GOS 981010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1092351624775
Annotathon code: GOS_981010
Sample :
  • GPS :1°23'21n; 91°49'1w
  • Galapagos Islands: Wolf Island - Ecuador
  • Coastal (-1.7m, 21.8°C, 0.1-0.8 microns)
Authors
Team : BSB06CIIT
Username : Faryal
Annotated on : 2009-05-27 18:42:32
  • Azariah Suleman Charles
  • Bashir Maria
  • Tahir Faryal

Synopsis

  • Taxonomy: Dictyostelium discoideum (NCBI info)
    Rank: species - Genetic Code: Standard - NCBI Identifier: 44689
    Kingdom: Eukaryota - Phylum: - Class: - Order: Dictyosteliida
    Eukaryota; Mycetozoa; Dictyosteliida; Dictyostelium;

Genomic Sequence

>JCVI_READ_1092351624775 GOS_981010 Genomic DNA
TTTAGATTGTTAGATCCTTGAAATTTATCACATTTATTATAATACCAAAGATTACTATATTTTGGTTCTTCTTTGCATACTGGGTTTTCTTTCATAGTTA
AATATTGATGATGTCCGTTTTCAGAAAGCCACTTATTAAAAAACCAATTTAAATTCTCAGCAAATAGATTGCTTGAAGCAAATAAGCTAAAAGTTAAAAT
CACTAATATTTTTTTCATTTTTTAAGCTTAGAAGAAAACTTTAGATTTTCATTTTTAAATTTTGTTTTATTTTCGTTTATAAAATTATCCATAATTTTAA
CTTTTTCTTCCTCAAATTCTGATACTTTTCTAGTATTGAGGTCAACATAAAGAGCCAGGACTTCTATTGTTGAAGCTAAGTAATTTTTTGTTTTATGAAT
CATTTCCATCTTATATTGAAGACGTTTTTTATCGTGATCGAAGTATGTTAAATTTATATCGACTTCATCATCAAGTTTAAGCTCTCCATTATATGTAATA
TTTGTTTCAACAACCATTGTACTCATTCCAGTAGTCTTTGCAGAGTGTTCTCCCATCTTAAAAATATTATTTAAGGTTTCTGCTCCATATACATCAAACA
TTAATAAGTAATAGGAAACATTCATGTGATTGTTATAGTCAATCCAATCTTTAATTACTTTTTGTGAACTTAAGTAAATTGACATGAAAAAATTAAAAAA
TATTTTTTAAAAACTCTGGTAATCCATCTGGGATTAGTCCATAAACCACTTTTACCACCTTCTTTAATTAATAATTTAACATTATCAATTTTAAGATGTG
GATTGACTATCTTGCTTAAATCATAAATTGTTATTAATGCTGCATTAACACCCATTATGGCTTCCATCTCTACACCAGTTTTTGCAACAGCTGATACTAC
ACAGAAAACTTCCAATGAATTGTCTACTTCGTTCATAATGATTTTAGTCGCAGTATGATCTATTGGGAAGTGGGTGACATAAAGGAATTAATTCACTAGT
TTTT

Translation

[69 - 332/1004]   indirect strand
>GOS_981010 Translation [69-332   indirect strand]
MNEVDNSLEVFCVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLKIDNVKLLIKEGGKSGLWTNPRWITRVFKKYFLIFSCQFT

Annotator commentaries

This DNA has a good ORF in reading frame 3 on the reverse strand extends from base 69 to base 335.

when we used SMS ORF Finder to detectthe ORF. Standard genetic table was used and minimum

length for reporting an ORF was 60 amino acids. The total polypeptide size is 88 aa. The selected ORF was then searched

for protein domains using 'InterPro Scan' at EBI.conserved domains can me found from the protein domain accession number when the results are displayed . We can also check the conserved domain from BLAST tool and also check the homology identity & check the good hits.

We selected 12 top hits from BLAST results and used them in Multiple sequence alignment in Phylogeny.fr ( in MUSCLE), we also used Clustal results & along GBlocks program to remove the gaps between the aligment,

Then we used BioNJ tool from phylogeny.fr with default paramters Except bootstrap was at 100, & then the tree was constructed . Taxonomy reports were taken from the BLAST Result page



This sequence encodes for MOLYBDOPTERIN COFACTOR SYNTHESIS PROTEIN A which belongs to the Moac protein family Accession number IPR002820 and is likely to be present in organism Candidatus Pelagibacter bacteria.

ORF finding

PROTOCOL


a)SMS ORFinder / Forward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'universal' genetic code

b)SMS ORFinder / reverse strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'universal' genetic code


RESULTS ANALYSIS


I have selected the ORF number 1 in reading frame 3 on the reverse strand extends from base 69 to base 335 just because it gives me Protein domain better than the ORF number 1 in reading frame 2 on the reverse strand. Though the E value of the short ORF (88 amino acid )is 6e-32 it gives me good results in Blastp.

RAW RESULTS
----------------------------------------------------------------------------------------------------------------------
a)
ORF Finder results
Results for 1004 residue sequence "Untitled" starting "TTTAGATTGT"
No ORFs were found in reading frame 1.
No ORFs were found in reading frame 2.
No ORFs were found in reading frame 3.

----------------------------------------------------------------------------------------------------------------------
b)
ORF Finder results
Results for 1004 residue sequence "Untitled" starting "TTTAGATTGT"
>ORF number 1 in reading frame 1 on the reverse strand extends from base 787 to base 1002.
ATGAAAAAAATATTAGTGATTTTAACTTTTAGCTTATTTGCTTCAAGCAATCTATTTGCT
GAGAATTTAAATTGGTTTTTTAATAAGTGGCTTTCTGAAAACGGACATCATCAATATTTA
ACTATGAAAGAAAACCCAGTATGCAAAGAAGAACCAAAATATAGTAATCTTTGGTATTAT
AATAAATGTGATAAATTTCAAGGATCTAACAATCTA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
MKKILVILTFSLFASSNLFAENLNWFFNKWLSENGHHQYLTMKENPVCKEEPKYSNLWYY
NKCDKFQGSNNL

>ORF number 1 in reading frame 2 on the reverse strand extends from base 320 to base 790.
ATGTCAATTTACTTAAGTTCACAAAAAGTAATTAAAGATTGGATTGACTATAACAATCAC
ATGAATGTTTCCTATTACTTATTAATGTTTGATGTATATGGAGCAGAAACCTTAAATAAT
ATTTTTAAGATGGGAGAACACTCTGCAAAGACTACTGGAATGAGTACAATGGTTGTTGAA
ACAAATATTACATATAATGGAGAGCTTAAACTTGATGATGAAGTCGATATAAATTTAACA
TACTTCGATCACGATAAAAAACGTCTTCAATATAAGATGGAAATGATTCATAAAACAAAA
AATTACTTAGCTTCAACAATAGAAGTCCTGGCTCTTTATGTTGACCTCAATACTAGAAAA
GTATCAGAATTTGAGGAAGAAAAAGTTAAAATTATGGATAATTTTATAAACGAAAATAAA
ACAAAATTTAAAAATGAAAATCTAAAGTTTTCTTCTAAGCTTAAAAAATGA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
MSIYLSSQKVIKDWIDYNNHMNVSYYLLMFDVYGAETLNNIFKMGEHSAKTTGMSTMVVE
TNITYNGELKLDDEVDINLTYFDHDKKRLQYKMEMIHKTKNYLASTIEVLALYVDLNTRK
VSEFEEEKVKIMDNFINENKTKFKNENLKFSSKLKK*

>ORF number 1 in reading frame 3 on the reverse strand extends from base 69 to base 335.
ATGAACGAAGTAGACAATTCATTGGAAGTTTTCTGTGTAGTATCAGCTGTTGCAAAAACT
GGTGTAGAGATGGAAGCCATAATGGGTGTTAATGCAGCATTAATAACAATTTATGATTTA
AGCAAGATAGTCAATCCACATCTTAAAATTGATAATGTTAAATTATTAATTAAAGAAGGT
GGTAAAAGTGGTTTATGGACTAATCCCAGATGGATTACCAGAGTTTTTAAAAAATATTTT
TTAATTTTTTCATGTCAATTTACTTAA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
MNEVDNSLEVFCVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLKIDNVKLLIKEG
GKSGLWTNPRWITRVFKKYFLIFSCQFT*

Multiple Alignement

PROTOCOL

A)Multiple Alignment of sequences using Muscle Default parameters without curation (CLUSTALW format)

B)Multiple Alignment of sequences after curation (Gblock Result)


RESULTS ANALYSIS


The ORF selected was


>ORF number 1 in reading frame 3 on the reverse strand extends from base 69 to base 335.

ATGAACGAAGTAGACAATTCATTGGAAGTTTTCTGTGTAGTATCAGCTGTTGCAAAAACT

GGTGTAGAGATGGAAGCCATAATGGGTGTTAATGCAGCATTAATAACAATTTATGATTTA

AGCAAGATAGTCAATCCACATCTTAAAATTGATAATGTTAAATTATTAATTAAAGAAGGT

GGTAAAAGTGGTTTATGGACTAATCCCAGATGGATTACCAGAGTTTTTAAAAAATATTTT

TTAATTTTTTCATGTCAATTTACTTAA


>Translation of ORF number 1 in reading frame 3 on the reverse strand.

MNEVDNSLEVFCVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLKIDNVKLLIKEG

GKSGLWTNPRWITRVFKKYFLIFSCQFT*



I align my query sequence and got good alignment.As my sequence started from base 69 to base 335. so alignment in start is good

RAW RESULTS

----------------------------------------------------------------------------------------------------
CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


GOS_981010      ------------------------------------------------------------
gi|2243909      --------MKNLKVINKDELKDWADEIFKKNSFNMVNVSSKKETFRRALASGKIYVGKQV
gi|7108346      --------MANLKVINEEKLKDWAKEIFKKNSFNMIDVSSKKETFRRALASGKIYVGKEV
gi|9176211      --------MANLKVINKEKLKDWAKDIFKKNSFNMIDVSSKKETFRRALASGKIYVGKEV
gi|1905746      ----------------------------------MADVRNKRISRRRAVAVGELHAGPVA
gi|2251391      ----------------------------------MADVRDKRITRRRAVAVGELHAGPVA
gi|1943660      ------------------------MSGELNAAFHMADVRDKRITRRRAVAVGELHAGPVA
gi|4140690      MARAPEASTASATRASGEPRSGALSHLDERGAAHMVDVSGKAPSKRTAVAAGVLRTSADV
gi|1184649      ----------------------------------MVDVSGKAPSKRTAVAAGVLRTSADV
gi|2253896      ---------------------MEFTHFDEQGNARMVDVGDKADTKREAVARGTIFMSPQC
gi|2182761      --------------------MGEFTHFNKEGNAVMVDVHAKDDTYRVAVAAGKIYVNEEV
                                                                            

GOS_981010      -------------------------------------------------MNEVDNSLEVF
gi|2243909      FDLISNKKMPKGDPTTLAEISAVLGVKKTSELIPLCHPLPIDHIATKIMMNDKDNSLEVF
gi|7108346      FNLIRNKEMPKGDPITLAEVSAILGVKKTSELIPLCHPLPIDHTATKIIMHEDDSSLEVF
gi|9176211      FELIKNKEMPKGDPITLAEVSAILGVKKTSELIPLCHPLPIDHTATKIIMHEDGSSLEVF
gi|1905746      YPLIVERRLPKGDALVMAEIAGLQGAKMASMLMPLCHPLPLELVQVFCAPVPERQAIRVW
gi|2251391      YPLIVERRLPKGDALVMAEIAGLQGAKMASMLMPLCHPLPLELVQVFCAPVPERQAIRVW
gi|1943660      YPLIVERRLPKGDALVMAEIAGLQGAKMASMLMPLCHPLPLELVQVFCAAVPERQAIRVW
gi|4140690      VALISTGGLPKGDALATARVAGIQAAKRTSDLIPLCHQLALTGVDVDFAVGESD--IEIT
gi|1184649      VALISTGGLPKGDALATARVAGIQAAKRTSDLIPLCHQLALTGVDVDFAVGESD--IEIT
gi|2253896      LDMVSRGTMAKGDVLGVARVAGIMGAKRTSDLIPLCHILNLTKLNVDFTIKKEINGIEAV
gi|2182761      YAAIKGHTAKKGDVLGVARIAGIMAAKKNSELIPLCHIIALTDCEIRYEMHDEEHSIEAF
                                                                        :   

GOS_981010      CVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLKIDNVKLLIKEGGKSGLWTNPRW
gi|2243909      CVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLKIDNIKLLIKEGGKSGLWTNPDG
gi|7108346      CVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLRIDNVKLLIKEGGKSGLWINPDG
gi|9176211      CVVSAVAKTGVEMEAIMGVNTALITIYDLSKIVNPHLRIDNVRLLIKEGGKSGLWINPDG
gi|1905746      CECASEARTGVEMEALAGVNAALLTLYDLSKPVEPALRIEGIRLLFKEGGKRGVWLHPDG
gi|2251391      CECASEARTGVEMEALAGVNAALLTLYDLSKPVEPALRIEGIRLLFKEGGKRGVWLHPDG
gi|1943660      CECASEARTGVEMEALAGVNAALLTLYDLSKPVEPALRIEGIRLLFKEGGKRGVWLHPDG
gi|4140690      ATVASTDRTGVEMEALTAVSVAGLTLYDMIKAVDPAARIDDVRVLRKEGGKTGMWTRS--
gi|1184649      ATVTSTDRTGVEMEALTAVSVAGLTLYDMIKAVDPAARIDDVRVLRKEGGKTGMWTRS--
gi|2253896      CTARTTGKTGVEMEALTGVTVALLTIYDMCKAVDKSMEIGNVYLEHKSGGKSGDFHNPRH
gi|2182761      CKTSCIGKTGVEMEAMTGVSVTLLTIYDMCKAMDRGMRITDIHLMEKDGGKSGHYVCEES
                .      .*******: .*..: :*:**: * ::    * .: :  *.*** * :     

GOS_981010      ITRVFKKYF---------------------------------------------------
gi|2243909      LPEFLKDIF---------------------------------------------------
gi|7108346      LPEFLKDIF---------------------------------------------------
gi|9176211      LPEFLKDIF---------------------------------------------------
gi|1905746      MDEAERVRFNPRAPKGLEGAACAVITLSDRASEGTYEDVSGPTLVTGLRKLGGDVVAAEV
gi|2251391      MDEAERARFKPRAPKGLEGATCAVITLSDRASDGTYEDISGPTLVTGVKKLGGEVVAAEV
gi|1943660      MDDAERARFKPRAPKGLEGAACAVITLSDRASEGTYEDVSGPTLVTGVKKLGGEVVAAEV
gi|4140690      ------------------------------------------------------------
gi|1184649      ------------------------------------------------------------
gi|2253896      NGEQVL------------------------------------------------------
gi|2182761      CS----------------------------------------------------------
                                                                            

GOS_981010      ------------------------------------------------------------
gi|2243909      ------------------------------------------------------------
gi|7108346      ------------------------------------------------------------
gi|9176211      ------------------------------------------------------------
gi|1905746      LPDGIEPLAGRLQALAAEGVRLCLCTGGTGLGPRDLTPEALRSLNARPVHGLAQMVRALS
gi|2251391      LPDGIEPLAGRLQALAADGVRLCLCTGGTGLGPRDLTPEALRSLNARPVHGLAQMVRALS
gi|1943660      LPDGIEPLAGRLQALAAEGVRLCLCTGGTGLGPRDLTPEALRSLNARPVHGLAQMVRALS
gi|4140690      ------------------------------------------------------------
gi|1184649      ------------------------------------------------------------
gi|2253896      ------------------------------------------------------------
gi|2182761      ------------------------------------------------------------
                                                                            

GOS_981010      --------------------LIFSCQFT---------------------------
gi|2243909      -------------------------------------------------------
gi|7108346      -------------------------------------------------------
gi|9176211      -------------------------------------------------------
gi|1905746      AQHTPMAWLSRAEVVQLGNMLVFALPGSPKAAAQCLDILAPVLGHALAMVEGDGH
gi|2251391      AQHTPMAWLSRAEVVQLGGMLVFALPGSPKAAAQCLDILAPVLGHALAMIDGGGH
gi|1943660      AQHTPMAWLSRAEVVQLGNMLVFALPGSPKAAAQCLDILAPVLGHALAMVDGGGH
gi|4140690      -------------------------------------------------------
gi|1184649      -------------------------------------------------------
gi|2253896      -------------------------------------------------------
gi|2182761      -------------------------------------------------------
                                                                       

---------------------------------------------------------------------------------------------------------------------


Gblocks 0.91b Results
Processed file: input.fasta
Number of sequences: 11
Alignment assumed to be: Protein
New number of positions: 55 (selected positions are underlined in blue) 

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
GOS_981010_Tran  ------------------------------------------------------------
gi|224390971|re  --------MKNLKVINKDELKDWADEIFKKNSFNMVNVSSKKETFRRALASGKIYVGKQV
gi|71083464|ref  --------MANLKVINEEKLKDWAKEIFKKNSFNMIDVSSKKETFRRALASGKIYVGKEV
gi|91762113|ref  --------MANLKVINKEKLKDWAKDIFKKNSFNMIDVSSKKETFRRALASGKIYVGKEV
gi|190574698|re  ----------------------------------MADVRNKRISRRRAVAVGELHAGPVA
gi|225139112|re  ----------------------------------MADVRDKRITRRRAVAVGELHAGPVA
gi|194366020|re  ------------------------MSGELNAAFHMADVRDKRITRRRAVAVGELHAGPVA
gi|41406900|ref  MARAPEASTASATRASGEPRSGALSHLDERGAAHMVDVSGKAPSKRTAVAAGVLRTSADV
gi|118464937|re  ----------------------------------MVDVSGKAPSKRTAVAAGVLRTSADV
gi|225389654|re  ---------------------MEFTHFDEQGNARMVDVGDKADTKREAVARGTIFMSPQC
gi|218276186|re  --------------------MGEFTHFNKEGNAVMVDVHAKDDTYRVAVAAGKIYVNEEV
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
GOS_981010_Tran  -------------------------------------------------MNEVDNSLEVF
gi|224390971|re  FDLISNKKMPKGDPTTLAEISAVLGVKKTSELIPLCHPLPIDHIATKIMMNDKDNSLEVF
gi|71083464|ref  FNLIRNKEMPKGDPITLAEVSAILGVKKTSELIPLCHPLPIDHTATKIIMHEDDSSLEVF
gi|91762113|ref  FELIKNKEMPKGDPITLAEVSAILGVKKTSELIPLCHPLPIDHTATKIIMHEDGSSLEVF
gi|190574698|re  YPLIVERRLPKGDALVMAEIAGLQGAKMASMLMPLCHPLPLELVQVFCAPVPERQAIRVW
gi|225139112|re  YPLIVERRLPKGDALVMAEIAGLQGAKMASMLMPLCHPLPLELVQVFCAPVPERQAIRVW
gi|194366020|re  YPLIVERRLPKGDALVMAEIAGLQGAKMASMLMPLCHPLPLELVQVFCAAVPERQAIRVW
gi|41406900|ref  VALISTGGLPKGDALATARVAGIQAAKRTSDLIPLCHQLALTGVDVDFAVGESD--IEIT
gi|118464937|re  VALISTGGLPKGDALATARVAGIQAAKRTSDLIPLCHQLALTGVDVDFAVGESD--IEIT
gi|225389654|re  LDMVSRGTMAKGDVLGVARVAGIMGAKRTSDLIPLCHILNLTKLNVDFTIKKEINGIEAV
gi|218276186|re  YAAIKGHTAKKGDVLGVARIAGIMAAKKNSELIPLCHIIALTDCEIRYEMHDEEHSIEAF
                                                                             


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
GOS_981010_Tran  CVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLKIDNVKLLIKEGGKSGLWTNPRW
gi|224390971|re  CVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLKIDNIKLLIKEGGKSGLWTNPDG
gi|71083464|ref  CVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLRIDNVKLLIKEGGKSGLWINPDG
gi|91762113|ref  CVVSAVAKTGVEMEAIMGVNTALITIYDLSKIVNPHLRIDNVRLLIKEGGKSGLWINPDG
gi|190574698|re  CECASEARTGVEMEALAGVNAALLTLYDLSKPVEPALRIEGIRLLFKEGGKRGVWLHPDG
gi|225139112|re  CECASEARTGVEMEALAGVNAALLTLYDLSKPVEPALRIEGIRLLFKEGGKRGVWLHPDG
gi|194366020|re  CECASEARTGVEMEALAGVNAALLTLYDLSKPVEPALRIEGIRLLFKEGGKRGVWLHPDG
gi|41406900|ref  ATVASTDRTGVEMEALTAVSVAGLTLYDMIKAVDPAARIDDVRVLRKEGGKTGMWTRS--
gi|118464937|re  ATVTSTDRTGVEMEALTAVSVAGLTLYDMIKAVDPAARIDDVRVLRKEGGKTGMWTRS--
gi|225389654|re  CTARTTGKTGVEMEALTGVTVALLTIYDMCKAVDKSMEIGNVYLEHKSGGKSGDFHNPRH
gi|218276186|re  CKTSCIGKTGVEMEAMTGVSVTLLTIYDMCKAMDRGMRITDIHLMEKDGGKSGHYVCEES
                 #######################################################     


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
GOS_981010_Tran  ITRVFKKYF---------------------------------------------------
gi|224390971|re  LPEFLKDIF---------------------------------------------------
gi|71083464|ref  LPEFLKDIF---------------------------------------------------
gi|91762113|ref  LPEFLKDIF---------------------------------------------------
gi|190574698|re  MDEAERVRFNPRAPKGLEGAACAVITLSDRASEGTYEDVSGPTLVTGLRKLGGDVVAAEV
gi|225139112|re  MDEAERARFKPRAPKGLEGATCAVITLSDRASDGTYEDISGPTLVTGVKKLGGEVVAAEV
gi|194366020|re  MDDAERARFKPRAPKGLEGAACAVITLSDRASEGTYEDVSGPTLVTGVKKLGGEVVAAEV
gi|41406900|ref  ------------------------------------------------------------
gi|118464937|re  ------------------------------------------------------------
gi|225389654|re  NGEQVL------------------------------------------------------
gi|218276186|re  CS----------------------------------------------------------
                                                                             


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
GOS_981010_Tran  ------------------------------------------------------------
gi|224390971|re  ------------------------------------------------------------
gi|71083464|ref  ------------------------------------------------------------
gi|91762113|ref  ------------------------------------------------------------
gi|190574698|re  LPDGIEPLAGRLQALAAEGVRLCLCTGGTGLGPRDLTPEALRSLNARPVHGLAQMVRALS
gi|225139112|re  LPDGIEPLAGRLQALAADGVRLCLCTGGTGLGPRDLTPEALRSLNARPVHGLAQMVRALS
gi|194366020|re  LPDGIEPLAGRLQALAAEGVRLCLCTGGTGLGPRDLTPEALRSLNARPVHGLAQMVRALS
gi|41406900|ref  ------------------------------------------------------------
gi|118464937|re  ------------------------------------------------------------
gi|225389654|re  ------------------------------------------------------------
gi|218276186|re  ------------------------------------------------------------
                                                                             


                        310       320       330       340       350
                 =========+=========+=========+=========+=========+=====
GOS_981010_Tran  --------------------LIFSCQFT---------------------------
gi|224390971|re  -------------------------------------------------------
gi|71083464|ref  -------------------------------------------------------
gi|91762113|ref  -------------------------------------------------------
gi|190574698|re  AQHTPMAWLSRAEVVQLGNMLVFALPGSPKAAAQCLDILAPVLGHALAMVEGDGH
gi|225139112|re  AQHTPMAWLSRAEVVQLGGMLVFALPGSPKAAAQCLDILAPVLGHALAMIDGGGH
gi|194366020|re  AQHTPMAWLSRAEVVQLGNMLVFALPGSPKAAAQCLDILAPVLGHALAMVDGGGH
gi|41406900|ref  -------------------------------------------------------
gi|118464937|re  -------------------------------------------------------
gi|225389654|re  -------------------------------------------------------
gi|218276186|re  -------------------------------------------------------
                                                                        





Parameters used
Minimum Number Of Sequences For A Conserved Position: 6
Minimum Number Of Sequences For A Flanking Position: 9
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes

Flank positions of the 1 selected block(s)
Flanks: [121  175]  

New number of positions in input.fasta-gb:  55  (15% of the original 355 positions)

Protein Domains

PROTOCOL

InterPro : Default Parameters at EBI


RESULTS ANALYSIS :


I have selected the ORF number 1 in reading frame 3 on the reverse strand extends from base 69 to base 335 just because it gives me Protein domain. Though the E value is 6e-32 it gives me good results in Blastp

The domain i found was


MOLYBDOPTERIN COFACTOR SYNTHESIS PROTEIN A belonging to Moac family within the range 6 - 67 and E value 3.4e-18

, though i got high E value but this was the only significant i got from my blast results showing homology of 85% which was better then other ORF .


GOS_981010	BEC228A8320E19ED	88	Gene3D	G3DSA:3.30.70.640	no description	6	72	1.6e-15	T	22-May-2009	IPR002820	Molybdopterin cofactor biosynthesis MoaC region	Biological Process: Mo-molybdopterin cofactor biosynthetic process (GO:0006777)
GOS_981010	BEC228A8320E19ED	88	HMMPanther	PTHR22960	MOLYBDOPTERIN COFACTOR SYNTHESIS PROTEIN A	1	75	8.7e-12	T	22-May-2009	NULL	NULL	
GOS_981010	BEC228A8320E19ED	88	superfamily	SSF55040	Molybdenum cofactor biosynthesis protein C, MoaC	6	67	3.4e-18	T	22-May-2009	IPR002820	Molybdopterin cofactor biosynthesis MoaC region	Biological Process: Mo-molybdopterin cofactor biosynthetic process (GO:0006777)
GOS_981010	BEC228A8320E19ED	88	HMMPfam	PF01967	MoaC	2	61	6.5e-19	T	22-May-2009	IPR002820	Molybdopterin cofactor biosynthesis MoaC region	Biological Process: Mo-molybdopterin cofactor biosynthetic process (GO:0006777)

Phylogeny

PROTOCOL

a)Phylogeny.fr / PhyML method / no bootstrap / default substitution model

b) Phylogeny.fr / BioNJ method / no bootstrap / default substitution model


RESULTS ANALYSIS


I Used two Output for Tree one displaying the proteins & the accesion number & the other tree displaying species name & accession number



My ORF was GOS_981010_Translation_69-332_indirect_strand and it was closely related to

gi_224390971_ref_YP_002591541.1_molybdenum_cofactor_biosynthesis[Candidatus Pelagibacter ] which was my specie having the protein MOLYBDOPTERIN COFACTOR SYNTHESIS PROTEIN A . this is what i predicted earlier from from my protein domains in my INTERPRO scan results.

RAW RESULTS

------------------------------------------------------------------------------------------------
TREE 1: 
                           +-------------------------gi_225389654_ref_ZP_03759378.1_hypothetical_protein_CLOSTASPAR_0
                 +---------+
                 |         +------------------------gi_163846348_ref_YP_001634392.1_molybdenum_cofactor_biosynthesis
   +-------------+
   |             |
 +-+             +--------------------------------------gi_218276186_ref_ZP_03485446.1_hypothetical_protein_ROSINTL182_0
 | |
 | +-----------------------------gi_41406900_ref_NP_959736.1_molybdenum_cofactor_biosynthesis_pro
 |
 |                                             +gi_190574698_ref_YP_001972543.1_putative_molybdenum_cofactor_bio
 |                                             |
 |                                             |gi_225139112_ref_YP_002707403.1_molybdenum_cofactor_biosynthesis
 |                 +---------------------------+
 |                 |                           |
 |                 |                           +gi_194366020_ref_YP_002028630.1_molybdenum_cofactor_biosynthesis
 +-----------------+
                   |                         +-gi_91762113_ref_ZP_01264078.1_molybdopterin_cofactor_synthesis_p
                   |                         |
                   |                         |   +GOS_981010_Translation_69-332_indirect_strand
                   +-------------------------+   |
                                             |+--+
                                             ++  +--gi_224390971_ref_YP_002591541.1_molybdenum_cofactor_biosynthesis[Candidatus Pelagibacter sp. HTCC7211]
                                              |
                                              +gi_71083464_ref_YP_266183.1_molybdopterin_cofactor_synthesis_pro


----------------------------------------------------------------------------------------------------------------------
TREE 2:


                                                  ----0.1---
 
                           +-------------------------Clostridium_asparagiforme_DSM_15981_gi_225389654_ref_ZP_03759378
                 +---------+
                 |         +------------------------Chloroflexus_aurantiacus_J-10-fl_gi_163846348_ref_YP_001634392.1
   +-------------+
   |             |
 +-+             +--------------------------------------Roseburia_intestinalis_L1-82_gi_218276186_ref_ZP_03485446.1_hypo
 | |
 | +-----------------------------Mycobacterium_avium_subsp._paratuberculosis_K-10_gi_41406900_ref
 |
 |                                             +Stenotrophomonas_maltophilia_K279a_gi_190574698_ref_YP_001972543
 |                                             |
 |                                             |Stenotrophomonas_sp._SKA14_gi_225139112_ref_YP_002707403.1_molyb
 |                 +---------------------------+
 |                 |                           |
 |                 |                           +Stenotrophomonas_maltophilia_R551-3_gi_194366020_ref_YP_00202863
 +-----------------+
                   |                         +-Candidatus_Pelagibacter_ubique_HTCC1002_gi_91762113_ref_ZP_01264
                   |                         |
                   |                         |   +GOS_981010_Translation_69-332_indirect_strand
                   +-------------------------+   |
                                             |+--+
                                             ++  +--Candidatus_Pelagibacter_sp._HTCC7211_gi_224390971_ref_YP_0025915
                                              |
                                              +Candidatus_Pelagibacter_ubique_HTCC1062_gi_71083464_ref_YP_26618

Taxonomy report

PROTOCOL

BLASTp VS Swissprot : default NCBI paramters


RESULTS ANALYSIS

According to the taxanomic report the query sequence best matches with the organism is ref|YP_002591541.1| Candidatus Pelagibacter sp. HTCC7211 and the bit score is 139 & Best hit is 2 hits

So i will Continue with this in my further step with Multipe sequence alignment

RAW RESULTS

----------------------------------------------------------------------------------------------------------------------

Lineage Report

cellular organisms
. Bacteria                [bacteria]
. . Proteobacteria          [proteobacteria]
. . . Alphaproteobacteria     [a-proteobacteria]
. . . . Candidatus Pelagibacter [a-proteobacteria]
. . . . . Candidatus Pelagibacter sp. HTCC7211 ----------------------  139 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Candidatus Pela
. . . . . Candidatus Pelagibacter ubique HTCC1062 ...................  134 2 hits [a-proteobacteria]    molybdopterin cofactor synthesis protein [Candidatus Pelagi
. . . . . Candidatus Pelagibacter ubique HTCC1002 ...................  128 2 hits [a-proteobacteria]    molybdopterin cofactor synthesis protein [Candidatus Pelagi
. . . . Erythrobacter sp. NAP1 --------------------------------------   63 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Erythrobacter s
. . . . Azorhizobium caulinodans ORS 571 ............................   61 3 hits [a-proteobacteria]    molybdopterin cofactor biosynthesis protein [Azorhizobium c
. . . . Aurantimonas sp. SI85-9A1 ...................................   60 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis enzyme [Aurantimonas sp. S
. . . . Sphingomonas sp. SKA58 ......................................   60 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Sphingomonas sp
. . . . Maricaulis maris MCS10 ......................................   60 2 hits [a-proteobacteria]    GTP cyclohydrolase subunit MoaC [Maricaulis maris MCS10] >g
. . . . Methylobacterium extorquens PA1 .............................   60 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Methylobacteriu
. . . . Methylobacterium chloromethanicum CM4 .......................   60 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Methylobacteriu
. . . . Novosphingobium aromaticivorans DSM 12444 ...................   59 3 hits [a-proteobacteria]    GTP cyclohydrolase subunit MoaC [Novosphingobium aromaticiv
. . . . Magnetospirillum magnetotacticum MS-1 .......................   58 2 hits [a-proteobacteria]    COG0315: Molybdenum cofactor biosynthesis enzyme [Magnetosp
. . . . Methylobacterium populi BJ001 ...............................   58 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Methylobacteriu
. . . . Roseovarius nubinhibens ISM .................................   58 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Roseovarius nub
. . . . Erythrobacter litoralis HTCC2594 ............................   58 3 hits [a-proteobacteria]    molybdopterin cofactor biosynthesis MoaC region [Erythrobac
. . . . Fulvimarina pelagi HTCC2506 .................................   58 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Fulvimarina pel
. . . . Magnetospirillum magneticum AMB-1 ...........................   58 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein [Magnetospirillum 
. . . . Rhizobium leguminosarum bv. trifolii WSM2304 ................   58 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Rhizobium legum
. . . . Rhizobium etli CFN 42 .......................................   58 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein [Rhizobium etli CF
. . . . Rhodopseudomonas palustris BisA53 ...........................   58 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Rhodopseudomona
. . . . Erythrobacter sp. SD-21 .....................................   57 2 hits [a-proteobacteria]    Molybdopterin cofactor biosynthesis MoaC region [Erythrobac
. . . . Rhodobacteraceae bacterium KLH11 ............................   57 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Rhodobacteracea
. . . . Rhizobium etli Brasil 5 .....................................   57 1 hit  [a-proteobacteria]    putative molybdenum cofactor biosynthesis protein [Rhizobiu
. . . . Rhizobium etli CIAT 652 .....................................   57 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein [Rhizobium etli CI
. . . . Rhizobium leguminosarum bv. viciae 3841 .....................   57 2 hits [a-proteobacteria]    putative molybdenum cofactor biosynthesis protein [Rhizobiu
. . . . Rhizobium leguminosarum bv. trifolii WSM1325 ................   57 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Rhizobium legum
. . . . Rhizobium etli GR56 .........................................   57 1 hit  [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Rhizobium etli 
. . . . Hyphomonas neptunium ATCC 15444 .............................   57 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Hyphomonas nept
. . . . Sphingomonas wittichii RW1 ..................................   57 2 hits [a-proteobacteria]    GTP cyclohydrolase subunit MoaC [Sphingomonas wittichii RW1
. . . . Rhizobium etli IE4771 .......................................   56 1 hit  [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Rhizobium etli 
. . . . Roseovarius sp. HTCC2601 ....................................   56 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Roseovarius sp.
. . . . Beijerinckia indica subsp. indica ATCC 9039 .................   56 3 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Beijerinckia in
. . . . Magnetospirillum gryphiswaldense MSR-1 ......................   56 1 hit  [a-proteobacteria]    Molybdopterin cofactor biosynthesis protein MoaC [Magnetosp
. . . . Ruegeria sp. TM1040 .........................................   56 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Silicibacter sp
. . . . Rhodospirillum rubrum ATCC 11170 ............................   56 3 hits [a-proteobacteria]    GTP cyclohydrolase subunit MoaC [Rhodospirillum rubrum ATCC
. . . . Roseobacter sp. CCS2 ........................................   56 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Roseobacter sp.
. . . . Methylobacterium radiotolerans JCM 2831 .....................   56 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Methylobacteriu
. . . . Hoeflea phototrophica DFL-43 ................................   56 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Hoeflea phototr
. . . . Pseudovibrio sp. JE062 ......................................   56 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Pseudovibrio sp
. . . . Methylocella silvestris BL2 .................................   55 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Methylocella si
. . . . Phaeobacter gallaeciensis BS107 .............................   55 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Phaeobacter gal
. . . . Phaeobacter gallaeciensis 2.10 ..............................   55 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Phaeobacter gal
. . . . Agrobacterium radiobacter K84 ...............................   55 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Agrobacterium r
. . . . Brucella ceti str. Cudo .....................................   55 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Brucella ceti s
. . . . Sagittula stellata E-37 .....................................   55 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Sagittula stell
. . . . Brucella melitensis 16M .....................................   55 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Brucella melite
. . . . Brucella melitensis ATCC 23457 ..............................   55 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Brucella melite
. . . . Brucella melitensis .........................................   55 1 hit  [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Brucella melite
. . . . Mesorhizobium sp. BNC1 ......................................   55 2 hits [a-proteobacteria]    GTP cyclohydrolase subunit MoaC [Mesorhizobium sp. BNC1] >g
. . . . Brevundimonas sp. BAL3 ......................................   55 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Brevundimonas s
. . . . Roseobacter sp. AzwK-3b .....................................   55 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Roseobacter sp.
. . . . Brucella abortus bv. 1 str. 9-941 ...........................   55 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Brucella abortu
. . . . Brucella melitensis biovar Abortus 2308 .....................   55 3 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Brucella abortu
. . . . Brucella ovis ATCC 25840 ....................................   55 3 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Brucella abortu
. . . . Brucella abortus S19 ........................................   55 3 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Brucella abortu
. . . . Brucella abortus ............................................   55 1 hit  [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Brucella abortu
. . . . Brucella abortus str. 2308 A ................................   55 1 hit  [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Brucella abortu
. . . . Rhodobacter sphaeroides 2.4.1 ...............................   55 3 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Rhodobacter sph
. . . . Rhodobacter sphaeroides KD131 ...............................   55 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Rhodobacter sph
. . . . Rhodobacter sphaeroides .....................................   55 1 hit  [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Rhodobacter sph
. . . . Rhodobacter sphaeroides ATCC 17029 ..........................   55 3 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Rhodobacter sph
. . . . Agrobacterium tumefaciens str. C58 ..........................   55 3 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Agrobacterium t
. . . . Paracoccus denitrificans PD1222 .............................   55 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Paracoccus deni
. . . . Ochrobactrum anthropi ATCC 49188 ............................   55 3 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Ochrobactrum an
. . . . Agrobacterium vitis S4 ......................................   55 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Agrobacterium v
. . . . Rhodobacterales bacterium HTCC2255 ..........................   55 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [alpha proteobac
. . . . Caulobacter crescentus CB15 .................................   54 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Caulobacter cre
. . . . Roseobacter litoralis Och 149 ...............................   54 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Roseobacter lit
. . . . Roseobacter sp. MED193 ......................................   54 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Roseobacter sp.
. . . . Caulobacter crescentus NA1000 ...............................   54 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Caulobacter cre
. . . . Caulobacter vibrioides ......................................   54 1 hit  [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Caulobacter cre
. . . . Roseovarius sp. 217 .........................................   54 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Roseovarius sp.
. . . . Rhodobacterales bacterium HTCC2150 ..........................   54 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Rhodobacterales
. . . . Roseobacter sp. SK209-2-6 ...................................   54 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Roseobacter sp.
. . . . Rhodobacterales bacterium HTCC2654 ..........................   54 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Rhodobacterales
. . . . Oceanibulbus indolifex HEL-45 ...............................   54 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Oceanibulbus in
. . . . Parvibaculum lavamentivorans DS-1 ...........................   54 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Parvibaculum la
. . . . Ruegeria pomeroyi DSS-3 .....................................   53 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Ruegeria pomero
. . . . Caulobacter sp. K31 .........................................   53 3 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Caulobacter sp.
. . . . Granulibacter bethesdensis CGDNIH1 ..........................   53 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Granulibacter b
. . . . Rhodobacter sphaeroides ATCC 17025 ..........................   53 3 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Rhodobacter sph
. . . . Rhodopseudomonas palustris HaA2 .............................   53 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Rhodopseudomona
. . . . Labrenzia alexandrii DFL-11 .................................   53 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Labrenzia alexa
. . . . Methylobacterium nodulans ORS 2060 ..........................   53 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Methylobacteriu
. . . . Labrenzia aggregata IAM 12614 ...............................   53 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Stappia aggrega
. . . . Roseobacter denitrificans OCh 114 ...........................   53 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Roseobacter den
. . . . Oceanicola granulosus HTCC2516 ..............................   53 2 hits [a-proteobacteria]    molybdenum cofactor biosynthesis protein C [Oceanicola gran
. . . Stenotrophomonas sp. SKA14 ------------------------------------   83 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Stenotrophomona
. . . Stenotrophomonas maltophilia K279a ............................   83 2 hits [g-proteobacteria]    putative molybdenum cofactor biosynthesis protein (putative
. . . Stenotrophomonas maltophilia R551-3 ...........................   83 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Stenotrophomona
. . . Alteromonas macleodii 'Deep ecotype' ..........................   67 4 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Alteromonas mac
. . . Marinomonas sp. MWYL1 .........................................   67 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Marinomonas sp.
. . . Azoarcus sp. BH72 .............................................   67 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Azoarcus sp. BH
. . . Thiobacillus denitrificans ATCC 25259 .........................   67 3 hits [b-proteobacteria]    GTP cyclohydrolase subunit MoaC [Thiobacillus denitrificans
. . . Laribacter hongkongensis HLHK9 ................................   65 2 hits [b-proteobacteria]    MoaC [Laribacter hongkongensis HLHK9] >gi|226716887|gb|ACO7
. . . Geobacter lovleyi SZ ..........................................   65 3 hits [d-proteobacteria]    molybdenum cofactor biosynthesis protein C [Geobacter lovle
. . . Lutiella nitroferrum 2002 .....................................   63 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Lutiella nitrof
. . . Pelobacter propionicus DSM 2379 ...............................   63 3 hits [d-proteobacteria]    molybdenum cofactor biosynthesis protein C [Pelobacter prop
. . . Cupriavidus taiwanensis .......................................   63 3 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Cupriavidus tai
. . . Plesiocystis pacifica SIR-1 ...................................   62 2 hits [d-proteobacteria]    molybdenum cofactor biosynthesis protein C [Plesiocystis pa
. . . Ralstonia eutropha JMP134 .....................................   62 3 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Ralstonia eutro
. . . Dechloromonas aromatica RCB ...................................   62 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Dechloromonas a
. . . Chromobacterium violaceum ATCC 12472 ..........................   62 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Chromobacterium
. . . Chromobacterium violaceum .....................................   62 1 hit  [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Chromobacterium
. . . Ralstonia eutropha H16 ........................................   62 3 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Ralstonia eutro
. . . Pseudoalteromonas atlantica T6c ...............................   62 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Pseudoalteromon
. . . Polaromonas naphthalenivorans CJ2 .............................   61 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Polaromonas nap
. . . Candidatus Vesicomyosocius okutanii HA ........................   61 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Candidatus Vesi
. . . Thioalkalivibrio sp. K90mix ...................................   61 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Thioalkalivibri
. . . Ralstonia metallidurans CH34 ..................................   60 3 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Ralstonia metal
. . . Leptothrix cholodnii SP-6 .....................................   60 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Leptothrix chol
. . . Thauera sp. MZ1T ..............................................   60 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Thauera sp. MZ1
. . . Aromatoleum aromaticum EbN1 ...................................   60 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Aromatoleum aro
. . . delta proteobacterium MLMS-1 ..................................   60 2 hits [d-proteobacteria]    Molybdopterin cofactor biosynthesis  MoaC region [delta pro
. . . Desulfotalea psychrophila LSv54 ...............................   60 2 hits [d-proteobacteria]    molybdenum cofactor biosynthesis protein C (MoaC) [Desulfot
. . . Variovorax paradoxus S110 .....................................   60 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Variovorax para
. . . Colwellia psychrerythraea 34H .................................   60 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Colwellia psych
. . . gamma proteobacterium NOR5-3 ..................................   59 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [gamma proteobac
. . . Desulfuromonas acetoxidans DSM 684 ............................   59 2 hits [d-proteobacteria]    molybdenum cofactor biosynthesis protein C [Desulfuromonas 
. . . Helicobacter canadensis MIT 98-5491 ...........................   59 1 hit  [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Helicobacter ca
. . . Thioalkalivibrio sp. HL-EbGR7 .................................   59 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Thioalkalivibri
. . . Burkholderia phytofirmans PsJN ................................   58 3 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ph
. . . Ralstonia solanacearum UW551 ..................................   58 2 hits [b-proteobacteria]    Molybdenum cofactor biosynthesis protein C [Ralstonia solan
. . . Acidithiobacillus ferrooxidans ATCC 53993 .....................   58 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Acidithiobacill
. . . Acidithiobacillus ferrooxidans ATCC 23270 .....................   58 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Acidithiobacill
. . . Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica) ...   58 3 hits [g-proteobacteria]    GTP cyclohydrolase subunit MoaC [Candidatus Ruthia magnific
. . . Vibrio cholerae RC385 .........................................   58 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Ralstonia solanacearum IPO1609 ................................   58 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein c [Ralstonia solan
. . . Burkholderia xenovorans LB400 .................................   58 3 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia xe
. . . Vibrio shilonii AK1 ...........................................   58 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio shilonii
. . . Sorangium cellulosum 'So ce 56' ...............................   58 2 hits [d-proteobacteria]    putative molybdenum cofactor biosynthesis protein C [Sorang
. . . Ralstonia pickettii 12J .......................................   58 3 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Ralstonia picke
. . . Alkalilimnicola ehrlichei MLHE-1 ..............................   58 2 hits [g-proteobacteria]    GTP cyclohydrolase subunit MoaC [Alkalilimnicola ehrlichei 
. . . Methylobacillus flagellatus KT ................................   58 3 hits [b-proteobacteria]    GTP cyclohydrolase subunit MoaC [Methylobacillus flagellatu
. . . Ralstonia solanacearum GMI1000 ................................   58 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Ralstonia solan
. . . Ralstonia solanacearum ........................................   58 1 hit  [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Ralstonia solan
. . . Marinobacter aquaeolei VT8 ....................................   58 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Marinobacter aq
. . . Rhodoferax ferrireducens T118 .................................   58 3 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Rhodoferax ferr
. . . Vibrio cholerae 12129(1) ......................................   58 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Caminibacter mediatlanticus TB-2 ..............................   58 2 hits [e-proteobacteria]    Molybdopterin cofactor biosynthesis MoaC region [Caminibact
. . . Oxalobacter formigenes HOxBLS .................................   58 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Oxalobacter for
. . . Methylococcus capsulatus str. Bath ............................   58 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Methylococcus c
. . . Methylococcus capsulatus ......................................   58 1 hit  [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Methylococcus c
. . . Hahella chejuensis KCTC 2396 ..................................   57 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Hahella chejuen
. . . Vibrio splendidus 12B01 .......................................   57 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio splendid
. . . Vibrio sp. MED222 .............................................   57 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio splendid
. . . Vibrionales bacterium SWAT-3 ..................................   57 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio splendid
. . . Vibrio splendidus LGP32 .......................................   57 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio splendid
. . . Desulfovibrio salexigens DSM 2638 .............................   57 2 hits [d-proteobacteria]    molybdenum cofactor biosynthesis protein C [Desulfovibrio s
. . . Nautilia profundicola AmH .....................................   57 2 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Nautilia profun
. . . Polaromonas sp. JS666 .........................................   57 2 hits [b-proteobacteria]    GTP cyclohydrolase subunit MoaC [Polaromonas sp. JS666] >gi
. . . Ralstonia pickettii 12D .......................................   57 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Ralstonia picke
. . . Herminiimonas arsenicoxydans ..................................   57 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Herminiimonas a
. . . Xanthomonas campestris pv. campestris str. B100 ...............   57 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Xanthomonas cam
. . . Xanthomonas campestris pv. campestris .........................   57 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Xanthomonas cam
. . . Geobacter sulfurreducens PCA ..................................   57 2 hits [d-proteobacteria]    molybdenum cofactor biosynthesis protein MoaC [Geobacter su
. . . Geobacter sulfurreducens ......................................   57 1 hit  [d-proteobacteria]    molybdenum cofactor biosynthesis protein MoaC [Geobacter su
. . . Ralstonia solanacearum MolK2 ..................................   57 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Ralstonia solan
. . . Haemophilus ducreyi 35000HP ...................................   57 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Haemophilus duc
. . . Haemophilus ducreyi ...........................................   57 1 hit  [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Haemophilus duc
. . . Methylophaga thiooxidans DMS010 ...............................   56 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Methylophaga sp
. . . Janthinobacterium sp. Marseille ...............................   56 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Janthinobacteri
. . . Xanthomonas campestris pv. campestris str. ATCC 33913 .........   56 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Xanthomonas cam
. . . Xanthomonas campestris pv. campestris str. 8004 ...............   56 3 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Xanthomonas cam
. . . Burkholderia graminis C4D1M ...................................   56 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia gr
. . . Burkholderia vietnamiensis G4 .................................   56 3 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia vi
. . . Helicobacter pullorum MIT 98-5489 .............................   56 1 hit  [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Helicobacter pu
. . . Wolinella succinogenes DSM 1740 ...............................   56 1 hit  [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Wolinella succi
. . . Wolinella succinogenes ........................................   56 1 hit  [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Wolinella succi
. . . Marinobacter algicola DG893 ...................................   56 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Marinobacter al
. . . Burkholderia mallei PRL-20 ....................................   56 1 hit  [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ma
. . . Nitrococcus mobilis Nb-231 ....................................   56 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Nitrococcus mob
. . . Burkholderia mallei GB8 horse 4 ...............................   56 1 hit  [b-proteobacteria]    COG0315: Molybdenum cofactor biosynthesis enzyme [Burkholde
. . . Helicobacter pylori HPKX_438_CA4C1 ............................   56 1 hit  [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Helicobacter py
. . . Burkholderia mallei ATCC 10399 ................................   56 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ma
. . . Burkholderia mallei FMH .......................................   56 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ma
. . . Burkholderia mallei JHU .......................................   56 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ma
. . . Burkholderia mallei 2002721280 ................................   56 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ma
. . . Burkholderia pseudomallei S13 .................................   56 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Helicobacter pylori J99 .......................................   56 3 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Helicobacter py
. . . Burkholderia sp. H160 .........................................   56 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia sp
. . . Bordetella pertussis Tohama I .................................   56 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein [Bordetella pertus
. . . Bordetella bronchiseptica RB50 ................................   56 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein [Bordetella pertus
. . . Bordetella pertussis ..........................................   56 1 hit  [b-proteobacteria]    molybdenum cofactor biosynthesis protein [Bordetella pertus
. . . Bordetella bronchiseptica .....................................   56 1 hit  [b-proteobacteria]    molybdenum cofactor biosynthesis protein [Bordetella pertus
. . . Beggiatoa sp. PS ..............................................   56 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Beggiatoa sp. P
. . . Campylobacter concisus 13826 ..................................   56 2 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Campylobacter c
. . . Vibrio cholerae MZO-2 .........................................   56 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Vibrio cholerae 623-39 ........................................   56 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Vibrio cholerae O1 biovar El Tor str. N16961 ..................   56 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Vibrio cholerae 2740-80 .......................................   56 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Vibrio cholerae V52 ...........................................   56 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Vibrio cholerae O395 ..........................................   56 5 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Vibrio cholerae MZO-3 .........................................   56 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Vibrio cholerae NCTC 8457 .....................................   56 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Vibrio cholerae B33 ...........................................   56 4 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Vibrio cholerae AM-19226 ......................................   56 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Vibrio cholerae M66-2 .........................................   56 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Vibrio cholerae BX 330286 .....................................   56 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Vibrio cholerae RC9 ...........................................   56 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Vibrio cholerae MJ-1236 .......................................   56 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Vibrio cholerae ...............................................   56 1 hit  [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Vibrio cholerae V51 ...........................................   56 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Helicobacter pylori NCTC 11637 ................................   56 1 hit  [e-proteobacteria]    unnamed protein product [Helicobacter pylori]
. . . Vibrio cholerae 1587 ..........................................   56 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Congregibacter litoralis KT71 .................................   56 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein c [gamma proteobac
. . . Campylobacter lari RM2100 .....................................   55 2 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Campylobacter l
. . . Helicobacter pylori Shi470 ....................................   55 3 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Helicobacter py
. . . Helicobacter pylori 98-10 .....................................   55 2 hits [e-proteobacteria]    hypothetical protein HP9810_868g48 [Helicobacter pylori 98-
. . . Bordetella petrii DSM 12804 ...................................   55 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein [Bordetella petrii
. . . Bordetella petrii .............................................   55 1 hit  [b-proteobacteria]    molybdenum cofactor biosynthesis protein [Bordetella petrii
. . . Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1 .   55 3 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Polynucleobacte
. . . Mannheimia haemolytica PHL213 .................................   55 2 hits [g-proteobacteria]    molybdenum (Mo2+) cofactor biosynthesis enzyme [Mannheimia 
. . . Helicobacter pylori HPAG1 .....................................   55 3 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Helicobacter py
. . . Marinomonas sp. MED121 ........................................   55 2 hits [g-proteobacteria]    Molybdopterin cofactor biosynthesis  MoaC region [Marinomon
. . . Helicobacter cinaedi CCUG 18818 ...............................   55 1 hit  [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Helicobacter ci
. . . Burkholderia multivorans CGD1 .................................   55 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia mu
. . . Helicobacter pylori B128 ......................................   55 2 hits [e-proteobacteria]    hypothetical protein HPB128_152g10 [Helicobacter pylori B12
. . . Actinobacillus pleuropneumoniae serovar 1 str. 4074 ...........   55 1 hit  [g-proteobacteria]    COG0315: Molybdenum cofactor biosynthesis enzyme [Actinobac
. . . Actinobacillus pleuropneumoniae L20 ...........................   55 3 hits [g-proteobacteria]    COG0315: Molybdenum cofactor biosynthesis enzyme [Actinobac
. . . Actinobacillus pleuropneumoniae serovar 3 str. JL03 ...........   55 3 hits [g-proteobacteria]    COG0315: Molybdenum cofactor biosynthesis enzyme [Actinobac
. . . Actinobacillus pleuropneumoniae serovar 7 str. AP76 ...........   55 3 hits [g-proteobacteria]    COG0315: Molybdenum cofactor biosynthesis enzyme [Actinobac
. . . Campylobacter coli RM2228 .....................................   55 2 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Campylobacter c
. . . Vibrio parahaemolyticus RIMD 2210633 ..........................   55 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio parahaem
. . . Vibrio parahaemolyticus AQ3810 ................................   55 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio parahaem
. . . Vibrio parahaemolyticus .......................................   55 1 hit  [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio parahaem
. . . Vibrio alginolyticus 12G01 ....................................   55 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio alginoly
. . . Haliangium ochraceum DSM 14365 ................................   55 2 hits [d-proteobacteria]    GTP cyclohydrolase subunit MoaC [Haliangium ochraceum DSM 1
. . . Vibrio harveyi HY01 ...........................................   55 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio harveyi 
. . . Vibrio harveyi ATCC BAA-1116 ..................................   55 3 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio harveyi 
. . . Psychrobacter cryohalolentis K5 ...............................   55 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Psychrobacter c
. . . Limnobacter sp. MED105 ........................................   55 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Limnobacter sp.
. . . Burkholderia cenocepacia PC184 ................................   55 2 hits [b-proteobacteria]    Molybdopterin cofactor biosynthesis protein MoaC [Burkholde
. . . Burkholderia cenocepacia MC0-3 ................................   55 3 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ce
. . . Helicobacter pylori HPKX_438_AG0C1 ............................   55 1 hit  [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Helicobacter py
. . . Burkholderia sp. 383 ..........................................   55 3 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia sp
. . . Helicobacter pylori G27 .......................................   55 3 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Helicobacter py
. . . Burkholderia cenocepacia AU 1054 ..............................   55 3 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ce
. . . Burkholderia cenocepacia HI2424 ...............................   55 3 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ce
. . . Helicobacter pylori P12 .......................................   55 3 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Helicobacter py
. . . Burkholderia cenocepacia J2315 ................................   55 3 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ce
. . . Neptuniibacter caesariensis ...................................   55 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Oceanospirillum
. . . Bordetella avium 197N .........................................   55 3 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Bordetella aviu
. . . Aliivibrio salmonicida LFI1238 ................................   55 3 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Aliivibrio salm
. . . Bordetella parapertussis 12822 ................................   55 1 hit  [b-proteobacteria]    molybdenum cofactor biosynthesis protein [Bordetella parape
. . . Bordetella parapertussis ......................................   55 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein [Bordetella parape
. . . Vibrio cholerae TM 11079-80 ...................................   55 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Helicobacter pylori 26695 .....................................   55 2 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Helicobacter py
. . . Helicobacter pylori ...........................................   55 1 hit  [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Helicobacter py
. . . Burkholderia multivorans ATCC 17616 ...........................   55 5 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia mu
. . . Burkholderia multivorans CGD2M ................................   55 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia mu
. . . Burkholderia multivorans CGD2 .................................   55 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia mu
. . . Moritella sp. PE36 ............................................   55 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Moritella sp. P
. . . gamma proteobacterium HTCC2207 ................................   55 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [marine gamma pr
. . . Vibrio cholerae TMA 21 ........................................   55 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Xanthomonas axonopodis pv. citri str. 306 .....................   55 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Xanthomonas axo
. . . Xanthomonas axonopodis pv. citri ..............................   55 1 hit  [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Xanthomonas axo
. . . Geobacter metallireducens GS-15 ...............................   55 3 hits [d-proteobacteria]    GTP cyclohydrolase subunit MoaC [Geobacter metallireducens 
. . . Desulfohalobium retbaense DSM 5692 ............................   55 2 hits [d-proteobacteria]    GTP cyclohydrolase subunit MoaC [Desulfohalobium retbaense 
. . . Vibrio cholerae bv. albensis VL426 ............................   55 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio cholerae
. . . Pseudomonas stutzeri A1501 ....................................   54 3 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Pseudomonas stu
. . . Arcobacter butzleri RM4018 ....................................   54 3 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Arcobacter butz
. . . Burkholderia phymatum STM815 ..................................   54 3 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ph
. . . Vibrio campbellii AND4 ........................................   54 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio campbell
. . . Burkholderia ubonensis Bu .....................................   54 1 hit  [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ub
. . . Vibrio fischeri ES114 .........................................   54 3 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio fischeri
. . . Vibrio fischeri MJ11 ..........................................   54 3 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio fischeri
. . . Vibrio vulnificus CMCP6 .......................................   54 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio vulnific
. . . Vibrio vulnificus .............................................   54 1 hit  [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio vulnific
. . . Vibrio parahaemolyticus 16 ....................................   54 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio parahaem
. . . Vibrio vulnificus YJ016 .......................................   54 3 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Vibrio vulnific
. . . Acidovorax sp. JS42 ...........................................   54 4 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Acidovorax sp. 
. . . Campylobacter hominis ATCC BAA-381 ............................   54 2 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Campylobacter h
. . . Burkholderia ambifaria MC40-6 .................................   54 3 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia am
. . . Mannheimia succiniciproducens MBEL55E .........................   54 3 hits [g-proteobacteria]    MoaC protein [Mannheimia succiniciproducens MBEL55E] >gi|81
. . . Haemophilus influenzae PittEE .................................   54 3 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Haemophilus inf
. . . Haemophilus influenzae 7P49H1 .................................   54 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Haemophilus inf
. . . Helicobacter hepaticus ATCC 51449 .............................   54 2 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Helicobacter he
. . . Helicobacter hepaticus ........................................   54 1 hit  [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Helicobacter he
. . . Burkholderia ambifaria IOP40-10 ...............................   54 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia am
. . . Burkholderia ambifaria AMMD ...................................   54 3 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia am
. . . Psychromonas ingrahamii 37 ....................................   54 3 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Psychromonas in
. . . Burkholderia ambifaria MEX-5 ..................................   54 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia am
. . . Pseudomonas fluorescens Pf0-1 .................................   54 4 hits [g-proteobacteria]    molybdopterin cofactor biosynthesis MoaC region [Pseudomona
. . . Anaeromyxobacter dehalogenans 2CP-C ...........................   54 2 hits [d-proteobacteria]    GTP cyclohydrolase subunit MoaC [Anaeromyxobacter dehalogen
. . . Methylibium petroleiphilum PM1 ................................   54 2 hits [b-proteobacteria]    GTP cyclohydrolase subunit MoaC [Methylibium petroleiphilum
. . . Pectobacterium carotovorum subsp. brasiliensis PBR1692 ........   54 1 hit  [enterobacteria]      molybdenum cofactor biosynthesis protein C [Pectobacterium 
. . . Pectobacterium carotovorum subsp. carotovorum WPP14 ...........   54 1 hit  [enterobacteria]      molybdenum cofactor biosynthesis protein C [Pectobacterium 
. . . Pectobacterium atrosepticum SCRI1043 ..........................   54 2 hits [enterobacteria]      molybdenum cofactor biosynthesis protein C [Pectobacterium 
. . . Campylobacter upsaliensis RM3195 ..............................   54 2 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Campylobacter u
. . . Anaeromyxobacter dehalogenans 2CP-1 ...........................   54 2 hits [d-proteobacteria]    molybdenum cofactor biosynthesis protein C [Anaeromyxobacte
. . . Anaeromyxobacter sp. K ........................................   54 2 hits [d-proteobacteria]    molybdenum cofactor biosynthesis protein C [Anaeromyxobacte
. . . Comamonas testosteroni KF-1 ...................................   53 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Comamonas testo
. . . Escherichia coli HS ...........................................   53 3 hits [enterobacteria]      molybdenum cofactor biosynthesis protein C [Escherichia col
. . . Burkholderia dolosa AUO158 ....................................   53 2 hits [b-proteobacteria]    Molybdopterin cofactor biosynthesis protein MoaC [Burkholde
. . . Geobacter uraniireducens Rf4 ..................................   53 3 hits [d-proteobacteria]    molybdenum cofactor biosynthesis protein C [Geobacter urani
. . . Kangiella koreensis DSM 16069 .................................   53 2 hits [g-proteobacteria]    GTP cyclohydrolase subunit MoaC [Kangiella koreensis DSM 16
. . . Psychrobacter arcticus 273-4 ..................................   53 2 hits [g-proteobacteria]    GTP cyclohydrolase subunit MoaC [Psychrobacter arcticus 273
. . . Helicobacter winghamensis ATCC BAA-430 ........................   53 2 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Helicobacter wi
. . . Campylobacter jejuni subsp. jejuni 81116 ......................   53 3 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Campylobacter j
. . . Halorhodospira halophila SL1 ..................................   53 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Halorhodospira 
. . . Xanthomonas oryzae pv. oryzae MAFF 311018 .....................   53 3 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Xanthomonas ory
. . . Xanthomonas oryzae pv. oryzicola BLS256 .......................   53 1 hit  [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Xanthomonas ory
. . . Xanthomonas oryzae pv. oryzae PXO99A ..........................   53 3 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Xanthomonas ory
. . . Campylobacter jejuni subsp. doylei 269.97 .....................   53 3 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Campylobacter j
. . . Campylobacter jejuni subsp. jejuni 81-176 .....................   53 4 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Campylobacter j
. . . Campylobacter jejuni subsp. jejuni HB93-13 ....................   53 2 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Campylobacter j
. . . Campylobacter jejuni subsp. jejuni 260.94 .....................   53 2 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein MoaC [Campylobacte
. . . Campylobacter jejuni RM1221 ...................................   53 3 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Campylobacter j
. . . Burkholderia pseudomallei Pakistan 9 ..........................   53 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Haemophilus influenzae Rd KW20 ................................   53 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Haemophilus inf
. . . Haemophilus influenzae R3021 ..................................   53 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Haemophilus inf
. . . Haemophilus influenzae 6P18H1 .................................   53 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Haemophilus inf
. . . Haemophilus influenzae ........................................   53 1 hit  [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Haemophilus inf
. . . Campylobacter jejuni subsp. jejuni CG8486 .....................   53 2 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Campylobacter j
. . . Burkholderia pseudomallei K96243 ..............................   53 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Burkholderia pseudomallei 1106a ...............................   53 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Burkholderia pseudomallei 305 .................................   53 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Burkholderia pseudomallei 1106b ...............................   53 1 hit  [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Burkholderia pseudomallei DM98 ................................   53 1 hit  [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Burkholderia pseudomallei 14 ..................................   53 1 hit  [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Burkholderia pseudomallei 91 ..................................   53 1 hit  [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Burkholderia pseudomallei B7210 ...............................   53 1 hit  [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Burkholderia pseudomallei BCC215 ..............................   53 1 hit  [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Burkholderia pseudomallei 576 .................................   53 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Campylobacter jejuni subsp. jejuni CG8421 .....................   53 2 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Campylobacter j
. . . Burkholderia pseudomallei 668 .................................   53 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Burkholderia pseudomallei 1710b ...............................   53 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Burkholderia pseudomallei 1710a ...............................   53 1 hit  [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Burkholderia pseudomallei 112 .................................   53 1 hit  [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Burkholderia pseudomallei MSHR346 .............................   53 1 hit  [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Campylobacter jejuni subsp. jejuni CF93-6 .....................   53 2 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein MoaC [Campylobacte
. . . Campylobacter jejuni subsp. jejuni 84-25 ......................   53 2 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein MoaC [Campylobacte
. . . Campylobacter jejuni subsp. jejuni NCTC 11168 .................   53 2 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein MoaC [Campylobacte
. . . Campylobacter jejuni ..........................................   53 1 hit  [e-proteobacteria]    molybdenum cofactor biosynthesis protein MoaC [Campylobacte
. . . Burkholderia pseudomallei 9 ...................................   53 1 hit  [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Burkholderia pseudomallei 7894 ................................   53 1 hit  [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Burkholderia pseudomallei Pasteur 52237 .......................   53 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Burkholderia pseudomallei 406e ................................   53 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Xanthomonas oryzae pv. oryzae KACC10331 .......................   53 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Xanthomonas ory
. . . Burkholderia pseudomallei NCTC 13177 ..........................   53 1 hit  [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Burkholderia pseudomallei 1655 ................................   53 2 hits [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia ps
. . . Burkholderia thailandensis MSMB43 .............................   53 1 hit  [b-proteobacteria]    molybdenum cofactor biosynthesis protein C [Burkholderia th
. . . marine gamma proteobacterium HTCC2143 .........................   53 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [marine gamma pr
. . . Campylobacter curvus 525.92 ...................................   53 2 hits [e-proteobacteria]    molybdenum cofactor biosynthesis protein C [Campylobacter c
. . . Psychromonas sp. CNPT3 ........................................   53 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Psychromonas sp
. . . Xanthomonas campestris pv. vesicatoria str. 85-10 .............   53 3 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Xanthomonas cam
. . . Psychrobacter sp. PRwf-1 ......................................   53 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Psychrobacter s
. . . Acidovorax citrulli AAC00-1 ...................................   53 2 hits [b-proteobacteria]    GTP cyclohydrolase subunit MoaC [Acidovorax avenae subsp. c
. . . Erwinia tasmaniensis Et1/99 ...................................   53 2 hits [enterobacteria]      Molybdopterin cofactor biosynthesis protein [Erwinia tasman
. . . Erwinia tasmaniensis ..........................................   53 1 hit  [enterobacteria]      Molybdopterin cofactor biosynthesis protein [Erwinia tasman
. . . Haemophilus somnus 129PT ......................................   53 3 hits [g-proteobacteria]    GTP cyclohydrolase subunit MoaC [Haemophilus somnus 129PT] 
. . . gamma proteobacterium NOR51-B .................................   53 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [gamma proteobac
. . . Proteus mirabilis HI4320 ......................................   53 3 hits [enterobacteria]      molybdenum cofactor biosynthesis protein C [Proteus mirabil
. . . Pseudomonas syringae pv. oryzae str. 1_6 ......................   53 1 hit  [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Pseudomonas syr
. . . Desulfobacterium autotrophicum HRM2 ...........................   53 2 hits [d-proteobacteria]    MoaC [Desulfobacterium autotrophicum HRM2] >gi|223690754|gb
. . . Proteus mirabilis ATCC 29906 ..................................   53 2 hits [enterobacteria]      molybdenum cofactor biosynthesis protein C [Proteus mirabil
. . . Haemophilus influenzae PittHH .................................   53 2 hits [g-proteobacteria]    molybdenum cofactor biosynthesis protein C [Haemophilus inf
. . . Haemophilus influenzae R2866 ..................................   53 1 hit  [g-proteobacteria]    COG0315: Molybdenum cofactor biosynthesis enzyme [Haemophil
. . . Haemophilus influenzae 22.1-21 ................................   53 2 hits [g-proteobacteria]    COG0315: Molybdenum cofactor biosynthesis enzyme [Haemophil
. . . Haemophilus influenzae PittII .................................   53 2 hits [g-proteobacteria]    COG0315: Molybdenum cofactor biosynthesis enzyme [Haemophil
. . . Escherichia coli ..............................................   53 1 hit  [enterobacteria]      moaC [Escherichia coli]
. . Clostridium asparagiforme DSM 15981 -----------------------------   72 2 hits [firmicutes]          hypothetical protein CLOSTASPAR_03402 [Clostridium asparagi
. . Mycobacterium avium subsp. paratuberculosis K-10 ................   71 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium a
. . Roseburia intestinalis L1-82 ....................................   71 2 hits [firmicutes]          hypothetical protein ROSINTL182_02850 [Roseburia intestinal
. . Mycobacterium avium 104 .........................................   70 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium a
. . Chloroflexus aurantiacus J-10-fl ................................   70 2 hits [GNS bacteria]        molybdenum cofactor biosynthesis protein C [Chloroflexus au
. . Chloroflexus sp. Y-400-fl .......................................   70 2 hits [GNS bacteria]        molybdenum cofactor biosynthesis protein C [Chloroflexus au
. . Ruminococcus torques ATCC 27756 .................................   70 2 hits [firmicutes]          hypothetical protein RUMTOR_01564 [Ruminococcus torques ATC
. . Clostridium bolteae ATCC BAA-613 ................................   69 2 hits [firmicutes]          hypothetical protein CLOBOL_05456 [Clostridium bolteae ATCC
. . Anaerotruncus colihominis DSM 17241 .............................   69 2 hits [firmicutes]          hypothetical protein ANACOL_00071 [Anaerotruncus colihomini
. . Roseburia inulinivorans DSM 16841 ...............................   68 2 hits [firmicutes]          hypothetical protein ROSEINA2194_01946 [Roseburia inulinivo
. . Mycobacterium sp. MCS ...........................................   68 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium s
. . Mycobacterium sp. KMS ...........................................   68 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium s
. . Mycobacterium sp. JLS ...........................................   68 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium s
. . Dorea longicatena DSM 13814 .....................................   68 2 hits [firmicutes]          hypothetical protein DORLON_02712 [Dorea longicatena DSM 13
. . Coprococcus comes ATCC 27758 ....................................   68 2 hits [firmicutes]          hypothetical protein COPCOM_01429 [Coprococcus comes ATCC 2
. . Mycobacterium marinum M .........................................   68 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C 2 MoaC2 [Mycobac
. . Mycobacterium abscessus .........................................   68 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein MoaC2 [Mycobacteri
. . Ruminococcus gnavus ATCC 29149 ..................................   68 2 hits [firmicutes]          hypothetical protein RUMGNA_02011 [Ruminococcus gnavus ATCC
. . Clostridium butyricum 5521 ......................................   67 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium but
. . Clostridium butyricum E4 str. BoNT E BL5262 .....................   67 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium but
. . Clostridiales bacterium 1_7_47_FAA ..............................   67 1 hit  [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridiales b
. . Anaerostipes caccae DSM 14662 ...................................   67 2 hits [firmicutes]          hypothetical protein ANACAC_03775 [Anaerostipes caccae DSM 
. . Clostridium sporogenes ATCC 15579 ...............................   66 2 hits [firmicutes]          hypothetical protein CLOSPO_03049 [Clostridium sporogenes A
. . Mycobacterium smegmatis str. MC2 155 ............................   66 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium s
. . Anaerococcus tetradius ATCC 35098 ...............................   66 2 hits [firmicutes]          molybdenum (Mo2+) cofactor biosynthesis enzyme [Anaerococcu
. . Subdoligranulum variabile DSM 15176 .............................   66 2 hits [firmicutes]          hypothetical protein SUBVAR_00028 [Subdoligranulum variabil
. . Clostridium bartlettii DSM 16795 ................................   65 2 hits [firmicutes]          hypothetical protein CLOBAR_00264 [Clostridium bartlettii D
. . Thermotogales bacterium TBF 19.5.1 ..............................   65 2 hits [thermotogales]       molybdenum cofactor biosynthesis protein C [Thermotogales b
. . Mycobacterium tuberculosis H37Rv ................................   64 4 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium t
. . Mycobacterium tuberculosis CDC1551 ..............................   64 4 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium t
. . Mycobacterium tuberculosis H37Ra ................................   64 6 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium t
. . Mycobacterium tuberculosis F11 ..................................   64 4 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium t
. . Mycobacterium tuberculosis C ....................................   64 4 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium t
. . Mycobacterium tuberculosis str. Haarlem .........................   64 4 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium t
. . Mycobacterium tuberculosis 02_1987 ..............................   64 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium t
. . Mycobacterium tuberculosis T92 ..................................   64 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium t
. . Mycobacterium tuberculosis EAS054 ...............................   64 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium t
. . Mycobacterium tuberculosis ......................................   64 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium t
. . Mycobacterium bovis .............................................   64 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium t
. . Chloroflexus aggregans DSM 9485 .................................   64 2 hits [GNS bacteria]        molybdenum cofactor biosynthesis protein C [Chloroflexus ag
. . Enterococcus faecalis TX1332 ....................................   64 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein MoaC [Enterococcus
. . Enterococcus faecalis ATCC 29200 ................................   64 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein MoaC [Enterococcus
. . Hydrogenivirga sp. 128-5-R1-1 ...................................   64 4 hits [aquificales]         molybdenum cofactor biosynthesis moaC [Hydrogenivirga sp. 1
. . Mycobacterium bovis AF2122/97 ...................................   64 4 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium b
. . Mycobacterium bovis BCG str. Pasteur 1173P2 .....................   64 4 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium b
. . Mycobacterium tuberculosis 94_M4241A ............................   64 1 hit  [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium b
. . Mycobacterium tuberculosis T85 ..................................   64 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium b
. . Mycobacterium tuberculosis GM 1503 ..............................   64 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium b
. . Mycobacterium tuberculosis T17 ..................................   64 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium b
. . Mycobacterium bovis BCG str. Tokyo 172 ..........................   64 4 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium b
. . Enterococcus faecalis V583 ......................................   64 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein MoaC [Enterococcus
. . Enterococcus faecalis TX0104 ....................................   64 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein MoaC [Enterococcus
. . Enterococcus faecalis HH22 ......................................   64 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein MoaC [Enterococcus
. . Synechococcus sp. JA-3-3Ab ......................................   63 2 hits [cyanobacteria]       molybdenum cofactor biosynthesis protein C [Synechococcus s
. . Anaerococcus prevotii DSM 20548 .................................   63 2 hits [firmicutes]          GTP cyclohydrolase subunit MoaC [Anaerococcus prevotii DSM 
. . Clostridium scindens ATCC 35704 .................................   63 2 hits [firmicutes]          hypothetical protein CLOSCI_02916 [Clostridium scindens ATC
. . Dethiosulfovibrio peptidovorans DSM 11002 .......................   63 2 hits [bacteria]            molybdenum cofactor biosynthesis protein MoaC [Dethiosulfov
. . uncultured marine bacterium 439 .................................   63 1 hit  [bacteria]            molybdenum cofactor biosynthesis protein C [uncultured mari
. . Ruminococcus obeum ATCC 29174 ...................................   63 2 hits [firmicutes]          hypothetical protein RUMOBE_01525 [Ruminococcus obeum ATCC 
. . Clostridium sp. SS2/1 ...........................................   63 2 hits [firmicutes]          hypothetical protein CLOSS21_01695 [Clostridium sp. SS2/1] 
. . Mycobacterium ulcerans Agy99 ....................................   63 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C 2 MoaC2 [Mycobac
. . Collinsella aerofaciens ATCC 25986 ..............................   63 2 hits [high GC Gram+]       Hypothetical protein COLAER_00777 [Collinsella aerofaciens 
. . Eubacterium biforme DSM 3989 ....................................   62 2 hits [firmicutes]          hypothetical protein EUBIFOR_01578 [Eubacterium biforme DSM
. . Synechococcus sp. WH 7803 .......................................   62 2 hits [cyanobacteria]       molybdenum cofactor biosynthesis protein C [Synechococcus s
. . Planctomyces limnophilus DSM 3776 ...............................   62 2 hits [planctomycetes]      GTP cyclohydrolase subunit MoaC [Planctomyces limnophilus D
. . Mycobacterium gilvum PYR-GCK ....................................   62 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium g
. . Dorea formicigenerans ATCC 27755 ................................   62 2 hits [firmicutes]          hypothetical protein DORFOR_01012 [Dorea formicigenerans AT
. . Blautia hydrogenotrophica DSM 10507 .............................   62 2 hits [firmicutes]          hypothetical protein RUMHYD_00614 [Blautia hydrogenotrophic
. . Synechococcus sp. WH 7805 .......................................   62 2 hits [cyanobacteria]       molybdenum cofactor biosynthesis protein C [Synechococcus s
. . Polaribacter irgensii 23-P ......................................   62 2 hits [CFB group bacteria]  bifunctional molybdenum cofactor biosynthesis protein C/mol
. . Epulopiscium sp. 'N.t. morphotype B' ............................   61 1 hit  [firmicutes]          molybdenum cofactor biosynthesis protein C [Epulopiscium sp
. . Clostridium sp. M62/1 ...........................................   61 2 hits [firmicutes]          hypothetical protein CLOM621_03733 [Clostridium sp. M62/1] 
. . Clostridium phytofermentans ISDg ................................   61 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium phy
. . Oribacterium sinus F0268 ........................................   61 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Oribacterium si
. . Cyanobium sp. PCC 7001 ..........................................   61 2 hits [cyanobacteria]       HAD-superfamily hydrolase subfamily IIB [Cyanobium sp. PCC 
. . uncultured marine bacterium 560 .................................   61 1 hit  [bacteria]            molybdenum cofactor biosynthesis protein C [uncultured mari
. . Petrotoga mobilis SJ95 ..........................................   61 2 hits [thermotogales]       molybdenum cofactor biosynthesis protein C [Petrotoga mobil
. . Finegoldia magna ATCC 53516 .....................................   61 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Finegoldia magn
. . Synechococcus sp. WH 8102 .......................................   61 2 hits [cyanobacteria]       molybdenum cofactor biosynthesis protein C [Synechococcus s
. . Syntrophomonas wolfei subsp. wolfei str. Goettingen .............   61 3 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Syntrophomonas 
. . Synechococcus sp. CC9605 ........................................   60 2 hits [cyanobacteria]       GTP cyclohydrolase subunit MoaC [Synechococcus sp. CC9605] 
. . Synechococcus sp. RS9916 ........................................   60 2 hits [cyanobacteria]       molybdenum cofactor biosynthesis protein C [Synechococcus s
. . Clostridium botulinum A3 str. Loch Maree ........................   60 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium bot
. . Finegoldia magna ATCC 29328 .....................................   60 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Finegoldia magn
. . Geodermatophilus obscurus DSM 43160 .............................   60 2 hits [high GC Gram+]       GTP cyclohydrolase subunit MoaC [Geodermatophilus obscurus 
. . Clostridium botulinum A str. ATCC 3502 ..........................   60 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium bot
. . Clostridium botulinum A str. ATCC 19397 .........................   60 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium bot
. . Clostridium botulinum A str. Hall ...............................   60 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium bot
. . Clostridium botulinum A2 str. Kyoto .............................   60 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium bot
. . Clostridium botulinum B1 str. Okra ..............................   60 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium bot
. . Aquifex aeolicus VF5 ............................................   60 2 hits [aquificales]         molybdenum cofactor biosynthesis moaC [Aquifex aeolicus VF5
. . Aquifex aeolicus ................................................   60 1 hit  [aquificales]         molybdenum cofactor biosynthesis moaC [Aquifex aeolicus VF5
. . Clostridium botulinum F str. Langeland ..........................   60 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium bot
. . Microcoleus chthonoplastes PCC 7420 .............................   60 2 hits [cyanobacteria]       molybdenum cofactor biosynthesis protein C [Microcoleus cht
. . Clostridium botulinum Bf ........................................   60 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium bot
. . Clostridium botulinum Ba4 str. 657 ..............................   60 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium bot
. . Catenibacterium mitsuokai DSM 15897 .............................   60 2 hits [firmicutes]          hypothetical protein CATMIT_00166 [Catenibacterium mitsuoka
. . Saccharomonospora viridis DSM 43017 .............................   59 2 hits [high GC Gram+]       GTP cyclohydrolase subunit MoaC [Saccharomonospora viridis 
. . Eggerthella lenta DSM 2243 ......................................   59 2 hits [high GC Gram+]       GTP cyclohydrolase subunit MoaC [Eggerthella lenta DSM 2243
. . Clostridium botulinum NCTC 2916 .................................   59 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium bot
. . Thermosynechococcus elongatus BP-1 ..............................   59 2 hits [cyanobacteria]       bifunctional molybdenum cofactor biosynthesis protein C/mol
. . Desulfotomaculum acetoxidans DSM 771 ............................   59 2 hits [firmicutes]          GTP cyclohydrolase subunit MoaC [Desulfotomaculum acetoxida
. . Polaribacter sp. MED152 .........................................   59 2 hits [CFB group bacteria]  molybdenum cofactor biosynthesis protein C [Polaribacter sp
. . Thermotoga lettingae TMO ........................................   59 2 hits [thermotogales]       molybdenum cofactor biosynthesis protein C [Thermotoga lett
. . Actinosynnema mirum DSM 43827 ...................................   59 2 hits [high GC Gram+]       GTP cyclohydrolase subunit MoaC [Actinosynnema mirum DSM 43
. . Clostridium beijerinckii NCIMB 8052 .............................   59 4 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium bei
. . Faecalibacterium prausnitzii M21/2 ..............................   59 2 hits [firmicutes]          hypothetical protein FAEPRAM212_02031 [Faecalibacterium pra
. . Cryptobacterium curtum DSM 15641 ................................   59 2 hits [high GC Gram+]       GTP cyclohydrolase subunit MoaC [Cryptobacterium curtum DSM
. . Carboxydothermus hydrogenoformans Z-2901 ........................   59 3 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Carboxydothermu
. . Synechococcus sp. RCC307 ........................................   59 2 hits [cyanobacteria]       molybdenum cofactor biosynthesis protein C [Synechococcus s
. . Hydrogenobaculum sp. Y04AAS1 ....................................   58 2 hits [aquificales]         molybdenum cofactor biosynthesis protein C [Hydrogenobaculu
. . Eubacterium hallii DSM 3353 .....................................   58 2 hits [firmicutes]          hypothetical protein EUBHAL_01352 [Eubacterium hallii DSM 3
. . Synechocystis sp. PCC 6803 ......................................   58 3 hits [cyanobacteria]       bifunctional molybdenum cofactor biosynthesis protein C/mol
. . Salinispora arenicola CNS-205 ...................................   58 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Salinispora are
. . Mycobacterium vanbaalenii PYR-1 .................................   58 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Mycobacterium v
. . Clostridium hylemonae DSM 15053 .................................   58 2 hits [firmicutes]          hypothetical protein CLOHYLEM_07398 [Clostridium hylemonae 
. . Collinsella intestinalis DSM 13280 ..............................   58 2 hits [high GC Gram+]       hypothetical protein COLINT_02942 [Collinsella intestinalis
. . Cyanothece sp. CCY 0110 .........................................   58 2 hits [cyanobacteria]       molybdenum cofactor biosynthesis protein C [Cyanothece sp. 
. . Collinsella stercoris DSM 13279 .................................   58 2 hits [high GC Gram+]       hypothetical protein COLSTE_00153 [Collinsella stercoris DS
. . Natranaerobius thermophilus JW/NM-WN-LF .........................   58 3 hits [firmicutes]          GTP cyclohydrolase subunit MoaC [Natranaerobius thermophilu
. . Synechococcus sp. CC9902 ........................................   58 3 hits [cyanobacteria]       molybdopterin cofactor biosynthesis MoaC region [Synechococ
. . Roseiflexus sp. RS-1 ............................................   57 3 hits [GNS bacteria]        molybdenum cofactor biosynthesis protein C [Roseiflexus sp.
. . Heliobacterium modesticaldum Ice1 ...............................   57 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein c [Heliobacterium 
. . Nakamurella multipartita DSM 44233 ..............................   57 2 hits [high GC Gram+]       GTP cyclohydrolase subunit MoaC [Nakamurella multipartita D
. . Nodularia spumigena CCY 9414 ....................................   57 4 hits [cyanobacteria]       Molybdopterin cofactor biosynthesis  MoaC region [Nodularia
. . Nocardia farcinica IFM 10152 ....................................   57 2 hits [high GC Gram+]       bifunctional molybdenum cofactor biosynthesis protein C/mol
. . Mitsuokella multacida DSM 20544 .................................   57 2 hits [firmicutes]          hypothetical protein MITSMUL_00073 [Mitsuokella multacida D
. . Frankia sp. EAN1pec .............................................   57 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Frankia sp. EAN
. . Arthrobacter chlorophenolicus A6 ................................   57 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Arthrobacter ch
. . Synechococcus sp. BL107 .........................................   57 2 hits [cyanobacteria]       Molybdopterin cofactor biosynthesis MoaC region [Synechococ
. . Rhodothermus marinus DSM 4252 ...................................   57 2 hits [CFB group bacteria]  GTP cyclohydrolase subunit MoaC [Rhodothermus marinus DSM 4
. . Clostridium botulinum E3 str. Alaska E43 ........................   57 3 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium bot
. . Rhodococcus opacus B4 ...........................................   56 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis bifunctional protein MoaCB
. . Frankia alni ACN14a .............................................   56 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Frankia alni AC
. . Corynebacterium urealyticum DSM 7109 ............................   56 2 hits [high GC Gram+]       putative molybdenum cofactor biosynthesis protein [Coryneba
. . Arthrospira maxima CS-328 .......................................   56 2 hits [cyanobacteria]       molybdenum cofactor biosynthesis protein C [Arthrospira max
. . Clostridium nexile DSM 1787 .....................................   56 2 hits [firmicutes]          hypothetical protein CLONEX_01414 [Clostridium nexile DSM 1
. . Cyanothece sp. PCC 8802 .........................................   56 2 hits [cyanobacteria]       molybdenum cofactor biosynthesis protein C [Cyanothece sp. 
. . Cyanothece sp. PCC 8801 .........................................   56 2 hits [cyanobacteria]       molybdenum cofactor biosynthesis protein C [Cyanothece sp. 
. . Slackia heliotrinireducens DSM 20476 ............................   56 2 hits [high GC Gram+]       GTP cyclohydrolase subunit MoaC [Slackia heliotrinireducens
. . Clavibacter michiganensis subsp. sepedonicus ....................   56 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Clavibacter mic
. . Nostoc punctiforme PCC 73102 ....................................   56 2 hits [cyanobacteria]       molybdenum cofactor biosynthesis protein C [Nostoc punctifo
. . Rhodococcus jostii RHA1 .........................................   56 2 hits [high GC Gram+]       bifunctional molybdenum cofactor biosynthesis protein C/mol
. . Desulfotomaculum reducens MI-1 ..................................   56 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Desulfotomaculu
. . Clostridium sp. 7_2_43FAA .......................................   56 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium sp.
. . Clostridium acetobutylicum ATCC 824 .............................   56 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium ace
. . Clostridium acetobutylicum ......................................   56 1 hit  [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium ace
. . Cytophaga hutchinsonii ATCC 33406 ...............................   56 2 hits [CFB group bacteria]  bifunctional molybdenum cofactor biosynthesis protein C/mol
. . Brevibacterium linens BL2 .......................................   56 1 hit  [high GC Gram+]       COG0315: Molybdenum cofactor biosynthesis enzyme [Brevibact
. . Acaryochloris marina MBIC11017 ..................................   56 2 hits [cyanobacteria]       molybdenum cofactor biosynthesis protein C [Acaryochloris m
. . Alkaliphilus metalliredigens QYMF ...............................   55 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Alkaliphilus me
. . Thermoanaerobacter sp. X514 .....................................   55 3 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Thermoanaerobac
. . Thermoanaerobacter pseudethanolicus ATCC 33223 ..................   55 3 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Thermoanaerobac
. . Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)' .......   55 2 hits [spirochetes]         molybdenum cofactor biosynthesis bifunctional protein: moly
. . Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)' ........   55 2 hits [spirochetes]         molybdenum cofactor biosynthesis bifunctional protein: moly
. . Kytococcus sedentarius DSM 20547 ................................   55 2 hits [high GC Gram+]       GTP cyclohydrolase subunit MoaC [Kytococcus sedentarius DSM
. . Synechococcus sp. CC9311 ........................................   55 2 hits [cyanobacteria]       molybdenum cofactor biosynthesis protein C [Synechococcus s
. . Rhodococcus erythropolis SK121 ..................................   55 2 hits [high GC Gram+]       bifunctional molybdenum cofactor biosynthesis protein C/mol
. . Synechococcus sp. WH 5701 .......................................   55 2 hits [cyanobacteria]       Molybdopterin cofactor biosynthesis MoaC region [Synechococ
. . Rhodococcus erythropolis PR4 ....................................   55 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis bifunctional protein MoaCB
. . Fusobacterium mortiferum ATCC 9817 ..............................   55 2 hits [fusobacteria]        molybdenum cofactor biosynthesis protein C [Fusobacterium m
. . Thermanaerovibrio acidaminovorans DSM 6589 ......................   55 2 hits [bacteria]            GTP cyclohydrolase subunit MoaC [Thermanaerovibrio acidamin
. . Cyanothece sp. PCC 7424 .........................................   55 2 hits [cyanobacteria]       molybdenum cofactor biosynthesis protein C [Cyanothece sp. 
. . Desulfitobacterium hafniense DCB-2 ..............................   55 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Desulfitobacter
. . Clostridium botulinum ...........................................   55 2 hits [firmicutes]          putative molybdenum cofactor biosynthesis protein C [Clostr
. . Opitutus terrae PB90-1 ..........................................   55 2 hits [verrucomicrobia]     molybdenum cofactor biosynthesis protein C [Opitutus terrae
. . Chryseobacterium gleum ATCC 35910 ...............................   55 2 hits [CFB group bacteria]  molybdenum (Mo2+) cofactor biosynthesis enzyme [Chryseobact
. . Desulfitobacterium hafniense Y51 ................................   55 2 hits [firmicutes]          hypothetical protein DSY3965 [Desulfitobacterium hafniense 
. . Denitrovibrio acetiphilus DSM 12809 .............................   55 2 hits [bacteria]            GTP cyclohydrolase subunit MoaC [Denitrovibrio acetiphilus 
. . Sphaerobacter thermophilus DSM 20745 ............................   55 2 hits [GNS bacteria]        GTP cyclohydrolase subunit MoaC [Sphaerobacter thermophilus
. . Salinibacter ruber DSM 13855 ....................................   55 3 hits [CFB group bacteria]  molybdenum cofactor biosynthesis protein C [Salinibacter ru
. . Dethiobacter alkaliphilus AHT 1 .................................   55 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Dethiobacter al
. . Moorella thermoacetica ATCC 39073 ...............................   55 2 hits [firmicutes]          GTP cyclohydrolase subunit MoaC [Moorella thermoacetica ATC
. . Arthrobacter aurescens TC1 ......................................   55 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Arthrobacter au
. . Roseiflexus castenholzii DSM 13941 ..............................   55 3 hits [GNS bacteria]        molybdenum cofactor biosynthesis protein C [Roseiflexus cas
. . Anabaena variabilis ATCC 29413 ..................................   55 3 hits [cyanobacteria]       molybdenum cofactor biosynthesis protein C [Anabaena variab
. . Nostoc sp. PCC 7120 .............................................   55 3 hits [cyanobacteria]       molybdenum cofactor biosynthesis protein C [Nostoc sp. PCC 
. . Flavobacteriales bacterium HTCC2170 .............................   55 2 hits [CFB group bacteria]  putative molybdopterin cofactor biosynthesis protein C [Fla
. . Alkaliphilus oremlandii OhILAs ..................................   55 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Alkaliphilus or
. . Deinococcus geothermalis DSM 11300 ..............................   55 3 hits [bacteria]            molybdenum cofactor biosynthesis protein C [Deinococcus geo
. . Streptomyces coelicolor A3(2) ...................................   55 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Streptomyces co
. . Streptomyces coelicolor .........................................   55 1 hit  [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Streptomyces co
. . Thermomicrobium roseum DSM 5159 .................................   54 2 hits [GNS bacteria]        molybdenum cofactor biosynthesis protein C [Thermomicrobium
. . Thermomonospora curvata DSM 43183 ...............................   54 2 hits [high GC Gram+]       GTP cyclohydrolase subunit MoaC [Thermomonospora curvata DS
. . Sebaldella termitidis ATCC 33386 ................................   54 2 hits [fusobacteria]        GTP cyclohydrolase subunit MoaC [Sebaldella termitidis ATCC
. . Arthrobacter nicotinovorans .....................................   54 1 hit  [high GC Gram+]       molybdopterin cofactor synthesis protein moaC [Arthrobacter
. . Brachybacterium faecium DSM 4810 ................................   54 2 hits [high GC Gram+]       GTP cyclohydrolase subunit MoaC [Brachybacterium faecium DS
. . Verrucomicrobiae bacterium DG1235 ...............................   54 2 hits [verrucomicrobia]     molybdenum cofactor biosynthesis protein C [Verrucomicrobia
. . Cyanothece sp. ATCC 51142 .......................................   54 2 hits [cyanobacteria]       molybdenum cofactor biosynthesis protein C [Cyanothece sp. 
. . Parvimonas micra ATCC 33270 .....................................   54 2 hits [firmicutes]          hypothetical protein PEPMIC_00648 [Peptostreptococcus micro
. . Kribbella flavida DSM 17836 .....................................   54 2 hits [high GC Gram+]       GTP cyclohydrolase subunit MoaC [Kribbella flavida DSM 1783
. . Saccharopolyspora erythraea NRRL 2338 ...........................   54 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein [Saccharopolyspora
. . Lactobacillus fermentum ATCC 14931 ..............................   53 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Lactobacillus f
. . Frankia sp. CcI3 ................................................   53 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Frankia sp. CcI
. . Arthrobacter sp. FB24 ...........................................   53 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Arthrobacter sp
. . Clostridium perfringens E str. JGS1987 ..........................   53 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium per
. . Clostridium difficile 630 .......................................   53 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium dif
. . Thermodesulfovibrio yellowstonii DSM 11347 ......................   53 2 hits [bacteria]            molybdenum cofactor biosynthesis protein C [Thermodesulfovi
. . Tsukamurella paurometabola DSM 20162 ............................   53 2 hits [high GC Gram+]       GTP cyclohydrolase subunit MoaC [Tsukamurella paurometabola
. . Thermosinus carboxydivorans Nor1 ................................   53 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Thermosinus car
. . Alicyclobacillus acidocaldarius LAA1 ............................   53 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Alicyclobacillu
. . Chitinophaga pinensis DSM 2588 ..................................   53 2 hits [CFB group bacteria]  GTP cyclohydrolase subunit MoaC [Chitinophaga pinensis DSM 
. . Corynebacterium glutamicum ATCC 13032 ...........................   53 4 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Corynebacterium
. . Corynebacterium glutamicum ......................................   53 1 hit  [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Corynebacterium
. . Lactobacillus fermentum IFO 3956 ................................   53 3 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Lactobacillus f
. . Corynebacterium efficiens YS-314 ................................   53 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Corynebacterium
. . Corynebacterium efficiens .......................................   53 1 hit  [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Corynebacterium
. . Streptomyces avermitilis MA-4680 ................................   53 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Streptomyces av
. . Streptomyces avermitilis ........................................   53 1 hit  [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Streptomyces av
. . Beutenbergia cavernae DSM 12333 .................................   53 2 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Beutenbergia ca
. . Corynebacterium glutamicum R ....................................   53 3 hits [high GC Gram+]       molybdenum cofactor biosynthesis protein C [Corynebacterium
. . Sulfurihydrogenibium azorense Az-Fu1 ............................   53 2 hits [aquificales]         molybdenum cofactor biosynthesis bifunctional protein: moly
. . Clostridium perfringens SM101 ...................................   53 3 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium per
. . Trichodesmium erythraeum IMS101 .................................   53 3 hits [cyanobacteria]       molybdenum cofactor biosynthesis protein C [Trichodesmium e
. . Clostridium perfringens D str. JGS1721 ..........................   53 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium per
. . Synechococcus sp. PCC 7335 ......................................   53 2 hits [cyanobacteria]       molybdenum cofactor biosynthesis protein C [Synechococcus s
. . Clostridium perfringens str. 13 .................................   53 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium per
. . Clostridium perfringens ATCC 13124 ..............................   53 3 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium per
. . Clostridium perfringens CPE str. F4969 ..........................   53 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium per
. . Clostridium perfringens NCTC 8239 ...............................   53 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium per
. . Clostridium perfringens .........................................   53 1 hit  [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium per
. . Eubacterium acidaminophilum .....................................   53 2 hits [firmicutes]          Molybdenum cofactor biosynthesis protein C >gi|51241640|emb
. . Crocosphaera watsonii WH 8501 ...................................   53 2 hits [cyanobacteria]       Molybdopterin cofactor biosynthesis protein MoaC [Crocospha
. . Clavibacter michiganensis subsp. michiganensis NCPPB 382 ........   53 2 hits [high GC Gram+]       putative molybdenum cofactor biosynthesis protein [Clavibac
. . Gemmata obscuriglobus UQM 2246 ..................................   53 1 hit  [planctomycetes]      molybdenum cofactor biosynthesis protein C [Gemmata obscuri
. . Clostridium cellulolyticum H10 ..................................   53 2 hits [firmicutes]          molybdenum cofactor biosynthesis protein C [Clostridium cel
. Botryotinia fuckeliana B05.10 -------------------------------------   62 2 hits [ascomycetes]         hypothetical protein BC1G_13444 [Botryotinia fuckeliana B05
. Talaromyces stipitatus ATCC 10500 .................................   60 1 hit  [ascomycetes]         molybdopterin cofactor biosynthetic protein [Talaromyces st
. Aspergillus clavatus NRRL 1 .......................................   60 2 hits [ascomycetes]         molybdopterin cofactor biosynthetic protein [Aspergillus cl
. Penicillium chrysogenum Wisconsin 54-1255 .........................   60 1 hit  [ascomycetes]         Pc21g23080 [Penicillium chrysogenum Wisconsin 54-1255]
. Aspergillus flavus NRRL3357 .......................................   60 1 hit  [ascomycetes]         molybdopterin cofactor biosynthetic protein [Aspergillus fl
. Ostreococcus lucimarinus CCE9901 ..................................   59 2 hits [green algae]         Molybdopterin biosynthesis CNX3/MoaC precursor Z synthase s
. Populus trichocarpa (black cottonwood) ............................   59 2 hits [eudicots]            predicted protein [Populus trichocarpa] >gi|222861642|gb|EE
. Nematostella vectensis ............................................   58 2 hits [sea anemones]        predicted protein [Nematostella vectensis] >gi|156225070|gb
. Penicillium marneffei ATCC 18224 ..................................   57 2 hits [ascomycetes]         molybdopterin cofactor biosynthetic protein [Penicillium ma
. Aspergillus terreus NIH2624 .......................................   57 2 hits [ascomycetes]         molybdenum cofactor biosynthesis protein 1 B [Aspergillus t
. Phaeosphaeria nodorum SN15 ........................................   57 2 hits [ascomycetes]         hypothetical protein SNOG_02351 [Phaeosphaeria nodorum SN15
. Ricinus communis ..................................................   57 2 hits [eudicots]            molybdopterin cofactor synthesis protein A, putative [Ricin
. Arabidopsis thaliana (thale-cress) ................................   56 5 hits [eudicots]            CNX3 (COFACTOR OF NITRATE REDUCTASE AND XANTHINE DEHYDROGEN
. Aspergillus fumigatus Af293 .......................................   56 2 hits [ascomycetes]         molybdenum cofactor biosynthesis protein (MoaC) [Aspergillu
. Aspergillus fumigatus A1163 .......................................   56 1 hit  [ascomycetes]         molybdenum cofactor biosynthesis protein (MoaC) [Aspergillu
. Neosartorya fischeri NRRL 181 .....................................   56 2 hits [ascomycetes]         hypothetical protein NFIA_009060 [Neosartorya fischeri NRRL
. Physcomitrella patens subsp. patens ...............................   56 2 hits [mosses]              predicted protein [Physcomitrella patens subsp. patens] >gi
. Aspergillus nidulans FGSC A4 ......................................   56 2 hits [ascomycetes]         hypothetical protein AN0947.2 [Aspergillus nidulans FGSC A4
. Emericella nidulans ...............................................   56 1 hit  [ascomycetes]         hypothetical protein AN0947.2 [Aspergillus nidulans FGSC A4
. Drosophila mojavensis .............................................   56 2 hits [flies]               GI11449 [Drosophila mojavensis] >gi|193920708|gb|EDW19575.1
. Vitis vinifera (wine grape) .......................................   56 1 hit  [eudicots]            unnamed protein product [Vitis vinifera]
. Oryza sativa Japonica Group (Japanese rice) .......................   55 4 hits [monocots]            Os04g0460500 [Oryza sativa (japonica cultivar-group)] >gi|1
. Aspergillus niger CBS 513.88 ......................................   55 1 hit  [ascomycetes]         hypothetical protein An09g03020 [Aspergillus niger] >gi|134
. Aspergillus niger .................................................   55 1 hit  [ascomycetes]         hypothetical protein An09g03020 [Aspergillus niger] >gi|134
. Oryza sativa Indica Group (Indian rice) ...........................   55 2 hits [monocots]            OSJNBa0072F16.9 [Oryza sativa (japonica cultivar-group)] >g
. Pyrenophora tritici-repentis Pt-1C-BFP ............................   54 2 hits [ascomycetes]         molybdenum cofactor biosynthesis protein 1 B [Pyrenophora t
. Phaeodactylum tricornutum CCAP 1055/1 .............................   54 2 hits [diatoms]             predicted protein [Phaeodactylum tricornutum CCAP 1055/1] >
. Neurospora crassa OR74A ...........................................   53 2 hits [ascomycetes]         molybdenum cofactor biosynthesis protein 1 B [Neurospora cr
. Paracoccidioides brasiliensis Pb18 ................................   53 1 hit  [ascomycetes]         molybdenum cofactor biosynthesis protein 1 A [Paracoccidioi
. Paracoccidioides brasiliensis Pb01 ................................   53 1 hit  [ascomycetes]         molybdenum cofactor biosynthesis protein 1 A [Paracoccidioi

BLAST

PROTOCOL

BLASTp vs NCBI ; default NCBI parameters _"1000 max target sequences"


RESULTS ANALYSIS


ORF number 1 in reading frame 3 give me these BLASTp results :


Results:

Query ID lcl|36893

Description Translation of ORF number 1 in reading frame 3 on the reverse strand.

Molecule type amino acid

Query Length 89


Score _ 139 bits (351),

Expected value _ 6e-32, Method: Compositional matrix adjust.

percentage Identities _ 68/80 (85%),

Positives _ 71/80 (88%), Gaps _ 0/80 (0%)

Colour of score _ pink



RAW RESULTS

BLASTp vs SWISSPROT 
---------------------------------------------------------------------------------------------------------------------


                                                                  Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|YP_002591541.1|  molybdenum cofactor biosynthesis protein ...   139    6e-32 
ref|YP_266183.1|  molybdopterin cofactor synthesis protein [Ca...   134    3e-30 
ref|ZP_01264078.1|  molybdopterin cofactor synthesis protein [...   128    2e-28
ref|YP_002707403.1|  molybdenum cofactor biosynthesis protein ...  84.0    5e-15 
ref|YP_001972543.1|  putative molybdenum cofactor biosynthesis...  84.0    5e-15 
ref|YP_002028630.1|  molybdenum cofactor biosynthesis protein ...  84.0    5e-15 
ref|ZP_03759378.1|  hypothetical protein CLOSTASPAR_03402 [Clo...  72.0    2e-11
ref|NP_959736.1|  molybdenum cofactor biosynthesis protein C [...  71.6    2e-11 
ref|ZP_03485446.1|  hypothetical protein ROSINTL182_02850 [Ros...  71.2    3e-11
ref|YP_880253.1|  molybdenum cofactor biosynthesis protein C [...  70.9    3e-11 
ref|YP_001634392.1|  molybdenum cofactor biosynthesis protein ...  70.5    5e-11 
ref|ZP_01967998.1|  hypothetical protein RUMTOR_01564 [Ruminoc...  70.1    7e-11
ref|ZP_02087905.1|  hypothetical protein CLOBOL_05456 [Clostri...  69.7    7e-11
ref|ZP_02440807.1|  hypothetical protein ANACOL_00071 [Anaerot...  69.7    9e-11
ref|ZP_03753529.1|  hypothetical protein ROSEINA2194_01946 [Ro...  68.9    1e-10
ref|YP_641642.1|  molybdenum cofactor biosynthesis protein C [...  68.9    1e-10 
ref|ZP_01996694.1|  hypothetical protein DORLON_02712 [Dorea l...  68.6    2e-10
ref|ZP_03799172.1|  hypothetical protein COPCOM_01429 [Coproco...  68.6    2e-10
ref|YP_001852926.1|  molybdenum cofactor biosynthesis protein ...  68.6    2e-10 
ref|YP_001701612.1|  molybdenum cofactor biosynthesis protein ...  68.6    2e-10 
ref|ZP_02041245.1|  hypothetical protein RUMGNA_02011 [Ruminoc...  68.2    3e-10
ref|ZP_02951607.1|  molybdenum cofactor biosynthesis protein C...  67.8    3e-10
ref|YP_002125356.1|  molybdenum cofactor biosynthesis protein ...  67.8    3e-10 
ref|YP_001340936.1|  molybdenum cofactor biosynthesis protein ...  67.8    3e-10 
ref|ZP_03653079.1|  molybdenum cofactor biosynthesis protein C...  67.4    4e-10
ref|ZP_02421121.1|  hypothetical protein ANACAC_03775 [Anaeros...  67.4    4e-10
ref|YP_934424.1|  molybdenum cofactor biosynthesis protein C [...  67.0    5e-10 
ref|YP_314327.1|  GTP cyclohydrolase subunit MoaC [Thiobacillu...  67.0    5e-10 
ref|ZP_02995926.1|  hypothetical protein CLOSPO_03049 [Clostri...  66.2    8e-10
ref|YP_889936.1|  molybdenum cofactor biosynthesis protein C [...  66.2    8e-10 
ref|ZP_03931332.1|  molybdenum (Mo2+) cofactor biosynthesis en...  66.2    9e-10
ref|ZP_03773533.1|  hypothetical protein SUBVAR_00028 [Subdoli...  66.2    9e-10
ref|ZP_02210697.1|  hypothetical protein CLOBAR_00264 [Clostri...  65.5    1e-09
ref|ZP_03329563.1|  molybdenum cofactor biosynthesis protein C...  65.5    1e-09
ref|YP_002797034.1|  MoaC [Laribacter hongkongensis HLHK9] >gb...  65.1    2e-09 
ref|YP_001951171.1|  molybdenum cofactor biosynthesis protein ...  65.1    2e-09 
ref|NP_215379.1|  molybdenum cofactor biosynthesis protein C [...  64.7    2e-09 
ref|YP_002464140.1|  molybdenum cofactor biosynthesis protein ...  64.7    2e-09 
ref|ZP_04434648.1|  molybdenum cofactor biosynthesis protein M...  64.3    3e-09
ref|ZP_02177234.1|  molybdenum cofactor biosynthesis moaC [Hyd...  64.3    3e-09
ref|NP_854545.1|  molybdenum cofactor biosynthesis protein C [...  64.3    3e-09 
ref|NP_815113.1|  molybdenum cofactor biosynthesis protein Moa...  64.3    3e-09 
ref|ZP_03699189.1|  molybdenum cofactor biosynthesis protein C...  63.9    4e-09
ref|YP_473662.1|  molybdenum cofactor biosynthesis protein C [...  63.9    4e-09 
ref|ZP_04050044.1|  GTP cyclohydrolase subunit MoaC [Anaerococ...  63.9    4e-09
ref|YP_900226.1|  molybdenum cofactor biosynthesis protein C [...  63.9    5e-09 
ref|ZP_02432669.1|  hypothetical protein CLOSCI_02916 [Clostri...  63.9    5e-09
ref|ZP_04339829.1|  molybdenum cofactor biosynthesis protein M...  63.5    6e-09
gb|AAR37642.1|  molybdenum cofactor biosynthesis protein C [un...  63.5    6e-09
ref|ZP_01963802.1|  hypothetical protein RUMOBE_01525 [Ruminoc...  63.5    6e-09
ref|ZP_02439229.1|  hypothetical protein CLOSS21_01695 [Clostr...  63.2    7e-09
ref|YP_001795896.1|  molybdenum cofactor biosynthesis protein ...  63.2    7e-09 
ref|ZP_01039790.1|  molybdenum cofactor biosynthesis protein C...  63.2    7e-09
ref|YP_904492.1|  molybdenum cofactor biosynthesis protein C 2...  63.2    7e-09 
ref|ZP_01771788.1|  Hypothetical protein COLAER_00777 [Collins...  63.2    8e-09
ref|ZP_01908261.1|  molybdenum cofactor biosynthesis protein C...  62.8    1e-08
ref|ZP_03488992.1|  hypothetical protein EUBIFOR_01578 [Eubact...  62.8    1e-08
ref|YP_294766.1|  molybdenum cofactor biosynthesis protein C [...  62.4    1e-08 
ref|YP_001226207.1|  molybdenum cofactor biosynthesis protein ...  62.4    1e-08 
ref|ZP_04425712.1|  GTP cyclohydrolase subunit MoaC [Planctomy...  62.4    1e-08
ref|YP_001132970.1|  molybdenum cofactor biosynthesis protein ...  62.4    1e-08 
ref|ZP_02234154.1|  hypothetical protein DORFOR_01012 [Dorea f...  62.4    1e-08
ref|YP_286290.1|  molybdenum cofactor biosynthesis protein C [...  62.4    1e-08 
ref|NP_904005.1|  molybdenum cofactor biosynthesis protein C [...  62.4    1e-08 
ref|YP_725071.1|  molybdenum cofactor biosynthesis protein C [...  62.4    1e-08 
ref|XP_001548067.1|  hypothetical protein BC1G_13444 [Botryoti...  62.0    1e-08 
ref|ZP_03781184.1|  hypothetical protein RUMHYD_00614 [Blautia...  62.0    1e-08
ref|YP_661729.1|  molybdenum cofactor biosynthesis protein C [...  62.0    2e-08 
ref|ZP_01124923.1|  molybdenum cofactor biosynthesis protein C...  62.0    2e-08
ref|ZP_01117391.1|  bifunctional molybdenum cofactor biosynthe...  62.0    2e-08
ref|ZP_02692542.1|  molybdenum cofactor biosynthesis protein C...  61.6    2e-08
ref|YP_001525119.1|  molybdopterin cofactor biosynthesis prote...  61.6    2e-08 
ref|YP_984137.1|  molybdenum cofactor biosynthesis protein C [...  61.6    2e-08 
ref|ZP_03733697.1|  hypothetical protein CLOM621_03733 [Clostr...  61.6    2e-08
ref|YP_001558592.1|  molybdenum cofactor biosynthesis protein ...  61.6    2e-08 
ref|ZP_03992417.1|  molybdenum cofactor biosynthesis protein C...  61.6    2e-08
ref|YP_002598368.1|  HAD-superfamily hydrolase subfamily IIB [...  61.6    2e-08 
ref|YP_001219479.1|  molybdenum cofactor biosynthesis protein ...  61.6    2e-08 
gb|AAR37877.1|  molybdenum cofactor biosynthesis protein C [un...  61.2    3e-08
ref|YP_001567437.1|  molybdenum cofactor biosynthesis protein ...  61.2    3e-08 
ref|ZP_03689302.1|  molybdenum cofactor biosynthesis protein C...  61.2    3e-08
ref|ZP_04019425.1|  molybdenum cofactor biosynthesis protein C...  61.2    3e-08
ref|NP_898557.1|  molybdenum cofactor biosynthesis protein C [...  61.2    3e-08 
ref|YP_754528.1|  molybdenum cofactor biosynthesis protein C [...  61.2    3e-08 
gb|EED21429.1|  molybdopterin cofactor biosynthetic protein [T...  60.8    3e-08
ref|YP_582641.1|  molybdenum cofactor biosynthesis protein C [...  60.8    3e-08 
ref|ZP_01227520.1|  molybdenum cofactor biosynthesis enzyme [A...  60.8    4e-08
ref|YP_382928.1|  GTP cyclohydrolase subunit MoaC [Synechococc...  60.8    4e-08 
ref|ZP_01471489.1|  molybdenum cofactor biosynthesis protein C...  60.8    4e-08
ref|YP_001789531.1|  molybdenum cofactor biosynthesis protein ...  60.8    4e-08 
ref|YP_002889770.1|  molybdenum cofactor biosynthesis protein ...  60.8    4e-08
ref|YP_161103.1|  molybdenum cofactor biosynthesis protein C [...  60.8    4e-08 
ref|XP_001268641.1|  molybdopterin cofactor biosynthetic prote...  60.5    4e-08 
ref|YP_001787334.1|  molybdenum cofactor biosynthesis protein ...  60.5    4e-08 
emb|CAP97205.1|  Pc21g23080 [Penicillium chrysogenum Wisconsin...  60.5    4e-08
ref|YP_001692737.1|  molybdenum cofactor biosynthesis protein ...  60.5    4e-08 
ref|ZP_01287861.1|  Molybdopterin cofactor biosynthesis  MoaC ...  60.5    5e-08
ref|ZP_03890949.1|  GTP cyclohydrolase subunit MoaC [Geodermat...  60.5    5e-08
ref|YP_065219.1|  molybdenum cofactor biosynthesis protein C (...  60.5    5e-08 
ref|YP_001254442.1|  molybdenum cofactor biosynthesis protein ...  60.5    5e-08 
ref|YP_001781503.1|  molybdenum cofactor biosynthesis protein ...  60.5    5e-08 
ref|ZP_01303030.1|  molybdenum cofactor biosynthesis protein C...  60.5    5e-08
ref|NP_213370.1|  molybdenum cofactor biosynthesis moaC [Aquif...  60.5    5e-08 
ref|YP_001391264.1|  molybdenum cofactor biosynthesis protein ...  60.5    5e-08 
ref|YP_002618750.1|  molybdenum cofactor biosynthesis protein ...  60.5    5e-08 
ref|ZP_02619591.1|  molybdenum cofactor biosynthesis protein C...  60.5    5e-08
ref|ZP_03552249.1|  molybdenum cofactor biosynthesis protein C...  60.1    6e-08
ref|ZP_03681554.1|  hypothetical protein CATMIT_00166 [Catenib...  60.1    6e-08
gb|EED57619.1|  molybdopterin cofactor biosynthetic protein [A...  60.1    6e-08
ref|YP_757939.1|  GTP cyclohydrolase subunit MoaC [Maricaulis ...  60.1    7e-08 
ref|YP_271283.1|  molybdenum cofactor biosynthesis protein C [...  60.1    7e-08 
ref|YP_001642112.1|  molybdenum cofactor biosynthesis protein ...  60.1    7e-08 
ref|ZP_04507092.1|  GTP cyclohydrolase subunit MoaC [Saccharom...  59.7    7e-08
ref|ZP_03895906.1|  GTP cyclohydrolase subunit MoaC [Eggerthel...  59.7    8e-08
ref|YP_002660093.1|  molybdenum cofactor biosynthesis protein ...  59.7    8e-08 
ref|ZP_02614313.1|  molybdenum cofactor biosynthesis protein C...  59.7    8e-08
ref|YP_497300.1|  GTP cyclohydrolase subunit MoaC [Novosphingo...  59.7    8e-08 
ref|NP_682152.1|  bifunctional molybdenum cofactor biosynthesi...  59.7    8e-08 
ref|ZP_04352804.1|  GTP cyclohydrolase subunit MoaC [Desulfoto...  59.7    8e-08
ref|YP_002789874.1|  molybdenum cofactor biosynthesis protein ...  59.7    9e-08 
ref|YP_002128143.1|  molybdenum cofactor biosynthesis protein ...  59.3    9e-08 
ref|YP_001470602.1|  molybdenum cofactor biosynthesis protein ...  59.3    9e-08 
ref|ZP_03816401.1|  GTP cyclohydrolase subunit MoaC [Actinosyn...  59.3    1e-07
ref|YP_001309116.1|  molybdenum cofactor biosynthesis protein ...  59.3    1e-07 
ref|YP_001310865.1|  molybdenum cofactor biosynthesis protein ...  59.3    1e-07 
ref|ZP_02091746.1|  hypothetical protein FAEPRAM212_02031 [Fae...  59.3    1e-07
ref|ZP_04355981.1|  GTP cyclohydrolase subunit MoaC [Cryptobac...  59.3    1e-07
ref|XP_001416524.1|  Molybdopterin biosynthesis CNX3/MoaC prec...  59.3    1e-07 
ref|YP_359657.1|  molybdenum cofactor biosynthesis protein C [...  59.3    1e-07 
ref|ZP_01311889.1|  molybdenum cofactor biosynthesis protein C...  59.3    1e-07
ref|XP_002320869.1|  predicted protein [Populus trichocarpa] >...  59.3    1e-07 
ref|YP_001228756.1|  molybdenum cofactor biosynthesis protein ...  59.3    1e-07 
ref|ZP_03656261.1|  molybdenum cofactor biosynthesis protein C...  59.3    1e-07
ref|YP_002515009.1|  molybdenum cofactor biosynthesis protein ...  59.3    1e-07 
ref|YP_002120803.1|  molybdenum cofactor biosynthesis protein ...  58.9    1e-07 
ref|YP_001896902.1|  molybdenum cofactor biosynthesis protein ...  58.9    1e-07 
ref|ZP_00055034.1|  COG0315: Molybdenum cofactor biosynthesis ...  58.9    1e-07
ref|ZP_00943143.1|  Molybdenum cofactor biosynthesis protein C...  58.9    1e-07
ref|ZP_03716288.1|  hypothetical protein EUBHAL_01352 [Eubacte...  58.9    1e-07
ref|NP_442382.1|  bifunctional molybdenum cofactor biosynthesi...  58.9    1e-07 
ref|YP_001927842.1|  molybdenum cofactor biosynthesis protein ...  58.9    1e-07 
ref|ZP_00960568.1|  molybdenum cofactor biosynthesis protein C...  58.9    1e-07
ref|YP_002220601.1|  molybdenum cofactor biosynthesis protein ...  58.9    1e-07 
ref|YP_903903.1|  GTP cyclohydrolase subunit MoaC [Candidatus ...  58.9    1e-07 
ref|YP_002069914.1|  molybdenum cofactor biosynthesis protein ...  58.9    1e-07 
ref|YP_002258808.1|  molybdenum cofactor biosynthesis protein ...  58.9    1e-07 
ref|YP_560307.1|  molybdenum cofactor biosynthesis protein C [...  58.9    1e-07 
ref|YP_458193.1|  molybdopterin cofactor biosynthesis MoaC reg...  58.9    1e-07 
ref|ZP_01868655.1|  molybdenum cofactor biosynthesis protein C...  58.9    2e-07
ref|YP_001539793.1|  molybdenum cofactor biosynthesis protein ...  58.9    2e-07 
ref|YP_001613579.1|  putative molybdenum cofactor biosynthesis...  58.5    2e-07 
ref|YP_001898068.1|  molybdenum cofactor biosynthesis protein ...  58.5    2e-07 
ref|YP_955830.1|  molybdenum cofactor biosynthesis protein C [...  58.5    2e-07 
ref|ZP_00049418.1|  COG0315: Molybdenum cofactor biosynthesis ...  58.5    2e-07
ref|ZP_03780296.1|  hypothetical protein CLOHYLEM_07398 [Clost...  58.5    2e-07
ref|ZP_01440318.1|  molybdenum cofactor biosynthesis protein C...  58.5    2e-07
ref|YP_742160.1|  GTP cyclohydrolase subunit MoaC [Alkalilimni...  58.5    2e-07 
ref|YP_544311.1|  GTP cyclohydrolase subunit MoaC [Methylobaci...  58.5    2e-07 
ref|YP_422227.1|  molybdenum cofactor biosynthesis protein [Ma...  58.5    2e-07 
ref|NP_518681.1|  molybdenum cofactor biosynthesis protein C [...  58.5    2e-07 
ref|YP_959702.1|  molybdenum cofactor biosynthesis protein C [...  58.5    2e-07 
ref|ZP_04446210.1|  hypothetical protein COLINT_02942 [Collins...  58.5    2e-07
ref|YP_525269.1|  molybdenum cofactor biosynthesis protein C [...  58.5    2e-07 
ref|XP_001637954.1|  predicted protein [Nematostella vectensis...  58.2    2e-07 
ref|ZP_04419272.1|  molybdenum cofactor biosynthesis protein C...  58.2    2e-07
ref|YP_002281334.1|  molybdenum cofactor biosynthesis protein ...  58.2    2e-07 
ref|ZP_01728437.1|  molybdenum cofactor biosynthesis protein C...  58.2    2e-07
ref|ZP_03296269.1|  hypothetical protein COLSTE_00153 [Collins...  58.2    2e-07
ref|YP_469685.1|  molybdenum cofactor biosynthesis protein [Rh...  58.2    2e-07 
ref|YP_001916684.1|  GTP cyclohydrolase subunit MoaC [Natranae...  58.2    2e-07 
ref|ZP_01872552.1|  Molybdopterin cofactor biosynthesis MoaC r...  58.2    2e-07
ref|ZP_04577123.1|  molybdenum cofactor biosynthesis protein C...  58.2    3e-07
ref|YP_378277.1|  molybdopterin cofactor biosynthesis MoaC reg...  58.2    3e-07 
ref|YP_115130.1|  molybdenum cofactor biosynthesis protein C [...  58.2    3e-07 
ref|YP_781507.1|  molybdenum cofactor biosynthesis protein C [...  58.2    3e-07 
ref|YP_436945.1|  molybdenum cofactor biosynthesis protein C [...  57.8    3e-07 
ref|ZP_00992140.1|  molybdenum cofactor biosynthesis protein C...  57.8    3e-07
ref|ZP_03465731.1|  molybdenum cofactor biosynthesis protein C...  57.8    3e-07
ref|XP_002146089.1|  molybdopterin cofactor biosynthetic prote...  57.8    3e-07 
ref|YP_002606798.1|  molybdenum cofactor biosynthesis protein ...  57.8    3e-07 
ref|YP_001274915.1|  molybdenum cofactor biosynthesis protein ...  57.8    3e-07 
ref|YP_001678699.1|  molybdenum cofactor biosynthesis protein ...  57.8    3e-07 
ref|ZP_01862926.1|  Molybdopterin cofactor biosynthesis MoaC r...  57.8    3e-07
ref|XP_001214342.1|  molybdenum cofactor biosynthesis protein ...  57.8    3e-07 
ref|ZP_04348751.1|  GTP cyclohydrolase subunit MoaC [Nakamurel...  57.8    3e-07
ref|YP_002688465.1|  molybdenum cofactor biosynthesis protein ...  57.8    3e-07 
ref|ZP_03507220.1|  putative molybdenum cofactor biosynthesis ...  57.8    3e-07
ref|ZP_01632816.1|  Molybdopterin cofactor biosynthesis  MoaC ...  57.8    3e-07
ref|YP_001978396.1|  molybdenum cofactor biosynthesis protein ...  57.8    3e-07 
ref|YP_768079.1|  putative molybdenum cofactor biosynthesis pr...  57.8    3e-07 
ref|ZP_01632640.1|  molybdenum cofactor biosynthesis protein C...  57.8    4e-07
ref|YP_551452.1|  GTP cyclohydrolase subunit MoaC [Polaromonas...  57.4    4e-07 
ref|YP_120531.1|  bifunctional molybdenum cofactor biosynthesi...  57.4    4e-07 
ref|ZP_02007475.1|  molybdenum cofactor biosynthesis protein C...  57.4    4e-07
ref|YP_001100860.1|  molybdenum cofactor biosynthesis protein ...  57.4    4e-07 
ref|XP_001792959.1|  hypothetical protein SNOG_02351 [Phaeosph...  57.4    4e-07 
ref|ZP_03471750.1|  hypothetical protein MITSMUL_00073 [Mitsuo...  57.4    4e-07
ref|YP_001904767.1|  molybdenum cofactor biosynthesis protein ...  57.4    4e-07 
ref|NP_953749.1|  molybdenum cofactor biosynthesis protein Moa...  57.4    4e-07 
ref|ZP_02293120.1|  molybdenum cofactor biosynthesis protein C...  57.4    4e-07
ref|YP_002256411.1|  molybdenum cofactor biosynthesis protein ...  57.4    4e-07 
ref|ZP_03524129.1|  molybdenum cofactor biosynthesis protein C...  57.4    4e-07
ref|YP_001505055.1|  molybdenum cofactor biosynthesis protein ...  57.4    4e-07 
gb|EEF39052.1|  molybdopterin cofactor synthesis protein A, pu...  57.4    4e-07
ref|YP_002487525.1|  molybdenum cofactor biosynthesis protein ...  57.4    4e-07 
ref|NP_873814.1|  molybdenum cofactor biosynthesis protein C [...  57.4    4e-07 
ref|YP_759786.1|  molybdenum cofactor biosynthesis protein C [...  57.4    4e-07 
ref|YP_001263703.1|  GTP cyclohydrolase subunit MoaC [Sphingom...  57.4    4e-07 
ref|ZP_01469121.1|  Molybdopterin cofactor biosynthesis MoaC r...  57.4    4e-07
ref|ZP_04423851.1|  GTP cyclohydrolase subunit MoaC [Rhodother...  57.4    4e-07
gb|EEF38057.1|  molybdopterin cofactor synthesis protein A, pu...  57.4    4e-07
ref|YP_001920494.1|  molybdenum cofactor biosynthesis protein ...  57.4    5e-07 
ref|YP_002669759.1|  molybdenum cofactor biosynthesis protein ...  57.0    5e-07 
ref|YP_002783673.1|  molybdenum cofactor biosynthesis bifuncti...  57.0    5e-07 
ref|YP_001354544.1|  molybdenum cofactor biosynthesis protein ...  57.0    5e-07 
ref|ZP_03518852.1|  molybdenum cofactor biosynthesis protein C...  57.0    5e-07
ref|NP_636374.1|  molybdenum cofactor biosynthesis protein C [...  57.0    5e-07 
ref|ZP_01443525.1|  molybdenum cofactor biosynthesis protein C...  57.0    5e-07
ref|ZP_02884591.1|  molybdenum cofactor biosynthesis protein C...  57.0    5e-07
ref|YP_001832546.1|  molybdenum cofactor biosynthesis protein ...  57.0    5e-07 
ref|YP_001120579.1|  molybdenum cofactor biosynthesis protein ...  57.0    5e-07 
ref|NP_171636.1|  CNX3 (COFACTOR OF NITRATE REDUCTASE AND XANT...  57.0    5e-07 
ref|YP_716528.1|  molybdenum cofactor biosynthesis protein C [...  57.0    5e-07 
ref|ZP_03661400.1|  molybdenum cofactor biosynthesis protein C...  57.0    5e-07
ref|NP_907384.1|  molybdenum cofactor biosynthesis protein C [...  57.0    5e-07 
ref|ZP_01894996.1|  molybdenum cofactor biosynthesis protein C...  57.0    6e-07
ref|ZP_02269649.1|  molybdenum cofactor biosynthesis protein C...  57.0    6e-07
ref|ZP_01128544.1|  molybdenum cofactor biosynthesis protein C...  57.0    6e-07
ref|ZP_00438613.1|  COG0315: Molybdenum cofactor biosynthesis ...  57.0    6e-07
ref|ZP_03242763.1|  molybdenum cofactor biosynthesis protein C...  57.0    6e-07
ref|YP_001801128.1|  putative molybdenum cofactor biosynthesis...  57.0    6e-07 
ref|XP_753003.1|  molybdenum cofactor biosynthesis protein (Mo...  57.0    6e-07 
ref|YP_002010845.1|  molybdenum cofactor biosynthesis protein ...  57.0    6e-07 
emb|CAM75271.1|  Molybdopterin cofactor biosynthesis protein M...  57.0    6e-07
ref|ZP_03276488.1|  molybdenum cofactor biosynthesis protein C...  57.0    6e-07
ref|ZP_03289214.1|  hypothetical protein CLONEX_01414 [Clostri...  57.0    6e-07
ref|ZP_03144279.1|  molybdenum cofactor biosynthesis protein C...  57.0    6e-07
ref|YP_002051566.1|  molybdenum cofactor biosynthesis protein ...  57.0    6e-07 
ref|NP_223452.1|  molybdenum cofactor biosynthesis protein C [...  56.6    6e-07 
ref|ZP_03267158.1|  molybdenum cofactor biosynthesis protein C...  56.6    7e-07
ref|YP_613132.1|  molybdenum cofactor biosynthesis protein C [...  56.6    7e-07 
ref|XP_001264125.1|  hypothetical protein NFIA_009060 [Neosart...  56.6    7e-07 
ref|NP_881319.1|  molybdenum cofactor biosynthesis protein [Bo...  56.6    7e-07 
ref|ZP_02002532.1|  molybdenum cofactor biosynthesis protein C...  56.6    7e-07
ref|YP_001467676.1|  molybdenum cofactor biosynthesis protein ...  56.6    7e-07 
ref|ZP_01977569.1|  molybdenum cofactor biosynthesis protein C...  56.6    7e-07
ref|YP_427897.1|  GTP cyclohydrolase subunit MoaC [Rhodospiril...  56.6    7e-07 
ref|ZP_01751399.1|  molybdenum cofactor biosynthesis protein C...  56.6    8e-07
ref|ZP_04499189.1|  GTP cyclohydrolase subunit MoaC [Slackia h...  56.6    8e-07
ref|XP_001773716.1|  predicted protein [Physcomitrella patens ...  56.6    8e-07 
ref|NP_230671.1|  molybdenum cofactor biosynthesis protein C [...  56.2    8e-07 
ref|YP_001711146.1|  molybdenum cofactor biosynthesis protein ...  56.2    8e-07 
ref|XP_658551.1|  hypothetical protein AN0947.2 [Aspergillus n...  56.2    8e-07 
ref|XP_002009099.1|  GI11449 [Drosophila mojavensis] >gb|EDW19...  56.2    8e-07 
ref|YP_002723560.1|  molybdenum cofactor biosynthesis protein ...  56.2    8e-07 
emb|CAA63245.1|  unnamed protein product [Helicobacter pylori]     56.2    8e-07
ref|YP_001864353.1|  molybdenum cofactor biosynthesis protein ...  56.2    8e-07 
ref|ZP_01949785.1|  molybdenum cofactor biosynthesis protein C...  56.2    8e-07
ref|YP_706360.1|  bifunctional molybdenum cofactor biosynthesi...  56.2    8e-07 
ref|YP_001755763.1|  molybdenum cofactor biosynthesis protein ...  56.2    9e-07 
ref|YP_001113602.1|  molybdenum cofactor biosynthesis protein ...  56.2    9e-07 
ref|YP_002852229.1|  molybdenum cofactor biosynthesis protein ...  56.2    9e-07 
ref|NP_348611.1|  molybdenum cofactor biosynthesis protein C [...  56.2    9e-07 
emb|CAO14386.1|  unnamed protein product [Vitis vinifera]          56.2    9e-07
ref|ZP_01101114.1|  molybdenum cofactor biosynthesis protein c...  56.2    9e-07
ref|ZP_02167158.1|  molybdenum cofactor biosynthesis protein C...  56.2    9e-07
ref|YP_677942.1|  bifunctional molybdenum cofactor biosynthesi...  56.2    9e-07 
ref|ZP_00380584.1|  COG0315: Molybdenum cofactor biosynthesis ...  56.2    1e-06
ref|YP_002684093.1|  molybdenum cofactor biosynthesis protein ...  56.2    1e-06 
ref|YP_001514513.1|  molybdenum cofactor biosynthesis protein ...  56.2    1e-06 
ref|YP_002360836.1|  molybdenum cofactor biosynthesis protein ...  55.8    1e-06 
ref|YP_002574759.1|  molybdenum cofactor biosynthesis protein ...  55.8    1e-06 
ref|YP_001320024.1|  molybdenum cofactor biosynthesis protein ...  55.8    1e-06 
ref|YP_001910045.1|  molybdenum cofactor biosynthesis protein ...  55.8    1e-06 
ref|ZP_03439575.1|  hypothetical protein HP9810_868g48 [Helico...  55.8    1e-06
ref|YP_001663018.1|  molybdenum cofactor biosynthesis protein ...  55.8    1e-06 
ref|YP_001664854.1|  molybdenum cofactor biosynthesis protein ...  55.8    1e-06 
ref|YP_001632280.1|  molybdenum cofactor biosynthesis protein ...  55.8    1e-06 
ref|YP_001840122.1|  molybdenum cofactor biosynthesis bifuncti...  55.8    1e-06 
ref|YP_001156601.1|  molybdenum cofactor biosynthesis protein ...  55.8    1e-06 
ref|ZP_02143981.1|  molybdenum cofactor biosynthesis protein C...  55.8    1e-06
ref|YP_002173050.1|  molybdenum (Mo2+) cofactor biosynthesis e...  55.8    1e-06 
ref|YP_627524.1|  molybdenum cofactor biosynthesis protein C [...  55.8    1e-06 
ref|ZP_02150175.1|  molybdenum cofactor biosynthesis protein C...  55.8    1e-06
ref|ZP_01077698.1|  Molybdopterin cofactor biosynthesis  MoaC ...  55.8    1e-06
ref|ZP_03658783.1|  molybdenum cofactor biosynthesis protein C...  55.8    1e-06
ref|ZP_03584322.1|  molybdenum cofactor biosynthesis protein C...  55.8    1e-06
ref|ZP_03438370.1|  hypothetical protein HPB128_152g10 [Helico...  55.8    1e-06
ref|YP_002544557.1|  molybdenum cofactor biosynthesis protein ...  55.8    1e-06 
ref|ZP_00134037.1|  COG0315: Molybdenum cofactor biosynthesis ...  55.8    1e-06
ref|ZP_00367509.1|  molybdenum cofactor biosynthesis protein C...  55.8    1e-06
ref|ZP_04042129.1|  GTP cyclohydrolase subunit MoaC [Kytococcu...  55.8    1e-06
ref|NP_798473.1|  molybdenum cofactor biosynthesis protein C [...  55.8    1e-06 
ref|YP_732078.1|  molybdenum cofactor biosynthesis protein C [...  55.8    1e-06 
ref|ZP_01261741.1|  molybdenum cofactor biosynthesis protein C...  55.8    1e-06
ref|ZP_03880074.1|  GTP cyclohydrolase subunit MoaC [Haliangiu...  55.5    1e-06
ref|ZP_01987993.1|  molybdenum cofactor biosynthesis protein C...  55.5    1e-06
ref|ZP_04387159.1|  bifunctional molybdenum cofactor biosynthe...  55.5    1e-06
ref|ZP_03785648.1|  molybdenum cofactor biosynthesis protein C...  55.5    1e-06
ref|ZP_01084347.1|  Molybdopterin cofactor biosynthesis MoaC r...  55.5    1e-06
ref|ZP_01747173.1|  molybdenum cofactor biosynthesis protein C...  55.5    1e-06
ref|NP_539759.1|  molybdenum cofactor biosynthesis protein C [...  55.5    1e-06 
ref|YP_674200.1|  GTP cyclohydrolase subunit MoaC [Mesorhizobi...  55.5    1e-06 
ref|YP_002765786.1|  molybdenum cofactor biosynthesis bifuncti...  55.5    1e-06 
ref|YP_002589291.1|  molybdenum cofactor biosynthesis protein ...  55.5    1e-06 
ref|YP_579976.1|  molybdenum cofactor biosynthesis protein C [...  55.5    1e-06 
ref|ZP_04568809.1|  molybdenum cofactor biosynthesis protein C...  55.5    1e-06
ref|ZP_04468775.1|  GTP cyclohydrolase subunit MoaC [Thermanae...  55.5    1e-06
ref|ZP_01902297.1|  molybdenum cofactor biosynthesis protein C...  55.5    1e-06
ref|YP_002376301.1|  molybdenum cofactor biosynthesis protein ...  55.5    1e-06 
ref|ZP_01916488.1|  molybdenum cofactor biosynthesis protein C...  55.5    1e-06
ref|YP_002457893.1|  molybdenum cofactor biosynthesis protein ...  55.5    1e-06 
ref|YP_002650831.1|  putative molybdenum cofactor biosynthesis...  55.5    2e-06 
ref|YP_221848.1|  molybdenum cofactor biosynthesis protein C [...  55.5    2e-06 
ref|YP_352050.1|  molybdenum cofactor biosynthesis protein C [...  55.5    2e-06 
ref|YP_002093335.1|  Molybdopterin cofactor biosynthesis prote...  55.5    2e-06 
ref|YP_001817837.1|  molybdenum cofactor biosynthesis protein ...  55.5    2e-06 
ref|YP_001765949.1|  molybdenum cofactor biosynthesis protein ...  55.5    2e-06 
ref|ZP_03849254.1|  molybdenum (Mo2+) cofactor biosynthesis en...  55.5    2e-06
ref|ZP_03239800.1|  molybdenum cofactor biosynthesis protein C...  55.5    2e-06
ref|YP_370207.1|  molybdenum cofactor biosynthesis protein C [...  55.5    2e-06 
ref|YP_520198.1|  hypothetical protein DSY3965 [Desulfitobacte...  55.5    2e-06 
ref|YP_002266375.1|  molybdenum cofactor biosynthesis protein ...  55.5    2e-06 
ref|ZP_03906691.1|  GTP cyclohydrolase subunit MoaC [Denitrovi...  55.5    2e-06
ref|YP_001042594.1|  molybdenum cofactor biosynthesis protein ...  55.5    2e-06 
ref|YP_621901.1|  molybdenum cofactor biosynthesis protein C [...  55.5    2e-06 
ref|YP_002301437.1|  molybdenum cofactor biosynthesis protein ...  55.5    2e-06 
ref|NP_354675.1|  molybdenum cofactor biosynthesis protein C [...  55.5    2e-06 
ref|YP_002230116.1|  molybdenum cofactor biosynthesis protein ...  55.5    2e-06 
ref|ZP_01166526.1|  molybdenum cofactor biosynthesis protein C...  55.5    2e-06
ref|ZP_04497113.1|  GTP cyclohydrolase subunit MoaC [Sphaeroba...  55.5    2e-06
ref|YP_785355.1|  molybdenum cofactor biosynthesis protein C [...  55.5    2e-06 
ref|YP_445293.1|  molybdenum cofactor biosynthesis protein C [...  55.5    2e-06 
ref|YP_915928.1|  molybdenum cofactor biosynthesis protein C [...  55.5    2e-06 
ref|YP_002263274.1|  molybdenum cofactor biosynthesis protein ...  55.1    2e-06 
ref|NP_883432.1|  molybdenum cofactor biosynthesis protein [Bo...  55.1    2e-06 
ref|ZP_03729183.1|  molybdenum cofactor biosynthesis protein C...  55.1    2e-06
ref|ZP_04412592.1|  molybdenum cofactor biosynthesis protein C...  55.1    2e-06
ref|NP_207591.1|  molybdenum cofactor biosynthesis protein C [...  55.1    2e-06 
ref|YP_001370592.1|  molybdenum cofactor biosynthesis protein ...  55.1    2e-06 
ref|YP_430969.1|  GTP cyclohydrolase subunit MoaC [Moorella th...  55.1    2e-06 
ref|YP_002549851.1|  molybdenum cofactor biosynthesis protein ...  55.1    2e-06 
ref|YP_947346.1|  molybdenum cofactor biosynthesis protein C [...  55.1    2e-06 
ref|YP_001578852.1|  molybdenum cofactor biosynthesis protein ...  55.1    2e-06 
ref|ZP_01898259.1|  molybdenum cofactor biosynthesis protein C...  55.1    2e-06
ref|YP_001433924.1|  molybdenum cofactor biosynthesis protein ...  55.1    2e-06 
ref|ZP_01224636.1|  molybdenum cofactor biosynthesis protein C...  55.1    2e-06
ref|YP_323901.1|  molybdenum cofactor biosynthesis protein C [...  55.1    2e-06 
ref|NP_001052991.1|  Os04g0460500 [Oryza sativa (japonica cult...  55.1    2e-06 
ref|ZP_04404869.1|  molybdenum cofactor biosynthesis protein C...  55.1    2e-06
ref|NP_641436.1|  molybdenum cofactor biosynthesis protein C [...  55.1    2e-06 
ref|NP_487422.1|  molybdenum cofactor biosynthesis protein C [...  55.1    2e-06 
ref|ZP_01106921.1|  putative molybdopterin cofactor biosynthes...  55.1    2e-06
ref|XP_001393618.1|  hypothetical protein An09g03020 [Aspergil...  55.1    2e-06 
ref|ZP_01448531.1|  molybdenum cofactor biosynthesis protein C...  55.1    2e-06
ref|YP_384002.1|  GTP cyclohydrolase subunit MoaC [Geobacter m...  55.1    2e-06 
ref|ZP_03903808.1|  GTP cyclohydrolase subunit MoaC [Desulfoha...  55.1    2e-06
ref|YP_001513348.1|  molybdenum cofactor biosynthesis protein ...  55.1    2e-06 
ref|YP_603810.1|  molybdenum cofactor biosynthesis protein C [...  55.1    2e-06 
ref|ZP_04415041.1|  molybdenum cofactor biosynthesis protein C...  55.1    2e-06
emb|CAE01534.2|  OSJNBa0072F16.9 [Oryza sativa (japonica culti...  55.1    2e-06
ref|NP_627395.1|  molybdenum cofactor biosynthesis protein C [...  55.1    2e-06 
ref|YP_001171710.1|  molybdenum cofactor biosynthesis protein ...  54.7    2e-06 
ref|YP_002522288.1|  molybdenum cofactor biosynthesis protein ...  54.7    2e-06 
ref|NP_418834.1|  molybdenum cofactor biosynthesis protein C [...  54.7    2e-06 
ref|YP_001491149.1|  molybdenum cofactor biosynthesis protein ...  54.7    2e-06 
ref|YP_001856687.1|  molybdenum cofactor biosynthesis protein ...  54.7    2e-06 
ref|ZP_02196737.1|  molybdenum cofactor biosynthesis protein C...  54.7    2e-06
gb|EEC77405.1|  hypothetical protein OsI_16170 [Oryza sativa I...  54.7    3e-06
ref|ZP_02377953.1|  molybdenum cofactor biosynthesis protein C...  54.7    3e-06
ref|YP_204324.1|  molybdenum cofactor biosynthesis protein C [...  54.7    3e-06 
ref|NP_761882.1|  molybdenum cofactor biosynthesis protein C [...  54.7    3e-06 
ref|YP_002666712.1|  molybdenum cofactor biosynthesis protein ...  54.7    3e-06 
ref|NP_933993.1|  molybdenum cofactor biosynthesis protein C [...  54.7    3e-06 
ref|YP_988218.1|  molybdenum cofactor biosynthesis protein C [...  54.7    3e-06 
ref|ZP_04029737.1|  GTP cyclohydrolase subunit MoaC [Thermomon...  54.7    3e-06
ref|ZP_02139435.1|  molybdenum cofactor biosynthesis protein C...  54.7    3e-06
ref|YP_001405658.1|  molybdenum cofactor biosynthesis protein ...  54.7    3e-06 
ref|YP_001809251.1|  molybdenum cofactor biosynthesis protein ...  54.7    3e-06 
ref|YP_088214.1|  MoaC protein [Mannheimia succiniciproducens ...  54.7    3e-06 
ref|ZP_01057413.1|  molybdenum cofactor biosynthesis protein C...  54.7    3e-06
ref|YP_001290539.1|  molybdenum cofactor biosynthesis protein ...  54.7    3e-06 
ref|NP_859583.1|  molybdenum cofactor biosynthesis protein C [...  54.7    3e-06 
ref|ZP_02888686.1|  molybdenum cofactor biosynthesis protein C...  54.7    3e-06
ref|YP_002515389.1|  molybdenum cofactor biosynthesis protein ...  54.7    3e-06 
ref|YP_774575.1|  molybdenum cofactor biosynthesis protein C [...  54.3    3e-06 
ref|ZP_04501197.1|  GTP cyclohydrolase subunit MoaC [Sebaldell...  54.3    3e-06
ref|ZP_01034697.1|  molybdenum cofactor biosynthesis protein C...  54.3    3e-06
ref|ZP_01742213.1|  molybdenum cofactor biosynthesis protein C...  54.3    3e-06
ref|YP_943509.1|  molybdenum cofactor biosynthesis protein C [...  54.3    3e-06 
ref|XP_001940476.1|  molybdenum cofactor biosynthesis protein ...  54.3    3e-06 
ref|ZP_02908444.1|  molybdenum cofactor biosynthesis protein C...  54.3    3e-06
ref|YP_979472.1|  molybdenum cofactor biosynthesis protein C [...  54.3    3e-06 
ref|XP_002186251.1|  predicted protein [Phaeodactylum tricornu...  54.3    3e-06 
ref|YP_347879.1|  molybdopterin cofactor biosynthesis MoaC reg...  54.3    3e-06 
ref|ZP_01753617.1|  molybdenum cofactor biosynthesis protein C...  54.3    3e-06
emb|CAD47960.1|  molybdopterin cofactor synthesis protein moaC...  54.3    3e-06
ref|YP_467153.1|  GTP cyclohydrolase subunit MoaC [Anaeromyxob...  54.3    3e-06 
ref|NP_337953.1|  molybdenum cofactor biosynthesis protein C [...  54.3    3e-06 
ref|YP_001019259.1|  GTP cyclohydrolase subunit MoaC [Methylib...  54.3    3e-06 
ref|ZP_04532430.1|  GTP cyclohydrolase subunit MoaC [Brachybac...  54.3    3e-06
ref|ZP_03826661.1|  molybdenum cofactor biosynthesis protein C...  54.3    3e-06
ref|YP_002718126.1|  molybdenum cofactor biosynthesis protein ...  54.3    3e-06 
ref|ZP_01015112.1|  molybdenum cofactor biosynthesis protein C...  54.3    4e-06
ref|ZP_02153925.1|  molybdenum cofactor biosynthesis protein C...  54.3    4e-06
ref|YP_050906.1|  molybdenum cofactor biosynthesis protein C [...  54.3    4e-06 
ref|ZP_00371601.1|  molybdenum cofactor biosynthesis protein C...  54.3    4e-06
ref|YP_988214.1|  GTP cyclohydrolase subunit MoaC [Acidovorax ...  54.3    4e-06 
ref|YP_001805095.1|  molybdenum cofactor biosynthesis protein ...  54.3    4e-06 
ref|YP_002494479.1|  molybdenum cofactor biosynthesis protein ...  54.3    4e-06 
ref|ZP_02093893.1|  hypothetical protein PEPMIC_00648 [Peptost...  54.3    4e-06
ref|YP_001414439.1|  molybdenum cofactor biosynthesis protein ...  54.3    4e-06 
ref|YP_002136396.1|  molybdenum cofactor biosynthesis protein ...  54.3    4e-06 
ref|ZP_03859658.1|  GTP cyclohydrolase subunit MoaC [Kribbella...  54.3    4e-06
ref|YP_001102836.1|  molybdenum cofactor biosynthesis protein ...  54.3    4e-06 
ref|ZP_03945026.1|  molybdenum cofactor biosynthesis protein C...  53.9    4e-06
ref|YP_483117.1|  molybdenum cofactor biosynthesis protein C [...  53.9    4e-06 
ref|YP_830939.1|  molybdenum cofactor biosynthesis protein C [...  53.9    4e-06 
ref|ZP_03545900.1|  molybdenum cofactor biosynthesis protein C...  53.9    4e-06
ref|YP_167379.1|  molybdenum cofactor biosynthesis protein C [...  53.9    4e-06 
ref|ZP_02631896.1|  molybdenum cofactor biosynthesis protein C...  53.9    4e-06
ref|YP_001457576.1|  molybdenum cofactor biosynthesis protein ...  53.9    4e-06 
ref|YP_002097523.1|  Molybdopterin cofactor biosynthesis prote...  53.9    4e-06 
ref|YP_001088218.1|  molybdenum cofactor biosynthesis protein ...  53.9    4e-06 
ref|YP_001232268.1|  molybdenum cofactor biosynthesis protein ...  53.9    4e-06 
ref|XP_955789.1|  molybdenum cofactor biosynthesis protein 1 B...  53.9    4e-06 
ref|ZP_04045451.1|  GTP cyclohydrolase subunit MoaC [Kangiella...  53.9    4e-06
ref|YP_001681696.1|  molybdenum cofactor biosynthesis protein ...  53.9    4e-06 
ref|YP_002249068.1|  molybdenum cofactor biosynthesis protein ...  53.9    5e-06 
ref|ZP_04026473.1|  GTP cyclohydrolase subunit MoaC [Tsukamure...  53.9    5e-06
gb|EEH50516.1|  molybdenum cofactor biosynthesis protein 1 A [...  53.9    5e-06
gb|EEH38818.1|  molybdenum cofactor biosynthesis protein 1 A [...  53.9    5e-06
ref|ZP_01666980.1|  molybdenum cofactor biosynthesis protein C...  53.9    5e-06
ref|YP_744639.1|  molybdenum cofactor biosynthesis protein C [...  53.9    5e-06 
ref|ZP_03493834.1|  molybdenum cofactor biosynthesis protein C...  53.9    5e-06
ref|YP_263908.1|  GTP cyclohydrolase subunit MoaC [Psychrobact...  53.9    5e-06 
ref|ZP_04582905.1|  molybdenum cofactor biosynthesis protein C...  53.9    5e-06
ref|YP_001169285.1|  molybdenum cofactor biosynthesis protein ...  53.9    5e-06 
ref|ZP_04360581.1|  GTP cyclohydrolase subunit MoaC [Chitinoph...  53.9    5e-06
ref|YP_001481805.1|  molybdenum cofactor biosynthesis protein ...  53.9    5e-06 
ref|YP_001002842.1|  molybdenum cofactor biosynthesis protein ...  53.9    5e-06 
ref|YP_486412.1|  molybdenum cofactor biosynthesis protein C [...  53.9    5e-06 
ref|YP_449990.1|  molybdenum cofactor biosynthesis protein C [...  53.9    5e-06 
ref|NP_599464.1|  molybdenum cofactor biosynthesis protein C [...  53.9    5e-06 
ref|YP_002608684.1|  molybdenum cofactor biosynthesis protein ...  53.9    5e-06 
ref|YP_001397477.1|  molybdenum cofactor biosynthesis protein ...  53.5    5e-06 
ref|YP_999967.1|  molybdenum cofactor biosynthesis protein C [...  53.5    5e-06 
ref|ZP_01071883.1|  molybdenum cofactor biosynthesis protein C...  53.5    5e-06
ref|ZP_02179377.1|  molybdenum cofactor biosynthesis protein [...  53.5    5e-06
ref|ZP_01069565.1|  molybdenum cofactor biosynthesis protein M...  53.5    5e-06
ref|YP_178322.1|  molybdenum cofactor biosynthesis protein C [...  53.5    5e-06 
ref|YP_002500722.1|  molybdenum cofactor biosynthesis protein ...  53.5    5e-06 
ref|ZP_03794962.1|  molybdenum cofactor biosynthesis protein C...  53.5    5e-06
ref|NP_439817.1|  molybdenum cofactor biosynthesis protein C [...  53.5    5e-06 
ref|ZP_01810081.1|  molybdenum cofactor biosynthesis protein C...  53.5    5e-06
ref|YP_001843882.1|  molybdenum cofactor biosynthesis protein ...  53.5    5e-06 
ref|YP_107411.1|  molybdenum cofactor biosynthesis protein C [...  53.5    5e-06 
ref|ZP_03223285.1|  molybdenum cofactor biosynthesis protein C...  53.5    5e-06
ref|YP_001057873.1|  molybdenum cofactor biosynthesis protein ...  53.5    5e-06 
ref|NP_736796.1|  molybdenum cofactor biosynthesis protein C [...  53.5    5e-06 
ref|YP_332396.1|  molybdenum cofactor biosynthesis protein C [...  53.5    6e-06 
ref|ZP_01067816.1|  molybdenum cofactor biosynthesis protein M...  53.5    6e-06
ref|ZP_02454396.1|  molybdenum cofactor biosynthesis protein C...  53.5    6e-06
ref|NP_824848.1|  molybdenum cofactor biosynthesis protein C [...  53.5    6e-06 
ref|YP_199700.1|  molybdenum cofactor biosynthesis protein C [...  53.5    6e-06 
ref|YP_002881712.1|  molybdenum cofactor biosynthesis protein ...  53.5    6e-06 
ref|ZP_02488687.1|  molybdenum cofactor biosynthesis protein C...  53.5    6e-06
ref|YP_001137156.1|  molybdenum cofactor biosynthesis protein ...  53.5    6e-06 
ref|YP_002728701.1|  molybdenum cofactor biosynthesis bifuncti...  53.5    6e-06 
ref|ZP_02462468.1|  molybdenum cofactor biosynthesis protein C...  53.5    6e-06
ref|YP_699361.1|  molybdenum cofactor biosynthesis protein C [...  53.5    6e-06 
ref|ZP_01617027.1|  molybdenum cofactor biosynthesis protein C...  53.5    6e-06
ref|YP_722375.1|  molybdenum cofactor biosynthesis protein C [...  53.5    6e-06 
ref|ZP_02951784.1|  molybdenum cofactor biosynthesis protein C...  53.5    6e-06
ref|ZP_01547336.1|  molybdenum cofactor biosynthesis protein C...  53.5    6e-06
ref|YP_002711944.1|  molybdenum cofactor biosynthesis protein ...  53.5    6e-06 
ref|NP_562999.1|  molybdenum cofactor biosynthesis protein C [...  53.5    6e-06 
ref|YP_001409053.1|  molybdenum cofactor biosynthesis protein ...  53.5    6e-06 
ref|YP_683402.1|  molybdenum cofactor biosynthesis protein C [...  53.5    6e-06 
ref|ZP_01215876.1|  molybdenum cofactor biosynthesis protein C...  53.5    6e-06
ref|YP_346696.1|  molybdenum cofactor biosynthesis protein C [...  53.5    6e-06 
ref|YP_362838.1|  molybdenum cofactor biosynthesis protein C [...  53.5    6e-06 
sp|Q93KD0|MOAC_EUBAC  Molybdenum cofactor biosynthesis protein...  53.5    7e-06
ref|YP_001279129.1|  molybdenum cofactor biosynthesis protein ...  53.1    7e-06 
ref|YP_972986.1|  GTP cyclohydrolase subunit MoaC [Acidovorax ...  53.1    7e-06 
ref|ZP_00515470.1|  Molybdopterin cofactor biosynthesis protei...  53.1    7e-06
ref|YP_001908181.1|  Molybdopterin cofactor biosynthesis prote...  53.1    7e-06 
ref|YP_001223058.1|  putative molybdenum cofactor biosynthesis...  53.1    7e-06 
ref|YP_719242.1|  GTP cyclohydrolase subunit MoaC [Haemophilus...  53.1    7e-06 
ref|YP_002657137.1|  molybdenum cofactor biosynthesis protein ...  53.1    7e-06 
ref|YP_002150380.1|  molybdenum cofactor biosynthesis protein ...  53.1    8e-06 
ref|YP_002602201.1|  MoaC [Desulfobacterium autotrophicum HRM2...  53.1    8e-06 
ref|ZP_03841074.1|  molybdenum cofactor biosynthesis protein C...  53.1    8e-06
ref|ZP_02733946.1|  molybdenum cofactor biosynthesis protein C...  53.1    8e-06
ref|ZP_01793357.1|  molybdenum cofactor biosynthesis protein C...  53.1    8e-06
ref|ZP_01156895.1|  molybdenum cofactor biosynthesis protein C...  53.1    8e-06
ref|ZP_00157441.2|  COG0315: Molybdenum cofactor biosynthesis ...  53.1    8e-06
ref|YP_002505935.1|  molybdenum cofactor biosynthesis protein ...  53.1    8e-06 
emb|CAA49863.1|  moaC [Escherichia coli]                           53.1    8e-06
ref|ZP_01018185.1|  probable molybdenum cofactor biosynthesis ...  53.1    8e-06
ref|YP_001885362.1|  molybdenum cofactor biosynthesis protein ...  53.1    8e-06 
ref|YP_479043.1|  molybdenum cofactor biosynthesis protein C [...  53.1    8e-06 
ref|YP_001718018.1|  molybdenum cofactor biosynthesis protein ...  53.1    8e-06 
ref|YP_846725.1|  molybdenum cofactor biosynthesis protein C [...  53.1    8e-06 
ref|ZP_04421031.1|  GTP cyclohydrolase subunit MoaC [Sulfurosp...  53.1    8e-06
ref|YP_001784828.1|  molybdenum cofactor biosynthesis protein ...  53.1    8e-06 
ref|NP_385768.1|  molybdenum cofactor biosynthesis protein C [...  53.1    8e-06 
ref|XP_001908046.1|  unnamed protein product [Podospora anseri...  53.1    9e-06 
ref|YP_692997.1|  molybdenum cofactor biosynthesis protein C [...  53.1    9e-06 
ref|NP_791077.1|  molybdenum cofactor biosynthesis protein C [...  53.1    9e-06 
pdb|1EKR|A  Chain A, Moac Protein From E. Coli                     53.1    9e-06 
ref|XP_002333488.1|  predicted protein [Populus trichocarpa] >...  52.8    9e-06 
ref|ZP_00962559.1|  molybdenum cofactor biosynthesis protein C...  52.8    9e-06
ref|YP_002209383.1|  molybdenum cofactor biosynthesis protein ...  52.8    9e-06 
ref|ZP_00955058.1|  molybdenum cofactor biosynthesis protein C...  52.8    9e-06
ref|ZP_03070520.1|  molybdenum cofactor biosynthesis protein C...  52.8    9e-06
ref|NP_286546.1|  molybdenum cofactor biosynthesis protein C [...  52.8    9e-06 
ref|ZP_03395243.1|  molybdenum cofactor biosynthesis protein C...  52.8    9e-06
ref|YP_309746.1|  molybdenum cofactor biosynthesis protein C [...  52.8    9e-06 
ref|YP_001602183.1|  molybdenum cofactor biosynthesis protein ...  52.8    9e-06 
ref|YP_234161.1|  molybdenum cofactor biosynthesis protein C [...  52.8    9e-06 
ref|ZP_04469691.1|  GTP cyclohydrolase subunit MoaC [Streptosp...  52.8    9e-06
ref|ZP_01803592.1|  hypothetical protein CdifQ_04001979 [Clost...  52.8    9e-06
ref|ZP_03609516.1|  molybdenum cofactor biosynthesis protein C...  52.8    1e-05
ref|ZP_04561241.1|  molybdopterin biosynthesis protein [Citrob...  52.8    1e-05
ref|ZP_01614441.1|  molybdenum cofactor biosynthesis protein C...  52.8    1e-05
ref|ZP_03835967.1|  hypothetical protein CIT292_01791 [Citroba...  52.8    1e-05
ref|ZP_02551997.1|  molybdenum cofactor biosynthesis protein C...  52.8    1e-05
ref|YP_001327091.1|  molybdenum cofactor biosynthesis protein ...  52.8    1e-05 
ref|XP_639890.1|  hypothetical protein [Dictyostelium discoide...  52.8    1e-05 
ref|YP_002296364.1|  molybdenum cofactor biosynthesis protein ...  52.8    1e-05 
ref|NP_337719.1|  molybdenum cofactor biosynthesis protein C [...  52.8    1e-05 
ref|YP_929398.1|  molybdenum cofactor biosynthesis protein C [...  52.8    1e-05 
ref|YP_574128.1|  GTP cyclohydrolase subunit MoaC [Chromohalob...  52.8    1e-05 
ref|NP_001148907.1|  molybdopterin biosynthesis CNX3 protein [...  52.8    1e-05 
ref|YP_002129119.1|  molybdenum cofactor biosynthesis protein ...  52.8    1e-05 
ref|YP_002554811.1|  molybdenum cofactor biosynthesis protein ...  52.8    1e-05 
ref|ZP_03620213.1|  molybdenum cofactor biosynthesis protein C...  52.8    1e-05
ref|YP_001438642.1|  hypothetical protein ESA_02561 [Enterobac...  52.8    1e-05 
ref|YP_856128.1|  molybdenum cofactor biosynthesis protein C [...  52.8    1e-05 
ref|ZP_01061657.1|  bifunctional protein [Flavobacterium sp. M...  52.4    1e-05
ref|YP_002798330.1|  molybdenum cofactor biosynthesis protein ...  52.4    1e-05 
ref|YP_001419251.1|  molybdenum cofactor biosynthesis protein ...  52.4    1e-05 
gb|EEP60575.1|  molybdenum cofactor biosynthesis protein C/mol...  52.4    1e-05
ref|YP_454589.1|  molybdopterin biosynthesis protein C [Sodali...  52.4    1e-05 
ref|YP_001931915.1|  molybdenum cofactor biosynthesis protein ...  52.4    1e-05 
ref|ZP_02372840.1|  molybdenum cofactor biosynthesis protein C...  52.4    1e-05
gb|ACF82268.1|  unknown [Zea mays]                                 52.4    1e-05
ref|NP_719972.1|  molybdenum cofactor biosynthesis protein C [...  52.4    1e-05 
ref|YP_961649.1|  molybdenum cofactor biosynthesis protein C [...  52.4    1e-05 
ref|YP_001552728.1|  molybdenum cofactor biosynthesis protein ...  52.4    1e-05 
ref|ZP_03163063.1|  molybdenum cofactor biosynthesis protein C...  52.4    1e-05
ref|YP_258169.1|  molybdenum cofactor biosynthesis protein C [...  52.4    1e-05 
ref|ZP_01159887.1|  molybdenum cofactor biosynthesis protein C...  52.4    1e-05
ref|ZP_03281718.1|  hypothetical protein ENTCAN_01495 [Enterob...  52.4    1e-05
ref|ZP_02903423.1|  molybdenum cofactor biosynthesis protein C...  52.4    1e-05
ref|ZP_02655748.1|  molybdenum cofactor biosynthesis protein C...  52.4    1e-05
ref|YP_001453901.1|  molybdenum cofactor biosynthesis protein ...  52.4    1e-05 
ref|ZP_01234949.1|  molybdenum cofactor biosynthesis protein C...  52.4    1e-05
ref|YP_001176007.1|  molybdenum cofactor biosynthesis protein ...  52.4    1e-05 
ref|YP_561122.1|  molybdenum cofactor biosynthesis protein C [...  52.4    1e-05 
gb|ACN27895.1|  unknown [Zea mays]                                 52.4    1e-05
ref|NP_296291.1|  molybdenum cofactor biosynthesis protein C [...  52.4    1e-05 
ref|NP_785100.1|  molybdenum cofactor biosynthesis protein C [...  52.4    1e-05 
ref|NP_459782.1|  molybdenum cofactor biosynthesis protein C [...  52.4    1e-05 
ref|YP_002663705.1|  molybdenum cofactor biosynthesis protein ...  52.4    1e-05 
ref|ZP_02157130.1|  molybdenum cofactor biosynthesis protein C...  52.4    1e-05
ref|YP_002559550.1|  molybdenum cofactor biosynthesis protein ...  52.4    1e-05 
ref|NP_698147.1|  molybdenum cofactor biosynthesis protein C [...  52.4    1e-05 
ref|YP_748784.1|  molybdenum cofactor biosynthesis protein C [...  52.4    1e-05 
ref|YP_001533144.1|  molybdenum cofactor biosynthesis protein ...  52.4    1e-05 
ref|ZP_03026254.1|  molybdenum cofactor biosynthesis protein C...  52.4    1e-05
ref|YP_001334478.1|  molybdenum cofactor biosynthesis protein ...  52.4    1e-05 
ref|XP_001120646.1|  PREDICTED: similar to molybdenum cofactor...  52.4    1e-05 
ref|ZP_04038596.1|  GTP cyclohydrolase subunit MoaC [Meiotherm...  52.4    1e-05
ref|YP_145055.1|  molybdenum cofactor biosynthesis protein C [...  52.0    1e-05 
ref|ZP_03885110.1|  GTP cyclohydrolase subunit MoaC [Gordonia ...  52.0    2e-05
ref|ZP_04489290.1|  GTP cyclohydrolase subunit MoaC [Spirosoma...  52.0    2e-05
ref|YP_922004.1|  molybdenum cofactor biosynthesis protein C [...  52.0    2e-05 
ref|YP_849222.1|  molybdenum cofactor biosynthesis protein C [...  52.0    2e-05 
ref|ZP_04483607.1|  GTP cyclohydrolase subunit MoaC [Stackebra...  52.0    2e-05
gb|ACJ85696.1|  unknown [Medicago truncatula]                      52.0    2e-05
ref|ZP_01796654.1|  molybdenum cofactor biosynthesis protein C...  52.0    2e-05
ref|YP_002138163.1|  molybdenum cofactor biosynthesis protein ...  52.0    2e-05 
ref|YP_615885.1|  molybdenum cofactor biosynthesis protein C [...  52.0    2e-05 
ref|YP_001623855.1|  molybdenum cofactor biosynthesis protein ...  52.0    2e-05 
ref|YP_001477554.1|  molybdenum cofactor biosynthesis protein ...  52.0    2e-05 
ref|ZP_01736216.1|  molybdenum cofactor biosynthesis protein C...  52.0    2e-05
ref|YP_995196.1|  molybdenum cofactor biosynthesis protein C [...  52.0    2e-05 
ref|ZP_02044080.1|  hypothetical protein ACTODO_00937 [Actinom...  52.0    2e-05
ref|YP_001735526.1|  molybdenum cofactor biosynthesis protein ...  52.0    2e-05 
ref|NP_455345.1|  molybdenum cofactor biosynthesis protein C [...  52.0    2e-05 
ref|YP_001142531.1|  molybdenum cofactor biosynthesis protein ...  52.0    2e-05 
ref|YP_069726.1|  molybdenum cofactor biosynthesis protein C [...  52.0    2e-05 
ref|NP_102385.1|  molybdenum cofactor biosynthesis protein C [...  52.0    2e-05 
ref|YP_002179805.1|  molybdenum cofactor biosynthesis protein ...  52.0    2e-05 
ref|YP_013667.1|  molybdenum cofactor biosynthesis protein C [...  52.0    2e-05 
ref|ZP_01551419.1|  molybdenum cofactor biosynthesis protein C...  52.0    2e-05
ref|NP_245561.1|  molybdenum cofactor biosynthesis protein C [...  52.0    2e-05 
ref|ZP_01880679.1|  molybdenum cofactor biosynthesis protein C...  52.0    2e-05
ref|YP_001186534.1|  molybdenum cofactor biosynthesis protein ...  52.0    2e-05 
ref|ZP_01790189.1|  molybdenum cofactor biosynthesis protein C...  52.0    2e-05
ref|YP_865412.1|  GTP cyclohydrolase subunit MoaC [Magnetococc...  51.6    2e-05 
ref|NP_464571.1|  molybdenum cofactor biosynthesis protein C [...  51.6    2e-05 
ref|XP_316123.4|  AGAP006072-PA [Anopheles gambiae str. PEST] ...  51.6    2e-05 
ref|ZP_03352843.1|  molybdenum cofactor biosynthesis protein C...  51.6    2e-05
gb|ABS84671.1|  molybdopterin cofactor biosynthesis protein [T...  51.6    2e-05
ref|YP_249387.1|  molybdenum cofactor biosynthesis protein C [...  51.6    2e-05 
ref|ZP_03855603.1|  GTP cyclohydrolase subunit MoaC [Veillonel...  51.6    2e-05
gb|EEH09619.1|  molybdopterin cofactor biosynthetic protein [A...  51.6    2e-05
ref|YP_001721648.1|  molybdenum cofactor biosynthesis protein ...  51.6    2e-05 
ref|ZP_01115828.1|  MoaC protein [Reinekea sp. MED297] >gb|EAR...  51.6    2e-05
ref|YP_650979.1|  molybdenum cofactor biosynthesis protein C [...  51.6    2e-05 
ref|ZP_02354624.1|  molybdenum cofactor biosynthesis protein C...  51.6    2e-05
ref|YP_569959.1|  molybdenum cofactor biosynthesis protein C [...  51.6    2e-05 
ref|ZP_02634411.1|  molybdenum cofactor biosynthesis protein C...  51.6    2e-05
emb|CAL52649.1|  molybdopterin biosynthesis CNX3 protein / mol...  51.6    2e-05
ref|ZP_00832241.1|  COG0315: Molybdenum cofactor biosynthesis ...  51.6    2e-05
ref|ZP_03371713.1|  molybdenum cofactor biosynthesis protein C...  51.6    2e-05
ref|NP_670321.1|  molybdenum cofactor biosynthesis protein C [...  51.6    2e-05 
ref|ZP_03741140.1|  molybdenum cofactor biosynthesis protein C...  51.6    2e-05
ref|YP_002731333.1|  molybdenum cofactor biosynthesis bifuncti...  51.6    2e-05 
ref|XP_002067921.1|  GK11286 [Drosophila willistoni] >gb|EDW78...  51.6    2e-05 
ref|ZP_01693183.1|  molybdenum cofactor biosynthesis protein C...  51.6    2e-05
ref|YP_441209.1|  molybdenum cofactor biosynthesis protein C [...  51.6    2e-05 
ref|NP_788494.1|  Mocs1, isoform C [Drosophila melanogaster] >...  51.6    2e-05 
ref|YP_001213159.1|  molybdenum cofactor biosynthesis enzyme [...  51.6    2e-05 
ref|YP_760263.1|  molybdenum cofactor biosynthesis protein C [...  51.6    2e-05 
ref|ZP_00821411.1|  COG0315: Molybdenum cofactor biosynthesis ...  51.6    2e-05
ref|ZP_00824675.1|  COG0315: Molybdenum cofactor biosynthesis ...  51.6    2e-05
ref|ZP_04052663.1|  GTP cyclohydrolase subunit MoaC [Alicyclob...  51.6    2e-05
ref|ZP_02864687.1|  molybdenum cofactor biosynthesis protein C...  51.6    2e-05
ref|YP_005405.1|  molybdenum cofactor biosynthesis protein C [...  51.6    2e-05 
ref|YP_001269737.1|  molybdenum cofactor biosynthesis protein ...  51.6    2e-05 
ref|ZP_01219683.1|  molybdenum cofactor biosynthesis protein C...  51.6    2e-05
ref|YP_002194460.1|  molybdenum cofactor biosynthesis protein ...  51.6    2e-05 
ref|XP_001542005.1|  molybdenum cofactor biosynthesis protein ...  51.6    2e-05 
gb|AAL87446.1|  molybdenum cofactor synthesis/low xanthine deh...  51.6    2e-05
ref|ZP_03746662.1|  hypothetical protein NEIMUCOT_00633 [Neiss...  51.6    3e-05
ref|XP_002047810.1|  GJ13646 [Drosophila virilis] >gb|EDW70152...  51.6    3e-05 
ref|YP_129338.1|  molybdenum cofactor biosynthesis protein C [...  51.6    3e-05 
ref|NP_470375.1|  molybdenum cofactor biosynthesis protein C [...  51.6    3e-05 
ref|ZP_04344166.1|  GTP cyclohydrolase subunit MoaC [Desulfomi...  51.2    3e-05
ref|ZP_03496939.1|  molybdenum cofactor biosynthesis protein C...  51.2    3e-05
ref|ZP_00829468.1|  COG0315: Molybdenum cofactor biosynthesis ...  51.2    3e-05
ref|YP_001825810.1|  molybdenum cofactor biosynthesis protein ...  51.2    3e-05 
ref|YP_002350539.1|  molybdenum cofactor biosynthesis protein ...  51.2    3e-05 
ref|YP_001346575.1|  molybdenum cofactor biosynthesis protein ...  51.2    3e-05 
ref|NP_252607.1|  molybdenum cofactor biosynthesis protein C [...  51.2    3e-05 
ref|YP_273390.1|  molybdenum cofactor biosynthesis protein C [...  51.2    3e-05 
ref|NP_788496.1|  Mocs1, isoform B [Drosophila melanogaster] >...  51.2    3e-05 
ref|YP_358167.1|  molybdenum cofactor biosynthesis protein C [...  51.2    3e-05 
ref|ZP_03701892.1|  molybdenum cofactor synthesis domain prote...  51.2    3e-05
ref|YP_001670779.1|  molybdenum cofactor biosynthesis protein ...  51.2    3e-05 
ref|ZP_01047939.1|  molybdenum cofactor biosynthesis protein C...  51.2    3e-05
ref|YP_002825983.1|  molybdenum cofactor biosynthesis protein ...  51.2    3e-05 
ref|YP_001661170.1|  molybdenum cofactor biosynthesis protein ...  51.2    3e-05 
gb|AAT50105.1|  PA3918 [synthetic construct]                       51.2    3e-05
ref|XP_001972336.1|  GG15475 [Drosophila erecta] >gb|EDV51362....  51.2    3e-05 
ref|ZP_04579258.1|  molybdenum cofactor biosynthesis protein C...  51.2    3e-05
ref|YP_190884.1|  molybdenum cofactor biosynthesis protein C [...  51.2    3e-05 
ref|YP_001476130.1|  molybdenum cofactor biosynthesis protein ...  51.2    3e-05 
ref|YP_002289284.1|  molybdenum cofactor biosynthesis protein ...  51.2    3e-05 
ref|NP_743452.1|  molybdenum cofactor biosynthesis protein C [...  51.2    3e-05 
ref|ZP_03857417.1|  GTP cyclohydrolase subunit MoaC [Thermobac...  50.8    3e-05
ref|YP_001344963.1|  molybdenum cofactor biosynthesis protein ...  50.8    3e-05 
emb|CAO87497.1|  moaC [Microcystis aeruginosa PCC 7806]            50.8    3e-05
ref|YP_002761738.1|  molybdenum cofactor biosynthesis protein ...  50.8    3e-05 
ref|YP_001357164.1|  molybdenum cofactor biosynthesis protein ...  50.8    3e-05 
ref|YP_001763135.1|  molybdenum cofactor biosynthesis protein ...  50.8    3e-05 
ref|YP_002537085.1|  molybdenum cofactor biosynthesis protein ...  50.8    4e-05 
ref|YP_001995778.1|  molybdenum cofactor biosynthesis protein ...  50.8    4e-05 
ref|XP_001591497.1|  hypothetical protein SS1G_06943 [Scleroti...  50.8    4e-05 
ref|YP_002239579.1|  molybdenum cofactor biosynthesis protein ...  50.8    4e-05 
ref|ZP_02189587.1|  Molybdenum cofactor biosynthesis enzyme [a...  50.8    4e-05
ref|YP_001747773.1|  molybdenum cofactor biosynthesis protein ...  50.8    4e-05 
ref|YP_001092220.1|  molybdenum cofactor biosynthesis protein ...  50.8    4e-05 
ref|ZP_01789081.1|  molybdenum cofactor biosynthesis protein C...  50.8    4e-05
ref|YP_528080.1|  GTP cyclohydrolase subunit MoaC [Saccharopha...  50.8    4e-05 
ref|ZP_00154573.2|  COG0315: Molybdenum cofactor biosynthesis ...  50.8    4e-05
ref|ZP_04035378.1|  GTP cyclohydrolase subunit MoaC [Meiotherm...  50.8    4e-05
ref|ZP_00996584.1|  molybdenum cofactor biosynthesis protein C...  50.8    4e-05
ref|ZP_01852430.1|  hypothetical protein PM8797T_05170 [Planct...  50.8    4e-05
ref|YP_001007086.1|  molybdenum cofactor biosynthesis protein ...  50.8    4e-05 
ref|ZP_03342204.1|  molybdenum cofactor biosynthesis protein C...  50.8    4e-05
gb|ACD50092.1|  molybdenum cofactor biosynthesis protein [uncu...  50.8    4e-05
ref|ZP_03316125.1|  hypothetical protein PROVRUST_02953 [Provi...  50.8    4e-05
sp|O31227.1|MOAC_ARTNI  RecName: Full=Molybdenum cofactor bios...  50.8    4e-05
ref|YP_002199054.1|  molybdenum cofactor biosynthesis protein ...  50.8    4e-05 
ref|XP_002030056.1|  GM25247 [Drosophila sechellia] >gb|EDW410...  50.8    4e-05 
ref|ZP_03735731.1|  molybdenum cofactor biosynthesis protein C...  50.8    4e-05
ref|YP_001240426.1|  GTP cyclohydrolase subunit MoaC [Bradyrhi...  50.8    4e-05 
ref|ZP_01882309.1|  bifunctional molybdenum cofactor biosynthe...  50.8    4e-05
ref|ZP_02959710.1|  hypothetical protein PROSTU_01601 [Provide...  50.4    4e-05
ref|ZP_03320293.1|  hypothetical protein PROVALCAL_03247 [Prov...  50.4    4e-05
ref|ZP_03639915.1|  hypothetical protein PROVRETT_03010 [Provi...  50.4    5e-05
ref|YP_001698950.1|  molybdenum cofactor biosynthesis protein ...  50.4    5e-05 
ref|XP_387076.1|  hypothetical protein FG06900.1 [Gibberella z...  50.4    5e-05 
ref|XP_002084443.1|  GD14281 [Drosophila simulans] >gb|EDX1002...  50.4    5e-05 
ref|XP_002094361.1|  GE21784 [Drosophila yakuba] >gb|EDW94073....  50.4    5e-05 
ref|ZP_03714337.1|  hypothetical protein EIKCOROL_02037 [Eiken...  50.4    5e-05
ref|YP_001772143.1|  molybdenum cofactor biosynthesis protein ...  50.4    5e-05 
ref|NP_765402.1|  molybdenum cofactor biosynthesis protein C [...  50.4    5e-05 
ref|YP_001992214.1|  molybdenum cofactor biosynthesis protein ...  50.4    5e-05 
ref|YP_001561892.1|  molybdenum cofactor biosynthesis protein ...  50.4    5e-05 
ref|NP_948233.1|  molybdenum cofactor biosynthesis protein C [...  50.4    5e-05 
ref|ZP_03912842.1|  GTP cyclohydrolase subunit MoaC [Xylanimon...  50.4    5e-05
ref|YP_002870655.1|  molybdenum cofactor biosynthesis protein ...  50.4    5e-05 
ref|XP_001984616.1|  GH14931 [Drosophila grimshawi] >gb|EDV969...  50.4    5e-05 
ref|NP_579583.1|  putative molybdenum cofactor biosynthesis pr...  50.4    5e-05 
ref|ZP_01311616.1|  molybdenum cofactor biosynthesis protein C...  50.4    6e-05
ref|ZP_03426482.1|  molybdenum cofactor biosynthesis protein C...  50.4    6e-05
ref|ZP_03538229.1|  molybdenum cofactor biosynthesis protein C...  50.1    6e-05
ref|YP_002436710.1|  molybdenum cofactor biosynthesis protein ...  50.1    6e-05 
ref|YP_390432.1|  molybdenum cofactor biosynthesis protein C [...  50.1    6e-05 
ref|YP_001854445.1|  molybdenum cofactor biosynthesis protein ...  50.1    6e-05 
ref|YP_002433290.1|  molybdenum cofactor biosynthesis protein ...  50.1    6e-05 
ref|YP_001547618.1|  molybdenum cofactor biosynthesis protein ...  50.1    6e-05 
ref|ZP_03072721.1|  molybdenum cofactor biosynthesis protein C...  50.1    6e-05
ref|YP_001206088.1|  molybdenum cofactor biosynthesis protein ...  50.1    6e-05 
ref|YP_001571140.1|  molybdenum cofactor biosynthesis protein ...  50.1    7e-05 
ref|XP_002293208.1|  predicted protein [Thalassiosira pseudona...  50.1    7e-05 
ref|ZP_01308238.1|  molybdenum cofactor biosynthesis protein C...  50.1    7e-05
ref|YP_002593825.1|  molybdenum cofactor biosynthesis protein ...  49.7    7e-05 
ref|YP_002754917.1|  molybdenum cofactor biosynthesis protein ...  49.7    8e-05 
ref|YP_002018211.1|  molybdenum cofactor biosynthesis protein ...  49.7    8e-05 
ref|YP_379370.1|  bifunctional molybdenum cofactor biosynthesi...  49.7    8e-05 
ref|YP_001357387.1|  molybdenum cofactor biosynthesis protein ...  49.7    8e-05 
ref|ZP_01625290.1|  molybdenum cofactor biosynthesis protein C...  49.7    8e-05
ref|YP_002692903.1|  molybdenum cofactor biosynthesis protein ...  49.7    9e-05 
ref|YP_609995.1|  molybdenum cofactor biosynthesis protein C [...  49.7    9e-05 
pdb|1EKS|A  Chain A, Asp128ala Variant Of Moac Protein From E....  49.7    9e-05 
ref|ZP_01466015.1|  molybdenum cofactor biosynthesis protein C...  49.7    9e-05
ref|ZP_03897870.1|  GTP cyclohydrolase subunit MoaC [Dyadobact...  49.7    9e-05
ref|XP_001848384.1|  molybdopterin cofactor synthesis protein ...  49.7    9e-05 
ref|XP_001657654.1|  molybdopterin cofactor synthesis protein ...  49.7    9e-05 
ref|YP_002186251.1|  molybdenum cofactor biosynthesis protein ...  49.7    1e-04 
ref|ZP_03568685.1|  molybdenum cofactor biosynthesis protein C...  49.3    1e-04
ref|YP_577007.1|  molybdenum cofactor biosynthesis protein C [...  49.3    1e-04 
ref|ZP_04380059.1|  GTP cyclohydrolase subunit MoaC [Acidimicr...  49.3    1e-04
gb|AAB39008.1|  molybdopterin cofactor biosynthesis enzyme [Br...  49.3    1e-04
ref|YP_001129739.1|  bifunctional molybdenum cofactor biosynth...  49.3    1e-04 
ref|YP_001998949.1|  molybdenum cofactor biosynthesis protein ...  49.3    1e-04 
ref|XP_001243611.1|  hypothetical protein CIMG_03052 [Coccidio...  49.3    1e-04 
gb|ACO68595.1|  molybdopterin biosynthesis protein CNX3 [Micro...  49.3    1e-04
ref|YP_318451.1|  molybdenum cofactor biosynthesis protein C [...  49.3    1e-04 
ref|ZP_04059535.1|  molybdenum cofactor biosynthesis protein C...  49.3    1e-04
ref|XP_001229676.1|  hypothetical protein CHGG_03160 [Chaetomi...  49.3    1e-04 
ref|ZP_01724498.1|  molybdenum cofactor biosynthesis protein C...  49.3    1e-04
ref|YP_394529.1|  molybdenum cofactor biosynthesis protein C [...  48.9    1e-04 
ref|YP_251385.1|  molybdenum cofactor biosynthesis protein [Co...  48.9    1e-04 
ref|YP_822682.1|  GTP cyclohydrolase subunit MoaC [Solibacter ...  48.9    1e-04 
ref|XP_002134983.1|  GA23788 [Drosophila pseudoobscura pseudoo...  48.9    1e-04 
ref|XP_001957592.1|  GF20122 [Drosophila ananassae] >gb|EDV403...  48.9    1e-04 
ref|YP_532335.1|  molybdenum cofactor biosynthesis protein C [...  48.9    1e-04 
ref|ZP_04365536.1|  GTP cyclohydrolase subunit MoaC [Cellulomo...  48.9    2e-04
ref|XP_002028286.1|  GL16744 [Drosophila persimilis] >gb|EDW39...  48.9    2e-04 
ref|YP_002572718.1|  molybdenum cofactor biosynthesis protein ...  48.5    2e-04 
ref|YP_374081.1|  bifunctional molybdenum cofactor biosynthesi...  48.5    2e-04 
ref|ZP_01622652.1|  molybdenum cofactor biosynthesis protein C...  48.5    2e-04
ref|NP_771451.1|  molybdenum cofactor biosynthesis protein C [...  48.5    2e-04 
ref|YP_593721.1|  GTP cyclohydrolase subunit MoaC [Acidobacter...  48.5    2e-04 
ref|YP_076730.1|  molybdenum cofactor biosynthesis protein C [...  48.5    2e-04 
ref|XP_783948.2|  PREDICTED: similar to MGC84142 protein [Stro...  48.5    2e-04 
ref|YP_303928.1|  putative molybdenum cofactor biosynthesis pr...  48.5    2e-04 
ref|YP_001234361.1|  molybdenum cofactor biosynthesis protein ...  48.1    2e-04 
ref|ZP_02849346.1|  molybdenum cofactor biosynthesis protein C...  48.1    3e-04
ref|ZP_02927347.1|  molybdenum cofactor biosynthesis protein C...  48.1    3e-04
gb|EEB14987.1|  molybdopterin cofactor synthesis protein A, pu...  48.1    3e-04
ref|YP_001196955.1|  bifunctional molybdenum cofactor biosynth...  48.1    3e-04 
ref|YP_460880.1|  molybdenum cofactor biosynthesis protein C [...  48.1    3e-04 
ref|XP_002117380.1|  hypothetical protein TRIADDRAFT_61388 [Tr...  48.1    3e-04 
ref|YP_002016776.1|  molybdenum cofactor biosynthesis protein ...  48.1    3e-04 
ref|ZP_02192629.1|  molybdenum cofactor biosynthesis protein C...  47.8    3e-04
ref|ZP_04335109.1|  GTP cyclohydrolase subunit MoaC [Nocardiop...  47.8    3e-04
ref|YP_182767.1|  putative molybdenum cofactor biosynthesis pr...  47.8    3e-04 
ref|ZP_04196790.1|  Molybdenum cofactor biosynthesis protein C...  47.8    3e-04
ref|NP_147886.2|  putative molybdenum cofactor biosynthesis pr...  47.8    3e-04 
ref|YP_288436.1|  molybdenum cofactor biosynthesis protein C [...  47.8    3e-04 
ref|NP_126061.1|  putative molybdenum cofactor biosynthesis pr...  47.8    3e-04 
ref|YP_644740.1|  GTP cyclohydrolase subunit MoaC [Rubrobacter...  47.8    3e-04 
ref|YP_260829.1|  molybdenum cofactor biosynthesis protein C [...  47.8    3e-04 
ref|YP_386745.1|  GTP cyclohydrolase subunit MoaC [Desulfovibr...  47.8    4e-04 
ref|YP_001944311.1|  molybdenum cofactor biosynthesis protein ...  47.4    4e-04 
ref|YP_001179783.1|  molybdenum cofactor biosynthesis protein ...  47.4    4e-04 
ref|ZP_03391928.1|  bifunctional molybdenum cofactor biosynthe...  47.4    4e-04
ref|ZP_03908936.1|  GTP cyclohydrolase subunit MoaC [Atopobium...  47.4    4e-04
ref|ZP_03130437.1|  molybdenum cofactor biosynthesis protein C...  47.4    4e-04
ref|ZP_04368839.1|  GTP cyclohydrolase subunit MoaC [Catenulis...  47.4    4e-04
ref|YP_860503.1|  bifunctional molybdenum cofactor biosynthesi...  47.4    4e-04 
ref|XP_756222.1|  hypothetical protein UM00075.1 [Ustilago may...  47.4    5e-04 
ref|YP_891351.1|  molybdenum cofactor biosynthesis protein C [...  47.0    5e-04 
emb|CAJ71648.1|  Strongly similar to molybdenum cofactor biosy...  47.0    5e-04
ref|NP_143646.1|  putative molybdenum cofactor biosynthesis pr...  47.0    5e-04 
ref|XP_001667242.1|  Hypothetical protein CBG16084 [Caenorhabd...  47.0    5e-04 
ref|XP_002167227.1|  PREDICTED: similar to predicted protein [...  46.6    7e-04 
ref|YP_002583725.1|  molybdenum cofactor biosynthesis protein ...  46.6    7e-04 
ref|YP_002307098.1|  molybdenum cofactor biosynthesis protein ...  46.6    7e-04 
ref|ZP_01718559.1|  bifunctional protein [Algoriphagus sp. PR1...  46.6    7e-04
ref|ZP_03852763.1|  bifunctional molybdenum cofactor biosynthe...  46.6    7e-04
ref|XP_001952088.1|  PREDICTED: similar to Mocs1 CG33048-PC [A...  46.6    7e-04 
ref|YP_002886287.1|  molybdenum cofactor biosynthesis protein ...  46.6    8e-04 
ref|NP_509612.2|  hypothetical protein F49E2.1 [Caenorhabditis...  46.6    8e-04 
ref|NP_938884.1|  molybdenum cofactor biosynthesis protein [Co...  46.2    8e-04 
ref|NP_928795.1|  molybdenum cofactor biosynthesis protein C [...  46.2    9e-04 
ref|ZP_01119755.1|  molybdenum cofactor biosynthesis protein C...  46.2    9e-04
gb|EEE24270.1|  molybdopterin cofactor synthesis protein A, pu...  46.2    0.001
ref|YP_001030779.1|  GTP cyclohydrolase subunit MoaC [Methanoc...  46.2    0.001 
ref|YP_630194.1|  molybdenum cofactor biosynthesis protein C [...  46.2    0.001 
ref|ZP_04482135.1|  GTP cyclohydrolase subunit MoaC [Stackebra...  46.2    0.001
ref|YP_400302.1|  bifunctional molybdenum cofactor biosynthesi...  46.2    0.001 
sp|Q56208|MOACB_SYNP7  Molybdenum cofactor biosynthesis bifunc...  45.8    0.001
ref|ZP_03922263.1|  molybdenum (Mo2+) cofactor biosynthesis en...  45.8    0.001
ref|ZP_03628658.1|  molybdenum cofactor biosynthesis protein C...  45.8    0.001
ref|ZP_04177550.1|  Molybdenum cofactor biosynthesis protein C...  45.8    0.001
ref|NP_867673.1|  molybdenum cofactor biosynthesis protein C [...  45.8    0.001 
ref|ZP_03927902.1|  molybdenum (Mo2+) cofactor biosynthesis en...  45.8    0.001
ref|NP_634230.1|  putative molybdenum cofactor biosynthesis pr...  45.8    0.001 
ref|ZP_04294364.1|  Molybdenum cofactor biosynthesis protein C...  45.4    0.001
ref|YP_300729.1|  molybdenum cofactor biosynthesis protein C [...  45.4    0.002 
gb|AAB87524.1|  molybdenum cofactor biosynthesis protein C [Ho...  45.4    0.002 
ref|YP_001377671.1|  molybdenum cofactor biosynthesis protein ...  45.4    0.002 
ref|YP_002139082.1|  molybdenum cofactor biosynthesis protein ...  45.4    0.002 
emb|CAA11898.1|  MOCS1B protein [Homo sapiens]                     45.4    0.002 
ref|XP_001696086.1|  molybdenum cofactor synthesis-step 1 prot...  45.1    0.002 
ref|XP_001602493.1|  PREDICTED: similar to CG33048-PC [Nasonia...  45.1    0.002 
ref|ZP_03931738.1|  molybdenum cofactor biosynthesis protein [...  45.1    0.002
sp|Q7UP45|MOAC_RHOBA  Molybdenum cofactor biosynthesis protein C   45.1    0.002
ref|YP_912881.1|  bifunctional molybdenum cofactor biosynthesi...  45.1    0.002 
ref|ZP_02478522.1|  molybdopterin synthase small subunit [Haem...  45.1    0.002
ref|YP_002583407.1|  molybdenum cofactor biosynthesis protein ...  45.1    0.002 
ref|ZP_03024745.1|  molybdenum cofactor biosynthesis protein C...  45.1    0.002
ref|YP_001938711.1|  Molybdenum cofactor biosynthesis enzyme [...  45.1    0.002 
ref|YP_170978.1|  bifunctional molybdenum cofactor biosynthesi...  45.1    0.002 
ref|YP_871929.1|  GTP cyclohydrolase subunit MoaC [Acidothermu...  45.1    0.002 
ref|YP_002481907.1|  molybdenum cofactor biosynthesis protein ...  44.7    0.002 
ref|ZP_01173065.1|  molybdenum cofactor biosynthesis protein C...  44.7    0.003
ref|YP_023839.1|  molybdenum cofactor biosynthesis protein C [...  44.7    0.003 
ref|ZP_03933902.1|  molybdenum cofactor biosynthesis protein [...  44.7    0.003
gb|EEA99571.1|  molybdenum cofactor biosynthesis protein c, pu...  44.3    0.004
ref|XP_001873409.1|  predicted protein [Laccaria bicolor S238N...  44.3    0.004 
ref|ZP_04164690.1|  Molybdenum cofactor biosynthesis protein C...  44.3    0.004
ref|YP_002580100.1|  molybdenum cofactor biosynthesis protein ...  43.9    0.004 
ref|ZP_03388478.1|  molybdenum cofactor biosynthesis protein C...  43.9    0.004
ref|ZP_02170078.1|  Molybdenum cofactor biosynthesis enzyme-li...  43.9    0.004
gb|EDM18954.1|  molybdenum cofactor synthesis 1 (predicted), i...  43.9    0.004 
dbj|BAG51799.1|  unnamed protein product [Homo sapiens]            43.9    0.005 
emb|CAI20011.1|  molybdenum cofactor synthesis 1 [Homo sapiens]    43.9    0.005 
emb|CAI20007.1|  molybdenum cofactor synthesis 1 [Homo sapiens]    43.9    0.005 
gb|EAX03999.1|  molybdenum cofactor synthesis 1, isoform CRA_b...  43.9    0.005 
ref|NP_620306.2|  molybdenum cofactor synthesis-step 1 protein...  43.9    0.005 
ref|NP_005933.2|  molybdenum cofactor synthesis-step 1 protein...  43.9    0.005 
ref|XP_527381.2|  PREDICTED: molybdenum cofactor synthesis-ste...  43.9    0.005 
ref|XP_001173942.1|  PREDICTED: molybdenum cofactor synthesis-...  43.9    0.005 
ref|XP_001173946.1|  PREDICTED: molybdenum cofactor synthesis-...  43.9    0.005 
ref|XP_001173932.1|  PREDICTED: molybdenum cofactor synthesis-...  43.9    0.005 
ref|XP_001173937.1|  PREDICTED: molybdenum cofactor synthesis-...  43.9    0.005 
sp|Q9NZB8.3|MOCS1_HUMAN  RecName: Full=Molybdenum cofactor bio...  43.9    0.005 
gb|AAH27444.1|  Molybdenum cofactor synthesis 1 [Mus musculus]...  43.9    0.005 
ref|YP_001363414.1|  molybdenum cofactor biosynthesis protein ...  43.9    0.005 
ref|ZP_03711988.1|  hypothetical protein CORMATOL_02841 [Coryn...  43.9    0.005
gb|AAI72067.1|  Unknown (protein for IMAGE:9054353) [Mus muscu...  43.5    0.005 
gb|AAI47413.1|  Mocs1 protein [Mus musculus]                       43.5    0.005 
ref|NP_064426.2|  molybdenum cofactor synthesis 1 isoform 1 [M...  43.5    0.005 
ref|NP_616109.1|  putative molybdenum cofactor biosynthesis pr...  43.5    0.005 
ref|ZP_01002955.1|  molybdenum cofactor biosynthesis protein C...  43.5    0.006
ref|YP_002578009.1|  molybdenum cofactor biosynthesis protein ...  43.5    0.006 
ref|YP_002578447.1|  molybdenum cofactor biosynthesis protein ...  43.5    0.006 
ref|XP_001379493.1|  PREDICTED: similar to Molybdenum cofactor...  43.5    0.006 
ref|YP_001737470.1|  molybdenum cofactor biosynthesis protein ...  43.5    0.006 
ref|YP_002634853.1|  Molybdenum cofactor biosynthesis protein ...  43.5    0.007 
ref|YP_252693.1|  molybdenum cofactor biosynthesis protein C [...  43.1    0.007 
ref|NP_275948.1|  putative molybdenum cofactor biosynthesis pr...  43.1    0.008 
ref|ZP_03612333.1|  molybdenum cofactor biosynthesis protein C...  42.7    0.009
ref|YP_582633.1|  molybdenum cofactor biosynthesis-like protei...  42.7    0.009 
ref|ZP_03972648.1|  molybdenum (Mo2+) cofactor biosynthesis en...  42.7    0.010
ref|YP_001376602.1|  molybdenum cofactor biosynthesis protein ...  42.7    0.011 
ref|ZP_03918273.1|  molybdenum (Mo2+) cofactor biosynthesis en...  42.7    0.011
ref|ZP_01877176.1|  molybdenum cofactor biosynthesis protein C...  42.4    0.012
ref|YP_002314208.1|  Molybdopterin cofactor biosynthesis prote...  42.4    0.014 
ref|YP_187074.1|  molybdenum cofactor biosynthesis protein C [...  42.4    0.014 
ref|NP_647009.1|  molybdenum cofactor biosynthesis protein C [...  42.4    0.015 
ref|YP_417603.1|  molybdenum cofactor biosynthesis protein C [...  42.4    0.015 
ref|NP_372798.1|  molybdenum cofactor biosynthesis protein C [...  42.4    0.015 
ref|YP_002834591.1|  molybdenum cofactor biosynthesis protein ...  42.4    0.015 
ref|NP_926324.1|  molybdenum cofactor biosynthesis protein C [...  42.0    0.016 
ref|YP_001124345.1|  molybdenum cofactor biosynthesis protein ...  42.0    0.016 
ref|YP_041713.1|  molybdenum cofactor biosynthesis protein C [...  42.0    0.016 
ref|YP_055209.1|  molybdenum cofactor biosynthesis protein [Pr...  42.0    0.017 
ref|XP_419475.2|  PREDICTED: similar to molybdenum cofactor sy...  42.0    0.018 
ref|YP_001435785.1|  molybdenum cofactor biosynthesis protein ...  42.0    0.019 
ref|YP_001404985.1|  molybdenum cofactor biosynthesis protein ...  41.6    0.022 
ref|XP_001829207.1|  hypothetical protein CC1G_06544 [Coprinop...  41.6    0.023 
ref|YP_001047591.1|  molybdenum cofactor biosynthesis protein ...  41.6    0.024 
ref|ZP_04432571.1|  molybdenum cofactor biosynthesis protein C...  41.6    0.025
ref|YP_001960744.1|  molybdenum cofactor biosynthesis protein ...  41.2    0.028 
ref|NP_393970.1|  putative molybdenum cofactor biosynthesis pr...  41.2    0.028 
ref|YP_002479089.1|  molybdenum cofactor biosynthesis protein ...  41.2    0.029 
ref|NP_662217.1|  bifunctional molybdenum cofactor biosynthesi...  41.2    0.031 
ref|NP_070975.1|  putative molybdenum cofactor biosynthesis pr...  41.2    0.032 
ref|NP_111268.2|  putative molybdenum cofactor biosynthesis pr...  41.2    0.032 
ref|YP_146094.1|  molybdenum cofactor biosynthesis protein C [...  41.2    0.032 
ref|ZP_01001185.1|  molybdenum cofactor biosynthesis protein C...  41.2    0.032
ref|ZP_01092550.1|  molybdenum cofactor biosynthesis protein C...  40.8    0.037
ref|XP_002205830.1|  hypothetical protein BRAFLDRAFT_118735 [B...  40.8    0.038 
ref|YP_001325097.1|  putative molybdenum cofactor biosynthesis...  40.8    0.039 
ref|YP_001273935.1|  molybdenum cofactor biosynthesis protein ...  40.8    0.043 
ref|ZP_03608179.1|  hypothetical protein METSMIALI_01305 [Meth...  40.8    0.043
ref|ZP_02913407.1|  molybdenum cofactor biosynthesis protein C...  40.4    0.046
ref|YP_002720723.1|  Molybdenum cofactor biosynthesis protein ...  40.4    0.046 
ref|ZP_03875159.1|  GTP cyclohydrolase subunit MoaC [Halomicro...  40.4    0.049
ref|YP_002786826.1|  putative molybdenum cofactor biosynthesis...  40.4    0.050 
ref|ZP_03869106.1|  molybdenum cofactor biosynthesis protein M...  40.4    0.050
ref|YP_919725.1|  molybdenum cofactor biosynthesis protein C [...  40.4    0.051 
ref|ZP_03806394.1|  hypothetical protein PROPEN_04797 [Proteus...  40.4    0.051
ref|YP_509818.1|  molybdenum cofactor biosynthesis protein C [...  40.4    0.052 
ref|YP_984158.1|  molybdenum cofactor biosynthesis-like protei...  40.4    0.053 
ref|XP_001928743.1|  PREDICTED: similar to Molybdenum cofactor...  40.4    0.054 
ref|YP_001503963.1|  molybdenum cofactor biosynthesis protein ...  40.4    0.054 
ref|NP_248127.1|  putative molybdenum cofactor biosynthesis pr...  40.4    0.057 
ref|YP_843515.1|  putative molybdenum cofactor biosynthesis pr...  40.4    0.058 
ref|YP_001672359.1|  molybdenum cofactor biosynthesis protein ...  40.0    0.059 
ref|ZP_03704005.1|  hypothetical protein METSMIF1_00432 [Metha...  40.0    0.064
sp|Q1JQD7.2|MOCS1_BOVIN  RecName: Full=Molybdenum cofactor bio...  40.0    0.065 
gb|AAI16031.1|  MOCS1 protein [Bos taurus]                         40.0    0.065 
ref|ZP_04047222.1|  GTP cyclohydrolase subunit MoaC [Brachyspi...  40.0    0.075
ref|ZP_03924020.1|  molybdenum (Mo2+) cofactor biosynthesis en...  39.7    0.086
ref|YP_002427906.1|  molybdenum cofactor biosynthesis protein ...  39.3    0.10  
ref|ZP_03312957.1|  hypothetical protein DESPIG_02894 [Desulfo...  39.3    0.13 
ref|NP_388477.1|  molybdenum cofactor biosynthesis protein C [...  38.9    0.13  
ref|YP_001420257.1|  molybdenum cofactor biosynthesis protein ...  38.9    0.14  
ref|YP_001981978.1|  molybdenum cofactor biosynthesis protein ...  38.9    0.14  
ref|YP_566511.1|  putative molybdenum cofactor biosynthesis pr...  38.9    0.15  
ref|XP_001470309.1|  molybdenum cofactor biosynthesis protein ...  38.9    0.16  
ref|YP_686778.1|  putative molybdenum cofactor biosynthesis pr...  38.9    0.16  
ref|YP_077844.1|  molybdenum cofactor biosynthesis protein C [...  38.9    0.16  
ref|XP_817726.1|  molybdenum cofactor biosynthesis protein [Tr...  38.9    0.17  
ref|ZP_03746630.1|  hypothetical protein NEIMUCOT_00600 [Neiss...  38.5    0.17 
ref|YP_001097057.1|  putative molybdenum cofactor biosynthesis...  38.5    0.18  
ref|ZP_03054526.1|  molybdenum cofactor biosynthesis protein C...  38.5    0.19 
ref|YP_001485782.1|  molybdenum cofactor biosynthesis protein ...  38.5    0.19  
ref|YP_001041579.1|  GTP cyclohydrolase subunit MoaC [Staphylo...  38.5    0.20  
ref|YP_001013100.1|  molybdenum cofactor biosynthesis protein ...  38.5    0.20  
ref|XP_001566311.1|  molybdenum cofactor biosynthesis protein ...  38.5    0.21  
ref|ZP_03511278.1|  putative molybdenum cofactor biosynthesis ...  38.5    0.22 
ref|NP_613839.1|  putative molybdenum cofactor biosynthesis pr...  38.5    0.22  
ref|YP_009513.1|  molybdenum cofactor biosynthesis protein C [...  38.1    0.22  
ref|YP_968130.1|  molybdenum cofactor biosynthesis protein C [...  38.1    0.24  
ref|YP_002773668.1|  molybdenum cofactor biosynthesis protein ...  38.1    0.24  
ref|XP_002205827.1|  hypothetical protein BRAFLDRAFT_118731 [B...  38.1    0.25  
ref|ZP_00740869.1|  Molybdenum cofactor biosynthesis protein C...  38.1    0.29 
ref|YP_046553.1|  bifunctional molybdenum cofactor biosynthesi...  37.7    0.30  
ref|XP_001684550.1|  molybdenum cofactor biosynthesis protein ...  37.7    0.31  
ref|ZP_04230135.1|  Molybdenum cofactor biosynthesis protein C...  37.7    0.32 
ref|ZP_03230861.1|  molybdenum cofactor biosynthesis protein C...  37.7    0.33 
ref|YP_174391.1|  molybdenum cofactor biosynthesis protein C [...  37.7    0.34  
ref|YP_503702.1|  molybdenum cofactor biosynthesis protein C [...  37.4    0.38  
ref|ZP_02328750.1|  molybdenum cofactor biosynthesis protein C...  37.4    0.40 
ref|YP_001322909.1|  putative molybdenum cofactor biosynthesis...  37.4    0.43  
ref|ZP_03694385.1|  molybdenum cofactor biosynthesis protein C...  37.4    0.43 
ref|ZP_04193998.1|  Molybdenum cofactor biosynthesis protein C...  37.4    0.44 
ref|ZP_04236002.1|  Molybdenum cofactor biosynthesis protein C...  37.4    0.44 
ref|NP_834426.1|  molybdenum cofactor biosynthesis protein C [...  37.4    0.44  
ref|ZP_04209200.1|  Molybdenum cofactor biosynthesis protein C...  37.4    0.45 
ref|NP_847170.1|  molybdenum cofactor biosynthesis protein C [...  37.4    0.45  
ref|ZP_04319966.1|  Molybdenum cofactor biosynthesis protein C...  37.4    0.46 
ref|YP_002467526.1|  molybdenum cofactor biosynthesis protein ...  37.4    0.46  
ref|ZP_03824573.1|  molybdenum cofactor biosynthesis protein [...  37.4    0.48 
ref|YP_038769.1|  molybdenum cofactor biosynthesis protein C [...  37.4    0.49  
ref|ZP_04291665.1|  Molybdenum cofactor biosynthesis protein C...  37.0    0.54 
ref|YP_001549637.1|  putative molybdenum cofactor biosynthesis...  37.0    0.60  
ref|YP_001329540.1|  putative molybdenum cofactor biosynthesis...  36.6    0.68  
ref|NP_376357.1|  putative molybdenum cofactor biosynthesis pr...  36.6    0.69  
ref|NP_988186.2|  putative molybdenum cofactor biosynthesis pr...  36.6    0.70  
emb|CAF30622.1|  Molybdopterin cofactor biosynthesis protein M...  36.6    0.74  
ref|YP_001192112.1|  putative molybdenum cofactor biosynthesis...  36.6    0.81  
ref|XP_002186662.1|  PREDICTED: molybdenum cofactor synthesis ...  36.6    0.83  
ref|ZP_04042520.1|  GTP cyclohydrolase subunit MoaC [Kytococcu...  36.2    0.94 
ref|YP_001531053.1|  molybdenum cofactor biosynthesis protein ...  36.2    1.0   
ref|YP_001539950.1|  molybdopterin cofactor biosynthesis MoaC ...  35.8    1.2   
ref|ZP_04302953.1|  Molybdenum cofactor biosynthesis protein C...  35.8    1.2  
gb|ABO12423.2|  hypothetical protein A1S_1996 [Acinetobacter b...  35.8    1.2   
ref|YP_001846781.1|  molybdenum cofactor biosynthesis protein ...  35.8    1.2   
ref|ZP_04286401.1|  Molybdenum cofactor biosynthesis protein C...  35.8    1.2  
ref|YP_255561.2|  putative molybdenum cofactor biosynthesis pr...  35.8    1.3   
sp|Q4JAB2.1|MOAC_SULAC  RecName: Full=Probable molybdenum cofa...  35.8    1.3  
ref|YP_001713451.1|  bifunctional protein [Includes: molybdenu...  35.8    1.4   
ref|YP_327516.1|  putative molybdenum cofactor biosynthesis pr...  35.8    1.4   
gb|AAG60572.1|AF250774_3  putative molybdenum cofactor biosynt...  35.4    1.6  
ref|NP_981158.1|  molybdenum cofactor biosynthesis protein C [...  35.4    1.6   
ref|ZP_00236192.1|  molybdenum cofactor biosynthesis protein C...  35.4    1.6  
ref|ZP_04098844.1|  Molybdenum cofactor biosynthesis protein C...  35.4    1.7  
ref|ZP_04153380.1|  Molybdenum cofactor biosynthesis protein C...  35.4    1.8  
ref|ZP_04220131.1|  Molybdenum cofactor biosynthesis protein C...  35.4    1.8  
ref|NP_342277.1|  putative molybdenum cofactor biosynthesis pr...  35.0    1.9   
gb|EEC17908.1|  molybdenum cofactor biosynthesis pathway prote...  35.0    2.0  
ref|YP_135842.1|  putative molybdenum cofactor biosynthesis pr...  35.0    2.0   
ref|XP_001506834.1|  PREDICTED: similar to development and dif...  35.0    2.2   
ref|YP_002565898.1|  molybdenum cofactor biosynthesis protein ...  35.0    2.3   
gb|AAW25116.1|  SJCHGC05070 protein [Schistosoma japonicum]        34.7    2.8  





>ref|YP_002591541.1|  molybdenum cofactor biosynthesis protein C [Candidatus Pelagibacter 
sp. HTCC7211]
 gb|EDZ59704.1|  molybdenum cofactor biosynthesis protein C [Candidatus Pelagibacter 
sp. HTCC7211]
Length=181

 GENE ID: 7526788 moaC | molybdenum cofactor biosynthesis protein C
[Candidatus Pelagibacter sp. HTCC7211]

 Score =  139 bits (351),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 71/80 (88%), Gaps = 0/80 (0%)

Query  1    MNEVDNSLEVFCVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLKIDNVKLLIKEG  60
            MN+ DNSLEVFCVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLKIDN+KLLIKEG
Sbjct  102  MNDKDNSLEVFCVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLKIDNIKLLIKEG  161

Query  61   GKSGLWTNPRWITRVFKKYF  80
            GKSGLWTNP  +    K  F
Sbjct  162  GKSGLWTNPDGLPEFLKDIF  181


>ref|YP_266183.1|  molybdopterin cofactor synthesis protein [Candidatus Pelagibacter 
ubique HTCC1062]
 gb|AAZ21580.1|  molybdopterin cofactor synthesis protein [Candidatus Pelagibacter 
ubique HTCC1062]
Length=181

 GENE ID: 3517404 moaC | molybdopterin cofactor synthesis protein
[Candidatus Pelagibacter ubique HTCC1062] (10 or fewer PubMed links)

 Score =  134 bits (336),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/80 (82%), Positives = 70/80 (87%), Gaps = 0/80 (0%)

Query  1    MNEVDNSLEVFCVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLKIDNVKLLIKEG  60
            M+E D+SLEVFCVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHL+IDNVKLLIKEG
Sbjct  102  MHEDDSSLEVFCVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLRIDNVKLLIKEG  161

Query  61   GKSGLWTNPRWITRVFKKYF  80
            GKSGLW NP  +    K  F
Sbjct  162  GKSGLWINPDGLPEFLKDIF  181


>ref|ZP_01264078.1|  molybdopterin cofactor synthesis protein [Candidatus Pelagibacter 
ubique HTCC1002]
 gb|EAS84565.1|  molybdopterin cofactor synthesis protein [Candidatus Pelagibacter 
ubique HTCC1002]
Length=181

 Score =  128 bits (322),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/80 (78%), Positives = 68/80 (85%), Gaps = 0/80 (0%)

Query  1    MNEVDNSLEVFCVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLKIDNVKLLIKEG  60
            M+E  +SLEVFCVVSAVAKTGVEMEAIMGVN ALITIYDLSKIVNPHL+IDNV+LLIKEG
Sbjct  102  MHEDGSSLEVFCVVSAVAKTGVEMEAIMGVNTALITIYDLSKIVNPHLRIDNVRLLIKEG  161

Query  61   GKSGLWTNPRWITRVFKKYF  80
            GKSGLW NP  +    K  F
Sbjct  162  GKSGLWINPDGLPEFLKDIF  181


>ref|YP_002707403.1|  molybdenum cofactor biosynthesis protein C [Stenotrophomonas 
sp. SKA14]
 gb|EED37389.1|  molybdenum cofactor biosynthesis protein C [Stenotrophomonas 
sp. SKA14]
Length=321

 GENE ID: 7599870 SSKA14_396 | molybdenum cofactor biosynthesis protein C
[Stenotrophomonas sp. SKA14]

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 51/63 (80%), Gaps = 0/63 (0%)

Query  7    SLEVFCVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLKIDNVKLLIKEGGKSGLW  66
            ++ V+C  ++ A+TGVEMEA+ GVNAAL+T+YDLSK V P L+I+ ++LL KEGGK G+W
Sbjct  82   AIRVWCECASEARTGVEMEALAGVNAALLTLYDLSKPVEPALRIEGIRLLFKEGGKRGVW  141

Query  67   TNP  69
             +P
Sbjct  142  LHP  144


>ref|YP_001972543.1|  putative molybdenum cofactor biosynthesis protein (putative secreted 
protein) [Stenotrophomonas maltophilia K279a]
 emb|CAQ46248.1|  putative molybdenum cofactor biosynthesis protein (putative secreted 
protein) [Stenotrophomonas maltophilia K279a]
Length=321

 GENE ID: 6394986 moaC | bifunctional molybdenum cofactor biosynthesis protein
C/molybdopterin-binding protein [Stenotrophomonas maltophilia K279a]
(10 or fewer PubMed links)

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 51/63 (80%), Gaps = 0/63 (0%)

Query  7    SLEVFCVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLKIDNVKLLIKEGGKSGLW  66
            ++ V+C  ++ A+TGVEMEA+ GVNAAL+T+YDLSK V P L+I+ ++LL KEGGK G+W
Sbjct  82   AIRVWCECASEARTGVEMEALAGVNAALLTLYDLSKPVEPALRIEGIRLLFKEGGKRGVW  141

Query  67   TNP  69
             +P
Sbjct  142  LHP  144


>ref|YP_002028630.1|  molybdenum cofactor biosynthesis protein C [Stenotrophomonas 
maltophilia R551-3]
 gb|ACF51947.1|  molybdenum cofactor biosynthesis protein C [Stenotrophomonas 
maltophilia R551-3]
Length=331

 GENE ID: 6476656 moaC | bifunctional molybdenum cofactor biosynthesis protein
C/molybdopterin-binding protein [Stenotrophomonas maltophilia R551-3]

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 51/63 (80%), Gaps = 0/63 (0%)

Query  7    SLEVFCVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLKIDNVKLLIKEGGKSGLW  66
            ++ V+C  ++ A+TGVEMEA+ GVNAAL+T+YDLSK V P L+I+ ++LL KEGGK G+W
Sbjct  92   AIRVWCECASEARTGVEMEALAGVNAALLTLYDLSKPVEPALRIEGIRLLFKEGGKRGVW  151

Query  67   TNP  69
             +P
Sbjct  152  LHP  154


>ref|ZP_03759378.1|  hypothetical protein CLOSTASPAR_03402 [Clostridium asparagiforme 
DSM 15981]
 gb|EEG54535.1|  hypothetical protein CLOSTASPAR_03402 [Clostridium asparagiforme 
DSM 15981]
Length=165

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 42/66 (63%), Gaps = 0/66 (0%)

Query  6    NSLEVFCVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLKIDNVKLLIKEGGKSGL  65
            N +E  C      KTGVEMEA+ GV  AL+TIYD+ K V+  ++I NV L  K GGKSG 
Sbjct  94   NGIEAVCTARTTGKTGVEMEALTGVTVALLTIYDMCKAVDKSMEIGNVYLEHKSGGKSGD  153

Query  66   WTNPRW  71
            + NPR 
Sbjct  154  FHNPRH  159


>ref|NP_959736.1|  molybdenum cofactor biosynthesis protein C [Mycobacterium avium 
subsp. paratuberculosis K-10]
 gb|AAS03119.1|  MoaC2 [Mycobacterium avium subsp. paratuberculosis K-10]
Length=176

 GENE ID: 2718512 moaC | molybdenum cofactor biosynthesis protein C
[Mycobacterium avium subsp. paratuberculosis K-10] (10 or fewer PubMed links)

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 48/64 (75%), Gaps = 0/64 (0%)

Query  5    DNSLEVFCVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLKIDNVKLLIKEGGKSG  64
            ++ +E+   V++  +TGVEMEA+  V+ A +T+YD+ K V+P  +ID+V++L KEGGK+G
Sbjct  112  ESDIEITATVASTDRTGVEMEALTAVSVAGLTLYDMIKAVDPAARIDDVRVLRKEGGKTG  171

Query  65   LWTN  68
            +WT 
Sbjct  172  MWTR  175


>ref|ZP_03485446.1|  hypothetical protein ROSINTL182_02850 [Roseburia intestinalis 
L1-82]
 gb|EED00592.1|  hypothetical protein ROSINTL182_02850 [Roseburia intestinalis 
L1-82]
Length=162

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 49/66 (74%), Gaps = 0/66 (0%)

Query  1    MNEVDNSLEVFCVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLKIDNVKLLIKEG  60
            M++ ++S+E FC  S + KTGVEMEA+ GV+  L+TIYD+ K ++  ++I ++ L+ K+G
Sbjct  90   MHDEEHSIEAFCKTSCIGKTGVEMEAMTGVSVTLLTIYDMCKAMDRGMRITDIHLMEKDG  149

Query  61   GKSGLW  66
            GKSG +
Sbjct  150  GKSGHY  155


>ref|YP_880253.1|  molybdenum cofactor biosynthesis protein C [Mycobacterium avium 
104]
 gb|ABK67121.1|  molybdenum cofactor biosynthesis protein C [Mycobacterium avium 
104]
Length=142

 GENE ID: 4528198 moaC | molybdenum cofactor biosynthesis protein C
[Mycobacterium avium 104]

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 48/64 (75%), Gaps = 0/64 (0%)

Query  5    DNSLEVFCVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLKIDNVKLLIKEGGKSG  64
            ++ +E+   V++  +TGVEMEA+  V+ A +T+YD+ K V+P  +ID+V++L KEGGK+G
Sbjct  78   ESDIEITATVTSTDRTGVEMEALTAVSVAGLTLYDMIKAVDPAARIDDVRVLRKEGGKTG  137

Query  65   LWTN  68
            +WT 
Sbjct  138  MWTR  141


>ref|YP_001634392.1|  molybdenum cofactor biosynthesis protein C [Chloroflexus aurantiacus 
J-10-fl]
 ref|YP_002568584.1|  molybdenum cofactor biosynthesis protein C [Chloroflexus sp. 
Y-400-fl]
 gb|ABY34003.1|  molybdenum cofactor biosynthesis protein C [Chloroflexus aurantiacus 
J-10-fl]
 gb|ACM52258.1|  molybdenum cofactor biosynthesis protein C [Chloroflexus sp. 
Y-400-fl]
Length=163

 GENE ID: 5827860 Caur_0765 | molybdenum cofactor biosynthesis protein C
[Chloroflexus aurantiacus J-10-fl]

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 0/69 (0%)

Query  2    NEVDNSLEVFCVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLKIDNVKLLIKEGG  61
            +   N+LE+   V    +TGVEMEA+  V+ A +TIYD+ K V+  ++ID ++L+ K GG
Sbjct  95   DPASNALEIEATVRCQGQTGVEMEALTAVSIAALTIYDMCKAVDKTMQIDQIRLIAKRGG  154

Query  62   KSGLWTNPR  70
            +SG W  PR
Sbjct  155  RSGDWQRPR  163


>ref|ZP_01967998.1|  hypothetical protein RUMTOR_01564 [Ruminococcus torques ATCC 
27756]
 gb|EDK24310.1|  hypothetical protein RUMTOR_01564 [Ruminococcus torques ATCC 
27756]
Length=371

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/69 (47%), Positives = 49/69 (71%), Gaps = 1/69 (1%)

Query  1    MNEVDNSLEVFCVVSAVAKTGVEMEAIMGVNAALITIYDLSKIVNPHLKIDNVKLLIKEG  60
            MNE + ++   C V    KTGVEMEA+ GV+AAL+TIYD+ K ++  ++I +++LL K G
Sbjct  102  MNEKECAIFCTCTVKVTGKTGVEMEALTGVSAALLTIYDMCKALDKKMEITDIRLLKKTG  161

Query  61   GKSG-LWTN  68
            GKSG +W +
Sbjct  162  GKSGDIWND  170