherichia coli O157:H7 EDL933] >gi|1
. . Escherichia coli O157:H7 str. EC4206 ............................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli O157:H7 EDL933] >gi|1
. . Escherichia coli O157:H7 str. EC4045 ............................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli O157:H7 EDL933] >gi|1
. . Escherichia coli O157:H7 str. EC4042 ............................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli O157:H7 EDL933] >gi|1
. . Escherichia coli O157:H7 str. EC4115 ............................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli O157:H7 EDL933] >gi|1
. . Escherichia coli O157:H7 str. TW14588 ...........................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli O157:H7 EDL933] >gi|1
. . Escherichia coli B7A ............................................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli B7A] >gi|193070633|re
. . Escherichia coli E110019 ........................................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli B7A] >gi|193070633|re
. . Escherichia coli UMN026 .........................................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli UMN026] >gi|218431113
. . Escherichia coli IAI39 ..........................................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli IAI39] >gi|218369037|
. . Escherichia coli SMS-3-5 ........................................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli SMS-3-5] >gi|17051998
. . Escherichia coli 101-1 ..........................................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli 101-1] >gi|194421805|
. . Escherichia coli str. K-12 substr. MG1655 .......................   64  2 hits [enterobacteria]        fused sensory histidine kinase in two-component regulatory 
. . Escherichia coli str. K-12 substr. W3110 ........................   64  2 hits [enterobacteria]        fused sensory histidine kinase in two-component regulatory 
. . Escherichia coli str. K-12 substr. DH10B ........................   64  2 hits [enterobacteria]        fused sensory histidine kinase in two-component regulatory 
. . Escherichia coli K-12 ...........................................   64  1 hit  [enterobacteria]        fused sensory histidine kinase in two-component regulatory 
. . Escherichia coli 53638 ..........................................   64  2 hits [enterobacteria]        osmosensitive K+ channel His kinase sensor domain family [E
. . Escherichia coli HS .............................................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli HS] >gi|157065855|gb|
. . Shigella boydii CDC 3083-94 .....................................   64  2 hits [enterobacteria]        sensor protein KdpD [Shigella boydii CDC 3083-94] >gi|18742
. . Agrobacterium radiobacter K84 ...................................   64  2 hits [a-proteobacteria]      two-component sensor histidine kinase protein [Agrobacteriu
. . Pseudomonas aeruginosa UCBPP-PA14 ...............................   64  2 hits [g-proteobacteria]      putative two-component sensor [Pseudomonas aeruginosa UCBPP
. . Lactobacillus salivarius ATCC 11741 .............................   64  2 hits [firmicutes]            two component system histidine kinase [Lactobacillus saliva
. . Rhodobacterales bacterium HTCC2255 ..............................   64  2 hits [a-proteobacteria]      Nitrogen regulation protein, NtrB signal transduction histi
. . Shigella boydii Sb227 ...........................................   64  2 hits [enterobacteria]        sensor protein KdpD [Shigella boydii Sb227] >gi|81244539|gb
. . Escherichia coli E24377A ........................................   64  2 hits [enterobacteria]        sensor protein KdpD [Escherichia coli E24377A] >gi|15707913
. . Geobacter sulfurreducens PCA ....................................   64  4 hits [d-proteobacteria]      sensor histidine kinase [Geobacter sulfurreducens PCA] >gi|
. . Magnetospirillum magnetotacticum MS-1 ...........................   64  1 hit  [a-proteobacteria]      COG3852: Signal transduction histidine kinase, nitrogen spe
. . Psychrobacter cryohalolentis K5 .................................   64  2 hits [g-proteobacteria]      histidine kinase [Psychrobacter cryohalolentis K5] >gi|9239
. . Bacillus amyloliquefaciens FZB42 ................................   64  2 hits [firmicutes]            putative signal transduction histidine kinase [Bacillus amy
. . Magnetospirillum magneticum AMB-1 ...............................   64  2 hits [a-proteobacteria]      Signal transduction histidine kinase [Magnetospirillum magn
. . Vibrio cholerae 12129(1) ........................................   64  2 hits [g-proteobacteria]      osmosensitive K+ channel histidine kinase KdpD [Vibrio chol
. . Providencia rustigianii DSM 4541 ................................   64  2 hits [enterobacteria]        hypothetical protein PROVRUST_02885 [Providencia rustigiani
. . Jannaschia sp. CCS1 .............................................   64  2 hits [a-proteobacteria]      periplasmic sensor signal transduction histidine kinase [Ja
. . Vibrio cholerae 1587 ............................................   64  2 hits [g-proteobacteria]      sensor histidine kinase [Vibrio cholerae 1587] >gi|12411648
. . Streptomyces coelicolor A3(2) ...................................   63  2 hits [high GC Gram+]         two-component system sensor kinase [Streptomyces coelicolor
. . Mesorhizobium loti MAFF303099 ...................................   63  2 hits [a-proteobacteria]      histidine protein kinase sensor for nitrogen regulator II, 
. . Sphaerobacter thermophilus DSM 20745 ............................   63  2 hits [GNS bacteria]          PAS domain S-box protein [Sphaerobacter thermophilus DSM 20
. . Vibrio cholerae AM-19226 ........................................   63  2 hits [g-proteobacteria]      sensor histidine kinase [Vibrio cholerae AM-19226] >gi|1504
. . Clostridium difficile 630 .......................................   63  2 hits [firmicutes]            putative two-component histidine kinase [Clostridium diffic
. . Clostridium bartlettii DSM 16795 ................................   63  2 hits [firmicutes]            hypothetical protein CLOBAR_02471 [Clostridium bartlettii D
. . Vibrio cholerae bv. albensis VL426 ..............................   63  2 hits [g-proteobacteria]      osmosensitive K+ channel histidine kinase KdpD [Vibrio chol
. . Bacteroides fragilis YCH46 ......................................   63  2 hits [CFB group bacteria]    two-component system sensor histidine kinase/response regul
. . Vibrio cholerae V51 .............................................   63  2 hits [g-proteobacteria]      sensor histidine kinase [Vibrio cholerae V51] >gi|125620976
. . Clostridium nexile DSM 1787 .....................................   63  2 hits [firmicutes]            hypothetical protein CLONEX_00300 [Clostridium nexile DSM 1
. . Clostridium bolteae ATCC BAA-613 ................................   63  2 hits [firmicutes]            hypothetical protein CLOBOL_05222 [Clostridium bolteae ATCC
. . Bradyrhizobium sp. RP501 ........................................   63  1 hit  [a-proteobacteria]      RecName: Full=Nitrogen regulation protein ntrB >gi|77976|pi
. . Bradyrhizobium sp. ..............................................   63  2 hits [a-proteobacteria]      RecName: Full=Nitrogen regulation protein ntrB >gi|77976|pi
. . Bacteroides fragilis NCTC 9343 ..................................   63  2 hits [CFB group bacteria]    putative two-component system sensor histidine kinase/respo
. . Vibrio cholerae V52 .............................................   63  2 hits [g-proteobacteria]      sensor histidine kinase [Vibrio cholerae V52] >gi|153831310
. . Vibrio cholerae 623-39 ..........................................   63  2 hits [g-proteobacteria]      sensor histidine kinase [Vibrio cholerae V52] >gi|153831310
. . Rhodothermus marinus DSM 4252 ...................................   63  2 hits [CFB group bacteria]    PAS domain S-box protein [Rhodothermus marinus DSM 4252] >g
. . Salmonella enterica subsp. enterica serovar Typhi str. E02-1180 .   63  1 hit  [enterobacteria]        sensor protein KdpD [Salmonella enterica subsp. enterica se
. . Pseudomonas fluorescens .........................................   63  2 hits [g-proteobacteria]      hybrid histidine kinase homolog [Pseudomonas fluorescens]
. . Agrobacterium tumefaciens str. C58 ..............................   63  2 hits [a-proteobacteria]      two component sensor kinase [Agrobacterium tumefaciens str.
. . Bacteroides intestinalis DSM 17393 ..............................   63  2 hits [CFB group bacteria]    hypothetical protein BACINT_03180 [Bacteroides intestinalis
. . Idiomarina baltica OS145 ........................................   63  2 hits [g-proteobacteria]      Hybrid sensor histidine kinase (HisK, 2 CheY, Hpt domains) 
. . Pedobacter heparinus DSM 2366 ...................................   63  2 hits [CFB group bacteria]    signal transduction histidine kinase, COG0642 [Pedobacter h
. . Ruegeria sp. R11 ................................................   63  2 hits [a-proteobacteria]      periplasmic sensor signal transduction histidine kinase [Ru
. . Escherichia albertii TW07627 ....................................   63  2 hits [enterobacteria]        sensor protein KdpD [Escherichia albertii TW07627] >gi|1701
. . Geobacter sp. FRC-32 ............................................   63  2 hits [d-proteobacteria]      histidine kinase [Geobacter sp. FRC-32] >gi|221563758|gb|AC
. . Vibrio cholerae TMA 21 ..........................................   63  2 hits [g-proteobacteria]      osmosensitive K+ channel histidine kinase KdpD [Vibrio chol
. . Sagittula stellata E-37 .........................................   63  2 hits [a-proteobacteria]      nitrogen regulation protein NtrB [Sagittula stellata E-37] 
. . Thiobacillus denitrificans ATCC 25259 ...........................   63  2 hits [b-proteobacteria]      multi-sensor Signal transduction histidine kinase [Thiobaci
. . Vibrio cholerae O1 biovar El Tor str. N16961 ....................   63  2 hits [g-proteobacteria]      sensor histidine kinase [Vibrio cholerae O1 biovar eltor st
. . Vibrio cholerae 2740-80 .........................................   63  2 hits [g-proteobacteria]      sensor histidine kinase [Vibrio cholerae O1 biovar eltor st
. . Vibrio cholerae MAK 757 .........................................   63  2 hits [g-proteobacteria]      sensor histidine kinase [Vibrio cholerae O1 biovar eltor st
. . Vibrio cholerae NCTC 8457 .......................................   63  2 hits [g-proteobacteria]      sensor histidine kinase [Vibrio cholerae O1 biovar eltor st
. . Vibrio cholerae B33 .............................................   63  4 hits [g-proteobacteria]      sensor histidine kinase [Vibrio cholerae O1 biovar eltor st
. . Vibrio cholerae M66-2 ...........................................   63  2 hits [g-proteobacteria]      sensor histidine kinase [Vibrio cholerae O1 biovar eltor st
. . Vibrio cholerae BX 330286 .......................................   63  2 hits [g-proteobacteria]      sensor histidine kinase [Vibrio cholerae O1 biovar eltor st
. . Vibrio cholerae RC9 .............................................   63  2 hits [g-proteobacteria]      sensor histidine kinase [Vibrio cholerae O1 biovar eltor st
. . Vibrio cholerae MJ-1236 .........................................   63  2 hits [g-proteobacteria]      sensor histidine kinase [Vibrio cholerae O1 biovar eltor st
. . Methylibium petroleiphilum PM1 ..................................   63  4 hits [b-proteobacteria]      PAS/PAC sensor hybrid histidine kinase [Methylibium petrole
. . Phaeobacter gallaeciensis BS107 .................................   63  2 hits [a-proteobacteria]      periplasmic sensor signal transduction histidine kinase [Ph
. . Clostridium thermocellum ATCC 27405 .............................   63  2 hits [firmicutes]            Hpt sensor hybrid histidine kinase [Clostridium thermocellu
. . Desulfatibacillum alkenivorans AK-01 ............................   63  2 hits [d-proteobacteria]      PAS/PAC sensor signal transduction histidine kinase [Desulf
. . Marinomonas sp. MED121 ..........................................   63  2 hits [g-proteobacteria]      two-component sensor NtrB [Marinomonas sp. MED121] >gi|8616
. . Thermosipho africanus TCF52B ....................................   63  2 hits [thermotogales]         sensor histidine kinase [Thermosipho africanus TCF52B] >gi|
. . Bacillus cereus subsp. cytotoxis NVH 391-98 .....................   63  2 hits [firmicutes]            integral membrane sensor signal transduction histidine kina
. . Anaeromyxobacter sp. Fw109-5 ....................................   63  2 hits [d-proteobacteria]      histidine kinase [Anaeromyxobacter sp. Fw109-5] >gi|1520288
. . Thioalkalivibrio sp. HL-EbGR7 ...................................   63  2 hits [g-proteobacteria]      PAS/PAC sensor signal transduction histidine kinase [Thioal
. . Pseudomonas fluorescens Pf0-1 ...................................   63  2 hits [g-proteobacteria]      multi-sensor hybrid histidine kinase [Pseudomonas fluoresce
. . Rhodobacteraceae bacterium KLH11 ................................   63  2 hits [a-proteobacteria]      sensor histidine kinase [Rhodobacteraceae bacterium KLH11] 
. . Shewanella amazonensis SB2B .....................................   63  2 hits [g-proteobacteria]      putative two-component sensor histidine kinase protein [She
. Dictyostelium discoideum ------------------------------------------   70  5 hits [cellular slime molds]  hybrid histidine kinase [Dictyostelium discoideum]
. Methanococcus vannielii SB ........................................   70  4 hits [euryarchaeotes]        integral membrane sensor signal transduction histidine kina
. Dictyostelium discoideum AX4 ......................................   69  4 hits [cellular slime molds]  histidine kinase [Dictyostelium discoideum AX4] >gi|7485508
. Nitrosopumilus maritimus SCM1 .....................................   67  2 hits [crenarchaeotes]        histidine kinase [Nitrosopumilus maritimus SCM1] >gi|160339

--------------------------------------------------------------------------------
Organism Report 

BLAST

PROTOCOL

BLASTp vs NCBI ; default NCBI parameters _"1000 max target sequences"



RESULTS ANALYSIS


ORF number 1 in reading frame 1 on the direct strand give me these BLASTp results :


Query ID : lcl|1793

Description : Translation of ORF number 1 in reading frame 1 on the direct strand.

Molecule type : amino acid

Query Length : 231

Database Name : nr

Description : All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS

Program BLASTP 2.2.20+


Score _ 90.1 bits (222),

Expect value _ 2e-16,

Method: Compositional matrix adjust.

Identities _ 58/167 (34%),

Positives _ 92/167 (55%),

Gaps _ 6/167 (3%)

colour of Score _ pink(80-200)


So Query shows 34% identities with Thiolase enzyme which is involve actively in catalytic activity i.e oxidation reduction


And the Blastn gives me these results :


Query ID lcl|14111

Description GOS_981020 Genomic DNA (Galapagos Islands: Devil's Crown, Floreana Island)

Molecule type nucleic acid

Query Length 880

Database Name dbindex/9606/allcontig_and_rna

Description Human build 36.3 RNA, reference, and HuRef assemblies See details

Program BLASTN 2.2.20


No significant similarity found.



RAW RESULTS
--------------------------------------------------------------------------------------------------

Results

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_03276205.1|  cyclic nucleotide-binding protein [Arthros...  90.1    2e-16
ref|YP_001274590.1|  integral membrane sensor hybrid histidine...  84.7    6e-15 
ref|YP_001618581.1|  sensor histidine kinase [Sorangium cellul...  83.6    1e-14 
ref|YP_001741470.1|  putative Histidine kinase [Candidatus Clo...  81.6    5e-14 
ref|ZP_03878325.1|  signal transduction histidine kinase, COG0...  80.1    1e-13
ref|YP_002534774.1|  Sensor protein [Thermotoga neapolitana DS...  80.1    1e-13 
ref|YP_001789087.1|  histidine kinase [Leptothrix cholodnii SP...  79.3    2e-13 
ref|YP_001619642.1|  putative two-component sensor kinase [Sor...  78.6    5e-13 
ref|YP_001739497.1|  PAS/PAC sensor signal transduction histid...  77.8    7e-13 
ref|NP_229160.1|  sensor histidine kinase [Thermotoga maritima...  77.8    7e-13 
ref|YP_001245013.1|  PAS/PAC sensor signal transduction histid...  77.8    7e-13 
ref|ZP_01547164.1|  Signal transduction histidine kinase [Stap...  77.8    7e-13
ref|YP_797985.1|  sensor histidine kinase and response regulat...  77.4    1e-12 
ref|YP_800707.1|  sensor histidine kinase and response regulat...  77.4    1e-12 
ref|YP_779579.1|  periplasmic sensor signal transduction histi...  76.6    2e-12 
emb|CAJ89886.1|  putative two-component system sensor kinase [...  76.3    2e-12
ref|YP_002290494.1|  histidine kinase [Oligotropha carboxidovo...  75.9    2e-12 
ref|YP_001243093.1|  putative sensor histidine kinase [Bradyrh...  75.5    4e-12 
ref|YP_001921036.1|  sensory transduction histidine kinase [Cl...  75.1    4e-12 
gb|AAG09417.1|AF180147_9  bZIP histidine kinase TobS [Pseudomo...  75.1    5e-12
ref|YP_002700960.1|  sensor histidine kinase [Roseobacter sp. ...  75.1    5e-12 
gb|ABA10818.1|  bZIP histidine kinase [Pseudomonas putida]         75.1    5e-12
ref|YP_001268187.1|  multi-sensor signal transduction histidin...  75.1    5e-12 
ref|YP_359782.1|  sensory box histidine kinase [Carboxydotherm...  74.7    6e-12 
emb|CAB43735.1|  bZIP histidine kinase [Pseudomonas putida]        74.7    6e-12
ref|YP_741510.1|  periplasmic sensor signal transduction histi...  74.7    6e-12 
gb|AAC45438.1|  bZIP histidine kinase [Pseudomonas putida]         74.7    6e-12
ref|NP_774735.1|  two-component hybrid sensor and regulator [B...  73.9    1e-11 
ref|YP_002775158.1|  two-component sensor histidine kinase [Br...  73.9    1e-11 
ref|YP_001202947.1|  putative sensor histidine kinase [Bradyrh...  73.9    1e-11 
ref|YP_001886045.1|  sensory transduction histidine kinase [Cl...  73.6    1e-11 
ref|YP_001818074.1|  integral membrane sensor signal transduct...  73.6    1e-11 
ref|ZP_03547679.1|  hypothetical protein BLAHAN_01461 [Blautia...  73.2    2e-11
ref|ZP_02164959.1|  putative sensor histidine kinase transmemb...  72.8    2e-11
ref|YP_002315743.1|  Signal transduction histidine kinase [Ano...  72.8    2e-11 
ref|YP_002316336.1|  Signal transduction histidine kinase [Ano...  72.8    2e-11 
emb|CAD21009.1|  two component regulatory protein [Prevotella ...  72.8    3e-11
ref|YP_096159.1|  response regulator TutC [Legionella pneumoph...  72.4    3e-11 
ref|YP_001250883.1|  response regulator TutC [Legionella pneum...  72.4    3e-11 
ref|YP_124396.1|  sensor histidine kinase [Legionella pneumoph...  72.4    3e-11 
ref|YP_001921035.1|  sensory transduction histidine kinase [Cl...  72.4    3e-11 
ref|ZP_03130742.1|  PAS/PAC sensor hybrid histidine kinase [Ch...  72.4    3e-11
ref|YP_618326.1|  two-component system, sensor histidine kinas...  72.4    3e-11 
ref|ZP_04433024.1|  PAS/PAC sensor signal transduction histidi...  72.0    4e-11
gb|AAL13332.1|  bZIP histidine kinase [Pseudomonas mendocina]      72.0    4e-11
ref|YP_612311.1|  periplasmic sensor signal transduction histi...  72.0    4e-11 
ref|ZP_03844194.1|  sensor histidine kinase [Lactobacillus sak...  72.0    4e-11
ref|ZP_02929751.1|  response regulator receiver sensor signal ...  72.0    4e-11
ref|ZP_03129828.1|  multi-sensor hybrid histidine kinase [Chth...  72.0    4e-11
ref|ZP_01227797.1|  putative sensor histidine kinase [Aurantim...  72.0    4e-11
ref|YP_530710.1|  periplasmic sensor signal transduction histi...  72.0    4e-11 
ref|ZP_03629971.1|  cyclic nucleotide-binding protein [bacteri...  71.6    5e-11
ref|YP_674780.1|  multi-sensor signal transduction histidine k...  71.6    5e-11 
ref|YP_319677.1|  Signal transduction histidine kinase [Nitrob...  71.6    5e-11 
ref|YP_001821342.1|  integral membrane sensor signal transduct...  71.2    7e-11 
ref|ZP_01252536.1|  sensory transduction histidine kinase [Psy...  71.2    7e-11
ref|ZP_03857311.1|  histidine kinase [Thermobaculum terrenum A...  70.9    9e-11
gb|AAB84171.1|  hybrid histidine kinase [Dictyostelium discoid...  70.9    9e-11
emb|CAJ71118.1|  similar to two-component sensor histidine kin...  70.9    9e-11
ref|NP_712403.1|  two-component hybrid sensor and regulator [L...  70.9    1e-10 
ref|YP_812231.1|  Signal transduction histidine kinase [Lactob...  70.9    1e-10 
ref|ZP_01875188.1|  sensor protein atoS [Lentisphaera araneosa...  70.5    1e-10
ref|YP_001322663.1|  integral membrane sensor signal transduct...  70.5    1e-10 
ref|YP_001618758.1|  sensor histidine kinase [Sorangium cellul...  70.5    1e-10 
ref|ZP_02182220.1|  sensory box sensor histidine kinase [Flavo...  70.5    1e-10
ref|YP_672920.1|  periplasmic sensor signal transduction histi...  70.5    1e-10 
ref|YP_001592140.1|  autoinducer 1 sensor kinase/phosphatase l...  70.1    1e-10 
ref|YP_520315.1|  hypothetical protein DSY4082 [Desulfitobacte...  70.1    1e-10 
ref|YP_001258314.1|  sensor histidine kinase [Brucella ovis AT...  70.1    1e-10 
ref|YP_001989674.1|  integral membrane sensor signal transduct...  70.1    2e-10 
ref|YP_970588.1|  PAS/PAC sensor signal transduction histidine...  70.1    2e-10 
ref|NP_945988.1|  sensor histidine kinase [Rhodopseudomonas pa...  70.1    2e-10 
ref|ZP_02437194.1|  hypothetical protein BACSTE_03467 [Bactero...  70.1    2e-10
ref|ZP_04565169.1|  conserved hypothetical protein [Mollicutes...  70.1    2e-10
ref|YP_148131.1|  two-component sensor histidine kinase [Geoba...  70.1    2e-10 
ref|ZP_02427849.1|  hypothetical protein CLORAM_01237 [Clostri...  70.1    2e-10
ref|NP_540565.1|  sensory transduction protein kinase [Brucell...  70.1    2e-10 
ref|NP_697308.1|  sensor histidine kinase [Brucella suis 1330]...  70.1    2e-10 
ref|YP_002732056.1|  integral membrane sensor signal transduct...  70.1    2e-10 
ref|YP_413775.1|  histidine kinase A [Brucella melitensis biov...  69.7    2e-10 
ref|YP_001433738.1|  multi-sensor hybrid histidine kinase [Ros...  69.7    2e-10 
ref|YP_001602511.1|  putative histidine kinase, nitrogen regul...  69.7    2e-10 
ref|ZP_03784841.1|  sensor histidine kinase [Brucella ceti str...  69.7    2e-10
ref|ZP_03504596.1|  PAS/PAC sensor signal transduction histidi...  69.7    2e-10
ref|YP_001512405.1|  integral membrane sensor signal transduct...  69.7    2e-10 
ref|ZP_04593760.1|  histidine kinase A [Brucella abortus str. ...  69.7    2e-10
ref|YP_002139298.1|  PAS/PAC sensor hybrid histidine kinase [G...  69.7    2e-10 
ref|ZP_01439733.1|  two component sensor kinase [Fulvimarina p...  69.3    2e-10
ref|ZP_04196599.1|  hypothetical protein bcere0026_13260 [Baci...  69.3    2e-10
ref|ZP_03835870.1|  hypothetical protein CIT292_01680 [Citroba...  69.3    2e-10
ref|YP_001277375.1|  multi-sensor signal transduction histidin...  69.3    3e-10 
ref|ZP_02622082.1|  two-component sensor histidine kinase [Clo...  69.3    3e-10
ref|ZP_04242955.1|  hypothetical protein bcere0018_56770 [Baci...  69.3    3e-10
ref|ZP_02298452.1|  histidine kinase [Rhizobium leguminosarum ...  69.3    3e-10
ref|ZP_04254354.1|  hypothetical protein bcere0016_54890 [Baci...  69.3    3e-10
ref|YP_002611907.1|  ATPase, histidine kinase-, DNA gyrase B-,...  69.3    3e-10 
gb|AAK50005.1|AF361475_1  double histidine kinase DhkD [Dictyo...  69.3    3e-10
ref|XP_640257.1|  histidine kinase [Dictyostelium discoideum A...  69.3    3e-10 
ref|YP_001578006.1|  two-component sensor [Lactobacillus helve...  68.9    3e-10 
ref|YP_001568645.1|  PAS/PAC sensor signal transduction histid...  68.9    3e-10 
ref|YP_472339.1|  two-component sensor histidine kinase protei...  68.9    3e-10 
ref|YP_153544.1|  nitrogen regulation protein [Anaplasma margi...  68.9    3e-10 
ref|ZP_03390581.1|  two-component system sensor histidine kina...  68.9    3e-10
ref|YP_002667434.1|  sensor histidine kinase/response regulato...  68.9    3e-10 
ref|ZP_03127798.1|  integral membrane sensor hybrid histidine ...  68.9    3e-10
ref|ZP_02298442.1|  histidine kinase [Rhizobium leguminosarum ...  68.9    4e-10
ref|YP_194652.1|  two-component sensor histidine kinase-like p...  68.9    4e-10 
ref|NP_982221.1|  sensor histidine kinase [Bacillus cereus ATC...  68.9    4e-10 
ref|YP_001819952.1|  PAS/PAC sensor hybrid histidine kinase [O...  68.9    4e-10 
ref|YP_001270727.1|  integral membrane sensor signal transduct...  68.6    4e-10 
ref|YP_001626962.1|  autoinducer 1 sensor kinase/phosphatase l...  68.6    4e-10 
ref|ZP_04378850.1|  signal transduction histidine kinase, COG0...  68.6    4e-10
ref|ZP_04168077.1|  hypothetical protein bmyco0001_13350 [Baci...  68.6    4e-10
ref|ZP_03907669.1|  histidine kinase with GAF domain [Denitrov...  68.6    4e-10
ref|YP_343702.1|  PAS sensor, signal transduction histidine ki...  68.6    5e-10 
ref|ZP_04173762.1|  hypothetical protein bcere0030_14020 [Baci...  68.6    5e-10
ref|ZP_01012785.1|  Nitrogen regulation protein, NtrB signal t...  68.6    5e-10
ref|ZP_02161354.1|  periplasmic sensor signal transduction his...  68.6    5e-10
ref|YP_002362192.1|  multi-sensor signal transduction histidin...  68.6    5e-10 
ref|ZP_03128603.1|  histidine kinase [Chthoniobacter flavus El...  68.2    5e-10
ref|YP_002457776.1|  histidine kinase [Desulfitobacterium hafn...  68.2    5e-10 
ref|ZP_03330176.1|  multi-sensor signal transduction histidine...  68.2    5e-10
ref|YP_001229282.1|  integral membrane sensor signal transduct...  68.2    6e-10 
ref|ZP_04144686.1|  hypothetical protein bthur0001_12140 [Baci...  68.2    6e-10
ref|YP_746631.1|  periplasmic sensor signal transduction histi...  68.2    6e-10 
ref|ZP_03556790.1|  multi-sensor signal transduction histidine...  68.2    6e-10
ref|ZP_03997065.1|  sensor histidine kinase [Lactobacillus cri...  68.2    6e-10
ref|YP_002658086.1|  PAS/PAC sensor signal transduction histid...  68.2    6e-10 
ref|YP_587437.1|  ATP-binding region, ATPase-like protein [Ral...  68.2    6e-10 
ref|YP_001126300.1|  two-component sensor histidine kinase [Ge...  68.2    6e-10 
ref|NP_970336.1|  sensory transduction histidine kinase [Bdell...  68.2    6e-10 
ref|ZP_03954867.1|  signal transduction histidine kinase [Lact...  67.8    7e-10
gb|AAA96818.1|  FixL [Rhizobium leguminosarum bv. phaseoli]        67.8    7e-10
ref|YP_844986.1|  signal transduction histidine kinase, nitrog...  67.8    7e-10 
ref|YP_001454019.1|  sensor protein KdpD [Citrobacter koseri A...  67.8    7e-10 
gb|AAD12184.1|  utilizing regulatory protein tutC [Thauera aro...  67.8    7e-10
ref|YP_631541.1|  sensor histidine kinase [Myxococcus xanthus ...  67.8    8e-10 
ref|YP_002670645.1|  ATPase, histidine kinase-, DNA gyrase B-,...  67.8    8e-10 
ref|ZP_00948454.1|  sensor histidine kinase [Sulfitobacter sp....  67.8    8e-10
ref|YP_002587306.1|  ATPase, histidine kinase-, DNA gyrase B-,...  67.4    9e-10 
ref|ZP_03320589.1|  hypothetical protein PROVALCAL_03555 [Prov...  67.4    9e-10
ref|ZP_00951842.1|  two-component sensor histidine kinase [Oce...  67.4    9e-10
ref|NP_947934.1|  signal transduction histidine kinase, nitrog...  67.4    9e-10 
ref|ZP_01727801.1|  sensory box histidine kinase/response regu...  67.4    9e-10
ref|YP_221064.1|  sensor histidine kinase [Brucella abortus bv...  67.4    9e-10 
ref|YP_001817846.1|  multi-sensor hybrid histidine kinase [Opi...  67.4    9e-10 
ref|NP_977770.1|  sensor histidine kinase KinD [Bacillus cereu...  67.4    1e-09 
ref|ZP_01546779.1|  multi-sensor signal transduction histidine...  67.4    1e-09
ref|YP_722209.1|  cyclic nucleotide-binding protein [Trichodes...  67.4    1e-09 
ref|YP_002625922.1|  response regulator receiver domain protei...  67.4    1e-09 
ref|YP_343302.1|  hybrid signal transduction histidine kinase ...  67.4    1e-09 
ref|YP_127410.1|  sensor histidine kinase [Legionella pneumoph...  67.4    1e-09 
ref|ZP_03940707.1|  signal transduction histidine kinase [Lact...  67.4    1e-09
ref|YP_001644275.1|  PAS/PAC sensor signal transduction histid...  67.4    1e-09 
ref|YP_002484447.1|  response regulator receiver sensor hybrid...  67.4    1e-09 
ref|ZP_02089788.1|  hypothetical protein FAEPRAM212_00016 [Fae...  67.0    1e-09
ref|ZP_00237250.1|  sporulation kinase D [Bacillus cereus G924...  67.0    1e-09
ref|YP_634972.1|  sensory box histidine kinase/response regula...  67.0    1e-09 
gb|AAO22901.1|  histidine kinase [Myxococcus xanthus]              67.0    1e-09
ref|YP_771256.1|  putative transmembrane two-component sensor ...  67.0    1e-09 
ref|ZP_04283115.1|  hypothetical protein bcere0010_11950 [Baci...  67.0    1e-09
ref|YP_002848591.1|  sensor protein KdpD [Citrobacter sp. 30_2...  67.0    1e-09 
ref|NP_946678.1|  sensor histidine kinase [Rhodopseudomonas pa...  67.0    1e-09 
ref|ZP_04023402.1|  sensor histidine kinase [Lactobacillus reu...  67.0    1e-09
ref|ZP_03973874.1|  sensor histidine kinase [Lactobacillus reu...  67.0    1e-09
ref|YP_114634.1|  sensor histidine kinase KdpD [Methylococcus ...  67.0    1e-09 
ref|ZP_03633762.1|  hypothetical protein HOLDEFILI_01043 [Hold...  67.0    1e-09
ref|YP_001581583.1|  histidine kinase [Nitrosopumilus maritimu...  67.0    1e-09 
ref|ZP_01735187.1|  periplasmic sensor signal transduction his...  67.0    1e-09
ref|YP_001682262.1|  multi-sensor signal transduction histidin...  67.0    1e-09 
ref|YP_002139606.1|  signal transduction histidine kinase, nit...  67.0    1e-09 
ref|ZP_04092739.1|  hypothetical protein bthur0010_44060 [Baci...  67.0    1e-09
ref|ZP_03943722.1|  signal transduction histidine kinase [Lact...  67.0    1e-09
ref|YP_283452.1|  PAS [Dechloromonas aromatica RCB] >gb|AAZ449...  67.0    1e-09 
ref|YP_002453733.1|  sensor histidine kinase [Bacillus cereus ...  67.0    1e-09 
ref|YP_484308.1|  signal transduction histidine kinase, nitrog...  67.0    1e-09 
ref|ZP_03731440.1|  hypothetical protein CLOM621_01438 [Clostr...  67.0    1e-09
ref|YP_001305542.1|  multi-sensor signal transduction histidin...  67.0    1e-09 
ref|ZP_04190899.1|  hypothetical protein bcere0027_12290 [Baci...  67.0    1e-09
ref|ZP_01287416.1|  Response regulator receiver [delta proteob...  67.0    1e-09
ref|ZP_01290888.1|  Response regulator receiver [delta proteob...  66.6    2e-09
ref|NP_928715.1|  sensor protein KdpD [Photorhabdus luminescen...  66.6    2e-09 
ref|YP_085996.1|  sensor histidine kinase [Bacillus cereus E33...  66.6    2e-09 
ref|YP_002532200.1|  Two component system histidine kinase [Ba...  66.6    2e-09 
ref|YP_385506.1|  signal transduction histidine kinase, nitrog...  66.6    2e-09 
gb|ABB02535.1|  signal transduction histidine kinase [Lactobac...  66.6    2e-09
ref|YP_001323131.1|  integral membrane sensor signal transduct...  66.6    2e-09 
ref|YP_604379.1|  histidine kinase [Deinococcus geothermalis D...  66.6    2e-09 
ref|ZP_01543954.1|  sensor protein kinase [Oenococcus oeni ATC...  66.6    2e-09
ref|ZP_04288384.1|  hypothetical protein bcere0009_11800 [Baci...  66.6    2e-09
ref|YP_002679956.1|  periplasmic sensor signal transduction hi...  66.6    2e-09 
ref|YP_001866492.1|  Chase sensor signal transduction histidin...  66.6    2e-09 
ref|YP_038716.1|  sensor histidine kinase [Bacillus thuringien...  66.6    2e-09 
ref|ZP_00953910.1|  sensor histidine kinase [Sulfitobacter sp....  66.6    2e-09
ref|YP_002785098.1|  putative histidine kinase, classic [Deino...  66.6    2e-09 
ref|NP_692739.1|  two-component sensor histidine kinase [Ocean...  66.6    2e-09 
ref|YP_001368900.1|  integral membrane sensor signal transduct...  66.6    2e-09 
ref|YP_285694.1|  sensor histidine kinase [Dechloromonas aroma...  66.6    2e-09 
ref|YP_002340727.1|  sensor histidine kinase [Bacillus cereus ...  66.2    2e-09 
ref|ZP_03073504.1|  integral membrane sensor signal transducti...  66.2    2e-09
ref|YP_809802.1|  Signal transduction histidine kinase [Oenoco...  66.2    2e-09 
ref|YP_002890370.1|  PAS/PAC sensor signal transduction histid...  66.2    2e-09 
ref|YP_123578.1|  hypothetical protein lpp1254 [Legionella pne...  66.2    2e-09 
ref|ZP_02993196.1|  hypothetical protein CLOSPO_00238 [Clostri...  66.2    2e-09
ref|ZP_04132054.1|  hypothetical protein bthur0003_12080 [Baci...  66.2    2e-09
ref|YP_002383529.1|  sensor protein KdpD [Escherichia ferguson...  66.2    2e-09 
ref|ZP_03210067.1|  hypothetical protein BACPLE_03758 [Bactero...  66.2    2e-09
ref|ZP_04080874.1|  hypothetical protein bthur0012_45310 [Baci...  66.2    2e-09
emb|CAR67585.1|  sensor protein (histidine kinase) [Photorhabd...  66.2    2e-09
ref|ZP_02171750.1|  metal dependent phosphohydrolase [Bacillus...  66.2    2e-09
ref|ZP_03700404.1|  multi-sensor signal transduction histidine...  66.2    2e-09
ref|YP_002616492.1|  ATPase, histidine kinase-, DNA gyrase B-,...  66.2    2e-09 
ref|YP_002239668.1|  sensor protein KdpD [Klebsiella pneumonia...  66.2    2e-09 
ref|ZP_04277866.1|  hypothetical protein bcere0011_11940 [Baci...  66.2    2e-09
ref|NP_831117.1|  sporulation kinase D [Bacillus cereus ATCC 1...  66.2    2e-09 
ref|ZP_04255763.1|  hypothetical protein bcere0015_12080 [Baci...  66.2    2e-09
ref|YP_002417409.1|  hypothetical protein VS_1800 [Vibrio sple...  66.2    2e-09 
ref|YP_002714634.1|  ATPase, histidine kinase-, DNA gyrase B-,...  66.2    2e-09 
ref|ZP_04083495.1|  hypothetical protein bthur0011_11630 [Baci...  66.2    2e-09
ref|ZP_04101157.1|  hypothetical protein bthur0008_12140 [Baci...  66.2    2e-09
ref|ZP_04125510.1|  hypothetical protein bthur0004_12450 [Baci...  66.2    2e-09
ref|ZP_01255135.1|  two-component system sensor histidine kina...  66.2    2e-09
ref|YP_002279097.1|  PAS/PAC sensor signal transduction histid...  66.2    2e-09 
ref|ZP_02532922.1|  multi-sensor signal transduction histidine...  66.2    2e-09
ref|ZP_01064593.1|  hypothetical protein MED222_16191 [Vibrio ...  66.2    2e-09
ref|YP_002824645.1|  two component sensor histidine kinase pro...  66.2    2e-09 
ref|YP_115241.1|  nitrogen regulation protein NtrY, putative [...  66.2    2e-09 
ref|YP_002366117.1|  sensor histidine kinase KinD [Bacillus ce...  66.2    2e-09 
ref|ZP_00739433.1|  Sporulation kinase D [Bacillus thuringiens...  66.2    2e-09
ref|ZP_04064251.1|  hypothetical protein bthur0014_12240 [Baci...  66.2    2e-09
ref|ZP_04272454.1|  hypothetical protein bcere0012_12010 [Baci...  66.2    2e-09
ref|ZP_04150531.1|  hypothetical protein bpmyx0001_13280 [Baci...  65.9    2e-09
ref|ZP_03752368.1|  hypothetical protein ROSEINA2194_00771 [Ro...  65.9    2e-09
ref|YP_002698495.1|  nitrogen regulation protein NR(II) [Roseo...  65.9    2e-09 
ref|ZP_02418505.1|  hypothetical protein ANACAC_01087 [Anaeros...  65.9    2e-09
ref|YP_001334387.1|  sensor protein KdpD [Klebsiella pneumonia...  65.9    3e-09 
ref|YP_002444777.1|  sensor histidine kinase KinD [Bacillus ce...  65.9    3e-09 
ref|ZP_04156305.1|  hypothetical protein bmyco0003_12530 [Baci...  65.9    3e-09
ref|ZP_04119450.1|  hypothetical protein bthur0005_12210 [Baci...  65.9    3e-09
ref|ZP_01813225.1|  nitrogen regulation protein NR(II) [Vibrio...  65.9    3e-09
ref|YP_126604.1|  hypothetical protein lpl1253 [Legionella pne...  65.9    3e-09 
ref|ZP_04070930.1|  hypothetical protein bthur0013_12390 [Baci...  65.9    3e-09
ref|YP_001613702.1|  two-component hybrid sensor and regulator...  65.9    3e-09 
ref|YP_532446.1|  signal transduction histidine kinase, nitrog...  65.9    3e-09 
ref|ZP_00959116.1|  two-component hybrid sensor and regulator ...  65.9    3e-09
ref|YP_759952.1|  sensory box sensor histidine kinase FixL [Hy...  65.9    3e-09 
ref|YP_095321.1|  two component sensor kinase [Legionella pneu...  65.9    3e-09 
ref|ZP_03128700.1|  integral membrane sensor signal transducti...  65.9    3e-09
ref|YP_001250175.1|  sensor histidine kinase CpxA [Legionella ...  65.9    3e-09 
ref|YP_742456.1|  periplasmic sensor signal transduction histi...  65.9    3e-09 
ref|YP_001438720.1|  sensor protein KdpD [Enterobacter sakazak...  65.9    3e-09 
ref|YP_526489.1|  sensor histidine kinase [Saccharophagus degr...  65.9    3e-09 
ref|NP_762063.1|  FOG: CheY-like receiver [Vibrio vulnificus C...  65.9    3e-09 
ref|YP_002292030.1|  sensor protein KdpD [Escherichia coli SE1...  65.9    3e-09 
ref|ZP_04098789.1|  hypothetical protein bthur0009_44240 [Baci...  65.5    3e-09
ref|NP_936640.1|  hypothetical protein VVA0584 [Vibrio vulnifi...  65.5    3e-09 
ref|YP_002549529.1|  two component sensor kinase [Agrobacteriu...  65.5    3e-09 
ref|ZP_02041601.1|  hypothetical protein RUMGNA_02373 [Ruminoc...  65.5    3e-09
ref|ZP_03644165.1|  hypothetical protein BACCOPRO_02541 [Bacte...  65.5    3e-09
ref|YP_002794210.1|  Signal transduction histidine kinase [Lar...  65.5    3e-09 
ref|YP_578892.1|  histidine kinase [Nitrobacter hamburgensis X...  65.5    3e-09 
ref|ZP_04214420.1|  hypothetical protein bcere0023_45560 [Baci...  65.5    4e-09
ref|ZP_03767561.1|  response regulator receiver sensor signal ...  65.5    4e-09
ref|YP_001564997.1|  PAS/PAC sensor signal transduction histid...  65.5    4e-09 
ref|YP_001560959.1|  integral membrane sensor signal transduct...  65.5    4e-09 
ref|YP_001834576.1|  integral membrane sensor signal transduct...  65.5    4e-09 
ref|NP_384556.1|  putative sensor histidine kinase transmembra...  65.5    4e-09 
ref|ZP_04107393.1|  hypothetical protein bthur0007_11980 [Baci...  65.5    4e-09
ref|ZP_02147688.1|  sensor histidine kinase [Phaeobacter galla...  65.5    4e-09
ref|ZP_01907183.1|  Signal transduction histidine kinase [Ples...  65.5    4e-09
ref|ZP_04077627.1|  hypothetical protein bthur0012_12420 [Baci...  65.5    4e-09
ref|YP_001976304.1|  two-component sensor histidine kinase nit...  65.5    4e-09 
ref|YP_126943.1|  sensor histidine kinase [Legionella pneumoph...  65.5    4e-09 
ref|YP_002675770.1|  ATPase, histidine kinase-, DNA gyrase B-,...  65.5    4e-09 
ref|ZP_04308325.1|  hypothetical protein bcere0005_43340 [Baci...  65.5    4e-09
ref|ZP_03712250.1|  hypothetical protein CORMATOL_03106 [Coryn...  65.5    4e-09
ref|ZP_04089536.1|  hypothetical protein bthur0010_11830 [Baci...  65.5    4e-09
ref|ZP_04095588.1|  hypothetical protein bthur0009_11910 [Baci...  65.5    4e-09
ref|ZP_03238428.1|  sensor histidine kinase KinD [Bacillus cer...  65.5    4e-09
ref|YP_853326.1|  sensory histidine kinase AtoS [Escherichia c...  65.5    4e-09 
ref|YP_670159.1|  sensory histidine kinase AtoS [Escherichia c...  65.5    4e-09 
ref|ZP_01135898.1|  hypothetical protein PTD2_09494 [Pseudoalt...  65.5    4e-09
ref|YP_541499.1|  sensory histidine kinase AtoS [Escherichia c...  65.1    4e-09 
ref|YP_123716.1|  sensor histidine kinase [Legionella pneumoph...  65.1    4e-09 
ref|YP_001419512.1|  multi-sensor hybrid histidine kinase [Xan...  65.1    4e-09 
ref|ZP_04253430.1|  hypothetical protein bcere0016_45230 [Baci...  65.1    4e-09
ref|ZP_03107964.1|  sensor histidine kinase KinD [Bacillus cer...  65.1    4e-09
ref|YP_082826.1|  sensor histidine kinase; sporulation kinase ...  65.1    4e-09 
ref|NP_841991.1|  sensory transduction histidine kinase [Nitro...  65.1    4e-09 
ref|ZP_04005082.1|  sensory histidine kinase AtoS [Escherichia...  65.1    4e-09
ref|ZP_03102838.1|  sensor histidine kinase KinD [Bacillus cer...  65.1    4e-09
ref|ZP_04119573.1|  hypothetical protein bthur0005_13460 [Baci...  65.1    4e-09
ref|ZP_04342478.1|  histidine kinase [Desulfomicrobium baculat...  65.1    4e-09
ref|YP_002310777.1|  PAS domain protein [Shewanella piezotoler...  65.1    4e-09 
ref|ZP_03228377.1|  hypothetical protein Bcoam_21676 [Bacillus...  65.1    4e-09
ref|ZP_02203287.1|  multi-sensor hybrid histidine kinase [Deha...  65.1    5e-09
ref|NP_754648.1|  sensory histidine kinase AtoS [Escherichia c...  65.1    5e-09 
ref|ZP_04266718.1|  hypothetical protein bcere0013_12440 [Baci...  65.1    5e-09
ref|ZP_04322396.1|  hypothetical protein bcere0001_11970 [Baci...  65.1    5e-09
ref|ZP_03307509.1|  hypothetical protein BACFIN_01849 [Bactero...  65.1    5e-09
ref|ZP_04083615.1|  hypothetical protein bthur0011_12830 [Baci...  65.1    5e-09
ref|YP_002337458.1|  sensor histidine kinase KinD [Bacillus ce...  65.1    5e-09 
ref|YP_472839.1|  two-component sensor histidine kinase protei...  65.1    5e-09 
ref|YP_002529127.1|  sensor histidine kinase; possible sporula...  65.1    5e-09 
ref|YP_002396711.1|  sensor protein KdpD [Escherichia coli ED1...  65.1    5e-09 
ref|ZP_02925114.1|  two-component sensor histidine kinase [Ver...  65.1    5e-09
ref|YP_851813.1|  sensor protein KdpD [Escherichia coli APEC O...  65.1    5e-09 
ref|YP_539723.1|  sensor protein KdpD [Escherichia coli UTI89]...  65.1    5e-09 
ref|YP_323508.1|  PAS/PAC sensor hybrid histidine kinase [Anab...  65.1    5e-09 
ref|ZP_03035569.1|  sensor protein KdpD [Escherichia coli F11]...  65.1    5e-09
ref|ZP_04113913.1|  hypothetical protein bthur0006_12290 [Baci...  65.1    5e-09
ref|ZP_04224870.1|  hypothetical protein bcere0021_44950 [Baci...  65.1    5e-09
ref|NP_977904.1|  sensor histidine kinase, putative [Bacillus ...  65.1    5e-09 
ref|YP_001927569.1|  PAS/PAC sensor hybrid histidine kinase [M...  65.1    5e-09 
ref|ZP_03229523.1|  sensor histidine kinase KinD [Bacillus cer...  65.1    5e-09
ref|YP_002289075.1|  nitrogen regulation protein NtrB [Oligotr...  65.1    5e-09 
ref|ZP_01912044.1|  multi-sensor hybrid histidine kinase [Ples...  65.1    5e-09
gb|ABD75783.1|  putative signal transduction histidine kinase ...  65.1    5e-09
ref|ZP_04202278.1|  hypothetical protein bcere0025_11930 [Baci...  65.1    5e-09
ref|ZP_01004726.1|  sensory box sensor histidine kianse/respon...  65.1    5e-09
ref|ZP_04193945.1|  hypothetical protein bcere0027_43450 [Baci...  65.1    5e-09
ref|ZP_03337032.1|  sensor protein KdpD [Salmonella enterica s...  65.1    5e-09
ref|YP_001307580.1|  integral membrane sensor signal transduct...  65.1    5e-09 
ref|ZP_02947988.1|  sensor histidine kinase [Clostridium butyr...  65.1    5e-09
ref|ZP_04316532.1|  hypothetical protein bcere0002_11950 [Baci...  65.1    5e-09
ref|YP_589829.1|  periplasmic sensor signal transduction histi...  65.1    5e-09 
ref|ZP_04211176.1|  hypothetical protein bcere0023_12840 [Baci...  65.1    5e-09
ref|ZP_04305214.1|  hypothetical protein bcere0005_12050 [Baci...  65.1    5e-09
ref|ZP_01093572.1|  sensor histidine kinase/response regulator...  64.7    6e-09
ref|YP_390337.1|  periplasmic sensor hybrid histidine kinase [...  64.7    6e-09 
ref|YP_002608618.1|  ATPase, histidine kinase-, DNA gyrase B-,...  64.7    6e-09 
ref|ZP_01102004.1|  Sensor protein zraS [gamma proteobacterium...  64.7    6e-09
ref|ZP_04250215.1|  hypothetical protein bcere0016_12820 [Baci...  64.7    6e-09
ref|YP_001514624.1|  two-component sensor histidine kinase [Ac...  64.7    6e-09 
ref|YP_165803.1|  sensor histidine kinase [Ruegeria pomeroyi D...  64.7    6e-09 
ref|ZP_00391663.1|  COG0642: Signal transduction histidine kin...  64.7    6e-09
ref|ZP_04150398.1|  hypothetical protein bpmyx0001_11950 [Baci...  64.7    6e-09
ref|ZP_04156173.1|  hypothetical protein bmyco0003_11210 [Baci...  64.7    6e-09
ref|ZP_04161986.1|  hypothetical protein bmyco0002_11500 [Baci...  64.7    6e-09
ref|ZP_04216703.1|  hypothetical protein bcere0022_10630 [Baci...  64.7    6e-09
ref|ZP_04002135.1|  histidine kinase [Escherichia coli 83972] ...  64.7    6e-09
ref|NP_752710.1|  sensor protein KdpD [Escherichia coli CFT073...  64.7    6e-09 
ref|YP_002622629.1|  ATPase, histidine kinase-, DNA gyrase B-,...  64.7    6e-09 
ref|NP_834372.1|  two component system histidine kinase [Bacil...  64.7    6e-09 
ref|ZP_01046492.1|  Nitrogen regulation protein ntrB [Nitrobac...  64.7    6e-09
ref|YP_001789094.1|  histidine kinase [Leptothrix cholodnii SP...  64.7    6e-09 
ref|ZP_02392649.1|  sensor histidine kinase KinD [Bacillus ant...  64.7    6e-09
ref|YP_156114.1|  hybrid sensor histidine kinase [Idiomarina l...  64.7    6e-09 
ref|ZP_04241679.1|  hypothetical protein bcere0018_43790 [Baci...  64.7    6e-09
ref|NP_843811.1|  sensor histidine kinase KinD [Bacillus anthr...  64.7    6e-09 
ref|YP_431662.1|  Signal transduction histidine kinase regulat...  64.7    6e-09 
ref|YP_002398594.1|  sensory histidine kinase AtoS [Escherichi...  64.7    6e-09 
ref|ZP_01462478.1|  histidine kinase [Stigmatella aurantiaca D...  64.7    6e-09
ref|YP_864671.1|  PAS/PAC sensor signal transduction histidine...  64.7    6e-09 
ref|YP_002386139.1|  sensor protein KdpD [Escherichia coli IAI...  64.7    6e-09 
ref|NP_485322.1|  two-component hybrid sensor and regulator [N...  64.7    6e-09 
ref|YP_001395646.1|  sensory transduction histidine kinase [Cl...  64.7    6e-09 
ref|YP_002884815.1|  histidine kinase [Exiguobacterium sp. AT1...  64.7    6e-09 
ref|YP_001641867.1|  PAS sensor protein [Methylobacterium exto...  64.7    6e-09 
ref|ZP_02179290.1|  sensory box histidine kinase [Hydrogenivir...  64.7    7e-09
ref|NP_254171.1|  two-component sensor [Pseudomonas aeruginosa...  64.7    7e-09 
ref|YP_002089048.1|  hypothetical protein PA2G_03824 [Pseudomo...  64.7    7e-09 
ref|ZP_04299638.1|  hypothetical protein bcere0006_11870 [Baci...  64.7    7e-09
ref|ZP_03127477.1|  response regulator receiver sensor signal ...  64.7    7e-09
ref|ZP_03046620.1|  sensor protein KdpD [Escherichia coli E22]...  64.7    7e-09
ref|ZP_04344711.1|  PAS domain S-box protein [Desulfomicrobium...  64.7    7e-09
ref|YP_002472457.1|  hypothetical protein CKR_1992 [Clostridiu...  64.7    7e-09 
ref|YP_486496.1|  signal transduction histidine kinase, nitrog...  64.7    7e-09 
ref|YP_474381.1|  sensor histidine kinase [Synechococcus sp. J...  64.7    7e-09 
ref|YP_309639.1|  sensor protein KdpD [Shigella sonnei Ss046] ...  64.7    7e-09 
ref|ZP_03412098.1|  sensor protein KdpD [Salmonella enterica s...  64.7    7e-09
ref|ZP_03640408.1|  hypothetical protein PROVRETT_03509 [Provi...  64.3    7e-09
ref|YP_001735598.1|  two-component hybrid sensor kinase/respon...  64.3    7e-09 
ref|YP_567208.1|  ATP-binding region, ATPase-like [Rhodopseudo...  64.3    7e-09 
ref|ZP_02733136.1|  GAF sensor hybrid histidine kinase [Gemmat...  64.3    7e-09
ref|YP_535104.1|  two component system histidine kinase [Lacto...  64.3    7e-09 
ref|YP_590666.1|  PAS/PAC sensor signal transduction histidine...  64.3    8e-09 
ref|ZP_04185203.1|  hypothetical protein bcere0028_12070 [Baci...  64.3    8e-09
gb|ACI86646.1|  sensor for high-affinity potassium transport s...  64.3    8e-09
ref|ZP_03066253.1|  sensor protein KdpD [Shigella dysenteriae ...  64.3    8e-09
ref|NP_286408.1|  sensor protein KdpD [Escherichia coli O157:H...  64.3    8e-09 
ref|ZP_03029017.1|  sensor protein KdpD [Escherichia coli B7A]...  64.3    8e-09
ref|ZP_04216826.1|  hypothetical protein bcere0022_11900 [Baci...  64.3    8e-09
ref|YP_002411535.1|  sensor protein KdpD [Escherichia coli UMN...  64.3    8e-09 
ref|YP_002406680.1|  sensor protein KdpD [Escherichia coli IAI...  64.3    8e-09 
ref|YP_001742806.1|  sensor protein KdpD [Escherichia coli SMS...  64.3    8e-09 
ref|ZP_03071300.1|  sensor protein KdpD [Escherichia coli 101-...  64.3    8e-09
ref|YP_001487.1|  histidine kinase sensor protein [Leptospira ...  64.3    8e-09 
ref|NP_415223.1|  fused sensory histidine kinase in two-compon...  64.3    8e-09 
ref|ZP_02999031.1|  osmosensitive K+ channel His kinase sensor...  64.3    8e-09
ref|YP_001457493.1|  sensor protein KdpD [Escherichia coli HS]...  64.3    8e-09 
ref|YP_001879306.1|  sensor protein KdpD [Shigella boydii CDC ...  64.3    8e-09 
ref|ZP_03230895.1|  sensor histidine kinase [Bacillus cereus A...  64.3    8e-09
ref|YP_002543261.1|  two-component sensor histidine kinase pro...  64.3    8e-09 
ref|YP_793961.1|  putative two-component sensor [Pseudomonas a...  64.3    8e-09 
ref|ZP_04009680.1|  two component system histidine kinase [Lac...  64.3    8e-09
ref|ZP_01448581.1|  Nitrogen regulation protein, NtrB signal t...  64.3    8e-09
ref|YP_407075.1|  sensor protein KdpD [Shigella boydii Sb227] ...  64.3    8e-09 
ref|YP_001461857.1|  sensor protein KdpD [Escherichia coli E24...  64.3    8e-09 
ref|NP_953958.1|  sensor histidine kinase [Geobacter sulfurred...  64.3    8e-09 
ref|ZP_00053406.1|  COG3852: Signal transduction histidine kin...  64.3    8e-09
ref|ZP_03108153.1|  sensor histidine kinase [Bacillus cereus N...  64.3    9e-09
ref|YP_581548.1|  histidine kinase [Psychrobacter cryohalolent...  64.3    9e-09 
ref|YP_002620424.1|  ATPase, histidine kinase-, DNA gyrase B-,...  64.3    9e-09 
ref|YP_520549.1|  hypothetical protein DSY4316 [Desulfitobacte...  64.3    9e-09 
ref|ZP_02396404.1|  sensor histidine kinase [Bacillus anthraci...  64.3    9e-09
ref|YP_001423292.1|  putative signal transduction histidine ki...  64.3    9e-09 
ref|NP_712602.1|  two-component hybrid sensor and regulator [L...  64.3    9e-09 
ref|YP_421729.1|  Signal transduction histidine kinase [Magnet...  64.3    9e-09 
ref|ZP_04417014.1|  osmosensitive K+ channel histidine kinase ...  64.3    9e-09
ref|ZP_03316061.1|  hypothetical protein PROVRUST_02885 [Provi...  64.3    9e-09
ref|YP_896963.1|  sensor histidine kinase [Bacillus thuringien...  64.3    9e-09 
ref|YP_508588.1|  periplasmic sensor signal transduction histi...  64.3    9e-09 
ref|ZP_01948218.1|  sensor histidine kinase [Vibrio cholerae 1...  64.3    9e-09
ref|NP_847119.1|  sensor histidine kinase [Bacillus anthracis ...  63.9    9e-09 
ref|YP_001683970.1|  PAS/PAC sensor signal transduction histid...  63.9    1e-08 
ref|NP_631287.1|  two-component system sensor kinase [Streptom...  63.9    1e-08 
ref|NP_105594.1|  histidine protein kinase sensor for nitrogen...  63.9    1e-08 
ref|ZP_04497502.1|  PAS domain S-box protein [Sphaerobacter th...  63.9    1e-08
ref|YP_002176955.1|  sensor histidine kinase [Vibrio cholerae ...  63.9    1e-08 
ref|YP_001088079.1|  putative two-component histidine kinase [...  63.9    1e-08 
ref|ZP_02212852.1|  hypothetical protein CLOBAR_02471 [Clostri...  63.9    1e-08
ref|ZP_04416238.1|  osmosensitive K+ channel histidine kinase ...  63.9    1e-08
ref|YP_097611.1|  two-component system sensor histidine kinase...  63.9    1e-08 
ref|YP_002723452.1|  sensor histidine kinase [Vibrio cholerae ...  63.9    1e-08 
ref|ZP_04116961.1|  hypothetical protein bthur0006_43090 [Baci...  63.9    1e-08
ref|YP_002315401.1|  Redox sensor histidine kinase ResE [Anoxy...  63.9    1e-08 
ref|ZP_03288116.1|  hypothetical protein CLONEX_00300 [Clostri...  63.9    1e-08
ref|NP_952058.1|  sensory box histidine kinase [Geobacter sulf...  63.9    1e-08 
ref|ZP_02087677.1|  hypothetical protein CLOBOL_05222 [Clostri...  63.9    1e-08
ref|ZP_04321054.1|  hypothetical protein bcere0002_57900 [Baci...  63.9    1e-08
sp|P10578.1|NTRB_BRASR  RecName: Full=Nitrogen regulation prot...  63.9    1e-08
ref|YP_210013.1|  putative two-component system sensor histidi...  63.9    1e-08 
ref|ZP_01679430.1|  sensor histidine kinase [Vibrio cholerae V...  63.9    1e-08
ref|ZP_04423214.1|  PAS domain S-box protein [Rhodothermus mar...  63.9    1e-08
ref|YP_001205856.1|  nitrogen regulation protein [Bradyrhizobi...  63.9    1e-08 
ref|ZP_03360921.1|  sensor protein KdpD [Salmonella enterica s...  63.9    1e-08
ref|ZP_04148028.1|  hypothetical protein bthur0001_45870 [Baci...  63.9    1e-08
ref|ZP_04122573.1|  hypothetical protein bthur0005_43950 [Baci...  63.9    1e-08
ref|ZP_03132700.1|  histidine kinase [Chthoniobacter flavus El...  63.9    1e-08
gb|AAC06271.1|  hybrid histidine kinase homolog [Pseudomonas f...  63.9    1e-08
ref|NP_353418.1|  two component sensor kinase [Agrobacterium t...  63.9    1e-08 
ref|ZP_03015589.1|  hypothetical protein BACINT_03180 [Bactero...  63.9    1e-08
ref|ZP_03100614.1|  sensor histidine kinase [Bacillus cereus W...  63.9    1e-08
ref|ZP_01043503.1|  Hybrid sensor histidine kinase (HisK, 2 Ch...  63.9    1e-08
ref|ZP_04110700.1|  hypothetical protein bthur0007_45430 [Baci...  63.9    1e-08
ref|ZP_04329401.1|  signal transduction histidine kinase, COG0...  63.9    1e-08
ref|YP_002752031.1|  sensor histidine kinase [Bacillus cereus ...  63.9    1e-08 
ref|ZP_04128785.1|  hypothetical protein bthur0004_45580 [Baci...  63.9    1e-08
ref|YP_002704661.1|  periplasmic sensor signal transduction hi...  63.9    1e-08 
ref|ZP_02902121.1|  sensor protein KdpD [Escherichia albertii ...  63.9    1e-08
ref|ZP_01632152.1|  Response Regulator Receiver Signal Transdu...  63.9    1e-08
ref|YP_002536831.1|  histidine kinase [Geobacter sp. FRC-32] >...  63.5    1e-08 
ref|ZP_04402764.1|  osmosensitive K+ channel histidine kinase ...  63.5    1e-08
ref|ZP_04168058.1|  hypothetical protein bmyco0001_13160 [Baci...  63.5    1e-08
ref|ZP_04074337.1|  hypothetical protein bthur0013_46690 [Baci...  63.5    1e-08
ref|ZP_04144810.1|  hypothetical protein bthur0001_13390 [Baci...  63.5    1e-08
ref|YP_001240041.1|  signal transduction histidine kinase, nit...  63.5    1e-08 
ref|ZP_02418673.1|  hypothetical protein ANACAC_01256 [Anaeros...  63.5    1e-08
ref|ZP_01747140.1|  nitrogen regulation protein NtrB [Sagittul...  63.5    1e-08
ref|YP_313776.1|  multi-sensor Signal transduction histidine k...  63.5    1e-08 
ref|ZP_00740755.1|  Two component system histidine kinase [Bac...  63.5    1e-08
ref|NP_232922.1|  sensor histidine kinase [Vibrio cholerae O1 ...  63.5    1e-08 
ref|YP_002448235.1|  sensor histidine kinase [Bacillus cereus ...  63.5    1e-08 
ref|YP_001020009.1|  PAS/PAC sensor hybrid histidine kinase [M...  63.5    1e-08 
ref|ZP_04067320.1|  hypothetical protein bthur0014_43510 [Baci...  63.5    1e-08
ref|NP_763089.1|  Signal transduction histidine kinase [Vibrio...  63.5    1e-08 
ref|NP_936064.1|  signal transduction histidine kinase [Vibrio...  63.5    1e-08 
ref|ZP_04104397.1|  hypothetical protein bthur0008_44860 [Baci...  63.5    1e-08
ref|ZP_04535175.1|  sensory histidine kinase AtoS [Escherichia...  63.5    1e-08
ref|ZP_02146911.1|  periplasmic sensor signal transduction his...  63.5    1e-08
ref|ZP_01908487.1|  probable serine/threonine kinase protein w...  63.5    1e-08
ref|YP_629337.1|  sensory box histidine kinase [Myxococcus xan...  63.5    1e-08 
gb|AAD47419.1|AF100457_2  histidine kinase [Myxococcus xanthus]    63.5    1e-08
ref|YP_001038239.1|  Hpt sensor hybrid histidine kinase [Clost...  63.5    1e-08 
ref|YP_002432099.1|  PAS/PAC sensor signal transduction histid...  63.5    1e-08 
ref|YP_001990553.1|  ATP-binding region ATPase domain protein ...  63.5    1e-08 
ref|ZP_04141670.1|  hypothetical protein bthur0002_45310 [Baci...  63.5    1e-08
ref|YP_001927212.1|  integral membrane sensor signal transduct...  63.5    1e-08 
ref|ZP_01076273.1|  two-component sensor NtrB [Marinomonas sp....  63.5    1e-08
ref|YP_002334404.1|  sensor histidine kinase [Thermosipho afri...  63.5    1e-08 
ref|YP_001515990.1|  serine/threonine protein kinase and signa...  63.5    1e-08 
ref|ZP_04314085.1|  hypothetical protein bcere0004_44710 [Baci...  63.5    1e-08
ref|ZP_02170887.1|  Histidine kinase [Bacillus selenitireducen...  63.5    1e-08
ref|YP_001374380.1|  integral membrane sensor signal transduct...  63.5    1e-08 
ref|ZP_03227871.1|  histidine kinase [Bacillus coahuilensis m4-4]  63.5    1e-08
ref|ZP_00239815.1|  sensor histidine kinase, putative [Bacillu...  63.5    1e-08
ref|YP_002619586.1|  PAS fold family [Microcoleus chthonoplast...  63.5    1e-08 
ref|YP_001206937.1|  two-component sensor histidine kinase [Br...  63.5    1e-08 
ref|YP_001379564.1|  histidine kinase [Anaeromyxobacter sp. Fw...  63.5    1e-08 
ref|YP_002512285.1|  PAS/PAC sensor signal transduction histid...  63.5    2e-08 
ref|YP_095466.1|  sensor histidine kinase CpxA [Legionella pne...  63.5    2e-08 
ref|YP_349703.1|  multi-sensor hybrid histidine kinase [Pseudo...  63.5    2e-08 
ref|ZP_01905715.1|  sensory box histidine kinase/response regu...  63.5    2e-08
ref|ZP_04205384.1|  hypothetical protein bcere0025_43410 [Baci...  63.5    2e-08
ref|YP_002687329.1|  sensor histidine kinase [Rhodobacteraceae...  63.5    2e-08 
gb|AAQ18124.1|  CpxA [Legionella pneumophila]                      63.5    2e-08
ref|YP_035560.1|  sensor histidine kinase; sporulation kinase ...  63.2    2e-08 
ref|YP_928087.1|  putative two-component sensor histidine kina...  63.2    2e-08 
ref|YP_002529248.1|  sensor histidine kinase, putative [Bacill...  63.2    2e-08 
ref|ZP_04288502.1|  hypothetical protein bcere0009_12990 [Baci...  63.2    2e-08
ref|ZP_03208334.1|  hypothetical protein BACPLE_01978 [Bactero...  63.2    2e-08
ref|ZP_04244285.1|  hypothetical protein bcere0017_11690 [Baci...  63.2    2e-08
ref|ZP_01048098.1|  Signal transduction histidine kinase [Nitr...  63.2    2e-08
ref|YP_917890.1|  signal transduction histidine kinase, nitrog...  63.2    2e-08 
ref|YP_001832640.1|  signal transduction histidine kinase, nit...  63.2    2e-08 
ref|YP_001528313.1|  signal transduction histidine kinase, nit...  63.2    2e-08 
ref|ZP_02092769.1|  hypothetical protein FAEPRAM212_03072 [Fae...  63.2    2e-08
ref|YP_001744413.1|  sensory box histidine kinase AtoS [Escher...  63.2    2e-08 
ref|YP_001379573.1|  histidine kinase [Anaeromyxobacter sp. Fw...  63.2    2e-08 
ref|ZP_04281053.1|  hypothetical protein bcere0011_44020 [Baci...  63.2    2e-08
ref|ZP_03680931.1|  hypothetical protein BACCELL_05305 [Bacter...  63.2    2e-08
ref|ZP_03037812.1|  ATP-binding region ATPase domain protein [...  63.2    2e-08
ref|ZP_03660938.1|  putative histidine kinase sensor protein [...  63.2    2e-08
ref|ZP_03653305.1|  integral membrane sensor signal transducti...  63.2    2e-08
ref|YP_002154865.1|  nitrogen regulation protein NtrB [Vibrio ...  63.2    2e-08 
ref|YP_001381313.1|  multi-sensor signal transduction histidin...  63.2    2e-08 
ref|ZP_03543300.1|  PAS/PAC sensor signal transduction histidi...  63.2    2e-08
ref|YP_203479.1|  nitrogen regulation protein NR(II) [Vibrio f...  63.2    2e-08 
ref|YP_001374499.1|  signal transduction histidine kinase, nit...  63.2    2e-08 
ref|YP_001547164.1|  integral membrane sensor signal transduct...  63.2    2e-08 
ref|NP_923962.1|  two-component hybrid sensor and regulator [G...  63.2    2e-08 
ref|YP_001235152.1|  signal transduction histidine kinase, nit...  63.2    2e-08 
ref|NP_805923.1|  sensor protein KdpD [Salmonella enterica sub...  63.2    2e-08 
ref|NP_455263.1|  sensor protein KdpD [Salmonella enterica sub...  63.2    2e-08 
ref|YP_002369468.1|  sensor histidine kinase [Bacillus cereus ...  63.2    2e-08 
ref|NP_635229.1|  two component system histidine kinase [Metha...  63.2    2e-08 
ref|ZP_02632904.1|  sensor histidine kinase KdpD [Clostridium ...  63.2    2e-08
ref|YP_001547526.1|  integral membrane sensor signal transduct...  63.2    2e-08 
ref|YP_001021320.1|  multi-sensor signal transduction histidin...  63.2    2e-08 
ref|YP_001325780.1|  integral membrane sensor signal transduct...  63.2    2e-08 
ref|YP_372848.1|  PAS/PAC sensor hybrid histidine kinase [Burk...  63.2    2e-08 
ref|YP_002481335.1|  PAS/PAC sensor signal transduction histid...  63.2    2e-08 
ref|YP_358164.1|  two component sensor histidine kinase [Pelob...  63.2    2e-08 
ref|ZP_03166930.1|  hypothetical protein RUMLAC_00587 [Ruminoc...  62.8    2e-08
ref|YP_001496570.1|  Na+/proline symporter and signal transduc...  62.8    2e-08 
ref|YP_537512.1|  Na+/proline symporter and signal transductio...  62.8    2e-08 
ref|ZP_01227544.1|  nitrogen regulation protein NTRB [Aurantim...  62.8    2e-08
ref|NP_969810.1|  nitrogen regulation protein NtrY [Bdellovibr...  62.8    2e-08 
ref|ZP_03906006.1|  PAS domain S-box [Denitrovibrio acetiphilu...  62.8    2e-08
ref|ZP_03036885.1|  PAS sensor protein [Geobacillus sp. Y412MC...  62.8    2e-08
ref|YP_592790.1|  multi-sensor signal transduction histidine k...  62.8    2e-08 
ref|YP_001792936.1|  PAS/PAC sensor signal transduction histid...  62.8    2e-08 
ref|YP_001351594.1|  alginate biosynthesis sensor protein KinB...  62.8    2e-08 
ref|ZP_01288425.1|  ATP-binding region, ATPase-like:Histidine ...  62.8    2e-08
ref|YP_002794064.1|  AtoS [Laribacter hongkongensis HLHK9] >gb...  62.8    2e-08 
ref|YP_002423585.1|  PAS/PAC sensor hybrid histidine kinase [M...  62.8    2e-08 
ref|YP_591856.1|  histidine kinase [Acidobacteria bacterium El...  62.8    2e-08 
ref|YP_569719.1|  signal transduction histidine kinase, nitrog...  62.8    2e-08 
ref|ZP_04477267.1|  histidine kinase [Streptosporangium roseum...  62.8    2e-08
ref|ZP_04227024.1|  hypothetical protein bcere0020_12980 [Baci...  62.8    2e-08
ref|YP_364898.1|  two-component system sensor histidine kinase...  62.8    2e-08 
ref|ZP_03737945.1|  PAS/PAC sensor hybrid histidine kinase [De...  62.8    2e-08
ref|ZP_02901889.1|  sensory box histidine kinase AtoS [Escheri...  62.8    2e-08
ref|YP_385731.1|  histidine kinase [Geobacter metallireducens ...  62.8    2e-08 
ref|ZP_04432544.1|  GAF sensor hybrid histidine kinase [Bacill...  62.8    2e-08
ref|YP_383522.1|  histidine kinase [Geobacter metallireducens ...  62.8    2e-08 
ref|YP_001215305.1|  sensor histidine kinase [Vibrio cholerae ...  62.8    2e-08 
ref|ZP_02293964.1|  multi-sensor signal transduction histidine...  62.8    2e-08
ref|ZP_04286343.1|  hypothetical protein bcere0010_44540 [Baci...  62.8    2e-08
ref|ZP_01915924.1|  two-component hybrid sensor and regulator ...  62.8    2e-08
ref|ZP_03681122.1|  hypothetical protein BACCELL_05497 [Bacter...  62.8    3e-08
ref|YP_970766.1|  signal transduction histidine kinase with Ch...  62.8    3e-08 
gb|ABD75785.1|  putative signal transduction histidine kinase ...  62.8    3e-08
ref|NP_437702.1|  putative two-component sensor histidine kina...  62.8    3e-08 
ref|ZP_04232746.1|  hypothetical protein bcere0019_11980 [Baci...  62.8    3e-08
emb|CAJ74703.1|  hypothetical protein [Candidatus Kuenenia stu...  62.8    3e-08
ref|ZP_03959808.1|  sensor histidine kinase [Lactobacillus vag...  62.8    3e-08
ref|YP_002259376.1|  two-component transmembrane sensor histid...  62.8    3e-08 
ref|ZP_03239157.1|  sensor histidine kinase [Bacillus cereus H...  62.8    3e-08
ref|ZP_03503818.1|  probable two-component sensor histidine ki...  62.8    3e-08
ref|YP_504103.1|  multi-sensor signal transduction histidine k...  62.8    3e-08 
gb|ACF09742.1|  integral membrane sensor signal transduction h...  62.8    3e-08
ref|ZP_01728402.1|  two-component hybrid sensor and regulator ...  62.8    3e-08
ref|ZP_03632730.1|  hypothetical protein HOLDEFILI_00004 [Hold...  62.8    3e-08
ref|ZP_04291613.1|  hypothetical protein bcere0009_44310 [Baci...  62.8    3e-08
ref|ZP_04283237.1|  hypothetical protein bcere0010_13180 [Baci...  62.4    3e-08
ref|ZP_01752801.1|  sensor histidine kinase [Roseobacter sp. S...  62.4    3e-08
ref|YP_001212147.1|  hypothetical protein PTH_1597 [Pelotomacu...  62.4    3e-08 
ref|YP_001470015.1|  multi-sensor signal transduction histidin...  62.4    3e-08 
ref|ZP_01462609.1|  phytochrome [Stigmatella aurantiaca DW4/3-...  62.4    3e-08
ref|ZP_04353297.1|  signal transduction histidine kinase, COG0...  62.4    3e-08
ref|ZP_02181463.1|  sensory transduction histidine kinase [Fla...  62.4    3e-08
ref|ZP_01619691.1|  Response Regulator Receiver Signal Transdu...  62.4    3e-08
ref|ZP_04322518.1|  hypothetical protein bcere0001_13220 [Baci...  62.4    3e-08
ref|ZP_02959656.1|  hypothetical protein PROSTU_01540 [Provide...  62.4    3e-08
ref|ZP_02243542.1|  two-component system sensor protein [Xanth...  62.4    3e-08
ref|ZP_03208065.1|  hypothetical protein BACPLE_01699 [Bactero...  62.4    3e-08
ref|NP_932990.1|  nitrogen regulation protein NR(II) [Vibrio v...  62.4    3e-08 
ref|YP_002241056.1|  sensor protein ZraS [Klebsiella pneumonia...  62.4    3e-08 
ref|YP_002617382.1|  PAS fold family [Microcoleus chthonoplast...  62.4    3e-08 
gb|AAO09394.1|AE016799_292  Nitrogen regulation protein NtrB [...  62.4    3e-08 
ref|NP_766897.1|  two-component sensor histidine kinase [Brady...  62.4    3e-08 
ref|YP_002315907.1|  Signal transduction histidine kinase [Ano...  62.4    3e-08 
ref|YP_544294.1|  multi-sensor signal transduction histidine k...  62.4    3e-08 
ref|ZP_01966887.1|  hypothetical protein RUMTOR_00428 [Ruminoc...  62.4    3e-08
ref|ZP_02621902.1|  sensor histidine kinase [Clostridium botul...  62.4    3e-08
ref|YP_001549416.1|  integral membrane sensor signal transduct...  62.4    3e-08 
ref|ZP_00991789.1|  hypothetical protein V12B01_03918 [Vibrio ...  62.4    3e-08
ref|ZP_01956013.1|  sensor histidine kinase [Vibrio cholerae M...  62.4    3e-08
ref|YP_002071761.1|  sensor histidine kinase [Vibrio cholerae ...  62.4    3e-08 
ref|YP_002827870.1|  sensory transduction histidine kinase [Rh...  62.4    3e-08 
ref|NP_487315.1|  two-component hybrid sensor and regulator [N...  62.4    3e-08 
ref|YP_002664889.1|  periplasmic sensor signal transduction hi...  62.4    3e-08 
ref|ZP_01291081.1|  ATP-binding region, ATPase-like [delta pro...  62.4    3e-08
ref|ZP_00942912.1|  Sensor protein fixL [Ralstonia solanacearu...  62.4    3e-08
sp|O34206.1|KINB_PSEAE  RecName: Full=Alginate biosynthesis se...  62.4    3e-08
ref|ZP_02069748.1|  hypothetical protein BACUNI_01163 [Bactero...  62.4    3e-08
ref|ZP_03858570.1|  histidine kinase [Thermobaculum terrenum A...  62.4    3e-08
ref|YP_002254531.1|  two-component transmembrane sensor histid...  62.4    4e-08 
ref|YP_001983813.1|  two-component hybrid sensor and regulator...  62.4    4e-08 
ref|ZP_00954820.1|  nitrogen regulation protein NtrB [Sulfitob...  62.4    4e-08
ref|YP_001414394.1|  signal transduction histidine kinase, nit...  62.0    4e-08 
ref|YP_591474.1|  multi-sensor signal transduction histidine k...  62.0    4e-08 
ref|ZP_03690650.1|  signal transduction histidine kinase, nitr...  62.0    4e-08
ref|ZP_01386807.1|  PAS:ATP-binding region, ATPase-like:Histid...  62.0    4e-08
ref|NP_809894.1|  two-component system sensor histidine kinase...  62.0    4e-08 
ref|ZP_03156152.1|  response regulator receiver sensor signal ...  62.0    4e-08
ref|ZP_04416719.1|  nitrogen regulation protein NR(II) [Vibrio...  62.0    4e-08
ref|ZP_04294156.1|  hypothetical protein bcere0007_13720 [Baci...  62.0    4e-08
ref|ZP_03806803.1|  two-component system histidine kinase [Lac...  62.0    4e-08
ref|ZP_01547294.1|  nitrogen regulation (two-component sensor ...  62.0    4e-08
ref|YP_001928129.1|  putative two-component system sensor hist...  62.0    4e-08 
ref|YP_972963.1|  PAS/PAC sensor signal transduction histidine...  62.0    4e-08 
ref|ZP_03041447.1|  diguanylate cyclase [Geobacillus sp. Y412M...  62.0    4e-08
ref|YP_286757.1|  sensor histidine kinase [Dechloromonas aroma...  62.0    4e-08 
ref|NP_904374.1|  sensor histidine kinase [Porphyromonas gingi...  62.0    4e-08 
ref|ZP_04196581.1|  hypothetical protein bcere0026_13080 [Baci...  62.0    4e-08
ref|YP_001951394.1|  integral membrane sensor signal transduct...  62.0    4e-08 
ref|NP_831238.1|  sporulation kinase [Bacillus cereus ATCC 145...  62.0    4e-08 
ref|YP_001903433.1|  Two-component system sensor histidine kin...  62.0    4e-08 
ref|YP_002715962.1|  PAS fold family [Verrucomicrobiae bacteri...  62.0    4e-08 
ref|NP_384144.1|  putative sensor histidine kinase protein [Si...  62.0    4e-08 
ref|NP_771127.1|  two-component sensor histidine kinase [Brady...  62.0    4e-08 
ref|NP_435753.1|  sensor histidine kinase of two-component sys...  62.0    4e-08 
ref|ZP_04553811.1|  two-component system sensor histidine kina...  62.0    4e-08
ref|ZP_03911608.1|  histidine kinase with HAMP domain [Xylanim...  62.0    4e-08
ref|ZP_03741522.1|  multi-sensor signal transduction histidine...  62.0    4e-08
ref|ZP_02167191.1|  probable nitrogen regulation transmembrane...  62.0    4e-08
ref|YP_619676.1|  two-component system, sensor histidine kinas...  62.0    4e-08 
ref|ZP_02912001.1|  multi-sensor signal transduction histidine...  62.0    4e-08
ref|YP_001532987.1|  integral membrane sensor hybrid histidine...  62.0    4e-08 
ref|YP_286195.1|  PAS/PAC sensor signal transduction histidine...  62.0    4e-08 
ref|ZP_03876451.1|  PAS domain S-box [Haliangium ochraceum DSM...  62.0    4e-08
ref|ZP_03685381.1|  hypothetical protein BRYFOR_01011 [Bryante...  62.0    4e-08
ref|YP_002691184.1|  periplasmic sensor signal transduction hi...  62.0    4e-08 
ref|ZP_02862720.1|  hypothetical protein ANASTE_01941 [Anaerof...  62.0    4e-08
ref|ZP_04207768.1|  hypothetical protein bcere0024_13040 [Baci...  62.0    4e-08
ref|ZP_02191103.1|  PAS/PAC domain [alpha proteobacterium BAL1...  62.0    4e-08
ref|ZP_03652639.1|  hypothetical protein Cbac1_15993 [Clostrid...  62.0    4e-08
ref|YP_002360862.1|  signal transduction histidine kinase, nit...  62.0    4e-08 
ref|ZP_03739409.1|  histidine kinase [Halothiobacillus neapoli...  62.0    4e-08
ref|YP_001925627.1|  signal transduction histidine kinase, nit...  62.0    4e-08 
ref|ZP_01460827.1|  histidine kinase [Stigmatella aurantiaca D...  62.0    4e-08
ref|YP_617499.1|  PAS/PAC sensor signal transduction histidine...  62.0    5e-08 
ref|ZP_04179414.1|  hypothetical protein bcere0029_12400 [Baci...  62.0    5e-08
ref|YP_002450501.1|  sensor histidine kinase [Bacillus cereus ...  62.0    5e-08 
ref|YP_002631799.1|  sensor histidine kinase/response regulato...  62.0    5e-08 
ref|ZP_04171003.1|  hypothetical protein bmyco0001_42840 [Baci...  62.0    5e-08
ref|ZP_04232871.1|  hypothetical protein bcere0019_13230 [Baci...  62.0    5e-08
ref|YP_002150959.1|  two-component sensor kinase [Proteus mira...  62.0    5e-08 
ref|ZP_03055657.1|  sensor protein ResE [Bacillus pumilus ATCC...  62.0    5e-08
ref|YP_002163954.1|  sensor histidine kinase [Fusobacterium nu...  62.0    5e-08 
ref|YP_002127767.1|  Multi-sensor Signal Transduction Histidin...  61.6    5e-08 
ref|ZP_04297110.1|  hypothetical protein bcere0007_43500 [Baci...  61.6    5e-08
ref|YP_002636329.1|  sensor protein KdpD [Salmonella enterica ...  61.6    5e-08 
ref|ZP_03150804.1|  multi-sensor hybrid histidine kinase [Clos...  61.6    5e-08
ref|NP_642380.1|  two-component system sensor protein [Xanthom...  61.6    5e-08 
ref|YP_765295.1|  putative repetitive two-component sensor his...  61.6    5e-08 
ref|YP_002717434.1|  ATPase, histidine kinase-, DNA gyrase B-,...  61.6    5e-08 
ref|YP_412251.1|  multi-sensor hybrid histidine kinase [Nitros...  61.6    5e-08 
ref|YP_002015464.1|  multi-sensor signal transduction histidin...  61.6    5e-08 
ref|YP_001002907.1|  histidine kinase [Halorhodospira halophil...  61.6    5e-08 
ref|YP_001225281.1|  adaptive-response sensory kinase [Synecho...  61.6    5e-08 
ref|YP_576731.1|  periplasmic sensor signal transduction histi...  61.6    5e-08 
ref|ZP_02364779.1|  sensor protein evgS precursor [Burkholderi...  61.6    5e-08
ref|ZP_01906381.1|  Serine/Threonine protein kinase and Signal...  61.6    5e-08
ref|ZP_02360126.1|  sensor protein evgS precursor [Burkholderi...  61.6    5e-08
ref|ZP_02291759.1|  integral membrane sensor signal transducti...  61.6    5e-08
ref|YP_001571252.1|  sensor protein KdpD [Salmonella enterica ...  61.6    5e-08 
ref|YP_001640280.1|  PAS sensor protein [Methylobacterium exto...  61.6    5e-08 
ref|YP_001581794.1|  histidine kinase [Nitrosopumilus maritimu...  61.6    5e-08 
ref|YP_001260776.1|  PAS/PAC sensor signal transduction histid...  61.6    5e-08 
ref|ZP_01628823.1|  two-component hybrid sensor and regulator ...  61.6    5e-08
ref|ZP_04488147.1|  monosaccharide ABC transporter substrate-b...  61.6    5e-08
ref|ZP_04211295.1|  hypothetical protein bcere0023_14040 [Baci...  61.6    5e-08
emb|CAM74410.1|  Response Regulator Receiver Signal Transducti...  61.6    5e-08
ref|YP_001381560.1|  signal transduction histidine kinase, nit...  61.6    5e-08 
ref|ZP_04426967.1|  PAS domain S-box protein [Planctomyces lim...  61.6    5e-08
ref|YP_001582254.1|  histidine kinase [Nitrosopumilus maritimu...  61.6    5e-08 
ref|YP_781674.1|  signal transduction histidine kinase, nitrog...  61.6    6e-08 
ref|ZP_03001974.1|  signal transduction histidine-protein kina...  61.6    6e-08
ref|YP_001728753.1|  Signal transduction histidine kinase [Leu...  61.6    6e-08 
ref|YP_001430940.1|  multi-sensor signal transduction histidin...  61.6    6e-08 
ref|YP_001644125.1|  histidine kinase [Bacillus weihenstephane...  61.6    6e-08 
ref|ZP_03308695.1|  hypothetical protein BACFIN_03061 [Bactero...  61.6    6e-08
ref|YP_001890348.1|  integral membrane sensor signal transduct...  61.6    6e-08 
ref|YP_318057.1|  nitrogen regulation protein ntrB [Nitrobacte...  61.6    6e-08 
gb|AAU82473.1|  two-component hybrid sensor and regulator [unc...  61.6    6e-08
ref|YP_001724421.1|  sensory histidine kinase AtoS [Escherichi...  61.6    6e-08 
ref|YP_002464436.1|  multi-sensor hybrid histidine kinase [Chl...  61.6    6e-08 
ref|ZP_02431543.1|  hypothetical protein CLOSCI_01763 [Clostri...  61.6    6e-08
ref|YP_001370669.1|  multi-sensor hybrid histidine kinase [Och...  61.6    6e-08 
ref|YP_001338011.1|  sensor protein ZraS [Klebsiella pneumonia...  61.6    6e-08 
ref|ZP_04114032.1|  hypothetical protein bthur0006_13480 [Baci...  61.6    6e-08
ref|YP_695659.1|  sensor histidine kinase KdpD [Clostridium pe...  61.6    6e-08 
ref|YP_746469.1|  multi-sensor hybrid histidine kinase [Nitros...  61.6    6e-08 
ref|ZP_03879110.1|  PAS domain S-box [Haliangium ochraceum DSM...  61.6    6e-08
ref|ZP_03228889.1|  sensor histidine kinase [Bacillus cereus A...  61.6    6e-08
ref|ZP_03068453.1|  sensory box histidine kinase AtoS [Escheri...  61.6    6e-08
ref|YP_766063.1|  putative transmembrane two-component sensor ...  61.6    6e-08 
ref|NP_953621.1|  sensor histidine kinase/response regulator [...  61.6    6e-08 
ref|YP_363946.1|  two-component system sensor histidine kinase...  61.6    6e-08 
ref|NP_942216.1|  two-component hybrid sensor and regulator [S...  61.6    6e-08 
ref|NP_907972.1|  sensor kinase of two-component regulatory sy...  61.6    6e-08 
ref|ZP_04202402.1|  hypothetical protein bcere0025_13170 [Baci...  61.6    6e-08
ref|ZP_04176697.1|  hypothetical protein bcere0030_44000 [Baci...  61.2    6e-08
ref|ZP_04261086.1|  hypothetical protein bcere0014_11680 [Baci...  61.2    6e-08
ref|ZP_03738893.1|  multi-sensor signal transduction histidine...  61.2    6e-08
ref|ZP_03679921.1|  hypothetical protein BACCELL_04287 [Bacter...  61.2    6e-08
ref|YP_002461401.1|  multi-sensor signal transduction histidin...  61.2    6e-08 
ref|YP_587838.1|  PAS/PAC sensor hybrid histidine kinase [Rals...  61.2    6e-08 
ref|ZP_03952194.1|  sensor histidine kinase [Lactobacillus gas...  61.2    6e-08
ref|YP_002890813.1|  Hpt sensor hybrid histidine kinase [Thaue...  61.2    6e-08 
ref|ZP_02954319.1|  sensor histidine kinase KdpD [Clostridium ...  61.2    6e-08
ref|ZP_04167927.1|  hypothetical protein bmyco0001_11850 [Baci...  61.2    6e-08
ref|ZP_04182503.1|  hypothetical protein bcere0029_44100 [Baci...  61.2    6e-08
ref|YP_035674.1|  sporulation kinase [Bacillus thuringiensis s...  61.2    6e-08 
ref|ZP_04294027.1|  hypothetical protein bcere0007_12420 [Baci...  61.2    6e-08
ref|ZP_03637267.1|  hypothetical protein PROVRETT_00330 [Provi...  61.2    6e-08
ref|ZP_02639570.1|  sensor histidine kinase KdpD [Clostridium ...  61.2    6e-08
ref|ZP_02641565.1|  sensor histidine kinase KdpD [Clostridium ...  61.2    6e-08
ref|NP_346958.1|  sensory transduction histidine kinase [Clost...  61.2    6e-08 
ref|YP_523466.1|  multi-sensor signal transduction histidine k...  61.2    6e-08 
ref|YP_002716105.1|  PAS fold family [Verrucomicrobiae bacteri...  61.2    6e-08 
ref|ZP_03104206.1|  sensor histidine kinase [Bacillus cereus W...  61.2    6e-08
ref|YP_001725914.1|  sensor protein KdpD [Escherichia coli ATC...  61.2    6e-08 
ref|ZP_01288139.1|  ATP-binding region, ATPase-like:Histidine ...  61.2    6e-08
ref|YP_002710228.1|  ATPase, histidine kinase-, DNA gyrase B-,...  61.2    7e-08 
ref|YP_325420.1|  multi-sensor hybrid histidine kinase [Anabae...  61.2    7e-08 
ref|ZP_03699778.1|  PAS/PAC sensor signal transduction histidi...  61.2    7e-08
ref|YP_002296390.1|  Nitrogen regulation protein NtrB [Rhodosp...  61.2    7e-08 
ref|ZP_02217306.1|  sensor histidine kinase [Bacillus anthraci...  61.2    7e-08
ref|ZP_04077750.1|  hypothetical protein bthur0012_13660 [Baci...  61.2    7e-08
ref|YP_162860.1|  two-component signal transduction histidine ...  61.2    7e-08 
ref|YP_311160.1|  sensory histidine kinase AtoS [Shigella sonn...  61.2    7e-08 
ref|NP_416723.1|  sensory histidine kinase in two-component re...  61.2    7e-08 
ref|YP_001635059.1|  histidine kinase [Chloroflexus aurantiacu...  61.2    7e-08 
ref|ZP_03114840.1|  sensor histidine kinase [Bacillus cereus 0...  61.2    7e-08
gb|AAD53895.1|AF176314_5  NtrY [Zymomonas mobilis]                 61.2    7e-08
ref|YP_444793.1|  sensory transduction histidine kinase [Salin...  61.2    7e-08 
ref|YP_082938.1|  sensor histidine kinase, C-terminal region; ...  61.2    7e-08 
ref|YP_215710.1|  sensor protein KdpD [Salmonella enterica sub...  61.2    7e-08 
ref|NP_619239.1|  sensory transduction histidine kinase [Metha...  61.2    7e-08 
ref|YP_673467.1|  multi-sensor signal transduction histidine k...  61.2    7e-08 
ref|ZP_04007105.1|  sensor histidine kinase [Lactobacillus joh...  61.2    7e-08
emb|CAA03998.1|  styrene sensor kinase [Pseudomonas sp. Y2]        61.2    7e-08
ref|ZP_01014750.1|  multisensor hybrid histidine kinase [Rhodo...  61.2    7e-08
ref|ZP_03215955.1|  sensor protein kdpD [Salmonella enterica s...  61.2    7e-08
ref|ZP_02701581.1|  sensor protein KdpD [Salmonella enterica s...  61.2    7e-08
ref|YP_002145676.1|  sensor protein KdpD [Salmonella enterica ...  61.2    7e-08 
ref|NP_459688.1|  sensor protein KdpD [Salmonella typhimurium ...  61.2    7e-08 
ref|YP_001644256.1|  signal transduction histidine kinase, nit...  61.2    7e-08 
ref|NP_440530.1|  sensory transduction histidine kinase [Synec...  61.2    7e-08 
ref|ZP_02655650.1|  sensor protein kdpD [Salmonella enterica s...  61.2    7e-08
ref|YP_001589038.1|  sensor protein KdpD [Salmonella enterica ...  61.2    7e-08 
ref|ZP_02686290.1|  sensor protein kdpD [Salmonella enterica s...  61.2    7e-08
ref|ZP_02665483.1|  sensor protein kdpD [Salmonella enterica s...  61.2    7e-08
ref|ZP_03221077.1|  sensor protein kdpD [Salmonella enterica s...  61.2    7e-08
ref|ZP_02346633.1|  sensor protein KdpD [Salmonella enterica s...  61.2    7e-08
ref|ZP_01160950.1|  putative nitrogen regulation protein [Phot...  61.2    7e-08
ref|NP_232374.1|  nitrogen regulation protein NR(II) [Vibrio c...  61.2    7e-08 
ref|YP_002754000.1|  two-component hybrid sensor and regulator...  61.2    7e-08 
ref|YP_001886701.1|  sensor histidine kinase/response regulato...  61.2    7e-08 
ref|YP_002430854.1|  PAS/PAC sensor hybrid histidine kinase [D...  61.2    7e-08 
ref|YP_894165.1|  sensor histidine kinase [Bacillus thuringien...  61.2    7e-08 
ref|YP_001328905.1|  histidine kinase [Sinorhizobium medicae W...  61.2    7e-08 
ref|YP_002313681.1|  Sensory box histidine kinase/response reg...  61.2    7e-08 
ref|ZP_02427332.1|  hypothetical protein CLORAM_00710 [Clostri...  61.2    7e-08
ref|YP_211245.1|  putative two-component system sensor histidi...  61.2    7e-08 
ref|ZP_01997058.1|  signal transduction histidine kinase [Begg...  61.2    8e-08
ref|YP_002548322.1|  two component sensor kinase [Agrobacteriu...  61.2    8e-08 
ref|YP_002483248.1|  histidine kinase [Cyanothece sp. PCC 7425...  61.2    8e-08 
ref|ZP_03157291.1|  PAS/PAC sensor signal transduction histidi...  61.2    8e-08
ref|YP_158754.1|  sensor histidine kinase [Aromatoleum aromati...  61.2    8e-08 
ref|YP_865134.1|  multi-sensor hybrid histidine kinase [Magnet...  61.2    8e-08 
ref|YP_078350.1|  two-component sensor histidine kinase [Bacil...  61.2    8e-08 
ref|YP_322079.1|  response regulator receiver Signal transduct...  61.2    8e-08 
ref|YP_002277425.1|  response regulator receiver sensor signal...  61.2    8e-08 
ref|YP_002789842.1|  two-component system sensor histidine kin...  61.2    8e-08 
ref|YP_001241359.1|  cell cycle control histidine kinase CckA ...  61.2    8e-08 
ref|YP_001634790.1|  PAS sensor protein [Chloroflexus aurantia...  61.2    8e-08 
ref|YP_002415804.1|  nitrogen regulation protein NR(II) [Vibri...  60.8    8e-08 
ref|ZP_03402277.1|  sensor protein KdpD [Salmonella enterica s...  60.8    8e-08
ref|ZP_02633382.1|  sensor histidine kinase/response regulator...  60.8    8e-08
ref|YP_001088334.1|  two-component sensor histidine kinase [Cl...  60.8    8e-08 
ref|YP_428573.1|  Cache sensor hybrid histidine kinase [Rhodos...  60.8    8e-08 
ref|YP_001908642.1|  hybrid sensory histidine kinase BarA [Erw...  60.8    8e-08 
ref|ZP_01951138.1|  nitrogen regulation protein [Vibrio choler...  60.8    8e-08
ref|YP_815509.1|  Signal transduction histidine kinase [Lactob...  60.8    8e-08 
ref|YP_001212590.1|  signal transduction histidine kinase [Pel...  60.8    8e-08 
ref|YP_098875.1|  putative two-component system sensor histidi...  60.8    8e-08 
ref|YP_001487274.1|  sensor histidine kinase [Bacillus pumilus...  60.8    8e-08 
ref|NP_968630.1|  two-component sensor KdpD [Bdellovibrio bact...  60.8    8e-08 
ref|ZP_04422388.1|  PAS domain S-box protein [Rhodothermus mar...  60.8    8e-08
ref|YP_001360981.1|  integral membrane sensor signal transduct...  60.8    8e-08 
ref|ZP_00989343.1|  nitrogen regulation protein [Vibrio splend...  60.8    8e-08
ref|ZP_04414130.1|  nitrogen regulation protein NR(II) [Vibrio...  60.8    8e-08
ref|YP_002279377.1|  multi-sensor signal transduction histidin...  60.8    8e-08 
ref|YP_002535730.1|  PAS/PAC sensor hybrid histidine kinase [G...  60.8    8e-08 
ref|ZP_04428808.1|  PAS domain S-box protein [Planctomyces lim...  60.8    9e-08
ref|YP_001520155.1|  PAS/PAC sensor signal transduction histid...  60.8    9e-08 
ref|ZP_01287923.1|  PAS:ATP-binding region, ATPase-like:Histid...  60.8    9e-08
ref|YP_002176096.1|  nitrogen regulation protein [Vibrio chole...  60.8    9e-08 
ref|YP_002101401.1|  Response regulator receiver [Burkholderia...  60.8    9e-08 
ref|YP_001477477.1|  sensor protein KdpD [Serratia proteamacul...  60.8    9e-08 
ref|ZP_03737168.1|  PAS/PAC sensor hybrid histidine kinase [De...  60.8    9e-08
ref|YP_002685687.1|  histidine kinase [Rhodobacteraceae bacter...  60.8    9e-08 
ref|ZP_02376004.1|  putative two-component regulatory system, ...  60.8    9e-08
ref|YP_002484443.1|  multi-sensor signal transduction histidin...  60.8    9e-08 
ref|YP_001227018.1|  adaptive-response sensory kinase [Synecho...  60.8    9e-08 
ref|YP_756673.1|  periplasmic sensor signal transduction histi...  60.8    9e-08 
ref|ZP_01064908.1|  nitrogen regulation protein [Vibrio sp. ME...  60.8    9e-08
ref|YP_001953669.1|  Hpt sensor hybrid histidine kinase [Geoba...  60.8    9e-08 
ref|ZP_01092965.1|  probable two-component sensor histidine ki...  60.8    9e-08
ref|ZP_00544919.1|  ATP-binding region, ATPase-like:Histidine ...  60.8    9e-08
ref|ZP_04584515.1|  sensory box histidine kinase [Sulfurihydro...  60.8    9e-08
ref|ZP_03016036.1|  hypothetical protein BACINT_03637 [Bactero...  60.8    9e-08
ref|ZP_03012046.1|  hypothetical protein BACCOP_03978 [Bactero...  60.8    9e-08
ref|YP_001867124.1|  multi-sensor signal transduction histidin...  60.8    9e-08 
ref|YP_001581523.1|  histidine kinase [Nitrosopumilus maritimu...  60.8    9e-08 
ref|ZP_03499243.1|  multi-sensor signal transduction histidine...  60.8    9e-08
ref|ZP_02066444.1|  hypothetical protein BACOVA_03441 [Bactero...  60.8    9e-08
ref|ZP_02082528.1|  hypothetical protein CLOBOL_00040 [Clostri...  60.8    9e-08
ref|ZP_00235304.1|  sporulation kinase [Bacillus cereus G9241]...  60.8    9e-08
ref|ZP_04247519.1|  hypothetical protein bcere0017_44290 [Baci...  60.8    1e-07
ref|YP_002413269.1|  sensory histidine kinase AtoS [Escherichi...  60.8    1e-07 
ref|ZP_01466541.1|  sensor protein ZraS [Stigmatella aurantiac...  60.8    1e-07
ref|YP_634188.1|  sensor histidine kinase [Myxococcus xanthus ...  60.8    1e-07 
ref|ZP_04411238.1|  nitrogen regulation protein NR(II) [Vibrio...  60.8    1e-07
ref|ZP_04344519.1|  PAS domain S-box protein [Desulfomicrobium...  60.8    1e-07
ref|ZP_01288586.1|  PAS:ATP-binding region, ATPase-like:Histid...  60.8    1e-07
ref|ZP_04209147.1|  hypothetical protein bcere0024_43760 [Baci...  60.8    1e-07
ref|YP_002592859.1|  histidine kinase [Campylobacterales bacte...  60.8    1e-07 
ref|ZP_01740761.1|  sensor histidine kinase [Rhodobacterales b...  60.8    1e-07
sp|P45670.1|NTRB_AZOBR  RecName: Full=Nitrogen regulation prot...  60.8    1e-07
ref|YP_001865605.1|  PAS/PAC sensor hybrid histidine kinase [N...  60.8    1e-07 
ref|ZP_04284790.1|  hypothetical protein bcere0010_28880 [Baci...  60.8    1e-07
ref|YP_001354112.1|  two-component sensor histidine kinase [Ja...  60.8    1e-07 
ref|ZP_01803724.1|  hypothetical protein CdifQ_04002117 [Clost...  60.8    1e-07
ref|ZP_03208625.1|  hypothetical protein BACPLE_02281 [Bactero...  60.8    1e-07
ref|ZP_04299760.1|  hypothetical protein bcere0006_13100 [Baci...  60.8    1e-07
ref|YP_001195693.1|  PAS/PAC sensor signal transduction histid...  60.8    1e-07 
ref|ZP_04443316.1|  histidine kinase [Listeria grayi DSM 20601...  60.5    1e-07
ref|YP_001796828.1|  putative SENSOR HISTIDINE KINASE with GAF...  60.5    1e-07 
ref|NP_903115.1|  two-component sensor [Chromobacterium violac...  60.5    1e-07 
ref|ZP_03463101.1|  hypothetical protein BACPEC_02190 [Bactero...  60.5    1e-07
ref|ZP_02732404.1|  Response regulator receiver:ATP-binding re...  60.5    1e-07
ref|ZP_04546752.1|  two-component system sensor histidine kina...  60.5    1e-07
ref|YP_002007998.1|  two-component regulatory system protein; ...  60.5    1e-07 
ref|YP_002072623.1|  nitrogen regulation protein [Vibrio chole...  60.5    1e-07 
ref|YP_001189622.1|  PAS/PAC sensor signal transduction histid...  60.5    1e-07 
ref|YP_426766.1|  multi-sensor Signal transduction histidine k...  60.5    1e-07 
ref|YP_002018814.1|  PAS/PAC sensor hybrid histidine kinase [P...  60.5    1e-07 
ref|ZP_03628823.1|  integral membrane sensor signal transducti...  60.5    1e-07
ref|YP_303334.1|  sensor histidine kinase [Ehrlichia canis str...  60.5    1e-07 
ref|YP_001011481.1|  adaptive-response sensory kinase [Prochlo...  60.5    1e-07 
emb|CAA47915.1|  ntrB [Azospirillum brasilense]                    60.5    1e-07
ref|ZP_01157575.1|  two-component hybrid sensor and regulator ...  60.5    1e-07
dbj|BAE94500.1|  signal transduction histidine kinase [Acidovo...  60.5    1e-07
ref|YP_932422.1|  two-component sensor kinase [Azoarcus sp. BH...  60.5    1e-07 
ref|YP_001909268.1|  sensor protein KdpD [Erwinia tasmaniensis...  60.5    1e-07 
emb|CAM77881.1|  sensor protein [Magnetospirillum gryphiswalde...  60.5    1e-07
ref|ZP_01131338.1|  putative histidine kinase [marine actinoba...  60.5    1e-07
ref|ZP_03037022.1|  ATP-binding region ATPase domain protein [...  60.5    1e-07
ref|ZP_02864934.1|  sensor histidine kinase/response regulator...  60.5    1e-07
ref|NP_562428.1|  sensor histidine kinase/response regulator [...  60.5    1e-07 
ref|ZP_04198564.1|  hypothetical protein bcere0026_33050 [Baci...  60.5    1e-07
ref|ZP_01462874.1|  conserved hypothetical protein [Stigmatell...  60.5    1e-07
gb|AAB35495.1|  ntrB [Azospirillum brasilense]                     60.5    1e-07
ref|ZP_03906906.1|  amino acid-binding domain sensor histidine...  60.5    1e-07
ref|YP_002130919.1|  sensor histidine kinase/response regulato...  60.5    1e-07 
ref|ZP_02642523.1|  sensor histidine kinase/response regulator...  60.5    1e-07
ref|ZP_02635041.1|  sensor histidine kinase/response regulator...  60.5    1e-07
ref|YP_002667144.1|  nitrogen regulation protein NtrB [Vibrio ...  60.5    1e-07 
ref|ZP_03689520.1|  integral membrane sensor signal transducti...  60.5    1e-07
ref|ZP_02000728.1|  response regulator receiver modulated meta...  60.5    1e-07
ref|YP_002366239.1|  sensor histidine kinase [Bacillus cereus ...  60.5    1e-07 
ref|YP_780487.1|  multi-sensor hybrid histidine kinase [Rhodop...  60.5    1e-07 
ref|ZP_04181508.1|  hypothetical protein bcere0029_33850 [Baci...  60.5    1e-07
ref|ZP_02952540.1|  sensor histidine kinase/response regulator...  60.5    1e-07
ref|YP_001646130.1|  PAS/PAC sensor signal transduction histid...  60.5    1e-07 
ref|ZP_04277986.1|  hypothetical protein bcere0011_13140 [Baci...  60.5    1e-07
ref|ZP_03210001.1|  hypothetical protein BACPLE_03692 [Bactero...  60.5    1e-07
ref|YP_001913404.1|  two-component system sensor protein [Xant...  60.5    1e-07 
ref|YP_001921661.1|  sensor histidine kinase/response regulato...  60.5    1e-07 
ref|YP_200962.1|  two-component system sensor protein [Xanthom...  60.5    1e-07 
ref|YP_283269.1|  PAS/PAC sensor hybrid histidine kinase [Dech...  60.5    1e-07 
ref|YP_451229.1|  two-component system sensor protein [Xanthom...  60.5    1e-07 
ref|ZP_04175687.1|  hypothetical protein bcere0030_33570 [Baci...  60.5    1e-07
ref|ZP_01631301.1|  two-component hybrid sensor and regulator ...  60.5    1e-07
ref|YP_001865885.1|  multi-sensor hybrid histidine kinase [Nos...  60.5    1e-07 
ref|ZP_04169991.1|  hypothetical protein bmyco0001_32610 [Baci...  60.5    1e-07
ref|ZP_04302899.1|  hypothetical protein bcere0006_44640 [Baci...  60.5    1e-07
ref|YP_002297227.1|  sensor histidine kinase, putative [Rhodos...  60.5    1e-07 
ref|ZP_02067387.1|  hypothetical protein BACOVA_04394 [Bactero...  60.5    1e-07
ref|YP_854803.1|  nitrogen regulation protein NR(II) [Aeromona...  60.5    1e-07 
ref|ZP_01387063.1|  PAS:ATP-binding region, ATPase-like:Histid...  60.5    1e-07
ref|ZP_04263256.1|  hypothetical protein bcere0014_33540 [Baci...  60.5    1e-07
ref|YP_001817353.1|  PAS/PAC sensor hybrid histidine kinase [O...  60.5    1e-07 
ref|ZP_01959644.1|  hypothetical protein BACCAC_01252 [Bactero...  60.5    1e-07
ref|ZP_04264294.1|  hypothetical protein bcere0014_44020 [Baci...  60.1    1e-07
ref|ZP_04296082.1|  hypothetical protein bcere0007_33140 [Baci...  60.1    1e-07
ref|ZP_03737088.1|  integral membrane sensor signal transducti...  60.1    1e-07
ref|ZP_03288078.1|  hypothetical protein CLONEX_00262 [Clostri...  60.1    1e-07
ref|YP_001228917.1|  GAF sensor signal transduction histidine ...  60.1    1e-07 
ref|YP_002433595.1|  PAS/PAC sensor hybrid histidine kinase [D...  60.1    1e-07 
ref|ZP_03899218.1|  PAS domain S-box [Dyadobacter fermentans D...  60.1    1e-07
ref|ZP_03013348.1|  hypothetical protein BACINT_00906 [Bactero...  60.1    1e-07
ref|ZP_02208009.1|  hypothetical protein COPEUT_02836 [Coproco...  60.1    1e-07
ref|YP_003574.1|  histidine kinase sensor protein [Leptospira ...  60.1    1e-07 
ref|ZP_04488494.1|  predicted periplasmic ligand-binding senso...  60.1    1e-07
ref|YP_001680119.1|  signal transduction histidine kinase, put...  60.1    1e-07 
ref|YP_001196520.1|  histidine kinase [Flavobacterium johnsoni...  60.1    1e-07 
ref|YP_001115073.1|  PAS/PAC sensor hybrid histidine kinase [B...  60.1    1e-07 
ref|YP_002770355.1|  two-component sensor histidine kinase [Br...  60.1    1e-07 
ref|ZP_02065123.1|  hypothetical protein BACOVA_02097 [Bactero...  60.1    1e-07
ref|YP_002459379.1|  histidine kinase [Desulfitobacterium hafn...  60.1    1e-07 
ref|YP_321605.1|  multi-sensor hybrid histidine kinase [Anabae...  60.1    1e-07 
ref|NP_714785.1|  two-component hybrid sensor and regulator [L...  60.1    1e-07 
ref|ZP_01912591.1|  Serine/Threonine protein kinase and Signal...  60.1    1e-07
ref|YP_487043.1|  histidine kinase [Rhodopseudomonas palustris...  60.1    1e-07 
ref|ZP_03025699.1|  multi-sensor signal transduction histidine...  60.1    1e-07
ref|ZP_01613797.1|  putative sensory box histidine kinase/resp...  60.1    1e-07
ref|ZP_04020787.1|  histidine kinase [Lactobacillus acidophilu...  60.1    2e-07
ref|ZP_01966278.1|  hypothetical protein RUMOBE_04033 [Ruminoc...  60.1    2e-07
ref|YP_528584.1|  PAS/PAC sensor signal transduction histidine...  60.1    2e-07 
ref|YP_593129.1|  periplasmic sensor signal transduction histi...  60.1    2e-07 
ref|ZP_01258253.1|  putative two-component sensor [Vibrio algi...  60.1    2e-07
ref|YP_001319889.1|  PAS/PAC sensor hybrid histidine kinase [A...  60.1    2e-07 
ref|ZP_04376155.1|  histidine kinase with HAMP domain [Catenul...  60.1    2e-07
ref|YP_518000.1|  hypothetical protein DSY1767 [Desulfitobacte...  60.1    2e-07 
gb|ACR29559.1|  Sensory box histidine kinase [Burkholderia glu...  60.1    2e-07
ref|YP_001350305.1|  putative two-component sensor [Pseudomona...  60.1    2e-07 
ref|YP_002265292.1|  response regulator, histidine kinase [Ali...  60.1    2e-07 
ref|YP_002584133.1|  7TM diverse intracellular signalling doma...  60.1    2e-07 
ref|YP_002537178.1|  signal transduction histidine kinase, nit...  60.1    2e-07 
ref|YP_193012.1|  putative histidine kinase [Lactobacillus aci...  60.1    2e-07 
ref|ZP_04185328.1|  hypothetical protein bcere0028_13330 [Baci...  60.1    2e-07
ref|YP_002719125.1|  ATPase, histidine kinase-, DNA gyrase B-,...  60.1    2e-07 
ref|ZP_03630074.1|  multi-sensor signal transduction histidine...  60.1    2e-07
ref|YP_002715460.1|  response regulator receiver domain protei...  60.1    2e-07 
ref|YP_590851.1|  signal transduction histidine kinase, nitrog...  60.1    2e-07 
ref|ZP_01090177.1|  sensory transduction histidine kinase [Bla...  60.1    2e-07
ref|YP_980680.1|  multi-sensor hybrid histidine kinase [Polaro...  60.1    2e-07 
ref|YP_001321096.1|  integral membrane sensor signal transduct...  60.1    2e-07 
ref|YP_002549531.1|  two component sensor kinase [Agrobacteriu...  60.1    2e-07 
gb|ACR28250.1|  Multi-sensor hybrid histidine kinase [Burkhold...  60.1    2e-07
ref|YP_002605035.1|  two-component sensory box histidine kinas...  60.1    2e-07 
ref|ZP_01467377.1|  hypothetical protein STIAU_7484 [Stigmatel...  60.1    2e-07
ref|NP_102202.1|  nitrogen regulation protein ntrY [Mesorhizob...  60.1    2e-07 
ref|ZP_03784316.1|  hypothetical protein RUMHYD_03799 [Blautia...  60.1    2e-07
ref|YP_001950808.1|  PAS/PAC sensor hybrid histidine kinase [G...  60.1    2e-07 
ref|NP_638989.1|  sensor histidine kinase [Xanthomonas campest...  60.1    2e-07 
ref|YP_002435518.1|  multi-sensor hybrid histidine kinase [Des...  60.1    2e-07 
ref|YP_846325.1|  multi-sensor hybrid histidine kinase [Syntro...  60.1    2e-07 
ref|ZP_04226898.1|  hypothetical protein bcere0020_11710 [Baci...  60.1    2e-07
ref|ZP_01815338.1|  Probable sensor/response regulator hybrid ...  60.1    2e-07
ref|YP_001175939.1|  sensor protein KdpD [Enterobacter sp. 638...  60.1    2e-07 
ref|YP_001559062.1|  integral membrane sensor signal transduct...  60.1    2e-07 
ref|ZP_03843257.1|  histidine kinase [Lactobacillus sakei subs...  59.7    2e-07
ref|YP_970810.1|  PAS/PAC sensor signal transduction histidine...  59.7    2e-07 
ref|YP_001761678.1|  multi-sensor hybrid histidine kinase [She...  59.7    2e-07 
ref|ZP_03996903.1|  histidine kinase [Lactobacillus crispatus ...  59.7    2e-07
ref|ZP_02951009.1|  two-component sensor histidine kinase [Clo...  59.7    2e-07
ref|YP_001329767.1|  integral membrane sensor signal transduct...  59.7    2e-07 
ref|YP_901275.1|  histidine kinase [Pelobacter propionicus DSM...  59.7    2e-07 
ref|YP_001260231.1|  response regulator receiver sensor signal...  59.7    2e-07 
ref|ZP_03807021.1|  putative histidine kinase [Lactobacillus j...  59.7    2e-07
ref|YP_001983018.1|  signal-transducing histidine kinase [Cell...  59.7    2e-07 
ref|YP_001430968.1|  multi-sensor signal transduction histidin...  59.7    2e-07 
ref|ZP_01870003.1|  nitrogen regulation protein NR(II) [Vibrio...  59.7    2e-07
ref|YP_957542.1|  PAS/PAC sensor signal transduction histidine...  59.7    2e-07 
ref|YP_001519585.1|  two-component hybrid sensor and regulator...  59.7    2e-07 
ref|YP_879287.1|  sensor histidine kinase [Clostridium novyi N...  59.7    2e-07 
ref|YP_308531.1|  sensor histidine kinase/response regulator [...  59.7    2e-07 
ref|ZP_03776898.1|  hypothetical protein CLOHYLEM_03946 [Clost...  59.7    2e-07
ref|ZP_01306713.1|  probable sensor/response regulator hybrid ...  59.7    2e-07
ref|YP_696200.1|  sensor histidine kinase/response regulator [...  59.7    2e-07 
ref|NP_772448.1|  two-component hybrid sensor and regulator [B...  59.7    2e-07 
ref|YP_001419278.1|  signal transduction histidine kinase, nit...  59.7    2e-07 
ref|NP_988423.1|  sensory transduction histidine kinase [Metha...  59.7    2e-07 
ref|YP_928824.1|  sensory box histidine kinase/response regula...  59.7    2e-07 
ref|ZP_02849653.1|  GAF sensor signal transduction histidine k...  59.7    2e-07
ref|ZP_01860665.1|  sensor histidine kinase [Bacillus sp. SG-1...  59.7    2e-07
ref|ZP_01154870.1|  Response regulator receiver:ATP-binding re...  59.7    2e-07
ref|YP_002127182.1|  putative sensory box sensor histidine kin...  59.7    2e-07 
ref|ZP_03518695.1|  probable two-component sensor histidine ki...  59.7    2e-07
ref|YP_001866383.1|  multi-sensor hybrid histidine kinase [Nos...  59.7    2e-07 
ref|ZP_04364445.1|  signal transduction histidine kinase, COG0...  59.7    2e-07




>ref|ZP_03276205.1|  cyclic nucleotide-binding protein [Arthrospira maxima CS-328]
 gb|EDZ92238.1|  cyclic nucleotide-binding protein [Arthrospira maxima CS-328]
Length=381

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/167 (34%), Positives = 92/167 (55%), Gaps = 6/167 (3%)

Query  31   GLTGDIVEFAKGKMELHPEQLNLEDFKEQLDA-QLGFIGELRLEYVIDPKDQMLPIKIDC  89
            G+  +++EF++G   L  + + +E+  +Q +     ++    +E VID  D +  +  D 
Sbjct  201  GMAEEVLEFSRGSTSLLLKPVAIEEIIQQFEKLNRVYLHSSDVELVIDIPDGIYVLA-DL  259

Query  90   RKICRVIVNLVKNSWEKLQDDEDDGLIQVRMSTLHNNDFQVQVYDNGSPIPDKIEKNLFE  149
             KI RV+ NLV N+ E   + +   +I    +T  +N   + V DNG+ IP  I+++LF+
Sbjct  260  NKIIRVLQNLVSNAVEAFPNSQGKIII---TATTQDNWGVIMVKDNGTGIPKAIQEHLFD  316

Query  150  AFRTEGKQQGTGLGLAICKKLIDLHRGLIRGRNLKNGTGVIFEILLP  196
            AF T GKQ GTGLG AI K +++ H G IR  +   G G  F I LP
Sbjct  317  AFVTYGKQGGTGLGTAIAKSIVEAHGGAIRFESTA-GAGTTFWIRLP  362


>ref|YP_001274590.1|  integral membrane sensor hybrid histidine kinase [Roseiflexus 
sp. RS-1]
 gb|ABQ88640.1|  integral membrane sensor hybrid histidine kinase [Roseiflexus 
sp. RS-1]
Length=687

 GENE ID: 5207139 RoseRS_0204 | integral membrane sensor hybrid histidine kinase
[Roseiflexus sp. RS-1]

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 66/213 (30%), Positives = 105/213 (49%), Gaps = 27/213 (12%)

Query  18   FIRRIKQSSVNISGLTGDIVEFAK---GKMELHPEQLNLEDFKEQLDAQL-GFIGELRLE  73
            ++ R++QS  ++ GL  DI++ +K   G+MEL  E   + D  + + A   G + E  +E
Sbjct  235  YLNRVRQSGEHLLGLINDILDLSKIEAGRMELFRESFQIGDLIQSVLATASGLVKEKPIE  294

Query  74   YVIDPKDQMLPIKIDCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRMSTLHNNDFQVQVY  133
               +    + P+  D  ++ +V++NL+ N+        D G I V      N +  + V 
Sbjct  295  LRSEIAPHLPPVYADRTRVRQVLLNLLSNA----AKFTDAGTITVHAEGC-NGEIVIHVS  349

Query  134  DNGSPI-PDKIEKNLFEAFR-----TEGKQQGTGLGLAICKKLIDLHRGLIRGRNLKNGT  187
            D G  I P+ +EK +FEAFR     +  + +GTGLGLAIC++L+DLH G +   +   G 
Sbjct  350  DTGIGIAPEHLEK-IFEAFRQLDNASNRRYEGTGLGLAICRRLVDLHGGRLWVES-AVGV  407

Query  188  GVIFEILLPDCVLPSQTAHTTQETQSGNQPASK  220
            G  F   LP           T  TQS + P S 
Sbjct  408  GSTFSFSLP----------LTAATQSASSPESS  430


>ref|YP_001618581.1|  sensor histidine kinase [Sorangium cellulosum 'So ce 56']
 emb|CAN98101.1|  sensor histidine kinase [Sorangium cellulosum 'So ce 56']
Length=695

 GENE ID: 5812249 sce7931 | sensor histidine kinase
[Sorangium cellulosum 'So ce 56'] (10 or fewer PubMed links)

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 71/219 (32%), Positives = 112/219 (51%), Gaps = 23/219 (10%)

Query  22   IKQSSVNISGLTGDIVEFAKGKMELHPEQLNLE----DFKEQLDAQLGFIG-ELRLEYVI  76
            +KQ  V IS +  +++EFA+G+  +   ++ L     D ++QL+ +L   G  L LE   
Sbjct  457  LKQFDV-ISAMQREVLEFARGERSILVRKVYLTKFFGDIEKQLEHELAGTGVSLSLEL--  513

Query  77   DPKDQMLPIKIDCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRMSTLHNNDFQVQVYDNG  136
               +     + D  K+ R++ NLV+N+ E ++     G + +R +     D  + V D G
Sbjct  514  ---EDRGTARFDEAKMTRLLHNLVRNAVEAMR--PGGGTVTIR-AYRDGGDLAICVADTG  567

Query  137  SPIPDKIEKNLFEAFRTEGKQQGTGLGLAICKKLIDLHRGLIRGRNLKNGTGVIFEILLP  196
              IP +I+  LF++F T GK+ GTGLGLAI KK++D H G I   +  +  G  F I LP
Sbjct  568  KGIPKEIQGRLFQSFVTSGKRGGTGLGLAIVKKIVDEHAGTITVAS--SDKGAKFTIRLP  625

Query  197  DCVLPSQTAHTT----QETQSGNQPASKSAGSLTNLAPV  231
                PS++  T     Q       PA+K+  S   +APV
Sbjct  626  QESAPSRSPGTAGGQPQLVSRDGSPATKAGAS---VAPV  661


>ref|YP_001741470.1|  putative Histidine kinase [Candidatus Cloacamonas acidaminovorans]
 emb|CAO81264.1|  putative Histidine kinase [Candidatus Cloacamonas acidaminovorans]
Length=389

 GENE ID: 7194320 CLOAM1412 | putative Histidine kinase
[Candidatus Cloacamonas acidaminovorans]

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 96/158 (60%), Gaps = 10/158 (6%)

Query  22   IKQSSVNISGLTGDIVEFAKGKMELHP--EQLNLEDF-KEQLDAQLGFIGELRLEYVIDP  78
            +KQ+ + I  L  +I++FA+G  E  P  +++NL+ F +E  +       E ++ +V++ 
Sbjct  216  VKQTKL-IDQLVHEILDFARGT-ESPPLIQKVNLDSFLREVSELYSASFKERKIIFVVEN  273

Query  79   KDQMLPIKIDCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRMSTLHNNDFQVQVYDNGSP  138
            K     +  D  KI RV++NL+KN+ E + +    G I++ +S++ +   Q+ V DNG  
Sbjct  274  KVNDC-VYFDEGKIRRVLINLIKNALEAIPEA---GEIKI-ISSVSSGWLQISVIDNGPG  328

Query  139  IPDKIEKNLFEAFRTEGKQQGTGLGLAICKKLIDLHRG  176
            +  K+++ LF+ F T+GK QGTGLGLAICKKL+  H G
Sbjct  329  VSRKVKEELFQPFVTDGKTQGTGLGLAICKKLVQEHYG  366


>ref|ZP_03878325.1|  signal transduction histidine kinase, COG0642 [Haliangium ochraceum 
DSM 14365]
 gb|EEJ01944.1|  signal transduction histidine kinase, COG0642 [Haliangium ochraceum 
DSM 14365]
Length=598

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/169 (33%), Positives = 96/169 (56%), Gaps = 8/169 (4%)

Query  29   ISGLTGDIVEFAKGKMELHPEQLNLEDFKEQLDAQLGF-IGELRLEYVIDPKDQMLPIKI  87
            + G+T +++ FA+G+ EL   ++ +  F ++L  QL   +    ++  IDP+ +      
Sbjct  426  MKGMTQEVLLFARGESELLVRRIFVNKFMDELLTQLNHALAGRNIKLTIDPEYRDTA-HF  484

Query  88   DCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRMSTLHNNDFQVQVYDNGSPIPDKIEKNL  147
            D +KI RV+ NL +N+ + + +    G + +R  T  +     +V D+G  IP +++  L
Sbjct  485  DEQKILRVMHNLARNAADAMPEG---GSLAIRTKT-KDGSLVFEVEDSGGGIPPELDGRL  540

Query  148  FEAFRTEGKQQGTGLGLAICKKLIDLHRGLIRGRNLKNGTGVIFEILLP  196
            F+ F + GKQ GTGLGLAI KK+I+ H G I  R+++ G G  F I LP
Sbjct  541  FDLF-SSGKQGGTGLGLAIVKKIIEEHGGDITYRSVQ-GQGTCFTIRLP  587


>ref|YP_002534774.1|  Sensor protein [Thermotoga neapolitana DSM 4359]
 gb|ACM23408.1|  Sensor protein [Thermotoga neapolitana DSM 4359]
Length=744

 GENE ID: 7379123 CTN_1232 | Sensor protein [Thermotoga neapolitana DSM 4359]
(10 or fewer PubMed links)

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 54/174 (31%), Positives = 100/174 (57%), Gaps = 21/174 (12%)

Query  29   ISGLTGDIVEFAKGKMELHPEQLNLED--------FKEQLDAQLGFIGELRLEYVIDPKD  80
            + G+  +I+E++K +  L   + NL +        F+E+L        E+ +++  +  +
Sbjct  573  LEGIVREILEYSKEEQILEFSEFNLNELIKEVYVLFEEKLR-------EMNIDFFFETDN  625

Query  81   QMLPIKIDCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRMSTLHNNDFQVQVYDNGSPIP  140
            + L +K D  +I +V++NLV+N+ E   ++   G I+++   ++N   +V V+++G PIP
Sbjct  626  EDLRVKADRSRIKQVLINLVQNAIEATGEN---GKIKIKSEDVYNVA-RVSVWNSGPPIP  681

Query  141  DKIEKNLFEAFRTEGKQQGTGLGLAICKKLI-DLHRGLIRGRNLKNGTGVIFEI  193
            +++++ +F  F T  K QGTGLGL IC+K++ D H G I   N + G   IFEI
Sbjct  682  EELKEKIFSPFFTT-KTQGTGLGLPICRKIVEDEHGGKIWVENTEGGVMFIFEI  734


>ref|YP_001789087.1|  histidine kinase [Leptothrix cholodnii SP-6]
 gb|ACB32322.1|  histidine kinase [Leptothrix cholodnii SP-6]
Length=508

 GENE ID: 6159819 Lcho_0047 | histidine kinase [Leptothrix cholodnii SP-6]

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 98/200 (49%), Gaps = 19/200 (9%)

Query  13   VRSLTFIRRIKQSSVNISGLTGDIVEFAK---GKMELHPEQLNLEDFKEQLDAQLGFIGE  69
             + L ++R I  S  ++  L  D+++ +K   G+MEL P + +L    E LD  L  + E
Sbjct  313  AKQLEYLRDIHASGHHLLTLINDVLDLSKIEAGRMELQPSRFHL---PELLDNSLTLVRE  369

Query  70   LR----LEYVIDPKDQMLPIKIDCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRMSTLHN  125
                  L   +D +D +     D RKI +V+VNL+ N+   ++     G + +R   +  
Sbjct  370  RAANHGLRLTLDVQDGLGDWVADPRKIKQVVVNLLSNA---VKFTPAGGHVTLRARRIDA  426

Query  126  NDFQVQVYDNGSPIPDKIEKNLFEAFRTEG-----KQQGTGLGLAICKKLIDLHRGLIRG  180
               ++ V D G  I  + +  +FE FR  G     K +GTGLGLA+ ++ ++LH G +R 
Sbjct  427  GTAEIAVIDTGVGIAPEEQAQVFEEFRQAGTDPLRKSEGTGLGLALARRFVELHGGTLR-  485

Query  181  RNLKNGTGVIFEILLPDCVL  200
             +   G G  F   LPD  L
Sbjct  486  VDSAPGRGSTFAFTLPDRTL  505


>ref|YP_001619642.1|  putative two-component sensor kinase [Sorangium cellulosum 'So 
ce 56']
 emb|CAN99162.1|  putative two-component sensor kinase [Sorangium cellulosum 'So 
ce 56']
Length=651

 GENE ID: 5813128 sce8990 | putative two-component sensor kinase
[Sorangium cellulosum 'So ce 56'] (10 or fewer PubMed links)

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 84/168 (50%), Gaps = 11/168 (6%)

Query  35   DIVEFAKGKMELHPEQLNLEDFK-EQLDAQLGFIG-----ELRLEYVIDPKDQMLPIKID  88
            D+V  A+G + LH    + E     +L +  G          R+E V DP  +   +  D
Sbjct  463  DLVAVARGVVTLHAAPASGEATSGARLSSGAGATSGTGAPSPRVELVADPIPE---VSAD  519

Query  89   CRKICRVIVNLVKNSWEKLQDDEDDGLIQVRMSTLHNNDFQVQVYDNGSPIPDKIEKNLF  148
              ++ +V+ NLV+N  +       D  + V +  L N+  ++ V DNG  + D +   LF
Sbjct  520  RDQLIQVLTNLVQNGLDAASAIRRDPRVSVTIGPLPNDRVRIVVRDNGPGVADDMVPRLF  579

Query  149  EAFRTEGKQQGTGLGLAICKKLIDLHRGLIRGRNLKNGTGVIFEILLP  196
            E + T  K++GTGLGLAI ++++  H G I  R  K G G +FEI LP
Sbjct  580  EPYATS-KEKGTGLGLAIAQRIVFEHGGEITYRKAKKG-GAVFEIWLP  625


>ref|YP_001739497.1|  PAS/PAC sensor signal transduction histidine kinase [Thermotoga 
sp. RQ2]
 gb|ACB09814.1|  PAS/PAC sensor signal transduction histidine kinase [Thermotoga 
sp. RQ2]
Length=755

 GENE ID: 6092916 TRQ2_1470 | PAS/PAC sensor signal transduction histidine
kinase [Thermotoga sp. RQ2]

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 101/178 (56%), Gaps = 7/178 (3%)

Query  18   FIRRIKQSSVNISGLTGDIVEFAKGKMELHPEQLNLEDFKEQLDAQLG-FIGELRLEYVI  76
            +I  I      +  +  +I+E++K +  L   + NL +   ++       I ++ +++  
Sbjct  576  YINIITNELSRLETIVKEILEYSKERQVLEFTEFNLNELIREVYVLFEEKIRKMNIDFCF  635

Query  77   DPKDQMLPIKIDCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRMSTLHNNDFQVQVYDNG  136
            +  ++ L ++ D  +I +V++NLV+N+   ++   ++G I++    ++    +V V+++G
Sbjct  636  ETDNEDLRVEADRTRIKQVLINLVQNA---IEATGENGKIKITSEDMYTK-VRVSVWNSG  691

Query  137  SPIPDKIEKNLFEAFRTEGKQQGTGLGLAICKKLI-DLHRGLIRGRNLKNGTGVIFEI  193
             PIP+++++ +F  F T  K QGTGLGL+IC+K+I D H G I   N +NG   IFEI
Sbjct  692  PPIPEELKEKIFSPFFT-TKTQGTGLGLSICRKIIEDEHGGKIWTENRENGVVFIFEI  748


>ref|NP_229160.1|  sensor histidine kinase [Thermotoga maritima MSB8]
 gb|AAD36429.1|AE001790_1  sensor histidine kinase [Thermotoga maritima MSB8]
Length=755

 GENE ID: 898121 TM1359 | sensor histidine kinase [Thermotoga maritima MSB8]
(10 or fewer PubMed links)

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 101/178 (56%), Gaps = 7/178 (3%)

Query  18   FIRRIKQSSVNISGLTGDIVEFAKGKMELHPEQLNLEDFKEQLDAQLG-FIGELRLEYVI  76
            +I  I      +  +  +I+E++K +  L   + NL +   ++       I ++ +++  
Sbjct  576  YINIITNELSRLETIVKEILEYSKERQVLEFTEFNLNELIREVYVLFEEKIRKMNIDFCF  635

Query  77   DPKDQMLPIKIDCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRMSTLHNNDFQVQVYDNG  136
            +  ++ L ++ D  +I +V++NLV+N+   ++   ++G I++    ++    +V V+++G
Sbjct  636  ETDNEDLRVEADRTRIKQVLINLVQNA---IEATGENGKIKITSEDMYTK-VRVSVWNSG  691

Query  137  SPIPDKIEKNLFEAFRTEGKQQGTGLGLAICKKLI-DLHRGLIRGRNLKNGTGVIFEI  193
             PIP+++++ +F  F T  K QGTGLGL+IC+K+I D H G I   N +NG   IFEI
Sbjct  692  PPIPEELKEKIFSPFFT-TKTQGTGLGLSICRKIIEDEHGGKIWTENRENGVVFIFEI  748


>ref|YP_001245013.1|  PAS/PAC sensor signal transduction histidine kinase [Thermotoga 
petrophila RKU-1]
 ref|YP_002615470.1|  hypothetical protein MPKA3_647 [Marinitoga piezophila KA3]
 gb|ABQ47437.1|  PAS/PAC sensor signal transduction histidine kinase [Thermotoga 
petrophila RKU-1]
 gb|EEB82092.1|  hypothetical protein MPKA3_647 [Marinitoga piezophila KA3]
Length=720

 GENE ID: 5170157 Tpet_1424 | PAS/PAC sensor signal transduction histidine
kinase [Thermotoga petrophila RKU-1]

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 97/167 (58%), Gaps = 7/167 (4%)

Query  29   ISGLTGDIVEFAKGKMELHPEQLNLEDFKEQLDAQLG-FIGELRLEYVIDPKDQMLPIKI  87
            +  +  +I+E++K +  L   + NL +   ++       I ++ +++  +  ++ L I  
Sbjct  552  LETIVKEILEYSKERQVLEFTEFNLNELIREVYVLFEEKIRKMNIDFCFETDNEDLRIDA  611

Query  88   DCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRMSTLHNNDFQVQVYDNGSPIPDKIEKNL  147
            D  +I +V++NLV+N+   ++   ++G I++    ++    +V V+++G PIP+++++ +
Sbjct  612  DRTRIKQVLINLVQNA---IEATGENGKIKITSEDMYTR-VRVSVWNSGPPIPEELKEKI  667

Query  148  FEAFRTEGKQQGTGLGLAICKKLI-DLHRGLIRGRNLKNGTGVIFEI  193
            F  F T  K QGTGLGL+IC+K+I D H G I   N +NG   IFEI
Sbjct  668  FSPFFT-TKTQGTGLGLSICRKIIEDEHGGKIWTENRENGVVFIFEI  713


>ref|ZP_01547164.1|  Signal transduction histidine kinase [Stappia aggregata IAM 12614]
 gb|EAV44481.1|  Signal transduction histidine kinase [Stappia aggregata IAM 12614]
Length=490

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 92/176 (52%), Gaps = 18/176 (10%)

Query  31   GLTGDIVEFAKGKMELHPEQ--LNLEDFKEQLDAQLGFIGELRLEYVIDPKDQMLPIKI-  87
            G T  ++ + K + E  P++  L L    + +   LG +    + +     D  +P  I 
Sbjct  321  GYTQAVMSYGKAQ-ERAPQRRLLALRRVADDVADVLGLVDHATVRF-----DNKVPADIE  374

Query  88   ---DCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRMSTLHNND---FQVQVYDNGSPIPD  141
               D  +I RV++NLV+N+++ L+ ++D+ L++ R++     +    +V+V D G  IPD
Sbjct  375  IDADPEQIFRVLLNLVRNAFQALEAEKDESLVR-RITIEAEREGACVRVRVSDTGPGIPD  433

Query  142  KIEKNLFEAFRTEGKQQGTGLGLAICKKLIDLHRGLIRGRNLKNGTGVIFEILLPD  197
             I K LF AF +  K  G GLGLAI  +L+  H G +R  + + GT   FE+  PD
Sbjct  434  NIRKALFRAFHSGSKNGGVGLGLAIVAELLKAHGGSVRLEDNRTGTCFCFEV--PD  487


>ref|YP_797985.1|  sensor histidine kinase and response regulator of a two component 
complex [Leptospira borgpetersenii serovar Hardjo-bovis 
L550]
 gb|ABJ79052.1|  Sensor histidine kinase and response regulator of a two component 
complex [Leptospira borgpetersenii serovar Hardjo-bovis 
L550]
Length=839

 GENE ID: 4408467 LBL_1593 | sensor histidine kinase and response regulator of a
two component complex [Leptospira borgpetersenii serovar Hardjo-bovis L550]
(10 or fewer PubMed links)

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/190 (30%), Positives = 103/190 (54%), Gaps = 17/190 (8%)

Query  17   TFIRRIKQSSVNISGLTGDIVEFAK---GKMELHPEQLNLEDFKEQLDAQLGFIGELR-L  72
            TF+  ++++S  +     D+++ +K   GKM L     NL D  + + A    + + R +
Sbjct  246  TFLETMERNSYTLLKHVNDLLDLSKLEAGKMTLRYSNANLSDMIQDIAAHFNSVADERNI  305

Query  73   EYVID-PKDQMLPIKIDCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRMSTLHNNDFQVQ  131
            ++V+D PK+   PI+ID  K+ R+I+NL+ N+++ + D    G I   +  + +    + 
Sbjct  306  DFVLDLPKN--FPIQIDVPKMERIILNLISNAFKFVPDS---GKIHCTLK-MESATAYIY  359

Query  132  VYDNGSPIPDKIEKNLFEAFR--TEGKQQ---GTGLGLAICKKLIDLHRGLIRGRNLKNG  186
            V DNG  +P  +   +FE FR   EG  +   GTGLGLAI ++ ++LH G I   +   G
Sbjct  360  VADNGPGVPVHLRDQIFEKFRQGEEGDSRSFGGTGLGLAIAREFVNLHLGSIGVFDSFLG  419

Query  187  TGVIFEILLP  196
             G +F++ +P
Sbjct  420  -GALFKVQIP  428


>ref|YP_800707.1|  sensor histidine kinase and response regulator of a two component 
complex [Leptospira borgpetersenii serovar Hardjo-bovis 
JB197]
 gb|ABJ75949.1|  Sensor histidine kinase and response regulator of a two component 
complex [Leptospira borgpetersenii serovar Hardjo-bovis 
JB197]
Length=839

 GENE ID: 4410169 LBJ_1368 | sensor histidine kinase and response regulator of a
two component complex [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
(10 or fewer PubMed links)

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/190 (30%), Positives = 103/190 (54%), Gaps = 17/190 (8%)

Query  17   TFIRRIKQSSVNISGLTGDIVEFAK---GKMELHPEQLNLEDFKEQLDAQLGFIGELR-L  72
            TF+  ++++S  +     D+++ +K   GKM L     NL D  + + A    + + R +
Sbjct  246  TFLETMERNSYTLLKHVNDLLDLSKLEAGKMTLRYSNANLSDMIQDIAAHFNSVADERNI  305

Query  73   EYVID-PKDQMLPIKIDCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRMSTLHNNDFQVQ  131
            ++V+D PK+   PI+ID  K+ R+I+NL+ N+++ + D    G I   +  + +    + 
Sbjct  306  DFVLDLPKN--FPIQIDVPKMERIILNLISNAFKFVPDS---GKIHCTLK-MESATAYIY  359

Query  132  VYDNGSPIPDKIEKNLFEAFR--TEGKQQ---GTGLGLAICKKLIDLHRGLIRGRNLKNG  186
            V DNG  +P  +   +FE FR   EG  +   GTGLGLAI ++ ++LH G I   +   G
Sbjct  360  VADNGPGVPVHLRDQIFEKFRQGEEGDSRSFGGTGLGLAIAREFVNLHLGSIGVFDSFLG  419

Query  187  TGVIFEILLP  196
             G +F++ +P
Sbjct  420  -GALFKVQIP  428


>ref|YP_779579.1|  periplasmic sensor signal transduction histidine kinase [Rhodopseudomonas 
palustris BisA53]
 gb|ABJ04599.1|  periplasmic sensor signal transduction histidine kinase [Rhodopseudomonas 
palustris BisA53]
Length=492

 GENE ID: 4358112 RPE_0641 | periplasmic sensor signal transduction histidine
kinase [Rhodopseudomonas palustris BisA53]

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 70/119 (58%), Gaps = 7/119 (5%)

Query  83   LPIKIDCRKICRVIVNLVKNSWEKLQD--DEDDGLIQVRMSTLHNNDFQ-VQVYDNGSPI  139
            L I  D  ++ RV++NLV+N+ + L++    D G++Q+R++         V+V D G  +
Sbjct  362  LTIDADPDQLFRVLLNLVRNAAQALENLPQSDSGVLQIRITGRREGAVTIVEVADTGPGV  421

Query  140  PDKIEKNLFEAFRTEGKQQGTGLGLAICKKLIDLHRGLIRGRNLKNGT-GVIFEILLPD  197
            P K + +LFEAF+   ++ GTGLGLAI  +L+  H G I   NL  GT G  F I +PD
Sbjct  422  PQKAKAHLFEAFQGSVREGGTGLGLAIAAELVRAHGGDI---NLVEGTIGATFRITIPD  477


>emb|CAJ89886.1|  putative two-component system sensor kinase [Streptomyces ambofaciens 
ATCC 23877]
Length=503

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 94/191 (49%), Gaps = 24/191 (12%)

Query  19   IRRIKQSSVNISGLTGDIVE---FAKGKMELHPEQLNLEDFKEQLDAQLGFIGELRLEYV  75
            +R I + +  ++GL  D++E   F  G   LH ++++L +   +  A  G++  +  +  
Sbjct  305  VRLISEETTKLAGLVDDLMEISRFDAGAAALHLDEIDLAESLRRTLASRGWLDTVETDL-  363

Query  76   IDPKDQMLPIKIDCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRMSTLHNNDFQ------  129
              P+   L  ++D R++  V+ NLV N+          G   VR+S    +D +      
Sbjct  364  --PEPGTLRGRVDPRRLDVVVANLVANALRH-------GAPPVRLSLRQEDDPRAGRRAV  414

Query  130  VQVYDNGSPIPDKIEKNLFEAF----RTEGKQQGTGLGLAICKKLIDLHRGLIRGRNLKN  185
            V V D G+ IPD +  ++F+ F        + +G+GLGLAI  + + LH G +R  N   
Sbjct  415  VTVADGGAGIPDDVLPHVFDRFYKSDSARTRSEGSGLGLAITTENVALHGGTVRAANHPR  474

Query  186  GTGVIFEILLP  196
            G G +F ++LP
Sbjct  475  G-GAVFTVVLP  484


>ref|YP_002290494.1|  histidine kinase [Oligotropha carboxidovorans OM5]
 gb|ACI94629.1|  histidine kinase [Oligotropha carboxidovorans OM5]
Length=477

 GENE ID: 6990573 OCAR_7527 | histidine kinase [Oligotropha carboxidovorans OM5]
(10 or fewer PubMed links)

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 71/123 (57%), Gaps = 7/123 (5%)

Query  83   LPIKIDCRKICRVIVNLVKNSWEKL--QDDEDDGLIQVRMSTLHNNDFQV-QVYDNGSPI  139
            L +  D  ++ RV++NLV+N+++ L  Q D D    Q+R++        V ++ D G  I
Sbjct  347  LVVDADPDQLFRVLLNLVRNAFQALETQPDADIAPKQIRVAGRREGAVAVLEISDTGPGI  406

Query  140  PDKIEKNLFEAFRTEGKQQGTGLGLAICKKLIDLHRGLIRGRNLKNGT-GVIFEILLPDC  198
            P +  ++LFEAF+   ++ GTGLGLAI  +LI  H G I   +L  GT G  F I++PD 
Sbjct  407  PPRAREHLFEAFQGSSREGGTGLGLAIAAELIRAHGGQI---DLVEGTIGATFRIVIPDR  463

Query  199  VLP  201
             +P
Sbjct  464  TIP  466


>ref|YP_001243093.1|  putative sensor histidine kinase [Bradyrhizobium sp. BTAi1]
 gb|ABQ39187.1|  Putative sensor histidine kinase [Bradyrhizobium sp. BTAi1]
Length=491

 GENE ID: 5154866 BBta_7323 | putative sensor histidine kinase
[Bradyrhizobium sp. BTAi1] (10 or fewer PubMed links)

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 73/132 (55%), Gaps = 6/132 (4%)

Query  83   LPIKIDCRKICRVIVNLVKNSWEKLQDDEDD-GLIQVRMSTLHNNDFQV-QVYDNGSPIP  140
            L I  D  ++ RV++NLV+N+ + L     D G+ Q+R++        + +V D G  +P
Sbjct  362  LKIDADPDQLFRVLLNLVRNAAQALDSLSGDVGVRQIRITGRREGSVTILEVSDTGPGVP  421

Query  141  DKIEKNLFEAFRTEGKQQGTGLGLAICKKLIDLHRGLIRGRNLKNGT-GVIFEILLPDCV  199
             K+ ++LFEAFR  G+  G+GLGLAI  +L+  H G I    L  GT G  F I +PD  
Sbjct  422  AKVREHLFEAFRGAGRPGGSGLGLAIAAELVRAHDGDI---QLVEGTLGATFRITIPDRP  478

Query  200  LPSQTAHTTQET  211
            +  QT  T + +
Sbjct  479  VELQTFWTERAS  490


>ref|YP_001921036.1|  sensory transduction histidine kinase [Clostridium botulinum 
E3 str. Alaska E43]
 gb|ACD51552.1|  sensory transduction histidine kinase [Clostridium botulinum 
E3 str. Alaska E43]
Length=515

 GENE ID: 6318736 CLH_1650 | sensory transduction histidine kinase
[Clostridium botulinum E3 str. Alaska E43]

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 102/193 (52%), Gaps = 16/193 (8%)

Query  15   SLTFIRRIKQSSVNISGLTGDIVEFAK---GKMELHPEQLNLEDFKEQLDAQLG-FIGEL  70
            +L +I  IKQ+S  +  L  ++++  +   G  +L  E  N+    E +   +  +I E 
Sbjct  296  NLKYINGIKQNSYRLLKLVNNLIDITQIDGGIYKLSLENCNIVSVIENIVISVSKYINEK  355

Query  71   RLEYVIDPKDQMLPIKIDCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRMST-LHNNDFQ  129
                + D   + + + IDC KI R+I+NL+ N+   ++     G I V +ST ++NN   
Sbjct  356  NRNIIFDTTKEEIILAIDCDKIERIILNLLSNA---VKYTNRGGNIYVNLSTDINNNRVI  412

Query  130  VQVYDNGSPIPDKIEKNLFEAFRTEG-----KQQGTGLGLAICKKLIDLHRGLIRGRN-L  183
            V++ D+G  IP+K   ++F  F+  G     + +GTG+GL+I + LI++H G I+  N +
Sbjct  413  VKIKDDGIGIPEKDMDSIFRRFKQSGDVFTRRCEGTGIGLSIVRSLIEMHGGKIKVNNEI  472

Query  184  KNGTGVIFEILLP  196
            K G   IF   LP
Sbjct  473  KKGAEFIF--FLP  483


>gb|AAG09417.1|AF180147_9  bZIP histidine kinase TobS [Pseudomonas putida]
Length=978

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 72/126 (57%), Gaps = 13/126 (10%)

Query  80   DQMLPIK----IDCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRMSTLHNNDFQVQVYDN  135
            D  LP++    +DC K  R+I+NL+ N++   +   D GLI+  +S    N   V V D+
Sbjct  281  DTKLPVQMVAEVDCEKYERIILNLLSNAF---KFTPDGGLIRCCLSLSRPNYALVTVSDS  337

Query  136  GSPIPDKIEKNLFEAFRT---EGKQ--QGTGLGLAICKKLIDLHRGLIRGRNLKNGTGVI  190
            G  IP  + K +FE F     EG+Q  +GTGLGL+I K+ ++LHRG I   +   G G +
Sbjct  338  GPGIPPALRKEIFERFHQLSQEGQQATRGTGLGLSIVKEFVELHRGTISVSDAPGG-GAL  396

Query  191  FEILLP  196
            F++ LP
Sbjct  397  FQVKLP  402


 Score = 45.1 bits (105),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 58/111 (52%), Gaps = 5/111 (4%)

Query  70   LRLEYVIDPKDQMLPIKIDCRKICRVIVNLVKNSWEKL-QDDEDDGLIQVRMSTLHNND-  127
            + L+ V D  D++  I  D  +I ++I+NL  N+ E + Q D +   + +  S     D 
Sbjct  847  VNLDVVAD--DELPEIWGDGVQIQQLIINLAMNAIEAISQADCETRQLTLSFSGNDTGDA  904

Query  128  FQVQVYDNGSPIPDKIEKNLFEAFRTEGKQQGTGLGLAICKKLIDLHRGLI  178
              + V D G  I ++    LF AF T  K++G G+GLAIC  + ++H G I
Sbjct  905  LVISVKDTGPGISERQMAQLFNAFYTT-KKEGLGMGLAICLTITEVHNGKI  954


>ref|YP_002700960.1|  sensor histidine kinase [Roseobacter sp. GAI101]
 gb|EEB83445.1|  sensor histidine kinase [Roseobacter sp. GAI101]
Length=461

 GENE ID: 7594562 regM | sensor histidine kinase [Roseobacter sp. GAI101]

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 75/136 (55%), Gaps = 11/136 (8%)

Query  61   DAQLGFIGELRLEYVIDPKDQMLPIKIDCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRM  120
            DA++GF   +       P D M  I+ D  +I RV+ NLV+N+ + +      G I V  
Sbjct  331  DAKIGFTAHI-------PPDLM--IRADPEQIFRVLANLVRNARQAIAATGQPGHISV-T  380

Query  121  STLHNNDFQVQVYDNGSPIPDKIEKNLFEAFRTEGKQQGTGLGLAICKKLIDLHRGLIRG  180
            +  H  ++ ++V+D+G  +P K +++LF AFR   ++ G+GLGLAI  +L+  H G +  
Sbjct  381  ALDHPKNWCIEVHDSGPGLPKKAQEHLFTAFRGGARKGGSGLGLAIAAELVRGHGGALEL  440

Query  181  RNLKNGTGVIFEILLP  196
                  +G +F+I LP
Sbjct  441  VE-TGASGTVFKITLP  455


>gb|ABA10818.1|  bZIP histidine kinase [Pseudomonas putida]
Length=978

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 72/126 (57%), Gaps = 13/126 (10%)

Query  80   DQMLPIK----IDCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRMSTLHNNDFQVQVYDN  135
            D  LP++    +DC K  R+I+NL+ N++   +   D GLI+  +S    N   V V D+
Sbjct  281  DTKLPVQMVAEVDCEKYERIILNLLSNAF---KFTPDGGLIRCCLSLSRPNYALVTVSDS  337

Query  136  GSPIPDKIEKNLFEAFRT---EGKQ--QGTGLGLAICKKLIDLHRGLIRGRNLKNGTGVI  190
            G  IP  + K +FE F     EG+Q  +GTGLGL+I K+ ++LHRG I   +   G G +
Sbjct  338  GPGIPPALRKEIFERFHQLSQEGQQATRGTGLGLSIVKEFVELHRGTISVSDAPGG-GAL  396

Query  191  FEILLP  196
            F++ LP
Sbjct  397  FQVKLP  402


 Score = 45.1 bits (105),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 58/111 (52%), Gaps = 5/111 (4%)

Query  70   LRLEYVIDPKDQMLPIKIDCRKICRVIVNLVKNSWEKL-QDDEDDGLIQVRMSTLHNND-  127
            + L+ V D  D++  I  D  +I ++I+NL  N+ E + Q D +   + +  S     D 
Sbjct  847  VNLDVVAD--DELPEIWGDGVQIQQLIINLAMNAIEAISQADCETRQLTLSFSGNDTGDA  904

Query  128  FQVQVYDNGSPIPDKIEKNLFEAFRTEGKQQGTGLGLAICKKLIDLHRGLI  178
              + V D G  I ++    LF AF T  K++G G+GLAIC  + ++H G I
Sbjct  905  LVISVKDTGPGISERQMAQLFNAFYTT-KKEGLGMGLAICLTITEVHNGKI  954


>ref|YP_001268187.1|  multi-sensor signal transduction histidine kinase [Pseudomonas 
putida F1]
 gb|ABQ79003.1|  PAS/PAC sensor hybrid histidine kinase [Pseudomonas putida F1]
Length=978

 GENE ID: 5194483 Pput_2872 | multi-sensor signal transduction histidine kinase
[Pseudomonas putida F1]

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 72/126 (57%), Gaps = 13/126 (10%)

Query  80   DQMLPIK----IDCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRMSTLHNNDFQVQVYDN  135
            D  LP++    +DC K  R+I+NL+ N++   +   D GLI+  +S    N   V V D+
Sbjct  281  DTKLPVQMVAEVDCEKYERIILNLLSNAF---KFTPDGGLIRCCLSLSRPNYALVTVSDS  337

Query  136  GSPIPDKIEKNLFEAFRT---EGKQ--QGTGLGLAICKKLIDLHRGLIRGRNLKNGTGVI  190
            G  IP  + K +FE F     EG+Q  +GTGLGL+I K+ ++LHRG I   +   G G +
Sbjct  338  GPGIPPALRKEIFERFHQLSQEGQQATRGTGLGLSIVKEFVELHRGTISVSDAPGG-GAL  396

Query  191  FEILLP  196
            F++ LP
Sbjct  397  FQVKLP  402


 Score = 45.1 bits (105),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 58/111 (52%), Gaps = 5/111 (4%)

Query  70   LRLEYVIDPKDQMLPIKIDCRKICRVIVNLVKNSWEKL-QDDEDDGLIQVRMSTLHNND-  127
            + L+ V D  D++  I  D  +I ++I+NL  N+ E + Q D +   + +  S     D 
Sbjct  847  VNLDVVAD--DELPEIWGDGVQIQQLIINLAMNAIEAISQADCETRQLTLSFSGNDTGDA  904

Query  128  FQVQVYDNGSPIPDKIEKNLFEAFRTEGKQQGTGLGLAICKKLIDLHRGLI  178
              + V D G  I ++    LF AF T  K++G G+GLAIC  + ++H G I
Sbjct  905  LVISVKDTGPGISERQMAQLFNAFYTT-KKEGLGMGLAICLTITEVHNGKI  954


>ref|YP_359782.1|  sensory box histidine kinase [Carboxydothermus hydrogenoformans 
Z-2901]
 gb|ABB13996.1|  sensory box histidine kinase [Carboxydothermus hydrogenoformans 
Z-2901]
Length=406

 GENE ID: 3726552 CHY_0935 | sensory box histidine kinase
[Carboxydothermus hydrogenoformans Z-2901] (10 or fewer PubMed links)

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/121 (39%), Positives = 70/121 (57%), Gaps = 9/121 (7%)

Query  88   DCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRMSTLH-NNDFQVQVYDNGSPIPDKIEKN  146
            D   +   I +++ N++E LQ D   G+I +     H +N+  +++ DNG  IP+++   
Sbjct  286  DEESLYLAITSILNNAFEALQKD---GVIVIETFYEHGSNEIGLRIADNGPGIPEELRSK  342

Query  147  LFEAFRTEGKQQGTGLGLAICKKLIDLHRGLIRGRNLKNGTGVIFEILLPDCVLPSQTAH  206
            +FE F T  K +GTGLGLAIC + I+ H G IR  N + G G  FEI LP   LP + AH
Sbjct  343  IFEPFFTT-KPEGTGLGLAICYRTIEEHGGEIRVYNNETG-GATFEITLP---LPLENAH  397

Query  207  T  207
            T
Sbjct  398  T  398


>emb|CAB43735.1|  bZIP histidine kinase [Pseudomonas putida]
Length=978

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 72/126 (57%), Gaps = 13/126 (10%)

Query  80   DQMLPIK----IDCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRMSTLHNNDFQVQVYDN  135
            D  LP++    +DC K  R+I+NL+ N++   +   D GLI+  +S    N   V V D+
Sbjct  281  DTKLPVQMVAEVDCEKYERIILNLLSNAF---KFTPDGGLIRCCLSLSRPNYALVTVSDS  337

Query  136  GSPIPDKIEKNLFEAFRT---EGKQ--QGTGLGLAICKKLIDLHRGLIRGRNLKNGTGVI  190
            G  IP  + K +FE F     EG+Q  +GTGLGL+I K+ ++LHRG I   +   G G +
Sbjct  338  GPGIPPALRKEIFERFHQLSQEGQQATRGTGLGLSIVKEFVELHRGTISVSDAPGG-GAL  396

Query  191  FEILLP  196
            F++ LP
Sbjct  397  FQVKLP  402


 Score = 45.1 bits (105),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 64/129 (49%), Gaps = 6/129 (4%)

Query  70   LRLEYVIDPKDQMLPIKIDCRKICRVIVNLVKNSWEKL-QDDEDDGLIQVRMSTLHNND-  127
            + L+ V D  D++  I  D  +I ++I+NL  N+ E + Q D +   + +  S     D 
Sbjct  847  VNLDVVAD--DELPEIWGDGVQIQQLIINLAMNAIEAISQADCETRQLTLSFSGNDTGDA  904

Query  128  FQVQVYDNGSPIPDKIEKNLFEAFRTEGKQQGTGLGLAICKKLIDLHRGLIRGRNLKNGT  187
              + V D G  I ++    LF AF T  K++G G+GLAIC  + ++H G I       G 
Sbjct  905  LVISVKDTGPGISERQMAQLFNAFYTT-KKEGLGMGLAICLTITEVHNGKIWVECPPAG-  962

Query  188  GVIFEILLP  196
            G  F + +P
Sbjct  963  GACFLVSIP  971


>ref|YP_741510.1|  periplasmic sensor signal transduction histidine kinase [Alkalilimnicola 
ehrlichei MLHE-1]
 gb|ABI56020.1|  periplasmic sensor signal transduction histidine kinase [Alkalilimnicola 
ehrlichei MLHE-1]
Length=917

 GENE ID: 4268278 Mlg_0666 | periplasmic sensor signal transduction histidine
kinase [Alkalilimnicola ehrlichei MLHE-1]

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 52/196 (26%), Positives = 100/196 (51%), Gaps = 12/196 (6%)

Query  10   MDLVRSLTFIRRIKQSSVNISGLTGDIVEFAK---GKMELHPEQLNLEDF-KEQLDAQLG  65
            +D  +   F++ + + S  ++ L   +++ +K   G  E H E L+L    +E  DA   
Sbjct  711  LDAEQRKEFLQVVVKESERLTRLINQVLDLSKIESGAAEWHLETLDLNQVVQEAADATRQ  770

Query  66   FIGELRLEYVIDPKDQMLPIKIDCRKICRVIVNLVKNSWEKLQDDEDDGLIQVRMSTLHN  125
               + R++  +   +Q   I  D  ++ ++++NL+ N+ +    D D+G ++V +  +  
Sbjct  771  IFHDTRVDLQVKAPEQPTIITGDHDRLIQLVINLLSNAAKF--TDPDNGRVEVSVVPVSA  828

Query  126  NDFQVQVYDNGSPIPDKIEKNLFEAF-----RTEGKQQGTGLGLAICKKLIDLHRGLIRG  180
               +++V DNG  I +  ++ +F+ F     +  GK +G+GLGLAICK ++D H G IR 
Sbjct  829  RKLELRVQDNGPGISEAEQRKIFDKFHQVSSQQAGKPKGSGLGLAICKLIMDAHSGDIRV  888

Query  181  RNLKNGTGVIFEILLP  196
             + + G G  F    P
Sbjct  889  ES-EPGAGATFICEFP  903