GOS 711030

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091118857976
Annotathon code: GOS_711030
Sample :
  • GPS :24°10'29n; 84°20'40w
  • Caribbean Sea: Gulf of Mexico - USA
  • Coastal Sea (-2m, 26.4°C, 0.1-0.8 microns)
Authors
Team : BioCell2008
Username : fowen
Annotated on : 2009-02-04 21:56:41
  • FORAY Chloé
  • WENGLER Aude

Synopsis

Genomic Sequence

>JCVI_READ_1091118857976 GOS_711030 genomic DNA
GTGGACGAGGTCAGCTACCAAGTCCCCTTTGGACCTCTAGGAAACCTAGCTGACAGAGTTCTGGGCGGTAGGTTGGTCAGGAGACGCCTCTCTCAGATGT
TCACTGCAAGGGAACTTCGTCTCAAGAGGGACATGGCTCATCATTCGAAGTTCGGCGACTCTCCTCGAAGAAAAATCCTGGTGGCCGGTTCGTCCGGGAT
GATAGGTACCCAACTGGTTGCCTTCCTAGATACCGGGGGGCATGAGGTTTGGAGATTGGTCAGAAGGAGCCCCAAAGAGGGTAAGAAGGAGCTCTTCTGG
GATCCGGCTTCGGGAGAAATGGATGCAGGAATTCTGGAAGGATTCGACTCTATCATCCACCTCGGAGGAGAGGGGATCGGTGACAAGAGATGGAGCAAGA
AGAGGAAGAGCGCCATCAGGAATTCCAGAGTGGATAGTACTACCCTGCTTTCGGAGGCAATAGCGAAGATGAAGAATAAGCCGGAGGTTTTCATCGTGGC
GAGTGCGATTGGCTGGTATGGAGACCGTGGCGATGAGGAGCTGACCGAGGAGAGTGAGATTGGAGAGGGTTTCCTCCCAGAGACCTGCTCGGATTGGGAA
GGTGCATCCGCAAACCTCCCCGATGAAGTAAGACATGTTTACCTTAGGTCGGGCATCGTACTCTCAGGGACCGGTGGCGCTCTGGGCAAGATGCTGCTGC
CCTTCAAGATGGGAGCTGGAGGACCAATGGGCAATGGGAAGCAGTGGATGTCGTGGATATCCCTCGACGACGAGATATACGCCATCCACCACCTGCTGAT
GGAAACCGGTTCCAAGGGAGTGTACAACCTGACTGCACCAAACCCAGTCAGGCAGAAGACATTCGCAAAGACTCTGGGCAGGGTATTGAAGAGGCCTGCA
TTCGCCCCCCTACCGGGTTTTGTTATCAAAATCTTGTTCGGAGAGATGGGAGTAAAGTTGACGCTGGAAAGTCAGAAAGTTTTCCCCGACCGGCTCTT

Translation

[1 - 996/998]   direct strand
>GOS_711030 Translation [1-996   direct strand]
VDEVSYQVPFGPLGNLADRVLGGRLVRRRLSQMFTARELRLKRDMAHHSKFGDSPRRKILVAGSSGMIGTQLVAFLDTGGHEVWRLVRRSPKEGKKELFW
DPASGEMDAGILEGFDSIIHLGGEGIGDKRWSKKRKSAIRNSRVDSTTLLSEAIAKMKNKPEVFIVASAIGWYGDRGDEELTEESEIGEGFLPETCSDWE
GASANLPDEVRHVYLRSGIVLSGTGGALGKMLLPFKMGAGGPMGNGKQWMSWISLDDEIYAIHHLLMETGSKGVYNLTAPNPVRQKTFAKTLGRVLKRPA
FAPLPGFVIKILFGEMGVKLTLESQKVFPDRL

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Phylogeny

PROTOCOLE: Phylogeny.fr, ProtPars/DnaPars, ProtDist/DnaDist-Neighbor et PhyML, step by step

---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:


Nous avons réalisé les mêmes arbres en les racinant avec la séquence eukaryote O. tauri (plantae). 
Nous avons obtenu les mêmes résultats que ceux obtenus avec les arbres non racinés. Ces résultats
ne nous apportant aucune information complémentaire, il ne nous a pas semblé intéressant de les 
reporter dans les résultats bruts.

Les deux arbres obtenus, par parcimonie et distance, ne nous donnent pas les mêmes résultats : ils 
ne sont pas congruents. 

De plus, dans les 2 cas, la phylogénie de notre gène ne correspond pas du tout à la phylogénie de 
référence des organismes. En effet, les bacteria, les archaea et les eukaryotes sont tous mélangés.
Tous les sous-groupes de ces 3 grands groupes sont également mélangés entre eux. 

Comme nos 2 arbres ne sont pas congruents, nous avons réalisé un arbre par la méthode PhyML afin de 
regarder si on peut faire pencher la balance en faveur de l'un ou de l'autre.

L'arbre obtenu par PhyML nous donne des résultats intéressants car il se rapproche plus de l'arbre 
obtenu par distance que l'arbre obtenu par parcimonie. On remarque aussi que la phylogénie de notre 
gène ne correspond pas du tout à la phylogénie de référence des organismes. 

D'après les résultats de ces 3 arbres, on peut donc déduire que l'histoire de notre gène est différente 
de celle des organismes. On peut alors supposer que des phénomènes de transferts et d'endosymbioses se 
sont produits, ou qu'il s'agit d'un gène très ancien qui a été conservé au cours du temps. Notre gène 
code donc pour une protéine que l'on retrouve chez la plupart des organismes vivants appartenant aux 
groupes des bacteria, des archaea et des eukaryotes.

Nous ne pouvons donc pas conclure sur l'appartenance de notre séquence à un groupe particulier ni sur 
la position de l'organisme qui portait notre séquence par rapport aux autres organismes du vivant.


D'autre part, les arbres obtenus nous montrent que notre séquence est plus proche des séquences qui 
commencent en amont de notre séquence dans l'alignement multiple, que de celles qui commencent en aval.
Ceci nous permettra de faire l'hypothèse que notre ORF est incomplet en 5'.


---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:

ProtDist/DnaDist-Neighbor :


  +-----------------K_rhizophila                                               [high GC gram+]     
  !  
  !                  +-----------P_maris                                       [planctomycetes]     
  !               +-17  
  !            +-22  +-------------R_baltica                                   [planctomycetes]     
  !            !  !  
  !         +-24  +------------B_marina                                        [planctomycetes]     
  !         !  !  
  !         !  +--------------G_obscuriglobus                                  [planctomycetes]
  !         !  
  !      +-26        +----------D_oleovorans                                   [d-proteobacteria]     
  !      !  !     +-13  
  !      !  !  +-23  +------------D_alkenivorans                               [d-proteobacteria]     
  !      !  !  !  !  
  !      !  +-25  +-------------S_ruber                                        [CFB bacteria]    
  !   +-27     !  
  !   !  !     !        +-----S_aurantiaca                                     [d-proteobacteria]     
  !   !  !     +--------7 
  !   !  !              +------M_xanthus                                       [d-proteobacteria]    
  !   !  !  
  !   !  !  +-----------Frankia_sp                                             [high GC gram+]
  !   !  +-19  
  !   !     +-------------O_terrae                                             [verrucomicrobia]    
  !   !  
  !   !                             +------P_sitchensis                        [plantae]   
  !   !                          +--3 
  !   !                    +-----5  +------V_vinifera                          [plantae]   
  !   !                    !     ! 
  !   !               +----6     +----------------O_tauri                      [plantae]    
 12--28               !    ! 
  !   !           +---8    +-------S_elongatus                                 [cyanobacteria]
  !   !           !   ! 
  !   !        +-10   +---------------P_marinus                                [cyanobacteria]    
  !   !        !  !  
  !   !        !  +----------------R_castenholzii                              [GNS bacteria]   
  !   !     +-11  
  !   !     !  !                  +-H_sapiens                                  [metazoa]    
  !   !     !  !                +-1 
  !   !  +-18  +----------------2 +--S_scrofa                                  [metazoa]    
  !   !  !  !                   ! 
  !   !  !  !                   +--R_norvegicus                                [metazoa]    
  !   !  !  !  
  !   !  !  +-----------------M_marina                                         [CFB bacteria]    
  !   !  !  
  !   +-21     +-----------Oceanobacter_sp                                     [g-proteobacteria]    
  !      !  +-15  
  !      !  !  !  +---------------P_ingrahamii                                 [g-proteobacteria]    
  !      !  !  +-14  
  !      !  !     !   +--------C_Protochlamydia_amoebophila                    [chlamydias]    
  !      +-20     +---9 
  !         !         +------------------D_discoideum                          [mycetozoa]   
  !         !  
  !         !  +----------------V_bacterium                                    [verrucomicrobia]    
  !         +-16  
  !            !                +------------T_volcanium                       [euryarchaeotes]    
  !            +----------------4 
  !                             +--------T_acidophilum                         [euryarchaeotes]    
  !  
  +------------GOS_711030     



---------------------------------------------------------------------------------------------------

ProtPars/DnaPars :

  
                                                                               +------P_sitchensis                           [plantae]
                                                                        +--1.0-|
                                                                 +--1.0-|      +------V_vinifera                             [plantae]
                                                                 |      |
                                                          +--1.0-|      +-------------S_elongatus                            [cyanobacteria]
                                                          |      |
                                                   +--1.0-|      +--------------------P_marinus                              [cyanobacteria]
                                                   |      |
                                            +--1.0-|      +---------------------------R_castenholzii                         [GNS bacteria]
                                            |      |
                                            |      |                    +-------------R_norvegicus                           [metazoa]
                                            |      +----------------1.0-|
                                     +--1.0-|                           |      +------H_sapiens                              [metazoa]
                                     |      |                           +--1.0-|
                                     |      |                                  +------S_scrofa                               [metazoa]
                                     |      |
                              +--1.0-|      |                                  +------T_acidophilum                          [euryarchaeotes]   
                              |      |      +------------------------------1.0-|
                              |      |                                         +------T_volcanium                            [euryarchaeotes]
                              |      |
                       +--1.0-|      +------------------------------------------------M_marina                               [CFB bacteria]
                       |      |
                       |      |                                                +------D_discoideum                           [mycetozoa]
                       |      |                                         +--1.0-|
                       |      |                                         |      +------C_Protochlamydia_amoebophila           [chlamydias]
                +--1.0-|      +-------------------------------------1.0-|
                |      |                                                |      +------Oceanobacter_sp                        [g-proteobacteria]
                |      |                                                +--1.0-|
         +--1.0-|      |                                                       +------P_ingrahamii                           [g-proteobacteria]
         |      |      |
         |      |      +--------------------------------------------------------------P_maris                                [planctomycetes]
         |      |
         |      +---------------------------------------------------------------------Frankia_sp                             [highGC gram+]
         |
         |                                                                     +------B_marina                               [planctomycetes]
         |                                                +----------------1.0-|
         |                                                |                    +------G_obscuriglobus                        [planctomycetes]
         |                                                |
         |                                         +--0.5-|             +-------------S_ruber                                [CFB bacteria]
         |                                         |      |      +--1.0-|
  +------|                                         |      |      |      |      +------D_alkenivorans                         [d-proteobacteria]
  |      |                                         |      |      |      +--1.0-|
  |      |                                         |      +--1.0-|             +------D_oleovorans                           [d-proteobacteria]
  |      |                                  +--1.0-|             |
  |      |                                  |      |             |             +------M_xanthus                              [d-proteobacteria]
  |      |                                  |      |             +---------1.0-|
  |      |                                  |      |                           +------S_aurantiaca                           [d-proteobacteria]
  |      |                                  |      |
  |      |                           +--1.0-|      |                    +-------------K_rhizophila                           [highGC gram+]
  |      |                           |      |      +----------------1.0-|
  |      |                           |      |                           |      +------R_baltica                              [planctomycetes
  |      |                           |      |                           +--1.0-|
  |      +-----------------------1.0-|      |                                  +------O_tauri                                [plantae]
  |                                  |      |
  |                                  |      +-----------------------------------------V_bacterium                            [verrucomicrobia]
  |                                  |
  |                                  +------------------------------------------------GOS_711030
  |
  +-----------------------------------------------------------------------------------O_terrae                               [verrucomicrobia]


  remember: this is an unrooted tree!


---------------------------------------------------------------------------------------------------

PhyML Results



               +---------------V_bacterium                                               [verrucomicrobia]    
            +-12  
            |  |   +------------O_terrae                                                 [verrucomicrobia]    
            |  +--13  
            |      +---------Frankia_sp                                                  [highGC gram+]    
            |  
         +-11     +-----------S_ruber                                                    [CFB bacteria]    
         |  |  +-15  
         |  |  |  |  +---------D_alkenivorans                                            [d-proteobacteria]     
         |  |  |  +-16  
         |  |  |     +--------D_oleovorans                                               [d-proteobacteria]     
         |  +-14  
      +-10     |        +----M_xanthus                                                   [d-proteobacteria]    
      |  |     |  +----18  
      |  |     +-17     +---S_aurantiaca                                                 [d-proteobacteria]     
      |  |        |  
      |  |        +-----------G_obscuriglobus                                            [planctomycetes]     
      |  |  
      |  |  +------------R_baltica                                                       [planctomycetes]     
      |  +-19  
  +---8     |  +--------B_marina                                                         [planctomycetes]     
  |   |     +-20  
  |   |        +-----------P_maris                                                       [planctomycetes]     
  |   |  
  |   |        +------------P_ingrahamii                                                 [g-proteobacteria]    
  |   |     +-21  
  |   |     |  +---------Oceanobacter_sp                                                 [g-proteobacteria]    
  |   |     |  
  |   +-----7       +----------------D_discoideum                                        [mycetozoa]    
  |         |  +---22  
  |         |  |    +-----C_Protochlamydia_amoebophila                                   [chlamydias]    
  |         |  |  
  |         +--6  +--------------M_marina                                                [CFB bacteria]    
  |            |  |  
  |            |  |                     +-----T_acidophilum                              [euryarchaea]    
  |            |  |   +----------------23  
  |            +--5   |                 +----------T_volcanium                           [euryarchaea]    
  |               |   |  
  |               |   |        +--------------R_castenholzii                             [GNS bacteria]    
  |               |   |   +---24  
  |               +---4   |    |   +---------------P_marinus                             [cyanobacteria]    
  |                   |   |    +--25  
  |                   |   |        |   +-------S_elongatus                               [cyanobacteria]    
  |                   |   |        +--26  
  |                   |   |            |     +-------------O_tauri                       [plantae]    
  |                   +---3            +----27  
  |                       |                  |   +-----V_vinifera                        [plantae]    
  |                       |                  +--28  
  |                       |                      +----P_sitchensis                       [plantae]    
  |                       |  
  |                       |                 +R_norvegicus                                [metazoa]    
  |                       +-----------------2  
  |                                         |  +-S_scrofa                                [metazoa]    
  |                                         +--1  
  |                                            +H_sapiens                                [metazoa]    
  |  
  9--------------K_rhizophila                                                            [highGC gram+]     
  |  
  +---------GOS_711030     

Annotator commentaries

Les recherches d'ORF par ORF Finder ont permis d'identifier 8 ORF. L'ORF le plus long se situe sur le brin direct dans le cadre 1 de lecture (nucléotide 1 au nucléotide 996 en incluant le codon "STOP"). Au vu de sa taille, on peut supposer que notre ORF est codant. La séquence protéique obtenue à partir de cet ORF contient 332 acides aminés et nous permettra de réaliser la suite des analyses. La masse moléculaire ne peut être déterminée avec exactitude car l'ORF est incomplet en 5' et en 3'. En effet, l'alignement multiple révèle que notre séquence est plus courte que les séquences homologues étudiées : il manque environ 20 acides aminés en aval de notre ORF. De plus, il révèle également que notre ORF est à cheval entre 2 groupes de séquences, l'un commençant en amont de notre séquence et l'autre en aval. Les arbres nous ont permis de trancher : l'ORF serait incomplet en 5'. Notre étude se limite donc à une portion restreinte du gène impliqué.


L'analyse de notre protéine avec InterProScan a permis l'identification de deux domaines potentiels : le domaine NAD-dependent epimerase/dehydratase (e-value : 2.7e-09), et le domaine Conserved hypothetical protein, YfcH (e-value : 5.6e-116). Le premier domaine est impliqué dans la fonction épimérase (elle-même impliquée dans le métabolisme des sucres), et nécessite un co-facteur : le NAD ; le 2ème domaine est impliqué dans la liaison avec le NAD. Ces 2 domaines semblent donc compatibles et complémentaires, bien qu'ils soient chevauchants. Les BLAST effectués confirment ces résultats : on obtient de nombreuses protéines homologues, en particulier parmi les meilleurs scores, qui ont, pour la plupart, une fonction épimérase dépendante du NAD. L'alignement multiple nous a également donné des arguments en faveur de cette fonction. En effet, les régions les mieux alignées (acides aminés 117 à 332) se trouvent au milieu de nos 2 domaines conservés. Il y a donc de fortes chances pour que notre protéine possède la même fonction que ses homologues, c'est-à-dire une fonction épimérase impliquée dans le métabolisme des sucres et dépendante du NAD.


D'aprés les résultats comparés du BLAST et de la recherche interpro, le fragment protéique issu de notre ORF serait le fragment d'une protéine à fonction épimérase, utilisant comme co-facteur le NAD. Nous avons donc choisi "carbohydrate metabolism" comme "processus biologique", et "isomerase activity" comme "fonction moléculaire"(une épimérase étant une isomérase).


Le rapport taxonomique nous a permis de définir l'ensemble du monde vivant comme groupe d'étude. Nous n'avons donc pas pu définir de groupe extérieur. Les arbres obtenus par parcimonie et par distance ne nous donnent pas des résultats intéressants car ils ne sont pas congruents. L'arbre obtenu par PhyML nous permet de pencher en faveur de l'arbre obtenu par distance. Comme la phylogénie de notre gène ne correspond pas du tout à la phylogénie de référence, nous n'avons pas pu conclure quant à l'appartenance de notre séquence à un groupe taxonomique particulier. Nous pouvons seulement dire que notre gène code pour une enzyme que l'on retrouve chez la plupart des organismes du monde vivant (bacteria, eukaryotes et archaea). Ceci serait peut être dû à des phénomènes de transferts et d'endosymbioses, ou un gène très ancien et conservé au cours du temps.





Multiple Alignement

PROTOCOLE: EBI, CLUSTAL W2, paramètres par défaut

---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

Pour réaliser cet alignement multiple, nous avons choisi, parmi les meilleurs scores et les 
meilleures E value, 21 séquences bactériennes appartenant à divers sous-groupes (cyanobacteria, 
actinobacteria, GNS bacteria, chlamydiales, verrucomicrobiales, d et g-proteobacteria, CFB bacteria),
2 séquences d'archaea (euryarchaeota) et enfin 7 séquences eukaryotes appartenant à divers 
sous-groupes (plantae, metazoa, mycetozoa et alveolata).

Les séquences homologues possèdent certaines parties relativement bien alignées, notamment la deuxième 
moitié de notre séquence (régions 117 à 332). En effet, auparavant, il y a de nombreuses 
insertions/délétions. Ces régions conservées se situent au même endroit que les domaines protéiques 
trouvés précédemment. Ceci nous permet de dire que les informations concernant les domaines protéiques 
sont pertinentes.

D'après l'alignement multiple, il semble que notre orf soit un peu plus court que les séquences 
homologues étudiées. En effet, il manque environ 20 acides aminés à la fin de notre séquence ce qui 
confirme que le codon STOP se situe bien en aval de la séquence. 

En ce qui concerne le début de la séquence, on remarque que les 20 premiers aa de notre séquence sont 
"très mal" alignés : il y a de nombreuses insertions/délétions, qui, de plus, sont de taille importante. 
D'autre part, l'alignement commence pour de nombreuses séquences environ au 55ième acide aminé de notre 
séquence. Au vu de ces constations, il se pourrait que notre séquence commence au nucléotide 97 de la 
séquence nucléotidique (c'est-à-dire 33ième aa de la séquence sur laquelle nous nous basions jusqu'à 
présent), et que l'atg trouvé à cette position soit un codon d'initiation. 

Il est cependant délicat de conclure sur ce point. En effet, notre séquence est à cheval entre un groupe 
de séquences qui commence en amont (avec des séquences parmi les meilleures e-value), et un groupe qui 
commence en aval. D'autre part, les arbres obtenus nous montrent que notre séquence est plus proche des 
séquences qui commencent en amont que de celles qui commencent en aval. On peut alors peut être supposer 
que notre ORF est incomplet en 5'.


---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:



CLUSTAL 2.0.10 multiple sequence alignment


GOS_711030                          --------------------------------------------------
K.rhizophila_highGC.gram+_          --------------------------------------------------
P.maris_planctomycetes_             --------------------------------------------------
R.baltica_planctomycetes_           --------------------------------------------------
B.marina_planctomycetes_            --------------------------------------------------
G.obscuriglobus_planctomycetes      --------------------------------------------------
D.oleovorans_d-proteo_              --------------------------------------------------
D.alkenivorans_d-proteo_            --------------------------------------------------
S.aurantiaca_d-proteo_              --------------------------------------------------
M.xanthus_d-proteo_                 --------------------------------------------------
S.ruber_CFB.bacteria_               --------------------------------------------------
Frankia.sp_highGC.gram+_            --------------------------------------------------
O.terrae_verrucomicrobia_           --------------------------------------------------
P.sitchensis_plantae_               --------------------------------------------------
V.vinifera_plantae_                 --------------------------------------------------
O.tauri_plantae_                    MPVRRTSNGRVYVLPHLSLKAEPAVGSPSFVALNTAPHRGLQLTKLQTIS 50
S.elongatus_cyano_                  --------------------------------------------------
P.marinus_cyano_                    --------------------------------------------------
H.sapiens_metazoa_                  --------------------------------------------------
S.scrofa_metazoa_                   --------------------------------------------------
R.norvegicus_metazoa_               --------------------------------------------------
R.castenholzii_GNS.bacteria_        --------------------------------------------------
Oceanobacter.sp_g-proteo_           --------------------------------------------------
P.ingrahamii_g-proteo_              --------------------------------------------------
C.Protochlamydia.amoebophila_c      --------------------------------------------------
D.discoideum_mycetozoa_             --------------------------------------------------
M.marina_CFB.bacteria_              --------------------------------------------------
V.bacterium_verrucomicrobia_        --------------------------------------------------
T.volcanium_euryarchaea_            --------------------------------------------------
T.acidophilum_euryarchaea_          --------------------------------------------------
                                                                                      

GOS_711030                          --------------------------------------------------
K.rhizophila_highGC.gram+_          --------------------------------------------------
P.maris_planctomycetes_             --------------------------------------------------
R.baltica_planctomycetes_           --------------------------------------------------
B.marina_planctomycetes_            --------------------------------------------------
G.obscuriglobus_planctomycetes      --------------------------------------------------
D.oleovorans_d-proteo_              --------------------------------------------------
D.alkenivorans_d-proteo_            --------------------------------------------------
S.aurantiaca_d-proteo_              --------------------------------------------------
M.xanthus_d-proteo_                 --------------------------------------------------
S.ruber_CFB.bacteria_               --------------------------------------------------
Frankia.sp_highGC.gram+_            --------------------------------------------------
O.terrae_verrucomicrobia_           --------------------------------------------------
P.sitchensis_plantae_               --------------------------------------------------
V.vinifera_plantae_                 --------------------------------------------------
O.tauri_plantae_                    GHKLESRCEASTNSKAGCDQRYDRIQVKNVRSHRNLCASAVTPRFTPTLP 100
S.elongatus_cyano_                  --------------------------------------------------
P.marinus_cyano_                    --------------------------------------------------
H.sapiens_metazoa_                  --------------------------------------------------
S.scrofa_metazoa_                   --------------------------------------------------
R.norvegicus_metazoa_               --------------------------------------------------
R.castenholzii_GNS.bacteria_        --------------------------------------------------
Oceanobacter.sp_g-proteo_           --------------------------------------------------
P.ingrahamii_g-proteo_              --------------------------------------------------
C.Protochlamydia.amoebophila_c      --------------------------------------------------
D.discoideum_mycetozoa_             --------------------------------------------------
M.marina_CFB.bacteria_              --------------------------------------------------
V.bacterium_verrucomicrobia_        --------------------------------------------------
T.volcanium_euryarchaea_            --------------------------------------------------
T.acidophilum_euryarchaea_          --------------------------------------------------
                                                                                      

GOS_711030                          --------------------------------------------------
K.rhizophila_highGC.gram+_          --------------------------------------------------
P.maris_planctomycetes_             --------------------------------------------------
R.baltica_planctomycetes_           --------------------------------------------------
B.marina_planctomycetes_            --------------------------------------------------
G.obscuriglobus_planctomycetes      --------------------------------------------------
D.oleovorans_d-proteo_              --------------------------------------------------
D.alkenivorans_d-proteo_            --------------------------------------------------
S.aurantiaca_d-proteo_              --------------------------------------------------
M.xanthus_d-proteo_                 --------------------------------------------------
S.ruber_CFB.bacteria_               --------------------------------------------------
Frankia.sp_highGC.gram+_            --------------------------------------------------
O.terrae_verrucomicrobia_           --------------------------------------------------
P.sitchensis_plantae_               --------------------------------------------------
V.vinifera_plantae_                 --------------------------------------------------
O.tauri_plantae_                    PLSVRSARRHGAGXXXXXXXDTTDRSQFLDCCGTRECVHGDCVKSFKGEH 150
S.elongatus_cyano_                  --------------------------------------------------
P.marinus_cyano_                    --------------------------------------------------
H.sapiens_metazoa_                  --------------------------------------------------
S.scrofa_metazoa_                   --------------------------------------------------
R.norvegicus_metazoa_               --------------------------------------------------
R.castenholzii_GNS.bacteria_        --------------------------------------------------
Oceanobacter.sp_g-proteo_           --------------------------------------------------
P.ingrahamii_g-proteo_              --------------------------------------------------
C.Protochlamydia.amoebophila_c      --------------------------------------------------
D.discoideum_mycetozoa_             --------------------------------------------------
M.marina_CFB.bacteria_              --------------------------------------------------
V.bacterium_verrucomicrobia_        --------------------------------------------------
T.volcanium_euryarchaea_            --------------------------------------------------
T.acidophilum_euryarchaea_          --------------------------------------------------
                                                                                      

GOS_711030                          --------------------------------------------------
K.rhizophila_highGC.gram+_          --------------------------------------------------
P.maris_planctomycetes_             --------------------------------------------------
R.baltica_planctomycetes_           --------------------------------------------------
B.marina_planctomycetes_            --------------------------------------------------
G.obscuriglobus_planctomycetes      --------------------------------------------------
D.oleovorans_d-proteo_              --------------------------------------------------
D.alkenivorans_d-proteo_            --------------------------------------------------
S.aurantiaca_d-proteo_              --------------------------------------------------
M.xanthus_d-proteo_                 --------------------------------------------------
S.ruber_CFB.bacteria_               --------------------------------------------------
Frankia.sp_highGC.gram+_            --------------------------------------------------
O.terrae_verrucomicrobia_           --------------------------------------------------
P.sitchensis_plantae_               --------------------------------------------------
V.vinifera_plantae_                 --------------------------------------------------
O.tauri_plantae_                    IAFRFELLSLLGAGNFGQVFQCYDHKHSRRVAVKMIKVDTMFKDQTRVEI 200
S.elongatus_cyano_                  --------------------------------------------------
P.marinus_cyano_                    --------------------------------------------------
H.sapiens_metazoa_                  --------------------------------------------------
S.scrofa_metazoa_                   --------------------------------------------------
R.norvegicus_metazoa_               --------------------------------------------------
R.castenholzii_GNS.bacteria_        --------------------------------------------------
Oceanobacter.sp_g-proteo_           --------------------------------------------------
P.ingrahamii_g-proteo_              --------------------------------------------------
C.Protochlamydia.amoebophila_c      --------------------------------------------------
D.discoideum_mycetozoa_             --------------------------------------------------
M.marina_CFB.bacteria_              --------------------------------------------------
V.bacterium_verrucomicrobia_        --------------------------------------------------
T.volcanium_euryarchaea_            --------------------------------------------------
T.acidophilum_euryarchaea_          --------------------------------------------------
                                                                                      

GOS_711030                          --------------------------------------------------
K.rhizophila_highGC.gram+_          --------------------------------------------------
P.maris_planctomycetes_             --------------------------------------------------
R.baltica_planctomycetes_           --------------------------------------------------
B.marina_planctomycetes_            --------------------------------------------------
G.obscuriglobus_planctomycetes      --------------------------------------------------
D.oleovorans_d-proteo_              --------------------------------------------------
D.alkenivorans_d-proteo_            --------------------------------------------------
S.aurantiaca_d-proteo_              --------------------------------------------------
M.xanthus_d-proteo_                 --------------------------------------------------
S.ruber_CFB.bacteria_               --------------------------------------------------
Frankia.sp_highGC.gram+_            --------------------------------------------------
O.terrae_verrucomicrobia_           --------------------------------------------------
P.sitchensis_plantae_               --------------------------------------------------
V.vinifera_plantae_                 --------------------------------------------------
O.tauri_plantae_                    KTLERASIGSSRVVQMFEHFSFRKHKCVVLELLHINLYELLAARKFERIR 250
S.elongatus_cyano_                  --------------------------------------------------
P.marinus_cyano_                    --------------------------------------------------
H.sapiens_metazoa_                  --------------------------------------------------
S.scrofa_metazoa_                   --------------------------------------------------
R.norvegicus_metazoa_               --------------------------------------------------
R.castenholzii_GNS.bacteria_        --------------------------------------------------
Oceanobacter.sp_g-proteo_           --------------------------------------------------
P.ingrahamii_g-proteo_              --------------------------------------------------
C.Protochlamydia.amoebophila_c      --------------------------------------------------
D.discoideum_mycetozoa_             --------------------------------------------------
M.marina_CFB.bacteria_              --------------------------------------------------
V.bacterium_verrucomicrobia_        --------------------------------------------------
T.volcanium_euryarchaea_            --------------------------------------------------
T.acidophilum_euryarchaea_          --------------------------------------------------
                                                                                      

GOS_711030                          --------------------------------------------------
K.rhizophila_highGC.gram+_          --------------------------------------------------
P.maris_planctomycetes_             --------------------------------------------------
R.baltica_planctomycetes_           ------------------------------------MSQRNESVSSNAAQ 14
B.marina_planctomycetes_            --------------------------------------------------
G.obscuriglobus_planctomycetes      --------------------------------------------------
D.oleovorans_d-proteo_              --------------------------------------------------
D.alkenivorans_d-proteo_            --------------------------------------------------
S.aurantiaca_d-proteo_              --------------------------------------------------
M.xanthus_d-proteo_                 --------------------------------------------------
S.ruber_CFB.bacteria_               --------------------------------------------------
Frankia.sp_highGC.gram+_            --------------------------------------------------
O.terrae_verrucomicrobia_           --------------------------------------------------
P.sitchensis_plantae_               --------------------------------------------------
V.vinifera_plantae_                 --------------------------------------------------
O.tauri_plantae_                    IEHVRHIATQMVDALLYLKQIGVVHCDIKPENILLVHAETFDVKLIDFGS 300
S.elongatus_cyano_                  --------------------------------------------------
P.marinus_cyano_                    --------------------------------------------------
H.sapiens_metazoa_                  --------------------------------------------------
S.scrofa_metazoa_                   --------------------------------------------------
R.norvegicus_metazoa_               --------------------------------------------------
R.castenholzii_GNS.bacteria_        --------------------------------------------------
Oceanobacter.sp_g-proteo_           --------------------------------------------------
P.ingrahamii_g-proteo_              --------------------------------------------------
C.Protochlamydia.amoebophila_c      --------------------------------------------------
D.discoideum_mycetozoa_             --------------------------------------------------
M.marina_CFB.bacteria_              --------------------------------------------------
V.bacterium_verrucomicrobia_        --------------------------------------------------
T.volcanium_euryarchaea_            --------------------------------------------------
T.acidophilum_euryarchaea_          --------------------------------------------------
                                                                                      

GOS_711030                          --------------------------------------------------
K.rhizophila_highGC.gram+_          --------------------------------------------------
P.maris_planctomycetes_             --------------------------------------------------
R.baltica_planctomycetes_           WTNSVRWLVTSSWQSWKRSIRWHQTPTTRIILLVKFHPRTDPHCPGGGES 64
B.marina_planctomycetes_            --------------------------------------------------
G.obscuriglobus_planctomycetes      --------------------------------------------------
D.oleovorans_d-proteo_              --------------------------------------------------
D.alkenivorans_d-proteo_            --------------------------------------------------
S.aurantiaca_d-proteo_              --------------------------------------------------
M.xanthus_d-proteo_                 --------------------------------------------------
S.ruber_CFB.bacteria_               --------------------------------------------------
Frankia.sp_highGC.gram+_            --------------------------------------------------
O.terrae_verrucomicrobia_           --------------------------------------------------
P.sitchensis_plantae_               --------------------------------------------------
V.vinifera_plantae_                 --------------------------------------------------
O.tauri_plantae_                    ACFEGHSSFTYIQSRFYRAPEVMLGIEYGHPIDMWSLACVLAELATGRTL 350
S.elongatus_cyano_                  --------------------------------------------------
P.marinus_cyano_                    --------------------------------------------------
H.sapiens_metazoa_                  --------------------------------------------------
S.scrofa_metazoa_                   --------------------------------------------------
R.norvegicus_metazoa_               --------------------------------------------------
R.castenholzii_GNS.bacteria_        --------------------------------------------------
Oceanobacter.sp_g-proteo_           --------------------------------------------------
P.ingrahamii_g-proteo_              --------------------------------------------------
C.Protochlamydia.amoebophila_c      --------------------------------------------------
D.discoideum_mycetozoa_             --------------------------------------------------
M.marina_CFB.bacteria_              --------------------------------------------------
V.bacterium_verrucomicrobia_        --------------------------------------------------
T.volcanium_euryarchaea_            --------------------------------------------------
T.acidophilum_euryarchaea_          --------------------------------------------------
                                                                                      

GOS_711030                          ----------------VDEVSYQVP--------------------FG--- 11
K.rhizophila_highGC.gram+_          ----MNGNGSAMTHEYVHETRLTQPREQVFAWHERPGALPRLTPPFGGGP 46
P.maris_planctomycetes_             --------------------------------------------------
R.baltica_planctomycetes_           SQQPEECQPQAGTEHYAATVQLPVSLDDAFAYHERPGCLNRLTPPWES-- 112
B.marina_planctomycetes_            ----------MPSQVFQLRSEIPAPVEVVFRWHQLPGALERLTPPWES-- 38
G.obscuriglobus_planctomycetes      ----------MPDDVFTLRSPMPVSADELYAWHARPLAFRRLAPPWED-- 38
D.oleovorans_d-proteo_              ----------MITDTFTRQSIIDADARTLFLWHARPGAIERLSPPWDP-- 38
D.alkenivorans_d-proteo_            ----------MPNTIFVKKSRIPASVEEVFAWHARPGALERLTPPWTD-- 38
S.aurantiaca_d-proteo_              ---------MGKSRVFDARSRMPVSATELFAWHTREGAFERLTPPWET-- 39
M.xanthus_d-proteo_                 ---------MGKSHVFDARTRMPVTAKDLFAWHAREGAFERLTPPWER-- 39
S.ruber_CFB.bacteria_               ------------MHTFTASSSLGASADALFTWHSRPGAFERLTPPWAP-- 36
Frankia.sp_highGC.gram+_            --------------------------------------------------
O.terrae_verrucomicrobia_           --------------------------------------------------
P.sitchensis_plantae_               --------------------------------------------------
V.vinifera_plantae_                 --------------------------------------------------
O.tauri_plantae_                    FVGDDEAQQLSIIANLIGPPPTRMITEASHPNRRVDCHRRVSLGAIPPKT 400
S.elongatus_cyano_                  --------------------------------------------------
P.marinus_cyano_                    --------------------------------------------------
H.sapiens_metazoa_                  --------------------------------------------------
S.scrofa_metazoa_                   --------------------------------------------------
R.norvegicus_metazoa_               --------------------------------------------------
R.castenholzii_GNS.bacteria_        --------------------------------------------------
Oceanobacter.sp_g-proteo_           --------------------------------------------------
P.ingrahamii_g-proteo_              --------------------------------------------------
C.Protochlamydia.amoebophila_c      --------------------------------------------------
D.discoideum_mycetozoa_             --------------------------------------------------
M.marina_CFB.bacteria_              --------------------------------------------------
V.bacterium_verrucomicrobia_        -------------MKFEKRSEIQASARELFEWHGRPGAFARLTPPWQT-- 35
T.volcanium_euryarchaea_            --------------------------------------------------
T.acidophilum_euryarchaea_          --------------------------------------------------
                                                                                      

GOS_711030                          --------------------------------------------------
K.rhizophila_highGC.gram+_          DQVRQAPSDGIEPGSEAKLGVSVPGTFGMVHLPWTAEHGEWDPPHYFTDR 96
P.maris_planctomycetes_             --------------------------------------------------
R.baltica_planctomycetes_           VQVEHSDQSL-APGSRVVLKT----KIAGIPVRWKARHVWYDPPHGFADV 157
B.marina_planctomycetes_            LTVQSYEPGL-APGSQAKLIT----KIGPFRVTWVAEHRELIENRLFRDV 83
G.obscuriglobus_planctomycetes      TQVVKQEGAFGTEGFRVTLRTN---VVGPVSGTWLAESYNFRPGLGFRDR 85
D.oleovorans_d-proteo_              LEVIFR-TGGITVGARVVLKM----FAGPVPYRWHARHTVYEENQKFVDE 83
D.alkenivorans_d-proteo_            MAVLEK-TGLLEVGTRVTLRL----KTGPIAYKWRSEHFALEENRFFADQ 83
S.aurantiaca_d-proteo_              MEVLERHGEGIREGAKAVMRM----RLGPVPRKWVARHTQYVEGSLFQDE 85
M.xanthus_d-proteo_                 MEVLERTGDGIRTGARVVVRM----RVGPIPQRLVAEHTAYIEDAMFQDT 85
S.ruber_CFB.bacteria_               VRLQS--FEGIEAGDRAVLRI----GPGPLAVRWVAEHYGVEPGRQFCDR 80
Frankia.sp_highGC.gram+_            --------------------------------------------------
O.terrae_verrucomicrobia_           --------------------------------------------------
P.sitchensis_plantae_               ------------------------MSTSTTPICR-----PFSPRSNGRHM 21
V.vinifera_plantae_                 ----------------------MELCRTTAAFSW-----AHS-ISPSLHF 22
O.tauri_plantae_                    SASNSTHRRRSKQRIQRLPSARLALVSIPQALARGRQGAPLPPLAQALHT 450
S.elongatus_cyano_                  --------------------------------------------------
P.marinus_cyano_                    --------------------------------------------------
H.sapiens_metazoa_                  --------------------------------------------------
S.scrofa_metazoa_                   --------------------------------------------------
R.norvegicus_metazoa_               --------------------------------------------------
R.castenholzii_GNS.bacteria_        --------------------------------------------------
Oceanobacter.sp_g-proteo_           --------------------------------------------------
P.ingrahamii_g-proteo_              --------------------------------------------------
C.Protochlamydia.amoebophila_c      --------------------------------------------------
D.discoideum_mycetozoa_             --------------------------------------------------
M.marina_CFB.bacteria_              --------------------------------------------------
V.bacterium_verrucomicrobia_        -VEVLREDAGLATGKRIELKLG----TPLGKRVWKARHTSCVEGQEFTDT 80
T.volcanium_euryarchaea_            --------------------------------------------------
T.acidophilum_euryarchaea_          --------------------------------------------------
                                                                                      

GOS_711030                          ----PLGN------------------LADRV--------------LGGRL 25
K.rhizophila_highGC.gram+_          MAKGPLGEWEHRHVFEE--TEAGGTLIQDRVTVRPLPQWAGRLNDVGERV 144
P.maris_planctomycetes_             --------------------------------------------------
R.baltica_planctomycetes_           QDSGPFARWAHRHLFES--LGSDRSQLTDAIEYKLPAGVAGK--VFGSGK 203
B.marina_planctomycetes_            QLSGPFAHWDHEHRFGA--IDATHSYLEDHVEYSPPGGSLGR--MLGGSF 129
G.obscuriglobus_planctomycetes      QLEGPFAAFNHNHEFIP--NGPDHSFLEDRIEYRVPLGWPGR--VLGSGI 131
D.oleovorans_d-proteo_              QVKGPMAFWRHTHAFEP--AGENQCRLIDTIDYRLPLYPLTR--FPGKLL 129
D.alkenivorans_d-proteo_            QVSGPFAEWIHKHRFHP--D-NGDCIYEDNVEYRLPLSFVSS--PAAGWW 128
S.aurantiaca_d-proteo_              QESGPFARWVHTHRMVP-ESPS-SSSMEDVVEYTLPLGLLGQ--GVGGGF 131
M.xanthus_d-proteo_                 QMSGPFAKWVHTHRMWP-EPTTGTSILEDEVEYVLPVGTLGS--LFGGGF 132
S.ruber_CFB.bacteria_               QVQGPFSHWEHTHRFTPADDDTGGATLTDRIEYEPPGGALGR--QAAP-W 127
Frankia.sp_highGC.gram+_            --------------------------------------------------
O.terrae_verrucomicrobia_           --------------------------------------------------
P.sitchensis_plantae_               PIA----TTFTCYLQYKLQQPAR--------------------------- 40
V.vinifera_plantae_                 PQR----FSMCESKGLRVCCAVN--------------------------- 41
O.tauri_plantae_                    AAHRTDVTSFVSSRASRAMTIANTLSRGAAGAPSHARGSRRGPATRTDKT 500
S.elongatus_cyano_                  --------------------------------------------------
P.marinus_cyano_                    --------------------------------------------------
H.sapiens_metazoa_                  --------------------------------------------------
S.scrofa_metazoa_                   --------------------------------------------------
R.norvegicus_metazoa_               --------------------------------------------------
R.castenholzii_GNS.bacteria_        --------------------------------------------------
Oceanobacter.sp_g-proteo_           --------------------------------------------------
P.ingrahamii_g-proteo_              --------------------------------------------------
C.Protochlamydia.amoebophila_c      ---------------------------------------------MIPFL 5
D.discoideum_mycetozoa_             -----------------------------MKRFAAVLIGVSITGLAIPNI 21
M.marina_CFB.bacteria_              --------------------------------------------------
V.bacterium_verrucomicrobia_        QDQGPFKSWTHRHEFAQ--WGESSAELIDQIDFELPFGSLG--EALGSSF 126
T.volcanium_euryarchaea_            --------------------------------------------------
T.acidophilum_euryarchaea_          --------------------------------------------------
                                                                                      

GOS_711030                          VRRRLSQMFTARELRLKRDMAHHSKFGDSP-RRKILVAGSSGMIGTQLVA 74
K.rhizophila_highGC.gram+_          MTPQLNRIFAYRERQLKADLAFHDQH-DGP-RLTIAVAGSSGLVGTQVCA 192
P.maris_planctomycetes_             --------------------------------MKLLISGSSGLVGSHLCQ 18
R.baltica_planctomycetes_           ARRTIEAMFAYRHRVTQDDLQMMADYPMS--PKTIAVSGSSGLVGNALCT 251
B.marina_planctomycetes_            VTGKLERMFRYRHATMLADLAAHQPYRENR-SMKIAITGASGLVGKQLSA 178
G.obscuriglobus_planctomycetes      VKRRLAQVFAYRHFITASDLARHAKFADRP-RLTVAVTGSRGLVGSELVP 180
D.oleovorans_d-proteo_              VENKLARIFAWRHRITAFDMALHRRFNKKG-PMTVLISGASGVLASALIP 178
D.alkenivorans_d-proteo_            TAKQLETMFTWRHETVLQDVALHKKLAAK--PMTIVISGASGMIGRTLVP 176
S.aurantiaca_d-proteo_              ARRTLERMFSYRHSVLRADLRRHAAFAEQG-PLTVAVSGATGLVGRALVP 180
M.xanthus_d-proteo_                 ARRTLERMFAYRHRVTLEDLKRHAAFAGQG-PLTIAVTGASGLVGSSLVP 181
S.ruber_CFB.bacteria_               LEAELRRQFAYRHRITRRDLSLHQQYNPDDRSLTIAVSGASGLVGSSLVP 177
Frankia.sp_highGC.gram+_            --------------------------------MKVAVTGSSGLIGSALLP 18
O.terrae_verrucomicrobia_           ----------------MSDQAKVFPTAERARPRRVVIAGASGLIGTALTA 34
P.sitchensis_plantae_               -------------------ASTTTQRPAKTDEMTISITGATGFIGRKLVQ 71
V.vinifera_plantae_                 -------------------ASASGQ----SQKMIVSVTGATGFIGRRLVQ 68
O.tauri_plantae_                    RVQRPFRFARASPTRVNASASEDGTSSTTPERLVVAVTGATGFVGSKLVE 550
S.elongatus_cyano_                  --------------------------------MKIAITGATGFVGQRLVE 18
P.marinus_cyano_                    --------------------------------MKLLLLGCSGFIGRELVP 18
H.sapiens_metazoa_                  --------------------------------MRVLVGGGTGFIGTALTQ 18
S.scrofa_metazoa_                   --------------------------------MRVLVGGGSGFIGTALTQ 18
R.norvegicus_metazoa_               --------------------------------MRVLVGGGTGFIGTALTQ 18
R.castenholzii_GNS.bacteria_        ----------------------------MSAHKHIVITGATGLIGKALCR 22
Oceanobacter.sp_g-proteo_           -----------------------------MN---ILISGASGLIGTALMQ 18
P.ingrahamii_g-proteo_              -----------------------------MDKGKVLLTGSSGLVGTALSE 21
C.Protochlamydia.amoebophila_c      KLG----------------------------------------------- 8
D.discoideum_mycetozoa_             NFNNSINNNNNNNNKNTKISRMNQNQNQNQNVKKVLISGASGFIGNALTK 71
M.marina_CFB.bacteria_              ------------------------------MTKTILITGGTGLIGQRLTE 20
V.bacterium_verrucomicrobia_        VERQLEKSFEYRHWITKKDLELKAALPHFR-PMKIAITGGSGFLGTQLSA 175
T.volcanium_euryarchaea_            --------------------------------MKVVIFGGTGLIGRAIYS 18
T.acidophilum_euryarchaea_          --------------------------------MDIVISGGTGLIGRAITE 18
                                                                                      

GOS_711030                          FLDT---------GGHEVWRLVR---RSPKEGKKELFWDPASGEMDAGIL 112
K.rhizophila_highGC.gram+_          LLET---------GGHTVIRMKR---GAS-TGDGVIGWDPDKGVLNPHDL 229
P.maris_planctomycetes_             KLDAD--------PAYETVRLVRKQSAE--KQGTTVLWQPGSDCMDLSLF 58
R.baltica_planctomycetes_           TLTL---------LGHKVLTITRDDHGD--EESVAAWGDPP----EFEKF 286
B.marina_planctomycetes_            FLST---------GGHDVVPVTR--SRD--KQGVYWNYKKGE--IDAASL 213
G.obscuriglobus_planctomycetes      LLTT---------GGHRVVRLLTGDARPPYDDGTTWTSWKPDAPLASSAL 221
D.oleovorans_d-proteo_              LLTT---------GGHRVVRLVR---RKP-SAENEVFWNPADNVIDTDAL 215
D.alkenivorans_d-proteo_            FLTT---------GGHKVKKLVR---RQP-ANEDEIFWDPVHVKINPRDL 213
S.aurantiaca_d-proteo_              FLTA---------GGHRVRRLVR---GRPEAARGDVAWNPAQGEIDAAAL 218
M.xanthus_d-proteo_                 FLTT---------GGHTVKRMVR---GKADPARNEVAWSPDTGEVDTDAL 219
S.ruber_CFB.bacteria_               FLTT---------GGHTVKRLTR---SGPTGAD-EILWDPRTDRVEADKL 214
Frankia.sp_highGC.gram+_            ALRG---------DGHEVVTLVR----RPPRAPSEIRWDPAAGTLDAAAL 55
O.terrae_verrucomicrobia_           RLRS---------SGGEVRQLVR----GTARAPAEWSWDPANGKIDVAAL 71
P.sitchensis_plantae_               RLVAD---------NHKIRVLTRS--MSK-AKRIFPANDYPG--IIIVEE 107
V.vinifera_plantae_                 RLLAD---------NHRVHVLTRS--RSK-AQFIFPAKDFRG--IVIAEE 104
O.tauri_plantae_                    TLLRS---------GAEVRVLTRD--VSK-AKSKLSARGMPRGDVAFVPP 588
S.elongatus_cyano_                  RLQAE---------GHELRILSQR--PTV-AQQLTGCQVFDT-----ATE 51
P.marinus_cyano_                    QLIQA---------GHFVTVVSRK--SQRSSPFQIKSENYSYISLNPASA 57
H.sapiens_metazoa_                  LLNAR---------GHEVTLVSRK--PGP---GRITWDELAA-------- 46
S.scrofa_metazoa_                   MLKAK---------GHKVTLVSRK--PGL---DRITWDELAS-------- 46
R.norvegicus_metazoa_               LLKTK---------GHEVKLVSRQ--PGP---DRITWTELSR-------- 46
R.castenholzii_GNS.bacteria_        RLMAR---------GDTVTVFTRR--PDAARAVLPGATQYIA--WDAATG 59
Oceanobacter.sp_g-proteo_           YLEE---------QGHTVYKLHR-----DKQIGSF-YWKPEFGHIHLDSR 53
P.ingrahamii_g-proteo_              LLKS---------QGYQVGRLLR-----SDQPGEP-YWDIKQHYFALKDF 56
C.Protochlamydia.amoebophila_c      --------------QHQIAKLVRK--KTGLKSGEI-AWDLEKGIINPELL 41
D.discoideum_mycetozoa_             TLTEGNDNNSNTDTKYEIYKLVR---KTPTSMYEI-EWNPDKQFIDKESL 117
M.marina_CFB.bacteria_              LLLAQ--------KGYSIRYLSRS--KRSIKNVEVFEWHPQKGEIDAAAF 60
V.bacterium_verrucomicrobia_        LLNSQ---------GHEVFVVTRS-----KRRESDIRWDPHKGEIELSRM 211
T.volcanium_euryarchaea_            SLPHD------------FYIVSRS----------AKGQEGQAHIIGLDEI 46
T.acidophilum_euryarchaea_          IQGNT------------YNVITRG----------PSRTDGNINLVNWNDL 46
                                                        .                             

GOS_711030                          EG------------FDSIIHLGGEGIGDK--RWSKKRKSAIRNSRVDSTT 148
K.rhizophila_highGC.gram+_          EG------------VDVVVHLGGASIAT---RFTAENKKKIMNSRVDSTE 264
P.maris_planctomycetes_             AG------------IDAVIHLGGVNIADK--RWSPEIKQKIYNSRVQSTS 94
R.baltica_planctomycetes_           ES------------VDVVVHLAGKSIAGK--RWTPEFKKQIRESRVEKTQ 322
B.marina_planctomycetes_            AG------------VDAVVHLAGEGIADS--RWNEKQKAKIRDSRVDGTT 249
G.obscuriglobus_planctomycetes      EG------------VDALVHLAGDNVAEG--RWTAAKKQKIVDSRDGPTR 257
D.oleovorans_d-proteo_              KNHT----------IDAVIHLAGEHVGTG--RWTDAKKKTIIDSRQQGTR 253
D.alkenivorans_d-proteo_            DG------------ADAIIHLAGDNIGQG--LWTNKKKRRIIDSRELGTG 249
S.aurantiaca_d-proteo_              EG------------VDAVVHLAGENVA-Q--RWTPEAQDRIRRSRTEGTR 253
M.xanthus_d-proteo_                 EG------------VDVVVHLAGVNVAGQ--RWTPEYKDAILKSRTQGTR 255
S.ruber_CFB.bacteria_               EG------------IDAVIHLAGENVF-G--PWTPAKKQRIYSSRADGTR 249
Frankia.sp_highGC.gram+_            AG------------VDGVVNLAGAGIGDR--RWTAAYKQTLRTSRIDGTR 91
O.terrae_verrucomicrobia_           VG------------TEAVVNLAGANIGAG--RWTAARKTLLRQSRIDATR 107
P.sitchensis_plantae_               PEWT-----KYIQGSTAVVNLAGTPISTR---WSPEIKTDIKNSRVSVTS 149
V.vinifera_plantae_                 PEWK-----DCIQGSNAVVNLAGMPISTR---WSPEIKKEIKESRVRITS 146
O.tauri_plantae_                    EKWR-----RGILGATHVVNLAGEPISTR---WDPRVKGEIMASRVKTTK 630
S.elongatus_cyano_                  TSWL-----AALEGADAVVNLAGEPIAEQR--WTPAQKQRLKNSRVQTTR 94
P.marinus_cyano_                    ISWESANLQKAIIESEGVINLVGEPIAEKR--WTKKHCQLIANSRLDSTK 105
H.sapiens_metazoa_                  ---------SGLPSCDAAVNLAGENILNPLRRWNETFQKEVIGSRLETTQ 87
S.scrofa_metazoa_                   ---------SGLPPCDAAVNLAGENILNPLRRWNEAFQKEVISSRLETTH 87
R.norvegicus_metazoa_               ---------SGLPLCDVVINLAGENILNPLRRWNETFQKEVLTSRLDTTH 87
R.castenholzii_GNS.bacteria_        GTWE-----SVLETADAVVHLAGASIAGRR--WTPAYKHEILESRTVSTH 102
Oceanobacter.sp_g-proteo_           IHLD------------AVINLNGVNIGDK--PWTQSRKKAILDTRIQSTQ 89
P.ingrahamii_g-proteo_              ENPD------------VIIHLAGENIGDG--RWTKDKKKKLRDSRILSTQ 92
C.Protochlamydia.amoebophila_c      EGVE------------AVIHLAGENIAS---IWTEKKKKQILESRVKGTK 76
D.discoideum_mycetozoa_             ESLQP----------DVVIHLAGENILG---IWTEEKKRKILESRTKGTT 154
M.marina_CFB.bacteria_              EGVD------------VVVHLAGAGVADK--RWTESRKEEILKSRTQSTE 96
V.bacterium_verrucomicrobia_        EG------------LDAVIHLAGESLTSG--RWNEERKRRLWSSRVDSTA 247
T.volcanium_euryarchaea_            DKIK---------ECDVVINLSGYSIASK--RWNRKVKEEIVRSRIDTTR 85
T.acidophilum_euryarchaea_          RKIR---------HCDVVINLAGYNIGSK--RWNPKIKEEIIRSRIESTR 85
                                                      ::* *  :      :       :  :*   * 

GOS_711030                          LLSEAIAKMKN---KPEVFIVASAIGWYGD-RG--DEELTEESEI-GEGF 191
K.rhizophila_highGC.gram+_          LLVRALGQVPAEK-RPRALVVSSAVGYYGTGRG--DEVLTEDSPS-GDGF 310
P.maris_planctomycetes_             LLANSMAQLEQ---PPATFICASAIGYYGD-RG--DERLDENSPR-GTGF 137
R.baltica_planctomycetes_           ALCEGLAKLQQ---KPPVLICASATGIYGD-RG--EEILTETSAD-GDDF 365
B.marina_planctomycetes_            FLSNKLAALAN---PPKSLICASAIGYYGD-SG--DQPVDETSLA-GEGF 292
G.obscuriglobus_planctomycetes      ALVQSLVALPAER-RPKVFVCASAVGFYGD-RG--EEELTEESAA-GTGF 302
D.oleovorans_d-proteo_              LLAETAARLSP---RPGVFLCASATGFYGE-RG--EAVLTENDGP-GNDF 296
D.alkenivorans_d-proteo_            LLAQAAAAMNP---KPKVFLSASAIGFYGD-TG--DRLVSESDGP-GVLF 292
S.aurantiaca_d-proteo_              VVCEALARLKR---KPRVLVSASAVGFYGD-RG--EALLTEASDS-GEGF 296
M.xanthus_d-proteo_                 TLAEALARMKR---KPKVLVSAGGSSIYGD-RG--DEVLAEESSTDGKGF 299
S.ruber_CFB.bacteria_               LLAEALAGLDD---PPEVLVSSSAVGYYGD-HG--ADRITEESAPRDAGF 293
Frankia.sp_highGC.gram+_            LLAEALAGLDP---RPRVLLSGSAIGWYGTNAGSAGAALDETAPP-GTGF 137
O.terrae_verrucomicrobia_           TLVEAIARMTE---KPAVLLNASAVGYYGDRG---AEVLDETSAS-GRGF 150
P.sitchensis_plantae_               KVVEAINAATIEN-RPSVFVSATAIGYYGTSEG---ETFDETSSSG-NDY 194
V.vinifera_plantae_                 KVVDIINNSQDEV-RPTVLVSASAIGYYGASET---LVFKEQSPSG-NDY 191
O.tauri_plantae_                    TIVDHVNSISDESKRPKVLVNASAIGYYGTSET---DTYDEASGPG-ADY 676
S.elongatus_cyano_                  ALVTAITAATQKP---QVLVTASAIGYYGTSET---AQFTEESAAG-QDY 137
P.marinus_cyano_                    HLINAMVRSKNPP---KVLVNGSAIGFYGTSQD---AVFSEESSSG-KDF 148
H.sapiens_metazoa_                  LLAKAITKAPQPP---KAWVLVTGVAYYQPSLT---AEYDEDSPGGDFDF 131
S.scrofa_metazoa_                   MMATAIAKAPQPP---QAWVLVTGVAYYQPSLT---AEYDEDSPGGDFDF 131
R.norvegicus_metazoa_               LLAKAITEAAQPP---QAWILVTGVAYYQPSLT---EEYDEDSPGGDFDF 131
R.castenholzii_GNS.bacteria_        TLVEAMARASRRP---SVFVCASGIDYYGPRGD---EPVDENAPPG-RNF 145
Oceanobacter.sp_g-proteo_           VLAEAISKRSQKP---SVFISASAIGFYG-DTG---SEWADESSPSGKNF 132
P.ingrahamii_g-proteo_              LLVEHFKKVLPPP---KLFICASAIGFYG-NRG---DQKLDENSAAGADF 135
C.Protochlamydia.amoebophila_c      LLCQNLIRLKSPP---EVLISSSAIGYYG-DHS---DQILTEHSPKGQGF 119
D.discoideum_mycetozoa_             TLCEALSSISNPP---KVFISASGCTYYG-SNV---YDPVDEYSPKGSGF 197
M.marina_CFB.bacteria_              LIAQTIRKMSTAP---KALVNASAIGYYGINTG---DQLLHEESPAGNDF 140
V.bacterium_verrucomicrobia_        FLADVFLRLEKPP---GVFLSGSGIGFYGSETE----TVFAEGSRRGEGF 290
T.volcanium_euryarchaea_            LVVNFIRNLEKKP---SAFLSGSAIGFYGHNTN----KELTEEDPFGSGF 128
T.acidophilum_euryarchaea_          RMVEFISSLDSKP---EAFLSGSAIGYYGYGEN----TVFDENSPPGTGF 128
                                     :                 :   .   *                     :

GOS_711030                          LPETCSDWEGAS------------------------ANLPDE-------- 209
K.rhizophila_highGC.gram+_          LAEVCRAWERAAH-----------------------GATAYG-------- 329
P.maris_planctomycetes_             LPDVCEGWETATQ-----------------------PARDAG-------- 156
R.baltica_planctomycetes_           LADVARQWEDACQ-----------------------PAREAG-------- 384
B.marina_planctomycetes_            LPDVCRAWELSCA-----------------------PAASAG-------- 311
G.obscuriglobus_planctomycetes      FPEVTKKWEEACA-----------------------PARDAG-------- 321
D.oleovorans_d-proteo_              LAKVCKIWEASVQ-----------------------PATDAG-------- 315
D.alkenivorans_d-proteo_            ISEVCDRWEKAAQ-----------------------PAVDAG-------- 311
S.aurantiaca_d-proteo_              LASVVRDWEAAAA-----------------------PALDAG-------- 315
M.xanthus_d-proteo_                 LSQVSREWEAAAA-----------------------PAEAAG-------- 318
S.ruber_CFB.bacteria_               LGEVCEAWEAAAE-----------------------PAAAAG-------- 312
Frankia.sp_highGC.gram+_            LAELARDWENATT-----------------------AAQEAG-------- 156
O.terrae_verrucomicrobia_           LAEVCEAWETEAR-----------------------RAEPLG-------- 169
P.sitchensis_plantae_               LSEVCREWEANA-----------------------QKVDDT--------- 212
V.vinifera_plantae_                 LAEVCREWEGKA-----------------------FKVNKD--------- 209
O.tauri_plantae_                    LSQVCQAWEQAA-----------------------TGAQG---------- 693
S.elongatus_cyano_                  LAEICQAWEQEA-----------------------QAVTVSG-------- 156
P.marinus_cyano_                    LANLCKEWESIA-----------------------AQKPNR--------- 166
H.sapiens_metazoa_                  FSNLVTKWEAAA-----------------------RLPGDS--------- 149
S.scrofa_metazoa_                   FSNLVTKWEAAA-----------------------RLPGDS--------- 149
R.norvegicus_metazoa_               FSNLVTKWEAAA-----------------------RLPGES--------- 149
R.castenholzii_GNS.bacteria_        LAQVCVAWEGEA-----------------------SRAADLG-------- 164
Oceanobacter.sp_g-proteo_           LSDIAKHWEQAS-----------------------RAAKDAG-------- 151
P.ingrahamii_g-proteo_              VSQLALDWEESS-----------------------QGIKEAG-------- 154
C.Protochlamydia.amoebophila_c      LADVCQQWEAAT-----------------------QSATEAG-------- 138
D.discoideum_mycetozoa_             FSDVVEKWEQSCDPLRKHNQQILNQNTNSTISSNGEVEVVAGGGVGGVGT 247
M.marina_CFB.bacteria_              LAEVTSKWENAT-----------------------KEIEEQG-------- 159
V.bacterium_verrucomicrobia_        LAELCEAWEAAAL-----------------------RVESLG-------- 309
T.volcanium_euryarchaea_            LADLARSWEEEAM-----------------------QADG---------- 145
T.acidophilum_euryarchaea_          LAELANAWEDEAL-----------------------KASR---------- 145
                                    . .    **                                         

GOS_711030                          -----VRHVYLRSGIVLSGTGGALGKMLLPFKMGAGGPMGNGKQWMSWIS 254
K.rhizophila_highGC.gram+_          -----MRVVNIRTGLVLSPTGGLLKPQLPLMEAGLSGPLGGGQQWQSWIG 374
P.maris_planctomycetes_             -----VRVVNTRFGMILDKQGGALGQMLTPFKFGVGGKLGSGSQYWSWIA 201
R.baltica_planctomycetes_           -----IRVVNTRFGIVLSPKGGALQQMLLPAKM-MGGKLGSGRQWWSWIA 428
B.marina_planctomycetes_            -----IRVANVRLGVVLSPQGGALAKMLLPFKLGVGGVIGSGKQFWSWIT 356
G.obscuriglobus_planctomycetes      -----IRVVNLRIGVVLSPKGGALGKQLLAFKAGGGAVLGSGRQFVPWIT 366
D.oleovorans_d-proteo_              -----IRTVRMRIGVVLTPKGGALQRLLLPFQLGMGGRLGNGRQYLSWIG 360
D.alkenivorans_d-proteo_            -----IRTVLGRIGVVLSPQGGALAEFLPLFRMGLGGKVGSGKQYLSWLG 356
S.aurantiaca_d-proteo_              -----IRVVHLRIGLVLDASGGALAKMVPAFLLGGGGRVGSGQQWVSWIA 360
M.xanthus_d-proteo_                 -----IRVVHLRIGPVLDAREGALAKMLPAFLAGGGGPIGSGQQWMSWVS 363
S.ruber_CFB.bacteria_               -----IRTVQMRTGIVLTPAGGALRLMLPAFWLGLGGRVGGRHQYFPWIT 357
Frankia.sp_highGC.gram+_            -----IRVVRVRTGIVLSGRGGTLQRLLPIFRRGAGGRLGSGRQWLSWIS 201
O.terrae_verrucomicrobia_           -----VRVVLARFAMVLAPSGGALAKLRPLFQLGLGGRLGRGEQWMSWVT 214
P.sitchensis_plantae_               -----VRLVLLRIGIVLDKDGGALAKMIPLFMLFAGGPIGSGKQWFSWIH 257
V.vinifera_plantae_                 -----VRLVLIRIGVVLGKDGGALAKMIPLFNLFAGGPLGSGKQWFSWIH 254
O.tauri_plantae_                    -----CRVVILRLGIVLDRDGGALGKMVPTFQAFMGGPLGDGQQWFSWIH 738
S.elongatus_cyano_                  -----TRLVTLRIGIVVGP-GGAIGKMLGPFKLFAGGPIGSGRQWVSWIQ 200
P.marinus_cyano_                    -----TRLVVIRIGIVLEKDGGALGKMLPIFRSGFGGPLGNGMQWMSWIH 211
H.sapiens_metazoa_                  -----TRQVVVRSGVVLGRGGGAMGHMLLPFRLGLGGPIGSGHQFFPWIH 194
S.scrofa_metazoa_                   -----TRQVVVRSGVVLGRGGGAIGHMLLPFRLGLGGPIGSGHQFFPWIH 194
R.norvegicus_metazoa_               -----TRQVVVRSGVVLGRRGGAIGHMLLPFRLGLGGPIGSGHQFFPWIH 194
R.castenholzii_GNS.bacteria_        -----VRTVMMRTGIVLDRHEGALARLLLPFQLFVGGPILPGTQWWSWIH 209
Oceanobacter.sp_g-proteo_           -----IRTVNIRTGVVLDKKGGALAKMLLPFKLGLGGRVGTGEQYMSWIS 196
P.ingrahamii_g-proteo_              -----TRLVNLRTGIVISEKGGALAKMLPAFKLGLGGKIGSGEQIMSWID 199
C.Protochlamydia.amoebophila_c      -----IRTVFLRTGIVLSTQGGALKSMLTPFKLGLGGELGSGKQYMSWIS 183
D.discoideum_mycetozoa_             QSVKPTRIVNLRIGLVMDKAGGLLGSMYYPFLFGLGGVIGSGKQYLPWIS 297
M.marina_CFB.bacteria_              -----IRTVKIRVGVVLSPQSGALPKLLQPVRLGLGAPLGSGDQYMSWIH 204
V.bacterium_verrucomicrobia_        -----ARVCLLRTGVVIDPRGGALQQMLPAFRLGLGGPLGDGKQWFPWIG 354
T.volcanium_euryarchaea_            ----ICRTVLLRTANFLSPKGGFLSALIN-PKSKNVMYFGDGRQPVSWMH 190
T.acidophilum_euryarchaea_          ----YTRTVILRTSNVLSSSGGFLARIMN-SRSRRVYYFGDGDQPVSWIH 190
                                          *    * . .:    * :              .    *  .*: 

GOS_711030                          LDDEIYAIHHLLMETGSKGVYNLTAPNPVR-QKTFAKTLGRVLKRPAFAP 303
K.rhizophila_highGC.gram+_          LDDMAGAVAHLALSEDAEGPFNVAAPQPVR-QKQFAKTVAGVLHRPAVVP 423
P.maris_planctomycetes_             LPDVVNAILFCLQHSEIQGPVNFVAPDEVT-NLEFTKTLGKVLARPTCLP 250
R.baltica_planctomycetes_           LDDVVGAIVHCIHNEQINGPVNFVSPDPIQ-NREFAKVLGEVLNRPALFP 477
B.marina_planctomycetes_            LDDVIGAIHHCLMNDELVGPVNLTAPNPAT-NREFTKTLGRVLQRPTIFP 405
G.obscuriglobus_planctomycetes      VNDTAGAIYHTLMNESVSGPVNIVGPNPVT-NREFTKALGRVLNRPAFLW 415
D.oleovorans_d-proteo_              IDDAIGAIFYLLMNETVSGPVNVVSPSPVT-NAEFTRTLATVLCRPALMP 409
D.alkenivorans_d-proteo_            IDDAVGALFHLVCSDKVEGPVNIVGPEPVS-NLEFTRTLAGVLKRPAFFP 405
S.aurantiaca_d-proteo_              LEDVLGLAHFALMKPELRGPVNAVAPHAVR-QEEFARSLGRVLSRPSVFP 409
M.xanthus_d-proteo_                 LEDLLGLIHFSVFTDAARGAINAVAPGAVR-QADFARTLGKVLRRPAVFP 412
S.ruber_CFB.bacteria_               LDDVIGGIYHALWTDALEGPVNLTAPRPVT-MQAYTDTLADVLHRPAFLN 406
Frankia.sp_highGC.gram+_            LADTVDALCFLLEADGVRGPVNLVAPTPVT-NAEFTSALARTLRRPAFAQ 250
O.terrae_verrucomicrobia_           LGDAVRAVEHALADPQMNGPMNVAAPVPVT-NAEFTRALAAALHRPAVFP 263
P.sitchensis_plantae_               RDDLVSLILEALSNPAYKGVINGTAPNPVR-LAEMCDRLGSVMGRPSWLP 306
V.vinifera_plantae_                 LDDIVELIYEALSNPSYTGVINGTAPNPVR-LAEMCDHLGNAMGRPSWLP 303
O.tauri_plantae_                    RDDAVGLIMEGLTNEKLVGPVNCVAPTPVR-MREMCESLGETLGKPSWLP 787
S.elongatus_cyano_                  REDLVSLILEAIANPSYQGTYNATAPQAVR-MADLSATLGEVLQRPSWLP 249
P.marinus_cyano_                    RNDLCKIIEKVLTTQSFSGPINCVSPNPVR-MNTFTQTLGKSLNRPNLLP 260
H.sapiens_metazoa_                  IGDLAGILTHALEANHVHGVLNGVAPSSAT-NAEFAQTLGAALGRRAFIP 243
S.scrofa_metazoa_                   IGDLAGILVHALEASHVQGVLNGVAPASATTNAEFARALGAALGRPAFIP 244
R.norvegicus_metazoa_               ISDLAGILNHALEANHVQGVLNGVAPASTTTNADFAQALGAALGRPAFIP 244
R.castenholzii_GNS.bacteria_        LDDEVGLIMRCIDDERASGPFNGVAPEPQR-NRDFSATLGRVLGRPSWLP 258
Oceanobacter.sp_g-proteo_           LTDEIRAIEHILQNTSISGPVNLTAPEPVT-NDDFTKTLGSVLKRPTVFP 245
P.ingrahamii_g-proteo_              INDMIRAILFIIENENLQGPVNLVSPNPVT-NQIFSQLLAKQLNRPCFFP 248
C.Protochlamydia.amoebophila_c      IDDLIGIIYYVIRQKELQGAINAVSPNPVT-NREFTKILGTVLHRPTFFK 232
D.discoideum_mycetozoa_             LRDAIGVIKFAIENEQVQGPINVVSINPAT-NYEFTKTLGTVLNRPTIFW 346
M.marina_CFB.bacteria_              IDDIARIFMKALADETMRGAYNGVAPAPVT-NAEMTKRLASVVHRPAFLP 253
V.bacterium_verrucomicrobia_        LEDWMGAVNWLLFCEEVSGPVNLVAPEALR-QRQFAKILGRRLGRPAVLP 403
T.volcanium_euryarchaea_            YADYVKAVEFVIENASIAGPVNMSSPQPVT-FKEFAEAFSKSLG--SHIR 237
T.acidophilum_euryarchaea_          IKDYVNAVKFLMENKDISGPVNMAAPSPVS-FADLAHAIAREKG--YKEM 237
                                      *               *  *  .             ..          

GOS_711030                          -LPGFVIKILFG-EMGVKLTLESQKVFPDRL------------------- 332
K.rhizophila_highGC.gram+_          -TPLAGPKALLGTQATEELVAASQRVDVSKLLASGYRFRTEDLRSCAQHI 472
P.maris_planctomycetes_             -VPAWAINTIFG-EMGQALMLCSARVTPQKLQAAGYEFAYPKLEEAFRGL 298
R.baltica_planctomycetes_           -APAFALRLALG-EMADSLLLASSRVVPEQLQQTGYKFRFTDLKDCLRTL 525
B.marina_planctomycetes_            -MPGFAARLALG-EMADDLLLASARVTPARLLETNYTFRDPELEPALRRI 453
G.obscuriglobus_planctomycetes      -LPRFALRALFG-EIADEALLASMKARPAKLAMTGFTFSHTELEPALRFL 463
D.oleovorans_d-proteo_              -VPATAIDLAFG-EMGTTVLLTSTRVAPSKLTESGYCFGWPDLESALRHI 457
D.alkenivorans_d-proteo_            -VPAFAVDAVFG-EKGREVVLASARVSAEKLAGSGYDFRYPGLEAALRHM 453
S.aurantiaca_d-proteo_              -LPAVAVRTVFG-QLGQEALLAGAHVLPEVAQRQGFSFLFPELEEALRFT 457
M.xanthus_d-proteo_                 -VPSPVVRTLFG-QMGQEALLDGARIAPQAAQRLGFAFLLPDLESALRFT 460
S.ruber_CFB.bacteria_               -VPSSVVRTVGG-EMADEMLLTSARAVPQRLQDTGYDFGASALEDGLRHV 454
Frankia.sp_highGC.gram+_            -VPRFALRLALG-EFADEGPLASQRLAPATLVDAGFRFNHSDLATALADA 298
O.terrae_verrucomicrobia_           -VPRPVLRVALG-EMADAMLLASTRAMPGRLRASGFGFEQPQLDGALAQV 311
P.sitchensis_plantae_               -VPEFAVKAIFG-EGASVVLDG-QKVFPKRAQELGFKYKYPHVSDAIRAI 353
V.vinifera_plantae_                 -VPDFALKAVLG-EGASVVLDG-QKVLPARAQQLGFTFKYPYVKDALRAI 350
O.tauri_plantae_                    -VPDFALRAVLG-EGSTLVLQG-QRIQPKTALEVGYKFKYERIDQALKQI 834
S.elongatus_cyano_                  -VPAFALEALLG-EGALLVLEG-QQVLPKRLEAAGFQFRYPDLKSALQQF 296
P.marinus_cyano_                    -VPGAILKLLLG-DGAKVVLEG-QKVNSKKLKRLGFIFKHPQLESAINAV 307
H.sapiens_metazoa_                  -LPSAVVQAVFGRQRAIMLLEG-QKVIPQRTLATGYQYSFPELGAALKEI 291
S.scrofa_metazoa_                   -FPSTVVRAIFGQERAIMLLEG-QKVVPRRTLAAGYQYSFPELGVALKEI 292
R.norvegicus_metazoa_               -VPSAVVQAIFGRERAIMLLEG-QKVVPRRTLATGYQYSFPELGAALKDV 292
R.castenholzii_GNS.bacteria_        -LPGFVLRLLLGEMAPALLIER-QRAIPAKAQALGYPFAYPTLEPALRAA 306
Oceanobacter.sp_g-proteo_           -MPAFIVKLVFG-EMGDLLLLGSNRINSKVLQDNGFEFQYPDIESALQST 293
P.ingrahamii_g-proteo_              -LPEGMVKLLFA-EMGKELLLSSTRVNPKKLLDADFVFKYAKLEESFLQQ 296
C.Protochlamydia.amoebophila_c      -IPTFVLKWIVG-EMAEEVLLKSRRVIPEILEDKGFRFDHPNLKEALQSI 280
D.discoideum_mycetozoa_             -IPETPLRYLLGKDMSEETVLSSQRVLPRKLLDYGFRFQDTNLTATLDRI 395
M.marina_CFB.bacteria_              NVPAFMLKMMLG-EMAS-IVLEGNKVSCDKIVRAGFEFEHPGLTEALKDL 301
V.bacterium_verrucomicrobia_        -APRWAIRLALG-EMGDQALLSSIRAEPKVLEDSGYRFAVPRLEEAFERV 451
T.volcanium_euryarchaea_            SIPEFLGKIALGSEMYRELMSG-QKVIPKKLIQAGFKFDFPDINTAASSI 286
T.acidophilum_euryarchaea_          KIPEFIGKLILGSEMYRELMSG-QRVAPKKLTGSGFSFQYPDLESAIKNL 286
                                      *        .            :                         

GOS_711030                          -------------------
K.rhizophila_highGC.gram+_          LGRTD-------------- 477
P.maris_planctomycetes_             L------------------ 299
R.baltica_planctomycetes_           LGKELKPATQATA------ 538
B.marina_planctomycetes_            LGR---------------- 456
G.obscuriglobus_planctomycetes      LGR---------------- 466
D.oleovorans_d-proteo_              LGKTR-------------- 462
D.alkenivorans_d-proteo_            LGKTGESLQQEENE----- 467
S.aurantiaca_d-proteo_              LGRTTAGAQFMHGLAAKVP 476
M.xanthus_d-proteo_                 LGRTTKGPEYHHS------ 473
S.ruber_CFB.bacteria_               LGRTAD------------- 460
Frankia.sp_highGC.gram+_            VHRDA-------------- 303
O.terrae_verrucomicrobia_           LERSH-------------- 316
P.sitchensis_plantae_               ISS---------------- 356
V.vinifera_plantae_                 LLGS--------------- 354
O.tauri_plantae_                    LNR---------------- 837
S.elongatus_cyano_                  LP----------------- 298
P.marinus_cyano_                    LNN---------------- 310
H.sapiens_metazoa_                  VA----------------- 293
S.scrofa_metazoa_                   IA----------------- 294
R.norvegicus_metazoa_               VT----------------- 294
R.castenholzii_GNS.bacteria_        LARLP-------------- 311
Oceanobacter.sp_g-proteo_           LKN---------------- 296
P.ingrahamii_g-proteo_              FGGK--------------- 300
C.Protochlamydia.amoebophila_c      LAF---------------- 283
D.discoideum_mycetozoa_             VNDKK-------------- 400
M.marina_CFB.bacteria_              LGKH--------------- 305
V.bacterium_verrucomicrobia_        LS----------------- 453
T.volcanium_euryarchaea_            ASLMK-------------- 291
T.acidophilum_euryarchaea_          -------------------



---------------------------------------------------------------------------------------------------

BLAST

PROTOCOLE: NCBI, BLAST P contre Swissprot ; paramètres par défaut
           NCBI, BLAST P contre nr ; paramètres par défaut sauf "number of description = 1000" 

---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

Le BLAST P contre swissprot (gamme E value : 3e-54 à 9.6 ; gamme de score : 211 à 30.8) donne peu de 
résultats. En effet, on obtient peu d'homologues à notre séquence. Par contre, les homologues obtenus
ayant les meilleurs scores présentent la même fonction : YfcH (UPF0105 protein), qui semble impliquée
dans la liaison du NAD(P) (cf : analyse des domaines protéiques).

Nous avons ensuite effectué un BLAST P contre nr afin de vérifier s'il n'existait pas d'autres 
homologues possédant plus de similarités avec notre séquence.

Le BLAST P contre nr à 100 résultats s'arrêtant à une E value encore très faible, nous avons réalisé
un BLAST à 1000 résultats allant jusqu'à des E value élevées (gamme de E value de 5e-83 à 9.9 ; gamme 
de score : 311 à 35.0). On obtient de nombreuses séquences homologues avec de bons résultats : E value 
le plus faible = 5e-83 ; identités entre 40 et 50% sur la totalité des alignements 2 à 2, pour les 
meilleures séquences. Nous ne sommes pas en mesure de déterminer de valeur seuil servant à distinguer 
les vrais homologues des faux, car dans ces résultats, les valeurs des scores et des E value sont 
continues (on n'observe aucune cassure). 
De plus, la plupart des séquences (qu'elles aient des bons ou des mauvais scores) ont une fonction 
épimérase, ce qui nous permet de confirmer que le domaine NAD-dependent epimerase/dehydratase est 
pertinent.

Notre ORF présentant de nombreux homologues (avec de très bonnes E value et de très bons scores), il 
n'est pas nécessaire de réaliser un BLAST X car il y a peu de chance qu'un ORF plus petit soit plus 
pertinent. 

Comme on obtient une meilleure gamme de E value contre nr que contre swissprot, on utilisera ces 
résultats pour la suite de notre recherche. 


---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:


contre swissprot :
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|P73467.2|Y1223_SYNY3  RecName: Full=UPF0105 protein slr1223      211    3e-54
sp|O32960|Y860_MYCLE  UPF0105 protein ML0860                        202    2e-51
sp|P67233|Y2239_MYCBO  UPF0105 protein Mb2239 >sp|P67232|Y2216...   198    3e-50
sp|P77775.1|YFCH_ECOLI  RecName: Full=UPF0105 protein yfcH          187    9e-47
sp|P71373|Y1208_HAEIN  UPF0105 protein HI1208                       173    9e-43
sp|Q17QH8|CN124_BOVIN  UPF0105 protein C14orf124 homolog            171    4e-42 Gene info
sp|Q5M8N4.1|CN124_MOUSE  RecName: Full=UPF0105 protein C14orf1...   169    2e-41 Gene info
sp|O31574|YFHF_BACSU  UPF0105 protein yfhF                          163    2e-39
sp|Q9NRG7.1|CN124_HUMAN  RecName: Full=UPF0105 protein C14orf124    160    1e-38 Gene info
sp|Q49VZ4|Y1921_STAS1  UPF0105 protein SSP1921                      154    6e-37 Gene info
sp|Q4L4J7|Y2119_STAHJ  UPF0105 protein SH2119                       149    3e-35 Gene info
sp|Q5HQV8|Y438_STAEQ  UPF0105 protein SERP0438 >sp|Q8CPY7|Y553...   148    4e-35 Gene info
sp|Q6GIM1|Y825_STAAR  UPF0105 protein SAR0825                       147    7e-35 Gene info
sp|Q7A6Q5|Y724_STAAN  UPF0105 protein SA0724 >sp|Q99VK8|Y769_S...   146    2e-34 Gene info
sp|Q2YSF6|Y724_STAAB  UPF0105 protein SAB0724c                      145    2e-34 Gene info
sp|Q6GB61|Y734_STAAS  UPF0105 protein SAS0734 >sp|Q8NXL7|Y731_...   145    3e-34 Gene info
sp|Q5HHP9|Y834_STAAC  UPF0105 protein SACOL0834 >sp|Q2G035|Y79...   144    9e-34 Gene info
sp|P24550|RCP_VIBCH  Protein rcp (Protein sulA)                    47.4    1e-04
sp|Q12177.1|YL056_YEAST  RecName: Full=Uncharacterized protein...  38.1    0.059 Gene info
sp|Q9SNY3|GMD1_ARATH  GDP-mannose 4,6 dehydratase 1 (GDP-D-man...  36.2    0.29 
sp|P39630.1|SPSJ_BACSU  RecName: Full=Spore coat polysaccharid...  35.8    0.31 
sp|A6NKP2.3|YP030_HUMAN  RecName: Full=Putative 3-beta-HSD fam...  35.4    0.48 
sp|A9WBM7.1|PROA_CHLAA  RecName: Full=Gamma-glutamyl phosphate...  34.7    0.77  Gene info
sp|P56986.1|GALE_NEIMC  UDP-glucose 4-epimerase (UDP-galactose...  33.9    1.1  
sp|Q9Y7K4.1|YGI2_SCHPO  RecName: Full=Uncharacterized protein ...  33.9    1.3   Gene info
sp|P24325.2|GALE_HAEIN  UDP-glucose 4-epimerase (UDP-galactose...  33.9    1.4  
sp|P56985.1|GALE_NEIMB  UDP-glucose 4-epimerase (UDP-galactose...  33.1    2.1  
sp|P0AD13.1|YEEZ_ECO57  RecName: Full=Protein yeeZ; Flags: Pre...  33.1    2.4  
sp|O67619.1|PANE_AQUAE  RecName: Full=Putative 2-dehydropantoa...  33.1    2.4  
sp|Q57301.1|GALE_YEREN  UDP-glucose 4-epimerase (UDP-galactose...  32.7    2.5  
sp|Q9JJZ4.2|UB2J1_MOUSE  RecName: Full=Ubiquitin-conjugating e...  32.7    2.8   Gene info
sp|Q8K3X3|GMDS_CRIGR  GDP-mannose 4,6 dehydratase (GDP-D-manno...  32.3    3.4  
sp|P75822.2|YBJT_ECOLI  Uncharacterized protein ybjT               32.3    3.6  
sp|P52575.1|IFR_MEDSA  RecName: Full=Isoflavone reductase; Sho...  32.0    4.7  
sp|P93031|GMD2_ARATH  GDP-mannose 4,6 dehydratase 2 (GDP-D-man...  32.0    5.0  
sp|P65685|Y2073_MYCBO  Uncharacterized protein Mb2073c >sp|P65...  31.6    6.0  
sp|O60547.1|GMDS_HUMAN  RecName: Full=GDP-mannose 4,6 dehydrat...  31.6    6.2   Gene info
sp|Q09225.3|NRF6_CAEEL  RecName: Full=Nose resistant to fluoxe...  31.6    7.1   Gene info
sp|P37761.1|RFBB_NEIGO  RecName: Full=dTDP-glucose 4,6-dehydra...  31.2    7.7  
sp|P54059|RS3A_METJA  30S ribosomal protein S3Ae                   31.2    8.4  
sp|Q00016.1|IFR_CICAR  RecName: Full=Isoflavone reductase; Sho...  30.8    9.6  


>sp|P73467.2|Y1223_SYNY3  RecName: Full=UPF0105 protein slr1223
Length=307

 Score =  211 bits (538),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 121/283 (42%), Positives = 164/283 (57%), Gaps = 13/283 (4%)

Query  58   KILVAGSSGMIGTQLVAFLDTGGHEVWRLVRRSPKEGK----------KELFWDPASGEM  107
            KI++ G++G +G  LV  L   GHE+  LVR   K  +          K + ++      
Sbjct  2    KIILTGATGFVGCSLVPLLHQQGHELTLLVRSVSKAQRLFAPGSFPQLKAIAYEATKSGD  61

Query  108  DAGILEGFDSIIHLGGEGIGDKRWSKKRKSAIRNSRVDSTTLLSEAIAKMKNKPEVFIVA  167
               +++G D++I+L GE I + RW++  K+ I +SR   T  L EAIAK   KP+V I  
Sbjct  62   WQKVVDGQDAVINLAGEPISE-RWTEAYKAEIFDSRKLGTEKLVEAIAKADRKPQVMISG  120

Query  168  SAIGWYGDRGDEELTEESEIGEGFLPETCSDWEGASANLPDE-VRHVYLRSGIVLSGTGG  226
            SAIG+YG       TE S+ G+ FL E C  WE A+  +    VR V  R GIVL   GG
Sbjct  121  SAIGYYGTSETATFTESSKPGDDFLAEVCQAWENAAHQVEQLGVRLVVFRIGIVLGADGG  180

Query  227  ALGKMLLPFKMGAGGPMGNGKQWMSWISLDDEIYAIHHLLMETGSKGVYNLTAPNPVRQK  286
            AL KML PFK+ AGGP+G+G+QW SWI   D I  I   L ++  +G YN TAPNPV+ K
Sbjct  181  ALAKMLPPFKLFAGGPLGSGEQWFSWIDRRDLIALIDKALTDSTLRGTYNATAPNPVKMK  240

Query  287  TFAKTLGRVLKRPAFAPLPGFVIKILFGEMGVKLTLESQKVFP  329
             F  TLG+VL RP++ P+P   +++L GE G KL LE Q+V P
Sbjct  241  EFCHTLGKVLARPSWLPVPDIALELLLGE-GAKLVLEGQEVLP  282


>sp|O32960.1|Y860_MYCLE  RecName: Full=UPF0105 protein ML0860
Length=307

 Score =  202 bits (515),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/277 (39%), Positives = 153/277 (55%), Gaps = 8/277 (2%)

Query  59   ILVAGSSGMIGTQLVAFLDTGGHEVWRLVRRSPKEGKKELFWDPASGEMDAGILEGFDSI  118
            + +AGSSGMIG+ L A L    H V R+VRR+P   + EL W+P SGE D   +   D++
Sbjct  10   VAIAGSSGMIGSALAAALRANDHLVLRIVRRTPANAE-ELHWNPESGEFDTDAITDVDAV  68

Query  119  IHLGGEGIGDKRWSKKRKSAIRNSRVDSTTLLSEAIAKMKNKPEVFIVASAIGWYGDRGD  178
            ++L G  +G +RWS   K  +R+SR+  T +LS A+A+   K   FI ASA+G+YG+  D
Sbjct  69   VNLCGVNLGQRRWSGSFKQNLRDSRITPTEVLSAAVAEAGVK--TFINASAVGYYGNTRD  126

Query  179  EELTEESEIGEGFLPETCSDWEGASANLPDE---VRHVYLRSGIVLSGTGGALGKMLLPF  235
              + E    G GFL + C DWEGA+  LP +    R +  R+G+VL+   G L +M   F
Sbjct  127  RVVDENDRAGTGFLAQLCQDWEGAT--LPAQYAGTRVILARTGMVLAQEAGVLSRMRPLF  184

Query  236  KMGAGGPMGNGKQWMSWISLDDEIYAIHHLLMETGSKGVYNLTAPNPVRQKTFAKTLGRV  295
                G  +GNG+Q+MSWISL+DE+ A+   +      G  NLT P PV    F    GR 
Sbjct  185  SFALGARIGNGRQYMSWISLEDEVRALLFAISHQSLSGPLNLTGPAPVTNAEFTTAFGRA  244

Query  296  LKRPAFAPLPGFVIKILFGEMGVKLTLESQKVFPDRL  332
            + RP    LP F ++   GE   +  L  Q+  P  L
Sbjct  245  INRPTPLMLPSFAVRAALGEFADEGLLIGQRAIPAAL  281


>sp|P67233.1|Y2239_MYCBO  RecName: Full=UPF0105 protein Mb2239
 sp|P67232.1|Y2216_MYCTU  RecName: Full=UPF0105 protein Rv2216/MT2273
Length=301

 Score =  198 bits (504),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 108/277 (38%), Positives = 152/277 (54%), Gaps = 8/277 (2%)

Query  59   ILVAGSSGMIGTQLVAFLDTGGHEVWRLVRRSPKEGKKELFWDPASGEMDAGILEGFDSI  118
            + +AGSSG+IG+ L A L    H V R+VRR+P    +EL W+P SGE D   L   D++
Sbjct  6    VAIAGSSGLIGSALTAALRAADHTVLRIVRRAPAN-SEELHWNPESGEFDPHALTDVDAV  64

Query  119  IHLGGEGIGDKRWSKKRKSAIRNSRVDSTTLLSEAIAKMKNKPEVFIVASAIGWYGDRGD  178
            ++L G  I  +RWS   K ++R+SR+  T +LS A+A         I ASA+G+YG+  D
Sbjct  65   VNLCGVNIAQRRWSGAFKQSLRDSRITPTEVLSAAVADAGVA--TLINASAVGYYGNTKD  122

Query  179  EELTEESEIGEGFLPETCSDWEGASANLPDE---VRHVYLRSGIVLSGTGGALGKMLLPF  235
              + E    G GFL + C DWE  +A  P +    R V  R+G+VLS  GG L +M   F
Sbjct  123  RVVDENDSAGTGFLAQLCVDWE--TATRPAQQSGARVVLARTGVVLSPAGGMLRRMRPLF  180

Query  236  KMGAGGPMGNGKQWMSWISLDDEIYAIHHLLMETGSKGVYNLTAPNPVRQKTFAKTLGRV  295
             +G G  +G+G+Q+MSWISL+DE+ A+   + +    G  NLT P PV    F    GR 
Sbjct  181  SVGLGARLGSGRQYMSWISLEDEVRALQFAIAQPNLSGPVNLTGPAPVTNAEFTTAFGRA  240

Query  296  LKRPAFAPLPGFVIKILFGEMGVKLTLESQKVFPDRL  332
            + RP    LP   ++  FGE   +  L  Q+  P  L
Sbjct  241  VNRPTPLMLPSVAVRAAFGEFADEGLLIGQRAIPSAL  277


>sp|P77775.1|YFCH_ECOLI  RecName: Full=UPF0105 protein yfcH
Length=297

 Score =  187 bits (474),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 108/281 (38%), Positives = 158/281 (56%), Gaps = 12/281 (4%)

Query  58   KILVAGSSGMIGTQLVAFLDTGGHEVWRLVRRSPKE-----GKKELFWDPASGEMDAGIL  112
             I++ G +G+IG  L+  L   GH++  +V R+P++     G +   W    G  D   L
Sbjct  2    NIVITGGTGLIGRHLIPRLLELGHQI-TVVTRNPQKASSVLGPRVTLW---QGLADQSNL  57

Query  113  EGFDSIIHLGGEGIGDKRWSKKRKSAIRNSRVDSTTLLSEAIAKMKNKPEVFIVASAIGW  172
             G D++I+L GE I DKRW+ ++K  +  SR + T  L + I      P V I  SA G+
Sbjct  58   NGVDAVINLAGEPIADKRWTHEQKERLCQSRWNITQKLVDLINASDTPPSVLISGSATGY  117

Query  173  YGDRGDEELTEESEIGEGFLPETCSDWEG-ASANLPDEVRHVYLRSGIVLSGTGGALGKM  231
            YGD G+  +TEE      F  + C+ WE  A     D+ R   LR+G+VL+  GG LGKM
Sbjct  118  YGDLGEVVVTEEEPPHNEFTHKLCARWEEIACRAQSDKTRVCLLRTGVVLAPDGGILGKM  177

Query  232  LLPFKMGAGGPMGNGKQWMSWISLDDEIYAIHHLLMETGSKGVYNLTAPNPVRQKTFAKT  291
            L PF++G GGP+G+G+Q+++WI +DD +  I  LL +   +G +N+ +P PVR + FA  
Sbjct  178  LPPFRLGLGGPIGSGRQYLAWIHIDDMVNGILWLL-DNELRGPFNMVSPYPVRNEQFAHA  236

Query  292  LGRVLKRPAFAPLPGFVIKILFGEMGVKLTLESQKVFPDRL  332
            LG  L RPA   +P   I++L GE  V L L  Q+  P RL
Sbjct  237  LGHALHRPAILRVPATAIRLLMGESSV-LVLGGQRALPKRL  276


>sp|P71373.1|Y1208_HAEIN  RecName: Full=UPF0105 protein HI1208
Length=296

 Score =  173 bits (439),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 106/277 (38%), Positives = 159/277 (57%), Gaps = 9/277 (3%)

Query  59   ILVAGSSGMIGTQLVAFLDTGGHEVWRLVRRSPKEG---KKELFWDPASGEMDAGILEGF  115
            IL+ G +G+IG  LV  L     +V  L R S        K + +  A  ++++   E F
Sbjct  3    ILLTGGTGLIGKALVERLCLRNEQVTILTRSSSPHTLSKHKNIKFITALSQLNSQ--EQF  60

Query  116  DSIIHLGGEGIGDKRWSKKRKSAIRNSRVDSTTLLSEAIAKMKNKPEVFIVASAIGWYGD  175
            D+II+L GE I  K WSK +KS +R SR+  TT L E I + +  P +FI  SA G YGD
Sbjct  61   DAIINLAGEPIFHKVWSKNQKSILRESRLSLTTQLVEFINQYQQHP-IFISGSATGIYGD  119

Query  176  RGDEELTEESEIGEGFLPETCSDWEGASANLPDEVRHVYLRSGIVLSGTGGALGKMLLPF  235
            + ++++TE S+  + F  + C DWE  +      V    +R+G+V S  GGAL K+L  +
Sbjct  120  QDEQKITETSKTAKTFTAQLCQDWENIAQQANGRV--CLIRTGMVFSTKGGALAKILPFY  177

Query  236  KMGAGGPMGNGKQWMSWISLDDEIYAIHHLLMETGSKGVYNLTAPNPVRQKTFAKTLGRV  295
            K G GG +G G+Q+  WI+L+D +  I  LL  +  +G +N  AP  ++Q  F +TL ++
Sbjct  178  KWGLGGKLGKGEQYFPWIALEDMVNGILFLLDHSECRGAFNFAAPKSIKQHKFNRTLAQL  237

Query  296  LKRPAFAPLPGFVIKILFGEMGVKLTLESQKVFPDRL  332
            LKRPAFA +P +++  + GE    L LESQ V P++L
Sbjct  238  LKRPAFATIPKWLLHFILGERA-NLLLESQNVVPEKL  273


>sp|Q17QH8.1|CN124_BOVIN Gene info RecName: Full=UPF0105 protein C14orf124 homolog
Length=294

 GENE ID: 520897 C10H14orf124 | chromosome 14 open reading frame 124 ortholog
[Bos taurus]

 Score =  171 bits (434),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 103/279 (36%), Positives = 153/279 (54%), Gaps = 13/279 (4%)

Query  58   KILVAGSSGMIGTQLVAFLDTGGHEVWRLVRRSPKEGKKELFWDPASGEMDAGILEGFDS  117
            ++LV G +G IGT L   L   GHEV  L+ R P  G   + WD    ++    L   D+
Sbjct  2    RVLVGGGTGFIGTALTQLLKARGHEV-TLISRKP--GPDRITWD----DLTTSGLPRCDA  54

Query  118  IIHLGGEGIGD--KRWSKKRKSAIRNSRVDSTTLLSEAIAKMKNKPEVFIVASAIGWYGD  175
             ++L GE I +  +RW+   +  + +SR+++T  L+ AIAK    P+ +++ + + +Y  
Sbjct  55   AVNLAGENILNPLRRWNAAFQKEVLSSRLETTQTLARAIAKAPQPPQAWVLVTGVAYYQP  114

Query  176  RGDEELTEESEIGE-GFLPETCSDWEGASANLP-DEVRHVYLRSGIVLSGTGGALGKMLL  233
                E  E+S  G+  F     + WE A+A LP D  R V +RSG+VL   GGA+G MLL
Sbjct  115  SLTAEYDEDSPGGDFDFFSNLVTKWE-AAARLPGDSTRQVVVRSGVVLGRGGGAIGHMLL  173

Query  234  PFKMGAGGPMGNGKQWMSWISLDDEIYAIHHLLMETGSKGVYNLTAP-NPVRQKTFAKTL  292
            PF++G GGP+G+G Q+  WI + D    + H L  +  +G+ N  AP +      FA+ L
Sbjct  174  PFRLGLGGPIGSGHQFFPWIHIRDLAGILAHALETSHVQGILNGVAPASSTTNAEFARAL  233

Query  293  GRVLKRPAFAPLPGFVIKILFGEMGVKLTLESQKVFPDR  331
            G  L RPAF PLP  V++ +FG     + LE QKV P R
Sbjct  234  GTALGRPAFIPLPSAVVQAVFGRERAVMLLEGQKVVPRR  272


>sp|Q5M8N4.1|CN124_MOUSE Gene info RecName: Full=UPF0105 protein C14orf124 homolog
Length=308

 GENE ID: 654795 2310014G06Rik | RIKEN cDNA 2310014G06 gene [Mus musculus]
(Over 10 PubMed links)

 Score =  169 bits (428),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 105/279 (37%), Positives = 158/279 (56%), Gaps = 14/279 (5%)

Query  58   KILVAGSSGMIGTQLVAFLDTGGHEVWRLVRRSPKEGKKELFWDPASGEMDAGILEGFDS  117
            ++LV G +G IGT +   L   GHEV +LV R P  G+  + W     E+    L   D 
Sbjct  2    RVLVGGGTGFIGTAVTQLLRGRGHEV-KLVSRQPGPGR--ITWS----ELSESGLPLCDV  54

Query  118  IIHLGGEGIGD--KRWSKKRKSAIRNSRVDSTTLLSEAIAKMKNKPEVFIVASAIGWYGD  175
            +I+L GE I +  +RW++  +  +  SR+D+T LL++AI +  + P+ +I+ + + +Y  
Sbjct  55   VINLAGENILNPLRRWNETFQKEVLTSRLDTTHLLAKAITETAHPPQAWILVTGVAYYQP  114

Query  176  RGDEELTEESEIGE-GFLPETCSDWEGASANLPDE-VRHVYLRSGIVLSGTGGALGKMLL  233
               +E  E+S  G   F     + WE A+A LP E  R V +RSG+VL   GGA+  MLL
Sbjct  115  SLTKEYDEDSPGGNFDFFSNLVTKWE-AAARLPGESTRQVVVRSGVVLGRGGGAISHMLL  173

Query  234  PFKMGAGGPMGNGKQWMSWISLDDEIYAIHHLLMETGSKGVYNLTAP-NPVRQKTFAKTL  292
            PF++G GGP+G+G+Q+  WI + D    +++ L     +GV N  AP +      FA+ L
Sbjct  174  PFRLGLGGPIGSGRQFFPWIHIGDLAGILNYALEANHVQGVLNGVAPASTTTNAEFAQAL  233

Query  293  GRVLKRPAFAPLPGFVIKILFGEMGVKLTLESQKVFPDR  331
            G  L RPAF P+P  V++ +FGE  + L LE QKV P R
Sbjct  234  GAALGRPAFIPVPSTVVRAVFGERAIML-LEGQKVVPRR  271


>sp|O31574.1|YFHF_BACSU  RecName: Full=UPF0105 protein yfhF
Length=303

 Score =  163 bits (412),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 100/278 (35%), Positives = 148/278 (53%), Gaps = 7/278 (2%)

Query  58   KILVAGSSGMIGTQLVAFLDTGGHEVWRLVRRSPKEGKKELFWDP--ASGEMDAGILEGF  115
             I + G +G +G  L   L   GH V+ L R + +  +K + +    + G      L   
Sbjct  2    NIAMTGGTGFLGQHLTGVLTRQGHHVYILSRNARETEQKNMTYVQWLSEGAAPEQELPHI  61

Query  116  DSIIHLGGEGIGDKRWSKKRKSAIRNSRVDSTTLLSEAIAKMKNKPEVFIVASAIGWYGD  175
            D  I+L G+ I   RW++K K  I +SR+++T  +   I K K KP+  I ASA+G YG 
Sbjct  62   DVWINLAGKSIFG-RWTEKTKQHILSSRINATREVQRLIQKQKEKPKTLIQASAVGIYGT  120

Query  176  RGDEELTEESEIG-EGFLPETCSDWEGASANLPDE-VRHVYLRSGIVLSGTGGALGKMLL  233
              ++  TE+S    E FL  T   WE    ++    +R VY R G++L G  GAL  M+L
Sbjct  121  SLEKTFTEDSATSDEDFLSHTAHLWEKEGQHIEAMGIRTVYARFGVML-GEKGALPLMIL  179

Query  234  PFKMGAGGPMGNGKQWMSWISLDDEIYAIHHLLMETGSKGVYNLTAPNPVRQKTFAKTLG  293
            P+K  AGG +G G+QW+SWI ++D    I + +   G  G  N+TAPNPV  K F KT+ 
Sbjct  180  PYKFLAGGTIGTGRQWLSWIHVEDAAQMIRYAVENAGISGPMNVTAPNPVDMKQFGKTIA  239

Query  294  RVLKRPAFAPLPGFVIKILFGEMGVKLTLESQKVFPDR  331
            RV  RP + P+P F +    GEM + L ++ Q+  P +
Sbjct  240  RVKHRPHWLPVPEFFLSKALGEMSL-LIVKGQRALPKK  276


>sp|Q9NRG7.1|CN124_HUMAN Gene info RecName: Full=UPF0105 protein C14orf124
Length=319

 GENE ID: 56948 C14orf124 | chromosome 14 open reading frame 124 [Homo sapiens]
(10 or fewer PubMed links)

 Score =  160 bits (404),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 141/255 (55%), Gaps = 12/255 (4%)

Query  81   HEVWRLVRRSPKEGKKELFWDPASGEMDAGILEGFDSIIHLGGEGIGD--KRWSKKRKSA  138
            HEV  LV R P  G+  + WD    E+ A  L   D+ ++L GE I +  +RW++  +  
Sbjct  51   HEV-TLVSRKPGPGR--ITWD----ELAASGLPSCDAAVNLAGENILNPLRRWNETFQKE  103

Query  139  IRNSRVDSTTLLSEAIAKMKNKPEVFIVASAIGWYGDRGDEELTEESEIGE-GFLPETCS  197
            +  SR+++T LL++AI K    P+ +++ + + +Y      E  E+S  G+  F     +
Sbjct  104  VLGSRLETTQLLAKAITKAPQPPKAWVLVTGVAYYQPSLTAEYDEDSPGGDFDFFSNLVT  163

Query  198  DWEGASANLP-DEVRHVYLRSGIVLSGTGGALGKMLLPFKMGAGGPMGNGKQWMSWISLD  256
             WE A+A LP D  R V +RSG+VL   GGA+G MLLPF++G GGP+G+G Q+  WI + 
Sbjct  164  KWE-AAARLPGDSTRQVVVRSGVVLGRGGGAMGHMLLPFRLGLGGPIGSGHQFFPWIHIG  222

Query  257  DEIYAIHHLLMETGSKGVYNLTAPNPVRQKTFAKTLGRVLKRPAFAPLPGFVIKILFGEM  316
            D    + H L      GV N  AP+      FA+TLG  L R AF PLP  V++ +FG  
Sbjct  223  DLAGILTHALEANHVHGVLNGVAPSSATNAEFAQTLGAALGRRAFIPLPSAVVQAVFGRQ  282

Query  317  GVKLTLESQKVFPDR  331
               + LE QKV P R
Sbjct  283  RAIMLLEGQKVIPQR  297


>sp|Q49VZ4.1|Y1921_STAS1 Gene info RecName: Full=UPF0105 protein SSP1921
Length=298

 GENE ID: 3615275 SSP1921 | putative nucleoside-diphosphate sugar epimerase
[Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
(10 or fewer PubMed links)

 Score =  154 bits (389),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 95/278 (34%), Positives = 139/278 (50%), Gaps = 4/278 (1%)

Query  57   RKILVAGSSGMIGTQLVAFLDTGGHEVWRLVRRSPKEGKKELFWDPASGEMDAGILEGFD  116
            +  L+ G +GMIG+QLV  +      +  L R+       ++ +   S       +   D
Sbjct  2    KHYLITGGTGMIGSQLVKAIIQSDAHITILTRQDMTSSHPKISYVNWSQPNWENEIPDID  61

Query  117  SIIHLGGEGIGDKRWSKKRKSAIRNSRVDSTTLLSEAIAKMKNKPEVFIVASAIGWYGDR  176
             +I+L G  + +KRW+K  K  I  SR+ +T  L E     K+KPEV   ASA+G+Y   
Sbjct  62   IVINLAGASL-NKRWTKSYKQTIMLSRIQATQALFELFQNRKHKPEVLFNASAVGYYKPD  120

Query  177  GDEELTE-ESEIGEGFLPETCSDWEGASANLPDE-VRHVYLRSGIVLSGTGGALGKMLLP  234
                 TE    +   FL E    WE  +        R V  R G+VLS  GGAL  M LP
Sbjct  121  LYRTYTELYKTLPFDFLSEVVYQWERMARQFETLGTRVVIGRFGMVLSNDGGALPMMKLP  180

Query  235  FKMGAGGPMGNGKQWMSWISLDDEIYAIHHLLMETGSKGVYNLTAPNPVRQKTFAKTLGR  294
            +    GG +G+G+QW SWI +DD + A+ H +    ++GV+N TAP    Q  F  TL R
Sbjct  181  YDFYLGGKLGSGRQWYSWIHIDDLVRALLHTINTESARGVFNFTAPIVEHQNMFGYTLAR  240

Query  295  VLKRPAFAPLPGFVIKILFGEMGVKLTLESQKVFPDRL  332
            V  RP    +P   I++  G+M   + L++QKV P++L
Sbjct  241  VSHRPHHTWVPSLAIRLALGQMST-VVLDTQKVIPNKL  277



---------------------------------------------------------------------------------------------------


contre nr :
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_01093586.1|  hypothetical 317 kDa protein-putative nucl...   311    5e-83
ref|ZP_02737688.1|  hypothetical protein GobsU_38117 [Gemmata ...   274    9e-72
ref|YP_001530946.1|  hypothetical protein Dole_3066 [Desulfoco...   266    2e-69 Gene info
gb|ABZ07560.1|  hypothetical protein ALOHA_HF4000ANIW137J11ctg...   260    1e-67
ref|ZP_01459687.1|  nucleoside-diphosphate sugar epimerase [St...   254    5e-66
ref|ZP_02131527.1|  domain of unknown function DUF1731 [Desulf...   253    1e-65
ref|ZP_01307004.1|  hypothetical 317 kDa protein-putative nucl...   253    2e-65
ref|ZP_01857906.1|  hypothetical 317 kDa protein-putative nucl...   251    5e-65
ref|YP_629798.1|  hypothetical protein MXAN_1546 [Myxococcus x...   243    1e-62 Gene info
ref|YP_001856036.1|  hypothetical protein KRH_21830 [Kocuria r...   242    3e-62 Gene info
ref|YP_001506122.1|  hypothetical protein Franean1_1778 [Frank...   241    4e-62 Gene info
ref|ZP_01874745.1|  hypothetical protein LNTAR_20718 [Lentisph...   239    2e-61
ref|YP_064991.1|  hypothetical protein DP1255 [Desulfotalea ps...   239    2e-61 Gene info
ref|ZP_01913122.1|  hypothetical protein PPSIR1_13720 [Plesioc...   235    5e-60
ref|NP_864388.1|  nucleoside-diphosphate sugar epimerase [Rhod...   233    1e-59 Gene info
ref|YP_944896.1|  sugar nucleotide epimerase [Psychromonas ing...   230    1e-58 Gene info
ref|YP_002187567.1|  NAD dependent epimerase/dehydratase [Stre...   229    2e-58 Gene info
ref|YP_872693.1|  hypothetical protein Acel_0934 [Acidothermus...   229    2e-58 Gene info
ref|ZP_03177506.1|  putative NAD dependent epimerase/dehydrata...   229    2e-58
gb|EDY81627.1|  conserved hypothetical protein TIGR01777, puta...   226    3e-57
ref|YP_643505.1|  hypothetical protein Rxyl_0724 [Rubrobacter ...   225    5e-57 Gene info
ref|YP_001106291.1|  nucleoside-diphosphate sugar epimerase [S...   222    3e-56 Gene info
ref|YP_001819547.1|  hypothetical protein Oter_2666 [Opitutus ...   221    9e-56 Gene info
ref|YP_007672.1|  hypothetical protein pc0673 [Candidatus Prot...   220    1e-55 Gene info
ref|YP_702515.1|  NAD-dependent epimerase [Rhodococcus sp. RHA...   219    3e-55 Gene info
ref|YP_444861.1|  hypothetical protein SRU_0723 [Salinibacter ...   219    3e-55 Gene info
ref|NP_827190.1|  NAD-dependent epimerase/dehydratase family p...   219    3e-55 Gene info
ref|YP_001550020.1|  putative cell division inhibitor [Prochlo...   218    5e-55 Gene info
ref|YP_002262316.1|  putative NAD dependent epimerase/dehydrat...   218    6e-55
ref|YP_001826835.1|  putative NAD dependent epimerase/dehydrat...   217    9e-55 Gene info
ref|YP_172337.1|  hypothetical protein syc1627_d [Synechococcu...   217    1e-54 Gene info
ref|YP_001431861.1|  hypothetical protein Rcas_1751 [Roseiflex...   216    2e-54 Gene info
ref|YP_001276449.1|  hypothetical protein RoseRS_2118 [Roseifl...   214    6e-54 Gene info
ref|YP_002204140.1|  NAD dependent epimerase/dehydratase [Stre...   214    7e-54 Gene info
ref|ZP_01694137.1|  conserved hypothetical protein [Microscill...   214    9e-54
ref|NP_626443.1|  hypothetical protein SCO2190 [Streptomyces c...   214    1e-53 Gene info
ref|YP_476126.1|  NAD-dependent epimerase/dehydratase family p...   214    1e-53 Gene info
ref|YP_225899.1|  nucleoside-diphosphate sugar epimerase [Cory...   213    1e-53 Gene info
ref|YP_001864224.1|  hypothetical protein Npun_R0504 [Nostoc p...   213    1e-53 Gene info
ref|NP_486430.1|  cell division inhibitor [Nostoc sp. PCC 7120...   213    1e-53 Gene info
ref|YP_001519358.1|  hypothetical protein AM1_5074 [Acaryochlo...   213    2e-53 Gene info
ref|YP_701137.1|  hypothetical protein RHA1_ro01152 [Rhodococc...   213    2e-53 Gene info
ref|YP_001702680.1|  hypothetical protein MAB_1944c [Mycobacte...   213    3e-53 Gene info
ref|YP_001134264.1|  hypothetical protein Mflv_2999 [Mycobacte...   212    3e-53 Gene info
ref|YP_001483343.1|  putative cell division inhibitor [Prochlo...   212    3e-53 Gene info
ref|YP_001138557.1|  hypothetical protein cgR_1663 [Corynebact...   212    3e-53 Gene info
sp|P73467.2|Y1223_SYNY3  RecName: Full=UPF0105 protein slr1223      211    5e-53
ref|NP_440827.1|  cell division inhibitor [Synechocystis sp. P...   211    5e-53 Gene info
ref|ZP_00378879.1|  COG1090: Predicted nucleoside-diphosphate ...   211    5e-53
gb|EDY38073.1|  conserved hypothetical protein TIGR01777 [Cyan...   211    1e-52
ref|ZP_03197471.1|  hypothetical protein SsviA_28280 [Streptom...   210    1e-52
ref|YP_563365.1|  hypothetical protein Sden_2362 [Shewanella d...   210    1e-52 Gene info
emb|CAR66741.1|  similar to putative sugar nucleotide epimeras...   210    2e-52
ref|YP_119274.1|  hypothetical protein nfa30630 [Nocardia farc...   210    2e-52 Gene info
ref|ZP_01168077.1|  hypothetical protein MED92_12621 [Oceanosp...   209    2e-52
ref|YP_589134.1|  hypothetical protein Acid345_0055 [Acidobact...   209    2e-52 Gene info
ref|NP_600828.2|  SulA family nucleoside-diphosphate sugar epi...   209    3e-52 Gene info
ref|NP_681255.1|  putative sugar nucleotide epimerase [Thermos...   209    4e-52 Gene info
ref|YP_954313.1|  hypothetical protein Mvan_3512 [Mycobacteriu...   208    5e-52 Gene info
ref|YP_320727.1|  hypothetical protein Ava_0206 [Anabaena vari...   207    9e-52 Gene info
ref|YP_888561.1|  hypothetical protein MSMEG_4284 [Mycobacteri...   207    1e-51 Gene info
ref|YP_001090361.1|  putative cell division inhibitor [Prochlo...   206    2e-51 Gene info
ref|YP_723449.1|  hypothetical protein Tery_3948 [Trichodesmiu...   206    2e-51 Gene info
ref|YP_827879.1|  hypothetical protein Acid_6672 [Solibacter u...   206    2e-51 Gene info
ref|YP_883042.1|  nucleoside-diphosphate sugar epimerase [Myco...   206    3e-51 Gene info
ref|YP_001849984.1|  hypothetical protein MMAR_1679 [Mycobacte...   206    3e-51 Gene info
ref|ZP_01783611.1|  arginine repressor [Haemophilus influenzae...   206    3e-51
ref|YP_001995645.1|  domain of unknown function DUF1731 [Chlor...   205    5e-51 Gene info
ref|YP_396621.1|  putative cell division inhibitor [Prochloroc...   205    5e-51 Gene info
ref|YP_113017.1|  hypothetical protein MCA0496 [Methylococcus ...   204    6e-51 Gene info
ref|NP_961999.1|  hypothetical protein MAP3065 [Mycobacterium ...   204    6e-51 Gene info
ref|ZP_02169212.1|  1-acyl-sn-glycerol-3-phosphate acyltransfe...   204    7e-51
ref|YP_248866.1|  cell division inhibitor SulA [Haemophilus in...   204    8e-51 Gene info
ref|ZP_00154386.1|  COG1090: Predicted nucleoside-diphosphate ...   204    9e-51
ref|YP_001008533.1|  putative cell division inhibitor [Prochlo...   204    9e-51 Gene info
ref|NP_898309.1|  putative cell division inhibitor [Synechococ...   204    1e-50 Gene info
ref|ZP_03112536.1|  cell division inhibitor-like protein [Baci...   204    1e-50
ref|NP_892241.1|  putative cell division inhibitor [Prochloroc...   203    1e-50 Gene info
ref|YP_376346.1|  hypothetical protein Syncc9902_0330 [Synecho...   203    2e-50 Gene info
ref|NP_301648.1|  hypothetical protein ML0860 [Mycobacterium l...   202    2e-50 Gene info
ref|YP_001657556.1|  hypothetical protein MAE_25420 [Microcyst...   202    3e-50 Gene info
ref|ZP_03155637.1|  protein of unknown function DUF1731 [Cyano...   202    3e-50
ref|ZP_00050154.1|  COG1090: Predicted nucleoside-diphosphate ...   202    4e-50
ref|YP_001010450.1|  putative cell division inhibitor [Prochlo...   202    4e-50 Gene info
ref|YP_963011.1|  hypothetical protein Sputw3181_1620 [Shewane...   202    4e-50 Gene info
ref|YP_204171.1|  hypothetical protein VF_0788 [Vibrio fischer...   202    4e-50 Gene info
ref|ZP_01628270.1|  hypothetical protein N9414_04940 [Nodulari...   202    4e-50
ref|ZP_01621282.1|  cell division inhibitor [Lyngbya sp. PCC 8...   201    5e-50
ref|NP_874534.1|  putative cell division inhibitor [Prochloroc...   201    6e-50 Gene info
ref|YP_002155549.1|  hypothetical protein VFMJ11_0825 [Vibrio ...   201    6e-50 Gene info
ref|YP_001734819.1|  hypothetical protein SYNPCC7002_A1572 [Sy...   201    7e-50 Gene info
ref|NP_930395.1|  hypothetical protein plu3165 [Photorhabdus l...   201    8e-50 Gene info
ref|YP_002314713.1|  NAD dependent epimerase/dehydratase famil...   201    9e-50 Gene info
ref|YP_881476.1|  hypothetical protein MAV_2272 [Mycobacterium...   201    9e-50 Gene info
ref|YP_001014021.1|  putative cell division inhibitor [Prochlo...   201    1e-49 Gene info
ref|YP_893353.1|  NAD-dependent epimerase/dehydratase family p...   200    1e-49 Gene info
ref|YP_001643326.1|  hypothetical protein BcerKBAB4_0432 [Baci...   200    1e-49 Gene info
ref|ZP_02961146.1|  hypothetical protein PROSTU_03140 [Provide...   200    1e-49
ref|YP_001226526.1|  nucleoside-diphosphate sugar epimerase [S...   200    2e-49 Gene info
ref|YP_001709934.1|  hypothetical protein CMS_1196 [Clavibacte...   200    2e-49 Gene info
gb|EDX71477.1|  conserved hypothetical protein TIGR01777 [Micr...   200    2e-49
ref|NP_960891.1|  hypothetical protein MAP1957 [Mycobacterium ...   200    2e-49 Gene info
ref|ZP_00994967.1|  putative NAD dependent epimerase/dehydrata...   199    2e-49
ref|ZP_01468741.1|  hypothetical protein BL107_04974 [Synechoc...   199    3e-49
ref|YP_001290937.1|  arginine repressor [Haemophilus influenza...   199    3e-49 Gene info
ref|YP_339796.1|  epimerase [Pseudoalteromonas haloplanktis TA...   199    4e-49 Gene info
ref|ZP_02974590.1|  domain of unknown function DUF1731 [Cyanot...   199    4e-49
gb|ABK23230.1|  unknown [Picea sitchensis]                          198    4e-49
ref|YP_001222780.1|  putative nucleoside-diphosphate sugar epi...   198    5e-49 Gene info
ref|ZP_02579575.1|  Cell division inhibitor [Bacillus cereus B...   198    5e-49
ref|NP_336744.1|  hypothetical protein MT2273 [Mycobacterium t...   198    5e-49 Gene info
ref|YP_001479548.1|  hypothetical protein Spro_3322 [Serratia ...   198    5e-49 Gene info
ref|NP_216732.1|  hypothetical protein Rv2216 [Mycobacterium t...   198    5e-49 Gene info
ref|YP_062509.1|  hypothetical protein Lxx16130 [Leifsonia xyl...   198    6e-49 Gene info
ref|ZP_01731468.1|  cell division inhibitor [Cyanothece sp. CC...   198    6e-49
ref|YP_002014833.1|  domain of unknown function DUF1731 [Prost...   198    7e-49 Gene info
ref|ZP_03274941.1|  protein of unknown function DUF1731 [Arthr...   197    7e-49
ref|YP_478649.1|  NAD-dependent epimerase/dehydratase family p...   197    8e-49 Gene info
ref|ZP_03136555.1|  protein of unknown function DUF1731 [Cyano...   197    9e-49
ref|ZP_00831032.1|  COG1090: Predicted nucleoside-diphosphate ...   197    1e-48
ref|YP_156147.1|  sugar nucleotide epimerase [Idiomarina loihi...   197    1e-48 Gene info
ref|YP_965885.1|  hypothetical protein Dvul_0435 [Desulfovibri...   197    1e-48 Gene info
ref|ZP_02585880.1|  Cell division inhibitor [Bacillus cereus G...   196    2e-48
ref|NP_406295.1|  hypothetical protein YPO2778 [Yersinia pesti...   196    2e-48 Gene info
ref|NP_668929.1|  hypothetical protein y1611 [Yersinia pestis ...   196    2e-48 Gene info
ref|ZP_03229405.1|  cell division inhibitor-like protein [Baci...   196    2e-48
ref|YP_292678.1|  putative cell division inhibitor [Prochloroc...   196    2e-48 Gene info
ref|YP_927365.1|  hypothetical protein Sama_1488 [Shewanella a...   196    2e-48 Gene info
ref|YP_001225952.1|  nucleoside-diphosphate sugar epimerase [S...   196    2e-48 Gene info
ref|ZP_00739594.1|  Cell division inhibitor [Bacillus thuringi...   196    2e-48
ref|ZP_01739251.1|  predicted nucleoside-diphosphate sugar epi...   196    2e-48
ref|YP_012144.1|  hypothetical protein DVU2932 [Desulfovibrio ...   196    2e-48 Gene info
ref|NP_830334.1|  cell division inhibitor [Bacillus cereus ATC...   196    3e-48 Gene info
ref|YP_382648.1|  hypothetical protein Syncc9605_2361 [Synecho...   196    3e-48 Gene info
ref|YP_001094525.1|  hypothetical protein Shew_2400 [Shewanell...   196    3e-48 Gene info
ref|YP_913083.1|  hypothetical protein Cpha266_2675 [Chlorobiu...   195    4e-48 Gene info
ref|ZP_00513853.1|  Conserved hypothetical protein YfcH [Croco...   195    5e-48
ref|YP_001958567.1|  domain of unknown function DUF1731 [Chlor...   195    5e-48 Gene info
ref|YP_797127.1|  nucleoside-diphosphate sugar epimerase [Lept...   195    5e-48 Gene info
ref|ZP_01122632.1|  putative cell division inhibitor [Synechoc...   195    6e-48
ref|ZP_01612281.1|  putative epimerase [Alteromonadales bacter...   194    6e-48
ref|ZP_00832443.1|  COG1090: Predicted nucleoside-diphosphate ...   194    7e-48
ref|YP_640408.1|  hypothetical protein Mmcs_3245 [Mycobacteriu...   194    7e-48 Gene info
ref|YP_001761263.1|  hypothetical protein Swoo_2895 [Shewanell...   194    8e-48 Gene info
ref|YP_001134199.1|  hypothetical protein Mflv_2934 [Mycobacte...   194    8e-48 Gene info
ref|ZP_03283455.1|  hypothetical protein ENTCAN_03254 [Enterob...   194    9e-48
ref|YP_002079450.1|  conserved hypothetical protein [Mycobacte...   194    9e-48 Gene info
gb|EDX84038.1|  conserved hypothetical protein TIGR01777 [Syne...   194    1e-47
ref|YP_262221.1|  hypothetical protein PFL_5142 [Pseudomonas f...   193    1e-47 Gene info
ref|ZP_02941712.1|  domain of unknown function DUF1731 [Cyanot...   193    2e-47
ref|YP_034779.1|  epimerase, NAD dependent epimerase family pr...   193    2e-47 Gene info
ref|ZP_00237996.1|  conserved hypothetical protein protein TIG...   193    2e-47
ref|YP_737603.1|  hypothetical protein Shewmr7_1548 [Shewanell...   193    2e-47 Gene info
ref|YP_001674817.1|  hypothetical protein Shal_2602 [Shewanell...   192    2e-47 Gene info
ref|ZP_03107368.1|  cell division inhibitor-like protein [Baci...   192    3e-47
ref|ZP_02261516.1|  possible epimerase, NAD dependent epimeras...   192    3e-47
ref|YP_001051040.1|  hypothetical protein Sbal_2683 [Shewanell...   192    3e-47 Gene info
ref|YP_002311287.1|  Nucleoside-diphosphate sugar epimerase, p...   192    4e-47 Gene info
ref|NP_738344.1|  hypothetical protein CE1734 [Corynebacterium...   192    4e-47 Gene info
ref|YP_082034.1|  epimerase, NAD dependent epimerase family pr...   192    4e-47 Gene info
ref|NP_843051.1|  cell division inhibitor-like protein [Bacill...   192    4e-47 Gene info
ref|ZP_00824691.1|  COG1090: Predicted nucleoside-diphosphate ...   192    4e-47
ref|ZP_01885188.1|  hypothetical protein PBAL39_04214 [Pedobac...   192    4e-47
ref|YP_001804820.1|  putative YfcH-like cell division inhibito...   192    5e-47 Gene info
ref|ZP_02156920.1|  hypothetical protein KT99_14865 [Shewanell...   192    5e-47
ref|YP_001160136.1|  hypothetical protein Strop_3324 [Salinisp...   192    5e-47 Gene info
ref|NP_245485.1|  hypothetical protein PM0548 [Pasteurella mul...   191    5e-47 Gene info
ref|YP_954380.1|  hypothetical protein Mvan_3580 [Mycobacteriu...   191    5e-47 Gene info
ref|YP_001625580.1|  cell division inhibitor [Renibacterium sa...   191    5e-47 Gene info
ref|ZP_03165593.1|  conserved hypothetical protein [Salmonella...   191    6e-47
ref|YP_733618.1|  hypothetical protein Shewmr4_1483 [Shewanell...   191    6e-47 Gene info
ref|NP_718492.1|  hypothetical protein SO_2922 [Shewanella one...   191    6e-47 Gene info
ref|ZP_02393029.1|  cell division inhibitor-like protein [Baci...   191    6e-47
ref|YP_051136.1|  hypothetical protein ECA3046 [Pectobacterium...   191    7e-47 Gene info
ref|YP_869182.1|  hypothetical protein Shewana3_1542 [Shewanel...   191    7e-47 Gene info
ref|YP_520338.1|  hypothetical protein DSY4105 [Desulfitobacte...   191    7e-47 Gene info
ref|ZP_01084631.1|  putative cell division inhibitor [Synechoc...   191    7e-47
ref|YP_001744504.1|  NAD-binding domain-containing protein [Es...   191    8e-47 Gene info
ref|YP_001005642.1|  hypothetical protein YE1323 [Yersinia ent...   191    8e-47 Gene info
ref|YP_715329.1|  NAD dependent epimerase/dehydratase family p...   191    1e-46 Gene info
ref|YP_001555207.1|  hypothetical protein Sbal195_2780 [Shewan...   190    1e-46 Gene info
ref|YP_374020.1|  hypothetical protein Plut_0087 [Pelodictyon ...   190    1e-46 Gene info
ref|NP_895798.1|  putative cell division inhibitor [Prochloroc...   190    1e-46 Gene info
ref|YP_001366901.1|  hypothetical protein Shew185_2704 [Shewan...   190    1e-46 Gene info
ref|ZP_00821427.1|  COG1090: Predicted nucleoside-diphosphate ...   190    1e-46
ref|YP_907192.1|  hypothetical protein MUL_3576 [Mycobacterium...   190    1e-46 Gene info
ref|YP_002151511.1|  cell division inhibitor, NAD(P)-binding [...   190    2e-46 Gene info
ref|YP_002126591.1|  putative sugar nucleotide epimerase [Alte...   190    2e-46 Gene info
ref|ZP_02662432.1|  conserved hypothetical protein [Salmonella...   190    2e-46
ref|YP_001538351.1|  hypothetical protein Sare_3558 [Salinispo...   190    2e-46 Gene info
ref|YP_001716637.1|  NAD-dependent epimerase/dehydratase [Cand...   189    2e-46 Gene info
ref|ZP_01225086.1|  hypothetical protein GB2207_05529 [marine ...   189    2e-46
ref|ZP_02683601.1|  conserved hypothetical protein [Salmonella...   189    2e-46
ref|ZP_01130084.1|  hypothetical protein A20C1_01316 [marine a...   189    2e-46
ref|ZP_01173020.1|  cell-division inhibitor [Bacillus sp. NRRL...   189    2e-46
ref|YP_311240.1|  putative sugar nucleotide epimerase [Shigell...   189    2e-46 Gene info
ref|YP_001981918.1|  conserved hypothetical protein TIGR01777 ...   189    2e-46 Gene info
ref|YP_002216422.1|  hypothetical protein SeD_A2700 [Salmonell...   189    2e-46 Gene info
ref|YP_001851543.1|  hypothetical protein MMAR_3261 [Mycobacte...   189    2e-46 Gene info
ref|YP_001177569.1|  hypothetical protein Ent638_2853 [Enterob...   189    3e-46 Gene info
ref|YP_002074273.1|  conserved hypothetical protein [Vibrio sp...   189    3e-46 Gene info
ref|NP_461292.1|  putative sugar nucleotide epimerase [Salmone...   189    3e-46 Gene info
emb|CAO90584.1|  unnamed protein product [Microcystis aerugino...   189    3e-46
ref|ZP_01043476.1|  Sugar nucleotide epimerase [Idiomarina bal...   189    3e-46
ref|YP_001452075.1|  hypothetical protein CKO_00483 [Citrobact...   189    4e-46 Gene info
ref|YP_066237.1|  hypothetical protein DP2501 [Desulfotalea ps...   189    4e-46 Gene info
ref|YP_149828.1|  hypothetical protein SPA0514 [Salmonella ent...   188    4e-46 Gene info
ref|ZP_03388768.1|  conserved hypothetical protein [Propioniba...   188    5e-46
gb|ABV27423.1|  conserved hypothetical protein [Candidatus Chl...   188    6e-46
ref|YP_662473.1|  hypothetical protein Patl_2911 [Pseudoaltero...   188    6e-46 Gene info
ref|YP_002195918.1|  NAD dependent epimerase/dehydratase famil...   188    7e-46 Gene info
ref|ZP_03220324.1|  conserved hypothetical protein [Salmonella...   187    8e-46
ref|ZP_02255192.1|  cell division inhibitor-like protein [Baci...   187    8e-46
ref|NP_708186.1|  putative sugar nucleotide epimerase [Shigell...   187    8e-46 Gene info
ref|NP_456892.1|  hypothetical protein STY2580 [Salmonella ent...   187    9e-46 Gene info
ref|ZP_02829914.1|  conserved hypothetical protein [Salmonella...   187    9e-46
ref|YP_958414.1|  NAD-dependent epimerase/dehydratase [Marinob...   187    1e-45 Gene info
ref|ZP_02134149.1|  domain of unknown function DUF1731 [Desulf...   187    1e-45
ref|ZP_03065166.1|  NAD-binding domain 4 protein [Shigella dys...   187    1e-45
ref|YP_001018621.1|  putative cell division inhibitor [Prochlo...   187    1e-45 Gene info
ref|NP_416807.1|  conserved protein with NAD(P)-binding Rossma...   187    1e-45 Gene info
ref|YP_001205284.1|  hypothetical protein BRADO3255 [Bradyrhiz...   187    1e-45 Gene info
ref|YP_751239.1|  hypothetical protein Sfri_2559 [Shewanella f...   187    1e-45 Gene info
ref|ZP_01066695.1|  putative sugar nucleotide epimerase [Vibri...   187    1e-45
ref|ZP_01260876.1|  putative sugar nucleotide epimerase [Vibri...   186    2e-45
ref|ZP_01792700.1|  arginine repressor [Haemophilus influenzae...   186    2e-45
ref|YP_001501522.1|  hypothetical protein Spea_1663 [Shewanell...   186    2e-45 Gene info
ref|ZP_03001638.1|  NAD dependent epimerase/dehydratase family...   186    2e-45
ref|YP_055002.1|  putative cell division inhibitor [Propioniba...   186    2e-45 Gene info
ref|ZP_03191852.1|  putative NAD dependent epimerase/dehydrata...   186    2e-45
ref|YP_001341076.1|  hypothetical protein Mmwyl1_2219 [Marinom...   186    2e-45 Gene info
ref|NP_976897.1|  cell division inhibitor-like protein [Bacill...   186    2e-45 Gene info
ref|ZP_03315513.1|  hypothetical protein PROVRUST_02326 [Provi...   186    3e-45
ref|YP_001907124.1|  Putative sugar nucleotide epimerase [Erwi...   186    3e-45 Gene info
ref|YP_001281265.1|  hypothetical protein PsycPRwf_2375 [Psych...   186    3e-45 Gene info
ref|NP_288878.1|  putative sugar nucleotide epimerase [Escheri...   186    3e-45 Gene info
ref|ZP_01978885.1|  rcp protein [Vibrio cholerae MZO-2] >gb|ED...   186    3e-45
ref|YP_001840049.1|  putative NAD dependent epimerase [Leptosp...   186    3e-45 Gene info
ref|YP_273286.1|  hypothetical protein PSPPH_1015 [Pseudomonas...   186    3e-45 Gene info
ref|YP_001569617.1|  hypothetical protein SARI_00549 [Salmonel...   186    3e-45 Gene info
ref|ZP_01950838.1|  rcp protein [Vibrio cholerae 1587] >ref|ZP...   185    4e-45
ref|ZP_01677130.1|  rcp protein [Vibrio cholerae 2740-80] >ref...   185    4e-45
ref|ZP_02957647.1|  rcp protein [Vibrio cholerae MZO-3] >gb|ED...   185    4e-45
ref|NP_771901.1|  hypothetical protein bll5261 [Bradyrhizobium...   185    4e-45 Gene info
ref|ZP_03320387.1|  hypothetical protein PROVALCAL_03345 [Prov...   185    5e-45
ref|NP_778474.1|  cell division inhibitor [Xylella fastidiosa ...   185    5e-45 Gene info
ref|YP_001459110.1|  NAD-binding domain-containing protein [Es...   185    5e-45 Gene info
ref|ZP_01372371.1|  conserved hypothetical protein [Desulfitob...   185    6e-45
ref|YP_261203.1|  hypothetical protein PFL_4106 [Pseudomonas f...   185    6e-45 Gene info
ref|YP_541586.1|  putative sugar nucleotide epimerase [Escheri...   184    6e-45 Gene info
ref|YP_001463648.1|  NAD-binding domain-containing protein [Es...   184    7e-45 Gene info
ref|YP_408730.1|  putative sugar nucleotide epimerase [Shigell...   184    8e-45 Gene info
ref|ZP_00651992.1|  Conserved hypothetical protein YfcH [Xylel...   184    8e-45
ref|YP_670238.1|  hypothetical protein ECP_2343 [Escherichia c...   184    9e-45 Gene info
ref|YP_350459.1|  hypothetical protein Pfl01_4731 [Pseudomonas...   184    9e-45 Gene info
ref|ZP_01102820.1|  conserved hypothetical protein [gamma prot...   184    1e-44
ref|NP_297579.1|  cell division inhibitor [Xylella fastidiosa ...   184    1e-44 Gene info
ref|ZP_00679976.1|  Conserved hypothetical protein YfcH [Xylel...   184    1e-44
ref|YP_001344903.1|  hypothetical protein Asuc_1614 [Actinobac...   184    1e-44 Gene info
ref|YP_001881125.1|  NAD dependent epimerase/dehydratase famil...   184    1e-44 Gene info
ref|ZP_01547146.1|  hypothetical protein SIAM614_04855 [Stappi...   184    1e-44
ref|YP_001129686.1|  hypothetical protein Cvib_0161 [Prostheco...   184    1e-44 Gene info
ref|ZP_01076144.1|  hypothetical protein MED121_08658 [Marinom...   183    1e-44
ref|YP_404062.1|  putative sugar nucleotide epimerase [Shigell...   183    1e-44 Gene info
ref|NP_754733.1|  hypothetical protein c2847 [Escherichia coli...   183    2e-44 Gene info
gb|EAZ49591.1|  rcp protein [Vibrio cholerae V51]                   183    2e-44
ref|ZP_00992540.1|  putative sugar nucleotide epimerase [Vibri...   182    2e-44
ref|YP_234060.1|  hypothetical protein Psyr_0966 [Pseudomonas ...   182    3e-44 Gene info
ref|YP_174802.1|  cell-division inhibitor [Bacillus clausii KS...   182    3e-44 Gene info
ref|ZP_02945431.1|  domain of unknown function DUF1731 [Microc...   182    3e-44
ref|YP_640477.1|  hypothetical protein Mmcs_3314 [Mycobacteriu...   182    4e-44 Gene info
ref|ZP_01471171.1|  putative cell division inhibitor [Synechoc...   181    5e-44
ref|YP_001942176.1|  domain of unknown function DUF1731 [Chlor...   181    7e-44 Gene info
ref|ZP_01134550.1|  putative epimerase [Pseudoalteromonas tuni...   181    9e-44
ref|ZP_00203135.1|  COG1090: Predicted nucleoside-diphosphate ...   181    9e-44
ref|ZP_01159278.1|  hypothetical sugar nucleotide epimerase [P...   181    1e-43
ref|YP_001103881.1|  NAD dependent epimerase/dehydratase famil...   181    1e-43 Gene info
ref|ZP_01081047.1|  hypothetical protein RS9917_07285 [Synecho...   181    1e-43
ref|YP_435888.1|  nucleoside-diphosphate sugar epimerase [Hahe...   180    1e-43 Gene info
ref|YP_351299.1|  hypothetical protein Pfl01_5571 [Pseudomonas...   180    1e-43 Gene info
ref|YP_001124584.1|  cell division inhibitor-like protein [Geo...   180    1e-43 Gene info
ref|ZP_03395356.1|  conserved hypothetical protein TIGR01777 [...   180    2e-43
ref|NP_790961.1|  hypothetical protein PSPTO_1127 [Pseudomonas...   180    2e-43 Gene info
ref|YP_581722.1|  hypothetical protein Pcryo_2461 [Psychrobact...   180    2e-43 Gene info
ref|YP_719269.1|  hypothetical protein HS_1057 [Haemophilus so...   180    2e-43 Gene info
ref|YP_002017057.1|  domain of unknown function DUF1731 [Pelod...   179    2e-43 Gene info
ref|NP_939689.1|  hypothetical protein DIP1336 [Corynebacteriu...   179    2e-43 Gene info
ref|YP_001473438.1|  hypothetical protein Ssed_1699 [Shewanell...   179    2e-43 Gene info
ref|NP_064580.2|  hypothetical protein LOC56948 [Homo sapiens]      179    2e-43 UniGene infoGene info
ref|ZP_01794877.1|  arginine repressor [Haemophilus influenzae...   179    2e-43
ref|ZP_01892778.1|  hypothetical protein MDG893_08105 [Marinob...   179    3e-43
ref|YP_001336341.1|  putative cell division inhibitor, NAD(P)-...   179    3e-43 Gene info
ref|ZP_01235164.1|  hypothetical sugar nucleotide epimerase [V...   179    4e-43
ref|ZP_02901758.1|  NAD-binding domain 4 protein [Escherichia ...   179    4e-43
ref|ZP_01450250.1|  putative sugar nucleotide epimerase [alpha...   179    4e-43
ref|YP_146304.1|  cell-division inhibitor [Geobacillus kaustop...   179    4e-43 Gene info
ref|NP_661037.1|  hypothetical protein CT0131 [Chlorobium tepi...   178    4e-43 Gene info
ref|YP_001813145.1|  hypothetical protein Exig_0647 [Exiguobac...   178    5e-43 Gene info
ref|YP_001652307.1|  hypothetical protein APJL_1307 [Actinobac...   178    7e-43 Gene info
ref|YP_389490.1|  hypothetical protein Dde_3001 [Desulfovibrio...   178    7e-43 Gene info
ref|NP_933783.1|  nucleoside-diphosphate sugar epimerase [Vibr...   178    7e-43 Gene info
ref|ZP_02991247.1|  protein of unknown function DUF1731 [Exigu...   177    8e-43
ref|ZP_01787031.1|  amidophosphoribosyltransferase [Haemophilu...   177    8e-43
ref|NP_759209.1|  nucleoside-diphosphate sugar epimerase [Vibr...   177    8e-43 Gene info
gb|AAH00989.1|  Chromosome 14 open reading frame 124 [Homo sap...   177    9e-43 Gene info
gb|EDM14291.1|  similar to HCDI protein (predicted), isoform C...   177    1e-42 Gene info
ref|YP_001363008.1|  hypothetical protein Krad_3280 [Kineococc...   177    1e-42 Gene info
ref|YP_378326.1|  hypothetical protein Cag_0004 [Chlorobium ch...   177    1e-42 Gene info
ref|YP_391052.1|  hypothetical protein Tcr_0782 [Thiomicrospir...   176    2e-42 Gene info
ref|YP_001293110.1|  amidophosphoribosyltransferase [Haemophil...   176    2e-42 Gene info
emb|CAO47253.1|  unnamed protein product [Vitis vinifera]           176    2e-42
ref|ZP_01790763.1|  amidophosphoribosyltransferase [Haemophilu...   176    2e-42
ref|YP_001969139.1|  hypothetical protein APP7_1345 [Actinobac...   176    3e-42 Gene info
ref|YP_001053985.1|  hypothetical protein APL_1294 [Actinobaci...   176    3e-42 Gene info
ref|ZP_01058915.1|  hypothetical protein MED217_14430 [Flavoba...   176    3e-42
ref|NP_905219.1|  hypothetical protein PG0996 [Porphyromonas g...   176    3e-42 Gene info
ref|YP_117899.1|  putative epimerase [Nocardia farcinica IFM 1...   176    3e-42 Gene info
ref|ZP_01718441.1|  hypothetical protein ALPR1_01005 [Algoriph...   176    3e-42
ref|YP_857960.1|  hypothetical protein AHA_3486 [Aeromonas hyd...   176    3e-42 Gene info
ref|ZP_02839583.1|  domain of unknown function DUF1731 [Arthro...   176    3e-42
ref|YP_002095731.1|  hypothetical protein BCPG_04588 [Burkhold...   176    3e-42 Gene info
ref|ZP_01521927.1|  conserved hypothetical protein [Comamonas ...   176    4e-42
ref|NP_465219.1|  hypothetical protein lmo1694 [Listeria monoc...   175    4e-42 Gene info
ref|YP_370962.1|  hypothetical protein Bcep18194_B0202 [Burkho...   175    4e-42 Gene info
ref|YP_002237306.1|  NAD dependent epimerase/dehydratase famil...   175    5e-42 Gene info
ref|YP_831101.1|  hypothetical protein Arth_1607 [Arthrobacter...   175    6e-42 Gene info
ref|NP_001048641.1|  Os02g0834700 [Oryza sativa (japonica cult...   175    6e-42 UniGene infoGene info
ref|YP_394360.1|  hypothetical protein Suden_1851 [Sulfurimona...   175    6e-42 Gene info
ref|YP_271354.1|  hypothetical protein CPS_4710 [Colwellia psy...   174    8e-42 Gene info
ref|YP_090503.1|  YfhF [Bacillus licheniformis ATCC 14580] >gb...   174    8e-42 Gene info
ref|ZP_01870628.1|  putative sugar nucleotide epimerase [Vibri...   174    9e-42
ref|YP_078100.1|  hypothetical protein BL03055 [Bacillus liche...   174    9e-42 Gene info
ref|ZP_01054202.1|  hypothetical protein MED152_12974 [Tenacib...   174    1e-41
ref|YP_793118.1|  hypothetical protein PA14_61590 [Pseudomonas...   174    1e-41 Gene info
ref|YP_625258.1|  hypothetical protein Bcen_5412 [Burkholderia...   174    1e-41 Gene info
ref|YP_014314.1|  hypothetical protein LMOf2365_1718 [Listeria...   174    1e-41 Gene info
ref|NP_565505.1|  GC1 (GIANT CHLOROPLAST 1); binding / catalyt...   174    1e-41 UniGene infoGene info
ref|YP_001380863.1|  hypothetical protein Anae109_3700 [Anaero...   174    1e-41 Gene info
ref|YP_002084616.1|  conserved hypothetical protein [Pseudomon...   174    1e-41 Gene info
ref|YP_002090464.1|  conserved hypothetical protein [Pseudomon...   174    1e-41 Gene info
gb|AAT51057.1|  PA4656 [synthetic construct]                        174    1e-41
ref|NP_253345.1|  hypothetical protein PA4656 [Pseudomonas aer...   174    1e-41 Gene info
ref|ZP_02926596.1|  hypothetical protein VspiD_08120 [Verrucom...   174    1e-41
ref|NP_439364.1|  hypothetical protein HI1208 [Haemophilus inf...   173    1e-41 GeoGene info
ref|ZP_01386538.1|  conserved hypothetical protein [Chlorobium...   173    1e-41
ref|YP_001437020.1|  hypothetical protein ESA_00914 [Enterobac...   173    2e-41 Gene info
ref|YP_731762.1|  hypothetical protein sync_2573 [Synechococcu...   173    2e-41 Gene info
ref|YP_001997714.1|  domain of unknown function DUF1731 [Chlor...   173    2e-41 Gene info
gb|EAW66009.1|  chromosome 14 open reading frame 124, isoform ...   172    3e-41 Gene info
ref|YP_001679889.1|  NAD dependent epimerase/dehydratase famil...   172    3e-41 Gene info
ref|YP_001266119.1|  NAD-dependent epimerase/dehydratase [Pseu...   172    3e-41 Gene info
ref|NP_001101848.1|  hypothetical protein LOC361044 [Rattus no...   172    3e-41 UniGene infoGene info
gb|EAW66011.1|  chromosome 14 open reading frame 124, isoform ...   172    3e-41 Gene info
ref|YP_001929076.1|  hypothetical protein PGN_0960 [Porphyromo...   172    4e-41 Gene info
gb|AAZ80902.1|  hypothetical protein [Leptospira interrogans]       172    4e-41
ref|XP_001926763.1|  PREDICTED: similar to CG8768 CG8768-PA [S...   172    5e-41 UniGene infoGene info
ref|YP_002235246.1|  NAD dependent epimerase/dehydratase famil...   172    5e-41 Gene info
ref|ZP_02163536.1|  possible sugar nucleotide epimerase [Kordi...   172    5e-41
ref|YP_088460.1|  hypothetical protein MS1268 [Mannheimia succ...   171    6e-41 Gene info
ref|NP_001069280.1|  hypothetical protein LOC520897 [Bos tauru...   171    7e-41 UniGene infoGene info
ref|YP_887399.1|  nucleoside-diphosphate sugar epimerase [Myco...   171    8e-41 Gene info
ref|XP_001766815.1|  predicted protein [Physcomitrella patens ...   171    8e-41 UniGene infoGene info
ref|YP_114661.1|  hypothetical protein MCA2243 [Methylococcus ...   171    1e-40 Gene info
ref|NP_471138.1|  hypothetical protein lin1802 [Listeria innoc...   171    1e-40 Gene info
ref|YP_001635801.1|  hypothetical protein Caur_2203 [Chlorofle...   171    1e-40 Gene info
ref|YP_676788.1|  sugar nucleotide epimerase [Cytophaga hutchi...   170    1e-40 Gene info
ref|XP_001114218.1|  PREDICTED: similar to CG8768-PA [Macaca m...   170    1e-40 UniGene infoGene info
ref|ZP_02985527.1|  NAD-dependent epimerase/dehydratase [Chlor...   170    1e-40
ref|NP_714059.1|  hypothetical protein LA3879 [Leptospira inte...   170    1e-40 Gene info
ref|ZP_01991051.1|  conserved hypothetical protein [Vibrio par...   170    2e-40
ref|YP_629153.1|  NAD dependent epimerase/dehydratase family p...   170    2e-40 Gene info
ref|ZP_03225444.1|  nucleoside diphosphate sugar epimerase [Ba...   170    2e-40
ref|ZP_01617784.1|  hypothetical protein GP2143_09235 [marine ...   170    2e-40
ref|YP_849909.1|  hypothetical protein lwe1712 [Listeria welsh...   170    2e-40 Gene info
ref|NP_001076444.1|  hypothetical protein LOC654795 [Mus muscu...   169    2e-40 UniGene infoGene info
ref|ZP_01117894.1|  hypothetical protein PI23P_07255 [Polariba...   169    3e-40
sp|Q5M8N4.1|CN124_MOUSE  RecName: Full=UPF0105 protein C14orf1...   169    3e-40 Gene info
ref|YP_001140728.1|  putative nucleoside-diphosphate sugar epi...   169    3e-40 Gene info
ref|XP_850648.1|  PREDICTED: similar to CG8768-PA [Canis famil...   169    3e-40 UniGene infoGene info
ref|YP_572529.1|  hypothetical protein Csal_0468 [Chromohaloba...   169    4e-40 Gene info
ref|YP_455290.1|  putative sugar nucleotide epimerase [Sodalis...   169    4e-40 Gene info
ref|ZP_01051456.1|  hypothetical protein MED134_13391 [Cellulo...   168    4e-40
ref|YP_002135986.1|  domain of unknown function DUF1731 [Anaer...   168    6e-40 Gene info
ref|YP_001444524.1|  hypothetical protein VIBHAR_01320 [Vibrio...   168    6e-40 Gene info
ref|XP_001702195.1|  hypothetical protein CHLREDRAFT_122924 [C...   168    6e-40 UniGene infoGene info
dbj|BAE43214.1|  unnamed protein product [Mus musculus]             168    6e-40 Gene info
ref|YP_001489418.1|  hypothetical protein Abu_0474 [Arcobacter...   168    6e-40 Gene info
ref|ZP_02196459.1|  phosphodiesterase [Vibrio campbellii AND4]...   168    7e-40
ref|ZP_01986766.1|  conserved hypothetical protein [Vibrio har...   168    7e-40
ref|NP_797188.1|  putative sugar nucleotide epimerase [Vibrio ...   168    7e-40 Gene info
ref|YP_001751295.1|  NAD-dependent epimerase/dehydratase [Pseu...   168    7e-40 Gene info
ref|YP_001240824.1|  hypothetical protein BBta_4896 [Bradyrhiz...   167    2e-39 Gene info
ref|YP_001784861.1|  hypothetical protein HSM_1541 [Haemophilu...   167    2e-39 Gene info
ref|YP_118462.1|  putative epimerase [Nocardia farcinica IFM 1...   166    2e-39 Gene info
ref|YP_594459.1|  nucleoside-diphosphate sugar epimerase [Laws...   166    2e-39 Gene info
ref|XP_001951051.1|  PREDICTED: similar to At2g21280, partial ...   166    2e-39 UniGene infoGene info
gb|EDX88218.1|  conserved hypothetical protein TIGR01777 [Alca...   166    2e-39
ref|YP_001529348.1|  NAD-dependent epimerase/dehydratase [Desu...   166    2e-39 Gene info
ref|NP_969046.1|  cell division inhibitor SULA [Bdellovibrio b...   166    2e-39 Gene info
ref|YP_365798.1|  hypothetical protein XCV4067 [Xanthomonas ca...   166    4e-39 Gene info
ref|YP_130987.1|  sugar nucleotide epimerase [Photobacterium p...   165    4e-39 Gene info
ref|NP_639230.1|  cell division inhibitor [Xanthomonas campest...   165    6e-39 Gene info
ref|YP_606607.1|  hypothetical protein PSEEN0885 [Pseudomonas ...   164    1e-38 Gene info
ref|XP_001369678.1|  PREDICTED: hypothetical protein [Monodelp...   163    2e-38 UniGene infoGene info
ref|ZP_01721759.1|  possible epimerase, NAD dependent epimeras...   163    2e-38
ref|YP_001350637.1|  hypothetical protein PSPA7_5305 [Pseudomo...   163    2e-38 Gene info
ref|ZP_02245080.1|  cell division inhibitor [Xanthomonas oryza...   163    2e-38
ref|YP_001696066.1|  hypothetical protein Bsph_0307 [Lysinibac...   163    2e-38 Gene info
ref|NP_001016261.1|  hypothetical protein LOC549015 [Xenopus t...   163    2e-38 UniGene infoGene info
ref|NP_388732.1|  hypothetical protein BSU08510 [Bacillus subt...   163    2e-38 Gene info
ref|YP_947510.1|  putative NAD dependent epimerase/dehydratase...   162    2e-38 Gene info
ref|YP_585986.1|  hypothetical protein Rmet_3849 [Ralstonia me...   162    5e-38 Gene info
ref|ZP_01625464.1|  cell division inhibitor [marine gamma prot...   162    5e-38
ref|NP_872855.1|  hypothetical protein HD0261 [Haemophilus duc...   161    6e-38 Gene info
ref|XP_001807381.1|  PREDICTED: similar to CG8768 CG8768-PA [T...   161    6e-38 UniGene infoGene info
ref|ZP_03132560.1|  protein of unknown function DUF1731 [Chtho...   161    8e-38
ref|YP_001295592.1|  nucleoside-diphosphate sugar epimerase [F...   160    1e-37 Gene info
ref|YP_001616720.1|  putative sugar nucleotide epimerase [Sora...   160    2e-37 Gene info
sp|Q9NRG7.1|CN124_HUMAN  RecName: Full=UPF0105 protein C14orf1...   160    2e-37 Gene info
ref|XP_001488775.2|  PREDICTED: similar to UPF0105 protein C14...   159    2e-37 UniGene infoGene info
ref|XP_001601508.1|  PREDICTED: similar to ENSANGP00000001519 ...   159    2e-37 Gene info
ref|XP_395737.2|  PREDICTED: similar to CG8768-PA [Apis mellif...   159    3e-37 UniGene infoGene info
ref|ZP_01859746.1|  possible epimerase, NAD dependent epimeras...   159    3e-37
ref|ZP_02850176.1|  domain of unknown function DUF1731 [Paenib...   159    3e-37
ref|YP_466782.1|  hypothetical protein Adeh_3579 [Anaeromyxoba...   159    4e-37 Gene info
ref|XP_001418003.1|  predicted protein [Ostreococcus lucimarin...   159    4e-37 Gene info
ref|XP_002127876.1|  PREDICTED: similar to CG8768 CG8768-PA [C...   159    4e-37 UniGene infoGene info
ref|ZP_00231537.1|  conserved hypothetical protein [Listeria m...   159    4e-37
ref|YP_002172020.1|  possible nucleoside-diphosphate sugar epi...   158    7e-37 Gene info
ref|YP_198695.1|  cell division inhibitor [Xanthomonas oryzae ...   157    1e-36 Gene info
ref|YP_001186575.1|  NAD-dependent epimerase/dehydratase [Pseu...   157    1e-36 Gene info
ref|XP_641432.2|  NAD-dependent epimerase/dehydratase family p...   157    2e-36 UniGene infoGene info
ref|YP_001172483.1|  nucleoside-diphosphate sugar epimerase [P...   156    2e-36 Gene info
ref|NP_691813.1|  cell-division inhibitor [Oceanobacillus ihey...   155    4e-36 Gene info
ref|ZP_03041811.1|  domain of unknown function DUF1731 [Geobac...   155    4e-36
ref|ZP_03056528.1|  conserved hypothetical protein [Bacillus p...   155    4e-36
ref|ZP_01732770.1|  possible sugar nucleotide epimerase [Flavo...   155    5e-36
ref|YP_001486038.1|  nucleoside diphosphate sugar epimerase [B...   155    6e-36 Gene info
ref|ZP_01128919.1|  hypothetical protein NB231_13776 [Nitrococ...   154    8e-36
ref|ZP_01900532.1|  Sugar nucleotide epimerase [Moritella sp. ...   154    8e-36
ref|YP_001001779.1|  NAD-dependent epimerase/dehydratase [Halo...   154    9e-36 Gene info
ref|YP_302011.1|  putative nucleoside-diphosphate sugar epimer...   154    9e-36 Gene info
ref|ZP_01121623.1|  possible epimerase, NAD dependent epimeras...   154    1e-35
ref|XP_001637995.1|  predicted protein [Nematostella vectensis...   154    1e-35 UniGene infoGene info
ref|ZP_01516576.1|  conserved hypothetical protein [Chloroflex...   154    1e-35
ref|ZP_02182206.1|  possible sugar nucleotide epimerase [Flavo...   154    1e-35
ref|ZP_02323081.1|  domain of unknown function DUF1731 [Anaero...   153    2e-35
emb|CAL54005.1|  U4/U6-associated splicing factor PRP4 (ISS) [...   153    2e-35
ref|ZP_02478748.1|  3-deoxy-manno-octulosonate cytidylyltransf...   152    3e-35
ref|YP_045639.1|  hypothetical protein ACIAD0921 [Acinetobacte...   152    3e-35 Gene info
ref|NP_742904.1|  NAD-dependent epimerase/dehydratase [Pseudom...   152    4e-35 Gene info
ref|ZP_01252161.1|  possible epimerase, NAD dependent epimeras...   150    1e-34
ref|YP_001845514.1|  nucleoside-diphosphate sugar epimerase [A...   150    2e-34 Gene info
ref|ZP_01889678.1|  possible sugar nucleotide epimerase [unide...   150    2e-34
ref|YP_001707758.1|  hypothetical protein ABSDF2527 [Acinetoba...   149    2e-34 Gene info
gb|ABO11336.2|  putative nucleoside-diphosphate sugar epimeras...   149    2e-34
gb|EEB14736.1|  conserved hypothetical protein [Pediculus huma...   149    2e-34
ref|YP_001667030.1|  NAD-dependent epimerase/dehydratase [Pseu...   149    3e-34 Gene info
ref|ZP_01220820.1|  hypothetical sugar nucleotide epimerase [P...   149    3e-34
ref|YP_254034.1|  hypothetical protein SH2119 [Staphylococcus ...   149    4e-34 Gene info
ref|NP_906361.1|  hypothetical protein WS0093 [Wolinella succi...   148    6e-34 Gene info
ref|YP_847323.1|  NAD-dependent epimerase/dehydratase [Syntrop...   148    6e-34 Gene info
ref|NP_764108.1|  cell-division inhibitor [Staphylococcus epid...   148    7e-34 Gene info
ref|ZP_01170686.1|  cell division inhibitor [Bacillus sp. NRRL...   147    9e-34
ref|YP_040251.1|  hypothetical protein SAR0825 [Staphylococcus...   147    1e-33 Gene info
ref|YP_001714708.1|  hypothetical protein ABAYE2911 [Acinetoba...   147    1e-33 Gene info
ref|NP_644273.1|  cell division inhibitor [Xanthomonas axonopo...   146    2e-33 Gene info
ref|YP_001420473.1|  YfhF [Bacillus amyloliquefaciens FZB42] >...   146    2e-33 Gene info
ref|NP_371293.1|  hypothetical protein SAV0769 [Staphylococcus...   146    3e-33 Gene info
ref|ZP_00951630.1|  possible epimerase, NAD dependent epimeras...   146    3e-33
ref|YP_416217.1|  hypothetical protein SAB0724c [Staphylococcu...   145    3e-33 Gene info
ref|NP_645548.1|  hypothetical protein MW0731 [Staphylococcus ...   145    4e-33 Gene info
ref|XP_001662979.1|  hypothetical protein AaeL_AAEL003019 [Aed...   145    5e-33 UniGene infoGene info
ref|XP_001987453.1|  GH19955 [Drosophila grimshawi] >gb|EDW023...   145    5e-33 Gene info
ref|ZP_00416101.1|  Conserved hypothetical protein, YfcH [Azot...   145    6e-33
ref|YP_786600.1|  hypothetical protein BAV2083 [Bordetella avi...   144    8e-33 Gene info
ref|YP_096226.1|  nucleoside-diphosphate sugar epimerase [Legi...   144    1e-32 Gene info
ref|YP_001192421.1|  hypothetical protein Fjoh_0064 [Flavobact...   144    1e-32 Gene info
ref|YP_185708.1|  hypothetical protein SACOL0834 [Staphylococc...   144    1e-32 Gene info
ref|YP_127474.1|  hypothetical protein lpl2139 [Legionella pne...   143    2e-32 Gene info
gb|EDZ63745.1|  conserved hypothetical protein TIGR01777 [Camp...   143    2e-32
ref|YP_124477.1|  hypothetical protein lpp2165 [Legionella pne...   143    2e-32 Gene info
ref|YP_860552.1|  NAD(P)-binding protein [Gramella forsetii KT...   142    3e-32 Gene info
ref|YP_001303526.1|  hypothetical protein BDI_2173 [Parabacter...   142    4e-32 Gene info
ref|YP_001250962.1|  nucleoside-diphosphate sugar epimerase [L...   142    4e-32 Gene info
gb|EEA62690.1|  hypothetical protein BRAFLDRAFT_157294 [Branch...   140    1e-31
ref|ZP_03337350.1|  hypothetical protein Salmonelentericaenter...   140    2e-31
ref|ZP_02161302.1|  cell-division inhibitor [Kordia algicida O...   140    2e-31
ref|YP_002167899.1|  conserved hypothetical protein [Francisel...   140    2e-31 Gene info
ref|YP_001121273.1|  hypothetical protein FTW_0174 [Francisell...   139    3e-31 Gene info
ref|YP_001098654.1|  putative nucleoside-diphosphate sugar epi...   139    3e-31 Gene info
gb|AAX77827.1|  unknown protein [synthetic construct]               139    3e-31
ref|YP_899231.1|  hypothetical protein FTN_1618 [Francisella t...   139    3e-31 Gene info
ref|YP_169165.1|  hypothetical protein FTT0093 [Francisella tu...   139    3e-31 Gene info
ref|YP_923494.1|  NAD-dependent epimerase/dehydratase [Nocardi...   139    3e-31 Gene info
ref|ZP_01115322.1|  hypothetical protein MED297_14245 [Reineke...   139    3e-31
ref|YP_100376.1|  putative sugar nucleotide epimerase [Bactero...   139    4e-31 Gene info
ref|YP_212549.1|  hypothetical protein BF2935 [Bacteroides fra...   139    4e-31 Gene info
ref|ZP_01844348.1|  domain of unknown function DUF1731 [Shewan...   139    4e-31
ref|YP_002169512.1|  NAD dependent epimerase/dehydratase famil...   138    6e-31 Gene info
ref|XP_001869568.1|  conserved hypothetical protein [Culex qui...   137    9e-31 UniGene infoGene info
ref|ZP_02068279.1|  hypothetical protein BACOVA_05294 [Bactero...   137    1e-30
ref|XP_002059871.1|  GJ15081 [Drosophila virilis] >gb|EDW57208...   137    2e-30 Gene info
ref|ZP_02912251.1|  NAD-dependent epimerase/dehydratase [Geoba...   137    2e-30
ref|YP_002166297.1|  conserved hypothetical protein [Francisel...   135    3e-30 Gene info
ref|XP_002004405.1|  GI19914 [Drosophila mojavensis] >gb|EDW08...   135    4e-30 Gene info
ref|NP_001040495.1|  C14orf124 protein [Bombyx mori] >gb|ABF51...   135    5e-30 UniGene infoGene info
ref|YP_001677726.1|  hypothetical protein Fphi_1002 [Francisel...   135    5e-30 Gene info
ref|NP_813404.1|  putative sugar nucleotide epimerase [Bactero...   135    5e-30 Gene info
gb|EDM14292.1|  similar to HCDI protein (predicted), isoform C...   135    6e-30 Gene info
ref|NP_244757.1|  cell-division inhibitor [Bacillus halodurans...   134    7e-30 Gene info
ref|ZP_01107944.1|  Cell division inhibitor [Flavobacteriales ...   134    9e-30
ref|YP_000814.1|  cell division inhibitor [Leptospira interrog...   133    2e-29 Gene info
ref|ZP_01962246.1|  hypothetical protein BACCAC_03896 [Bactero...   133    2e-29
ref|YP_001891027.1|  NAD dependent epimerase/dehydratase famil...   133    2e-29 Gene info
ref|XP_001975865.1|  GG22555 [Drosophila erecta] >gb|EDV56265....   133    2e-29 Gene info
ref|ZP_01050733.1|  cell-division inhibitor [Cellulophaga sp. ...   133    2e-29
ref|NP_713494.1|  cell-division inhibitor [Leptospira interrog...   133    3e-29 Gene info
ref|XP_002081239.1|  GD25817 [Drosophila simulans] >gb|EDX0682...   132    4e-29 Gene info
ref|YP_514394.1|  hypothetical protein FTL_1763 [Francisella t...   132    4e-29 Gene info
ref|NP_001133136.1|  myomesin 2-like [Salmo salar] >gb|ACH7075...   132    4e-29 Gene info
ref|YP_001083938.1|  nucleoside-diphosphate sugar epimerase [A...   132    4e-29 Gene info
ref|XP_002033605.1|  GM20339 [Drosophila sechellia] >gb|EDW476...   132    5e-29 Gene info
ref|NP_111024.1|  nucleoside-diphosphate sugar epimerase [Ther...   132    6e-29 Gene info
dbj|BAB59647.1|  hypothetical protein [Thermoplasma volcanium ...   131    7e-29 Gene info
ref|XP_002091006.1|  GE13425 [Drosophila yakuba] >gb|EDW90718....   131    1e-28 Gene info
ref|ZP_01200864.1|  yfcH-like protein, NAD dependent epimerase...   131    1e-28
ref|XP_002063000.1|  GK21688 [Drosophila willistoni] >gb|EDW73...   130    1e-28 Gene info
ref|NP_610813.3|  CG8768 CG8768-PA [Drosophila melanogaster] >...   129    3e-28 UniGene infoGene info
ref|ZP_01860434.1|  cell-division inhibitor [Bacillus sp. SG-1...   129    4e-28
ref|XP_002138643.1|  GA24893 [Drosophila pseudoobscura pseudoo...   128    7e-28 Gene info
ref|XP_002018487.1|  GL17730 [Drosophila persimilis] >gb|EDW36...   128    8e-28 Gene info
ref|XP_311172.3|  AGAP000649-PA [Anopheles gambiae str. PEST] ...   127    9e-28 UniGene infoGene info
ref|ZP_01890452.1|  cell-division inhibitor [unidentified euba...   125    4e-27
ref|YP_001801279.1|  hypothetical protein cur_1886 [Corynebact...   124    8e-27 Gene info
gb|EEA62687.1|  hypothetical protein BRAFLDRAFT_221880 [Branch...   124    1e-26
ref|ZP_01690754.1|  conserved hypothetical protein [Microscill...   124    1e-26
ref|ZP_01733299.1|  cell-division inhibitor [Flavobacteria bac...   124    2e-26
ref|YP_002070349.1|  cell division inhibitor [Vibrio cholerae ...   123    2e-26 Gene info
ref|ZP_03129200.1|  NAD-dependent epimerase/dehydratase [Chtho...   122    5e-26
ref|ZP_00204474.1|  COG1090: Predicted nucleoside-diphosphate ...   122    6e-26
ref|ZP_01881914.1|  cell-division inhibitor [Pedobacter sp. BA...   122    6e-26
ref|NP_001070046.1|  hypothetical protein LOC767637 [Danio rer...   121    8e-26 UniGene infoGene info
ref|ZP_01856515.1|  cell-division inhibitor [Planctomyces mari...   121    1e-25
ref|XP_001945917.1|  PREDICTED: similar to predicted protein [...   120    2e-25 UniGene infoGene info
ref|NP_394729.1|  hypothetical protein Ta1272 [Thermoplasma ac...   119    3e-25 Gene info
ref|ZP_01290332.1|  conserved hypothetical protein [delta prot...   119    3e-25
ref|YP_001877782.1|  domain of unknown function DUF1731 [Akker...   119    4e-25 Gene info
ref|ZP_02931383.1|  cell division inhibitor [Verrucomicrobium ...   119    4e-25
ref|XP_001918603.1|  PREDICTED: hypothetical protein [Danio re...   119    4e-25 UniGene infoGene info
ref|XP_001959896.1|  GF13097 [Drosophila ananassae] >gb|EDV367...   118    5e-25 Gene info
gb|EEA99875.1|  hypothetical protein TGME49_046080 [Toxoplasma...   118    7e-25
emb|CAD61875.1|  unnamed protein product [Homo sapiens]             118    7e-25 Gene info
ref|ZP_03384796.1|  hypothetical protein SentesT_22190 [Salmon...   118    8e-25
ref|ZP_03350251.1|  hypothetical protein Salmonentericaenteric...   117    1e-24
ref|YP_589703.1|  hypothetical protein Acid345_0624 [Acidobact...   114    9e-24 Gene info
ref|ZP_03370651.1|  hypothetical protein SentesTyp_10099 [Salm...   113    2e-23
ref|ZP_01876065.1|  cell-division inhibitor [Lentisphaera aran...   113    2e-23
gb|EDL36229.1|  mCG133750, isoform CRA_c [Mus musculus]             113    3e-23
ref|YP_001192798.1|  hypothetical protein Fjoh_0443 [Flavobact...   110    1e-22 Gene info
ref|ZP_02969131.1|  NAD-dependent epimerase/dehydratase [bacte...   109    3e-22
ref|ZP_01796769.1|  arginine repressor [Haemophilus influenzae...   109    3e-22
ref|ZP_01093051.1|  cell division inhibitor [Blastopirellula m...   109    4e-22
gb|EDY80563.1|  conserved hypothetical protein TIGR01777 [Verr...   107    1e-21
ref|ZP_02735910.1|  hypothetical protein GobsU_29134 [Gemmata ...   106    2e-21
ref|XP_789174.1|  PREDICTED: hypothetical protein [Strongyloce...   106    3e-21 Gene info
ref|ZP_03404273.1|  hypothetical protein Salmonellaentericaent...   105    6e-21
ref|ZP_02837009.1|  NAD-dependent epimerase/dehydratase [Arthr...   103    2e-20
ref|ZP_03040998.1|  domain of unknown function DUF1731 [Geobac...   101    9e-20
ref|ZP_00378885.1|  COG1090: Predicted nucleoside-diphosphate ...  99.8    3e-19
ref|ZP_03307238.1|  hypothetical protein BACFIN_01575 [Bactero...  99.8    3e-19
ref|YP_001362602.1|  NAD-dependent epimerase/dehydratase [Kine...  99.4    3e-19 Gene info
ref|ZP_00235150.1|  conserved hypothetical protein [Listeria m...  99.4    4e-19
emb|CAJ88345.1|  putative cell-division inhibitor [Streptomyce...  94.4    1e-17
gb|EDL36228.1|  mCG133750, isoform CRA_b [Mus musculus]            93.6    2e-17
ref|YP_946534.1|  putative NAD dependent epimerase/dehydratase...  92.0    6e-17 Gene info
ref|ZP_03178183.1|  NAD-dependent epimerase/dehydratase [Strep...  91.7    7e-17 Gene info
ref|YP_001112100.1|  NAD-dependent epimerase/dehydratase [Desu...  91.7    9e-17 Gene info
ref|YP_822244.1|  hypothetical protein Acid_0960 [Solibacter u...  91.3    1e-16 Gene info
ref|XP_728667.1|  hypothetical protein [Plasmodium yoelii yoel...  90.9    1e-16 Gene info
ref|ZP_01130653.1|  cell-division inhibitor [marine actinobact...  89.7    3e-16
ref|ZP_00743636.1|  Cell division inhibitor [Bacillus thuringi...  89.0    5e-16
gb|EAW66010.1|  chromosome 14 open reading frame 124, isoform ...  87.4    1e-15 Gene info
ref|YP_001222296.1|  NDP sugar epimerase, putative cell-divisi...  85.5    5e-15 Gene info
ref|YP_001710459.1|  putative DNA-binding protein [Clavibacter...  84.3    1e-14 Gene info
ref|ZP_03374052.1|  hypothetical protein SentesTyp_28657 [Salm...  82.8    3e-14
ref|YP_121209.1|  hypothetical protein nfa49930 [Nocardia farc...  80.1    2e-13 Gene info
gb|EDM14293.1|  similar to HCDI protein (predicted), isoform C...  80.1    3e-13 Gene info
ref|YP_830093.1|  hypothetical protein Arth_0594 [Arthrobacter...  77.8    1e-12 Gene info
ref|ZP_01816187.1|  putative sugar nucleotide epimerase [Vibri...  76.6    2e-12
ref|ZP_03183326.1|  putative NAD dependent epimerase/dehydrata...  76.3    3e-12
ref|ZP_00234956.1|  conserved hypothetical protein [Listeria m...  74.3    1e-11
ref|YP_462206.1|  cell division inhibitor [Syntrophus aciditro...  70.1    2e-10 Gene info
ref|ZP_01886292.1|  hypothetical protein PBAL39_11285 [Pedobac...  63.9    2e-08
ref|ZP_03409135.1|  hypothetical protein Salmonellaentericaent...  62.4    5e-08
gb|AAK70422.1|AF385140_2  unknown [uncultured bacterium]           62.4    5e-08
ref|ZP_01796768.1|  hypothetical protein CGSHiR3021_05284 [Hae...  61.6    9e-08
gb|AAK70426.1|AF385141_3  unknown [uncultured bacterium]           58.9    6e-07
ref|ZP_02912249.1|  domain of unknown function DUF1731 [Geobac...  57.4    2e-06
ref|YP_001875341.1|  NAD-dependent epimerase/dehydratase [Elus...  57.4    2e-06 Gene info
ref|YP_099129.1|  putative dehydratase [Bacteroides fragilis Y...  57.0    2e-06 Gene info
ref|ZP_03351597.1|  hypothetical protein Salmonentericaenteric...  57.0    2e-06
ref|YP_001357660.1|  NAD-dependent epimerase/dehydratase [Sulf...  55.8    4e-06 Gene info
ref|XP_797624.1|  PREDICTED: hypothetical protein, partial [St...  55.5    7e-06 Gene info
ref|ZP_02071512.1|  hypothetical protein BACUNI_02951 [Bactero...  54.3    1e-05
ref|ZP_02071346.1|  hypothetical protein BACUNI_02784 [Bactero...  53.1    4e-05
ref|YP_983702.1|  NAD-dependent epimerase/dehydratase [Polarom...  51.6    8e-05 Gene info
ref|YP_001510804.1|  NAD-dependent epimerase/dehydratase [Fran...  51.6    9e-05 Gene info
ref|YP_210712.1|  putative epimerase/dehydratase [Bacteroides ...  51.6    9e-05 Gene info
ref|YP_002300168.1|  NAD dependent epimerase [Rhodospirillum c...  51.6    1e-04 Gene info
ref|YP_062387.1|  NAD dependent epimerase/dehydratase [Leifson...  50.8    1e-04 Gene info
gb|AAM27579.1|AF498402_12  ORF_12; similar to NAD dependent ep...  49.3    5e-04
gb|AAM27681.1|AF498409_9  ORF_12; similar to NAD dependent epi...  48.9    6e-04
gb|AAF72958.1|AF236052_9  WbjFT [Pseudomonas aeruginosa]           48.9    6e-04
ref|YP_905377.1|  hypothetical protein MUL_1355 [Mycobacterium...  48.1    0.001 Gene info
ref|YP_001851555.1|  hypothetical protein MMAR_3274 [Mycobacte...  47.8    0.001 Gene info
ref|YP_889742.1|  hypothetical protein MSMEG_5504 [Mycobacteri...  47.8    0.001 Gene info
sp|P24550|RCP_VIBCH  Protein rcp (Protein sulA) >emb|CAA39495....  47.4    0.002
gb|AAB39483.1|  WbjF [Pseudomonas aeruginosa]                      46.6    0.003
ref|YP_001636556.1|  NAD-dependent epimerase/dehydratase [Chlo...  46.2    0.003 Gene info
ref|ZP_03015060.1|  hypothetical protein BACINT_02649 [Bactero...  45.8    0.005
ref|ZP_01437355.1|  UDP-glucose 4-epimerase [Fulvimarina pelag...  45.4    0.006
ref|ZP_01045646.1|  UDP-sugar epimerase [Nitrobacter sp. Nb-31...  45.4    0.006
ref|ZP_00135100.2|  COG1090: Predicted nucleoside-diphosphate ...  45.4    0.006
ref|ZP_03015461.1|  hypothetical protein BACINT_03051 [Bactero...  45.4    0.006
ref|ZP_02032757.1|  hypothetical protein PARMER_02776 [Parabac...  45.4    0.007
ref|NP_126857.1|  dTDP-glucose 4,6-dehydratase [Pyrococcus aby...  45.4    0.007 Gene info
ref|YP_419447.1|  nucleoside-diphosphate-sugar epimerase [Magn...  45.1    0.008 Gene info
ref|YP_001509918.1|  NAD-dependent epimerase/dehydratase [Fran...  45.1    0.009 Gene info
ref|YP_118292.1|  hypothetical protein nfa20820 [Nocardia farc...  45.1    0.009 Gene info
ref|YP_704670.1|  hypothetical protein RHA1_ro04727 [Rhodococc...  45.1    0.009 Gene info
ref|ZP_02456945.1|  NAD-dependent epimerase/dehydratase family...  44.3    0.013
ref|YP_002201567.1|  NAD-dependent epimerase/dehydratase [Stre...  44.3    0.015 Gene info
ref|ZP_03199920.1|  NAD-dependent epimerase/dehydratase [Strep...  44.3    0.015
ref|ZP_01882466.1|  hypothetical protein PBAL39_01342 [Pedobac...  43.9    0.019
ref|YP_001310733.1|  NAD-dependent epimerase/dehydratase [Clos...  43.9    0.019 Gene info
ref|YP_433724.1|  nucleoside-diphosphate sugar epimerase [Hahe...  43.9    0.020 Gene info
ref|ZP_01624383.1|  putative sugar nucleotide epimerase  dehyd...  43.9    0.020
ref|XP_001520074.1|  PREDICTED: hypothetical protein, partial ...  43.9    0.021 UniGene infoGene info
ref|YP_001380395.1|  NAD-dependent epimerase/dehydratase [Anae...  43.5    0.024 Gene info
ref|ZP_00204485.1|  COG1090: Predicted nucleoside-diphosphate ...  43.5    0.027
ref|YP_757110.1|  NAD-dependent epimerase/dehydratase [Maricau...  43.1    0.036 Gene info
ref|YP_461045.1|  cell division inhibitor [Syntrophus aciditro...  43.1    0.036 Gene info
ref|YP_002052309.1|  NAD-dependent epimerase/dehydratase famil...  42.7    0.046 Gene info
ref|ZP_01766864.1|  putative epimerase/dehydratase WbiG [Burkh...  42.7    0.046
ref|YP_480669.1|  NAD-dependent epimerase/dehydratase [Frankia...  42.7    0.046 Gene info
ref|ZP_02165392.1|  UDP-glucose 4-epimerase [Hoeflea phototrop...  42.4    0.048
ref|ZP_02070841.1|  hypothetical protein BACUNI_02269 [Bactero...  42.4    0.048
ref|YP_482923.1|  NAD-dependent epimerase/dehydratase [Frankia...  42.4    0.049 Gene info
ref|YP_103566.1|  NAD-dependent epimerase/dehydratase family p...  42.4    0.049 Gene info
ref|YP_334524.1|  UDP-glucose 4-epimerase [Burkholderia pseudo...  42.4    0.050 Gene info
ref|YP_001635239.1|  NAD-dependent epimerase/dehydratase [Chlo...  42.4    0.052 Gene info
ref|YP_002104259.1|  NAD-dependent epimerase/dehydratase famil...  42.4    0.052 Gene info
gb|AAR38451.1|  conserved hypothetical protein [uncultured mar...  42.4    0.055
ref|YP_505813.1|  NADH-ubiquinone oxidoreductase family protei...  42.4    0.057 Gene info
ref|YP_109270.1|  putative epimerase/dehydratase [Burkholderia...  42.4    0.058 Gene info
ref|ZP_02472473.1|  NAD-dependent epimerase/dehydratase family...  42.4    0.058
ref|ZP_01052743.1|  putative LPS biosynthesis related DNTP-hex...  42.4    0.062
ref|ZP_02499286.1|  UDP-glucose 4-epimerase [Burkholderia pseu...  42.0    0.063
ref|YP_075198.1|  UDP-glucose 4-epimerase [Symbiobacterium the...  42.0    0.064 Gene info
ref|NP_142398.1|  dTDP-glucose 4,6-dehydratase [Pyrococcus hor...  42.0    0.075 Gene info
ref|YP_467503.1|  NAD-dependent epimerase/dehydratase [Anaerom...  41.6    0.087 Gene info
ref|YP_002136770.1|  NAD-dependent epimerase/dehydratase [Anae...  41.6    0.088 Gene info
ref|YP_001710814.1|  hypothetical protein CMS_2127 [Clavibacte...  41.6    0.091 Gene info
ref|ZP_02321648.1|  NAD-dependent epimerase/dehydratase [Anaer...  41.6    0.094
ref|YP_002133481.1|  NAD-dependent epimerase/dehydratase [Anae...  41.6    0.095 Gene info
ref|YP_629779.1|  NAD dependent epimerase/dehydratase family p...  41.2    0.11  Gene info
ref|ZP_03136121.1|  NAD-dependent epimerase/dehydratase [Cyano...  41.2    0.12 
ref|YP_315631.1|  putative UDP-glucose 4-epimerase [Thiobacill...  41.2    0.12  Gene info
ref|YP_002035149.1|  NAD-dependent epimerase/dehydratase famil...  41.2    0.12  Gene info
ref|YP_001067367.1|  NAD-dependent epimerase/dehydratase famil...  41.2    0.12  Gene info
ref|ZP_01228313.1|  possible NAD-dependent epimerase/dehydrata...  41.2    0.12 
ref|ZP_03014726.1|  hypothetical protein BACINT_02304 [Bactero...  41.2    0.13 
ref|YP_002019375.1|  NAD-dependent epimerase/dehydratase [Pelo...  41.2    0.14  Gene info
ref|ZP_01721085.1|  putative UDP-galactose 4-epimerase [Algori...  41.2    0.14 
ref|YP_001142560.1|  hypothetical protein ASA_2795 [Aeromonas ...  40.8    0.17  Gene info
ref|NP_053130.1|  hypothetical protein pB171_068 [Escherichia ...  40.8    0.17  Gene info
ref|YP_001130421.1|  NAD-dependent epimerase/dehydratase [Pros...  40.8    0.17  Gene info
gb|AAX07739.1|  NAD-dependent epimerase/dehydratase [Escherich...  40.8    0.18 
ref|YP_113128.1|  UDP-glucose 4-epimerase [Methylococcus capsu...  40.4    0.18  Gene info
ref|YP_785673.1|  hypothetical protein BAV1151 [Bordetella avi...  40.4    0.20  Gene info
ref|YP_464272.1|  NAD-dependent epimerase/dehydratase [Anaerom...  40.4    0.20  Gene info
ref|ZP_02783411.1|  plasmid segregation protein ParM [Escheric...  40.4    0.21 
ref|YP_001304411.1|  NAD-dependent epimerase [Parabacteroides ...  40.4    0.21  Gene info
ref|ZP_02185140.1|  capsular polysaccharide synthesis enzyme C...  40.4    0.23 
ref|YP_001998578.1|  NAD-dependent epimerase/dehydratase [Chlo...  40.4    0.24  Gene info
ref|YP_822709.1|  NAD-dependent epimerase/dehydratase [Solibac...  40.0    0.24  Gene info
ref|NP_772563.1|  putative UDP-glucose 4-epimerase [Bradyrhizo...  40.0    0.24  Gene info
ref|YP_001965467.1|  ATPase [Escherichia coli] >gb|ABG29595.1|...  40.0    0.25  Gene info
ref|YP_538661.1|  stable plasmid inheritance protein [Escheric...  40.0    0.25  Gene info
ref|ZP_03385513.1|  putative sugar nucleotide epimerase [Salmo...  40.0    0.26 
ref|XP_001676331.1|  Hypothetical protein CBG14085 [Caenorhabd...  40.0    0.27  Gene info
ref|ZP_03039339.1|  NAD-dependent epimerase/dehydratase [Geoba...  40.0    0.27 
ref|YP_190183.1|  stable plasmid inheritance protein A [Escher...  40.0    0.27  Gene info
ref|YP_911794.1|  NAD-dependent epimerase/dehydratase [Chlorob...  40.0    0.30  Gene info
ref|YP_001717817.1|  dTDP-glucose 4,6-dehydratase [Candidatus ...  40.0    0.30  Gene info
ref|ZP_02015256.1|  NAD-dependent epimerase/dehydratase [Halor...  40.0    0.30 
ref|ZP_02322415.1|  NAD-dependent epimerase/dehydratase [Anaer...  40.0    0.30 
emb|CAJ89422.1|  putative dihydrodipicolinate reductase [Strep...  40.0    0.31 
ref|YP_441879.1|  GDP-6-deoxy-D-lyxo-4-hexulose reductase, put...  40.0    0.31  Gene info
ref|YP_843384.1|  dTDP-glucose 4,6-dehydratase [Methanosaeta t...  39.7    0.33  Gene info
gb|AAD13546.1|  NDP-hexose 4,6-dehydratase homolog [Streptomyc...  39.7    0.33 
ref|YP_826683.1|  NAD-dependent epimerase/dehydratase [Solibac...  39.7    0.34  Gene info
ref|YP_436009.1|  nucleoside-diphosphate-sugar epimerase [Hahe...  39.7    0.35  Gene info
ref|XP_001802768.1|  hypothetical protein SNOG_12547 [Phaeosph...  39.7    0.37  Gene info
ref|NP_625726.1|  hypothetical protein SCO1445 [Streptomyces c...  39.7    0.38  Gene info
ref|ZP_02909630.1|  NAD-dependent epimerase/dehydratase [Burkh...  39.7    0.39 
ref|ZP_02011300.1|  NAD-dependent epimerase/dehydratase [Opitu...  39.3    0.43 
ref|ZP_02845790.1|  NAD-dependent epimerase/dehydratase [Paeni...  39.3    0.44 
ref|YP_001501551.1|  NAD-dependent epimerase/dehydratase [Shew...  39.3    0.45  Gene info
ref|ZP_00631995.1|  NAD-dependent epimerase/dehydratase [Parac...  39.3    0.46 
ref|YP_002232232.1|  putative nucleotide sugar epimerase/dehyd...  39.3    0.48  Gene info
ref|YP_001822150.1|  putative NDP-glucose-4,6-dehydratase [Str...  39.3    0.48  Gene info
gb|AAQ82925.1|  dTDP-glucose 4,6-dehydratase [Raoultella terri...  38.9    0.53 
ref|ZP_03180593.1|  dTDP-glucose 4,6-dehydratase [Streptomyces...  38.9    0.54 
ref|NP_508390.1|  hypothetical protein F53B1.4 [Caenorhabditis...  38.9    0.56  UniGene infoGene info
ref|YP_001907296.1|  Putative nucleoside-diphosphate-sugar epi...  38.9    0.58  Gene info
ref|ZP_01372718.1|  NAD-dependent epimerase/dehydratase [Desul...  38.9    0.59 
ref|YP_520663.1|  hypothetical protein DSY4430 [Desulfitobacte...  38.9    0.60  Gene info
ref|ZP_03301406.1|  hypothetical protein BACDOR_02789 [Bactero...  38.9    0.61 
ref|ZP_02029404.1|  hypothetical protein BIFADO_01861 [Bifidob...  38.9    0.61 
ref|YP_001924693.1|  NAD-dependent epimerase/dehydratase [Meth...  38.9    0.62  Gene info
ref|YP_002016625.1|  NAD-dependent epimerase/dehydratase [Pros...  38.9    0.62  Gene info
gb|EDN59495.1|  conserved protein [Saccharomyces cerevisiae YJ...  38.9    0.63 
ref|ZP_02081362.1|  hypothetical protein CLOLEP_02837 [Clostri...  38.9    0.66 
ref|ZP_01130314.1|  putative UDP-galactose 4-epimerase [marine...  38.9    0.66 
ref|YP_001263849.1|  NAD-dependent epimerase/dehydratase [Sphi...  38.9    0.67  Gene info
ref|ZP_02083698.1|  hypothetical protein CLOBOL_01221 [Clostri...  38.9    0.68 
ref|YP_987286.1|  NAD-dependent epimerase/dehydratase [Acidovo...  38.5    0.71  Gene info
ref|NP_435626.1|  Nucleoside-diphosphate-sugar epimerase [Sino...  38.5    0.73  Gene info
ref|YP_001142674.1|  putative nucleoside-diphosphate-sugar epi...  38.5    0.80  Gene info
ref|NP_437179.1|  putative sugar nucleotide epimerase dehydrat...  38.5    0.83  Gene info
ref|ZP_03276910.1|  oxidoreductase domain protein [Thioalkaliv...  38.5    0.83 
ref|YP_479342.1|  NAD-dependent epimerase/dehydratase [Frankia...  38.5    0.83  Gene info
gb|EDZ61063.1|  UDP-glucose 4-epimerase [Candidatus Pelagibact...  38.5    0.85 
ref|NP_013044.1|  Putative protein of unknown function, transc...  38.1    0.91  Gene info
ref|YP_675723.1|  NAD-dependent epimerase/dehydratase [Mesorhi...  38.1    0.91  Gene info
gb|EEB12227.1|  UDP-glucuronic acid decarboxylase, putative [P...  38.1    0.94 
ref|ZP_00780960.1|  conserved hypothetical protein [Streptococ...  38.1    0.94 
ref|YP_001353946.1|  nucleoside-diphosphate-sugar epimerases [...  38.1    0.96  Gene info
gb|ABI15605.1|  UDP-glucose 4-epimerase [Spironucleus barkhanus]   38.1    0.98 
gb|ABO10605.2|  hypothetical protein A1S_0118 [Acinetobacter b...  38.1    1.0  
ref|YP_001840340.1|  hypothetical protein LEPBI_I2997 [Leptosp...  38.1    1.0   Gene info
ref|ZP_01517434.1|  NAD-dependent epimerase/dehydratase [Chlor...  38.1    1.0  
ref|YP_023088.1|  dTDP-glucose 4,6-dehydratase [Picrophilus to...  38.1    1.0   Gene info
ref|YP_001844804.1|  putative NAD dependent epimerase/dehydrat...  38.1    1.0   Gene info
ref|XP_002151665.1|  NAD dependent epimerase/dehydratase, puta...  38.1    1.0   Gene info
ref|ZP_00786051.1|  conserved hypothetical protein [Streptococ...  38.1    1.0  
ref|ZP_02491139.1|  NAD-dependent epimerase/dehydratase [Burkh...  38.1    1.1  
ref|ZP_00787143.1|  conserved hypothetical protein [Streptococ...  38.1    1.1  
ref|XP_488079.5|  PREDICTED: similar to NAD(P) dependent stero...  38.1    1.1   UniGene infoGene info
ref|YP_252533.1|  hypothetical protein SH0618 [Staphylococcus ...  38.1    1.1   Gene info
ref|NP_617102.1|  dTDP-glucose 4,6-dehydratase [Methanosarcina...  38.1    1.1   Gene info
ref|YP_394482.1|  hypothetical protein Suden_1973 [Sulfurimona...  38.1    1.1   Gene info
ref|YP_265949.1|  NAD-dependent epimerase/dehydratase family p...  38.1    1.1   Gene info
ref|YP_001241976.1|  putative NAD dependent epimerase/dehydrat...  38.1    1.1   Gene info
gb|ABC00738.1|  CosH [Streptomyces olindensis]                     38.1    1.1  
ref|YP_001939156.1|  Nucleoside-diphosphate-sugar epimerase [M...  38.1    1.2   Gene info
ref|YP_001617145.1|  hypothetical protein sce6496 [Sorangium c...  38.1    1.2   Gene info
ref|YP_001381221.1|  NAD-dependent epimerase/dehydratase [Anae...  38.1    1.2   Gene info
ref|ZP_02117899.1|  nucleoside-diphosphate-sugar epimerase [Me...  37.7    1.2  
ref|YP_918779.1|  NAD-dependent epimerase/dehydratase [Paracoc...  37.7    1.2   Gene info
ref|ZP_01035530.1|  oxidoreductase, Gfo/Idh/MocA family protei...  37.7    1.3  
ref|NP_687769.1|  hypothetical protein SAG0754 [Streptococcus ...  37.7    1.3   Gene info
ref|YP_001207511.1|  putative NAD dependent epimerase/dehydrat...  37.7    1.3   Gene info
ref|ZP_00789264.1|  conserved hypothetical protein [Streptococ...  37.7    1.3  
ref|ZP_02837896.1|  NAD-dependent epimerase/dehydratase [Arthr...  37.7    1.3  
ref|YP_001553946.1|  UDP-glucose 4-epimerase [Shewanella balti...  37.7    1.4   Gene info
ref|ZP_01078974.1|  hypothetical dTDP-4-dehydrorhamnose reduct...  37.7    1.4  
ref|YP_001336145.1|  dTDP-glucose 4,6-dehydratase [Klebsiella ...  37.7    1.5   Gene info
ref|ZP_01221062.1|  Hypothetical enzyme of sugar metabolism [P...  37.7    1.5  
ref|YP_001432744.1|  UDP-glucose 4-epimerase [Roseiflexus cast...  37.4    1.5   Gene info
ref|YP_001715470.1|  putative bifunctional protein [Includes: ...  37.4    1.6   Gene info
ref|YP_592340.1|  NAD-dependent epimerase/dehydratase [Acidoba...  37.4    1.6   Gene info
ref|YP_002015719.1|  NAD-dependent epimerase/dehydratase [Pros...  37.4    1.6   Gene info
ref|ZP_01253607.1|  UDP-glucose 4-epimerase [Psychroflexus tor...  37.4    1.6  
ref|YP_001876695.1|  NAD-dependent epimerase/dehydratase [Akke...  37.4    1.6   Gene info
ref|NP_661928.1|  3-beta hydroxysteroid dehydrogenase/isomeras...  37.4    1.6   Gene info
ref|ZP_03283209.1|  hypothetical protein ENTCAN_03005 [Enterob...  37.4    1.6  
ref|YP_001898734.1|  NAD-dependent epimerase/dehydratase [Rals...  37.4    1.6   Gene info
ref|ZP_02967775.1|  NAD-dependent epimerase/dehydratase [bacte...  37.4    1.7  
ref|ZP_02468667.1|  GDP-6-deoxy-D-lyxo-4-hexulose reductase, p...  37.4    1.7  
ref|NP_951137.1|  hypothetical protein GSU0075 [Geobacter sulf...  37.4    1.7   Gene info
ref|NP_896554.1|  UDP-glucose 4-epimerase [Synechococcus sp. W...  37.4    1.7   Gene info
gb|AAF12834.1|AF203881_7  HpnA [Zymomonas mobilis] >emb|CAA047...  37.4    1.8  
ref|XP_001742234.1|  hypothetical protein [Monosiga brevicolli...  37.4    1.8   Gene info
ref|YP_378279.1|  hypothetical protein Syncc9902_2278 [Synecho...  37.4    1.8   Gene info
gb|EDX82739.1|  NAD dependent epimerase/dehydratase family [Sy...  37.4    1.9  
ref|YP_625255.1|  NAD-dependent epimerase/dehydratase [Burkhol...  37.4    1.9   Gene info
ref|ZP_03155487.1|  NAD-dependent epimerase/dehydratase [Cyano...  37.4    1.9  
ref|YP_001192692.1|  NAD-dependent epimerase/dehydratase [Flav...  37.4    1.9   Gene info
ref|ZP_02191784.1|  NAD-dependent epimerase/dehydratase [alpha...  37.4    1.9  
ref|ZP_01901535.1|  UDP-N-acetylglucosamine 4-epimerase [Roseo...  37.4    2.0  
ref|YP_002235249.1|  NAD dependent epimerase/dehydratase famil...  37.0    2.0   Gene info
emb|CAP93534.1|  Pc16g08640 [Penicillium chrysogenum Wisconsin...  37.0    2.0  
ref|ZP_02661901.1|  NAD dependent epimerase/dehydratase family...  37.0    2.1  
ref|YP_001811997.1|  NAD-dependent epimerase/dehydratase [Burk...  37.0    2.1   Gene info
ref|ZP_00380720.1|  COG0451: Nucleoside-diphosphate-sugar epim...  37.0    2.1  
ref|ZP_03129450.1|  ActC family protein [Chthoniobacter flavus...  37.0    2.2  
ref|YP_001231905.1|  UDP-glucose 4-epimerase [Geobacter uranii...  37.0    2.2   Gene info
gb|EDZ70795.1|  YLL056Cp-like protein [Saccharomyces cerevisia...  37.0    2.2  
ref|YP_001750566.1|  NAD-dependent epimerase/dehydratase [Pseu...  37.0    2.2   Gene info
ref|ZP_01754997.1|  NAD-dependent epimerase/dehydratase family...  37.0    2.3  
gb|EDV09265.1|  conserved hypothetical protein [Saccharomyces ...  37.0    2.3  
ref|XP_219290.4|  PREDICTED: similar to NAD(P) dependent stero...  37.0    2.3   UniGene infoGene info
ref|ZP_02942861.1|  NmrA-like protein [Cyanothece sp. PCC 8801...  37.0    2.4  
ref|YP_776678.1|  NAD-dependent epimerase/dehydratase [Burkhol...  37.0    2.4   Gene info
ref|XP_001773952.1|  predicted protein [Physcomitrella patens ...  37.0    2.4   UniGene infoGene info
ref|YP_472752.1|  putative nucleoside-diphosphate-sugar epimer...  37.0    2.4   Gene info
ref|YP_002150434.1|  hypothetical protein PMI0667 [Proteus mir...  37.0    2.5   Gene info
ref|YP_001361430.1|  NAD-dependent epimerase/dehydratase [Kine...  37.0    2.5   Gene info
ref|ZP_00514755.1|  conserved hypothetical protein [Crocosphae...  37.0    2.5  
ref|YP_002277503.1|  NAD-dependent epimerase/dehydratase [Gluc...  36.6    2.6   Gene info
ref|ZP_03055661.1|  NAD-dependent epimerase/dehydratase [Bacil...  36.6    2.7  
ref|YP_001581502.1|  NAD-dependent epimerase/dehydratase [Nitr...  36.6    2.7   Gene info
ref|YP_557268.1|  putative epimerase/dehydratase [Burkholderia...  36.6    2.7   Gene info
dbj|BAC57041.1|  dTDP-glucose-4,6-dehydratase [Micromonospora ...  36.6    2.7  
ref|YP_485218.1|  UDP-glucose 4-epimerase [Rhodopseudomonas pa...  36.6    2.7   Gene info
ref|YP_095331.1|  oxidoreductase [Legionella pneumophila subsp...  36.6    2.7   Gene info
ref|YP_001894544.1|  NAD-dependent epimerase/dehydratase [Burk...  36.6    2.7   Gene info
ref|YP_479970.1|  NAD-dependent epimerase/dehydratase [Frankia...  36.6    2.7   Gene info
ref|YP_419471.1|  nucleoside-diphosphate-sugar epimerase [Magn...  36.6    2.7   Gene info
ref|ZP_02996162.1|  hypothetical protein CLOSPO_03285 [Clostri...  36.6    2.8  
ref|YP_130614.1|  hypothetical protein PBPRA2429 [Photobacteri...  36.6    2.8   Gene info
ref|YP_126614.1|  hypothetical protein lpl1264 [Legionella pne...  36.6    2.8   Gene info
ref|YP_001250050.1|  oxidoreductase [Legionella pneumophila st...  36.6    2.8   Gene info
ref|NP_633191.1|  dTDP-glucose 4,6-dehydratase [Methanosarcina...  36.6    2.8   Gene info
ref|YP_772653.1|  NAD-dependent epimerase/dehydratase [Burkhol...  36.6    2.9   Gene info
ref|ZP_01469119.1|  hypothetical protein BL107_06864 [Synechoc...  36.6    2.9  
ref|YP_123589.1|  hypothetical protein lpp1265 [Legionella pne...  36.6    2.9   Gene info
ref|YP_705681.1|  UDP-glucose 4-epimerase [Rhodococcus sp. RHA...  36.6    3.0   Gene info
gb|AAM27864.1|AF498419_18  ORF_18; similar to 3-beta hydroxyst...  36.6    3.0  
ref|ZP_00824285.1|  COG1088: dTDP-D-glucose 4,6-dehydratase [Y...  36.6    3.0  
gb|AAM27844.1|AF498418_18  ORF_18; similar to 3-beta hydroxyst...  36.6    3.0  
ref|YP_326854.1|  NADH dehydrogenase 32K chain-like protein [N...  36.6    3.0   Gene info
ref|YP_001378403.1|  NAD-dependent epimerase/dehydratase [Anae...  36.6    3.1   Gene info
ref|ZP_00135099.2|  COG1090: Predicted nucleoside-diphosphate ...  36.6    3.1  
ref|YP_001007266.1|  paratose synthase [Yersinia enterocolitic...  36.6    3.2   Gene info
ref|ZP_02885755.1|  NAD-dependent epimerase/dehydratase [Burkh...  36.6    3.2  
ref|YP_001336139.1|  dTDP-D-glucose 4,6-dehydratase [Klebsiell...  36.6    3.4   Gene info
ref|ZP_02971286.1|  NAD-dependent epimerase/dehydratase [bacte...  36.2    3.6  
ref|YP_001616016.1|  hypothetical protein sce5373 [Sorangium c...  36.2    3.6   Gene info
ref|NP_832289.1|  dTDP-glucose 4,6-dehydratase [Bacillus cereu...  36.2    3.6   Gene info
ref|YP_001365690.1|  UDP-glucose 4-epimerase [Shewanella balti...  36.2    3.7   Gene info
ref|ZP_01576489.1|  NAD-dependent epimerase/dehydratase [Clost...  36.2    3.7  
ref|YP_001603434.1|  putative steroid protein related [Glucona...  36.2    3.8   Gene info
ref|NP_769974.1|  putative short chain dehydrogenase [Bradyrhi...  36.2    3.8   Gene info
ref|YP_002018234.1|  NAD-dependent epimerase/dehydratase [Pelo...  36.2    3.8   Gene info
ref|ZP_01792048.1|  UDP-glucose 4-epimerase [Haemophilus influ...  36.2    3.8  
ref|YP_289710.1|  hypothetical protein Tfu_1652 [Thermobifida ...  36.2    3.8   Gene info
ref|NP_106310.1|  UDP-galactose 4-epimerase [Mesorhizobium lot...  36.2    3.8   Gene info
ref|YP_039595.1|  NAD dependent epimerase/dehydratase family p...  36.2    3.9   Gene info
ref|ZP_00121205.1|  COG1091: dTDP-4-dehydrorhamnose reductase ...  36.2    3.9   Gene info
gb|EDZ38696.1|  Putative type IV prepilin peptidase [Leptospir...  36.2    3.9  
ref|YP_001458854.1|  dTDP-glucose 4,6-dehydratase [Escherichia...  36.2    3.9   Gene info
ref|YP_001452356.1|  hypothetical protein CKO_00768 [Citrobact...  36.2    3.9   Gene info
ref|ZP_03342077.1|  hypothetical protein Salmonelentericaenter...  36.2    4.1  
ref|YP_001479125.1|  NAD-dependent epimerase/dehydratase [Serr...  36.2    4.1   Gene info
ref|YP_136726.1|  dTDP-glucose-46-dehydratase [Haloarcula mari...  36.2    4.1   Gene info
ref|YP_295789.1|  NAD-dependent epimerase/dehydratase:dTDP-4-d...  36.2    4.2   Gene info
ref|YP_964090.1|  UDP-glucose 4-epimerase [Shewanella sp. W3-1...  36.2    4.2   Gene info
ref|ZP_01627085.1|  oxidoreductase Rmd [marine gamma proteobac...  36.2    4.2  
ref|YP_001134419.1|  NAD-dependent epimerase/dehydratase [Myco...  36.2    4.2   Gene info
ref|YP_001182910.1|  UDP-glucose 4-epimerase [Shewanella putre...  36.2    4.2   Gene info
ref|YP_370959.1|  NAD-dependent epimerase/dehydratase [Burkhol...  36.2    4.3   Gene info
ref|YP_456053.1|  putative sugar-nucleotide epimerase/dehydrat...  36.2    4.3   Gene info
ref|XP_001328204.1|  ribonuclease HII family protein [Trichomo...  36.2    4.4   Gene info
ref|NP_201429.1|  GMD1 (GDP-D-MANNOSE 4,6-DEHYDRATASE 1); GDP-...  36.2    4.4   UniGene infoGene info
ref|ZP_03126923.1|  NAD-dependent epimerase/dehydratase [Chtho...  35.8    4.5  
ref|YP_001204163.1|  putative NAD-dependent epimerase/dehydrat...  35.8    4.6   Gene info
ref|ZP_01841218.1|  UDP-glucose 4-epimerase [Shewanella baltic...  35.8    4.6  
ref|ZP_01706510.1|  UDP-glucose 4-epimerase [Shewanella putref...  35.8    4.7  
ref|YP_001487085.1|  hypothetical protein BPUM_1854 [Bacillus ...  35.8    4.8   Gene info
ref|YP_001177348.1|  NAD-dependent epimerase/dehydratase [Ente...  35.8    4.8   Gene info
ref|ZP_01385444.1|  NAD-dependent epimerase/dehydratase:3-beta...  35.8    4.8  
ref|YP_001943794.1|  UDP-glucose 4-epimerase [Chlorobium limic...  35.8    4.8   Gene info
ref|NP_752932.1|  hypothetical protein c1002 [Escherichia coli...  35.8    4.8   Gene info
ref|YP_840925.1|  nucleoside-diphosphate-sugar epimerase [Rals...  35.8    4.9   Gene info
ref|YP_002242979.1|  hypothetical protein SEN0841 [Salmonella ...  35.8    5.0   Gene info
ref|YP_001633455.1|  NDP-sugar oxidoreductase [Bordetella petr...  35.8    5.0   Gene info
ref|YP_472838.1|  hypothetical protein RHE_PF00221 [Rhizobium ...  35.8    5.0   Gene info
ref|NP_881035.1|  hypothetical protein BP2404 [Bordetella pert...  35.8    5.0   Gene info
ref|ZP_02360089.1|  GDP-6-deoxy-D-lyxo-4-hexulose reductase, p...  35.8    5.1  
gb|EAY57219.1|  hypothetical protein UBAL2_79310059 [Leptospir...  35.8    5.1  
ref|YP_375738.1|  UDP-glucose 4-epimerase [Pelodictyon luteolu...  35.8    5.1   Gene info
ref|YP_162602.1|  nucleoside-diphosphate-sugar epimerase [Zymo...  35.8    5.1   Gene info
ref|ZP_02685555.1|  NAD dependent epimerase/dehydratase family...  35.8    5.1  
ref|ZP_02700378.1|  NAD dependent epimerase/dehydratase family...  35.8    5.1  
ref|YP_295763.1|  NAD-dependent epimerase/dehydratase [Ralston...  35.8    5.1   Gene info
ref|YP_002225946.1|  hypothetical protein SG0876 [Salmonella e...  35.8    5.2   Gene info
ref|ZP_03216167.1|  NAD dependent epimerase/dehydratase family...  35.8    5.2  
ref|YP_288230.1|  nucleoside-diphosphate-sugar epimerase (UDP-...  35.8    5.2   Gene info
ref|YP_326012.1|  NADH dehydrogenase 32K chain-like protein [N...  35.8    5.2   Gene info
ref|YP_856098.1|  NAD dependent epimerase/dehydratase family p...  35.8    5.3   Gene info
ref|YP_001624587.1|  UDP-N-acetyl-D-quinovosamine 4-epimerase ...  35.8    5.4   Gene info
ref|YP_002308230.1|  rfbB dTDP-glucose 4,6-dehydratase [Thermo...  35.8    5.4   Gene info
ref|YP_001588803.1|  hypothetical protein SPAB_02591 [Salmonel...  35.8    5.4   Gene info
ref|ZP_00822387.1|  COG0702: Predicted nucleoside-diphosphate-...  35.8    5.4  
ref|ZP_02655863.1|  NAD dependent epimerase/dehydratase family...  35.8    5.5  
ref|ZP_02344151.1|  NAD dependent epimerase/dehydratase family...  35.8    5.5  
ref|NP_885436.1|  hypothetical protein BPP3269 [Bordetella par...  35.8    5.5   Gene info
ref|YP_001116901.1|  NAD-dependent epimerase/dehydratase [Burk...  35.8    5.5   Gene info
ref|YP_002296776.1|  UDP-glucose 4-epimerase [Rhodospirillum c...  35.8    5.6   Gene info
ref|YP_344157.1|  NAD-dependent epimerase/dehydratase [Nitroso...  35.8    5.6   Gene info
ref|YP_002131322.1|  NAD-dependent epimerase/dehydratase [Phen...  35.8    5.6   Gene info
ref|YP_001754772.1|  NAD-dependent epimerase/dehydratase [Meth...  35.8    5.7   Gene info
ref|ZP_02169273.1|  transposase IS66 [Bacillus selenitireducen...  35.8    5.8  
ref|YP_001985038.1|  hypothetical protein RHECIAT_PC0000410 [R...  35.4    5.9   Gene info
ref|YP_001854903.1|  putative steroid dehydrogenase [Kocuria r...  35.4    5.9   Gene info
ref|YP_585989.1|  NAD-dependent epimerase/dehydratase [Ralston...  35.4    5.9   Gene info
ref|ZP_02363973.1|  GDP-6-deoxy-D-lyxo-4-hexulose reductase, p...  35.4    6.0  
ref|YP_002145849.1|  NAD dependent epimerase/dehydratase famil...  35.4    6.2   Gene info
ref|YP_001917745.1|  NAD-dependent epimerase/dehydratase [Natr...  35.4    6.2   Gene info
ref|NP_459910.1|  putative nucleoside-diphosphate-sugar epimer...  35.4    6.2   Gene info
ref|YP_215875.1|  hypothetical protein SC0888 [Salmonella ente...  35.4    6.4   Gene info
ref|YP_001858512.1|  NAD-dependent epimerase/dehydratase [Burk...  35.4    6.5   Gene info
gb|AAN87410.1|  UDP-glucose 4-epimerase [Heliobacillus mobilis]    35.4    6.5  
ref|ZP_02831938.1|  NAD dependent epimerase/dehydratase family...  35.4    6.5  
ref|ZP_00683833.1|  NAD-dependent epimerase/dehydratase [Xylel...  35.4    6.5  
ref|ZP_03354941.1|  dTDP-glucose 4,6-dehydratase [Salmonella e...  35.4    6.6  
ref|YP_001276713.1|  NAD-dependent epimerase/dehydratase [Rose...  35.4    6.7   Gene info
ref|YP_512186.1|  NAD-dependent epimerase/dehydratase [Jannasc...  35.4    6.8   Gene info
ref|YP_001099455.1|  UDP-glucose 4-epimerase (galactowaldenase...  35.4    6.8   Gene info
ref|YP_001602220.1|  putative transcriptional regulator NmrA-l...  35.4    6.9   Gene info
ref|YP_889479.1|  RmlD substrate binding domain-containing pro...  35.4    6.9   Gene info
ref|NP_712157.1|  3-oxoacyl-(acyl carrier protein) reductase [...  35.4    6.9   Gene info
ref|YP_734737.1|  UDP-galactose 4-epimerase [Shewanella sp. MR...  35.4    6.9   Gene info
ref|YP_002074392.1|  NAD dependent epimerase/dehydratase famil...  35.4    6.9   Gene info
ref|YP_002204484.1|  secreted protein [Streptomyces sviceus AT...  35.4    7.1   Gene info
ref|YP_001875.1|  short-chain dehydrogenase [Leptospira interr...  35.4    7.1   Gene info
ref|YP_001135128.1|  NAD-dependent epimerase/dehydratase [Myco...  35.4    7.1   Gene info
ref|YP_001645945.1|  NAD-dependent epimerase/dehydratase [Baci...  35.4    7.1   Gene info
ref|ZP_01739363.1|  UDP-glucose 4-epimerase [Marinobacter sp. ...  35.4    7.2  
ref|ZP_02325401.1|  NAD-dependent epimerase/dehydratase [Anaer...  35.4    7.2  
ref|YP_809165.1|  nucleoside-diphosphate-sugar epimerase [Lact...  35.4    7.2   Gene info
ref|ZP_03343342.1|  dTDP-glucose 4,6-dehydratase [Salmonella e...  35.4    7.4  
ref|ZP_01461960.1|  dTDP-4-dehydrorhamnose reductase [Stigmate...  35.4    7.4  
ref|YP_870416.1|  UDP-galactose 4-epimerase [Shewanella sp. AN...  35.4    7.4   Gene info
sp|A6NKP2.3|YP030_HUMAN  RecName: Full=Putative 3-beta-HSD fam...  35.4    7.4  
ref|YP_001477893.1|  NAD-dependent epimerase/dehydratase [Serr...  35.4    7.4   Gene info
ref|YP_001171355.1|  epimerase [Pseudomonas stutzeri A1501] >g...  35.4    7.5   Gene info
ref|YP_574520.1|  NAD-dependent epimerase/dehydratase [Chromoh...  35.4    7.5   Gene info
ref|YP_001801462.1|  putative GDP-L-fucose synthase [Cyanothec...  35.4    7.6   Gene info
ref|YP_002133585.1|  NAD-dependent epimerase/dehydratase [Anae...  35.4    7.6   Gene info
ref|YP_851961.1|  hypothetical protein APECO1_1225 [Escherichi...  35.0    7.7   Gene info
ref|ZP_02326877.1|  putative reductase [Paenibacillus larvae s...  35.0    7.9  
ref|NP_717275.1|  UDP-glucose 4-epimerase [Shewanella oneidens...  35.0    7.9   Gene info
ref|ZP_02295409.1|  NAD-dependent epimerase/dehydratase [Rhizo...  35.0    7.9  
ref|YP_001069000.1|  NAD-dependent epimerase/dehydratase [Myco...  35.0    7.9   Gene info
ref|NP_925152.1|  putative epimerase/dehydratase [Gloeobacter ...  35.0    7.9   Gene info
ref|YP_001547083.1|  NAD-dependent epimerase/dehydratase [Herp...  35.0    8.1   Gene info
ref|ZP_01516819.1|  gamma-glutamyl phosphate reductase [Chloro...  35.0    8.1  
ref|YP_464375.1|  NAD-dependent epimerase/dehydratase [Anaerom...  35.0    8.1   Gene info
ref|NP_455423.1|  hypothetical protein STY0929 [Salmonella ent...  35.0    8.1   Gene info
ref|ZP_00831407.1|  COG0451: Nucleoside-diphosphate-sugar epim...  35.0    8.1  
ref|ZP_00155358.2|  COG1087: UDP-glucose 4-epimerase [Haemophi...  35.0    8.1  
ref|YP_001823801.1|  putative NAD-dependent epimerase/dehydrat...  35.0    8.3   Gene info
ref|YP_539889.1|  hypothetical protein UTI89_C0872 [Escherichi...  35.0    8.3   Gene info
ref|YP_248068.1|  UDP-glucose 4-epimerase [Haemophilus influen...  35.0    8.4   Gene info
ref|ZP_01788335.1|  UDP-glucose 4-epimerase [Haemophilus influ...  35.0    8.5  
gb|EAY78127.1|  hypothetical protein OsI_032086 [Oryza sativa ...  35.0    8.5  
ref|YP_001275853.1|  UDP-glucose 4-epimerase [Roseiflexus sp. ...  35.0    8.5   Gene info
ref|ZP_01386463.1|  NAD-dependent epimerase/dehydratase:Short-...  35.0    8.6  
ref|YP_001222009.1|  putative NAD-dependant epimerase [Claviba...  35.0    8.7   Gene info
ref|YP_637881.1|  NAD-dependent epimerase/dehydratase [Mycobac...  35.0    8.7   Gene info
ref|NP_457825.1|  dTDP-glucose 4,6-dehydratase [Salmonella ent...  35.0    8.9   Gene info
ref|XP_001747788.1|  hypothetical protein [Monosiga brevicolli...  35.0    9.0   Gene info
ref|YP_593925.1|  NAD-dependent epimerase/dehydratase [Deinoco...  35.0    9.1   Gene info
ref|ZP_01991295.1|  nucleoside-diphosphate-sugar epimerase [Vi...  35.0    9.2  
gb|AAK31605.1|  GalE epimerase-like protein [Pseudomonas synxa...  35.0    9.2  
ref|ZP_01859275.1|  nucleoside-diphosphate-sugar epimerase [Ba...  35.0    9.3  
ref|NP_926738.1|  GDP-fucose synthetase [Gloeobacter violaceus...  35.0    9.3   Gene info
ref|NP_797602.1|  hypothetical protein VP1223 [Vibrio parahaem...  35.0    9.3   Gene info
ref|YP_658072.1|  nucleoside diphosphate sugar epimerase [Halo...  35.0    9.4   Gene info
ref|YP_094793.1|  dTDP-6-deoxy-L-mannose dehydrogenase RmlD [L...  35.0    9.4   Gene info
ref|ZP_02889361.1|  NAD-dependent epimerase/dehydratase [Burkh...  35.0    9.4  
ref|YP_002279512.1|  NAD-dependent epimerase/dehydratase [Rhiz...  35.0    9.4   Gene info
ref|NP_462812.1|  dTDP-glucose 4,6-dehydratase [Salmonella typ...  35.0    9.4   Gene info
emb|CAM77229.1|  UDP-sugar epimerase [Magnetospirillum gryphis...  35.0    9.5  
ref|ZP_02659300.1|  dTDP-glucose 4,6-dehydratase [Salmonella e...  35.0    9.7  
ref|ZP_02381928.1|  hypothetical protein BuboB_29678 [Burkhold...  35.0    9.7  
ref|YP_151089.1|  hypothetical protein SPA1866 [Salmonella ent...  35.0    9.7   Gene info
ref|ZP_03397408.1|  NAD-dependent epimerase/dehydratase family...  35.0    9.8  
ref|YP_002214860.1|  NAD dependent epimerase/dehydratase famil...  35.0    9.8   Gene info
emb|CAI94677.1|  putative TDP-glucose dehydratase [Streptomyce...  35.0    9.9  
ref|NP_967159.1|  dihydroflavonol-4-reductase [Bdellovibrio ba...  35.0    9.9   Gene info


>ref|ZP_01093586.1|  hypothetical 317 kDa protein-putative nucleoside-diphosphate 
sugar epimerase [Blastopirellula marina DSM 3645]
 gb|EAQ77792.1|  hypothetical 317 kDa protein-putative nucleoside-diphosphate 
sugar epimerase [Blastopirellula marina DSM 3645]
Length=456

 Score =  311 bits (797),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 162/332 (48%), Positives = 211/332 (63%), Gaps = 8/332 (2%)

Query  2    DEVSYQVPFGPLGNLADRVLGGRLVRRRLSQMFTARELRLKRDMAHHSKFGDSPRRKILV  61
            D V Y  P G LG    R+LGG  V  +L +MF  R   +  D+A H  + ++   KI +
Sbjct  110  DHVEYSPPGGSLG----RMLGGSFVTGKLERMFRYRHATMLADLAAHQPYRENRSMKIAI  165

Query  62   AGSSGMIGTQLVAFLDTGGHEVWRLVRRSPKEGKKELFWDPASGEMDAGILEGFDSIIHL  121
             G+SG++G QL AFL TGGH+V  + R   K+G   ++W+   GE+DA  L G D+++HL
Sbjct  166  TGASGLVGKQLSAFLSTGGHDVVPVTRSRDKQG---VYWNYKKGEIDAASLAGVDAVVHL  222

Query  122  GGEGIGDKRWSKKRKSAIRNSRVDSTTLLSEAIAKMKNKPEVFIVASAIGWYGDRGDEEL  181
             GEGI D RW++K+K+ IR+SRVD TT LS  +A + N P+  I ASAIG+YGD GD+ +
Sbjct  223  AGEGIADSRWNEKQKAKIRDSRVDGTTFLSNKLAALANPPKSLICASAIGYYGDSGDQPV  282

Query  182  TEESEIGEGFLPETCSDWEGASANLPDE-VRHVYLRSGIVLSGTGGALGKMLLPFKMGAG  240
             E S  GEGFLP+ C  WE + A      +R   +R G+VLS  GGAL KMLLPFK+G G
Sbjct  283  DETSLAGEGFLPDVCRAWELSCAPAASAGIRVANVRLGVVLSPQGGALAKMLLPFKLGVG  342

Query  241  GPMGNGKQWMSWISLDDEIYAIHHLLMETGSKGVYNLTAPNPVRQKTFAKTLGRVLKRPA  300
            G +G+GKQ+ SWI+LDD I AIHH LM     G  NLTAPNP   + F KTLGRVL+RP 
Sbjct  343  GVIGSGKQFWSWITLDDVIGAIHHCLMNDELVGPVNLTAPNPATNREFTKTLGRVLQRPT  402

Query  301  FAPLPGFVIKILFGEMGVKLTLESQKVFPDRL  332
              P+PGF  ++  GEM   L L S +V P RL
Sbjct  403  IFPMPGFAARLALGEMADDLLLASARVTPARL  434


>ref|ZP_02737688.1|  hypothetical protein GobsU_38117 [Gemmata obscuriglobus UQM 2246]
Length=466

 Score =  274 bits (700),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 149/338 (44%), Positives = 204/338 (60%), Gaps = 12/338 (3%)

Query  2    DEVSYQVPFGPLGNLADRVLGGRLVRRRLSQMFTARELRLKRDMAHHSKFGDSPRRKILV  61
            D + Y+VP G  G    RVLG  +V+RRL+Q+F  R      D+A H+KF D PR  + V
Sbjct  112  DRIEYRVPLGWPG----RVLGSGIVKRRLAQVFAYRHFITASDLARHAKFADRPRLTVAV  167

Query  62   AGSSGMIGTQLVAFLDTGGHEVWRLVR---RSP-KEGKKELFWDPASGEMDAGILEGFDS  117
             GS G++G++LV  L TGGH V RL+    R P  +G     W P    + +  LEG D+
Sbjct  168  TGSRGLVGSELVPLLTTGGHRVVRLLTGDARPPYDDGTTWTSWKP-DAPLASSALEGVDA  226

Query  118  IIHLGGEGIGDKRWSKKRKSAIRNSRVDSTTLLSEAIAKM--KNKPEVFIVASAIGWYGD  175
            ++HL G+ + + RW+  +K  I +SR   T  L +++  +  + +P+VF+ ASA+G+YGD
Sbjct  227  LVHLAGDNVAEGRWTAAKKQKIVDSRDGPTRALVQSLVALPAERRPKVFVCASAVGFYGD  286

Query  176  RGDEELTEESEIGEGFLPETCSDWEGASANLPDE-VRHVYLRSGIVLSGTGGALGKMLLP  234
            RG+EELTEES  G GF PE    WE A A   D  +R V LR G+VLS  GGALGK LL 
Sbjct  287  RGEEELTEESAAGTGFFPEVTKKWEEACAPARDAGIRVVNLRIGVVLSPKGGALGKQLLA  346

Query  235  FKMGAGGPMGNGKQWMSWISLDDEIYAIHHLLMETGSKGVYNLTAPNPVRQKTFAKTLGR  294
            FK G G  +G+G+Q++ WI+++D   AI+H LM     G  N+  PNPV  + F K LGR
Sbjct  347  FKAGGGAVLGSGRQFVPWITVNDTAGAIYHTLMNESVSGPVNIVGPNPVTNREFTKALGR  406

Query  295  VLKRPAFAPLPGFVIKILFGEMGVKLTLESQKVFPDRL  332
            VL RPAF  LP F ++ LFGE+  +  L S K  P +L
Sbjct  407  VLNRPAFLWLPRFALRALFGEIADEALLASMKARPAKL  444


>ref|YP_001530946.1| Gene info hypothetical protein Dole_3066 [Desulfococcus oleovorans Hxd3]
 gb|ABW68869.1| Gene info domain of unknown function DUF1731 [Desulfococcus oleovorans 
Hxd3]
Length=462

 GENE ID: 5695926 Dole_3066 | hypothetical protein
[Desulfococcus oleovorans Hxd3]

 Score =  266 bits (680),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 138/335 (41%), Positives = 199/335 (59%), Gaps = 8/335 (2%)

Query  1    VDEVSYQVPFGPLGNLADRVLGGRLVRRRLSQMFTARELRLKRDMAHHSKFGDSPRRKIL  60
            +D + Y++P  PL     R  G  LV  +L+++F  R      DMA H +F       +L
Sbjct  109  IDTIDYRLPLYPL----TRFPGKLLVENKLARIFAWRHRITAFDMALHRRFNKKGPMTVL  164

Query  61   VAGSSGMIGTQLVAFLDTGGHEVWRLVRRSPKEGKKELFWDPASGEMDAGILEG--FDSI  118
            ++G+SG++ + L+  L TGGH V RLVRR P   + E+FW+PA   +D   L+    D++
Sbjct  165  ISGASGVLASALIPLLTTGGHRVVRLVRRKP-SAENEVFWNPADNVIDTDALKNHTIDAV  223

Query  119  IHLGGEGIGDKRWSKKRKSAIRNSRVDSTTLLSEAIAKMKNKPEVFIVASAIGWYGDRGD  178
            IHL GE +G  RW+  +K  I +SR   T LL+E  A++  +P VF+ ASA G+YG+RG+
Sbjct  224  IHLAGEHVGTGRWTDAKKKTIIDSRQQGTRLLAETAARLSPRPGVFLCASATGFYGERGE  283

Query  179  EELTEESEIGEGFLPETCSDWEGASANLPDE-VRHVYLRSGIVLSGTGGALGKMLLPFKM  237
              LTE    G  FL + C  WE +     D  +R V +R G+VL+  GGAL ++LLPF++
Sbjct  284  AVLTENDGPGNDFLAKVCKIWEASVQPATDAGIRTVRMRIGVVLTPKGGALQRLLLPFQL  343

Query  238  GAGGPMGNGKQWMSWISLDDEIYAIHHLLMETGSKGVYNLTAPNPVRQKTFAKTLGRVLK  297
            G GG +GNG+Q++SWI +DD I AI +LLM     G  N+ +P+PV    F +TL  VL 
Sbjct  344  GMGGRLGNGRQYLSWIGIDDAIGAIFYLLMNETVSGPVNVVSPSPVTNAEFTRTLATVLC  403

Query  298  RPAFAPLPGFVIKILFGEMGVKLTLESQKVFPDRL  332
            RPA  P+P   I + FGEMG  + L S +V P +L
Sbjct  404  RPALMPVPATAIDLAFGEMGTTVLLTSTRVAPSKL  438


>gb|ABZ07560.1|  hypothetical protein ALOHA_HF4000ANIW137J11ctg1g13 [uncultured 
marine microorganism HF4000_ANIW137J11]
Length=484

 Score =  260 bits (665),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 152/334 (45%), Positives = 202/334 (60%), Gaps = 16/334 (4%)

Query  2    DEVSYQVPFGPLGNLADRVLGGRLVRRRLSQMFTARELRLKRDMAHHSKFGDSPRRKILV  61
            D V Y+ PFG LG    R +GG  V +R++Q+F  R    + D+  H +F    R ++ +
Sbjct  137  DLVEYEAPFGALG----RTVGG--VEQRIAQLFGYRHHVTRHDVEAHRRFPG--RLRVAI  188

Query  62   AGSSGMIGTQLVAFLDTGGHEVWRLVRRSPKEGKKELFWDPASGEMDAGILEGFDSIIHL  121
             G+SG+IG+ LV  L  GGH V R+VRR+P+ G+ E  W P    +  G LEG D+++HL
Sbjct  189  TGASGLIGSALVPLLTAGGHAVSRMVRRTPRAGEIE--WSPTRHYV--GPLEGHDAVVHL  244

Query  122  GGEGIGDK-RWSKKRKSAIRNSRVDSTTLLSEAIAKMKNKPEVFIVASAIGWYGDRGDEE  180
             GE +G   RWS  ++ AI  SR+  T LL+E +A M   P   I ASAIGWYGDRGDE 
Sbjct  245  AGENVGALLRWSPAKRRAIHESRIAGTRLLAEHLAAMVVPPRTLICASAIGWYGDRGDEL  304

Query  181  LTEESEIGEGFLPETCSDWEGAS-ANLPDEVRHVYLRSGIVLSGTGGALGKMLLPFKMG-  238
            L E++  G+ F      DWE A    L   +R V LR GIVLS   GAL +ML PF    
Sbjct  305  LNEDAPAGDDFFARVVRDWEAACEPALAAGIRVVNLRFGIVLSPQDGALPRMLPPFFAPL  364

Query  239  AGGPMGNGKQWMSWISLDDEIYAIHHLLMETGSKGVYNLTAPNPVRQKTFAKTLGRVLKR  298
            AGG +G G+QW SW++LDD I AIHH L +   +G +N+ A   VRQ+ FA T+G+VL+R
Sbjct  365  AGGSIGGGQQWWSWVALDDAIGAIHHALCDQRLRGPHNVVA-GAVRQRDFAATIGKVLRR  423

Query  299  PAFAPLPGFVIKILFGEMGVKLTLESQKVFPDRL  332
            PA  PLP FV+    GEMG  L L+S +V  +RL
Sbjct  424  PAVIPLPRFVVSGAMGEMGRSLLLDSTRVSSERL  457


>ref|ZP_01459687.1|  nucleoside-diphosphate sugar epimerase [Stigmatella aurantiaca 
DW4/3-1]
 gb|EAU69517.1|  nucleoside-diphosphate sugar epimerase [Stigmatella aurantiaca 
DW4/3-1]
Length=476

 Score =  254 bits (650),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 134/307 (43%), Positives = 199/307 (64%), Gaps = 2/307 (0%)

Query  25   LVRRRLSQMFTARELRLKRDMAHHSKFGDSPRRKILVAGSSGMIGTQLVAFLDTGGHEVW  84
              RR L +MF+ R   L+ D+  H+ F +     + V+G++G++G  LV FL  GGH V 
Sbjct  131  FARRTLERMFSYRHSVLRADLRRHAAFAEQGPLTVAVSGATGLVGRALVPFLTAGGHRVR  190

Query  85   RLVRRSPKEGKKELFWDPASGEMDAGILEGFDSIIHLGGEGIGDKRWSKKRKSAIRNSRV  144
            RLVR  P+  + ++ W+PA GE+DA  LEG D+++HL GE +  +RW+ + +  IR SR 
Sbjct  191  RLVRGRPEAARGDVAWNPAQGEIDAAALEGVDAVVHLAGENVA-QRWTPEAQDRIRRSRT  249

Query  145  DSTTLLSEAIAKMKNKPEVFIVASAIGWYGDRGDEELTEESEIGEGFLPETCSDWEGASA  204
            + T ++ EA+A++K KP V + ASA+G+YGDRG+  LTE S+ GEGFL     DWE A+A
Sbjct  250  EGTRVVCEALARLKRKPRVLVSASAVGFYGDRGEALLTEASDSGEGFLASVVRDWEAAAA  309

Query  205  NLPDE-VRHVYLRSGIVLSGTGGALGKMLLPFKMGAGGPMGNGKQWMSWISLDDEIYAIH  263
               D  +R V+LR G+VL  +GGAL KM+  F +G GG +G+G+QW+SWI+L+D +   H
Sbjct  310  PALDAGIRVVHLRIGLVLDASGGALAKMVPAFLLGGGGRVGSGQQWVSWIALEDVLGLAH  369

Query  264  HLLMETGSKGVYNLTAPNPVRQKTFAKTLGRVLKRPAFAPLPGFVIKILFGEMGVKLTLE  323
              LM+   +G  N  AP+ VRQ+ FA++LGRVL RP+  PLP   ++ +FG++G +  L 
Sbjct  370  FALMKPELRGPVNAVAPHAVRQEEFARSLGRVLSRPSVFPLPAVAVRTVFGQLGQEALLA  429

Query  324  SQKVFPD  330
               V P+
Sbjct  430  GAHVLPE  436


>ref|ZP_02131527.1|  domain of unknown function DUF1731 [Desulfatibacillum alkenivorans 
AK-01]
 gb|EDQ26824.1|  domain of unknown function DUF1731 [Desulfatibacillum alkenivorans 
AK-01]
Length=467

 Score =  253 bits (647),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 141/332 (42%), Positives = 200/332 (60%), Gaps = 7/332 (2%)

Query  2    DEVSYQVPFGPLGNLADRVLGGRLVRRRLSQMFTARELRLKRDMAHHSKFGDSPRRKILV  61
            D V Y++P   + + A     G    ++L  MFT R   + +D+A H K    P   I++
Sbjct  109  DNVEYRLPLSFVSSPA----AGWWTAKQLETMFTWRHETVLQDVALHKKLAAKPM-TIVI  163

Query  62   AGSSGMIGTQLVAFLDTGGHEVWRLVRRSPKEGKKELFWDPASGEMDAGILEGFDSIIHL  121
            +G+SGMIG  LV FL TGGH+V +LVRR P   + E+FWDP   +++   L+G D+IIHL
Sbjct  164  SGASGMIGRTLVPFLTTGGHKVKKLVRRQPAN-EDEIFWDPVHVKINPRDLDGADAIIHL  222

Query  122  GGEGIGDKRWSKKRKSAIRNSRVDSTTLLSEAIAKMKNKPEVFIVASAIGWYGDRGDEEL  181
             G+ IG   W+ K+K  I +SR   T LL++A A M  KP+VF+ ASAIG+YGD GD  +
Sbjct  223  AGDNIGQGLWTNKKKRRIIDSRELGTGLLAQAAAAMNPKPKVFLSASAIGFYGDTGDRLV  282

Query  182  TEESEIGEGFLPETCSDWEGASANLPDE-VRHVYLRSGIVLSGTGGALGKMLLPFKMGAG  240
            +E    G  F+ E C  WE A+    D  +R V  R G+VLS  GGAL + L  F+MG G
Sbjct  283  SESDGPGVLFISEVCDRWEKAAQPAVDAGIRTVLGRIGVVLSPQGGALAEFLPLFRMGLG  342

Query  241  GPMGNGKQWMSWISLDDEIYAIHHLLMETGSKGVYNLTAPNPVRQKTFAKTLGRVLKRPA  300
            G +G+GKQ++SW+ +DD + A+ HL+     +G  N+  P PV    F +TL  VLKRPA
Sbjct  343  GKVGSGKQYLSWLGIDDAVGALFHLVCSDKVEGPVNIVGPEPVSNLEFTRTLAGVLKRPA  402

Query  301  FAPLPGFVIKILFGEMGVKLTLESQKVFPDRL  332
            F P+P F +  +FGE G ++ L S +V  ++L
Sbjct  403  FFPVPAFAVDAVFGEKGREVVLASARVSAEKL  434


>ref|ZP_01307004.1|  hypothetical 317 kDa protein-putative nucleoside-diphosphate 
sugar epimerase [Oceanobacter sp. RED65]
 gb|EAT12485.1|  hypothetical 317 kDa protein-putative nucleoside-diphosphate 
sugar epimerase [Oceanobacter sp. RED65]
Length=296

 Score =  253 bits (645),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 132/271 (48%), Positives = 174/271 (64%), Gaps = 4/271 (1%)

Query  58   KILVAGSSGMIGTQLVAFLDTGGHEVWRLVRRSPKEGKKELFWDPASGEMDAGILEGFDS  117
             IL++G+SG+IGT L+ +L+  GH V++L  R  + G    +W P  G +        D+
Sbjct  2    NILISGASGLIGTALMQYLEEQGHTVYKL-HRDKQIG--SFYWKPEFGHIHLDSRIHLDA  58

Query  118  IIHLGGEGIGDKRWSKKRKSAIRNSRVDSTTLLSEAIAKMKNKPEVFIVASAIGWYGDRG  177
            +I+L G  IGDK W++ RK AI ++R+ ST +L+EAI+K   KP VFI ASAIG+YGD G
Sbjct  59   VINLNGVNIGDKPWTQSRKKAILDTRIQSTQVLAEAISKRSQKPSVFISASAIGFYGDTG  118

Query  178  DEELTEESEIGEGFLPETCSDWEGASANLPDE-VRHVYLRSGIVLSGTGGALGKMLLPFK  236
             E   E S  G+ FL +    WE AS    D  +R V +R+G+VL   GGAL KMLLPFK
Sbjct  119  SEWADESSPSGKNFLSDIAKHWEQASRAAKDAGIRTVNIRTGVVLDKKGGALAKMLLPFK  178

Query  237  MGAGGPMGNGKQWMSWISLDDEIYAIHHLLMETGSKGVYNLTAPNPVRQKTFAKTLGRVL  296
            +G GG +G G+Q+MSWISL DEI AI H+L  T   G  NLTAP PV    F KTLG VL
Sbjct  179  LGLGGRVGTGEQYMSWISLTDEIRAIEHILQNTSISGPVNLTAPEPVTNDDFTKTLGSVL  238

Query  297  KRPAFAPLPGFVIKILFGEMGVKLTLESQKV  327
            KRP   P+P F++K++FGEMG  L L S ++
Sbjct  239  KRPTVFPMPAFIVKLVFGEMGDLLLLGSNRI  269


>ref|ZP_01857906.1|  hypothetical 317 kDa protein-putative nucleoside-diphosphate 
sugar epimerase [Planctomyces maris DSM 8797]
 gb|EDL56223.1|  hypothetical 317 kDa protein-putative nucleoside-diphosphate 
sugar epimerase [Planctomyces maris DSM 8797]
Length=299

 Score =  251 bits (642),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 172/278 (61%), Gaps = 3/278 (1%)

Query  58   KILVAGSSGMIGTQLVAFLDTG-GHEVWRLVRRSPKEGK-KELFWDPASGEMDAGILEGF  115
            K+L++GSSG++G+ L   LD    +E  RLVR+   E +   + W P S  MD  +  G 
Sbjct  2    KLLISGSSGLVGSHLCQKLDADPAYETVRLVRKQSAEKQGTTVLWQPGSDCMDLSLFAGI  61

Query  116  DSIIHLGGEGIGDKRWSKKRKSAIRNSRVDSTTLLSEAIAKMKNKPEVFIVASAIGWYGD  175
            D++IHLGG  I DKRWS + K  I NSRV ST+LL+ ++A+++  P  FI ASAIG+YGD
Sbjct  62   DAVIHLGGVNIADKRWSPEIKQKIYNSRVQSTSLLANSMAQLEQPPATFICASAIGYYGD  121

Query  176  RGDEELTEESEIGEGFLPETCSDWEGASANLPDE-VRHVYLRSGIVLSGTGGALGKMLLP  234
            RGDE L E S  G GFLP+ C  WE A+    D  VR V  R G++L   GGALG+ML P
Sbjct  122  RGDERLDENSPRGTGFLPDVCEGWETATQPARDAGVRVVNTRFGMILDKQGGALGQMLTP  181

Query  235  FKMGAGGPMGNGKQWMSWISLDDEIYAIHHLLMETGSKGVYNLTAPNPVRQKTFAKTLGR  294
            FK G GG +G+G Q+ SWI+L D + AI   L  +  +G  N  AP+ V    F KTLG+
Sbjct  182  FKFGVGGKLGSGSQYWSWIALPDVVNAILFCLQHSEIQGPVNFVAPDEVTNLEFTKTLGK  241

Query  295  VLKRPAFAPLPGFVIKILFGEMGVKLTLESQKVFPDRL  332
            VL RP   P+P + I  +FGEMG  L L S +V P +L
Sbjct  242  VLARPTCLPVPAWAINTIFGEMGQALMLCSARVTPQKL  279


>ref|YP_629798.1| Gene info hypothetical protein MXAN_1546 [Myxococcus xanthus DK 1622]
 gb|ABF87207.1| Gene info conserved hypothetical protein [Myxococcus xanthus DK 1622]
Length=473

 GENE ID: 4104810 MXAN_1546 | hypothetical protein [Myxococcus xanthus DK 1622]
(10 or fewer PubMed links)

 Score =  243 bits (621),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 145/331 (43%), Positives = 196/331 (59%), Gaps = 6/331 (1%)

Query  2    DEVSYQVPFGPLGNLADRVLGGRLVRRRLSQMFTARELRLKRDMAHHSKFGDSPRRKILV  61
            DEV Y +P G LG+L     GG   RR L +MF  R      D+  H+ F       I V
Sbjct  113  DEVEYVLPVGTLGSL----FGGGFARRTLERMFAYRHRVTLEDLKRHAAFAGQGPLTIAV  168

Query  62   AGSSGMIGTQLVAFLDTGGHEVWRLVRRSPKEGKKELFWDPASGEMDAGILEGFDSIIHL  121
             G+SG++G+ LV FL TGGH V R+VR      + E+ W P +GE+D   LEG D ++HL
Sbjct  169  TGASGLVGSSLVPFLTTGGHTVKRMVRGKADPARNEVAWSPDTGEVDTDALEGVDVVVHL  228

Query  122  GGEGIGDKRWSKKRKSAIRNSRVDSTTLLSEAIAKMKNKPEVFIVASAIGWYGDRGDEEL  181
             G  +  +RW+ + K AI  SR   T  L+EA+A+MK KP+V + A     YGDRGDE L
Sbjct  229  AGVNVAGQRWTPEYKDAILKSRTQGTRTLAEALARMKRKPKVLVSAGGSSIYGDRGDEVL  288

Query  182  TEESEI-GEGFLPETCSDWEGASANLPDE-VRHVYLRSGIVLSGTGGALGKMLLPFKMGA  239
             EES   G+GFL +   +WE A+A      +R V+LR G VL    GAL KML  F  G 
Sbjct  289  AEESSTDGKGFLSQVSREWEAAAAPAEAAGIRVVHLRIGPVLDAREGALAKMLPAFLAGG  348

Query  240  GGPMGNGKQWMSWISLDDEIYAIHHLLMETGSKGVYNLTAPNPVRQKTFAKTLGRVLKRP  299
            GGP+G+G+QWMSW+SL+D +  IH  +    ++G  N  AP  VRQ  FA+TLG+VL+RP
Sbjct  349  GGPIGSGQQWMSWVSLEDLLGLIHFSVFTDAARGAINAVAPGAVRQADFARTLGKVLRRP  408

Query  300  AFAPLPGFVIKILFGEMGVKLTLESQKVFPD  330
            A  P+P  V++ LFG+MG +  L+  ++ P 
Sbjct  409  AVFPVPSPVVRTLFGQMGQEALLDGARIAPQ  439


>ref|YP_001856036.1| Gene info hypothetical protein KRH_21830 [Kocuria rhizophila DC2201]
 dbj|BAG30530.1| Gene info hypothetical protein [Kocuria rhizophila DC2201]
Length=477

 GENE ID: 6239039 KRH_21830 | hypothetical protein [Kocuria rhizophila DC2201]
(10 or fewer PubMed links)

 Score =  242 bits (618),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 144/331 (43%), Positives = 198/331 (59%), Gaps = 10/331 (3%)

Query  4    VSYQVPFGPLGNLADRV--LGGRLVRRRLSQMFTARELRLKRDMAHHSKFGDSPRRKILV  61
            +  +V   PL   A R+  +G R++  +L+++F  RE +LK D+A H +  D PR  I V
Sbjct  121  IQDRVTVRPLPQWAGRLNDVGERVMTPQLNRIFAYRERQLKADLAFHDQH-DGPRLTIAV  179

Query  62   AGSSGMIGTQLVAFLDTGGHEVWRLVRRSPKEGKKELFWDPASGEMDAGILEGFDSIIHL  121
            AGSSG++GTQ+ A L+TGGH V R+ +R    G   + WDP  G ++   LEG D ++HL
Sbjct  180  AGSSGLVGTQVCALLETGGHTVIRM-KRGASTGDGVIGWDPDKGVLNPHDLEGVDVVVHL  238

Query  122  GGEGIGDKRWSKKRKSAIRNSRVDSTTLLSEAIAKM--KNKPEVFIVASAIGWYGD-RGD  178
            GG  I   R++ + K  I NSRVDST LL  A+ ++  + +P   +V+SA+G+YG  RGD
Sbjct  239  GGASIA-TRFTAENKKKIMNSRVDSTELLVRALGQVPAEKRPRALVVSSAVGYYGTGRGD  297

Query  179  EELTEESEIGEGFLPETCSDWE-GASANLPDEVRHVYLRSGIVLSGTGGALGKMLLPFKM  237
            E LTE+S  G+GFL E C  WE  A       +R V +R+G+VLS TGG L   L   + 
Sbjct  298  EVLTEDSPSGDGFLAEVCRAWERAAHGATAYGMRVVNIRTGLVLSPTGGLLKPQLPLMEA  357

Query  238  GAGGPMGNGKQWMSWISLDDEIYAIHHLLMETGSKGVYNLTAPNPVRQKTFAKTLGRVLK  297
            G  GP+G G+QW SWI LDD   A+ HL +   ++G +N+ AP PVRQK FAKT+  VL 
Sbjct  358  GLSGPLGGGQQWQSWIGLDDMAGAVAHLALSEDAEGPFNVAAPQPVRQKQFAKTVAGVLH  417

Query  298  RPAFAPLPGFVIKILFGEMGV-KLTLESQKV  327
            RPA  P P    K L G     +L   SQ+V
Sbjct  418  RPAVVPTPLAGPKALLGTQATEELVAASQRV  448

ORF finding

PROTOCOLE: SMS ORF FINDER, paramètres : "any codon", cadre 1,2,3 sens direct et indirect, 60 codons minimum, code génétique bactérien

---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

Nous avons fait la recherche d'ORF avec les mêmes paramètres mais en utilisant le code standard : 
nous avons obtenu les mêmes résultats qu'avec le code bactérien.

On obtient 3 ORF sur le brin direct (un dans chaque cadre de lecture) et 5 ORF sur le brin indirect (2 
dans le cadre 1 et 3 dans le cadre 3 de lecture).

L'ORF le plus grand est situé sur le brin direct dans le cadre 1 de lecture (nucléotide 1 au nucléotide 
996 en incluant le codon "STOP"). C'est à partir de cet ORF que nous ferons les diverses analyses. 

Cet ORF est assez grand pour dire qu'il s'agit d'une séquence codante (332 acides aminés).

La traduction de cet ORF ne commence pas par une méthionine. Nous avons donc réalisé une recherche 
d'orf sur le sens direct, dans le cadre 1 de lecture, afin de déterminer si nous avions le début de la 
séquence protéique. On obtient en effet un orf du nucléotide 97 au nucléotide 996 (en incluant le codon 
"STOP"). Il est donc possible que nous ayions le début d'une séquence protéique ; l'alignement multiple 
nous permettra cependant de déterminer si cet atg correspond bien à un codon d'initiation, ou s'il s'agit 
d'une méthionine entrant dans la composition de la séquence protéique. D'autre part, cet ORF ne se 
termine pas par un codon STOP : la fin de la séquence codante se situe en 3' de la séquence analysée. 

Etant donné que l'on n'obtient qu'un fragment de la protéine, on ne peut pas calculer le poids 
moléculaire.

---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:

SMS ORF FINDER, paramètres : "any codon", cadre 1,2,3 sens direct, 60 codons minimum, code génétique bactérien

>ORF number 1 in reading frame 1 on the direct strand extends from base 1 to base 996.
GTGGACGAGGTCAGCTACCAAGTCCCCTTTGGACCTCTAGGAAACCTAGCTGACAGAGTT
CTGGGCGGTAGGTTGGTCAGGAGACGCCTCTCTCAGATGTTCACTGCAAGGGAACTTCGT
CTCAAGAGGGACATGGCTCATCATTCGAAGTTCGGCGACTCTCCTCGAAGAAAAATCCTG
GTGGCCGGTTCGTCCGGGATGATAGGTACCCAACTGGTTGCCTTCCTAGATACCGGGGGG
CATGAGGTTTGGAGATTGGTCAGAAGGAGCCCCAAAGAGGGTAAGAAGGAGCTCTTCTGG
GATCCGGCTTCGGGAGAAATGGATGCAGGAATTCTGGAAGGATTCGACTCTATCATCCAC
CTCGGAGGAGAGGGGATCGGTGACAAGAGATGGAGCAAGAAGAGGAAGAGCGCCATCAGG
AATTCCAGAGTGGATAGTACTACCCTGCTTTCGGAGGCAATAGCGAAGATGAAGAATAAG
CCGGAGGTTTTCATCGTGGCGAGTGCGATTGGCTGGTATGGAGACCGTGGCGATGAGGAG
CTGACCGAGGAGAGTGAGATTGGAGAGGGTTTCCTCCCAGAGACCTGCTCGGATTGGGAA
GGTGCATCCGCAAACCTCCCCGATGAAGTAAGACATGTTTACCTTAGGTCGGGCATCGTA
CTCTCAGGGACCGGTGGCGCTCTGGGCAAGATGCTGCTGCCCTTCAAGATGGGAGCTGGA
GGACCAATGGGCAATGGGAAGCAGTGGATGTCGTGGATATCCCTCGACGACGAGATATAC
GCCATCCACCACCTGCTGATGGAAACCGGTTCCAAGGGAGTGTACAACCTGACTGCACCA
AACCCAGTCAGGCAGAAGACATTCGCAAAGACTCTGGGCAGGGTATTGAAGAGGCCTGCA
TTCGCCCCCCTACCGGGTTTTGTTATCAAAATCTTGTTCGGAGAGATGGGAGTAAAGTTG
ACGCTGGAAAGTCAGAAAGTTTTCCCCGACCGGCTC

>Translation of ORF number 1 in reading frame 1 on the direct strand.
VDEVSYQVPFGPLGNLADRVLGGRLVRRRLSQMFTARELRLKRDMAHHSKFGDSPRRKIL
VAGSSGMIGTQLVAFLDTGGHEVWRLVRRSPKEGKKELFWDPASGEMDAGILEGFDSIIH
LGGEGIGDKRWSKKRKSAIRNSRVDSTTLLSEAIAKMKNKPEVFIVASAIGWYGDRGDEE
LTEESEIGEGFLPETCSDWEGASANLPDEVRHVYLRSGIVLSGTGGALGKMLLPFKMGAG
GPMGNGKQWMSWISLDDEIYAIHHLLMETGSKGVYNLTAPNPVRQKTFAKTLGRVLKRPA
FAPLPGFVIKILFGEMGVKLTLESQKVFPDRL

>ORF number 1 in reading frame 2 on the direct strand extends from base 230 to base 463.
ATACCGGGGGGCATGAGGTTTGGAGATTGGTCAGAAGGAGCCCCAAAGAGGGTAAGAAGG
AGCTCTTCTGGGATCCGGCTTCGGGAGAAATGGATGCAGGAATTCTGGAAGGATTCGACT
CTATCATCCACCTCGGAGGAGAGGGGATCGGTGACAAGAGATGGAGCAAGAAGAGGAAGA
GCGCCATCAGGAATTCCAGAGTGGATAGTACTACCCTGCTTTCGGAGGCAATAG

>Translation of ORF number 1 in reading frame 2 on the direct strand.
IPGGMRFGDWSEGAPKRVRRSSSGIRLREKWMQEFWKDSTLSSTSEERGSVTRDGARRGR
APSGIPEWIVLPCFRRQ*

>ORF number 1 in reading frame 3 on the direct strand extends from base 648 to base 998.
GTCGGGCATCGTACTCTCAGGGACCGGTGGCGCTCTGGGCAAGATGCTGCTGCCCTTCAA
GATGGGAGCTGGAGGACCAATGGGCAATGGGAAGCAGTGGATGTCGTGGATATCCCTCGA
CGACGAGATATACGCCATCCACCACCTGCTGATGGAAACCGGTTCCAAGGGAGTGTACAA
CCTGACTGCACCAAACCCAGTCAGGCAGAAGACATTCGCAAAGACTCTGGGCAGGGTATT
GAAGAGGCCTGCATTCGCCCCCCTACCGGGTTTTGTTATCAAAATCTTGTTCGGAGAGAT
GGGAGTAAAGTTGACGCTGGAAAGTCAGAAAGTTTTCCCCGACCGGCTCTT

>Translation of ORF number 1 in reading frame 3 on the direct strand.
VGHRTLRDRWRSGQDAAALQDGSWRTNGQWEAVDVVDIPRRRDIRHPPPADGNRFQGSVQ
PDCTKPSQAEDIRKDSGQGIEEACIRPPTGFCYQNLVRRDGSKVDAGKSESFPRPAL

--------------------------------------------------------------------------------------------------

SMS ORF FINDER, paramètres : "any codon", cadre 1,2,3 sens indirect, 60 codons minimum, code génétique bactérien

>ORF number 1 in reading frame 1 on the reverse strand extends from base 28 to base 360.
CTTTCCAGCGTCAACTTTACTCCCATCTCTCCGAACAAGATTTTGATAACAAAACCCGGT
AGGGGGGCGAATGCAGGCCTCTTCAATACCCTGCCCAGAGTCTTTGCGAATGTCTTCTGC
CTGACTGGGTTTGGTGCAGTCAGGTTGTACACTCCCTTGGAACCGGTTTCCATCAGCAGG
TGGTGGATGGCGTATATCTCGTCGTCGAGGGATATCCACGACATCCACTGCTTCCCATTG
CCCATTGGTCCTCCAGCTCCCATCTTGAAGGGCAGCAGCATCTTGCCCAGAGCGCCACCG
GTCCCTGAGAGTACGATGCCCGACCTAAGGTAA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
LSSVNFTPISPNKILITKPGRGANAGLFNTLPRVFANVFCLTGFGAVRLYTPLEPVSISR
WWMAYISSSRDIHDIHCFPLPIGPPAPILKGSSILPRAPPVPESTMPDLR*

>ORF number 2 in reading frame 1 on the reverse strand extends from base 361 to base 858.
ACATGTCTTACTTCATCGGGGAGGTTTGCGGATGCACCTTCCCAATCCGAGCAGGTCTCT
GGGAGGAAACCCTCTCCAATCTCACTCTCCTCGGTCAGCTCCTCATCGCCACGGTCTCCA
TACCAGCCAATCGCACTCGCCACGATGAAAACCTCCGGCTTATTCTTCATCTTCGCTATT
GCCTCCGAAAGCAGGGTAGTACTATCCACTCTGGAATTCCTGATGGCGCTCTTCCTCTTC
TTGCTCCATCTCTTGTCACCGATCCCCTCTCCTCCGAGGTGGATGATAGAGTCGAATCCT
TCCAGAATTCCTGCATCCATTTCTCCCGAAGCCGGATCCCAGAAGAGCTCCTTCTTACCC
TCTTTGGGGCTCCTTCTGACCAATCTCCAAACCTCATGCCCCCCGGTATCTAGGAAGGCA
ACCAGTTGGGTACCTATCATCCCGGACGAACCGGCCACCAGGATTTTTCTTCGAGGAGAG
TCGCCGAACTTCGAATGA

>Translation of ORF number 2 in reading frame 1 on the reverse strand.
TCLTSSGRFADAPSQSEQVSGRKPSPISLSSVSSSSPRSPYQPIALATMKTSGLFFIFAI
ASESRVVLSTLEFLMALFLFLLHLLSPIPSPPRWMIESNPSRIPASISPEAGSQKSSFLP
SLGLLLTNLQTSCPPVSRKATSWVPIIPDEPATRIFLRGESPNFE*

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 90 to base 335.
GGGGGCGAATGCAGGCCTCTTCAATACCCTGCCCAGAGTCTTTGCGAATGTCTTCTGCCT
GACTGGGTTTGGTGCAGTCAGGTTGTACACTCCCTTGGAACCGGTTTCCATCAGCAGGTG
GTGGATGGCGTATATCTCGTCGTCGAGGGATATCCACGACATCCACTGCTTCCCATTGCC
CATTGGTCCTCCAGCTCCCATCTTGAAGGGCAGCAGCATCTTGCCCAGAGCGCCACCGGT
CCCTGA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
GGECRPLQYPAQSLCECLLPDWVWCSQVVHSLGTGFHQQVVDGVYLVVEGYPRHPLLPIA
HWSSSSHLEGQQHLAQSATGP*

>ORF number 2 in reading frame 3 on the reverse strand extends from base 336 to base 773.
GAGTACGATGCCCGACCTAAGGTAAACATGTCTTACTTCATCGGGGAGGTTTGCGGATGC
ACCTTCCCAATCCGAGCAGGTCTCTGGGAGGAAACCCTCTCCAATCTCACTCTCCTCGGT
CAGCTCCTCATCGCCACGGTCTCCATACCAGCCAATCGCACTCGCCACGATGAAAACCTC
CGGCTTATTCTTCATCTTCGCTATTGCCTCCGAAAGCAGGGTAGTACTATCCACTCTGGA
ATTCCTGATGGCGCTCTTCCTCTTCTTGCTCCATCTCTTGTCACCGATCCCCTCTCCTCC
GAGGTGGATGATAGAGTCGAATCCTTCCAGAATTCCTGCATCCATTTCTCCCGAAGCCGG
ATCCCAGAAGAGCTCCTTCTTACCCTCTTTGGGGCTCCTTCTGACCAATCTCCAAACCTC
ATGCCCCCCGGTATCTAG

>Translation of ORF number 2 in reading frame 3 on the reverse strand.
EYDARPKVNMSYFIGEVCGCTFPIRAGLWEETLSNLTLLGQLLIATVSIPANRTRHDENL
RLILHLRYCLRKQGSTIHSGIPDGALPLLAPSLVTDPLSSEVDDRVESFQNSCIHFSRSR
IPEELLLTLFGAPSDQSPNLMPPGI*

>ORF number 3 in reading frame 3 on the reverse strand extends from base 774 to base 953.
GAAGGCAACCAGTTGGGTACCTATCATCCCGGACGAACCGGCCACCAGGATTTTTCTTCG
AGGAGAGTCGCCGAACTTCGAATGATGAGCCATGTCCCTCTTGAGACGAAGTTCCCTTGC
AGTGAACATCTGAGAGAGGCGTCTCCTGACCAACCTACCGCCCAGAACTCTGTCAGCTAG


>Translation of ORF number 3 in reading frame 3 on the reverse strand.
EGNQLGTYHPGRTGHQDFSSRRVAELRMMSHVPLETKFPCSEHLREASPDQPTAQNSVS*


--------------------------------------------------------------------------------------------------

SMS ORF FINDER, paramètres : atg, cadre 1 sens direct, 60 codons minimum, code génétique bactérien

>ORF number 1 in reading frame 1 on the direct strand extends from base 97 to base 996.
ATGTTCACTGCAAGGGAACTTCGTCTCAAGAGGGACATGGCTCATCATTCGAAGTTCGGC
GACTCTCCTCGAAGAAAAATCCTGGTGGCCGGTTCGTCCGGGATGATAGGTACCCAACTG
GTTGCCTTCCTAGATACCGGGGGGCATGAGGTTTGGAGATTGGTCAGAAGGAGCCCCAAA
GAGGGTAAGAAGGAGCTCTTCTGGGATCCGGCTTCGGGAGAAATGGATGCAGGAATTCTG
GAAGGATTCGACTCTATCATCCACCTCGGAGGAGAGGGGATCGGTGACAAGAGATGGAGC
AAGAAGAGGAAGAGCGCCATCAGGAATTCCAGAGTGGATAGTACTACCCTGCTTTCGGAG
GCAATAGCGAAGATGAAGAATAAGCCGGAGGTTTTCATCGTGGCGAGTGCGATTGGCTGG
TATGGAGACCGTGGCGATGAGGAGCTGACCGAGGAGAGTGAGATTGGAGAGGGTTTCCTC
CCAGAGACCTGCTCGGATTGGGAAGGTGCATCCGCAAACCTCCCCGATGAAGTAAGACAT
GTTTACCTTAGGTCGGGCATCGTACTCTCAGGGACCGGTGGCGCTCTGGGCAAGATGCTG
CTGCCCTTCAAGATGGGAGCTGGAGGACCAATGGGCAATGGGAAGCAGTGGATGTCGTGG
ATATCCCTCGACGACGAGATATACGCCATCCACCACCTGCTGATGGAAACCGGTTCCAAG
GGAGTGTACAACCTGACTGCACCAAACCCAGTCAGGCAGAAGACATTCGCAAAGACTCTG
GGCAGGGTATTGAAGAGGCCTGCATTCGCCCCCCTACCGGGTTTTGTTATCAAAATCTTG
TTCGGAGAGATGGGAGTAAAGTTGACGCTGGAAAGTCAGAAAGTTTTCCCCGACCGGCTC


>Translation of ORF number 1 in reading frame 1 on the direct strand.
MFTARELRLKRDMAHHSKFGDSPRRKILVAGSSGMIGTQLVAFLDTGGHEVWRLVRRSPK
EGKKELFWDPASGEMDAGILEGFDSIIHLGGEGIGDKRWSKKRKSAIRNSRVDSTTLLSE
AIAKMKNKPEVFIVASAIGWYGDRGDEELTEESEIGEGFLPETCSDWEGASANLPDEVRH
VYLRSGIVLSGTGGALGKMLLPFKMGAGGPMGNGKQWMSWISLDDEIYAIHHLLMETGSK
GVYNLTAPNPVRQKTFAKTLGRVLKRPAFAPLPGFVIKILFGEMGVKLTLESQKVFPDRL