GOS 715010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091118857972
Annotathon code: GOS_715010
Sample :
  • GPS :24°10'29n; 84°20'40w
  • Caribbean Sea: Gulf of Mexico - USA
  • Coastal Sea (-2m, 26.4°C, 0.1-0.8 microns)
Authors
Team : BioCell2008
Username : Dj-neiluj
Annotated on : 2009-02-13 16:34:58
  • Del Vecchio Alexandre
  • belaid amine
  • porte julien

Synopsis

Genomic Sequence

>JCVI_READ_1091118857972 GOS_715010 genomic DNA
AGAATATACAAATACAAACAAATTTAATACACTGTGCTTATAAATTTAATGTTAAAGACTTAATTTTTCTTGGATCTAGCTGCATATACCCAAAATATTC
AAAACAGCCAATAAAAGAAAAGTATCTGCTAACGAGTGTATTAGAAAAAACAAACCAAGCTTATGCAATTGCAAAGATTTCTGGTGTCAAGATGTGTGAA
TATTACAATGAACAATATAATACTAATTTTAAAAGTTTAATGCCTACAAATACTTTTGGCCCAAATGATAATTATGATCTCAGTACATCACATTTTTTAC
CAGCTTTGATTAGAAAAATTTATGAATCTAAAATTAATAAAAGAAACTATATAAATCTTTGGGGAGATGGAAAAACCAAAAGAGAATTGATTTATGTGGA
TGATTTAGCAGAAGCGTCAATATATTTTCTTTTTAAGAAAACAAAAAAAAATTTAATTAATATTGGAACTCAAAAAGATTTTACAATTGAATACTATGCA
AAAAAAATTATGAAAATTTTAGATATAAAATTAAAAATTAAATATATAAATAAGAACTTGAAAGGTACCCCAAGAAAAAAACTAGATTGTTCTCTTGCTA
CTAATTTAGGATGGAGACCAAAAATAAAAATAGATAAAGGATTAGAAATATCTATAAAAGATTTTATTGAAAATTATAAAGAATATACGAAATAATTAAT
TGATTAAAAAACAGATATTTTTGCAGTGTTTCAAGGTCCATATTTAAAAGAAACAACCACAAAAGCATTAGATGGTATTTATAAAATATTTAAAGACTCT
GAACTAATTTTTTAACATACTAAGCAGAAAAAATTGATAGTAAGTTGAAAAAATAGAAATATTCTATTACGAAACATAATGCTTGATTTCTTCATCAACC
ATTATTTTAATAAGTTGTTTTAAATTAGTTTTTGCTTGCC

Translation

[3 - 692/940]   direct strand
>GOS_715010 Translation [3-692   direct strand]
NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKISGVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLP
ALIRKIYESKINKRNYINLWGDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLKIKYINKNLKGTPRKKLDCSLAT
NLGWRPKIKIDKGLEISIKDFIENYKEYTK

[ Warning ] 5' incomplete: does not start with a Methionine

Phylogeny

PROTOCOLE:

a) INFOBIOGEN / Phylip / méthode Parcimonie Protpars / Groupe d'étude : tous les organismes du vivant / Non raciné
b) INFOBIOGEN / Phylip / méthode Neighbor / Groupe d'étude : tous les organismes du vivant / Non raciné

c) INFOBIOGEN / Phylip / méthode Parcimonie Protpars / Groupe d'étude : a-protéobactéries / Raciné avec Cbacterium (d-proteobacteria)
d) INFOBIOGEN / Phylip / méthode Neighbor / Groupe d'étude : a-protéobactéries / Raciné avec Cbacterium (d-proteobacteria)

---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

Nous avons préalablement fait différents arbres racinés ayant comme groupe extérieur les archées.
Cependant, toutes les séquences de ce groupe extérieur ne se retrouvaient pas à l'extérieur de l'arbre.
Il se trouve que nous retrouvions un aspect différent de la phylogénie de référence.
Ce qui nous a poussé à faire un arbre non raciné. Les résultats nous montraient que nous ne pouvions définir aucun groupe extérieur.


a) et b) Dans notre abre issu de l'alignement multiple général, nous observons que notre séquence GOS semble s'apparier
avec une séquence alpha-protéobactérie (Cpelagibacter).
Cependant elle reste à l'extérieur de notre arbre. Nous constatons également que nous ne retrouvons pas la phylogénie
de référence dans notre arbre (les séquences appartenant au même groupe sont mélangées avec celles des autres groupes)
Nous avons donc décider de faire un nouvel alignement multiple pour vérifier que notre séquence se niche
dans les a-protéobactéries.

c) et d) Suite à notre nouvel alignement multiple, nous avons créé un nouvel arbre correspondant à cet alignement.
Afin de vérifier que notre séquence se niche bien dans le groupe des a-protéobactéries, nous prenons donc comme
groupe extérieur les d- et e-protéobatéries.
Nous observons que les séquences ne se regroupent pas. Nous ne retrouvons toujours pas la phylogénie de référence.
Les séquences du groupe extérieur (d et e-protéobactéries) ne se retrouvent pas à l'extérieur de l'arbre comme il le faudrait.
Notre séquence GOS reste encore proche de la même alpha-protéobactérie (1Cpelagibacter).


Ces deux études phylogénétiques nous montrent des mélanges entre les groupes taxonomiques étudiés.
A la vue de ces résultats, nous supposons qu'il y a eu, à un moment de l'évolution, des transferts horizontaux de gènes
et des duplications de gènes suivies de pertes de gènes.

---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:

a) INFOBIOGEN / Phylip / méthode Parcimonie Protpars / Groupe d'étude : tous les organismes du vivant / Non raciné 


Arbre(s) issus de protpars :

Protein parsimony algorithm, version 3.6a2.1



One most parsimonious tree found:




        +--------------------------------------------------------------------------Mmaripaludis          [Methanococcales]
        !  
        !  +-----------------------------------------------------------------------bacterium             [Verrucomicrobiales]
        !  !  
        !  !                                                                 +-----Bambifaria            [b-proteobacteria]
        !  !                                                           +----27  
        !  !                                                           !     !  +--Aaegypti              [Metazoa]
        !  !                                                           !     +-26  
        !  !                                         +----------------25        +--Ggallus               [Metazoa]
     +-24  !                                         !                 !  
     !  !  !                                         !                 !        +--Synechococcus         [Cyanobacteria]
     !  !  !                                         !                 +-------22  
     !  !  !                                         !                          +--Ecoli                 [g-proteobacteria]
     !  !  !                             +----------21  
     !  !  !                             !           !                          +--Mpopuli               [a-proteobacteria]
     !  !  !                             !           !              +----------20  
     !  !  !                             !           !              !           +--Ddesulfuricans        [d-proteobacteria]
     !  !  !                             !           !              !  
     !  +-23                             !           +-------------17           +--Cmichiganensis        [Actinobacteria]
     !     !                             !                          !     +----19  
     !     !                             !                          !     !     +--Sgriseus              [Actinobacteria]
     !     !                          +-15                          +----18  
     !     !                          !  !                                !     +--Vvinifera             [Plantae]
     !     !                          !  !                                +----16  
     !     !                          !  !                                      +--Athaliana             [Plantae]
     !     !                          !  !  
     !     !                          !  !                                   +-----Bvietnamiensis        [b-proteobacteria]
     !     !  +----------------------11  !                                +-14  
     !     !  !                       !  !                                !  !  +--Rleguminosarum        [a-proteobacteria]
     !     !  !                       !  +-------------------------------12  +-13  
  +--2     !  !                       !                                   !     +--dproteobacterium      [d-proteobacteria]
  !  !     !  !                       !                                   !  
  !  !     !  !                       !                                   +--------Noceani               [g-proteobacteria]
  !  !     !  !                       !  
  !  !     !  !                       +--------------------------------------------Cacetobutylicum       [Firmicutes]
  !  !     +--9  
  !  !        !                                                                 +--Geobacillus           [Firmicutes]
  !  !        !                                                     +----------10  
  !  !        !                                                     !           +--Mchthonoplastes       [Cyanobacteria]
  !  !        !                                                     !  
  !  !        !                                               +-----5        +-----Cjejuni2              [e-proteobacteria]
  !  !        !                                               !     !     +--7  
  1  !        !                                               !     !     !  !  +--Amuciniphila          [Verrucomicrobiales]
  !  !        !                                               !     +-----6  +--8  
  !  !        +-----------------------------------------------4           !     +--Cjejuni1              [e-proteobacteria]
  !  !                                                        !           !  
  !  !                                                        !           +--------Sulfurihydrogenibium  [Aquificales]
  !  !                                                        !  
  !  !                                                        !                 +--Mmazei                [Methanomicrobia]
  !  !                                                        +-----------------3  
  !  !                                                                          +--Mbarkeri              [Methanomicrobia]
  !  !  
  !  +-----------------------------------------------------------------------------GOS_715010            [.....]
  !  
  +--------------------------------------------------------------------------------CPelagibac            [a-proteobacteria]








b) INFOBIOGEN / Phylip / méthode Neighbor / Groupe d'étude : tous les organismes du vivant / Non raciné




Arbre(s) issus de neighbor :

  28 Populations

Neighbor-Joining/UPGMA method version 3.6a2.1


 Neighbor-joining method

 Negative branch lengths allowed


             +------------------Mmaripaludis                                 [Methanococcales]
             ! 
          +--5                      +----------Ggallus                       [Metazoa]   
          !  !      +---------------1 
          !  +------2               +---------Aaegypti                       [Metazoa]  
          !         ! 
          !         +--------------------Bambifaria                          [b-proteobacteria]
          !  
          !  +-------Geobacillus                                             [Firmicutes]
          !  !  
          !  !                +----------Amuciniphila                        [Verrucomicrobiales]
          !  !              +-9 
  +------14  !              ! !   +------Cjejuni1                            [e-proteobacteria]  
  !       !  !              ! +---4 
  !       !  !           +-21     +---------------Cjejuni2                   [e-proteobacteria]
  !       !  !           !  !  
  !       !  !           !  !  +--Mmazei                                     [Methanomicrobia]
  !       !  !        +-22  +--7 
  !       !  !        !  !     +--Mbarkeri                                   [Methanomicrobia]
  !       !  !        !  !  
  !       !  !     +-23  !  +-------Sulfurihydrogenibium                     [Aquificales]
  !       !  !     !  !  +-13  
  !       !  !     !  !     +----------Cacetobutylicum                       [Firmicutes]
  !       +-24     !  !  
  !          !     !  +-------Mchthonoplastes                                [Cyanobacteria]
  !          !     !  
  !          !     !         +---Athaliana                                   [Plantae] 
  !          !     !     +---6 
  !          !  +-25     !   +---Vvinifera                                   [Plantae] 
  !          !  !  !     !  
  !          !  !  !     !          +--------Sgriseus                        [Actinobacteria]  
  !          !  !  !  +-18        +-8 
  !          !  !  !  !  !     +-15 +--------Cmichiganensis                  [Actinobacteria]
  !          !  !  !  !  !     !  !  
  !          !  !  !  !  !  +-16  +------------Synechococcus                 [Cyanobacteria]
  !          !  !  +-20  !  !  !  
  !          !  !     !  +-17  +---------Mpopuli                             [a-proteobacteria]   
  !          !  !     !     !  
  !          +-26     !     +--------Ddesulfuricans                          [d-proteobacteria]
  !             !     !  
  !             !     +---------bacterium                                    [Verrucomicrobiales] 
  !             !  
  !             !           +------dproteobacterium                          [d-proteobacteria]
  !             !        +-10  
  !             !     +-11  +------Noceani                                   [g-proteobacteria]   
  !             !     !  !  
  !             !  +-12  +------Rleguminosarum                               [a-proteobacteria]
  !             !  !  !  
  !             +-19  +--------Bvietnamiensis                                [b-proteobacteria]
  !                !  
  !                +----------Ecoli                                          [g-proteobacteria]
  ! 
  3----------GOS_715010                                                      [.....]
  ! 
  +-------CPelagibac                                                         [a-proteobacteria]





---------------------------------------------------------------------------------------------------

---------------------------------------------------------------------------------------------------

c) INFOBIOGEN / Phylip / méthode Parcimonie Protpars / Groupe d'étude : a-protéobactéries / Raciné avec Cbacterium (d-proteobacteria)




Arbre(s) issus de protpars :

Protein parsimony algorithm, version 3.6a2.1



One most parsimonious tree found:




  +--------------------------------------------------------------------------Cbacterium            [d-proteobacteria]
  !  
  !                                                                       +--Cjejuni2              [e-proteobacteria]
  !                                                                    +-20  
 17  +----------------------------------------------------------------19  +--Cjejuni3              [e-proteobacteria]
  !  !                                                                 !  
  !  !                                                                 +-----Cjejuni1              [e-proteobacteria]
  !  !  
  +-18        +--------------------------------------------------------------2CPelagibacter        [a-proteobacteria]
     !        !  
     !        !                                                     +--------Geobacter             [d-proteobacteria]
     !        !  +-------------------------------------------------15  
     !        !  !                                                  !  +-----Pgallaeciensis        [a-proteobacteria]
     +-------16  !                                                  +-10  
              !  !                                                     !  +--Roseobacter           [a-proteobacteria]
              !  !                                                     +--9  
              !  !                                                        +--Lvestfoldensis        [a-proteobacteria]
              !  !  
              !  !                                                        +--Doleovorans           [d-proteobacteria]
              +--8           +-------------------------------------------14  
                 !           !                                            +--Mloti                 [a-proteobacteria]
                 !           !  
                 !           !                                            +--proteobacterium       [d-proteobacteria]
                 !           !                          +----------------12  
                 !           !                          !                 +--Rleguminosarum        [a-proteobacteria]
                 !           !                          !  
                 !           !     +-------------------11     +--------------Gsulfurreducens       [d-proteobacteria]
                 +----------13     !                    !     !  
                             !     !                    !     !           +--Hphototrophica        [a-proteobacteria]
                             !     !                    +-----7        +--5  
                             !     !                          !  +-----4  +--Mpopuli               [a-proteobacteria]
                             !     !                          !  !     !  
                             !     !                          +--3     +-----Ddesulfuricans        [d-proteobacteria]
                             !     !                             !  
                             !     !                             !        +--Mnodulans             [a-proteobacteria]
                             +-----2                             +--------6  
                                   !                                      +--Bradyrhizobium        [a-proteobacteria]
                                   !  
                                   !                                   +-----Caulobacter           [a-proteobacteria]
                                   !                             +----25  
                                   !                             !     !  +--Saciditrophicus       [e-proteobacteria]
                                   !                             !     +-24  
                                   !                       +----23        +--Adehalogenans         [e-proteobacteria]
                                   !                       !     !  
                                   !                       !     !        +--Hpylori               [e-proteobacteria]
                                   +----------------------21     +-------22  
                                                           !              +--Acaulinodans          [a-proteobacteria]
                                                           !  
                                                           !              +--GOS_715010            [.....]
                                                           +--------------1  
                                                                          +--1CPelagibacter        [a-proteobacteria]








d) INFOBIOGEN / Phylip / méthode Neighbor / Groupe d'étude : a-protéobactéries / Raciné avec Cbacterium (d-proteobacteria)




Arbre(s) issus de neighbor :

  26 Populations

Neighbor-Joining/UPGMA method version 3.6a2.1


 Neighbor-joining method

 Negative branch lengths allowed


        +----------Gsulfurreducens                                                             [d-proteobacteria]
        !  
        !           +----------proteobacterium                                                 [d-proteobacteria]
        !        +-13  
        !        !  +---------Rleguminosarum                                                   [a-proteobacteria]
        !     +-20  
        !     !  !  +-------------------Mloti                                                  [a-proteobacteria]
        !     !  +-19  
        !     !     +------------Doleovorans                                                   [d-proteobacteria]
        !     !  
        !     !                         +-------------------------Hpylori                      [e-proteobacteria]
        !     !            +------------2 
        !     !            !            +----------------------Acaulinodans                    [a-proteobacteria]
        !     !     +------9 
  +----17     !     !      !                   +--------------Saciditrophicus                  [e-proteobacteria]
  !     !     !     !      !        +----------1 
  !     !     !     !      +--------4          +---------------Adehalogenans                   [e-proteobacteria]
  !     !  +-21     !               ! 
  !     !  !  !     !               +---------------------------------Caulobacter              [a-proteobacteria]
  !     !  !  !     !  
  !     !  !  !     !               +----------Mpopuli                                         [a-proteobacteria]
  !     !  !  !  +-23           +--10  
  !     !  !  !  !  !        +-14   +------------Hphototrophica                                [a-proteobacteria]
  !     !  !  !  !  !        !  !  
  !     !  !  !  !  !     +-15  +-------------Ddesulfuricans                                   [d-proteobacteria]
  !     !  !  !  !  !     !  !  
  !     !  !  !  !  !  +-16  +-------------Bradyrhizobium                                      [a-proteobacteria]
  !     !  !  !  !  !  !  !  
  !     !  !  !  !  !  !  +----------------Mnodulans                                           [a-proteobacteria]
  !     +-18  !  !  +-24  
  !        !  +-22     !       +---------Lvestfoldensis                                        [a-proteobacteria]
  !        !     !     !   +---8 
  !        !     !     +--11   +------------Roseobacter                                        [a-proteobacteria]
  !        !     !         !  
  !        !     !         +------------Pgallaeciensis                                         [a-proteobacteria]
  !        !     !  
  !        !     !             +-----------------GOS_715010                                    [.....]
  !        !     !  +----------5 
  !        !     +-12          +-----------1CPelagibacter                                      [a-proteobacteria]
  !        !        !  
  !        !        +---------------2CPelagibacter                                             [a-proteobacteria]
  !        !  
  !        +-------------------Geobacter                                                       [d-proteobacteria]
  ! 
  ! +----------Cjejuni1                                                                        [e-proteobacteria]
  7-6 
  ! !        +----------------Cjejuni2                                                         [e-proteobacteria]
  ! +--------3 
  !          +-------------Cjejuni3                                                            [e-proteobacteria]
  ! 
  +--------Cbacterium                                                                          [d-proteobacteria]



---------------------------------------------------------------------------------------

Annotator commentaries

Nous étudions la séquence d'ADN génomique (Caribbean Sea: Gulf of Mexico) portant le nom de GOS_715010. Cette séquence possède 940 pb.


Notre ORF semble codant car la protéine obtenue possède plus de 230 acides aminés car notre séquence n'est pas complète (elle ne débute pas par une méthionine). Les alignements multiples confirment bien que la séquence est incomplète en 5' car nous observons une suite d'indels en début d'alignement. D'après l'alignement multiple, il faut rajouter environ 88 à 133 acides aminés en amont de la séquence traduite de l'ORF afin d'avoir la séquence protéique complète : environ 318 à 363 acides aminés.


D'après la recherche de domaines protéiques, nous constatons que la protéine obtenue est une épimérase. Par exemple, l'UDP-galactose 4-epimerase (protéine issue du domaine protéique IPR016040 contenu dans celui de IPR001509) catalyse la conversion de l'UDP-galactose en UDP-glucose durant le métabolisme du galactose. Cependant son processus biologique n'est pas "connu" car notre recherche s'est avéré infructueuse : le terme employé dans les fiches Swissprot étant trop vague et général (cellular metabolic process). Quant à la fonction moléculaire, nous n'avons pas trouvé un GO dans liste proposé. Cependant, nous disposons de deux termes ("catalytic activity" et "coenzyme binding") qui nous poussent à dire que la fonction moléculaire proposée la plus proche est : "enzyme regulator activity". Grâce à notre BLASTp contre SwissProt, nous avons pu observer sur les fiches des séquences qui possèdent des scores élevés : un nom semblable (GDP-L-fucose synthetase) et un nom de gène commun (AtGER1).


Nous n'avons pas pu déterminer d'hypothèse sur la classification taxonomique de l'organisme portant ce fragment car notre séquence ne s'insère pas dans un phyllum (ou groupe taxonomique), même en élargissant à l'ensemble du vivant. Cependant, nous observons une alpha-protéobactérie (1Cpelagibacter) qui est "liée" à notre séquence. En zoomant sur les alpha-protéobactéries, nous n'avons toujours pas pu nicher notre séquence comme nous le supposions. Elle reste cependant encore "liée" à la même alpha-protéobactérie. Notre étude phylogénétique nous montre des mélanges entre les groupes taxonomiques étudiés. Nous supposons qu'il y a eu, à un moment de l'évolution, des transferts horizontaux de gènes et des duplications de gènes suivies de pertes de gènes.

Multiple Alignement

PROTOCOLE:

a) Alignement multiple à grande échelle :
INFOBIOGEN / CLUSTALW Alignement multiple / Format de sortie : Clustal / Nature des séquences : protéiques

b) Alignement multiple sur les  a-,d-,e-protéobactéries :
INFOBIOGEN / CLUSTALW Alignement multiple / Format de sortie : Clustal / Nature des séquences : protéiques 

---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

a) Nous observons des régions fortement conservées vers le 280ème acide aminé (WG)
L'alignement multiple montre de bonnes régions conservées, ce qui nous laisse supposer que nous pourrons nicher
notre séquence dans notre arbre suite à cet alignement.

Nous pouvons voir que la séquence GOS ne débute pas au début de l'alignement multiple par rapport aux séquences choisies.
Ces séquences choisies débutent par une méthionine, ce qui confirme que la méthionine doit se trouver en amont de notre ORF.
La protéine issue de l'ORF complet aurait environ 133 aa de plus à son extrémité 5'.
A l'extrémité 3', les séquences choisies se terminent au même niveau que la séquence GOS.

b) Nous observons des régions fortement conservées vers le 117ème acide aminé (GSSCVYP) et le 241ème acide aminé (WG)


Nous pouvons voir que la séquence GOS ne débute pas au début de l'alignement multiple par rapport aux séquences choisies.
Ces séquences choisies débutent par une méthionine, ce qui confirme à nouveau que la méthionine doit se trouver
en amont de notre ORF.
La protéine issue de l'ORF complet aurait environ 88 aa de plus à son extrémité 5'.
A l'extrémité 3', les séquences choisies se terminent au même niveau que la séquence GOS.
 
---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:


a) Alignement multiple à grande échelle :
INFOBIOGEN / CLUSTALW Alignement multiple / Format de sortie : Clustal / Nature des séquences : protéiques



CLUSTAL W (1.82) multiple sequence alignment


CPelagibacter             --------------------------------------------MINRNSRIFITGHKGL
GOS_715010                ------------------------------------------------------------
Mbarkeri                  ---------------------------------------------MEKESKIYVAGHRGL
Mmazei                    ---------------------------------------------MDKRSKIYVAGHRGL
Sulfurihydrogenibium      ---------------------------------------------MEKEAKIFVAGHKGL
Nchthonoplastes           -------------------------------------------MTMNKDSKIYVAGHRGL
Cjejuni1                  ---------------------------------------------MFKDSKIYIAGHRGL
Cjejuni2                  --------------------------------------------MMQKDSKIYIAGHGGT
Amuciniphila              ---------------------------------------------MKKNSRIFVAGHHGL
Cacetobutylicum           ---------------------------------------------MKEDSKIYIAGHTGF
Geobacillus               ---------------------------------------------MDRKSRIFVAGHRGL
Noceani                   ---------------------------------------------MDKEKKIYVAGHRGM
dproteobacterium          ----------------------------------------MMMPKIDKSSKIYVAGHRGM
Rleguminosarum            ---------------------------------------------MNRDVKIYVAGHRGM
Bvietnamiensis            ---------------------------------------------MNKNTRIFVAGHRGM
Athaliana                 ---------------------------------MAETIGSEVSSMSDKSAKIFVAGHRGL
Vvinifera                 MAVGRSEVDSPNLTLVLTPVLSPTVTSDNGKLQSRILGTTVDSFLSNQSAKVFVAGHRGL
Ddesulfuricans            -------------------------------------------MTLSPESLIYVAGHGGL
Sgriseus                  ------------------------MTTELPVPSQESDRSLLRPG-----SRIFVAGHRGL
Cmichiganensis            ------------------------MSAAPASAADERDAVAFTPAPLDRSARVYVAGHRGL
Mpopuli                   -------------------------------------------MYSLAGKTVFVAGHRGL
Ecoli                     ----------------------------------------------MSRQRIFIAGHRGM
Synechococcus             ------------------------------------MTNTSSKSLLRASDRIFIAGARGM
bacterium                 -------------------------------------------MKIARDARIYVAGHGGL
Mmaripaludis              ---------------------------------------------MDKNSKITIFGGSGL
Ggallus                   -----------------MSCEEASMPSLKARRSTATAPIIHQADHSSTEETEVGHPASAV
Aaegypti                  -----------------------------------------------MAITVLVTGGTGL
Bambifaria                --------------------------------------------MAGSEESVLITGAGGV
                                                                                      

CPelagibacter             VGSAIYRKLKAKGYT------NLLIADRKKLDLTNQIKVIKFLKK---------------
GOS_715010                ------------------------------------------------------------
Mbarkeri                  VGSALKRKLESKGY------TNLIFRTHKELDLTNQQAVNKFFEQ---------------
Mmazei                    VGSALKRKLESKDY------SNLIFRTHRELDLTNQQAVNEFFER---------------
Sulfurihydrogenibium      VGSAIVRKLKEKGY------TNIITKDKSEVDLRRQEEVERFFEK---------------
Nchthonoplastes           VGSAIVRCLRDNGY------TNLILKTSQEVDLRRQQAVEDFFAA---------------
Cjejuni1                  VGSSILKKLQNDGY------ENLIFRTHSELDLTNQKAVADFFVK---------------
Cjejuni2                  LGKTLYNTLIDEGF------NNIIVKTRKELDLVDQKAVTDFFAK---------------
Amuciniphila              VGSAIWKSLEDKGY------SHLIGRPHKELDLEDPAAVREFFDR---------------
Cacetobutylicum           VGSAILRNLERRGY------KNVVVRTHKELDLMHQESVKKFLEE---------------
Geobacillus               VGSAILRKLKEYGY------ENIITRSRNELDLTKFDDVEKFFQE---------------
Noceani                   VGSAIVRNLEERGY------INIITRTRQELDLRDQKKVFSFLEG---------------
dproteobacterium          VGTALVRRLERGGY------RNLLTRSRAELDLLDQAAVFDFLGR---------------
Rleguminosarum            VGSAIVRRLKAGGY------TNIVTRSHAELDLVNQAAVAEFMKA---------------
Bvietnamiensis            VGSAVVRNLDARGY------VNVVTRGRSELDLTNQNAVEEFFRT---------------
Athaliana                 VGSAIVRKLQEQGF------TNLVLKTHAELDLTRQADVESFFSQ---------------
Vvinifera                 VGSAIVRKLQQLGF------TNLLLRTHAELDLTRQTDVDAFFAA---------------
Ddesulfuricans            VGAAIVRRLQAEGC------QNLLLRRSRELDLRNQQAVDDFFAT---------------
Sgriseus                  VGSAVARRLADDG-------HEVLTRGRDLLDLRDAARTGAYLKE---------------
Cmichiganensis            VGSAIVRRLEAEGF------TDVVGRTSAELDLKDRDAVFAFFAA---------------
Mpopuli                   VGSALVRRLKAED-------CAILTATRAELDLRDQAAVRAWMRD---------------
Ecoli                     VGSAIRRQLEQRGD------VELVLRTRDELNLLDSRAVHDFFAS---------------
Synechococcus             AGSAISRGLTRKGYGDAARGGALLTPTRQKLDLLDGQAVSTWMQT---------------
bacterium                 VGSAIFRKLQELGFT------NLIGKTRAELNLLDVNATRQFYRQ---------------
Mmaripaludis              VGSSIFRQLSKKGYS------NVNYPSSKSVNLLDKNQVEEYIKS---------------
Ggallus                   VGHLLGTISARPPE----TPRRIISSAAVGSELSAQGVAISSRRLGFGGLGCFNGWRARY
Aaegypti                  VGKAIEKVIGDEKP----VDEKWVFVGSKDADLTDLQSTRAMFER---------------
Bambifaria                IGHALKQELADSGYS------NVVAITSSDIDLRDQSATEKMFDELR-------------
                                                                                      

CPelagibacter             ----------------------------KKPDFIFIAAAKVGGIYYNLKYKADFITENLQ
GOS_715010                ---------------------------------------------------------NIQ
Mbarkeri                  ----------------------------EKPEYVFLAAAKVGGILANSTYPAEFIYENLM
Mmazei                    ----------------------------EKPEYVFLAAAKVGGILANNTYPAEFIYENLM
Sulfurihydrogenibium      ----------------------------EKPDYVFLAAAKVGGILANNTYPAEFIYDNLA
Nchthonoplastes           ----------------------------ERPEYVFLAAAKVGGINANNTYRAEFLYDNLM
Cjejuni1                  ----------------------------EKPEYVFLSAAKVGGIGANNTYRADFIYQNLM
Cjejuni2                  ----------------------------EKPEYVFLCAAKLDTLGLFTP--ADVIYENSV
Amuciniphila              ----------------------------EKPEYVFLAAAFVGGIIANSRYRADFIFRNLQ
Cacetobutylicum           ----------------------------EKPDYVVLSAAKVGGIQANISNPVDFLMDNLI
Geobacillus               ----------------------------ERIDYVFLAAAKVGGILANDTYPADFLRENIL
Noceani                   ----------------------------ARPDYLFIAAAKVGGIYANNTYRAQFIYENLV
dproteobacterium          ----------------------------EKPDYIFLAAARVGGIQANNTRPADFIYENLA
Rleguminosarum            ----------------------------ERPDYIFMAAARVGGIHANNVYRAEFLYQNLM
Bvietnamiensis            ----------------------------EAIEVVVLAAAKVGGILANDTYPADFLYLNLM
Athaliana                 ----------------------------EKPVYVILAAAKVGGIHANNTYPADFIGVNLQ
Vvinifera                 ----------------------------EKPQFVILAAAKVGGIHANKTYPADFIAINLQ
Ddesulfuricans            ----------------------------YRPEYVFLAAAKVGGIHANSTYPADFIRDNLQ
Sgriseus                  ----------------------------VRPDAVVLAAAKVGGIMANSTYPVQFLEDNLR
Cmichiganensis            ----------------------------EEPVHVVLAAAKVGGILANSTYPVDFLSDNLR
Mpopuli                   ----------------------------RRPDAVFLAAAKVGGILANATYPADFLYENLM
Ecoli                     ----------------------------ERIDQVYLAAAKVGGIVANNTYPADFIYQNMM
Synechococcus             ----------------------------NHPDVVVLAAATVGGIEANRSRPADFLLQNLS
bacterium                 ----------------------------EKPEYVFVAAAKVGGILANSQQPVAFLHDNLV
Mmaripaludis              ----------------------------EKPEYLFMVAGLVGGIYGNMKRNADFLYQNSI
Ggallus                   PLLRACAHTLTATSCTLQVLWRQSSPLESKPTHVIHLAAMVGGLFKNIRCNLDFWRRNIH
Aaegypti                  ----------------------------HQPTHVIHLAAMVGGLFHNMNNNLDFLRKNIQ
Bambifaria                ------------------------------PTIVFHMAARVYGIMGNMSNRGIAYLDNVR
                                                                                   *  

CPelagibacter             IQTNLIHGAYKCG-IKDLIFLGSSCVYPKNCKQPIKETYLLSGKLEETNDAYAIAKIAGI
GOS_715010                IQTNLIHCAYKFN-VKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKISGV
Mbarkeri                  IESNIIHAAYKCG-VEKLLFLGSSCIYPKLAPQPLKEEYLLTGSLEETNEAYAIAKIAGI
Mmazei                    IEANIIHASYKCG-VKKLLFLGSSCIYPKLAPQPLKEEYLLTGPLEETNEAYAVAKIAGI
Sulfurihydrogenibium      IALNVIHSAYEYR-VKKLLNLGSSCIYPKYAPQPMKEEYLLTGSLEPTNEAYAIAKISAI
Nchthonoplastes           IESNIIHSAYLSG-VEKLLFLGSSCIYPKHCPQPMQEEHLLTGFLEPTNEPYAIAKIAGL
Cjejuni1                  IQNNVIHQSYLNG-VKKLLFLGTACIYPRECPQPIKEEYLLTSKLEYTNEPYAIAKIAGL
Cjejuni2                  LQANIIHSSYQNN-VKKLIFYGSAWAYPQKAINPIKEENLLDGKLDLKAVAYGLPKIIGT
Amuciniphila              IQQNVIGESFRHG-VSKLLFLGSTCIYPREAPQPMKENALLTSPLEYTNEPYAIAKIAGL
Cacetobutylicum           IEYNVIKNSFEVG-IENLLFLGSSCIYPKEAPQPLKEEYLLSGYLEPTNEGYAIAKISGL
Geobacillus               IQNNVIHNAYTYG-VKKLLFLGSSCIYPKYSKQPIKEDYLLTGKLEPTNEWYAIAKIAGI
Noceani                   IQSNLIHGAYLAG-VKRLCFLGSSCIYPKKCPQPIREDYLLTGPLEPTNEPYAIAKIAGV
dproteobacterium          IQNHVIHGALRAG-VSDLCFLGSSCIYPRECPQPIREEYLLTGPLEETNAPYAVAKIAGI
Rleguminosarum            IETNVVHAAWQAG-VERMLFLGSSCIYPRDCPQPIREEYLLTGPLEQTNEAYAIAKIAGV
Bvietnamiensis            IEANVIHAAYRSG-VQRLVFLGSSCIYPRDCPQPIKEAYLLSGPLEKTNEPYAIAKIAGI
Athaliana                 IQTNVIHSAYEHG-VKKLLFLGSSCIYPKFAPQPIPESALLTASLEPTNEWYAIAKIAGI
Vvinifera                 IQTNVIDSSYRHG-VKKLLFLGSSCIYPKFAPQPITEEALLTGPLEPTNEWYAVAKIAGI
Ddesulfuricans            IQTNVIDAAYRNG-TQKLLFLGSSCIYPKFAPQPMPEDCLLTSALEPTNECYALAKIAGI
Sgriseus                  IQLSVVAGAHAAG-VERLLFLGSSCIYPRLAPQPIREDALLTGELEPTNEAYALAKIAGI
Cmichiganensis            IQVNVLDAALAHG-VDRLLFLGSSCIYPKLAPQPITEDSLLTGHLEPTNDAYAIAKIAGI
Mpopuli                   IEANVIEAAFRED-VGKLLFLGSSCIYPKFAEQPIIEPSLLTGSLEPTNEWYAIAKIAGI
Ecoli                     IESNIIHAAHQND-VNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIAGI
Synechococcus             LQTNVMEAAWQAG-TRRLLFLGSSCIYPKFAEQPIREETLLTGALEPTNEWYAIAKIAGI
bacterium                 IQDNLIYGAYEQG-VKKLLFLGSSCIYPKLAPQPLKEDYLLSGPLEPTNQWYAIAKIAGI
Mmaripaludis              MILNVLESIKNCSKDTKILYTGSTCIYPKENPQPISENRLLNGLLEESNKGYALAKILGI
Ggallus                   INDNVLHSAYECG-VQKVVSCLSTCIFPDKTTYPIDETMIHNGPPHSSNFGYSYAKRMID
Aaegypti                  INDNVLLLSHEFK-VRKVVSCLSTCIFPDKTTYPIDETMIHNGPPHDSNFGYSYAKRLID
Bambifaria                INTNVVEAARQTG-CKKFVAMGSTAIYSDQVRLPMSEEQIWVGAPHHSEAPYAHSKRGML
                          :   ::           .    ::  :.     *: *  :  .  . .   *. .*    

CPelagibacter             KMCQSYNEQYKTKYKCLMPTNTYGPNDNYDKNNSHFIPALIKKIHKLKLSKKN-------
GOS_715010                KMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRN-------
Mbarkeri                  RLCKHYNHQYGTNFISVMPTNLYGPNDNFDLETSHVMPALIRKFHEAKVN----------
Mmazei                    RLCKHYNQQYGTNFISVMPTNLYGPNDNFDLETSHVMPALVRKFHEAKVN----------
Sulfurihydrogenibium      KLVRYYNQQYGTNFISVMPTNLYGPNDNFNLETSHVLPALIRKFHLAKLLEQGDIEGIKK
Nchthonoplastes           KLCENYCRQYGVNFISAMPTNLYGLNDNFDLANSHVLPALLRKTHEAKIN----------
Cjejuni1                  KMCESYNLQYKTNFISVMPCSLYGANDNFNLETSHVLPAFIRKMHLAKVLQEEGVAKVQY
Cjejuni2                  KMCESYNLQYGTNFITLYLANLYGETTEFDLQKAKVLPALLRKFHLAKLLDENKIDEVLK
Amuciniphila              KMCESFNLQYGTNYIAVMPTNLYGPNDNFHLENSHVLPAMVRKIHLAKCLMEGDWNAVRK
Cacetobutylicum           KMCEYYSKQYGLNYISAMPSNLYGMRDNFDLKTSHVMAALIRRFHEAKVSGSQ-------
Geobacillus               KMAQAYSKQYGFNVISLMPANLYGPNDNFDLKTSHVLPALLRKFHEAKVN----------
Noceani                   KMCESYNQQYGTRYISVMPTNLYGPHDNYDLNNSHVLPALIRKAHEANLRGDE-------
dproteobacterium          KLCQACNQQYGTRYVAVMPTNLYGPNDNYDLEASHVLPALIRKAHEARTGELA-------
Rleguminosarum            KLCESYNRQYGTRYVSGMPTNLYGPNDNYDLDSSHVMPALIRKVHEAKIRGDR-------
Bvietnamiensis            KLCESYNRQYGTRYVSLMPTNLYGPNDNYDLRTSHVLPALLRKAHEAKVEGRE-------
Athaliana                 KTCQAYRIQHGWDAISGMPTNLYGPNDNFHPENSHVLPALMRRFHEAKVNGAE-------
Vvinifera                 KMCQGYRLQHGFDAISGMPTNLYGPYDNFHPENSHVLPALIRRFHEAKVSGAK-------
Ddesulfuricans            KMCQAYRKQYGFDAISAMPTNLYGPGDNYHPENSHVIPALIRRFHEAKVQGLP-------
Sgriseus                  VQIQSYRRQYGASYISAMPTNLYGPGDNFDLETSHVLPALIRRFHEARRDGAP-------
Cmichiganensis            MQIQAVRRQYGLPWLSAMPTNLYGPGDNFSPQGSHVLPALIRRYDEARASGAE-------
Mpopuli                   KLAQAYRQQHDRDFISAMPTNLYGPGDNFDLTSSHVLPALIRKAHEAKCSGAK-------
Ecoli                     KLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAP-------
Synechococcus             KLAEALRQQHGFDAISLMPTNLYGPGDNYHPTGSHVLPALIRRFHEAKQANAP-------
bacterium                 KLCEALRRQHGCDFISAMPTNMYGPNDNYDLQNSHVLPALIRKFHEAKIANSAT------
Mmaripaludis              VGCELYKKQYGINSICVMPTNMYGPNDTYDLEDGHFIPSLIKKFVDAKNNNLK-------
Ggallus                   VQNRGYFEQHGCRFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVYLAK------------
Aaegypti                  ITNRAYNQQHGDMFTSVVPCNVFGPYDNFTPGVSHVIPGMIHRLHEIMYLKDQEKP----
Bambifaria                AQLEAYKDQYGMDYAFCVSTNLFGPHDKFDEKFGHVIPSLVSKFYRASVLGQP-------
                             .    *:          . :*    :    .:.:..:: :                 

CPelagibacter             ---------------------------------------TVILWGNGKAKREVIHVDDIA
GOS_715010                ---------------------------------------YINLWGDGKTKRELIYVDDLA
Mbarkeri                  ------------------------------------NKPEVVVWGTGKPLREFMHVDDMA
Mmazei                    ------------------------------------NEPEVVIWGTGKPYREFLHVDDMA
Sulfurihydrogenibium      DFRKYTIGFGLDKEIDFNDNDSILKVLSKLGIISLASKVSLTIWGSGEVYREFLYVDDLA
Nchthonoplastes           ------------------------------------NAEAVEIWGTGSPLREFLYVDDLA
Cjejuni1                  LLNFN-----------------DESEVKNYLNRFGVTENSVEIWGSGKAMREFLHADDMA
Cjejuni2                  DLQMN-----------------FLEQAMEYLQKFGVSKDSVEIWGSGSVIREFIHAKDLV
Amuciniphila              DLNARPV--------EQVDGTAEEKEILAVLAKYGITPGSVELWGTGTPLREFLWSEDMA
Cacetobutylicum           ---------------------------------------EISIWGSGEQYREFTYIEDLA
Geobacillus               ------------------------------------NMDTVTIWGTGTPRREFLHVDDLA
Noceani                   ---------------------------------------KWVVWGTGTPRREFLYVDDMA
dproteobacterium          ---------------------------------------ELVVWGSGTPRREFLYVDDLA
Rleguminosarum            ---------------------------------------QLVVWGSGRPMREFLYVDDMA
Bvietnamiensis            ---------------------------------------SLTVWGTGRVRREFLHVDDMA
Athaliana                 ---------------------------------------EVVVWGTGSPLREFLHVDDLA
Vvinifera                 ---------------------------------------EVVVWGTGSPLREFLHVDDLA
Ddesulfuricans            ---------------------------------------QVTIWGTGAPRREFLYSDDLG
Sgriseus                  ---------------------------------------EVTLWGSGSPRREFLHVDDLA
Cmichiganensis            ---------------------------------------SVTNWGTGTPRREFLHVDDMA
Mpopuli                   ---------------------------------------EMVIWGTGSPRREFLHVDDCA
Ecoli                     ---------------------------------------DVVVWGSGTPMREFLHVDDMA
Synechococcus             ---------------------------------------SVTCWGSGTPLREFLHADDLG
bacterium                 ----------------------------------------VTCWGTGTPLREFLYADDLA
Mmaripaludis              ---------------------------------------ELTFWGTGIPRREALYVDDCA
Ggallus                   -----------------------------------QNGSALTVWGTGKPRRQFIYSLDLA
Aaegypti                  -----------------------------------QEEKVFPVYGTGKPLRQFIYSIDLA
Bambifaria                ----------------------------------------ISVWGSGKAERDFLFSGDAA
                                                                     :* *   *:     *  

CPelagibacter             EACIFFMKKKTEHF-------------LINIGTGKDYSIKYYLEFIAKVILGNKKIKIKY
GOS_715010                EASIYFLFKKTKKN-------------LINIGTQKDFTIEYYAKKIMKILD--IKLKIKY
Mbarkeri                  DACVFLMENYDFSEVG----------EFVNIGVGEDVTISELVKLIKEIVG--FEGKINY
Mmazei                    DACVYLMENFNTDDIG----------EFVNIGVGKDITIGELAELIKEIVG--FKGEIRK
Sulfurihydrogenibium      DACVYLMENINALDMAKLCN-----DYFVNVGTGKDIKIKDLAILIKDIVG--FKGEIIH
Nchthonoplastes           DALVFLMNHYDDIQFVN-------------VGTGEEVSIKDLAMLIKAVVG--YEGELKF
Cjejuni1                  DACVYVMEKVNFNDLYKNNDV-EIRNTHINIGSGKDISIKDLAELVKHIVE--YRGNLVF
Cjejuni2                  NASIYVMKNIDFKDIVSSN------EPHLNVGSGEFLSIKELACLIKNIVG--FKGEIMF
Amuciniphila              DACVHVMEQVDFSQLQEGGR--EVRNCHINIGTGKEISIGGLARLIAATAG--YRGNLAF
Cacetobutylicum           DGIIFLMEHG------------EKVKGFLNIGCGKDIKIKDLAYKIKDVVG--FKGNIIF
Geobacillus               DACIFLMNNYDSPEIIN-------------VGTGKDISILKLAQKIKEIVG--FKGRIVT
Noceani                   NACILLMEKDIPGG-------------LFNVGTGVDVTIKELAEMIMGVVG--FQGSIVF
dproteobacterium          DACVFLMERGIGHG-------------LYNVGLGRDITIRELAETVMAAVG--FKGRIVF
Rleguminosarum            DACVFLMEKEVSEG-------------LINIGTGEDITIRELAETIMRVVG--FTGEIVY
Bvietnamiensis            DATIFALEVGLESG-------------LYNVGCGSDVTIEELAREAMQAVG--FNGRIEF
Athaliana                 DACVFLLDRYSG-------------LEHVNIGSGQEVTIRELAELVKEVVG--FEGKLGW
Vvinifera                 DGVVFLMDKYSG-------------LVHVNVGSGKEVTIKELAELVKEVVG--FEGELVW
Ddesulfuricans            DALVFLMKNYSD-------------IEHVNVGYGEDVTIKELAGLVAKVVG--YAGEILT
Sgriseus                  AACVTLLEAYDG-------------DEPVNIGCGEDLTIRELARTVAEVTE--YRGSIGW
Cmichiganensis            AACLHLLEHYDG-------------PEQVNVGTGTDVTIREIAETIARVVG--YEGRTEW
Mpopuli                   DACLHLMKTYSD-------------DEHVNVGSGEDIPIYDLTCLVCDVVG--FEGEIVR
Ecoli                     AASIHVMELAHEVWLENTQP----MLSHINVGTGVDCTIRELAQTIAKVVG--YKGRVVF
Synechococcus             EACVFALENWSALSANAPKDDQGAPLAFLNVGTGIDLSIRELAEQVAEAVG--YSGTIHW
bacterium                 AACFFLMENYSEEQ-------------FINIGYGNDISIKELAELVKKIID--YRGEIVW
Mmaripaludis              DACIYLMDNYNSPD-------------IINIGTGFDYSIKEYIEIMKKVLD--FDVEINW
Ggallus                   RLFVWVLREYEEVEP-----------IILSVGEEDEVSIREAAEAIVEAMD--FRGELIF
Aaegypti                  KLFIWVLRSYESVDP-----------IILSVDEEAEVSIAQLAESLVKAFD--FKGKIEF
Bambifaria                YALRLIAENHTG---------------AINLATGQSHTIRHTVDTLCQISG--FSGSVEW
                                                        :       *                     

CPelagibacter             DKTKPNGSPRKVMDISLAKKYG-WKSKMSLITSIRNTYKSFVRENF-------------
GOS_715010                INKNLKGTPRKKLDCSLATNLG-WRPKIKIDKGLEISIKDFIENYKEYTK---------
Mbarkeri                  DTSKPDGTPRKLMDVSRLNGLG-WKARMSLKDGIKETYEWYQDQIK-------------
Mmazei                    DLSKPDGTPQKLLDITKLSSLG-WKANISLKDGIRQTYEWYQSQIK-------------
Sulfurihydrogenibium      DLTKPDGTPRKLLDVSKINQLG-WKAKTSLEEGILKTYEEYIRKLENEKQGSEEYKSEM
Nchthonoplastes           DSSKPDGTPRKLLDTSKINAAG-WQPKISLKKGLELTYQWFVENYERIKGK--------
Cjejuni1                  NTNKPDGTMKKLGSCKRINSLG-WKAKIKLEYGIKMMYEWYLKEQNIRQ----------
Cjejuni2                  NNSKPDSTMDRMLDSSRLQNLG-WKAKIKLEDGIKMMYEWYLKEQNIRQ----------
Amuciniphila              NADKPDGTMRKLTDVSKLHSLG-WKHRVELEEGVERIYRWYLSRMEADGN---------
Cacetobutylicum           DKSKPDGMFRKVMDVSKINSLG-WHYKVELDEGITKTYRWYLNNC--------------
Geobacillus               DTSKPDGTPRKLLDITKLNNLG-WKSKIPLSRGIEETYSWFLENKDKLY----------
Noceani                   DSSKPDGTLRKLLDVSRIQELG-WRPQIDLREGINKAYRDFLNRVAA------------
dproteobacterium          DRSKPDGTPRKLLDVSRLEALG-WRAQTPLTEGIALAYADYLAR---------------
Rleguminosarum            DQTKPDGTPRKLMSVDRLSALG-WKATTSLGDGIARAYADFAS----------------
Bvietnamiensis            DTTKPDGTPQKLLDVGLLAQLG-WRAKIGLREGLASTYQEFLQRHDVAVAERI------
Athaliana                 DCTKPDGTPRKLMDSSKLASLG-WTPKVSLRDGLSQTYDWYLKNVCNR-----------
Vvinifera                 DTSKPDGTPRKLMDSSKLAELG-WVPKIALKEGLVDTYKWYLENVKQ------------
Ddesulfuricans            DPSMPDGTPRKLLDCTKLFSMG-WRPHVQLAEGLDFAYRDFTAVLP-------------
Sgriseus                  DTSKPDGTPRKLLDVTRLSSLG-FTPRIPLRDGVARTYAWWLGQLQPGQ----------
Cmichiganensis            DTSKPDGTPQKLLDVSKLADAG-WTSSIGLDEGLRSTVAWYREHIETLRE---------
Mpopuli                   DPTKPDGTPRKLMSADKLRGLG-WAPRVPLRDGIAETYAWFRANVAEA-----------
Ecoli                     DASKPDGTPRKLLDVTRLHQLG-WYHEISLEAGLASTYQWFLENQDRFRG---------
Synechococcus             DTSKPDGTPKKQLNVSRLSELG-WSARIPLSEGLLSAVQDFERNLSLGRLRE-------
bacterium                 DTSKPDGTPRKLMDSSKLFALG-WTPKVSLEIGIKSAYKDFLQKFHRPLAP--------
Mmaripaludis              DLSKPDGVFEKRTDISKLKEIMPEFNPRSFEDGVKEVLNDDF-----------------
Ggallus                   DTTKADGQFKKTASNAKLRHYLPNFQFTPFRQAVKETCTWFSTNYASARK---------
Aaegypti                  DTSKADGQYKKTASNAKLRKLLPDFKFTDFDSAIKESVQWYVENYDNARK---------
Bambifaria                DATKPDGQKLRAYDISRLTALG-FKPRFSFDEALAITYDWYCKNVASARK---------
                               ..   :  .               :  .:                         



---------------------------------------------------------------------------------------------------


b) Alignement multiple sur les  a-, d-, e-protéobactéries :
INFOBIOGEN / CLUSTALW Alignement multiple / Format de sortie : Clustal / Nature des séquences : protéiques 



CLUSTAL W (1.82) multiple sequence alignment


a1CPelagibacter       ---------------MINRNSRIFITGHKGLVGSAIYRK----LKAKGYTNLLIADRKKL
GOS_715010            ------------------------------------------------------------
aBradyrhizobium       ------------------------------MVGSALVR----RLASEGVELQTVSRG-EV
dDdesulfuricans       --------------MTLSPESLIYVAGHGGLVGAAIVR----RLQAEGCQNLLLRRSREL
aMpopuli              --------------MYSLAGKTVFVAGHRGLVGSALVR----RLKAEDCAILTATRA-EL
aHphototrophica       ----------MGDRRYSLSGKRIYVAGHNGMVGSAIAR----RLARENCAVLTATRS-EL
aMnodulans            ----------------------MWVAGHRGMVGSAVVR----RLEAGERCSVLTVSRRDV
dGsulfurreducens      ----------------MDRNARIYVAGHRGLVGSAIVR----KLTAEGYGNLLLRTSGEL
aLvestfoldensis       --------------------MRIYIAGHTGMVGSAILR----HLAITGGHDLITADRQQL
aRoseobacter          --------------------MRIFLAGHNGMVGSAILR----KLVATRDHDVITVAHAAL
aPgallaeciensis       ---------------MGTSTVKIYVAGHRGMVGGAILRRLQARRAAGEDIQLITRTSAEL
aRleguminosarum       ----------------MNRDVKIYVAGHRGMVGSAIVR----RLKAGGYTNIVTRSHAEL
dproteobacterium      -----------MMMPKIDKSSKIYVAGHRGMVGTALVR----RLERGGYRNLLTRSRAEL
aMloti                --------------MENKKMKKVYVAGHRGLVGSATMR----ALEALGSYEIITRTHDEL
dDoleovorans          ----------------MEKDAVIYIAGHRGLAGSALVR----QLEAQGYTDLLTRTHAEL
dGeobacter            ----------------MNSNNKIFIAGSKGLVGSALTR----SLKDAGYHNLLTPGKDQL
a2CPelagibacter       -----------------MSKLKIFIAGHNGMVGSALIR-----NLKTQNVEIITKEKKEL
dCbacterium           ----------------MNKKSKIYIAGHKGLVGSAIVEN----LQKKGYTNLIYKTHKEL
eCjejuni1             ----------------MFKDSKIYIAGHRGLVGSSILKK----LQNDGYENLIFRTHSEL
eCjejuni3             ----------------MQTNSKIYIAGHKGTAGTALVEN----LQKRGFNNLVLKTRQEL
eCjejuni2             ---------------MMQKDSKIYIAGHGGTLGKTLYNT----LIDEGFNNIIVKTRKEL
aAcaulinodans         MRESEGLYGDREGIPRVGKGKKLLITGGRGMVGRN--LIAC---AARSGWEIIAPTSVDL
eHpylori              ------------------MNEIILITGAYGMVGQNTALYFK---KNKPDVTLLTPKKSEL
eAdehalogenans        -------------MKFDWSSERVVVTGGAGFLGGFVQEA----LRRRGAKDVFVPRSKDY
eSaciditrophicus      -------------MPTDFTDKRIAVTGGKGFLGKHLISR----LQERGCRQIIIVDLPEY
aCaulobacter          ------------------MAGRILVTGATGFLGRHMTPVLS---EAYPDREIVGVSSADG
                                                                                  

a1CPelagibacter       DLTNQIKVIKFLKKKKPDFIFIAAAKVGGIYYNLKYKADFITENLQIQTNLIHGAYKCGI
GOS_715010            -------------------------------------------NIQIQTNLIHCAYKFNV
aBradyrhizobium       DLRDQAAVFSWFARAKPQVVFLAAAKVGGIVANNTLRAEFIYDNIAIATNVIHAAHVNGA
dDdesulfuricans       DLRNQQAVDDFFATYRPEYVFLAAAKVGGIHANSTYPADFIRDNLQIQTNVIDAAYRNGT
aMpopuli              DLRDQAAVRAWMRDRRPDAVFLAAAKVGGILANATYPADFLYENLMIEANVIEAAFREDV
aHphototrophica       DLVNQSAVEAWFADNKPDAVFLAAAKVGGILANDTLPANFLYENLMIEANIIQAAHHNKV
aMnodulans            DLTHQEATERWIKQQRPDVVVLAAAKVGGILANSQYPADFIGQNLAIALNVIRASHAVGV
dGsulfurreducens      DLRDQAAVAAFFAAEQPDYVFLAAAKVGGIVANNTYPAEFIYDNLMIEANVIHSSYRTGV
aLvestfoldensis       DLTDQRAVRDFMQAQRPDAVVLAAARVGGIMANATYPADFIHDNLLIAANVIHAAHSAGV
aRoseobacter          DLTNQAAVRSFVWAKKPDLVIIAAAKVGGIMANDTKPADFIQDNLMIASNLIQEAHAAGV
aPgallaeciensis       DLTDQAMVQAFFAAERPDQVVLAAAKVGGIHANNAYPAQFIYENLMMECNVIHAAHQQGV
aRleguminosarum       DLVNQAAVAEFMKAERPDYIFMAAARVGGIHANNVYRAEFLYQNLMIETNVVHAAWQAGV
dproteobacterium      DLLDQAAVFDFLGREKPDYIFLAAARVGGIQANNTRPADFIYENLAIQNHVIHGALRAGV
aMloti                DLFDRSETRRFFMSQRPDYVVMCAAKVGGILANASSPVDFLHNNLAIQVSVFDAAYASGV
dDoleovorans          DLTCQADTESFFQAHRPAYVFMAAAKVGGILANNTFPAEFIYQNLAIQTNIIHAAYRAGV
dGeobacter            DLTDHIGVKAFFESEKPEYVVLAAAKVGGIQANNTYPADFIYQNLAIQNNVIHQSHLNGV
a2CPelagibacter       NLLNQDDVQNFLKYQKIDQVYLAAAKVGGIHANNTYPAEFIYENLMIQTNVIHGSFLGGI
dCbacterium           DLINQQEVAAFFENEKPEYVILAAAKVGGIVANNTYRADFIYENLQIQNNVIHQSYKHKV
eCjejuni1             DLTNQKAVADFFVKEKPEYVFLSAAKVGGIGANNTYRADFIYQNLMIQNNVIHQSYLNGV
eCjejuni3             DLVNQQAVAKFFKEEKPEYVFLTAVLPCGAAN-VAQRADFIYENLMIQNNVIHNSFLNNV
eCjejuni2             DLVDQKAVTDFFAKEKPEYVFLCAAKLDTLG--LFTPADVIYENSVLQANIIHSSYQNNV
aAcaulinodans         DLRNAEAVEQYIRRQLPDVVVHAAGVVGGIHANIADPIHFLADNAAMALNVVMSSFRSEV
eHpylori              CLLDKDNVQAYLKEYKPTGIIHCAGRVGGIVANMNDLSTYMVENLLMGLYLFSSALDSGV
eAdehalogenans        DLVQMEGVRALYRDARPTMVLHLAARVGGIGANRDNPGKFFYDNLMMGVQLIEVGRQVGL
eSaciditrophicus      HLVHQDDIRKMYGEVKPDIVIHLAAKVGGIGFNQANPATLFYENLMMGVQLLHEGWAQGI
aCaulobacter          DLTSFDVTRALLERVRPDAVIHLAAYSGGIGANRSWPADFYWRNITLVSNMYEAAAQTGV
                                                                 *  :   :   .     

a1CPelagibacter       KDLIFLGSSCVYPKNCKQPIKETYLLSGKLEETNDAYAIAKIAGIKMCQSYNEQYKTK--
GOS_715010            KDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKISGVKMCEYYNEQYNTN--
aBradyrhizobium       EKLMFLGSSCIYPKLAPQPLREDAMLTGPLESTNEPYAIAKIAGIKMVEAYRSQYDA---
dDdesulfuricans       QKLLFLGSSCIYPKFAPQPMPEDCLLTSALEPTNECYALAKIAGIKMCQAYRKQYGF---
aMpopuli              GKLLFLGSSCIYPKFAEQPIIEPSLLTGSLEPTNEWYAIAKIAGIKLAQAYRQQHDR---
aHphototrophica       EKLLFLGSSCIYPKFANQPIAEDQLLTGPLEPTNEWYAVAKIAGIKLCQAYRKQHGA---
aMnodulans            RKLLFLGSTCIYPKFASQPLNEDALLTGPLEPTNEWYAVAKIAGIKLCQAYRLQHGN---
dGsulfurreducens      SKLLFLGSTCIYPKMASQPIREEYLLTGPLEPTNEAYAIAKIAGISLCRSYNRQYGT---
aLvestfoldensis       RRLLQLGSSCIYPRDAPQPITEDALLTGLLEPTNAPYAIAKIAAIKLCESYNRQHGT---
aRoseobacter          QRLIQLGSSCIYPRDTAQPIPESALMTGPLEPTNEPYAMAKIAAIKLCESYNRQYGR---
aPgallaeciensis       ERLLQLGSSCIYPKHAPQPMAEAALLSDVLEATNEPYAIAKIAGIKLCESYNRQYGR---
aRleguminosarum       ERMLFLGSSCIYPRDCPQPIREEYLLTGPLEQTNEAYAIAKIAGVKLCESYNRQYGT---
dproteobacterium      SDLCFLGSSCIYPRECPQPIREEYLLTGPLEETNAPYAVAKIAGIKLCQACNQQYGT---
aMloti                ERMIFLGSSCIYPRDCPQPIREEYLLTGPLEATNRPYALAKIAGVESCWSFNRQYKA---
dDoleovorans          RRLLFLGSSCIYPRECPQPMKEGHLLTGPLEPTNEPYAVAKIAGIKMCQSYNRQYNT---
dGeobacter            KRLLFLGSSCIYPKHAPQPMKEEHLLTGPLEPTNEPYAIAKIAGLKMCEAYNRQYGT---
a2CPelagibacter       KKLLFLGSSCIYPKNANQPMKEDELLTGKLEPTNEPYAISKIAGIKMCESYNRQYAQSHN
dCbacterium           TKLLFLGSTCIYPKNAPQPMTEDSLLTSPLEYTNEPYAIAKIAGIKMCESYNLQYGTN--
eCjejuni1             KKLLFLGTACIYPRECPQPIKEEYLLTSKLEYTNEPYAIAKIAGLKMCESYNLQYKTN--
eCjejuni3             KKLVFFGSGYMYPENAKNPLKEEYLFQGDLEYGAYSFGAAKIAGAIMCESYNIQYGTN--
eCjejuni2             KKLIFYGSAWAYPQKAINPIKEENLLDGKLDLKAVAYGLPKIIGTKMCESYNLQYGTN--
aAcaulinodans         VTLINLSSSCMYPACIEGPLKECDILRGPFEVTNEGYALAKTVGLKICEYIDKLPNFN--
eHpylori              KKAINLASSCAYPKFAPNPLKESDLLNGSLEPTNEGYALAKLSVMKYCEYVSAEKGVF--
eAdehalogenans        KKLVALGTICAYPKFCPVPFKEEDLWNGYPEETNAPYGLAKKMLLVQSEAYRQQYGFH--
eSaciditrophicus      EKFVGIGTICAYPKFTPVPFKEEDIWNGYPEETNAPYGLAKKMMLVQAQAYRQQYGFN--
aCaulobacter          KRIVYTMGGCSYPGTATSPISEDQMWEGYPQGDSAAYSAAKKMGIVAAKAYEAQHGIS--
                                 **     *: *  :  .  :     :. .*                   

a1CPelagibacter       --YKCLMPTNTYGPNDNYDKNNSHFIPALIKKIHKLKLSKKN------------------
GOS_715010            --FKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRN------------------
aBradyrhizobium       -DFINVMPTNLYGPGDNYHPEYSHVVAALIRRFHEAKLADAP------------------
dDdesulfuricans       -DAISAMPTNLYGPGDNYHPENSHVIPALIRRFHEAKVQGLP------------------
aMpopuli              -DFISAMPTNLYGPGDNFDLTSSHVLPALIRKAHEAKCSGAK------------------
aHphototrophica       -DFISAMPTNLYGTGDNYDLATSHVLPALIRKVYEAKAAAAP------------------
aMnodulans            -DFISAQPTNLYGPNDNYDLNSSHVMAALIAKIARAKQDSLD------------------
dGsulfurreducens      -RFIAAMPTNLYGPNDNFDLEKSHVLPALIRKFHEAKIAGAP------------------
aLvestfoldensis       -DYRSIMPTNLYGPGDNFHPDNAHVLPALLARFHDAVQSGAD------------------
aRoseobacter          -DYRSLMPTNLYGPGDNFHPDHSHVLPSLLRRYDDAVRSAQR------------------
aPgallaeciensis       -DYRSVMPTNLYGPGDNFHPENSHVLPALIRRFDAAARAGED------------------
aRleguminosarum       -RYVSGMPTNLYGPNDNYDLDSSHVMPALIRKVHEAKIRGDR------------------
dproteobacterium      -RYVAVMPTNLYGPNDNYDLEASHVLPALIRKAHEARTGELA------------------
aMloti                -RYLALMPTNLYGPGDNYHPENCHVLPALIRRFHQAKMNGDS------------------
dDoleovorans          -RFVAVMPTNLYGPNDNFDLETSHVLPALIRKFHEAKKSGAK------------------
dGeobacter            -KFIAVMPTNLYGPGDNFDLANSHVLPALIRKFHEAREQGAP------------------
a2CPelagibacter       IDYRSIMPTNLYGPGDNYHPENSHVVPGLIYRFHEAKVNNLQ------------------
dCbacterium           --FISVMPTNLYGPNDNFDLETSHVLPALLRKMHEAKLNNEP------------------
eCjejuni1             --FISVMPCSLYGANDNFNLETSHVLPAFIRKMHLAKVLQEEGVAKVQYLLNFNDESEVK
eCjejuni3             --FITLVLNNLYGTKANFDFGKSRVLPALLRKFHLAKLLSEGNITQILQDLKMNNFEEAK
eCjejuni2             --FITLYLANLYGETTEFDLQKAKVLPALLRKFHLAKLLDENKIDEVLKDLQMNFLEQAM
aAcaulinodans         --YKTLIACNLYGVGDNFDPRRSHLLPAIIEKIHKASQCGSE------------------
eHpylori              --YKTLVPCNLYGEFDKFEEKIAHMIPGLIARMHTAKLKNEK------------------
eAdehalogenans        --SVVLFPVNLYGPHDNFDLRTSHVIPALVRKCVEARERGDK------------------
eSaciditrophicus      --AIFLLPVNLYGPGDNFDPQSSHVIPALIKKCVDARLQKEE------------------
aCaulobacter          --STVLVPGNLFGEFDNYRNGESHVIPAFLRRFHEAKLNGVT------------------
                               . :*   ::    .:.:..:: :                            

a1CPelagibacter       -----------TVILWGNGKAKREVIHVDDIAEACIFFMKKKTEH------------FLI
GOS_715010            -----------YINLWGDGKTKRELIYVDDLAEASIYFLFKKTKK------------NLI
aBradyrhizobium       -----------EVVVWGTGTPRREFLYVDDMADACVHLMKTYSD------------HELV
dDdesulfuricans       -----------QVTIWGTGAPRREFLYSDDLGDALVFLMKNYSD------------IEHV
aMpopuli              -----------EMVIWGTGSPRREFLHVDDCADACLHLMKTYSD------------DEHV
aHphototrophica       -----------SITLWGSGTPLREFMHADDCADALVFLMQHYSG------------HDHV
aMnodulans            -----------TVTVWGTGEPRREFLHVDDLADAVVFLIKNYSD------------ETSI
dGsulfurreducens      -----------TVTVWGTGAPLREFIHVDDVADAALYLMRHHEG------------NDIV
aLvestfoldensis       -----------HVTIWGSGTPRREFLHVDDLAAAAVFVMGLDATILATETQP---MQSHL
aRoseobacter          -----------AVTIWGTGAPRREFLHVDDLADAVLFTMGLSQDQYAAATRP---MQSHL
aPgallaeciensis       -----------HVTIWGTGTPRREFLHVDDMAAASLFVLDLDPATYRRETSP---MLSHI
aRleguminosarum       -----------QLVVWGSGRPMREFLYVDDMADACVFLMEKEVS------------EGLI
dproteobacterium      -----------ELVVWGSGTPRREFLYVDDLADACVFLMERGIG------------HGLY
aMloti                -----------SVGVWGSGNPRREFMYSSDVGDAIAFLLGLPDSDFDALTAPD--TAPLI
dDoleovorans          -----------DVVVWGTGKPRREFLHVDDLAHAGLFIMNLPDADFDRLAGGS--GAPLI
dGeobacter            -----------EVVVWGTGTPRREFLYVDDMAQACLHLMNLPDSTITEELTTY-PKPCFV
a2CPelagibacter       -----------SVTIWGTGKPKREFLYVDDMANASIHLMNINKKIYDKHVLP---MCSHI
dCbacterium           -----------KVEIWGSGKPRREFLYSEDMADACVFLLENRDFKDTFLKDEKEIRNTHI
eCjejuni1             NYLNRFGVTENSVEIWGSGKAMREFLHADDMADACVYVMEKVNFNDLYKNNDVEIRNTHI
eCjejuni3             EYLHNFGISKKSVEIWGTGKVRREFIHSDDLADVAIYTMQNIDFKDLIKD--RKSKNTHI
eCjejuni2             EYLQKFGVSKDSVEIWGSGSVIREFIHAKDLVNASIYVMKNIDFKDIVS-----SNEPHL
aAcaulinodans         -----------SVSIWGDGTARREFMFAYDFAKIIIKALEVPELIP-----------SSM
eHpylori              -----------EFAMWGDGTARREYLNAKDLARFISLAYENIASIP-----------SVM
eAdehalogenans        -----------QIVVWGDGSASREFLHARDAAEGILDAAERYDRS------------EAV
eSaciditrophicus      -----------EIMVWGTGQATREFFYVEDAAEAIVLAAEKYDKS------------EPV
aCaulobacter          -----------EVTCWGRGIAQRDFVYAEDVAKAIPQFLDRTDVPG------------PV
                                  .  ** *   *: .   *                              

a1CPelagibacter       NIGTGKDYSIKYYLEFIAKVILGNKKIKIKYDKTKPNGSPRKVMDI-SLAKKYGWKSKMS
GOS_715010            NIGTQKDFTIEYYAKKIMKILD--IKLKIKYINKNLKGTPRKKLDC-SLATNLGWRPKIK
aBradyrhizobium       NIGTGEDITIADFARVVAATVG--YQGRLSFDPSRPDGTPRKLLDV-SRLAKLGWRATTS
dDdesulfuricans       NVGYGEDVTIKELAGLVAKVVG--YAGEILTDPSMPDGTPRKLLDC-TKLFSMGWRPHVQ
aMpopuli              NVGSGEDIPIYDLTCLVCDVVG--FEGEIVRDPTKPDGTPRKLMSA-DKLRGLGWAPRVP
aHphototrophica       NVGSGQEVTIRDLALMIARASG--YVGSIDLDPSKPDGTPRKLMDS-TRLGAMGWQPAIA
aMnodulans            NIGVGDDISIRQLAALIAEIVG--WQGRFAFDTSKPDGTPRKLVDV-SRLHSLGWKARIS
dGsulfurreducens      NIGSGEEISIRDLALLVKIVVG--FEGELVFDASKPDGTPRKLSDV-SRLHSLGWRHRIG
aLvestfoldensis       NIGWGTDISIIDLARMIADVTG--FTGQIVCDTTKPDGTPRKLLDC-ARMQRLGWVPKIS
aRoseobacter          NVGTGKDISILKLAHMVADLTG--FCRDTHTDPSKPDGTPRKLLDT-SVMQSLGWAPKIS
aPgallaeciensis       NVGCGQDISILELAQMVAGVVG--FDGEIRTNPEQPDGTPRKLMDV-SRLARLGWQAEIA
aRleguminosarum       NIGTGEDITIRELAETIMRVVG--FTGEIVYDQTKPDGTPRKLMSV-DRLSALGWKATTS
dproteobacterium      NVGLGRDITIRELAETVMAAVG--FKGRIVFDRSKPDGTPRKLLDV-SRLEALGWRAQTP
aMloti                NVGVGEDVTIREVAELVKAAVC--WEGNLVFDTTKPDGTPRKLLDV-TRLRNLGWKAKTS
dDoleovorans          NIGTGKDISIAELAGLIKEITG--FEGDIRFDATKPDGTFQKLLDV-SRMTALGWQAKTD
dGeobacter            NLGTGVDVTIRELAETVREAVG--FEGKLAFDTQQARRHPEEAAGS-IADEGAGMGSEGE
a2CPelagibacter       NIGSGEDLTIKELAEIIKEVVR--FKGKINFDHSKLDGSHRKFLDS-KKINNFGFKPKIS
dCbacterium           NIGTGVDVSIEELAITVKDIVG--YKGELYFNTDKPDGTMMKLTNP-EKLNDLGWKHKVN
eCjejuni1             NIGSGKDISIKDLAELVKHIVE--YRGNLVFNTNKPDGTMKKLGSC-KRINSLGWKAKIK
eCjejuni3             NIGTGIDYSIKEVALMVKNIVG--FSGELVFNTSRPDSTMDRLMDC-SKIHSLGWKHKIE
eCjejuni2             NVGSGEFLSIKELACLIKNIVG--FKGEIMFNNSKPDSTMDRMLDS-SRLQNLGWKAKIK
aAcaulinodans         NVGVGKDLSVLEYYSLVARVIG--WSGEFVYDLNRPVGMRSKLMDI-THLTALGWVPERS
eHpylori              NVGSGVDYSIEEYYEKVAQVLD--YKGVFVKDLSKPVGMQQKLMDI-SKQRALKWELEIP
eAdehalogenans        NLGAGFEIKIRDLVPLVARLCR--FEGELVWDTTKPNGQPRRMLDTSKALREFGWKARIG
eSaciditrophicus      NIGAGFEISIRDLVTLIAELTG--FTGRIVWDSSRPDGQPRRMLDTRRAYEEFGFQAKTD
aCaulobacter          NLSHGATTTIRELAETVADVVG--LKAEIKWDHDKPEGQLIKIFDV-KRMREMGIDCPTG
                      *:.      :      :                        .  .               

a1CPelagibacter       LITSIRNTYKSFVRENF---------
GOS_715010            IDKGLEISIKDFIENYKEYTK-----
aBradyrhizobium       LEDGIARAYQAFLRETGQAAA-----
dDdesulfuricans       LAEGLDFAYRDFTAVLP---------
aMpopuli              LRDGIAETYAWFRANVAEA-------
aHphototrophica       LEVGIARTVAEFRNIAA---------
aMnodulans            LPDGIRQTYRAYQEQMRSR-------
dGsulfurreducens      LEDGVRETYEWFVGQGFPAETM----
aLvestfoldensis       LQQGLHTTYGWVLRQHHAGVALRSS-
aRoseobacter          LHDGLAQTYDWYRTMQEAGQNLRAS-
aPgallaeciensis       LRDGIAQTYEWYLQQDPERLRSK---
aRleguminosarum       LGDGIARAYADFAS------------
dproteobacterium      LTEGIALAYADYLAR-----------
aMloti                LGAGLQATYEDFLRLHAA--------
dDoleovorans          LRTGIQSTYQWCLDHHVF--------
dGeobacter            PQRRRSQVLPVVSGEPGRPPEMK---
a2CPelagibacter       LKNGLLKTYQDYIKL-----------
dCbacterium           LESGIKKVYNWYKNQ-----------
eCjejuni1             LEYGIKMMYEWYLKEQNIRQ------
eCjejuni3             LKDGIKMMYEWYKTQN----------
eCjejuni2             LEDGIKMMYEWYLKEQNIRQ------
aAcaulinodans         LEGGIRSTYQYYITGNEVYE------
eHpylori              LEQGIKEAYEYYLKLLEV--------
eAdehalogenans        FEDGLRETVEWFEANRGSIP------
eSaciditrophicus      FRLGLKKTIDWYVEQRSRELGTKLIL
aCaulobacter          LREGLVKTYAWFQENYAEAGDGLRL-


---------------------------------------------------------------------------------------------------

BLAST

PROTOCOLE:

a) BLASTp contre SwissProt, paramètres par défaut au NCBI
b) BLASTp contre NR, paramètres par défaut au NCBI sauf "Max target sequences=1000", "Alignments=1000"

---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

Nous copions la séquence protéique dans l'outils BLAST sur le site du NCBI.
Notre première approche sera un BlastP contre SwissProt pour avoir une bonne qualité d'annotations.
Nous obtenons une centaine de résultats dont le meilleur a pour E-value 8e-56 et pour score 216,
et le moins bon a pour E-value 3.0 et pour score 32.
Il y a 16 HSP dont le E-value est inférieur à 10e-10, ce qui nous permet d'établir la bonne qualité des résultats
et la présence d'homologues.
Les meilleurs HSPs présentent la désignation : GDP-L-fucose synthetase

Cependant, pour obtenir un nombre plus important d'homologues, afin d'avoir un arbre conséquent, nous effectuons un BlastP contre NR.
Nous obtenons en premier lieu, une centaine de résultats dont tous les HSP ont une E-value et un score très élevés.
Nous recommençons donc la recherche en affichant un plus grand nombre d'HSP (1000).
Le meilleur a pour E-value 8e-71 et pour score 270
et le moins bon a pour E-value 1e-06 et pour score 56.6
Nous fixons comme score seuil 69.7 ce qui correspond à une E-value de 1e-10.
Il y a énormément d'HSP dont le E-value est inférieur à 10e-10, ce qui nous permet d'établir la bonne qualité des résultats
et la présence d'homologues.
Les meilleurs HSPs présentent la désignation : GDP-fucose synthetase chain A

---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:


a) BLASTp contre SwissProt, paramètres par défaut au NCBI



                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|O49213.2|FCL1_ARATH  RecName: Full=GDP-L-fucose synthase 1;...   216    8e-56
sp|Q9LMU0.1|FCL2_ARATH  RecName: Full=Putative GDP-L-fucose sy...   215    2e-55 Gene info
sp|P32055.2|FCL_ECOLI  RecName: Full=GDP-L-fucose synthetase; ...   212    1e-54
sp|P55353|Y4AF_RHISN  Uncharacterized protein y4aF                  208    1e-53 Gene info
sp|Q67WR2.1|FCL1_ORYSJ  RecName: Full=Probable GDP-L-fucose sy...   204    3e-52 Gene info
sp|Q67WR5.1|FCL2_ORYSJ  RecName: Full=Putative GDP-L-fucose sy...   151    3e-36 Gene info
sp|P33217.2|NOLK_AZOC5  Nodulation protein nolK                     134    4e-31
sp|Q8K3X2.1|FCL_CRIGR  RecName: Full=GDP-L-fucose synthetase; ...   107    4e-23
sp|Q5RBE5.1|FCL_PONAB  RecName: Full=GDP-L-fucose synthetase; ...   107    5e-23 Gene info
sp|Q13630|FCL_HUMAN  GDP-L-fucose synthetase (Protein FX) (Red...   106    9e-23 Gene info
sp|P23591.3|FCL_MOUSE  RecName: Full=GDP-L-fucose synthetase; ...   105    2e-22 Gene info
sp|Q9W1X8|FCL_DROME  Probable GDP-L-fucose synthetase (Protein...  79.3    1e-14
sp|Q93VR3|GME_ARATH  GDP-mannose 3,5-epimerase (GDP-Man 3,5-ep...  77.0    7e-14 Gene info
sp|A2Z7B3.1|GME1_ORYSI  RecName: Full=GDP-mannose 3,5-epimeras...  74.7    4e-13
sp|A3C4S4|GME1_ORYSJ  GDP-mannose 3,5-epimerase 1 (GDP-Man 3,5...  74.3    4e-13 Gene info
sp|Q2R1V8|GME2_ORYSJ  GDP-mannose 3,5-epimerase 2 (GDP-Man 3,5...  71.6    3e-12 Gene info
sp|Q57664.1|GALE_METJA  Putative UDP-glucose 4-epimerase (UDP-...  62.0    2e-09
sp|O95455.1|TGDS_HUMAN  RecName: Full=dTDP-D-glucose 4,6-dehyd...  59.3    2e-08 Gene info
sp|Q8VDR7|TGDS_MOUSE  dTDP-D-glucose 4,6-dehydratase               59.3    2e-08 Gene info
sp|A6QLW2.1|TGDS_BOVIN  dTDP-D-glucose 4,6-dehydratase             57.0    9e-08 Gene info
sp|Q9SYM5|RHM1_ARATH  Probable rhamnose biosynthetic enzyme 1      54.3    5e-07 Gene info
sp|Q6DF08|UXS1_XENTR  UDP-glucuronic acid decarboxylase 1 (UDP...  53.1    1e-06 Gene info
sp|Q58455|Y1055_METJA  Uncharacterized protein MJ1055              52.4    2e-06
sp|P39858|CAPI_STAAU  Protein capI                                 52.0    2e-06
sp|O84903.1|GALE_LACCA  RecName: Full=UDP-glucose 4-epimerase;...  50.8    6e-06
sp|Q91XL3.1|UXS1_MOUSE  UDP-glucuronic acid decarboxylase 1 (U...  50.4    8e-06 Gene info
sp|Q8NBZ7.1|UXS1_HUMAN  UDP-glucuronic acid decarboxylase 1 (U...  50.4    8e-06 Gene info
sp|Q5R885.1|UXS1_PONAB  UDP-glucuronic acid decarboxylase 1 (U...  50.1    9e-06 Gene info
sp|Q5PQX0.1|UXS1_RAT  UDP-glucuronic acid decarboxylase 1 (UDP...  50.1    9e-06 Gene info
sp|Q9LH76|RHM3_ARATH  Probable rhamnose biosynthetic enzyme 3      49.3    2e-05 Gene info
sp|Q7WTB1.1|GALE_LACHE  UDP-glucose 4-epimerase (UDP-galactose...  48.9    2e-05
sp|Q6GMI9|UXS1_BRARE  UDP-glucuronic acid decarboxylase 1 (UDP...  47.8    5e-05 Gene info
sp|P44914.1|RFFG_HAEIN  RecName: Full=dTDP-glucose 4,6-dehydra...  46.6    1e-04
sp|Q9LPG6.1|RHM2_ARATH  Probable rhamnose biosynthetic enzyme ...  46.6    1e-04 Gene info
sp|O22141|GAE4_ARATH  UDP-glucuronate 4-epimerase 4 (UDP-glucu...  46.2    1e-04 Gene info
sp|O54067.2|LPSL_RHIME  RecName: Full=UDP-glucuronate 5'-epime...  45.4    2e-04
sp|P39630|SPSJ_BACSU  Spore coat polysaccharide biosynthesis p...  43.5    9e-04
sp|B0RVL0.1|RFBB_XANCB  RecName: Full=dTDP-glucose 4,6-dehydra...  43.1    0.001 Gene info
sp|Q3A8K5|HLDD_PELCD  ADP-L-glycero-D-manno-heptose-6-epimeras...  42.7    0.001 Gene info
sp|P0C7J0.1|RFBB_XANCP  RecName: Full=dTDP-glucose 4,6-dehydra...  41.2    0.004
sp|Q9LPC1|GAE2_ARATH  UDP-glucuronate 4-epimerase 2 (UDP-glucu...  40.0    0.009 Gene info
sp|P33119.2|GALE_CORDI  UDP-glucose 4-epimerase (UDP-galactose...  40.0    0.009
sp|P51106|DFRA_HORVU  Dihydroflavonol-4-reductase (DFR) (Dihyd...  40.0    0.009
sp|Q9Y7X5.1|YGRE_SCHPO  Uncharacterized protein C365.14c           39.7    0.013 Gene info
sp|Q9HDU4.1|YHEB_SCHPO  Uncharacterized protein PB2B2.11           39.3    0.017 Gene info
sp|Q54WS6.1|TGDS_DICDI  RecName: Full=dTDP-D-glucose 4,6-dehyd...  39.3    0.017
sp|Q98I52|HLDD_RHILO  ADP-L-glycero-D-manno-heptose-6-epimeras...  38.9    0.021
sp|Q9LIS3.1|GAE6_ARATH  RecName: Full=UDP-glucuronate 4-epimer...  38.9    0.024 Gene info
sp|Q04973.1|VIPB_SALTI  RecName: Full=Vi polysaccharide biosyn...  38.5    0.025
sp|Q72ET7|HLDD_DESVH  ADP-L-glycero-D-manno-heptose-6-epimeras...  38.5    0.027 Gene info
sp|Q9M0B6|GAE1_ARATH  UDP-glucuronate 4-epimerase 1 (UDP-glucu...  38.5    0.030 Gene info
sp|Q04871|YCL2_ECO11  Uncharacterized 37.6 kDa protein in cld ...  38.5    0.030
sp|A1VGB0.1|HLDD_DESVV  ADP-L-glycero-D-manno-heptose-6-epimer...  38.1    0.034 Gene info
sp|Q59745|EXOB_RHILT  UDP-glucose 4-epimerase (UDP-galactose 4...  37.4    0.060
sp|P29782|STRE_STRGR  dTDP-glucose 4,6-dehydratase                 36.6    0.095
sp|O81312|GAE3_ARATH  UDP-glucuronate 4-epimerase 3 (UDP-glucu...  36.6    0.11  Gene info
sp|Q45291.2|GALE_CORGL  UDP-glucose 4-epimerase (UDP-galactose...  36.2    0.15 
sp|P55180.1|GALE_BACSU  UDP-glucose 4-epimerase (UDP-galactose...  36.2    0.15 
sp|P55462|RFBB_RHISN  Probable dTDP-glucose 4,6-dehydratase        35.8    0.16  Gene info
sp|Q9STI6.1|GAE5_ARATH  RecName: Full=UDP-glucuronate 4-epimer...  35.8    0.17  Gene info
sp|P26503|EXOB_RHIME  UDP-glucose 4-epimerase (Galactowaldenase)   35.8    0.20 
sp|Q87T56.1|HLDD_VIBPA  RecName: Full=ADP-L-glycero-D-manno-he...  35.0    0.28 
sp|P96995.2|GALE_STRMU  UDP-glucose 4-epimerase (UDP-galactose...  35.0    0.28 
sp|Q9CNY5.1|GALE_PASMU  UDP-glucose 4-epimerase (UDP-galactose...  35.0    0.29 
sp|A1KT78.1|HLDD_NEIMF  ADP-L-glycero-D-manno-heptose-6-epimer...  34.7    0.37  Gene info
sp|Q5P2S1.1|HLDD_AZOSE  RecName: Full=ADP-L-glycero-D-manno-he...  34.7    0.44  Gene info
sp|Q9W0P5.1|GALE_DROME  Probable UDP-glucose 4-epimerase (UDP-...  34.3    0.55 
sp|P26391.1|RFBB_SALTY  RecName: Full=dTDP-glucose 4,6-dehydra...  33.9    0.64 
sp|Q9WWX6|HLDD_BURPS  ADP-L-glycero-D-manno-heptose-6-epimeras...  33.9    0.65 
sp|A3MHP7.1|HLDD_BURM7  ADP-L-glycero-D-manno-heptose-6-epimer...  33.9    0.65  Gene info
sp|Q56093.2|GALE_SALTI  UDP-glucose 4-epimerase (UDP-galactose...  33.5    0.83 
sp|Q2SY18|HLDD_BURTA  ADP-L-glycero-D-manno-heptose-6-epimeras...  33.5    0.86  Gene info
sp|P51110.1|DFRA_VITVI  RecName: Full=Dihydroflavonol-4-reduct...  33.5    0.89 
sp|P22715.2|GALE_SALTY  UDP-glucose 4-epimerase (UDP-galactose...  33.5    0.90 
sp|P55293.1|RFBB_ECOLX  RecName: Full=dTDP-glucose 4,6-dehydra...  33.5    0.93 
sp|Q8RIA5|HLDD_FUSNN  ADP-L-glycero-D-manno-heptose-6-epimeras...  33.5    0.93 
sp|A4SHC0.1|HLDD_AERS4  ADP-L-glycero-D-manno-heptose-6-epimer...  33.5    0.95  Gene info
sp|Q47GJ3|HLDD_DECAR  ADP-L-glycero-D-manno-heptose-6-epimeras...  33.5    1.00  Gene info
sp|Q0A4T8.1|HLDD_ALHEH  ADP-L-glycero-D-manno-heptose-6-epimer...  33.5    1.0   Gene info
sp|A1TYR6.1|HLDD_MARAV  ADP-L-glycero-D-manno-heptose-6-epimer...  33.1    1.1   Gene info
sp|Q9K002.1|HLDD_NEIMB  RecName: Full=ADP-L-glycero-D-manno-he...  33.1    1.1  
sp|Q9SA77.1|ARAE1_ARATH  RecName: Full=UDP-arabinose 4-epimera...  33.1    1.1   Gene info
sp|A9M3Q7.1|HLDD_NEIM0  RecName: Full=ADP-L-glycero-D-manno-he...  33.1    1.1   Gene info
sp|Q9JQX8.1|HLDD_NEIMA  RecName: Full=ADP-L-glycero-D-manno-he...  33.1    1.1  
sp|Q57301.1|GALE_YEREN  UDP-glucose 4-epimerase (UDP-galactose...  32.7    1.5  
sp|A0KQV3.1|HLDD_AERHH  ADP-L-glycero-D-manno-heptose-6-epimer...  32.7    1.5   Gene info
sp|Q5F9J0|HLDD_NEIG1  ADP-L-glycero-D-manno-heptose-6-epimeras...  32.7    1.6   Gene info
sp|Q8H0B2.1|ARAE3_ORYSJ  RecName: Full=Probable UDP-arabinose ...  32.7    1.8   Gene info
sp|A9MKQ6.1|HLDD_SALAR  RecName: Full=ADP-L-glycero-D-manno-he...  32.7    1.8  
sp|Q00329.1|RFBJ_SALMU  RecName: Full=CDP-abequose synthase        32.3    1.8  
sp|P37759.2|RFBB_ECOLI  RecName: Full=dTDP-glucose 4,6-dehydra...  32.3    1.8  
sp|Q51061.1|HLDD_NEIGO  RecName: Full=ADP-L-glycero-D-manno-he...  32.3    1.9  
sp|A8GLC8.1|HLDD_SERP5  RecName: Full=ADP-L-glycero-D-manno-he...  32.3    2.1   Gene info
sp|A1KBH4.1|HLDD_AZOSB  ADP-L-glycero-D-manno-heptose-6-epimer...  32.3    2.2   Gene info
sp|Q12CM2|HLDD_POLSJ  ADP-L-glycero-D-manno-heptose-6-epimeras...  32.3    2.2   Gene info
sp|Q3J7X9|HLDD_NITOC  ADP-L-glycero-D-manno-heptose-6-epimeras...  32.0    2.6   Gene info
sp|P37777.2|RFBB_SHIFL  RecName: Full=dTDP-glucose 4,6-dehydra...  32.0    2.6  
sp|A3QJB2.1|HLDD_SHELP  ADP-L-glycero-D-manno-heptose-6-epimer...  32.0    2.8   Gene info
sp|A7MSM1.1|HLDD_VIBHB  ADP-L-glycero-D-manno-heptose-6-epimer...  32.0    3.0   Gene info
sp|Q57IC3|HLDD_SALCH  ADP-L-glycero-D-manno-heptose-6-epimeras...  32.0    3.0  



********************Alignements********************

>sp|O49213.2|FCL1_ARATH  RecName: Full=GDP-L-fucose synthase 1; AltName: Full=GDP-4-keto-6-deoxy-D-mannose-3, 
5-epimerase-4-reductase 1; Short=AtGER1; 
Short=AtFX
Length=312

 Score =  216 bits (550),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 99/224 (44%), Positives = 148/224 (66%), Gaps = 0/224 (0%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N+QIQTN+IH AY+  VK L+FLGSSCIYPK++ QPI E  LLT+ LE TN+ YAIAKI+
Sbjct  85   NLQIQTNVIHSAYEHGVKKLLFLGSSCIYPKFAPQPIPESALLTASLEPTNEWYAIAKIA  144

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
            G+K C+ Y  Q+  +  S MPTN +GPNDN+    SH LPAL+R+ +E+K+N    + +W
Sbjct  145  GIKTCQAYRIQHGWDAISGMPTNLYGPNDNFHPENSHVLPALMRRFHEAKVNGAEEVVVW  204

Query  121  GDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLKIK  180
            G G   RE ++VDDLA+A ++ L + +    +NIG+ ++ TI   A+ + +++  + K+ 
Sbjct  205  GTGSPLREFLHVDDLADACVFLLDRYSGLEHVNIGSGQEVTIRELAELVKEVVGFEGKLG  264

Query  181  YINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDFIEN  224
            +      GTPRK +D S   +LGW PK+ +  GL  +   +++N
Sbjct  265  WDCTKPDGTPRKLMDSSKLASLGWTPKVSLRDGLSQTYDWYLKN  308


>sp|Q9LMU0.1|FCL2_ARATH Gene info RecName: Full=Putative GDP-L-fucose synthase 2; AltName: Full=GDP-4-keto-6-deoxy-D-mannose-3, 
5-epimerase-4-reductase 2; 
Short=AtGER2
Length=328

 GENE ID: 838368 GER2 | GER2; catalytic [Arabidopsis thaliana]

 Score =  215 bits (547),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/224 (44%), Positives = 147/224 (65%), Gaps = 0/224 (0%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N+QIQTN+IH AY   VK L+FLGSSCIYPK++ QPI E  LLT  LE TN+ YAIAKI+
Sbjct  99   NLQIQTNVIHSAYTHGVKKLLFLGSSCIYPKFAPQPIPESALLTGPLEPTNEWYAIAKIA  158

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
            G+KMC+ Y  Q+  +  S MPTN +G NDN+    SH LPAL+R+ +E+K N  + + +W
Sbjct  159  GIKMCQAYRLQHQWDAISGMPTNLYGQNDNFHPENSHVLPALMRRFHEAKANNADEVVVW  218

Query  121  GDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLKIK  180
            G G   RE ++VDDLA+A ++ + + +    +N+G+  + TI+  A+ + +++  K K+ 
Sbjct  219  GSGSPLREFLHVDDLADACVFLMDQYSGFEHVNVGSGVEVTIKELAELVKEVVGFKGKLV  278

Query  181  YINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDFIEN  224
            +      GTPRK +D S   +LGW PKI +  GL  + + ++EN
Sbjct  279  WDTTKPDGTPRKLMDSSKLASLGWTPKISLKDGLSQTYEWYLEN  322


>sp|P32055.2|FCL_ECOLI  RecName: Full=GDP-L-fucose synthetase; AltName: Full=GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase
Length=321

 Score =  212 bits (539),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 150/237 (63%), Gaps = 9/237 (3%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N+ I++N+IH A++ +V  L+FLGSSCIYPK +KQP+ E  LL   LE TN+ YAIAKI+
Sbjct  83   NMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIA  142

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
            G+K+CE YN QY  +++S+MPTN +GP+DN+  S SH +PAL+R+ +E+       + +W
Sbjct  143  GIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVW  202

Query  121  GDGKTKRELIYVDDLAEASIYFL-------FKKTKKNL--INIGTQKDFTIEYYAKKIMK  171
            G G   RE ++VDD+A ASI+ +        + T+  L  IN+GT  D TI   A+ I K
Sbjct  203  GSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAK  262

Query  172  ILDIKLKIKYINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDFIENYKEY  228
            ++  K ++ +      GTPRK LD +    LGW  +I ++ GL  + + F+EN   +
Sbjct  263  VVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQDRF  319


>sp|P55353|Y4AF_RHISN Gene info Uncharacterized protein y4aF
Length=314

 GENE ID: 962636 y4aF | nolK homologue [Rhizobium sp. NGR234]
(10 or fewer PubMed links)

 Score =  208 bits (530),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/227 (41%), Positives = 146/227 (64%), Gaps = 0/227 (0%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N+ ++ N+I  +++  V+ L+FLGSSCIYPKY+ QPI+E+ LLT  LE TN+ YAIAKI+
Sbjct  87   NLIMEANVIEGSFRSGVEKLLFLGSSCIYPKYAAQPIREEALLTGPLEPTNEWYAIAKIA  146

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
            G+K+C+ Y +QY  NF S MPTN +GP D +DL++SH +PALIRK +E+KI     +++W
Sbjct  147  GIKLCQAYRKQYGANFISAMPTNLYGPRDKFDLNSSHVVPALIRKAHEAKIKDLGCLSIW  206

Query  121  GDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLKIK  180
            G G   R+ +Y +D ++A ++ L   ++   INIG+  + +I   A  + +++  K  I 
Sbjct  207  GSGTPTRDFLYSEDCSDALVFLLKHYSETEHINIGSGGEISIIELAHIVCRVVGFKGDIV  266

Query  181  YINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDFIENYKE  227
            +      GTPRK L      ++GWRPK  ++ GL  S + F+ N  +
Sbjct  267  FDTSKPDGTPRKLLSSERLVSMGWRPKTSLELGLAKSYESFVSNVAD  313


>sp|Q67WR2.1|FCL1_ORYSJ Gene info RecName: Full=Probable GDP-L-fucose synthase 1; AltName: Full=GDP-4-keto-6-deoxy-D-mannose-3, 
5-epimerase-4-reductase 1
Length=328

 GENE ID: 4341699 Os06g0652400 | Os06g0652400 [Oryza sativa Japonica Group]
(10 or fewer PubMed links)

 Score =  204 bits (519),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/225 (41%), Positives = 147/225 (65%), Gaps = 1/225 (0%)

Query  1    NIQIQTNLIHCAYK-FNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKI  59
            N+QIQTN++  A K  +V+ L+FLGSSCIYPK++ QPI E  LL+  LE TN+ YA+AKI
Sbjct  98   NLQIQTNVVDAALKCGSVRKLLFLGSSCIYPKFAPQPIPENSLLSGPLEPTNEWYAVAKI  157

Query  60   SGVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINL  119
            +G+KMC+ Y  Q+  +  S MPTN +GP DN+    SH LPALIR+ +E+K +    + +
Sbjct  158  AGIKMCQAYRIQHGFDAISAMPTNLYGPQDNFHPENSHVLPALIRRFHEAKASNAAEVVV  217

Query  120  WGDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLKI  179
            WG G   RE ++VDDLA+A I+ +   +    +N+G+  + TI+  A+ + +++  + K+
Sbjct  218  WGTGSPLREFLHVDDLADAVIFLMDHYSGLEHVNVGSGSEVTIKELAELVKEVVGFQGKL  277

Query  180  KYINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDFIEN  224
             + +    GTPRK +D S    +GW+PK+ + +GL  + K ++EN
Sbjct  278  VWDSSKPDGTPRKLMDSSKIQEMGWKPKVPLKEGLVETYKWYVEN  322


>sp|Q67WR5.1|FCL2_ORYSJ Gene info RecName: Full=Putative GDP-L-fucose synthase 2; AltName: Full=GDP-4-keto-6-deoxy-D-mannose-3, 
5-epimerase-4-reductase 2
Length=347

 GENE ID: 4341698 Os06g0652300 | Os06g0652300 [Oryza sativa Japonica Group]
(10 or fewer PubMed links)

 Score =  151 bits (381),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/216 (29%), Positives = 118/216 (54%), Gaps = 1/216 (0%)

Query  1    NIQIQTNLIHCAYK-FNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKI  59
            N++I  N++  A +  +V+ L+ L SS IYP  + QP  E  LLT    + ++ YAI KI
Sbjct  114  NLRITVNVVDAARRCGSVRKLLVLASSTIYPADAPQPTPESALLTGPPAEGSEWYAIPKI  173

Query  60   SGVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINL  119
            +G+KMC+    +Y  +  +  P N +GP   +    SH +PALIR+ + +K+     + +
Sbjct  174  AGIKMCQAVRAEYGLDAIAAAPNNLYGPRHPFPPEHSHVIPALIRRFHRAKLEGAGEVAV  233

Query  120  WGDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLKI  179
            WG G   RE  +VDDLAEA +  + + + +  +N+G+ ++ T+   A+ +  ++  +  +
Sbjct  234  WGSGAAAREFTHVDDLAEAVVVLMERYSGEEHVNVGSGEEVTVRELAEAVRGVVGYEGVV  293

Query  180  KYINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLE  215
             +     +G  R+ +D      LGW P++ +  G++
Sbjct  294  AWDAARPEGVARRVVDSGRMRKLGWEPRVALRDGIQ  329


>sp|P33217.2|NOLK_AZOC5  Nodulation protein nolK
Length=312

 Score =  134 bits (337),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 124/229 (54%), Gaps = 1/229 (0%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N  +  N++  +++  V  LI L SSC+YP   + P+KE  +L    E TN+ YA+AK  
Sbjct  83   NAAMALNVVMSSFRSEVVTLINLSSSCMYPACIEGPLKECDILRGPFEVTNEGYALAKTV  142

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
            G+K+CEY ++  N N+K+L+  N +G  DN+D   SH LPA+I KI+++       +++W
Sbjct  143  GLKICEYIDKLPNFNYKTLIACNLYGVGDNFDPRRSHLLPAIIEKIHKASQCGSESVSIW  202

Query  121  GDGKTKRELIYVDDLAEASIYFL-FKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLKI  179
            GDG  +RE ++  D A+  I  L   +   + +N+G  KD ++  Y   + +++    + 
Sbjct  203  GDGTARREFMFAYDFAKIIIKALEVPELIPSSMNVGVGKDLSVLEYYSLVARVIGWSGEF  262

Query  180  KYINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDFIENYKEY  228
             Y      G   K +D +  T LGW P+  ++ G+  + + +I   + Y
Sbjct  263  VYDLNRPVGMRSKLMDITHLTALGWVPERSLEGGIRSTYQYYITGNEVY  311


>sp|Q8K3X2.1|FCL_CRIGR  RecName: Full=GDP-L-fucose synthetase; AltName: Full=Protein 
FX; AltName: Full=Red cell NADP(H)-binding protein; AltName: 
Full=GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase
Length=321

 Score =  107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 102/183 (55%), Gaps = 3/183 (1%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N+ I  N++H A++   + ++   S+CI+P  +  PI E  +       +N  Y+ AK  
Sbjct  90   NVHINDNVLHSAFEVGTRKVVSCLSTCIFPDKTTYPIDETMIHNGPPHSSNFGYSYAKRM  149

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
                   Y +Q+   F +++PTN FGP+DN+++   H LP LI K++ +K N  + + +W
Sbjct  150  IDVQNRAYFQQHGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSNG-SALTVW  208

Query  121  GDGKTKRELIYVDDLAEASIYFL--FKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLK  178
            G GK +R+ IY  DLA   I+ L  + + +  ++++G + + +I+  A+ +++ +D   +
Sbjct  209  GTGKPRRQFIYSLDLARLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFCGE  268

Query  179  IKY  181
            + +
Sbjct  269  VTF  271


>sp|Q5RBE5.1|FCL_PONAB Gene info RecName: Full=GDP-L-fucose synthetase; AltName: Full=Protein 
FX; AltName: Full=Red cell NADP(H)-binding protein; AltName: 
Full=GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase
Length=321

 GENE ID: 100172434 TSTA3 | tissue specific transplantation antigen P35B
[Pongo abelii]

 Score =  107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 106/184 (57%), Gaps = 5/184 (2%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYA-IAKI  59
            N+ I  N++H A++   + ++   S+CI+P  +  PI E  +       +N  Y+ + ++
Sbjct  90   NVHINDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHSSNFGYSYVKRM  149

Query  60   SGVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINL  119
              V+   Y+ +QY   F +++PTN FGP+DN+++   H LP LI K++ +K +  + + +
Sbjct  150  IDVQNRAYF-QQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAK-SSGSALTV  207

Query  120  WGDGKTKRELIYVDDLAEASIYFL--FKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKL  177
            WG GK +R+ IY  DLA+  I+ L  + + +  ++++G   + +I+  A+ +++ +D   
Sbjct  208  WGTGKPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEDDEVSIKEAAEAVVEAMDFHG  267

Query  178  KIKY  181
            ++ +
Sbjct  268  EVTF  271


>sp|Q13630|FCL_HUMAN Gene info GDP-L-fucose synthetase (Protein FX) (Red cell NADP(H)-binding 
protein) (GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase)
Length=321

 GENE ID: 7264 TSTA3 | tissue specific transplantation antigen P35B
[Homo sapiens] (10 or fewer PubMed links)

 Score =  106 bits (265),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 102/183 (55%), Gaps = 3/183 (1%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N+ +  N++H A++   + ++   S+CI+P  +  PI E  +       +N  Y+ AK  
Sbjct  90   NVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRM  149

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
                   Y +QY   F +++PTN FGP+DN+++   H LP LI K++ +K +  + + +W
Sbjct  150  IDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAK-SSGSALTVW  208

Query  121  GDGKTKRELIYVDDLAEASIYFL--FKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLK  178
            G G  +R+ IY  DLA+  I+ L  + + +  ++++G + + +I+  A+ +++ +D   +
Sbjct  209  GTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGE  268

Query  179  IKY  181
            + +
Sbjct  269  VTF  271






----------------------------------------------------------------------------------------------------



b) BLASTp contre NR, paramètres par défaut au NCBI sauf "Max target sequences=1000", "Alignments=1000"



                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|YP_265995.1|  GDP-fucose synthetase chain A [Candidatus Pe...   270    8e-71 Gene info
ref|ZP_01264259.1|  GDP-fucose synthetase chain A [Candidatus ...   270    9e-71
ref|YP_001115674.1|  NAD-dependent epimerase/dehydratase [Burk...   251    2e-65 Gene info
ref|YP_557188.1|  putative nucleoside-diphosphate-sugar epimer...   249    1e-64 Gene info
ref|ZP_02882437.1|  NAD-dependent epimerase/dehydratase [Burkh...   248    3e-64
ref|YP_001894468.1|  NAD-dependent epimerase/dehydratase [Burk...   244    4e-63 Gene info
ref|ZP_02291384.1|  NAD-dependent epimerase/dehydratase [Rhizo...   243    9e-63
ref|ZP_02914223.1|  NAD-dependent epimerase/dehydratase [Geoba...   243    1e-62
ref|ZP_03135403.1|  NAD-dependent epimerase/dehydratase [Therm...   241    5e-62
ref|ZP_03270648.1|  NAD-dependent epimerase/dehydratase [Burkh...   239    1e-61
ref|YP_556301.1|  putative GDP-fucose synthetase [Burkholderia...   237    6e-61 Gene info
ref|ZP_03040068.1|  NAD-dependent epimerase/dehydratase [Geoba...   236    1e-60
ref|YP_303606.1|  GDP-fucose synthetase [Methanosarcina barker...   235    2e-60 Gene info
ref|YP_468304.1|  GDP-L-fucose synthase protein [Rhizobium etl...   233    7e-60 Gene info
ref|YP_343265.1|  NAD-dependent epimerase/dehydratase [Nitroso...   233    7e-60 Gene info
ref|YP_001858689.1|  NAD-dependent epimerase/dehydratase [Burk...   233    1e-59 Gene info
ref|YP_001112750.1|  NAD-dependent epimerase/dehydratase [Desu...   231    3e-59 Gene info
gb|EDX78741.1|  NAD dependent epimerase/dehydratase family [Mi...   231    3e-59
ref|ZP_01287217.1|  NAD-dependent epimerase/dehydratase:dTDP-4...   231    3e-59
ref|YP_860606.1|  GDP-L-fucose synthetase [Gramella forsetii K...   231    4e-59 Gene info
dbj|BAG50491.1|  putative nucleotide di-P-sugar epimerase or d...   229    9e-59
ref|NP_632682.1|  GDP-fucose synthetase [Methanosarcina mazei ...   229    1e-58 Gene info
ref|YP_935088.1|  putative GDP-fucose synthetase [Azoarcus sp....   227    5e-58 Gene info
ref|ZP_01122153.1|  GDP-fucose synthetase [Robiginitalea bifor...   227    6e-58
ref|ZP_02846607.1|  NAD-dependent epimerase/dehydratase [Paeni...   227    6e-58
ref|ZP_02967257.1|  NAD-dependent epimerase/dehydratase [bacte...   226    1e-57
ref|ZP_01884412.1|  GDP-fucose synthetase [Pedobacter sp. BAL3...   226    1e-57
ref|ZP_02467852.1|  GDP-L-fucose synthase protein [Burkholderi...   225    2e-57
ref|YP_001529165.1|  NAD-dependent epimerase/dehydratase [Desu...   224    3e-57 Gene info
ref|YP_459581.1|  GDP-fucose synthetase [Erythrobacter litoral...   224    4e-57 Gene info
ref|YP_002284187.1|  NAD-dependent epimerase/dehydratase [Rhiz...   224    5e-57 Gene info
ref|ZP_01552369.1|  GDP-L-fucose synthetase [Methylophilales b...   224    5e-57
ref|ZP_01665145.1|  NAD-dependent epimerase/dehydratase [Therm...   223    9e-57
ref|YP_001755512.1|  NAD-dependent epimerase/dehydratase [Meth...   223    1e-56 Gene info
ref|YP_904087.1|  NAD-dependent epimerase/dehydratase [Candida...   223    1e-56 Gene info
ref|YP_113617.1|  GDP-L-fucose synthetase [Methylococcus capsu...   223    1e-56 Gene info
ref|YP_001789664.1|  NAD-dependent epimerase/dehydratase [Lept...   223    1e-56 Gene info
ref|ZP_02013743.1|  NAD-dependent epimerase/dehydratase [Opitu...   222    2e-56
gb|AAO67556.1|  GDP-4-keto-6-deoxy-D-mannose epimerase/reducta...   222    2e-56
ref|YP_375755.1|  GDP-L-fucose synthetase [Pelodictyon luteolu...   222    2e-56 Gene info
ref|ZP_03131502.1|  NAD-dependent epimerase/dehydratase [Chtho...   222    2e-56
ref|ZP_01120042.1|  GDP-fucose synthetase [Robiginitalea bifor...   222    2e-56
ref|ZP_01052763.1|  GDP-fucose synthetase [Tenacibaculum sp. M...   221    3e-56
ref|YP_001192684.1|  NAD-dependent epimerase/dehydratase [Flav...   221    4e-56 Gene info
ref|NP_951685.1|  GDP-fucose synthetase [Geobacter sulfurreduc...   221    4e-56 Gene info
ref|YP_001791380.1|  NAD-dependent epimerase/dehydratase [Lept...   221    4e-56 Gene info
ref|YP_002168902.1|  hypothetical protein FTCG_00737 [Francise...   220    5e-56 Gene info
ref|ZP_01449584.1|  GDP-fucose synthetase [alpha proteobacteri...   220    6e-56
ref|YP_425346.1|  NAD-dependent epimerase/dehydratase [Rhodosp...   220    7e-56 Gene info
ref|YP_001303555.1|  GDP-4-keto-6-deoxy-D-mannose-3,5-epimeras...   220    8e-56 Gene info
ref|ZP_02032632.1|  hypothetical protein PARMER_02648 [Parabac...   220    8e-56
ref|ZP_01689054.1|  GDP-L-fucose synthase 1 [Microscilla marin...   219    9e-56
ref|YP_384273.1|  NAD-dependent epimerase/dehydratase [Geobact...   219    1e-55 Gene info
ref|NP_048649.1|  hypothetical protein PBCV1_A295L [Paramecium...   219    1e-55 Gene info
ref|ZP_01127533.1|  GDP-fucose synthetase [Nitrococcus mobilis...   219    2e-55
ref|XP_001781036.1|  predicted protein [Physcomitrella patens ...   219    2e-55 UniGene infoGene info
ref|YP_002137684.1|  NAD-dependent epimerase/dehydratase [Geob...   219    2e-55 Gene info
ref|YP_001231943.1|  NAD-dependent epimerase/dehydratase [Geob...   219    2e-55 Gene info
ref|YP_765423.1|  putative GDP-L-fucose synthetase [Rhizobium ...   219    2e-55 Gene info
ref|YP_676694.1|  GDP-fucose synthetase [Cytophaga hutchinsoni...   219    2e-55 Gene info
ref|ZP_02951616.1|  GDP-L-fucose synthetase [Clostridium butyr...   218    2e-55
ref|YP_001821115.1|  NAD-dependent epimerase/dehydratase [Opit...   218    2e-55 Gene info
ref|ZP_01117750.1|  GDP-fucose synthetase [Polaribacter irgens...   218    2e-55
ref|YP_825875.1|  NAD-dependent epimerase/dehydratase [Solibac...   218    2e-55 Gene info
ref|YP_001426763.1|  hypothetical protein ATCV1_Z282L [Acantho...   218    3e-55 Gene info
ref|YP_002187971.1|  NAD-dependent epimerase/dehydratase [Stre...   218    3e-55 Gene info
ref|NP_288539.1|  fucose synthetase [Escherichia coli O157:H7 ...   218    3e-55 Gene info
gb|AAC32346.1|  fucose synthetase Fcl [Escherichia coli] >gb|A...   218    3e-55
ref|YP_001130138.1|  NAD-dependent epimerase/dehydratase [Pros...   218    3e-55 Gene info
ref|YP_522500.1|  NAD-dependent epimerase/dehydratase [Rhodofe...   218    3e-55 Gene info
ref|ZP_03177017.1|  putative nucleoside-diphosphate-sugar epim...   218    4e-55
gb|ABE98425.1|  GDP-L-fucose synthetase [Escherichia coli]          218    4e-55
ref|YP_001497591.1|  hypothetical protein NY2A_B395L [Parameci...   217    4e-55 Gene info
gb|ABK24902.1|  unknown [Picea sitchensis]                          217    4e-55
ref|YP_002017499.1|  NAD-dependent epimerase/dehydratase [Pelo...   217    5e-55 Gene info
ref|YP_318990.1|  NAD-dependent epimerase/dehydratase [Nitroba...   217    5e-55 Gene info
ref|ZP_01253621.1|  GDP-fucose synthetase [Psychroflexus torqu...   217    6e-55
ref|YP_002137951.1|  NAD-dependent epimerase/dehydratase [Geob...   217    6e-55 Gene info
ref|YP_389390.1|  GDP-fucose synthetase NAD dependent epimeras...   217    6e-55 Gene info
ref|YP_002300183.1|  GDP-L-fucose synthetase [Rhodospirillum c...   217    7e-55 Gene info
ref|YP_001021919.1|  GDP-L-fucose synthetase [Methylibium petr...   217    7e-55 Gene info
ref|ZP_02294127.1|  NAD-dependent epimerase/dehydratase [Rhizo...   217    7e-55
ref|NP_177468.2|  ATFX/GER1 (GDP-4-KETO-6-DEOXYMANNOSE-3,5-EPI...   216    8e-55 UniGene infoGene info
ref|ZP_02924979.1|  GDP-L-fucose synthetase [Verrucomicrobium ...   216    8e-55
ref|YP_001007256.1|  GDP-fucose synthetase [Yersinia enterocol...   216    1e-54 Gene info
ref|NP_933143.1|  putative nucleotide di-P-sugar epimerase or ...   216    1e-54 Gene info
sp|O49213.2|FCL1_ARATH  RecName: Full=GDP-L-fucose synthase 1;...   216    1e-54
ref|YP_592887.1|  NAD-dependent epimerase/dehydratase [Acidoba...   216    1e-54 Gene info
gb|AAV34500.1|  fucose synthetase [Citrobacter freundii]            216    1e-54
ref|ZP_00603990.1|  GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase...   215    2e-54
ref|YP_009315.1|  GDP-fucose synthetase [Desulfovibrio vulgari...   215    2e-54 Gene info
ref|ZP_01235026.1|  GDP-fucose synthetase [Vibrio angustum S14...   215    2e-54
ref|NP_772104.1|  GDP-fucose synthetase [Bradyrhizobium japoni...   215    2e-54 Gene info
ref|NP_564040.1|  GER2; catalytic [Arabidopsis thaliana] >sp|Q...   215    2e-54 UniGene infoGene info
ref|NP_973853.1|  GER2; catalytic [Arabidopsis thaliana] >ref|...   215    2e-54 UniGene infoGene info
ref|YP_001952984.1|  NAD-dependent epimerase/dehydratase [Geob...   215    3e-54 Gene info
ref|YP_001241570.1|  GDP-4-dehydro-6-deoxy-D-mannose epimerase...   214    3e-54 Gene info
ref|ZP_03031280.1|  GDP-L-fucose synthetase [Escherichia coli ...   214    3e-54
ref|YP_485147.1|  NAD-dependent epimerase/dehydratase [Rhodops...   214    3e-54 Gene info
ref|YP_587987.1|  NAD-dependent epimerase/dehydratase [Ralston...   214    3e-54 Gene info
ref|ZP_01218696.1|  GDP-fucose synthetase [Photobacterium prof...   214    4e-54
pdb|1E6U|A  Chain A, Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Re...   214    6e-54 Related structures
dbj|BAF47068.1|  GDP-fucose synthetase [Klebsiella pneumoniae]      213    8e-54
ref|ZP_03283245.1|  hypothetical protein ENTCAN_03041 [Enterob...   213    8e-54
ref|ZP_01123660.1|  putative GDP-L-fucose synthetase [Synechoc...   213    1e-53
ref|YP_968310.1|  NAD-dependent epimerase/dehydratase [Desulfo...   213    1e-53 Gene info
ref|YP_527588.1|  putative nucleotide di-P-sugar epimerase or ...   213    1e-53 Gene info
ref|YP_214489.1|  nucleotide-sugar epimerase [Prochlorococcus ...   213    1e-53 Gene info
ref|ZP_01388621.1|  NAD-dependent epimerase/dehydratase:dTDP-4...   212    2e-53
ref|YP_001091669.1|  putative fucose synthetase [Prochlorococc...   212    2e-53 Gene info
ref|YP_386921.1|  GDP-fucose synthetase [Desulfovibrio desulfu...   212    2e-53 Gene info
ref|NP_288558.1|  putative nucleotide di-P-sugar epimerase or ...   212    2e-53 Gene info
ref|YP_397810.1|  NAD dependent epimerase/dehydratase [Prochlo...   212    2e-53 Gene info
ref|YP_001996965.1|  NAD-dependent epimerase/dehydratase [Chlo...   212    2e-53 Gene info
gb|AAV27331.1|  GDP-fucose synthetase [Klebsiella pneumoniae]       212    2e-53
ref|YP_345318.1|  putative nucleotide di-P-sugar epimerase or ...   212    2e-53 Gene info
ref|YP_001177383.1|  NAD-dependent epimerase/dehydratase [Ente...   212    2e-53 Gene info
ref|NP_416556.1|  bifunctional GDP-fucose synthetase: GDP-4-de...   212    2e-53 Gene info
ref|YP_407376.1|  putative nucleotide di-P-sugar epimerase [Sh...   212    2e-53 Gene info
dbj|BAF47051.1|  GDP-fucose synthetase [Raoultella planticola]      212    2e-53
ref|YP_001463405.1|  GDP-L-fucose synthetase [Escherichia coli...   212    2e-53 Gene info
ref|YP_310996.1|  putative nucleotide di-P-sugar epimerase or ...   212    2e-53 Gene info
dbj|BAD03939.1|  GDP-fucose synthetase [Klebsiella pneumoniae]      212    2e-53
ref|YP_002293586.1|  GDP-mannose-4-keto-6-D epimerase [Escheri...   212    2e-53 Gene info
dbj|BAG11916.1|  bifunctional GDP-fucose synthetase [Escherich...   212    2e-53
emb|CAO66600.1|  unnamed protein product [Vitis vinifera]           211    2e-53
dbj|BAD86777.1|  GDP-fucose synthetase [Klebsiella pneumoniae]      211    2e-53
pdb|1E7S|A  Chain A, Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Re...   211    2e-53 Related structures
gb|AAC77843.1|  GDP-L-fucose synthetase [Escherichia coli]          211    3e-53
gb|AAO37692.1|  GDP-fucose synthetase [Escherichia coli]            211    3e-53
pdb|1BWS|A  Chain A, Crystal Structure Of Gdp-4-Keto-6-Deoxy-D...   211    3e-53 Related structures
ref|YP_001437269.1|  hypothetical protein ESA_01166 [Enterobac...   211    3e-53 Gene info
pdb|1E7Q|A  Chain A, Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Re...   211    3e-53 Related structures
gb|EDY82350.1|  NAD dependent epimerase/dehydratase family [Ve...   211    3e-53
ref|ZP_00826188.1|  COG0451: Nucleoside-diphosphate-sugar epim...   211    4e-53
gb|EDZ62269.1|  GDP-L-fucose synthase 1 [Campylobacterales bac...   211    4e-53
ref|ZP_01574859.1|  NAD-dependent epimerase/dehydratase [Clost...   211    4e-53
ref|YP_595696.1|  GDP-L-fucose synthetase-related [Lawsonia in...   211    5e-53 Gene info
ref|NP_754466.1|  GDP-4-keto-6-L-galactose reductase [Escheric...   211    5e-53 Gene info
ref|YP_001484630.1|  nucleoside-diphosphate-sugar epimerase [P...   211    5e-53 Gene info
ref|YP_001207162.1|  GDP-L-fucose synthase (GDP-4-keto-6-deoxy...   211    5e-53 Gene info
ref|ZP_01385402.1|  NAD-dependent epimerase/dehydratase:dTDP-4...   210    5e-53
gb|ACA24893.1|  Fcl [Escherichia coli]                              210    6e-53
ref|NP_707947.1|  putative nucleotide di-P-sugar epimerase or ...   210    6e-53 Gene info
ref|ZP_03068128.1|  GDP-L-fucose synthetase [Escherichia coli ...   210    6e-53
ref|YP_001204267.1|  bifunctional GDP-fucose synthetase: GDP-4...   210    6e-53 Gene info
emb|CAN61442.1|  hypothetical protein [Vitis vinifera]              210    7e-53
ref|ZP_01987013.1|  GDP-L-fucose synthetase [Vibrio harveyi HY...   210    7e-53
ref|ZP_03063854.1|  GDP-L-fucose synthetase [Shigella dysenter...   210    8e-53
ref|ZP_02947741.1|  NAD-dependent epimerase/dehydratase [Methy...   210    8e-53
ref|ZP_03166010.1|  GDP-L-fucose synthetase [Salmonella enteri...   210    9e-53
ref|YP_063759.1|  GDP-L-fucose synthetase [Desulfotalea psychr...   210    9e-53 Gene info
ref|YP_001009791.1|  putative fucose synthetase [Prochlorococc...   209    1e-52 Gene info
ref|ZP_01157753.1|  putative nucleotide di-P-sugar epimerase o...   209    1e-52
ref|YP_217096.1|  GDP fucose synthetase [Salmonella enterica s...   209    1e-52 Gene info
gb|ABV27438.1|  GDP-L-fucose synthase 1 [Candidatus Chloracido...   209    1e-52
ref|NP_804607.1|  GDP-fucose synthetase [Salmonella enterica s...   209    1e-52 Gene info
pdb|1E7R|A  Chain A, Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Re...   209    1e-52 Related structures
ref|YP_867210.1|  NAD-dependent epimerase/dehydratase [Magneto...   209    1e-52 Gene info
ref|NP_456656.1|  GDP-fucose synthetase [Salmonella enterica s...   209    2e-52 Gene info
gb|ACD36999.1|  Fcl [Escherichia coli]                              209    2e-52
gb|AAV34513.1|  fucose synthetase [Salmonella enterica subsp. ...   209    2e-52
ref|ZP_02667113.1|  GDP-L-fucose synthetase [Salmonella enteri...   209    2e-52
ref|ZP_02157047.1|  GDP-fucose synthetase [Shewanella benthica...   209    2e-52
ref|ZP_02344809.1|  GDP-L-fucose synthetase [Salmonella enteri...   209    2e-52
ref|YP_150066.1|  GDP-fucose synthetase [Salmonella enterica s...   209    2e-52 Gene info
ref|YP_002041378.1|  GDP-L-fucose synthetase [Salmonella enter...   209    2e-52 Gene info
gb|ACD36987.1|  Fcl [Shigella dysenteriae]                          209    2e-52
ref|ZP_03171007.1|  putative nucleoside-diphosphate-sugar epim...   209    2e-52 Gene info
gb|ABP35573.1|  Fcl [Salmonella enterica subsp. enterica serov...   209    2e-52
ref|NP_443765.1|  NolK [Rhizobium sp. NGR234] >sp|P55353|Y4AF_...   208    2e-52 Gene info
ref|ZP_02654488.1|  GDP-L-fucose synthetase [Salmonella enteri...   208    2e-52
emb|CAI39176.1|  GDP-L-fucose synthase [Yersinia aldovae]           208    2e-52
ref|ZP_01035657.1|  putative nucleotide di-P-sugar epimerase o...   208    3e-52
ref|YP_797601.1|  nucleoside-diphosphate-sugar epimerase [Lept...   208    3e-52 Gene info
gb|AAN05765.1|  GDP-6-deoxy-4-keto-D-mannose-3-5-epimerase-4-r...   208    3e-52
ref|ZP_00953368.1|  GDP-L-fucose synthetase [Oceanicaulis alex...   208    3e-52
ref|ZP_01881646.1|  putative nucleotide di-P-sugar epimerase o...   208    3e-52
ref|YP_002216195.1|  GDP-L-fucose synthetase [Salmonella enter...   208    3e-52 Gene info
ref|YP_376191.1|  NAD dependent epimerase/dehydratase [Synecho...   208    3e-52 Gene info
gb|EDZ60897.1|  GDP-L-fucose synthase 1 [Candidatus Pelagibact...   208    3e-52
ref|ZP_01017342.1|  GDP-fucose synthetase [Parvularcula bermud...   207    4e-52
ref|YP_001796481.1|  GDP-L-fucose synthetase; GDP-4-keto-6-deo...   207    5e-52 Gene info
ref|ZP_03065867.1|  GDP-L-fucose synthetase [Shigella dysenter...   207    7e-52
ref|ZP_02164994.1|  GDP-fucose synthetase [Hoeflea phototrophi...   207    7e-52
ref|NP_699609.1|  fucose synthetase family protein [Brucella s...   207    7e-52 Gene info
ref|NP_768270.1|  GDP-fucose synthetase [Bradyrhizobium japoni...   207    7e-52 Gene info
ref|YP_669992.1|  GDP-fucose synthetase [Escherichia coli 536]...   207    7e-52 Gene info
ref|YP_001569852.1|  hypothetical protein SARI_00790 [Salmonel...   206    8e-52 Gene info
ref|YP_729382.1|  GDP-L-fucose synthetase [Synechococcus sp. C...   206    8e-52 Gene info
ref|ZP_01717488.1|  GDP-fucose synthetase [Algoriphagus sp. PR...   206    1e-51
ref|YP_002227052.1|  GDP-fucose synthetase [Salmonella enteric...   206    1e-51 Gene info
ref|YP_315533.1|  GDP-L-fucose synthetase [Thiobacillus denitr...   206    1e-51 Gene info
ref|YP_901099.1|  NAD-dependent epimerase/dehydratase [Pelobac...   206    1e-51 Gene info
ref|ZP_01083899.1|  putative GDP-L-fucose synthetase [Synechoc...   206    1e-51
ref|YP_001371906.1|  NAD-dependent epimerase/dehydratase [Ochr...   206    1e-51 Gene info
ref|YP_753319.1|  GDP-fucose synthetase [Syntrophomonas wolfei...   206    1e-51 Gene info
ref|YP_001257405.1|  fucose synthetase family protein [Brucell...   206    2e-51 Gene info
gb|AAG24814.1|  GDP-L-fucose synthetase [Salmonella typhimurium]    205    2e-51
ref|YP_001823053.1|  putative nucleoside-diphosphate-sugar epi...   205    3e-51 Gene info
ref|YP_001839416.1|  GDP-L-fucose synthetase (GDP-4-keto-6-deo...   204    3e-51 Gene info
gb|ABC42560.1|  putative fucose synthase [Streptomyces hygrosc...   204    3e-51
ref|YP_949779.1|  GDP-fucose synthetase [Arthrobacter aurescen...   204    4e-51 Gene info
ref|NP_893324.1|  putative fucose synthetase [Prochlorococcus ...   204    4e-51 Gene info
gb|ACG38331.1|  unknown [Zea mays]                                  204    5e-51
ref|ZP_03279581.1|  NAD-dependent epimerase/dehydratase [Thioa...   204    5e-51
ref|NP_865008.1|  GDP-fucose synthetase [Rhodopirellula baltic...   204    5e-51 Gene info
ref|NP_001058235.1|  Os06g0652400 [Oryza sativa (japonica cult...   204    5e-51 UniGene infoGene info
ref|YP_913022.1|  NAD-dependent epimerase/dehydratase [Chlorob...   204    5e-51 Gene info
ref|ZP_01900980.1|  putative nucleotide di-P-sugar epimerase o...   204    5e-51
ref|NP_711758.1|  GDP-fucose synthetase [Leptospira interrogan...   204    5e-51 Gene info
ref|NP_668408.1|  nucleotide di-P-sugar epimerase or dehydrata...   204    5e-51 Gene info
ref|NP_992210.1|  putative nucleotide di-P-sugar epimerase or ...   204    6e-51 Gene info
ref|NP_960166.1|  EpiA [Mycobacterium avium subsp. paratubercu...   204    6e-51 Gene info
ref|ZP_01056679.1|  putative nucleotide di-P-sugar epimerase o...   203    7e-51
ref|YP_613476.1|  NAD-dependent epimerase/dehydratase [Silicib...   203    7e-51 Gene info
ref|YP_378967.1|  GDP-L-fucose synthetase [Chlorobium chloroch...   203    7e-51 Gene info
ref|YP_173100.1|  GDP-fucose synthetase NAD dependent epimeras...   203    8e-51 Gene info
ref|YP_001452321.1|  hypothetical protein CKO_00733 [Citrobact...   203    9e-51 Gene info
gb|AAD44220.1|AF143772_26  MerA [Mycobacterium avium] >emb|CAA...   203    9e-51
emb|CAA11576.1|  gsbB [Mycobacterium avium subsp. paratubercul...   203    1e-50
gb|ABR25599.1|  gdp-l-fucose synthase 1 [Oryza sativa (indica ...   203    1e-50
ref|YP_001605789.1|  GDP-L-fucose synthetase [Yersinia pestis ...   202    1e-50 Gene info
gb|ABE10790.1|  putative GDP-L-fucose synthetase [uncultured P...   202    2e-50
ref|YP_847469.1|  NAD-dependent epimerase/dehydratase [Syntrop...   202    2e-50 Gene info
ref|ZP_01913997.1|  GDP-L-fucose synthetase [Limnobacter sp. M...   202    2e-50
ref|ZP_00954092.1|  putative nucleotide di-P-sugar epimerase o...   201    3e-50
ref|YP_001011683.1|  putative fucose synthetase [Prochlorococc...   201    3e-50 Gene info
ref|YP_001155088.1|  NAD-dependent epimerase/dehydratase [Poly...   201    3e-50 Gene info
gb|EAZ01913.1|  hypothetical protein OsI_023145 [Oryza sativa ...   201    5e-50
ref|ZP_02118983.1|  GDP-fucose synthetase [Methylobacterium no...   200    6e-50
ref|YP_983410.1|  NAD-dependent epimerase/dehydratase [Polarom...   200    6e-50 Gene info
ref|ZP_02150865.1|  GDP-L-fucose synthetase [Phaeobacter galla...   200    7e-50
ref|ZP_01201272.1|  GDP-4-keto-6-deoxy-D-mannose-3, 5-epimeras...   200    7e-50
ref|ZP_02147456.1|  GDP-L-fucose synthetase [Phaeobacter galla...   200    7e-50
ref|YP_766436.1|  putative GDP-L-fucose synthetase [Rhizobium ...   200    7e-50 Gene info
ref|ZP_01904493.1|  putative nucleotide di-P-sugar epimerase o...   200    8e-50
ref|NP_216028.1|  nucleotide-sugar epimerase epiA [Mycobacteri...   200    8e-50 Gene info
ref|NP_336015.1|  fucose synthetase [Mycobacterium tuberculosi...   200    8e-50 Gene info
ref|ZP_01002466.1|  putative nucleotide di-P-sugar epimerase o...   200    8e-50
ref|NP_348797.1|  nucleoside-diphosphate-sugar epimerase [Clos...   199    1e-49 Gene info
ref|YP_942217.1|  bifunctional GDP-fucose synthetase: GDP-4-de...   199    1e-49 Gene info
ref|YP_001642059.1|  NAD-dependent epimerase/dehydratase [Meth...   199    1e-49 Gene info
ref|ZP_00948636.1|  putative nucleotide di-P-sugar epimerase o...   199    1e-49
ref|ZP_01471690.1|  NAD dependent epimerase/dehydratase [Synec...   199    1e-49
ref|YP_001931565.1|  NAD-dependent epimerase/dehydratase [Sulf...   199    1e-49 Gene info
ref|ZP_01756722.1|  putative nucleotide di-P-sugar epimerase o...   199    2e-49
ref|ZP_02058189.1|  NAD-dependent epimerase/dehydratase [Methy...   199    2e-49
ref|YP_872210.1|  NAD-dependent epimerase/dehydratase [Acidoth...   199    2e-49 Gene info
ref|ZP_01873425.1|  GDP-L-fucose synthetase [Lentisphaera aran...   198    2e-49
ref|YP_001226474.1|  GDP-L fucose synthetase [Synechococcus sp...   198    2e-49 Gene info
ref|YP_002279950.1|  NAD-dependent epimerase/dehydratase [Rhiz...   198    3e-49 Gene info
ref|YP_001977015.1|  probable GDP-L-fucose synthase protein [R...   198    3e-49 Gene info
gb|EDY39381.1|  GDP-fucose synthetase [Cyanobium sp. PCC 7001]      197    6e-49
ref|YP_550792.1|  NAD-dependent epimerase/dehydratase [Polarom...   197    7e-49 Gene info
ref|YP_001223836.1|  GDP-L fucose synthetase [Synechococcus sp...   197    7e-49 Gene info
ref|ZP_03010033.1|  hypothetical protein BACCOP_01898 [Bactero...   196    9e-49
ref|NP_355874.2|  GDP-fucose synthetase [Agrobacterium tumefac...   196    9e-49 Gene info
ref|YP_001927789.1|  NAD-dependent epimerase/dehydratase [Meth...   195    2e-48 Gene info
ref|NP_106442.1|  GDP-L-fucose synthetase(nodulation protein N...   194    3e-48 Gene info
gb|AAS83023.1|  putative GDP-fucose synthetase [Azospirillum b...   194    3e-48
ref|YP_001542334.1|  NAD-dependent epimerase/dehydratase [Dino...   194    3e-48 Gene info
ref|YP_001361578.1|  NAD-dependent epimerase/dehydratase [Kine...   194    3e-48 Gene info
gb|EDX81315.1|  NAD dependent epimerase/dehydratase family [Br...   194    4e-48
ref|NP_896518.1|  putative GDP-L-fucose synthetase [Synechococ...   194    5e-48 Gene info
emb|CAD31385.1|  PROBABLE GDP-L-FUCOSE SYNTHETASE (NODULATION ...   193    8e-48
ref|ZP_03207867.1|  hypothetical protein BACPLE_01497 [Bactero...   193    1e-47
ref|YP_001710304.1|  GDP-l-fucose synthetase [Clavibacter mich...   193    1e-47 Gene info
ref|ZP_03024581.1|  NAD-dependent epimerase/dehydratase [Geoba...   193    1e-47
ref|YP_705383.1|  GDP-L-fucose synthase [Rhodococcus sp. RHA1]...   192    1e-47 Gene info
gb|AAV34520.1|  fucose synthetase [Salmonella enterica subsp. ...   192    2e-47
ref|YP_638115.1|  NAD-dependent epimerase/dehydratase [Mycobac...   192    2e-47 Gene info
gb|EDX80936.1|  NAD dependent epimerase/dehydratase family [Br...   191    4e-47
ref|ZP_02070681.1|  hypothetical protein BACUNI_02105 [Bactero...   191    4e-47
ref|YP_001222341.1|  hypothetical protein CMM_1599 [Clavibacte...   190    6e-47 Gene info
gb|AAV52286.1|  pPutative nucleotide di-P-sugar epimerase/dehy...   190    7e-47
ref|NP_810138.1|  GDP-fucose synthetase [Bacteroides thetaiota...   190    7e-47 Gene info
ref|ZP_01751998.1|  putative nucleotide di-P-sugar epimerase o...   190    9e-47
ref|YP_002248316.1|  GDP-L-fucose synthetase [Thermodesulfovib...   190    9e-47 Gene info
ref|ZP_01961473.1|  hypothetical protein BACCAC_03105 [Bactero...   189    1e-46
gb|AAR38454.1|  GDP-fucose synthetase [uncultured marine bacte...   189    1e-46
ref|ZP_02435804.1|  hypothetical protein BACSTE_02055 [Bactero...   189    1e-46
ref|YP_001136009.1|  NAD-dependent epimerase/dehydratase [Myco...   189    1e-46 Gene info
ref|YP_001398728.1|  GDP-fucose synthetase [Campylobacter jeju...   189    2e-46 Gene info
ref|YP_935101.1|  putative GDP-fucose synthetase [Azoarcus sp....   189    2e-46 Gene info
ref|ZP_01959457.1|  hypothetical protein BACCAC_01061 [Bactero...   188    2e-46
ref|YP_001301170.1|  GDP-4-keto-6-deoxy-D-mannose-3,5-epimeras...   188    3e-46 Gene info
ref|ZP_02063564.1|  hypothetical protein BACOVA_00512 [Bactero...   188    3e-46
ref|YP_001677975.1|  GDP-4-keto-6-deoxy-D-mannose-3,5-epimeras...   187    5e-46 Gene info
ref|NP_874458.1|  NAD dependent epimerase/dehydratase [Prochlo...   187    6e-46 Gene info
ref|ZP_02030540.1|  hypothetical protein PARMER_00511 [Parabac...   187    6e-46
ref|ZP_03015043.1|  hypothetical protein BACINT_02629 [Bactero...   186    9e-46
ref|YP_485149.1|  NAD-dependent epimerase/dehydratase [Rhodops...   185    2e-45 Gene info
ref|YP_419524.1|  hypothetical protein amb0161 [Magnetospirill...   185    3e-45 Gene info
ref|YP_001302049.1|  GDP-4-keto-6-deoxy-D-mannose-3, 5-epimera...   185    3e-45 Gene info
ref|ZP_01070104.1|  GDP-L-fucose synthetase [Campylobacter jej...   184    3e-45
gb|AAR90886.1|  GDP-fucose synthetase [Escherichia coli]            184    4e-45
ref|ZP_01452985.1|  GDP-fucose synthetase [Mariprofundus ferro...   184    5e-45
ref|YP_211521.1|  putative GDP-L-fucose synthetase [Bacteroide...   184    5e-45 Gene info
ref|YP_099103.1|  GDP-4-keto-6-deoxy-D-mannose-3, 5-epimerase-...   184    6e-45 Gene info
ref|YP_001299925.1|  GDP-4-keto-6-deoxy-D-mannose-3, 5-epimera...   183    1e-44 Gene info
ref|NP_859704.1|  hypothetical protein HH0173 [Helicobacter he...   182    1e-44 Gene info
ref|ZP_00998357.1|  putative nucleotide di-P-sugar epimerase o...   181    3e-44
ref|ZP_01049719.1|  hypothetical protein MED134_09371 [Cellulo...   181    4e-44
ref|ZP_02070726.1|  hypothetical protein BACUNI_02153 [Bactero...   181    5e-44
ref|ZP_00949533.1|  GDP-fucose synthetase [Croceibacter atlant...   179    1e-43
ref|ZP_02002697.1|  NAD-dependent epimerase/dehydratase [Beggi...   179    1e-43
ref|YP_001011714.1|  putative fucose synthetase [Prochlorococc...   179    1e-43 Gene info
ref|YP_420162.1|  nucleoside-diphosphate-sugar epimerase [Magn...   179    2e-43 Gene info
ref|YP_001877854.1|  NAD-dependent epimerase/dehydratase [Akke...   177    5e-43 Gene info
ref|XP_002060950.1|  GK19108 [Drosophila willistoni] >gb|EDW71...   176    9e-43 Gene info
ref|YP_001855900.1|  GDP-L-fucose synthase [Kocuria rhizophila...   175    2e-42 Gene info
ref|NP_905468.1|  GDP-fucose synthetase [Porphyromonas gingiva...   174    5e-42 Gene info
ref|YP_001929195.1|  GDP-fucose synthetase [Porphyromonas ging...   172    2e-41 Gene info
ref|NP_819718.1|  GDP-L-fucose synthase [Coxiella burnetii RSA...   171    3e-41 Gene info
gb|EDZ64565.1|  GDP-L-fucose synthase 1 [beta proteobacterium ...   167    4e-40
ref|ZP_01447260.1|  NAD-dependent epimerase/dehydratase family...   164    5e-39
ref|YP_001001083.1|  GDP-fucose synthetase [Campylobacter jeju...   161    4e-38 Gene info
emb|CAI38879.1|  GDP-4-keto-6-deoxy-D-sugar-3,5-epimerase-4-re...   161    4e-38
gb|AAK00171.1|AF222753_26  putative nodulation NAD-dependent n...   160    5e-38
gb|AAR01910.1|  putative GDP-fucose synthase [Campylobacter je...   160    6e-38
ref|ZP_03222899.1|  putative fucose synthetase [Campylobacter ...   160    6e-38
ref|ZP_03025733.1|  GDP-L-fucose synthase [Geobacter sp. M21] ...   160    7e-38
gb|AAR01887.1|  putative GDP-fucose synthase [Campylobacter je...   160    9e-38
ref|YP_001329559.1|  NAD-dependent epimerase/dehydratase [Meth...   159    2e-37 Gene info
emb|CAI38716.1|  GDP-4-keto-6-deoxy-D-sugar-3,5-epimerase-4-re...   157    4e-37
ref|ZP_01070185.1|  GDP-L-fucose synthetase [Campylobacter jej...   157    4e-37
ref|ZP_02736136.1|  GDP-fucose synthetase [Gemmata obscuriglob...   155    2e-36
ref|ZP_00371570.1|  GDP-fucose synthetase [Campylobacter upsal...   154    7e-36
gb|EAZ01911.1|  hypothetical protein OsI_023143 [Oryza sativa ...   152    2e-35
ref|YP_179593.1|  GDP-L-fucose synthetase [Campylobacter jejun...   152    2e-35 Gene info
ref|NP_001058234.1|  Os06g0652300 [Oryza sativa (japonica cult...   151    4e-35 UniGene infoGene info
ref|YP_001398729.1|  GDP-fucose synthetase [Campylobacter jeju...   151    4e-35 Gene info
ref|ZP_01514931.1|  NAD-dependent epimerase/dehydratase [Chlor...   150    5e-35
ref|YP_001518270.1|  NAD-dependent epimerase/dehydratase, puta...   150    8e-35 Gene info
ref|YP_477782.1|  NAD dependent epimerase/dehydratase family p...   149    1e-34 Gene info
ref|YP_475291.1|  NAD-dependent epimerase/dehydratase family p...   149    2e-34 Gene info
ref|NP_282569.1|  putative fucose synthetase [Campylobacter je...   148    3e-34 Gene info
ref|YP_001397851.1|  GDP-fucose synthetase [Campylobacter jeju...   146    1e-33 Gene info
ref|NP_681422.1|  GDP-fucose synthetase [Thermosynechococcus e...   146    1e-33 Gene info
ref|YP_720420.1|  NAD-dependent epimerase/dehydratase [Trichod...   145    2e-33 Gene info
gb|EDX87487.1|  NAD dependent epimerase/dehydratase family [Sy...   145    2e-33
ref|ZP_00371573.1|  GDP-fucose synthetase [Campylobacter upsal...   145    2e-33
ref|ZP_01623599.1|  3-beta hydroxysteroid dehydrogenase/isomer...   145    3e-33
ref|YP_001635722.1|  NAD-dependent epimerase/dehydratase [Chlo...   144    4e-33 Gene info
gb|AAV34528.1|  putative GDP-colitose biosynthetic protein [Sa...   144    4e-33
gb|AAG35232.1|  capsular polysaccharide synthesis protein [Esc...   144    5e-33
ref|ZP_00631675.1|  NAD-dependent epimerase/dehydratase [Parac...   144    5e-33 Gene info
gb|AAL67562.1|AF461121_13  WbdJ [Escherichia coli] >dbj|BAG118...   144    5e-33
ref|YP_270851.1|  NAD-dependent epimerase/dehydratase family p...   144    5e-33 Gene info
gb|AAD15752.1|  RfbB [Escherichia coli]                             144    8e-33
ref|YP_002068320.1|  GDP-L-fucose synthetase [Vibrio cholerae ...   143    8e-33 Gene info
ref|YP_136197.1|  UDP-glucose 4-epimerase [Haloarcula marismor...   143    1e-32 Gene info
ref|ZP_03061314.1|  GDP-L-fucose synthase 1 [Escherichia coli ...   143    1e-32
ref|YP_001960326.1|  NAD-dependent epimerase/dehydratase [Chlo...   142    2e-32 Gene info
ref|ZP_01730803.1|  3-beta hydroxysteroid dehydrogenase/isomer...   142    2e-32
ref|YP_001397850.1|  GDP-fucose synthetase [Campylobacter jeju...   142    2e-32 Gene info
ref|ZP_01631529.1|  3-beta hydroxysteroid dehydrogenase/isomer...   142    2e-32
ref|YP_001736056.1|  GDP-fucose synthetase [Synechococcus sp. ...   141    5e-32 Gene info
ref|ZP_00371572.1|  GDP-fucose synthetase [Campylobacter upsal...   141    5e-32
ref|YP_001381602.1|  NAD-dependent epimerase/dehydratase [Anae...   140    5e-32 Gene info
ref|YP_001866836.1|  NAD-dependent epimerase/dehydratase [Nost...   140    6e-32 Gene info
ref|ZP_03157388.1|  NAD-dependent epimerase/dehydratase [Cyano...   140    6e-32
gb|AAC82494.1|  OrfY [Vibrio cholerae]                              140    6e-32
dbj|BAA33627.1|  unknown [Vibrio cholerae]                          140    7e-32
ref|ZP_03271476.1|  NAD-dependent epimerase/dehydratase [Arthr...   140    8e-32
ref|ZP_00513970.1|  NAD-dependent epimerase/dehydratase [Croco...   140    9e-32
ref|ZP_02972476.1|  NAD-dependent epimerase/dehydratase [Cyano...   140    1e-31
ref|YP_467487.1|  NAD-dependent epimerase/dehydratase [Anaerom...   139    1e-31 Gene info
ref|ZP_01809302.1|  putative fucose synthetase [Campylobacter ...   139    1e-31
ref|ZP_03137100.1|  NAD-dependent epimerase/dehydratase [Cyano...   138    3e-31
ref|NP_439904.1|  hypothetical protein sll1213 [Synechocystis ...   138    3e-31 Gene info
ref|NP_926738.1|  GDP-fucose synthetase [Gloeobacter violaceus...   138    4e-31 Gene info
ref|YP_001804646.1|  NAD dependent epimerase/dehydratase famil...   137    5e-31 Gene info
ref|ZP_02940375.1|  NAD-dependent epimerase/dehydratase [Cyano...   137    5e-31
ref|ZP_02322425.1|  NAD-dependent epimerase/dehydratase [Anaer...   137    5e-31
ref|YP_322613.1|  3-beta hydroxysteroid dehydrogenase/isomeras...   137    6e-31 Gene info
ref|YP_001658004.1|  GDP-fucose synthetase [Microcystis aerugi...   137    7e-31 Gene info
gb|AAF21448.1|U36391_2  dTDP-glucose dehydratase [Synechococcu...   136    1e-30
ref|YP_135682.1|  dTDP-glucose dehydratase [Haloarcula marismo...   136    1e-30 Gene info
ref|YP_002136755.1|  NAD-dependent epimerase/dehydratase [Anae...   136    1e-30 Gene info
emb|CAJ72124.1|  similar to GDP-4-keto-6-deoxy-D-mannose-3,5-e...   136    1e-30
ref|ZP_01253584.1|  putative nucleotide di-P-sugar epimerase [...   136    1e-30
gb|AAD10233.1|  unknown [Anabaena sp. CA]                           136    1e-30
ref|NP_488866.1|  dTDP-glucose dehydratase [Nostoc sp. PCC 712...   136    1e-30 Gene info
ref|ZP_02730654.1|  NAD-dependent epimerase/dehydratase [Gemma...   136    1e-30
emb|CAO89516.1|  unnamed protein product [Microcystis aerugino...   135    2e-30
ref|ZP_00960438.1|  NAD-dependent epimerase/dehydratase family...   135    3e-30
ref|YP_462397.1|  GDP-L-fucose synthase [Syntrophus aciditroph...   135    4e-30 Gene info
ref|YP_001526766.1|  nodulation protein nolK [Azorhizobium cau...   134    4e-30 Gene info
sp|P33217.2|NOLK_AZOC5  Nodulation protein nolK                     134    5e-30
gb|AAK83014.1|AF285969_6  WbdJ [Salmonella enterica]                134    8e-30
ref|NP_541827.1|  GDP-4-dehydro-D-rhamnose reductase [Brucella...   133    8e-30 Gene info
ref|NP_206846.1|  nodulation protein (nolK) [Helicobacter pylo...   132    1e-29 Gene info
ref|NP_222761.1|  putative sugar nucleotide biosynthesis [Heli...   132    2e-29 Gene info
ref|YP_001909541.1|  nodulation protein (nolK) [Helicobacter p...   132    2e-29 Gene info
ref|YP_002300680.1|  GDP-fucose synthetase [Helicobacter pylor...   132    2e-29 Gene info
gb|AAC64910.1|  O-antigen biosynthesis protein [Helicobacter p...   131    4e-29
ref|YP_002265682.1|  GDP-fucosesynthetase [Helicobacter pylori...   129    1e-28 Gene info
ref|YP_626783.1|  GDP-fucose synthetase [Helicobacter pylori H...   128    3e-28 Gene info
ref|YP_663918.1|  GDP-fucose synthetase, putative [Helicobacte...   128    3e-28 Gene info
ref|ZP_02736427.1|  NAD-dependent epimerase/dehydratase [Gemma...   120    9e-26
ref|XP_001878856.1|  predicted protein [Laccaria bicolor S238N...   118    4e-25 Gene info
ref|YP_001686536.1|  NAD-dependent epimerase/dehydratase [Caul...   117    9e-25 Gene info
gb|AAH62507.1|  Tissue specific transplantation antigen P35B [...   114    5e-24 Gene info
ref|NP_001032328.1|  tissue specific transplantation antigen P...   114    6e-24 UniGene infoGene info
ref|XP_002129179.1|  PREDICTED: similar to Tissue specific tra...   114    6e-24 UniGene infoGene info
ref|XP_418405.2|  PREDICTED: similar to Tissue specific transp...   114    7e-24 Gene info
gb|AAI08858.1|  LOC398450 protein [Xenopus laevis]                  112    2e-23 Gene info
gb|AAH43886.1|  LOC398450 protein [Xenopus laevis]                  112    2e-23 Gene info
gb|AAH73614.1|  LOC398450 protein [Xenopus laevis]                  112    3e-23 Gene info
gb|AAI23105.1|  LOC398450 protein [Xenopus laevis]                  112    3e-23 Gene info
ref|XP_646604.1|  hypothetical protein [Dictyostelium discoide...   112    3e-23 UniGene infoGene info
ref|XP_002124066.1|  PREDICTED: similar to Tissue specific tra...   111    5e-23 UniGene infoGene info
ref|XP_001372888.1|  PREDICTED: similar to FX [Monodelphis dom...   110    7e-23 UniGene infoGene info
ref|YP_772640.1|  NAD-dependent epimerase/dehydratase [Burkhol...   110    8e-23 Gene info
ref|XP_532346.2|  PREDICTED: similar to GDP-L-fucose synthetas...   109    1e-22 UniGene infoGene info
ref|XP_819302.1|  GDP-L-fucose synthetase [Trypanosoma cruzi s...   109    1e-22 Gene info
ref|NP_001039604.1|  tissue specific transplantation antigen P...   108    3e-22 UniGene infoGene info
gb|EEA46632.1|  hypothetical protein BRAFLDRAFT_231666 [Branch...   108    3e-22
ref|XP_001086298.1|  PREDICTED: tissue specific transplantatio...   108    5e-22 UniGene infoGene info
ref|XP_001505053.1|  PREDICTED: similar to GDP-L-fucose synthe...   107    5e-22 UniGene infoGene info
sp|Q8K3X2.1|FCL_CRIGR  RecName: Full=GDP-L-fucose synthetase; ...   107    6e-22
ref|YP_303608.1|  GDP-fucose synthetase [Methanosarcina barker...   107    6e-22 Gene info
emb|CAN88990.1|  GDP-4-dehydro-6-deoxy-D-mannose epimerase/red...   107    6e-22
ref|NP_001125522.1|  tissue specific transplantation antigen P...   107    7e-22 Gene info
ref|XP_829455.1|  GDP-L-fucose synthetase [Trypanosoma brucei ...   107    9e-22 Gene info
ref|XP_001192993.1|  PREDICTED: similar to Tsta3-prov protein,...   106    1e-21 UniGene infoGene info
ref|XP_790329.2|  PREDICTED: similar to Tsta3-prov protein, pa...   106    1e-21 UniGene infoGene info
ref|NP_001120927.1|  tissue specific transplantation antigen P...   106    1e-21 UniGene infoGene info
ref|NP_003304.1|  tissue specific transplantation antigen P35B...   106    1e-21 UniGene infoGene info
ref|XP_001518831.1|  PREDICTED: similar to FX protein [Ornitho...   105    2e-21 UniGene infoGene info
gb|EDL29504.1|  tissue specific transplantation antigen P35B, ...   105    2e-21 Gene info
ref|NP_112478.1|  tissue specific transplantation antigen P35B...   105    2e-21 UniGene infoGene info
ref|XP_001420794.1|  predicted protein [Ostreococcus lucimarin...   105    3e-21 Gene info
ref|XP_002111019.1|  hypothetical protein TRIADDRAFT_14880 [Tr...   105    3e-21 Gene info
ref|XP_001153300.1|  PREDICTED: tissue specific transplantatio...   105    3e-21 UniGene infoGene info
ref|XP_001153250.1|  PREDICTED: similar to FX isoform 2 [Pan t...   105    4e-21 Gene info
ref|ZP_01099795.1|  GDP-L-fucose synthetase [Campylobacter jej...   105    4e-21
ref|XP_001153195.1|  PREDICTED: similar to FX isoform 1 [Pan t...   104    6e-21 UniGene infoGene info
gb|ABB05110.1|  LipDig4 [Streptomyces aureofaciens]                 103    9e-21
gb|EEA46690.1|  hypothetical protein BRAFLDRAFT_96433 [Branchi...   103    1e-20
ref|XP_001837895.1|  hypothetical protein CC1G_10316 [Coprinop...   102    2e-20 Gene info
gb|AAA39674.1|  MHC tum- transplantation antigen P35B >emb|CAB...   102    2e-20 Gene info
ref|XP_001742424.1|  hypothetical protein [Monosiga brevicolli...   101    6e-20 Gene info
ref|XP_001649253.1|  nad dependent epimerase/dehydratase [Aede...  99.4    2e-19 UniGene infoGene info
ref|XP_001653344.1|  nad dependent epimerase/dehydratase [Aede...  99.0    2e-19 UniGene infoGene info
ref|ZP_02055058.1|  NAD-dependent epimerase/dehydratase [Methy...  98.6    3e-19
ref|XP_001843590.1|  NAD dependent epimerase/dehydratase [Cule...  98.6    3e-19 UniGene infoGene info
ref|XP_967089.1|  PREDICTED: similar to nad dependent epimeras...  98.2    5e-19 UniGene infoGene info
ref|YP_001940878.1|  Nucleoside-diphosphate-sugar epimerase [M...  97.8    5e-19 Gene info
ref|XP_001627076.1|  predicted protein [Nematostella vectensis...  97.8    6e-19 UniGene infoGene info
ref|YP_001679444.1|  GDP-fucose synthetase NAD dependent epime...  97.4    7e-19 Gene info
ref|XP_001614451.1|  GDP-L-fucose synthetase [Plasmodium vivax...  97.1    9e-19 Gene info
emb|CAB61336.1|  GDP-4-keto-6-deoxy-D-mannose epimerase-reduct...  97.1    1e-18
ref|ZP_03173609.1|  NAD-dependent epimerase/dehydratase [Strep...  96.7    1e-18 Gene info
ref|NP_001003528.1|  hypothetical protein LOC445134 [Danio rer...  96.3    2e-18 UniGene infoGene info
emb|CAI21009.1|  novel protein similar to vertebrate tissue sp...  96.3    2e-18 Gene info
dbj|BAC57025.1|  4-ketoreductase [Micromonospora griseorubida]     96.3    2e-18
gb|AAW25559.1|  unknown [Schistosoma japonicum]                    96.3    2e-18
ref|XP_001952314.1|  PREDICTED: similar to GDP-L-fucose synthe...  96.3    2e-18 UniGene infoGene info
gb|AAW26283.1|  SJCHGC00869 protein [Schistosoma japonicum]        96.3    2e-18
gb|ABB52541.1|  hexose-4-ketoreductase [Streptomyces sp. KCTC ...  95.5    2e-18
ref|YP_659183.1|  nucleoside-diphosphate-sugar epimerase ( UDP...  95.5    3e-18 Gene info
ref|YP_001927245.1|  NAD-dependent epimerase/dehydratase [Meth...  95.5    3e-18 Gene info
ref|NP_001070752.1|  hypothetical protein LOC768139 [Danio rer...  94.7    5e-18 UniGene infoGene info
ref|XP_001665428.1|  hypothetical protein CBG16511 [Caenorhabd...  93.6    1e-17 Gene info
ref|XP_001600760.1|  PREDICTED: similar to nad dependent epime...  93.6    1e-17 Gene info
ref|XP_001347422.1|  GDP-fucose synthase [Plasmodium falciparu...  92.8    2e-17 Gene info
ref|ZP_02070833.1|  hypothetical protein BACUNI_02261 [Bactero...  92.8    2e-17
ref|XP_625134.1|  PREDICTED: similar to GDP-4-keto-6-deoxy-D-m...  92.8    2e-17 UniGene infoGene info
ref|NP_001008620.1|  tissue specific transplantation antigen P...  92.4    2e-17 UniGene infoGene info
ref|XP_001893725.1|  GDP-L-fucose synthetase [Brugia malayi] >...  92.4    3e-17 Gene info
ref|NP_442436.1|  hypothetical protein slr0583 [Synechocystis ...  92.0    3e-17 Gene info
emb|CAQ39550.1|  gdp-fucose synthase, putative [Plasmodium kno...  92.0    3e-17
emb|CAF98098.1|  unnamed protein product [Tetraodon nigroviridis]  92.0    3e-17
gb|AAS79455.1|  putative 4-ketoreductase in D-allose pathway [...  92.0    3e-17
ref|NP_001103317.1|  hypothetical protein LOC100126119 [Danio ...  91.7    4e-17 UniGene infoGene info
ref|XP_317364.3|  AGAP008092-PA [Anopheles gambiae str. PEST] ...  91.7    4e-17 UniGene infoGene info
gb|ABV49602.1|  NDP-4-ketoreductase [Streptomyces eurythermus]     90.5    9e-17
ref|YP_001753906.1|  GDP-L-fucose synthase [Methylobacterium r...  90.5    1e-16 Gene info
emb|CAF98096.1|  unnamed protein product [Tetraodon nigroviridis]  89.7    2e-16
ref|XP_002061316.1|  GK20854 [Drosophila willistoni] >gb|EDW72...  89.4    2e-16 Gene info
ref|NP_498540.1|  GDP-keto-6-deoxymannose 3,5-Epimerase/4-Redu...  89.4    2e-16 UniGene infoGene info
ref|YP_589972.1|  NAD-dependent epimerase/dehydratase [Acidoba...  89.0    2e-16 Gene info
gb|AAM33314.1|AF503594_5  Fcl [Erwinia chrysanthemi]               87.4    8e-16
ref|YP_903220.1|  NAD-dependent epimerase/dehydratase [Pelobac...  87.4    8e-16 Gene info
ref|YP_001230445.1|  NAD-dependent epimerase/dehydratase [Geob...  87.4    9e-16 Gene info
gb|ACI68997.1|  GDP-L-fucose synthetase [Salmo salar]              86.7    1e-15
ref|ZP_02969763.1|  NAD-dependent epimerase/dehydratase [bacte...  86.7    1e-15
ref|YP_002249176.1|  WbnF [Thermodesulfovibrio yellowstonii DS...  86.3    2e-15 Gene info
gb|ABL74942.1|  TlmG [Streptoalloteichus hindustanus]              86.3    2e-15
emb|CAQ15855.1|  novel protein (zgc:110348) [Danio rerio]          85.9    2e-15
ref|YP_444759.1|  sugar epimerase BlmG [Salinibacter ruber DSM...  84.7    5e-15 Gene info
ref|YP_594155.1|  GDP-L-fucose synthase [Deinococcus geotherma...  84.7    5e-15 Gene info
ref|ZP_01167807.1|  dTDP-glucose dehydratase [Oceanospirillum ...  84.3    6e-15
ref|ZP_01086016.1|  putative GDP-L-fucose synthetase [Synechoc...  84.0    8e-15
emb|CAL57257.1|  GDP-4-keto-6-deoxy-D-mannose epimerase-reduct...  83.2    1e-14
gb|AAD41816.1|AF147703_2  hypothetical NDP-hexose 4-ketoreduct...  83.2    1e-14
ref|ZP_03126923.1|  NAD-dependent epimerase/dehydratase [Chtho...  83.2    2e-14
ref|YP_001596875.1|  NAD dependent epimerase/dehydratase famil...  82.8    2e-14 Gene info
ref|NP_819849.1|  NAD dependent epimerase/dehydratase family p...  82.8    2e-14 Gene info
gb|AAO90363.2|  NAD dependent epimerase/dehydratase family [Co...  82.8    2e-14
gb|EAW82219.1|  tissue specific transplantation antigen P35B, ...  82.4    3e-14 Gene info
ref|XP_001976316.1|  GG20086 [Drosophila erecta] >gb|EDV56716....  82.0    3e-14 Gene info
gb|EAW82221.1|  tissue specific transplantation antigen P35B, ...  82.0    3e-14 Gene info
ref|ZP_01550511.1|  NAD-dependent epimerase/dehydratase family...  81.6    4e-14
ref|NP_001017789.1|  hypothetical protein LOC550486 [Danio rer...  81.6    4e-14 UniGene infoGene info
ref|XP_674119.1|  GDP-fucose synthase [Plasmodium berghei stra...  81.6    5e-14 Gene info
ref|YP_001424277.2|  NAD dependent epimerase/dehydratase famil...  81.3    5e-14 Gene info
ref|YP_001801462.1|  putative GDP-L-fucose synthase [Cyanothec...  81.3    6e-14 Gene info
ref|ZP_02218994.1|  NAD dependent epimerase/dehydratase family...  81.3    6e-14
gb|ABK24746.1|  unknown [Picea sitchensis]                         80.9    7e-14
ref|ZP_01946554.1|  NAD dependent epimerase/dehydratase family...  80.9    7e-14
ref|ZP_01253585.1|  GDP-fucose synthetase [Psychroflexus torqu...  80.9    7e-14
ref|XP_002092525.1|  GE11625 [Drosophila yakuba] >gb|EDW92237....  80.9    8e-14 Gene info
gb|AAI58886.1|  Tsta3 protein [Rattus norvegicus]                  80.9    8e-14 Gene info
ref|XP_001960809.1|  GF11320 [Drosophila ananassae] >gb|EDV376...  80.5    8e-14 Gene info
ref|ZP_02532793.1|  GDP-L-fucose synthetase [Endoriftia persep...  80.5    9e-14
ref|XP_001689497.1|  sugar nucleotide epimerase [Chlamydomonas...  80.5    9e-14 UniGene infoGene info
ref|YP_659182.1|  nucleoside-diphosphate-sugar epimerase ( UDP...  80.5    1e-13 Gene info
ref|ZP_02939775.1|  NAD-dependent epimerase/dehydratase [Cyano...  79.7    2e-13
ref|YP_001737199.1|  NAD-dependent epimerase/dehydratase [Cand...  79.7    2e-13 Gene info
ref|YP_782413.1|  NAD-dependent epimerase/dehydratase [Rhodops...  79.7    2e-13 Gene info
ref|NP_611734.1|  GDP-4-keto-6-deoxy-D-mannose 3,5-epimerase/4...  79.3    2e-13 UniGene infoGene info
ref|XP_001774081.1|  predicted protein [Physcomitrella patens ...  79.3    2e-13 UniGene infoGene info
gb|EEA46633.1|  hypothetical protein BRAFLDRAFT_231705 [Branch...  79.3    2e-13
ref|XP_001361894.1|  GA17480 [Drosophila pseudoobscura pseudoo...  78.6    3e-13 Gene info
ref|NP_616126.1|  UDP-glucose 4-epimerase [Methanosarcina acet...  78.6    3e-13 Gene info
ref|YP_828737.1|  NAD-dependent epimerase/dehydratase [Solibac...  78.6    4e-13 Gene info
ref|YP_001467375.1|  hypothetical protein CCC13826_0539 [Campy...  78.2    4e-13 Gene info
ref|XP_002005286.1|  GI19163 [Drosophila mojavensis] >gb|EDW09...  78.2    5e-13 Gene info
ref|XP_001767949.1|  predicted protein [Physcomitrella patens ...  78.2    5e-13 UniGene infoGene info
ref|XP_001986285.1|  GH20607 [Drosophila grimshawi] >gb|EDW011...  77.8    5e-13 Gene info
ref|XP_002050582.1|  GJ20119 [Drosophila virilis] >gb|EDW61775...  77.8    6e-13 Gene info
ref|YP_967835.1|  NAD-dependent epimerase/dehydratase [Desulfo...  77.4    7e-13 Gene info
ref|XP_001778348.1|  predicted protein [Physcomitrella patens ...  77.4    8e-13 UniGene infoGene info
gb|EEA46691.1|  hypothetical protein BRAFLDRAFT_127958 [Branch...  77.4    8e-13
pdb|2C5E|A  Chain A, Gdp-Mannose-3', 5'-Epimerase (Arabidopsis...  77.4    9e-13 Related structures
ref|NP_198236.1|  GME (GDP-D-MANNOSE 3',5'-EPIMERASE); GDP-man...  77.0    9e-13 UniGene infoGene info
ref|YP_890182.1|  NAD dependent epimerase/dehydratase family p...  77.0    9e-13 Gene info
pdb|2C59|A  Chain A, Gdp-Mannose-3', 5'-Epimerase (Arabidopsis...  77.0    1e-12 Related structures
dbj|BAE45242.1|  GDP-mannose-3'',5''-epimerase [Oryza sativa J...  77.0    1e-12
gb|ABB72807.1|  NAD-dependent epimerase/dehydratase family pro...  76.6    1e-12
ref|NP_882483.1|  NAD dependent epimerase/dehydratase family p...  76.6    1e-12 Gene info
pdb|2C54|A  Chain A, Gdp-Mannose-3', 5'-Epimerase (Arabidopsis...  76.6    1e-12 Related structures
ref|YP_009777.1|  NAD-dependent epimerase/dehydratase family p...  76.3    2e-12 Gene info
ref|ZP_02120637.1|  NAD-dependent epimerase/dehydratase [Methy...  75.9    2e-12
emb|CAD62190.1|  Ata17 protein [Saccharothrix mutabilis subsp....  75.9    2e-12
ref|NP_541828.1|  GDP-fucose synthetase [Brucella melitensis 1...  75.9    2e-12 Gene info
pdb|2C5A|A  Chain A, Gdp-Mannose-3', 5'-Epimerase (Arabidopsis...  75.9    2e-12 Related structures
gb|AAM51008.1|  RE55674p [Drosophila melanogaster]                 75.5    3e-12
ref|ZP_01731826.1|  hypothetical protein CY0110_27844 [Cyanoth...  75.5    3e-12
gb|ABB53472.1|  GDP-D-mannose-3',5'-epimerase [Malpighia glabra]   75.5    3e-12
gb|ABK24250.1|  unknown [Picea sitchensis]                         74.7    5e-12
ref|XP_002082696.1|  GD25098 [Drosophila simulans] >gb|EDX0828...  74.7    5e-12 Gene info
sp|A2Z7B3.1|GME1_ORYSI  RecName: Full=GDP-mannose 3,5-epimeras...  74.7    6e-12
ref|NP_001064609.1|  Os10g0417600 [Oryza sativa (japonica cult...  74.3    6e-12 UniGene infoGene info
emb|CAL57434.1|  GDP-mannose 4,6 dehydratase (ISS) [Ostreococc...  74.3    6e-12
gb|ACF79415.1|  unknown [Zea mays]                                 74.3    7e-12 Gene info
ref|XP_001421368.1|  predicted protein [Ostreococcus lucimarin...  74.3    7e-12 Gene info
gb|ACG32271.1|  unknown [Zea mays]                                 74.3    7e-12
ref|YP_460444.1|  dTDP-glucose 4,6-dehydratase [Syntrophus aci...  73.9    8e-12 Gene info
gb|EDZ38508.1|  UDP-glucose 4-epimerase [Leptospirillum sp. Gr...  73.9    1e-11
ref|ZP_00514947.1|  GDP-L-fucose synthase [Crocosphaera watson...  73.9    1e-11
ref|ZP_01722124.1|  Nucleoside-diphosphate-sugar epimerase and...  73.6    1e-11
ref|YP_001697011.1|  putative UDP-glucose 4-epimerase [Lysinib...  73.6    1e-11 Gene info
ref|ZP_03223580.1|  putative nucleotide sugar dehydratase [Cam...  73.6    1e-11
ref|ZP_00367374.1|  probable nucleotide sugar dehydratase Cj13...  73.6    1e-11
ref|YP_179498.1|  NAD-dependent epimerase/dehydratase family p...  73.2    1e-11 Gene info
ref|NP_282465.1|  putative nucleotide sugar dehydratase [Campy...  73.2    1e-11 Gene info
ref|NP_125996.1|  UDP-glucose 4-epimerase [Pyrococcus abyssi G...  73.2    1e-11 Gene info
gb|AAG02361.1|AF210249_20  sugar epimerase BlmG [Streptomyces ...  73.2    2e-11
gb|AAM77990.1|  NDP-hexose-4,6-dehydratase [Streptomyces carzi...  72.8    2e-11
ref|XP_002039993.1|  GM15602 [Drosophila sechellia] >gb|EDW568...  72.8    2e-11 Gene info
ref|YP_001489600.1|  NAD-dependent epimerase/dehydratase famil...  72.8    2e-11 Gene info
ref|YP_645832.1|  NAD-dependent epimerase/dehydratase [Rubroba...  72.8    2e-11 Gene info
ref|ZP_01068240.1|  NAD-dependent epimerase/dehydratase family...  72.4    2e-11
gb|ABR25644.1|  gdp-mannose 3, 5-epimerase 1 [Oryza sativa (in...  72.4    3e-11
ref|XP_001302740.1|  AT5g28840/F7P1_20 [Trichomonas vaginalis ...  72.4    3e-11 Gene info
ref|YP_001435579.1|  NAD-dependent epimerase/dehydratase [Igni...  72.0    3e-11 Gene info
ref|YP_001960534.1|  NAD-dependent epimerase/dehydratase [Chlo...  72.0    3e-11 Gene info
gb|EAY57424.1|  Nucleoside-diphosphate-sugar epimerase [Leptos...  72.0    3e-11
ref|YP_566663.1|  NAD-dependent epimerase/dehydratase [Methano...  72.0    3e-11 Gene info
ref|XP_001324280.1|  Epimerase/dehydratase [Trichomonas vagina...  71.6    4e-11 Gene info
gb|EAY97654.1|  hypothetical protein OsI_018887 [Oryza sativa ...  71.6    4e-11
ref|ZP_01689045.1|  NAD dependent epimerase/dehydratase family...  71.6    4e-11
ref|NP_001068183.1|  Os11g0591100 [Oryza sativa (japonica cult...  71.6    4e-11 UniGene infoGene info
ref|XP_383224.1|  hypothetical protein FG03048.1 [Gibberella z...  71.6    5e-11 Gene info
ref|YP_001397595.1|  NAD-dependent epimerase/dehydratase famil...  71.2    5e-11 Gene info
ref|YP_566237.1|  NAD-dependent epimerase/dehydratase [Methano...  71.2    6e-11 Gene info
gb|EDY35626.1|  hypothetical protein ABOONEI_163 [Aciduliprofu...  71.2    6e-11
ref|YP_842576.1|  NAD-dependent epimerase/dehydratase [Methano...  71.2    6e-11 Gene info
ref|ZP_02179066.1|  nucleotide sugar epimerase [Hydrogenivirga...  71.2    6e-11
emb|CAL58566.1|  dTDP-glucose 4-6-dehydratase/UDP-glucuronic a...  71.2    6e-11
ref|YP_001505325.1|  NAD-dependent epimerase/dehydratase [Fran...  71.2    6e-11 Gene info
ref|ZP_02177905.1|  nucleotide sugar epimerase [Hydrogenivirga...  70.9    8e-11
gb|ACG36947.1|  unknown [Zea mays]                                 70.9    8e-11
ref|YP_359403.1|  UDP-glucose 4-epimerase [Carboxydothermus hy...  70.9    8e-11 Gene info
gb|ABQ41112.1|  GDP-mannose-3',5'-epimerase [Vitis vinifera]       70.5    9e-11
emb|CAO43062.1|  unnamed protein product [Vitis vinifera]          70.5    1e-10
ref|NP_275523.1|  UDP-glucose 4-epimerase-like protein [Methan...  70.1    1e-10 Gene info
emb|CAN69149.1|  hypothetical protein [Vitis vinifera]             69.7    1e-10
ref|YP_001890379.1|  NAD-dependent epimerase/dehydratase [Burk...  69.7    1e-10 Gene info
emb|CAO71271.1|  unnamed protein product [Vitis vinifera]          69.7    2e-10
ref|YP_467621.1|  dTDP-glucose 4,6-dehydratase protein [Rhizob...  69.7    2e-10 Gene info
gb|ABG66078.1|  NAD dependent epimerase/dehydratase family pro...  69.7    2e-10
ref|NP_341721.1|  UDP-glucose 4-epimerase (galE-2) [Sulfolobus...  69.3    2e-10 Gene info
ref|YP_001568350.1|  NAD-dependent epimerase/dehydratase [Petr...  69.3    2e-10 Gene info
ref|ZP_02622029.1|  UDP-glucose 4-epimerase [Clostridium botul...  69.3    2e-10
ref|YP_753318.1|  nucleoside-diphosphate-sugar epimerase [Synt...  68.9    3e-10 Gene info
ref|XP_001422230.1|  predicted protein [Ostreococcus lucimarin...  68.9    3e-10 Gene info
ref|ZP_03172007.1|  UDP-glucose 4-epimerase [Streptomyces sp. ...  68.6    3e-10 Gene info
ref|NP_893919.1|  UDP-glucose-4-epimerase [Prochlorococcus mar...  68.6    4e-10 Gene info
ref|YP_001191887.1|  NAD-dependent epimerase/dehydratase [Meta...  68.6    4e-10 Gene info
ref|YP_134444.1|  UDP-glucose 4-epimerase [Haloarcula marismor...  68.6    4e-10 Gene info
ref|ZP_01467339.1|  UDP-glucose 4-epimerase [Stigmatella auran...  68.2    5e-10
ref|ZP_01123711.1|  putative nucleoside-diphosphate sugar epim...  67.8    6e-10
ref|YP_001099438.1|  putative UDP-glucose-4-epimerase [Hermini...  67.4    7e-10 Gene info
ref|YP_001997378.1|  NAD-dependent epimerase/dehydratase [Chlo...  67.4    8e-10 Gene info
ref|YP_001305417.1|  NAD-dependent epimerase/dehydratase [Ther...  67.4    9e-10 Gene info
ref|YP_454010.1|  GDP-L-fucose-synthase [Sodalis glossinidius ...  67.4    9e-10 Gene info
ref|YP_359903.1|  hypothetical protein CHY_1057 [Carboxydother...  67.4    9e-10 Gene info
ref|ZP_01083405.1|  putative nucleoside-diphosphate sugar epim...  67.4    9e-10
ref|ZP_00738622.1|  dTDP-glucose 4,6-dehydratase [Bacillus thu...  67.0    9e-10
ref|YP_001213316.1|  nucleoside-diphosphate-sugar epimerases [...  67.0    1e-09 Gene info
ref|XP_001580771.1|  NAD dependent epimerase/dehydratase famil...  66.6    1e-09 Gene info
ref|YP_877861.1|  UDP-glucose 4-epimerase [Clostridium novyi N...  66.6    1e-09 Gene info
ref|ZP_01576686.1|  NAD-dependent epimerase/dehydratase [Clost...  66.6    1e-09
emb|CAJ71376.1|  similar to UDPglucose 4-epimerase [Candidatus...  66.6    1e-09
ref|ZP_01014061.1|  UDP-glucose 4-epimerase [Rhodobacterales b...  66.6    1e-09
ref|YP_001594491.1|  NAD-dependent epimerase/dehydratase [Bruc...  66.6    2e-09 Gene info
ref|YP_001932591.1|  NAD-dependent epimerase/dehydratase [Bruc...  66.6    2e-09 Gene info
ref|YP_223448.1|  NAD-dependent epimerase/dehydratase family p...  66.6    2e-09 Gene info
ref|NP_699729.1|  NAD-dependent epimerase/dehydratase family p...  66.2    2e-09 Gene info
ref|ZP_01925681.1|  NAD-dependent epimerase/dehydratase [Victi...  66.2    2e-09
ref|NP_228319.1|  UDP-glucose 4-epimerase, putative [Thermotog...  66.2    2e-09 Gene info
ref|YP_331058.1|  nucleoside-diphosphate-sugar epimerase 1 ( U...  66.2    2e-09 Gene info
ref|YP_002221280.1|  NAD-dependent epimerase/dehydratase [Acid...  66.2    2e-09 Gene info
emb|CAL55169.1|  dTDP-glucose 4-6-dehydratase-like protein (IS...  66.2    2e-09
ref|NP_342318.1|  UDP-glucose 4-epimerase (galE-2) [Sulfolobus...  66.2    2e-09 Gene info
ref|YP_001091624.1|  nucleoside-diphosphate-sugar epimerase [P...  65.9    2e-09 Gene info
ref|ZP_00371492.1|  UDP-glucose 4-epimerase, putative [Campylo...  65.9    2e-09
ref|YP_001395481.1|  CapI [Clostridium kluyveri DSM 555] >gb|E...  65.9    2e-09 Gene info
ref|YP_001046120.1|  NAD-dependent epimerase/dehydratase [Meth...  65.9    2e-09 Gene info
ref|YP_001885902.1|  UDP-glucose 4-epimerase [Clostridium botu...  65.9    2e-09 Gene info
ref|ZP_01513889.1|  NAD-dependent epimerase/dehydratase [Chlor...  65.9    3e-09
ref|YP_001255178.1|  UDP-glucose 4-epimerase [Clostridium botu...  65.9    3e-09 Gene info
ref|NP_781526.1|  UDP-glucose 4-epimerase, galE [Clostridium t...  65.9    3e-09 Gene info
gb|EDX84058.1|  NAD dependent epimerase/dehydratase family [Sy...  65.9    3e-09
ref|YP_001788029.1|  UDP-glucose 4-epimerase [Clostridium botu...  65.5    3e-09 Gene info
gb|EDY35484.1|  hypothetical protein ABOONEI_767 [Aciduliprofu...  65.5    3e-09
ref|YP_001782294.1|  NAD-dependent epimerase/dehydratase famil...  65.5    3e-09 Gene info
ref|XP_001769957.1|  predicted protein [Physcomitrella patens ...  65.5    3e-09 UniGene infoGene info
ref|YP_468890.1|  dTDP-glucose 4,6-dehydratase protein [Rhizob...  65.5    3e-09 Gene info
ref|YP_001482921.1|  hypothetical protein C8J_1346 [Campylobac...  65.5    3e-09 Gene info
ref|ZP_02013745.1|  NAD-dependent epimerase/dehydratase [Opitu...  65.1    4e-09
ref|YP_594157.1|  NAD-dependent epimerase/dehydratase [Deinoco...  65.1    4e-09 Gene info
ref|YP_001372946.1|  NAD-dependent epimerase/dehydratase [Ochr...  65.1    4e-09 Gene info
ref|ZP_01099941.1|  GDP-L-fucose synthetase [Campylobacter jej...  65.1    5e-09
gb|ABZ79811.1|  nucleotidyl-sugar pyranose mutase [Campylobact...  64.7    5e-09
ref|YP_001324577.1|  NAD-dependent epimerase/dehydratase [Meth...  64.7    5e-09 Gene info
ref|YP_075199.1|  putative UDP-glucose 4-epimerase [Symbiobact...  64.7    5e-09 Gene info
ref|XP_001776651.1|  predicted protein [Physcomitrella patens ...  64.7    5e-09 UniGene infoGene info
ref|YP_001091635.1|  nucleoside-diphosphate-sugar epimerase [P...  64.7    5e-09 Gene info
ref|NP_736943.1|  putative dTDP-glucose 4-epimerase [Corynebac...  64.7    5e-09 Gene info
ref|YP_001244013.1|  NAD-dependent epimerase/dehydratase [Ther...  64.7    5e-09 Gene info
ref|NP_681454.1|  dTDP-glucose 4,6-dehydratase [Thermosynechoc...  64.7    6e-09 Gene info
ref|XP_729758.1|  transplantation antigen p35b [Plasmodium yoe...  64.7    6e-09 Gene info
ref|ZP_03286555.1|  UDP-glucose 4-epimerase [Dictyoglomus turg...  64.7    6e-09
ref|YP_001793871.1|  dTDP-glucose 4,6-dehydratase [Thermoprote...  64.7    6e-09 Gene info
ref|YP_001738467.1|  NAD-dependent epimerase/dehydratase [Ther...  64.3    6e-09 Gene info
ref|YP_631701.1|  UDP-glucose 4-epimerase [Myxococcus xanthus ...  64.3    7e-09 Gene info
ref|NP_213918.1|  nucleotide sugar epimerase [Aquifex aeolicus...  64.3    7e-09 Gene info
ref|YP_001434312.1|  NAD-dependent epimerase/dehydratase [Rose...  64.3    7e-09 Gene info
ref|NP_376034.1|  UDP-glucose 4-epimerase [Sulfolobus tokodaii...  64.3    7e-09 Gene info
ref|ZP_01998474.1|  NAD-dependent epimerase/dehydratase [Beggi...  64.3    7e-09
ref|ZP_02909403.1|  NAD-dependent epimerase/dehydratase [Burkh...  64.3    8e-09
ref|YP_001524438.1|  NAD-dependent epimerase [Azorhizobium cau...  64.3    8e-09 Gene info
emb|CAM74428.1|  NAD-dependent epimerase/dehydratase [Magnetos...  64.3    8e-09
ref|ZP_01693794.1|  nucleotide sugar dehydratase [Microscilla ...  63.9    8e-09
ref|YP_001787997.1|  NAD-dependent epimerase/dehydratase famil...  63.9    8e-09 Gene info
ref|ZP_02889798.1|  NAD-dependent epimerase/dehydratase [Burkh...  63.9    8e-09
ref|YP_002299957.1|  NAD dependent epimerase [Rhodospirillum c...  63.9    8e-09 Gene info
ref|YP_772044.1|  NAD-dependent epimerase/dehydratase [Burkhol...  63.9    8e-09 Gene info
ref|ZP_00519262.1|  NAD-dependent epimerase/dehydratase [Croco...  63.9    9e-09
ref|NP_001055318.1|  Os05g0363200 [Oryza sativa (japonica cult...  63.9    9e-09 UniGene infoGene info
ref|ZP_02614454.1|  NAD-dependent epimerase/dehydratase family...  63.9    9e-09
ref|ZP_01623113.1|  UDP-glucose 4-epimerase [Lyngbya sp. PCC 8...  63.9    9e-09
ref|YP_844936.1|  NAD-dependent epimerase/dehydratase [Syntrop...  63.9    9e-09 Gene info
gb|AAV31405.1|  putative UDP-glucuronic acid decarboxylase [Or...  63.9    9e-09
ref|ZP_00604823.1|  NAD-dependent epimerase/dehydratase [Enter...  63.9    9e-09
ref|YP_001876657.1|  NAD-dependent epimerase/dehydratase [Akke...  63.9    9e-09 Gene info
ref|YP_001391977.1|  NAD-dependent epimerase/dehydratase famil...  63.9    9e-09 Gene info
ref|ZP_01925298.1|  NAD-dependent epimerase/dehydratase [Victi...  63.9    9e-09
ref|ZP_01885077.1|  dTDP-glucose 4,6-dehydratase, NAD-dependen...  63.9    9e-09
emb|CAF18472.1|  dTDP-D-glucose-4,6-dehydratase [Thermoproteus...  63.9    9e-09
ref|NP_541709.1|  dTDP-glucose 4-6-dehydratase [Brucella melit...  63.9    9e-09 Gene info
gb|EAZ34012.1|  hypothetical protein OsJ_017495 [Oryza sativa ...  63.9    9e-09
ref|YP_001806879.1|  NAD-dependent epimerase/dehydratase [Burk...  63.9    1e-08 Gene info
ref|NP_143580.1|  UDP-glucose 4-epimerase [Pyrococcus horikosh...  63.9    1e-08 Gene info
ref|YP_002234637.1|  putative UDP-glucuronic acid decarboxylas...  63.9    1e-08 Gene info
ref|NP_710232.1|  dtdpglucose 4,6-dehydratase [Leptospira inte...  63.9    1e-08 Gene info
ref|XP_001763355.1|  predicted protein [Physcomitrella patens ...  63.5    1e-08 UniGene infoGene info
ref|YP_001976247.1|  probable dTDP-glucose 4,6-dehydratase pro...  63.5    1e-08 Gene info
ref|ZP_00232554.1|  dTDP-glucose 4,6-dehydratase [Listeria mon...  63.5    1e-08
ref|YP_632167.1|  NAD-dependent epimerase/dehydratase family p...  63.5    1e-08 Gene info
ref|ZP_02192493.1|  NAD-dependent epimerase/dehydratase [Metha...  63.5    1e-08
ref|YP_685010.1|  putative UDP-glucose 4-epimerase [uncultured...  63.5    1e-08 Gene info
ref|ZP_01012281.1|  putative sugar nucleotide dehydratase [Rho...  63.5    1e-08
ref|NP_464608.1|  hypothetical protein lmo1083 [Listeria monoc...  63.5    1e-08 Gene info
emb|CAO40019.1|  unnamed protein product [Vitis vinifera]          63.5    1e-08
ref|YP_534010.1|  NAD-dependent epimerase/dehydratase [Rhodops...  63.5    1e-08 Gene info
ref|XP_001422283.1|  putative NAD-dependent epimerase/dehydrat...  63.5    1e-08 Gene info
ref|ZP_01628858.1|  3-beta hydroxysteroid dehydrogenase/isomer...  63.2    1e-08
gb|EAZ41062.1|  hypothetical protein OsJ_024545 [Oryza sativa ...  63.2    1e-08
ref|NP_630283.1|  nucleotide-sugar dehydratase [Streptomyces c...  63.2    1e-08 Gene info
gb|EAZ05112.1|  hypothetical protein OsI_026344 [Oryza sativa ...  63.2    1e-08
ref|NP_001060612.1|  Os07g0674100 [Oryza sativa (japonica cult...  63.2    1e-08 UniGene infoGene info
gb|ABK24464.1|  unknown [Picea sitchensis]                         63.2    1e-08
gb|ABZ79853.1|  unknown [Campylobacter jejuni] >gb|ABZ79876.1|...  63.2    2e-08
ref|XP_002141852.1|  NAD dependent epimerase/dehydratase famil...  63.2    2e-08 Gene info
ref|ZP_03138309.1|  NAD-dependent epimerase/dehydratase [Cyano...  63.2    2e-08
ref|YP_765436.1|  putative epimerase [Rhizobium leguminosarum ...  63.2    2e-08 Gene info
ref|ZP_01188084.1|  NAD-dependent epimerase/dehydratase:3-beta...  63.2    2e-08
ref|YP_001918535.1|  NAD-dependent epimerase/dehydratase [Natr...  63.2    2e-08 Gene info
ref|YP_001622355.1|  hypothetical protein BSUIS_B0537 [Brucell...  63.2    2e-08 Gene info
ref|NP_294434.1|  UDP-glucose 4-epimerase, putative [Deinococc...  62.8    2e-08 Gene info
gb|ACG24357.1|  unknown [Zea mays]                                 62.8    2e-08
ref|ZP_02615561.1|  NAD-dependent epimerase/dehydratase family...  62.8    2e-08
ref|YP_001878325.1|  NAD-dependent epimerase/dehydratase [Akke...  62.8    2e-08 Gene info
ref|YP_504486.1|  NAD-dependent epimerase/dehydratase [Methano...  62.8    2e-08 Gene info
ref|ZP_01070232.1|  NAD dependent epimerase/dehydratase family...  62.8    2e-08
ref|XP_001769958.1|  predicted protein [Physcomitrella patens ...  62.8    2e-08 UniGene infoGene info
ref|YP_001717817.1|  dTDP-glucose 4,6-dehydratase [Candidatus ...  62.8    2e-08 Gene info
gb|AAQ23687.1|  dTDP-glucose 4,6-dehydratase [Geobacillus stea...  62.8    2e-08
ref|ZP_02382704.1|  NAD-dependent epimerase/dehydratase [Burkh...  62.8    2e-08
ref|NP_147763.1|  dTDP-glucose 4,6-dehydratase [Aeropyrum pern...  62.8    2e-08 Gene info
ref|YP_001312419.1|  NAD-dependent epimerase/dehydratase [Sino...  62.8    2e-08 Gene info
ref|YP_001965575.1|  putative dTDP-glucose 4,6-dehydratase pro...  62.8    2e-08 Gene info
ref|NP_633186.1|  UDP-N-acetylglucosamine 4-epimerase [Methano...  62.8    2e-08 Gene info
ref|YP_903054.1|  NAD-dependent epimerase/dehydratase [Pelobac...  62.4    2e-08 Gene info
ref|YP_001011736.1|  nucleoside-diphosphate-sugar epimerase [P...  62.4    2e-08 Gene info
ref|YP_001781648.1|  NAD-dependent epimerase/dehydratase famil...  62.4    2e-08 Gene info
ref|YP_001858518.1|  NAD-dependent epimerase/dehydratase [Burk...  62.4    2e-08 Gene info
ref|YP_001278372.1|  NAD-dependent epimerase/dehydratase [Rose...  62.4    2e-08 Gene info
ref|YP_183417.1|  UDP-glucose 4-epimerase [Thermococcus kodaka...  62.4    2e-08 Gene info
ref|ZP_02467853.1|  NAD-dependent epimerase/dehydratase [Burkh...  62.4    3e-08
ref|ZP_01389168.1|  NAD-dependent epimerase/dehydratase:Short-...  62.4    3e-08
ref|XP_001377580.1|  PREDICTED: hypothetical protein [Monodelp...  62.4    3e-08 UniGene infoGene info
ref|YP_480400.1|  NAD-dependent epimerase/dehydratase [Frankia...  62.4    3e-08 Gene info
ref|YP_001865941.1|  NAD-dependent epimerase/dehydratase [Nost...  62.4    3e-08 Gene info
ref|ZP_01079058.1|  NAD dependent epimerase/dehydratase family...  62.4    3e-08
ref|YP_371626.1|  NAD-dependent epimerase/dehydratase [Burkhol...  62.4    3e-08 Gene info
ref|ZP_02432181.1|  hypothetical protein CLOSCI_02426 [Clostri...  62.0    3e-08
ref|XP_001422288.1|  predicted protein [Ostreococcus lucimarin...  62.0    3e-08 Gene info
gb|EAY97732.1|  hypothetical protein OsI_018965 [Oryza sativa ...  62.0    3e-08
ref|ZP_02123025.1|  NAD-dependent epimerase/dehydratase [Methy...  62.0    3e-08
ref|XP_001419676.1|  predicted protein [Ostreococcus lucimarin...  62.0    3e-08 Gene info
ref|NP_247180.1|  UDP-glucose 4-epimerase (galE) [Methanocaldo...  62.0    3e-08 Gene info
ref|ZP_00958841.1|  NAD-dependent epimerase/dehydratase family...  62.0    3e-08
ref|YP_658400.1|  nucleoside-diphosphate-sugar epimerase 1 ( U...  62.0    3e-08 Gene info
ref|ZP_02298530.1|  NAD-dependent epimerase/dehydratase [Rhizo...  62.0    3e-08
ref|NP_182287.1|  UXS4 (UDP-XYLOSE SYNTHASE 4); catalytic [Ara...  62.0    4e-08 UniGene infoGene info
ref|ZP_02996162.1|  hypothetical protein CLOSPO_03285 [Clostri...  62.0    4e-08
ref|ZP_02965292.1|  NAD-dependent epimerase/dehydratase [bacte...  62.0    4e-08
ref|ZP_01201281.1|  dTDP-glucose 4, 6-dehydratase (NAD-depende...  62.0    4e-08
ref|YP_446800.1|  UDP-glucuronate decarboxylase [Salinibacter ...  62.0    4e-08 Gene info
ref|YP_001231054.1|  NAD-dependent epimerase/dehydratase [Geob...  61.6    4e-08 Gene info
ref|YP_001226442.1|  nucleoside-diphosphate-sugar epimerases [...  61.6    4e-08 Gene info
ref|NP_860178.1|  nucleotide sugar dehydratase [Helicobacter h...  61.6    4e-08 Gene info
ref|ZP_01665316.1|  NAD-dependent epimerase/dehydratase [Therm...  61.6    4e-08
ref|YP_001391998.1|  polysaccharide biosynthesis protein [Clos...  61.6    4e-08 Gene info
ref|ZP_01132662.1|  NAD-dependent epimerase/dehydratase family...  61.6    4e-08
emb|CAD89771.1|  hypothetical protein [Melittangium lichenicola]   61.6    4e-08
ref|NP_821531.1|  UDP-glucose 4-epimerase [Streptomyces avermi...  61.6    4e-08 Gene info
ref|NP_815827.1|  NAD-dependent epimerase/dehydratase family p...  61.6    4e-08 Gene info
ref|ZP_02615538.1|  UDP-glucose 4-epimerase [Clostridium botul...  61.6    5e-08
emb|CAJ70820.1|  similar to UDP-glucose 4-epimerase [Candidatu...  61.6    5e-08
ref|NP_243170.1|  nucleotide sugar epimerase [Bacillus halodur...  61.6    5e-08 Gene info
gb|ACF83937.1|  unknown [Zea mays]                                 61.6    5e-08
ref|YP_001395857.1|  hypothetical protein CKL_2474 [Clostridiu...  61.6    5e-08 Gene info
gb|AAL65400.1|  dTDP-glucose 4-6-dehydratase-like protein [Ory...  61.6    5e-08
ref|YP_001868436.1|  NAD-dependent epimerase/dehydratase [Nost...  61.6    5e-08 Gene info
ref|YP_429612.1|  NAD-dependent epimerase/dehydratase [Moorell...  61.6    5e-08 Gene info
ref|YP_001804836.1|  dTDP-glucose 4,6-dehydratase [Cyanothece ...  61.2    5e-08 Gene info
ref|YP_001223915.1|  dTDP-glucose 4,6-dehydratase (nucleoside-...  61.2    5e-08 Gene info
ref|YP_001940017.1|  Nucleoside-diphosphate-sugar epimerase [M...  61.2    5e-08 Gene info
ref|ZP_02969759.1|  NAD-dependent epimerase/dehydratase [bacte...  61.2    5e-08
ref|XP_002025935.1|  GL10196 [Drosophila persimilis] >gb|EDW32...  61.2    5e-08 Gene info
ref|ZP_03024733.1|  NAD-dependent epimerase/dehydratase [Geoba...  61.2    5e-08
ref|YP_001305671.1|  UDP-glucose 4-epimerase [Thermosipho mela...  61.2    5e-08 Gene info
ref|ZP_02925669.1|  NAD-dependent epimerase/dehydratase [Verru...  61.2    5e-08
ref|YP_001409669.1|  NAD-dependent epimerase/dehydratase [Ferv...  61.2    5e-08 Gene info
ref|YP_002251066.1|  UDP-glucose 4-epimerase [Dictyoglomus the...  61.2    6e-08 Gene info
ref|YP_001634836.1|  NAD-dependent epimerase/dehydratase [Chlo...  61.2    6e-08 Gene info
ref|ZP_01544456.1|  dTDP glucose 4, 6-dehydratase [Oenococcus ...  61.2    6e-08
ref|ZP_02122141.1|  NAD-dependent epimerase/dehydratase [Methy...  61.2    6e-08
ref|XP_416988.1|  PREDICTED: similar to dTDP-D-glucose 4,6-deh...  61.2    6e-08 UniGene infoGene info
ref|YP_810973.1|  dTDP-glucose 4,6-dehydratase [Oenococcus oen...  61.2    6e-08 Gene info
gb|AAT40109.1|  putative UDP-glucuronate decarboxylase 3 [Nico...  61.2    6e-08
ref|NP_579517.1|  NDP-sugar dehydratase or epimerase [Pyrococc...  61.2    7e-08 Gene info
ref|NP_001042876.1|  Os01g0315800 [Oryza sativa (japonica cult...  60.8    7e-08 UniGene infoGene info
ref|NP_279221.1|  GalE2 [Halobacterium sp. NRC-1] >ref|YP_0016...  60.8    7e-08 Gene info
ref|ZP_01169900.1|  UDP-glucose 4-epimerase [Bacillus sp. NRRL...  60.8    7e-08
ref|YP_002026898.1|  NAD-dependent epimerase/dehydratase [Sten...  60.8    7e-08 Gene info
ref|YP_001930363.1|  NAD-dependent epimerase/dehydratase [Sulf...  60.8    7e-08 Gene info
ref|NP_244516.1|  UDP-glucose 4-epimerase [Bacillus halodurans...  60.8    7e-08 Gene info
ref|YP_135542.1|  UDP-glucose 4-epimerase [Haloarcula marismor...  60.8    7e-08 Gene info
ref|YP_001254597.1|  UDP-glucose epimerase [Clostridium botuli...  60.8    7e-08 Gene info
ref|YP_444760.1|  UDP-glucuronate 5'-epimerase [Salinibacter r...  60.8    7e-08 Gene info
ref|ZP_02132166.1|  NAD-dependent epimerase/dehydratase [Desul...  60.8    8e-08
ref|YP_001130149.1|  NAD-dependent epimerase/dehydratase [Pros...  60.8    8e-08 Gene info
ref|ZP_02926109.1|  dTDP-glucose 4,6-dehydratase, NAD-dependen...  60.8    8e-08
ref|YP_001581502.1|  NAD-dependent epimerase/dehydratase [Nitr...  60.8    8e-08 Gene info
gb|EDX72406.1|  NAD dependent epimerase/dehydratase family [Mi...  60.5    9e-08
ref|NP_266367.1|  UDP-glucose 4-epimerase [Lactococcus lactis ...  60.5    9e-08 Gene info
ref|ZP_01003639.1|  putative dTDP-glucose 4,6-dehydratase prot...  60.5    9e-08
ref|ZP_02970935.1|  NAD-dependent epimerase/dehydratase [bacte...  60.5    9e-08
ref|YP_303593.1|  UDP-glucose 4-epimerase [Methanosarcina bark...  60.5    9e-08 Gene info
ref|ZP_01513890.1|  NAD-dependent epimerase/dehydratase [Chlor...  60.5    9e-08
ref|ZP_00995444.1|  putative nucleotide-sugar dehydratase [Jan...  60.5    1e-07
ref|YP_001921270.1|  UDP-glucose 4-epimerase [Clostridium botu...  60.5    1e-07 Gene info
ref|YP_001155046.1|  NAD-dependent epimerase/dehydratase [Poly...  60.5    1e-07 Gene info
ref|NP_348950.1|  UDP-glucose 4-epimerase [Clostridium acetobu...  60.5    1e-07 Gene info
gb|ABK24329.1|  unknown [Picea sitchensis]                         60.5    1e-07
ref|ZP_01666376.1|  NAD-dependent epimerase/dehydratase [Therm...  60.5    1e-07
ref|NP_693003.1|  UDP-glucose 4-epimerase [Oceanobacillus ihey...  60.5    1e-07 Gene info
ref|ZP_02294116.1|  NAD-dependent epimerase/dehydratase [Rhizo...  60.5    1e-07
ref|ZP_01726445.1|  dTDP-glucose 4-6-dehydratase [Cyanothece s...  60.5    1e-07
ref|NP_926719.1|  dTDP-glucose 4-6-dehydratase [Gloeobacter vi...  60.5    1e-07 Gene info
ref|YP_002131324.1|  dTDP-glucose 4,6-dehydratase protein [Phe...  60.5    1e-07 Gene info
ref|YP_753405.1|  NAD dependent epimerase/dehydratase family p...  60.5    1e-07 Gene info
gb|AAT80327.1|  UDP-D-glucuronate decarboxylase [Hordeum vulgare]  60.5    1e-07 Gene info
ref|YP_001427025.1|  hypothetical protein ATCV1_Z544R [Acantho...  60.1    1e-07 Gene info
ref|YP_001984900.1|  putative dTDP-glucose 4,6-dehydratase pro...  60.1    1e-07 Gene info
ref|YP_001137273.1|  hypothetical protein cgR_0407 [Corynebact...  60.1    1e-07 Gene info
ref|YP_001277885.1|  NAD-dependent epimerase/dehydratase [Rose...  60.1    1e-07 Gene info
ref|NP_191842.1|  UXS2 (UDP-GLUCURONIC ACID DECARBOXYLASE 2); ...  60.1    1e-07 UniGene infoGene info
ref|YP_001391393.1|  NAD-dependent epimerase/dehydratase famil...  60.1    1e-07 Gene info
ref|ZP_01253579.1|  sugar epimerase BlmG [Psychroflexus torqui...  60.1    1e-07
ref|ZP_02618417.1|  NAD-dependent epimerase/dehydratase family...  60.1    1e-07
ref|ZP_02183629.1|  4-epimerase [Flavobacteriales bacterium AL...  60.1    1e-07
ref|NP_349562.1|  UDP-galactose 4-epimerase [Clostridium aceto...  60.1    1e-07 Gene info
ref|YP_002246797.1|  dTDP-glucose 4,6 dehydratase [Coprothermo...  60.1    1e-07 Gene info
gb|AAK32785.1|AF361617_1  AT3g62830/F26K9_260 [Arabidopsis tha...  60.1    1e-07
ref|ZP_02165392.1|  UDP-glucose 4-epimerase [Hoeflea phototrop...  59.7    2e-07
ref|NP_599575.1|  nucleoside-diphosphate-sugar epimerase [Cory...  59.7    2e-07 Gene info
ref|YP_001859211.1|  NAD-dependent epimerase/dehydratase [Burk...  59.7    2e-07 Gene info
ref|YP_534041.1|  NAD-dependent epimerase/dehydratase [Rhodops...  59.7    2e-07 Gene info
emb|CAL58329.1|  UDP-glucose 4-epimerase/UDP-sulfoquinovose sy...  59.7    2e-07
ref|YP_444772.1|  NAD dependent epimerase/dehydratase family p...  59.7    2e-07 Gene info
ref|YP_001583745.1|  NAD-dependent epimerase/dehydratase [Burk...  59.7    2e-07 Gene info
ref|YP_001642745.1|  NAD-dependent epimerase/dehydratase [Baci...  59.7    2e-07 Gene info
ref|XP_502440.1|  YALI0D05335p [Yarrowia lipolytica] >emb|CAG8...  59.7    2e-07 Gene info
ref|YP_002300181.1|  dTDP-D-glucose 4,6-dehydratase, putative ...  59.7    2e-07 Gene info

ref|ZP_01471768.1|  putative nucleoside-diphosphate sugar epim...  59.7    2e-07
ref|YP_566845.1|  dTDP-glucose 4,6-dehydratase [Methanococcoid...  59.7    2e-07 Gene info
ref|NP_850694.2|  UXS1 (UDP-GLUCURONIC ACID DECARBOXYLASE 1); ...  59.7    2e-07 UniGene infoGene info
ref|YP_002139094.1|  NAD-dependent epimerase/dehydratase [Geob...  59.7    2e-07 Gene info
ref|NP_614008.1|  nucleoside-diphosphate-sugar epimerase [Meth...  59.7    2e-07 Gene info
ref|XP_522697.2|  PREDICTED: TDP-glucose 4,6-dehydratase [Pan ...  59.3    2e-07 UniGene infoGene info
ref|YP_260185.1|  NAD dependent epimerase/dehydratase family p...  59.3    2e-07 Gene info
ref|YP_211812.1|  putative NAD dependent epimerase/dehydratase...  59.3    2e-07 Gene info
gb|ABK94298.1|  unknown [Populus trichocarpa]                      59.3    2e-07
ref|YP_744557.1|  UDP-N-acetylglucosamine 4-epimerase [Granuli...  59.3    2e-07 Gene info
gb|AAT80328.1|  UDP-D-glucuronate decarboxylase [Hordeum vulgare]  59.3    2e-07 Gene info
ref|NP_868743.1|  nucleotide sugar epimerase [Rhodopirellula b...  59.3    2e-07 Gene info
ref|NP_055120.1|  TDP-glucose 4,6-dehydratase [Homo sapiens] >...  59.3    2e-07 UniGene infoGene info
ref|NP_436980.1|  putative dTDP-glucose 4,6-dehydratase protei...  59.3    2e-07 Gene info
ref|ZP_00741535.1|  dTDP-glucose 4,6-dehydratase [Bacillus thu...  59.3    2e-07
ref|YP_148981.1|  dTDP-glucose 4,6-dehydratase [Geobacillus ka...  59.3    2e-07 Gene info
ref|NP_083854.2|  TDP-glucose 4,6-dehydratase [Mus musculus] >...  59.3    2e-07 UniGene infoGene info
ref|YP_503561.1|  NAD-dependent epimerase/dehydratase [Methano...  59.3    2e-07 Gene info
ref|NP_297901.1|  dTDP-glucose 4-6-dehydratase [Xylella fastid...  59.3    2e-07 Gene info
gb|EAY73734.1|  hypothetical protein OsI_001581 [Oryza sativa ...  59.3    3e-07
ref|YP_255429.1|  epimerase [Sulfolobus acidocaldarius DSM 639...  59.3    3e-07 Gene info
ref|NP_244245.1|  UDP-glucose 4-epimerase [Bacillus halodurans...  58.9    3e-07 Gene info
ref|YP_001994967.1|  UDP-glucose 4-epimerase [Chloroherpeton t...  58.9    3e-07 Gene info
gb|ACG45261.1|  unknown [Zea mays]                                 58.9    3e-07
emb|CAO18089.1|  unnamed protein product [Vitis vinifera]          58.9    3e-07
gb|EEA39239.1|  hypothetical protein BRAFLDRAFT_244329 [Branch...  58.9    3e-07
ref|NP_779736.1|  dTDP-glucose 4-6-dehydratase [Xylella fastid...  58.9    3e-07 Gene info
ref|YP_002283489.1|  NAD-dependent epimerase/dehydratase [Rhiz...  58.9    3e-07 Gene info
gb|ABM68331.1|  RmlB [Geobacillus tepidamans]                      58.9    3e-07
ref|YP_001830309.1|  NAD-dependent epimerase/dehydratase [Xyle...  58.9    3e-07 Gene info
ref|YP_001520026.1|  NAD dependent epimerase/dehydratase prote...  58.9    3e-07 Gene info
ref|YP_002122119.1|  NAD-dependent epimerase/dehydratase [Hydr...  58.9    3e-07 Gene info
ref|YP_099413.1|  putative UDP-glucose 4-epimerase [Bacteroide...  58.9    3e-07 Gene info
ref|ZP_00650830.1|  NAD-dependent epimerase/dehydratase [Xylel...  58.9    3e-07
gb|AAX37335.1|  UDP-glucuronic acid decarboxylase 2 [Populus t...  58.9    3e-07
gb|ACF86406.1|  unknown [Zea mays]                                 58.9    3e-07
dbj|BAE38483.1|  unnamed protein product [Mus musculus]            58.9    3e-07 Gene info
dbj|BAE32527.1|  unnamed protein product [Mus musculus]            58.9    3e-07 Gene info
emb|CAN76038.1|  hypothetical protein [Vitis vinifera]             58.9    3e-07
gb|EDL00567.1|  TDP-glucose 4,6-dehydratase, isoform CRA_d [Mu...  58.5    3e-07 Gene info
ref|YP_001817065.1|  NAD-dependent epimerase/dehydratase [Opit...  58.5    4e-07 Gene info
ref|YP_211200.1|  putative dNTP-hexose dehydratase-epimerase [...  58.5    4e-07 Gene info
ref|ZP_01630394.1|  3-beta hydroxysteroid dehydrogenase/isomer...  58.5    4e-07
ref|YP_001430354.1|  NAD-dependent epimerase/dehydratase [Rose...  58.5    4e-07 Gene info
gb|AAT40110.1|  putative UDP-glucuronate decarboxylase 4 [Nico...  58.5    4e-07
ref|NP_107214.1|  UDP-glucose 4-epimerase [Mesorhizobium loti ...  58.5    4e-07 Gene info
ref|YP_001272900.1|  UDP-glucose 4-epimerase (NAD dependent) [...  58.5    4e-07 Gene info
ref|YP_001524487.1|  NAD-dependent epimerase/dehydratase famil...  58.5    4e-07 Gene info
ref|YP_001619591.1|  dTDP-glucose 4,6-dehydratase [Sorangium c...  58.5    4e-07 Gene info
gb|ABK92487.1|  unknown [Populus trichocarpa]                      58.5    4e-07
ref|YP_843502.1|  NAD-dependent epimerase/dehydratase [Methano...  58.5    4e-07 Gene info
ref|YP_303607.1|  dTDP-glucose 4,6-dehydratase [Methanosarcina...  58.5    4e-07 Gene info
ref|ZP_03156905.1|  NAD-dependent epimerase/dehydratase [Cyano...  58.5    4e-07
emb|CAO44791.1|  unnamed protein product [Vitis vinifera]          58.5    4e-07
ref|YP_001278172.1|  NAD-dependent epimerase/dehydratase [Rose...  58.5    4e-07 Gene info
ref|YP_001875930.1|  NAD-dependent epimerase/dehydratase [Elus...  58.2    4e-07 Gene info
ref|YP_729396.1|  dTDP-glucose 4-6-dehydratase-like protein [S...  58.2    4e-07 Gene info
emb|CAJ90901.1|  tissue specific transplantation antigen homol...  58.2    4e-07 Gene info
ref|YP_001787485.1|  NAD-dependent epimerase/dehydratase famil...  58.2    5e-07 Gene info
emb|CAJ74560.1|  strongly similar to dTDP-D-glucose 4,6-dehydr...  58.2    5e-07
ref|ZP_03169428.1|  UDP-glucose 4-epimerase [Streptomyces sp. ...  58.2    5e-07 Gene info
ref|ZP_01724642.1|  dTDP-glucose 4,6-dehydratase [Bacillus sp....  58.2    5e-07
ref|YP_843384.1|  dTDP-glucose 4,6-dehydratase [Methanosaeta t...  58.2    5e-07 Gene info
ref|XP_001512139.1|  PREDICTED: hypothetical protein [Ornithor...  58.2    5e-07 UniGene infoGene info
ref|NP_579086.1|  UDP- or dTTP-glucose 4-epimerase or 4-6-dehy...  58.2    5e-07 Gene info
ref|YP_001634835.1|  NAD-dependent epimerase/dehydratase [Chlo...  58.2    5e-07 Gene info
ref|YP_002284176.1|  NAD-dependent epimerase/dehydratase [Rhiz...  58.2    5e-07 Gene info
emb|CAN80550.1|  hypothetical protein [Vitis vinifera] >emb|CA...  58.2    5e-07
gb|EDY38340.1|  UDP-glucuronic acid decarboxylase 1 [Cyanobium...  58.2    6e-07
ref|ZP_02181944.1|  putative dNTP-hexose dehydratase-epimerase...  58.2    6e-07
ref|ZP_02970247.1|  NAD-dependent epimerase/dehydratase [bacte...  57.8    6e-07
ref|YP_001794171.1|  NAD-dependent epimerase/dehydratase [Ther...  57.8    6e-07 Gene info
ref|ZP_02948374.1|  UDP-glucose 4-epimerase [Clostridium butyr...  57.8    6e-07
ref|XP_385643.1|  hypothetical protein FG05467.1 [Gibberella z...  57.8    6e-07 Gene info
ref|ZP_02328485.1|  UDP-glucose 4-epimerase [Paenibacillus lar...  57.8    6e-07
ref|ZP_01877145.1|  hypothetical protein LNTAR_03144 [Lentisph...  57.8    6e-07
ref|YP_001679338.1|  NAD-dependent epimerase/dehydratase, puta...  57.8    6e-07 Gene info
ref|ZP_02974872.1|  NAD-dependent epimerase/dehydratase [Cyano...  57.8    6e-07
ref|YP_001528410.1|  NAD-dependent epimerase/dehydratase [Desu...  57.8    6e-07 Gene info
gb|AAQ87084.1|  dTDP-glucose 4,6-dehydratase [Rhizobium sp. NG...  57.8    6e-07
ref|NP_484701.1|  dTDP-glucose 4-6-dehydratase [Nostoc sp. PCC...  57.8    7e-07 Gene info
ref|NP_200737.1|  UXS3 (UDP-GLUCURONIC ACID DECARBOXYLASE); ca...  57.8    7e-07 UniGene infoGene info
gb|ABH03015.1|  SpaW [Spirochaeta aurantia]                        57.8    7e-07
ref|ZP_01252515.1|  putative udp-glucuronic acid epimerase [Ps...  57.8    7e-07
ref|NP_875704.1|  NAD dependent epimerase/dehydratase [Prochlo...  57.8    7e-07 Gene info
gb|AAM27842.1|AF498418_16  ORF_16; similar to NAD dependent ep...  57.8    7e-07
ref|YP_001735063.1|  NAD-dependent epimerase/dehydratase famil...  57.8    7e-07 Gene info
ref|NP_001078768.1|  UXS3 (UDP-GLUCURONIC ACID DECARBOXYLASE) ...  57.8    7e-07 UniGene infoGene info
ref|XP_001388213.1|  dTDP-glucose 4-6-dehydratase-like protein...  57.8    7e-07 Gene info
ref|YP_799238.1|  nucleoside-diphosphate-sugar epimerase [Lept...  57.8    7e-07 Gene info
ref|ZP_02691589.1|  UDP-glucose 4-epimerase [Epulopiscium sp. ...  57.8    7e-07
ref|NP_180443.1|  UXS6; catalytic [Arabidopsis thaliana] >ref|...  57.8    7e-07 Gene info
ref|XP_001083495.1|  PREDICTED: TDP-glucose 4,6-dehydratase [M...  57.8    7e-07 UniGene infoGene info
gb|AAK53026.1|AF375442_1  AT5g59290/mnc17_180 [Arabidopsis tha...  57.8    7e-07
ref|YP_001311485.1|  UDP-glucose 4-epimerase [Clostridium beij...  57.8    7e-07 Gene info
ref|YP_113634.1|  NAD-dependent epimerase/dehydratase family p...  57.4    7e-07 Gene info
ref|YP_001865027.1|  NAD-dependent epimerase/dehydratase [Nost...  57.4    7e-07 Gene info
ref|ZP_02014082.1|  NAD-dependent epimerase/dehydratase [Opitu...  57.4    7e-07
ref|YP_001255223.1|  dTDP-glucose 4,6-dehydratase [Clostridium...  57.4    7e-07 Gene info
ref|YP_679972.1|  dTDP-glucose 4,6-dehydratase, NAD-dependent ...  57.4    8e-07 Gene info
ref|YP_677521.1|  dTDP-glucose 4,6-dehydratase [Cytophaga hutc...  57.4    8e-07 Gene info
ref|NP_988210.1|  NAD-dependent epimerase/dehydratase [Methano...  57.4    8e-07 Gene info
ref|YP_304692.1|  dTDP-glucose 4,6-dehydratase [Methanosarcina...  57.4    8e-07 Gene info
gb|AAI66991.1|  Tgds protein [Rattus norvegicus]                   57.4    8e-07 Gene info
ref|YP_645833.1|  NAD-dependent epimerase/dehydratase [Rubroba...  57.4    8e-07 Gene info
gb|ABN41486.1|  putative dTDP-glucose 4,6-dehydratase [Campylo...  57.4    9e-07
gb|AAQ23681.1|  dTDP-glucose 4,6-dehydratase [Geobacillus stea...  57.4    9e-07
ref|YP_413085.1|  NAD-dependent epimerase/dehydratase [Nitroso...  57.4    9e-07 Gene info
ref|XP_001775323.1|  predicted protein [Physcomitrella patens ...  57.4    9e-07 UniGene infoGene info
ref|YP_780440.1|  NAD-dependent epimerase/dehydratase [Rhodops...  57.4    9e-07 Gene info
ref|YP_001782321.1|  UDP-glucose 4-epimerase [Clostridium botu...  57.4    9e-07 Gene info
ref|ZP_03131446.1|  NAD-dependent epimerase/dehydratase [Chtho...  57.4    9e-07
ref|YP_001392057.1|  UDP-glucose 4-epimerase [Clostridium botu...  57.4    9e-07 Gene info
ref|NP_925125.1|  dTDP-glucose 4-6-dehydratase [Gloeobacter vi...  57.4    9e-07 Gene info
ref|XP_001491790.1|  PREDICTED: similar to dTDP-D-glucose 4,6-...  57.4    1e-06 UniGene infoGene info
emb|CAB61752.1|  dTDP-glucose 4-6-dehydratase [Cicer arietinum]    57.4    1e-06
ref|YP_303795.1|  dTDP-glucose 4,6-dehydratase [Methanosarcina...  57.4    1e-06 Gene info
ref|YP_001641573.1|  NAD-dependent epimerase/dehydratase [Meth...  57.0    1e-06 Gene info
ref|ZP_02055056.1|  NAD-dependent epimerase/dehydratase [Methy...  57.0    1e-06
ref|ZP_02615478.1|  UDP-glucose 4-epimerase [Clostridium botul...  57.0    1e-06
ref|NP_772644.1|  dTDP-glucose 4-6-dehydratase [Bradyrhizobium...  57.0    1e-06 Gene info
emb|CAE17528.1|  NDP-4,6-dehydratase [Streptomyces griseus sub...  57.0    1e-06
gb|EEA62275.1|  hypothetical protein BRAFLDRAFT_222572 [Branch...  57.0    1e-06
ref|YP_001255278.1|  UDP-glucose 4-epimerase [Clostridium botu...  57.0    1e-06 Gene info
ref|ZP_01880233.1|  dTDP-glucose 4,6-dehydratase [Roseovarius ...  57.0    1e-06
ref|ZP_02070832.1|  hypothetical protein BACUNI_02260 [Bactero...  57.0    1e-06
ref|ZP_00683831.1|  dTDP-glucose 4,6-dehydratase [Xylella fast...  57.0    1e-06
ref|YP_325080.1|  3-beta hydroxysteroid dehydrogenase/isomeras...  57.0    1e-06 Gene info
ref|NP_347367.1|  fused nucleoside-diphosphate-sugar epimerase...  57.0    1e-06 Gene info
ref|YP_001038615.1|  NAD-dependent epimerase/dehydratase [Clos...  57.0    1e-06 Gene info
gb|AAR99612.1|  dTDP-glucose 4,6-dehydratase [Geobacillus stea...  57.0    1e-06
gb|ABQ76016.1|  GalE2 [uncultured haloarchaeon]                    57.0    1e-06
gb|ABE10792.1|  nucleoside-diphosphate-sugar epimerase [uncult...  57.0    1e-06
ref|YP_001757264.1|  NAD-dependent epimerase/dehydratase [Meth...  57.0    1e-06 Gene info
ref|XP_542640.2|  PREDICTED: similar to dTDP-D-glucose 4,6-deh...  57.0    1e-06 UniGene infoGene info
ref|ZP_01452536.1|  NAD-dependent epimerase/dehydratase family...  57.0    1e-06
ref|NP_001094629.1|  TDP-glucose 4,6-dehydratase [Bos taurus] ...  57.0    1e-06 UniGene infoGene info
ref|YP_685007.1|  dTDP-glucose 4,6-dehydratase [uncultured met...  57.0    1e-06 Gene info
ref|ZP_02912675.1|  NAD-dependent epimerase/dehydratase [Geoba...  56.6    1e-06
ref|ZP_02467836.1|  NAD-dependent epimerase/dehydratase family...  56.6    1e-06
ref|YP_444740.1|  UDP-glucuronate decarboxylase [Salinibacter ...  56.6    1e-06 Gene info
ref|YP_137348.1|  UDP-glucose 4-epimerase [Haloarcula marismor...  56.6    1e-06 Gene info
ref|NP_441431.1|  dTDP-glucose 4-6-dehydratase [Synechocystis ...  56.6    1e-06 Gene info
ref|NP_069197.1|  UDP-glucose 4-epimerase (galE-1) [Archaeoglo...  56.6    1e-06 Gene info




********************Alignements********************


>ref|YP_265995.1| Gene info GDP-fucose synthetase chain A [Candidatus Pelagibacter ubique 
HTCC1062]
 gb|AAZ21392.1| Gene info GDP-fucose synthetase chain A [Candidatus Pelagibacter ubique 
HTCC1062]
Length=312

 GENE ID: 3517118 wcaG | GDP-fucose synthetase chain A
[Candidatus Pelagibacter ubique HTCC1062] (10 or fewer PubMed links)

 Score =  270 bits (689),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 134/228 (58%), Positives = 177/228 (77%), Gaps = 3/228 (1%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N+QIQTNLIH AYK  +KDLIFLGSSC+YPK  KQPIKE YLL+  LE+TN AYAIAKI+
Sbjct  85   NLQIQTNLIHGAYKCGIKDLIFLGSSCVYPKNCKQPIKETYLLSGKLEETNDAYAIAKIA  144

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
            G+KMC+ YNEQY T +K LMPTNT+GPNDNYD + SHF+PALI+KI++ K++K+N + LW
Sbjct  145  GIKMCQSYNEQYKTKYKCLMPTNTYGPNDNYDKNNSHFIPALIKKIHKLKLSKKNTVILW  204

Query  121  GDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKIL--DIKLK  178
            G+GK KRE+I+VDD+AEA I+F+ KKT+  LINIGT KD++I+YY + I K++  + K+K
Sbjct  205  GNGKAKREVIHVDDIAEACIFFMKKKTEHFLINIGTGKDYSIKYYLEFIAKVILGNKKIK  264

Query  179  IKYINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDFI-ENY  225
            IKY      G+PRK +D SLA   GW+ K+ +   +  + K F+ EN+
Sbjct  265  IKYDKTKPNGSPRKVMDISLAKKYGWKSKMSLITSIRNTYKSFVRENF  312


>ref|ZP_01264259.1|  GDP-fucose synthetase chain A [Candidatus Pelagibacter ubique 
HTCC1002]
 gb|EAS84746.1|  GDP-fucose synthetase chain A [Candidatus Pelagibacter ubique 
HTCC1002]
Length=312

 Score =  270 bits (689),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 134/228 (58%), Positives = 177/228 (77%), Gaps = 3/228 (1%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N+QIQTNLIH AYK  +KDLIFLGSSC+YPK  KQPIKE YLL+  LE+TN AYAIAKI+
Sbjct  85   NLQIQTNLIHGAYKCGIKDLIFLGSSCVYPKNCKQPIKETYLLSGKLEETNDAYAIAKIA  144

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
            G+KMC+ YNEQY T +K LMPTNT+GPNDNYD + SHF+PALI+KI++ K++K+N + LW
Sbjct  145  GIKMCQSYNEQYKTKYKCLMPTNTYGPNDNYDKNNSHFIPALIKKIHKLKLSKKNTVILW  204

Query  121  GDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKIL--DIKLK  178
            G+GK KRE+I+VDD+AEA I+F+ KKT+  LINIGT KD++I+YY + I K++  + K+K
Sbjct  205  GNGKAKREVIHVDDIAEACIFFMKKKTEHFLINIGTGKDYSIKYYLEFIAKVILGNKKIK  264

Query  179  IKYINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDFI-ENY  225
            IKY      G+PRK +D SLA   GW+ K+ +   +  + K F+ EN+
Sbjct  265  IKYDKTKPNGSPRKVMDISLAKKYGWKSKMSLITSIRNTHKSFVRENF  312


>ref|YP_001115674.1| Gene info NAD-dependent epimerase/dehydratase [Burkholderia vietnamiensis 
G4]
 gb|ABO59419.1| Gene info NAD-dependent epimerase/dehydratase [Burkholderia vietnamiensis 
G4]
Length=316

 GENE ID: 4949426 Bcep1808_6522 | NAD-dependent epimerase/dehydratase
[Burkholderia vietnamiensis G4]

 Score =  251 bits (642),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/225 (48%), Positives = 156/225 (69%), Gaps = 0/225 (0%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N+ I+ N+IH AY+  V+ L+FLGSSCIYP+   QPIKE YLL+  LEKTN+ YAIAKI+
Sbjct  84   NLMIEANVIHAAYRSGVQRLVFLGSSCIYPRDCPQPIKEAYLLSGPLEKTNEPYAIAKIA  143

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
            G+K+CE YN QY T + SLMPTN +GPNDNYDL TSH LPAL+RK +E+K+  R  + +W
Sbjct  144  GIKLCESYNRQYGTRYVSLMPTNLYGPNDNYDLRTSHVLPALLRKAHEAKVEGRESLTVW  203

Query  121  GDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLKIK  180
            G G+ +RE ++VDD+A+A+I+ L    +  L N+G   D TIE  A++ M+ +    +I+
Sbjct  204  GTGRVRREFLHVDDMADATIFALEVGLESGLYNVGCGSDVTIEELAREAMQAVGFNGRIE  263

Query  181  YINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDFIENY  225
            +      GTP+K LD  L   LGWR KI + +GL  + ++F++ +
Sbjct  264  FDTTKPDGTPQKLLDVGLLAQLGWRAKIGLREGLASTYQEFLQRH  308


>ref|YP_557188.1| Gene info putative nucleoside-diphosphate-sugar epimerases [Burkholderia 
xenovorans LB400]
 gb|ABE29136.1| Gene info Putative nucleoside-diphosphate-sugar epimerases [Burkholderia 
xenovorans LB400]
Length=319

 GENE ID: 4002485 Bxe_A3862 | putative nucleoside-diphosphate-sugar epimerases
[Burkholderia xenovorans LB400]

 Score =  249 bits (636),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/229 (48%), Positives = 157/229 (68%), Gaps = 0/229 (0%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N+ I+TN+IH AY+  V+ L+F GSSCIYPK   QPI+E+YLLTS LE TN AYAIAKI+
Sbjct  84   NLVIETNVIHAAYRARVERLVFFGSSCIYPKQCPQPIREEYLLTSPLEPTNDAYAIAKIA  143

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
            GVK+CE YN +YNT + +LMPTN +GPNDNYDL++SH LPAL+RK +E+K+N    +++W
Sbjct  144  GVKLCEAYNREYNTQYVALMPTNLYGPNDNYDLNSSHVLPALLRKAHEAKLNGDATLSVW  203

Query  121  GDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLKIK  180
            G G  +RE ++VDDLA A+++ L     + L N+G  KD +I   A+ I K+     ++ 
Sbjct  204  GSGTPRREFLHVDDLAAATLFVLEHNVTEGLFNVGVGKDLSIRELAECICKVAGFDGELM  263

Query  181  YINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDFIENYKEYT  229
            +      GTPRK LD S    +GW+  I ++ G+  + +DF+E++   T
Sbjct  264  FDASKPDGTPRKLLDVSRLAQMGWQASIALEDGIASTYRDFVESHAGST  312


>ref|ZP_02882437.1|  NAD-dependent epimerase/dehydratase [Burkholderia graminis C4D1M]
 gb|EDT11640.1|  NAD-dependent epimerase/dehydratase [Burkholderia graminis C4D1M]
Length=318

 Score =  248 bits (633),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 157/226 (69%), Gaps = 0/226 (0%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N+ I+TN+IH AY+  V+ L+F GSSCIYPK   QPI+E+YLLTS LE TN AYAIAKI+
Sbjct  84   NLVIETNVIHAAYRAQVERLVFFGSSCIYPKQCPQPIREEYLLTSSLEPTNDAYAIAKIA  143

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
            G+K+CE YN +YNT + SLMPTN +GPNDNYDL +SH LPAL+RK +E+K+N  + + +W
Sbjct  144  GLKLCEAYNCEYNTQYVSLMPTNLYGPNDNYDLKSSHVLPALLRKAHEAKLNGADTLTVW  203

Query  121  GDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLKIK  180
            G G  +RE ++VDDLA A+++ L     + L N+G  +D +I   A+ I K++    ++ 
Sbjct  204  GSGTPRREFLHVDDLAAATLFVLENNVMEGLFNVGVGEDLSIRELAECICKVVGFDGELV  263

Query  181  YINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDFIENYK  226
            +      GTPRK LD S    +GWR  I +++G+  + ++F+E+Y 
Sbjct  264  FDASKPDGTPRKLLDVSRLAQMGWRATIGLEQGIASTYREFVESYA  309


>ref|YP_001894468.1| Gene info NAD-dependent epimerase/dehydratase [Burkholderia phytofirmans 
PsJN]
 gb|ACD15244.1| Gene info NAD-dependent epimerase/dehydratase [Burkholderia phytofirmans 
PsJN]
Length=319

 GENE ID: 6282319 Bphyt_0822 | NAD-dependent epimerase/dehydratase
[Burkholderia phytofirmans PsJN]

 Score =  244 bits (622),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/229 (47%), Positives = 155/229 (67%), Gaps = 0/229 (0%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N+ I+TN+IH AY+  V+ L+F GSSCIYPK   QPI+E+YLLTS LE TN AYAIAKI+
Sbjct  84   NLVIETNVIHAAYRAKVERLVFFGSSCIYPKQCPQPIREEYLLTSPLEPTNDAYAIAKIA  143

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
            GVK+CE YN +YNT + +LMPTN +GPNDNYDL +SH LPAL+RK +E+K+N    + +W
Sbjct  144  GVKLCEAYNREYNTQYVALMPTNLYGPNDNYDLKSSHVLPALLRKAHEAKLNGDATLTVW  203

Query  121  GDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLKIK  180
            G G   RE ++VDDLA A+++ L     + L N+G   D +I   A+ I K++  + ++ 
Sbjct  204  GSGTPLREFLHVDDLAAATLFVLEHNVTEGLFNVGVGNDLSIRELAECICKVVGFEGELV  263

Query  181  YINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDFIENYKEYT  229
            +      GTPRK LD S   ++GW+  I +  G+  + +DF+E++   T
Sbjct  264  FDASKPDGTPRKLLDVSRLAHMGWQATIGLTDGIASTYRDFVESHAGST  312


>ref|ZP_02291384.1|  NAD-dependent epimerase/dehydratase [Rhizobium leguminosarum 
bv. trifolii WSM1325]
 gb|EDR80326.1|  NAD-dependent epimerase/dehydratase [Rhizobium leguminosarum 
bv. trifolii WSM1325]
Length=306

 Score =  243 bits (620),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 106/221 (47%), Positives = 152/221 (68%), Gaps = 0/221 (0%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N+ I+TN++H A++  V+ ++FLGSSCIYP+   QPI+E+YLLT  LE+TN+AYAIAKI+
Sbjct  84   NLMIETNVVHAAWQAGVERMLFLGSSCIYPRDCPQPIREEYLLTGPLEQTNEAYAIAKIA  143

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
            GVK+CE YN QY T + S MPTN +GPNDNYDL +SH +PALIRK++E+KI     + +W
Sbjct  144  GVKLCESYNRQYGTRYVSGMPTNLYGPNDNYDLDSSHVMPALIRKVHEAKIRGDRQLVVW  203

Query  121  GDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLKIK  180
            G G+  RE +YVDD+A+A ++ + K+  + LINIGT +D TI   A+ IM+++    +I 
Sbjct  204  GSGRPMREFLYVDDMADACVFLMEKEVSEGLINIGTGEDITIRELAETIMRVVGFTGEIV  263

Query  181  YINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDF  221
            Y      GTPRK +     + LGW+    +  G+  +  DF
Sbjct  264  YDQTKPDGTPRKLMSVDRLSALGWKATTSLGDGIARAYADF  304


>ref|ZP_02914223.1|  NAD-dependent epimerase/dehydratase [Geobacillus sp. WCH70]
 gb|EDT34677.1|  NAD-dependent epimerase/dehydratase [Geobacillus sp. WCH70]
Length=312

 Score =  243 bits (619),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/224 (52%), Positives = 156/224 (69%), Gaps = 0/224 (0%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            NI IQ N+IH AY + VK L+FLGSSCIYPKYSKQPIKE YLLT  LE TN+ YAIAKI+
Sbjct  84   NILIQNNVIHNAYTYGVKKLLFLGSSCIYPKYSKQPIKEDYLLTGKLEPTNEWYAIAKIA  143

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
            G+KM + Y++QY  N  SLMP N +GPNDN+DL TSH LPAL+RK +E+K+N  + + +W
Sbjct  144  GIKMAQAYSKQYGFNVISLMPANLYGPNDNFDLKTSHVLPALLRKFHEAKVNNMDTVTIW  203

Query  121  GDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLKIK  180
            G G  +RE ++VDDLA+A I+ +       +IN+GT KD +I   A+KI +I+  K +I 
Sbjct  204  GTGTPRREFLHVDDLADACIFLMNNYDSPEIINVGTGKDISILKLAQKIKEIVGFKGRIV  263

Query  181  YINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDFIEN  224
                   GTPRK LD +   NLGW+ KI + +G+E +   F+EN
Sbjct  264  TDTSKPDGTPRKLLDITKLNNLGWKSKIPLSRGIEETYSWFLEN  307


>ref|ZP_03135403.1|  NAD-dependent epimerase/dehydratase [Thermus aquaticus Y51MC23]
 gb|EDY13939.1|  NAD-dependent epimerase/dehydratase [Thermus aquaticus Y51MC23]
Length=317

 Score =  241 bits (614),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 153/214 (71%), Gaps = 0/214 (0%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N+ IQTN+I  AY++ VK L+FLGSSCIYPKY+ QP+KE+YLLT  LE TN+AYA+AKI+
Sbjct  84   NLLIQTNVIDAAYRYGVKKLLFLGSSCIYPKYAPQPMKEEYLLTGPLEPTNEAYAVAKIA  143

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
            G++M + Y  QY  N  SLMPTN +GP DN+DL TSH +PAL+RK +E+K++ R  + +W
Sbjct  144  GIEMVQAYRRQYGFNGISLMPTNLYGPGDNFDLETSHVIPALLRKFHEAKVSGRWEVVVW  203

Query  121  GDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLKIK  180
            G G  +RE ++VDDLA+A+++ +     + ++N+G  +D +I   A+ I K++  + KI 
Sbjct  204  GTGTPRREFLHVDDLADAALFLMRHYDGEEIVNVGVGEDISIRELAELIAKVVGFRGKIV  263

Query  181  YINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGL  214
            Y      GTPRK LD S   ++GWRP+I +++GL
Sbjct  264  YDTSKPDGTPRKLLDVSRLFSMGWRPRIPLEEGL  297


>ref|ZP_03270648.1|  NAD-dependent epimerase/dehydratase [Burkholderia sp. H160]
 gb|EDZ97771.1|  NAD-dependent epimerase/dehydratase [Burkholderia sp. H160]
Length=318

 Score =  239 bits (610),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/224 (46%), Positives = 154/224 (68%), Gaps = 0/224 (0%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N+ I+TN+IH AY+  V+ L+F GSSCIYPK   QPI+E+YLL S LE TN AYAIAKI+
Sbjct  84   NLVIETNVIHAAYRARVERLVFFGSSCIYPKQCPQPIREEYLLRSPLEPTNDAYAIAKIA  143

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
            G+K+CE YN +Y T + SLMPTN +GPNDNYDL++SH LPAL+RK +E++ +    + +W
Sbjct  144  GLKLCEAYNREYGTQYVSLMPTNLYGPNDNYDLNSSHVLPALLRKAHEARQSDAPTLTVW  203

Query  121  GDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLKIK  180
            G G  +RE ++VDDLA A+++ L       + N+G  +D TI   A+ I K++  + ++ 
Sbjct  204  GTGTPRREFLHVDDLAAATLFVLEHNVANGMFNVGVGEDMTIRELAECICKVVGFEGELV  263

Query  181  YINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDFIEN  224
            + +    GTPRK LD S  T LGW   I +++G+  + ++F+E+
Sbjct  264  FDSSKPDGTPRKLLDVSRLTQLGWSATIGLEEGIAATYREFLES  307


>ref|YP_556301.1| Gene info putative GDP-fucose synthetase [Burkholderia xenovorans LB400]
 gb|ABE36951.1| Gene info Putative GDP-fucose synthetase [Burkholderia xenovorans LB400]
Length=316

 GENE ID: 4010596 Bxe_C1084 | putative GDP-fucose synthetase
[Burkholderia xenovorans LB400]

 Score =  237 bits (604),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 103/226 (45%), Positives = 153/226 (67%), Gaps = 0/226 (0%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N+ I+ N+IH A++  ++ L FLGSSCIYP+ + QPIKE YLL+  LE TN+ YAIAKI+
Sbjct  84   NLIIEANVIHSAFRAGIQRLGFLGSSCIYPREAPQPIKEDYLLSGPLESTNEPYAIAKIA  143

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
            G+K+CE +N Q+ T + SLMPTN +GPNDNYDL TSH LPAL+RK +E+K++  + + +W
Sbjct  144  GIKLCEAFNRQFGTQYVSLMPTNLYGPNDNYDLKTSHVLPALLRKAHEAKVSGASKLAVW  203

Query  121  GDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLKIK  180
            G G+ +RE ++VDD+A+A I+ L +   +   N+G   D TIE  A+  M ++     I+
Sbjct  204  GTGRARREFLHVDDMADAVIFMLERGIGEGWYNVGCGADVTIEELARAAMHVVGFDGDIE  263

Query  181  YINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDFIENYK  226
            +      GTP+K LD S    LGW  KI + +GL  +  DF+++++
Sbjct  264  FDVSKPDGTPQKLLDVSKLAELGWSAKIGLQEGLAATYDDFLQHHE  309


>ref|ZP_03040068.1|  NAD-dependent epimerase/dehydratase [Geobacillus sp. Y412MC10]
 gb|EDV76469.1|  NAD-dependent epimerase/dehydratase [Geobacillus sp. Y412MC10]
Length=319

 Score =  236 bits (601),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 154/230 (66%), Gaps = 0/230 (0%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N+ IQ N+I  +Y++ VK L+FLGS+CIYPK + QP+KE+YL+T  LE TN+ YA+AKI+
Sbjct  84   NLLIQNNIIDLSYRYGVKKLLFLGSTCIYPKLAPQPMKEEYLMTGALEPTNEPYAVAKIA  143

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
            G+ MC+ YN QY T F S MPTN +GPNDNYDL TSH LPAL+RKI+E+K   +  + +W
Sbjct  144  GITMCQSYNRQYGTRFISAMPTNLYGPNDNYDLETSHVLPALLRKIHEAKETGQREVEIW  203

Query  121  GDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLKIK  180
            G G+ KRE +Y DDLA+A ++ +    +  ++NIG  +D +I   A+ I   +       
Sbjct  204  GTGQPKREFLYADDLADACLFLMKHYEENTIVNIGCGEDVSIRELAESIASTVGYDGSFV  263

Query  181  YINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDFIENYKEYTK  230
            Y      GTPRK +D S  T LGW+P I +++GL  + + ++E+ + Y+K
Sbjct  264  YNASKPDGTPRKLVDVSKLTALGWKPSISLEQGLARTYEHYLESQQIYSK  313


>ref|YP_303606.1| Gene info GDP-fucose synthetase [Methanosarcina barkeri str. Fusaro]
 gb|AAZ69026.1| Gene info GDP-fucose synthetase [Methanosarcina barkeri str. Fusaro]
Length=312

 GENE ID: 3627294 Mbar_A0035 | GDP-fucose synthetase
[Methanosarcina barkeri str. Fusaro] (10 or fewer PubMed links)

 Score =  235 bits (599),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/234 (47%), Positives = 161/234 (68%), Gaps = 9/234 (3%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N+ I++N+IH AYK  V+ L+FLGSSCIYPK + QP+KE+YLLT  LE+TN+AYAIAKI+
Sbjct  84   NLMIESNIIHAAYKCGVEKLLFLGSSCIYPKLAPQPLKEEYLLTGSLEETNEAYAIAKIA  143

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
            G+++C++YN QY TNF S+MPTN +GPNDN+DL TSH +PALIRK +E+K+N +  + +W
Sbjct  144  GIRLCKHYNHQYGTNFISVMPTNLYGPNDNFDLETSHVMPALIRKFHEAKVNNKPEVVVW  203

Query  121  GDGKTKRELIYVDDLAEASIYFL----FKKTKKNLINIGTQKDFTIEYYAKKIMKILDIK  176
            G GK  RE ++VDD+A+A ++ +    F +  +  +NIG  +D TI    K I +I+  +
Sbjct  204  GTGKPLREFMHVDDMADACVFLMENYDFSEVGE-FVNIGVGEDVTISELVKLIKEIVGFE  262

Query  177  LKIKYINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDFIENYKEYTK  230
             KI Y      GTPRK +D S    LGW+ ++ +  G    IK+  E Y++  K
Sbjct  263  GKINYDTSKPDGTPRKLMDVSRLNGLGWKARMSLKDG----IKETYEWYQDQIK  312


>ref|YP_468304.1| Gene info GDP-L-fucose synthase protein [Rhizobium etli CFN 42]
 gb|ABC89577.1| Gene info GDP-L-fucose synthase protein [Rhizobium etli CFN 42]
Length=309

 GENE ID: 3891110 nolK | GDP-L-fucose synthase protein [Rhizobium etli CFN 42]
(10 or fewer PubMed links)

 Score =  233 bits (595),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 148/221 (66%), Gaps = 0/221 (0%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N+ I+TN++H A++  V+ ++FLGSSCIYP+   QPI+E YLLT  LE+TN+ YAIAKI+
Sbjct  84   NLMIETNIVHAAWQAGVQGMLFLGSSCIYPRDCPQPIREDYLLTGPLEQTNEPYAIAKIA  143

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
            GVK+CE YN QY T + S MPTN +GPND+YDL+ SH LPALIRK +E+KI     + +W
Sbjct  144  GVKLCESYNRQYGTQYASAMPTNLYGPNDSYDLNNSHVLPALIRKAHEAKIRGEKELVVW  203

Query  121  GDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLKIK  180
            G G+  RE +YVDD+A+A ++ +  +  + L NIGT +D TI   A+ +M+I+  +  I 
Sbjct  204  GSGQPMREFLYVDDMADACVFLMENQISEGLFNIGTGEDVTIRQLAETVMEIVGFEGGIV  263

Query  181  YINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDF  221
            Y      GTPRK L+      LGW+ +  +  G+  +  DF
Sbjct  264  YDISKPDGTPRKLLNVDRMKALGWQARTSLADGIAKAYADF  304


>ref|YP_343265.1| Gene info NAD-dependent epimerase/dehydratase [Nitrosococcus oceani ATCC 
19707]
 gb|ABA57735.1| Gene info NAD-dependent epimerase/dehydratase [Nitrosococcus oceani ATCC 
19707]
 gb|EDZ67453.1|  NAD dependent epimerase/dehydratase family [Nitrosococcus oceani 
C-27]
Length=310

 GENE ID: 3706385 Noc_1234 | NAD-dependent epimerase/dehydratase
[Nitrosococcus oceani ATCC 19707] (10 or fewer PubMed links)

 Score =  233 bits (595),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 113/222 (50%), Positives = 147/222 (66%), Gaps = 0/222 (0%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N+ IQ+NLIH AY   VK L FLGSSCIYPK   QPI+E YLLT  LE TN+ YAIAKI+
Sbjct  84   NLVIQSNLIHGAYLAGVKRLCFLGSSCIYPKKCPQPIREDYLLTGPLEPTNEPYAIAKIA  143

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
            GVKMCE YN+QY T + S+MPTN +GP+DNYDL+ SH LPALIRK +E+ +       +W
Sbjct  144  GVKMCESYNQQYGTRYISVMPTNLYGPHDNYDLNNSHVLPALIRKAHEANLRGDEKWVVW  203

Query  121  GDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLKIK  180
            G G  +RE +YVDD+A A I  + K     L N+GT  D TI+  A+ IM ++  +  I 
Sbjct  204  GTGTPRREFLYVDDMANACILLMEKDIPGGLFNVGTGVDVTIKELAEMIMGVVGFQGSIV  263

Query  181  YINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDFI  222
            + +    GT RK LD S    LGWRP+I + +G+  + +DF+
Sbjct  264  FDSSKPDGTLRKLLDVSRIQELGWRPQIDLREGINKAYRDFL  305


>ref|YP_001858689.1| Gene info NAD-dependent epimerase/dehydratase [Burkholderia phymatum STM815]
 gb|ACC71643.1| Gene info NAD-dependent epimerase/dehydratase [Burkholderia phymatum STM815]
Length=331

 GENE ID: 6243954 Bphy_2470 | NAD-dependent epimerase/dehydratase
[Burkholderia phymatum STM815]

 Score =  233 bits (593),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 148/227 (65%), Gaps = 0/227 (0%)

Query  1    NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS  60
            N+ I+TN+IH AY+ NV  L+F GSSCIYPK   QPI E YLLTS LE TN AYAIAKI+
Sbjct  84   NLVIETNVIHAAYRANVDRLVFFGSSCIYPKLCPQPILESYLLTSELEPTNDAYAIAKIA  143

Query  61   GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW  120
            G+K+C+ YN +Y T + +LMPTN +GPNDNYDL  SH LPALIRK +E++++    + +W
Sbjct  144  GLKLCDAYNREYGTRYVALMPTNLYGPNDNYDLKNSHVLPALIRKAHEARLHGDRSLIVW  203

Query  121  GDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLKIK  180
            G G  +RE ++VDDLA A+++ L       + N+G  +D +I   A+ +  ++  +  ++
Sbjct  204  GSGTPRREFLHVDDLAAATLFVLEHDVNTGVFNVGVGEDLSIRELAQTVCDVVGFEGDLQ  263

Query  181  YINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDFIENYKE  227
            +      GTPRK LD S    +GWR  I + +G+  + ++F   Y E
Sbjct  264  FDASKPDGTPRKLLDVSRLAAMGWRASIGLAEGIGNTYREFAARYDE  310

ORF finding

PROTOCOLE:

a) SMS ORFinder / sens direct   / cadres 1, 2 & 3 / min 60 AA / initiation 'any codon' / code génétique 'universel'
b) SMS ORFinder / sens indirect / cadres 1, 2 & 3 / min 60 AA / initiation 'any codon' / code génétique 'universel'
---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

Nous avons utilisé l'outils ORF Finder sur le site SMS dans le but de trouver les cadres ouverts de lecture.
Nous avons effectué deux recherches. Une sur un brin dans le sens direct et l'autre dans le sens indirect.
Nous obtenons deux résultats (un dans chacun des sens).
Nous observons que l'ORF le plus long se situe sur le brin dans le sens direct sur le 3ème cadre de lecture (3-695 soit 693 nucléotides)
En raison de la grandeur de cet ORF, nous pouvons en conclure qu'il s'agit d'une séquence codante.
Nous constatons également que la séquence traduite de l'ORF est incomplète en 5' (ne commence pas par une méthionine
car nous avons pris en paramètre "any codon") mais est complète en 3' (se termine par un codon stop).
Les prochaines recherches, et en particulier l'alignement multiple, nous permettrons d'établir si le codon initiateur
se trouve en amont ou dans l'ORF.

---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:

a) sens direct

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 3 to base 695.
AATATACAAATACAAACAAATTTAATACACTGTGCTTATAAATTTAATGTTAAAGACTTA
ATTTTTCTTGGATCTAGCTGCATATACCCAAAATATTCAAAACAGCCAATAAAAGAAAAG
TATCTGCTAACGAGTGTATTAGAAAAAACAAACCAAGCTTATGCAATTGCAAAGATTTCT
GGTGTCAAGATGTGTGAATATTACAATGAACAATATAATACTAATTTTAAAAGTTTAATG
CCTACAAATACTTTTGGCCCAAATGATAATTATGATCTCAGTACATCACATTTTTTACCA
GCTTTGATTAGAAAAATTTATGAATCTAAAATTAATAAAAGAAACTATATAAATCTTTGG
GGAGATGGAAAAACCAAAAGAGAATTGATTTATGTGGATGATTTAGCAGAAGCGTCAATA
TATTTTCTTTTTAAGAAAACAAAAAAAAATTTAATTAATATTGGAACTCAAAAAGATTTT
ACAATTGAATACTATGCAAAAAAAATTATGAAAATTTTAGATATAAAATTAAAAATTAAA
TATATAAATAAGAACTTGAAAGGTACCCCAAGAAAAAAACTAGATTGTTCTCTTGCTACT
AATTTAGGATGGAGACCAAAAATAAAAATAGATAAAGGATTAGAAATATCTATAAAAGAT
TTTATTGAAAATTATAAAGAATATACGAAATAA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
NIQIQTNLIHCAYKFNVKDLIFLGSSCIYPKYSKQPIKEKYLLTSVLEKTNQAYAIAKIS
GVKMCEYYNEQYNTNFKSLMPTNTFGPNDNYDLSTSHFLPALIRKIYESKINKRNYINLW
GDGKTKRELIYVDDLAEASIYFLFKKTKKNLINIGTQKDFTIEYYAKKIMKILDIKLKIK
YINKNLKGTPRKKLDCSLATNLGWRPKIKIDKGLEISIKDFIENYKEYTK*

---------------------------------------------------------------------------------------------------

b) sens indirect



>ORF number 1 in reading frame 1 on the reverse strand extends from base 268 to base 447.
TTTTCAATAAAATCTTTTATAGATATTTCTAATCCTTTATCTATTTTTATTTTTGGTCTC
CATCCTAAATTAGTAGCAAGAGAACAATCTAGTTTTTTTCTTGGGGTACCTTTCAAGTTC
TTATTTATATATTTAATTTTTAATTTTATATCTAAAATTTTCATAATTTTTTTTGCATAG


>Translation of ORF number 1 in reading frame 1 on the reverse strand.
FSIKSFIDISNPLSIFIFGLHPKLVAREQSSFFLGVPFKFLFIYLIFNFISKIFIIFFA*


No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.
---------------------------------------------------------------------------------------------------