GOS 711020

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091120566126
Annotathon code: GOS_711020
Sample :
  • GPS :0°35'38s; 91°4'10w
  • Galapagos Islands: Mangrove on Isabella Island - Ecuador
  • Mangrove (-0.1m, 25.4°C, 0.1-0.8 microns)
Authors
Team : BioCell2008
Username : fowen
Annotated on : 2009-02-04 21:56:41
  • FORAY Chloé
  • WENGLER Aude

Synopsis

  • Taxonomy: Crenarchaeota (NCBI info)
    Rank: phylum - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 28889
    Kingdom: Archaea - Phylum: Crenarchaeota - Class: - Order:
    Archaea; Crenarchaeota;

Genomic Sequence

>JCVI_READ_1091120566126 GOS_711020 genomic DNA
CGGCTAGATATTTTGGACAAAGTATTGGCATATTATATTTAGGAAAGATTGTAGAGTTTGGACCAATCAATGAAGTATTGCTAAAACCAAAGCATCCCTA
TACTCAAGCACTCATTGATGCAATATCAGAACCAGATCCAGAAAATCTTTACAAAGAAAAGAAAATTCGAATTAATGAGCCATTAGAGATAGATATCTAC
AAGGGATGTAGGTTCAGAGCAAGATGCCCATATGCTATTGAAAAATGCATAGAAGAGCCAAAATTAGTTAACATAGGTGACGAGCATCATGTTTCATGTT
TTGTGGAATTAGATTAACTTGTTTGTAATGATGGTACGTTACGTTTGTCTTTGTATGTAACTACTTGTGAAACACCATTTTTTGGATATACACCATAAAT
TAATTTGGCTTTTTGAACAACAGAATCCTTCAATGATACCATAATGAATTGGCTTTCTTGGGATCTTTCATCTAGAATTTTTGATAGGCGTTCAGAGTTT
GGAGCATCAAGGTGAGCATCAACTTCATCAAATAGATAAAATGGTGAAGGTTTGAGTTTTTGCAGTGCCAAAACAAAGACTATTGCAGCTAGTGTCTTTT
CACCACCACTAATTGAGGTTGATTCTCTTTTTGGTTTATTGGGGAATTGAATTAGATATGACAAACCTGAATTAAAGATATCATCTTCATTTTGTATTTC
AAGCCATGCGTTTCCTCCAGTCATCTTATTGAATATAGTACGAATTTCTTTATCTACAATATCAAATGCATCCAAGAATGTTTGTTTTTTATCCCTTTCA
ATTTTTTCAATAAAGTTAACTATTGATGTACGTTCTCCTTCAAGGGAGTTCTTTCTTACAGACATGGAGCGATATCCATAAGAAACATCCATGTATTGCT
CTGGGGCTTTGCCATTAAGTGCAGTGAGGGATTTTTGCTCTGTGTTAAGTCCCTGTATGATTGACTCTACATCAAAGTCTTCAAGTTCATCAG

Translation

[3 - 677/993]   indirect strand
>GOS_711020 Translation [3-677   indirect strand]
DELEDFDVESIIQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQ
NEDDIFNSGLSYLIQFPNKPKRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKDSVVQKAKLIYG
VYPKNGVSQVVTYKDKRNVPSLQTS

[ Warning ] 5' incomplete: does not start with a Methionine

Phylogeny

PROTOCOLE: Phylogeny.fr, ProtPars/DnaPars, ProtDist/DnaDist-Neighbor et PhyML, step by step

---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

Nous avons raciné notre arbre avec A_stercorihominis_firmicutes_ pour la méthode ProtPars/DnaPars et 
avec S_cerevisiae_eukaryotes_ pour la méthode par ProtDist/DnaDist-Neighbor car ces 2 séquences 
appartiennent au groupe extérieur.

Les deux arbres obtenus ne sont pas congruents dans leur totalité mais sont congruents au niveau des
sous-groupes. En effet, on voit bien que tous les sous-groupes sont bien séparés les uns des autres
et on constate que les cyanobacteria sont proches des methanomicrobia, des archaeoglobales et des 
halobacteria, et que les aquificales sont proches des thermococcales et des methanococcales. On peut
penser que ces rapprochements seraient dûs à des transferts horizontaux de gènes.

D'après ces résultats, on ne peut rien conclure quand à l'appartenance de notre séquence à un groupe
particulier. Cependant, il semble que notre séquence appartienne aux crenarchaeotes car elle est à 
la racine de ce groupe. 

Afin de vérifier si notre séquence appartient bien aux crenarchaeotes et plus généralement aux archaea 
(notre groupe d'étude), nous avons réalisé un arbre par la méthode PhyML.

L'arbre obtenu par PhyML nous donne des résultats intéressants car la phylogénie de notre gène 
correspond tout à fait à la phylogénie de référence. En effet, les bacteria, les eukaryotes et les
archaea forment bien 3 groupes séparés et les sous-groupes sont bien séparés les uns des autres. 
Cependant, on retrouve les sous-groupes des aquificales et des cyanobacteria (appartenant aux 
bacteria) dans le groupe des archaea et plus précisément dans le sous-groupe des euryarchaeotes ce 
qui nous permet de dire qu'il y a eu des transferts horizontaux de gènes d'archaea vers les 
aquificales et les cyanobacteria.

D'après les résultats de cet arbre, on peut conclure que notre séquence appartient bien à notre 
groupe d'étude et plus précisément au sous-groupe des crenarchaeotes car elle est bien nichée au 
milieu de ce sous-groupe. 

---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:


ProtDist/DnaDist-Neighbor Results

 
                            +-----------Geobacter_sp [d-proteobacteria]    
             +--------------2 
          +-16              +---------G_bemidjiensis [d-proteobacteria]    
          !  !  
     +---17  +----------------------------marine_gamma_proteobacterium [g-proteobacteria]    
     !    !  
     !    +----------------------------G_obscuriglobus [planctomycetales]    
     !  
     !                                    +------H_marismortui_halobacteria [euryarchaeotes]    
     !                         +---------14  
     !                      +-21          +------H_lacusprofundi_halobacteria [euryarchaeotes]   
     !                      !  !  
     !                   +-22  +-----------------M_thermophila_methanomicrobia [euryarchaeotes]    
     !                   !  !  
     !                +-23  +---------------------C_Methanoregula_methanomicrobia [euryarchaeotes]    
     !                !  !  
     !                !  +--------------------A_fulgidus_archaeoglobales [euryarchaeotes]    
     !            +--24  
     !            !   !                 +--------N_spumigena [cyanobacteria]    
     !            !   !               +-8 
     !            !   +---------------9 +--------Lyngbya_sp [cyanobacteria]    
  +-19            !                   ! 
  !  !            !                   +----------Synechocystis_sp [cyanobacteria]    
  !  !            !  
  !  !            !                         +----P_horikoshii_thermococcales [euryarchaeotes]     
  !  !            !                      +-11  
  !  !         +-29        +------------12  +----P_furiosus_thermococcales [euryarchaeotes]  
  !  !         !  !        !             !  
  !  !         !  !     +-25             +------T_kodakarensis_thermococcales [euryarchaeotes]     
  !  !         !  !     !  !  
  !  !         !  !     !  !               +----------M_voltae_methanococcales [euryarchaeotes]     
  !  !         !  !     !  +--------------10  
  !  !         !  !  +-28                  +--------M_jannaschii_methanococcales [euryarchaeotes]    
  !  !         !  !  !  !  
  !  !         !  !  !  !                +-----------Hydrogenivirga [aquificales]    
  !  !         !  !  !  !            +--13  
  !  !         !  +-30  +-----------15   +----------A_aeolicus [aquificales]    
  !  !         !     !               !  
  !  !         !     !               +----------------Hydrogenobaculum_sp [aquificales]   
  !  +--------27     !  
  !            !     +------------------------------P_torridus_thermoplasmatales [euryarchaeotes]    
  !            !  
  !            !                               +--------N_maritimus_thermoproteales [crenarchaeotes]    
  !            !                             +-4 
  !            !                             ! !           +uncultured_m_crenarchaeote_thermoplasmatales [crenarchaeotes]     
  !            !                        +----5 +-----------1 
  !            !                        !    !             +uncultured_m_crenarchaeote2_thermoplasmatales [crenarchaeotes]    
  !            !  +---------------------6    ! 
  !            !  !                     !    +-------------C_symbiosum_thermoproteales [crenarchaeotes]     
  !            !  !                     ! 
  !            !  !                     +GOS_711020     
  !            +-26  
  !               !                        +---------------V_polyspora [eukaryotes]    
  !               !  +---------------------3 
  !               +-20                     +---------------P_tritici-repentis [eukaryotes]    
  !                  !  
  !                  +----------------------------------------S_cerevisiae [eukaryotes]    
  !  
  !          +-----------C_eutactus [firmicutes]    
 18----------7 
  !          +-----------R_lactaris [firmicutes]    
  !  
  +------------------------A_stercorihominis [firmicutes] 


---------------------------------------------------------------------------------------------------


ProtPars/DnaPars Results


                                                                        +------H_marismortui_halobacteria [euryarchaeotes]
                                                                 +--1.0-|
                                                          +--1.0-|      +------H_lacusprofundi_halobacteria [euryarchaeotes]
                                                          |      |
                                                   +--0.5-|      +-------------M_thermophila_methanomicrobia [euryarchaeotes]
                                                   |      |
                                                   |      |             +------C_Methanoregula_methanomicrobia [euryarchaeotes]
                                                   |      +---------0.5-|
                                     +---------1.0-|                    +------A_fulgidus_archaeoglobales [euryarchaeotes]
                                     |             |
                                     |             |                    +------Lyngbya_sp [cyanobacteria]
                                     |             |             +--1.0-|
                                     |             +---------1.0-|      +------N_spumigena [cyanobacteria]
                                     |                           |
                                     |                           +-------------Synechocystis_sp [cyanobacteria]
                                     |
                              +--1.0-|                                  +------uncultured_m_crenarchaeote2_thermoproteales [crenarchaeotes]
                              |      |                           +--1.0-|
                              |      |                    +--1.0-|      +------uncultured_m_crenarchaeote_thermoproteales [crenarchaeotes]
                              |      |                    |      |
                              |      |             +--1.0-|      +-------------N_maritimus_thermoproteales [crenarchaeotes]
                              |      |             |      |
                       +--1.0-|      |      +--1.0-|      +--------------------C_symbiosum_thermoproteales [crenarchaeotes]
                       |      |      |      |      |
                       |      |      +--1.0-|      +---------------------------GOS_711020
                       |      |             |
                       |      |             +----------------------------------P_torridus_thermoplasmatales [euryarchaeotes]
                       |      |
                       |      |                                         +------M_jannaschii_methanococcales [euryarchaeotes]
                +--1.0-|      +-------------------------------------1.0-|
                |      |                                                +------M_voltae_methanococcales [euryarchaeotes]
                |      |
                |      |                                                +------Hydrogenivirga [aquificales]
                |      |                                         +--1.0-|
                |      |                                  +--1.0-|      +------A_aeolicus [aquificales]
                |      |                                  |      |
                |      |                                  |      +-------------Hydrogenobaculum_sp [aquificales]
                |      +------------------------------1.0-|
                |                                         |             +------P_horikoshii_thermococcales [euryarchaeotes]
                |                                         |      +--1.0-|
                |                                         +--1.0-|      +------P_furiosus_thermococcales [euryarchaeotes]
         +--1.0-|                                                |
         |      |                                                +-------------T_kodakarensis_thermococcales [euryarchaeotes]
         |      |
         |      |                                                       +------Geobacter_sp [d-proteobacteria]
         |      |                                                +--1.0-|
         |      |                                                |      +------G_bemidjiensis [d-proteobacteria]
         |      |                                         +--1.0-|
         |      |                                         |      |      +------G_obscuriglobus [planctomycetales]
         |      |                                         |      +--1.0-|
  +------|      |                                  +--1.0-|             +------marine_gamma_proteobacterium [g-proteobacteria]
  |      |      |                                  |      |
  |      |      |                                  |      |             +------R_lactaris [firmicutes]
  |      |      +------------------------------1.0-|      +---------1.0-|
  |      |                                         |                    +------C_eutactus [firmicutes]
  |      |                                         |
  |      |                                         +---------------------------A_stercorihominis [firmicutes]
  |      |
  |      |                                                              +------P_tritici-repentis [eukaryotes]
  |      +----------------------------------------------------------1.0-|
  |                                                                     +------V_polyspora [eukaryotes]
  |
  +----------------------------------------------------------------------------S_cerevisiae [eukaryotes]



----------------------------------------------------------------------------------------------------


PhyML Results


            +uncultured_m_crenarchaeote2_thermoproteales [crenarchaeotes]     
     +------1  
     |      +uncultured_m_crenarchaeote_thermoproteales [crenarchaeotes]     
     |  
     |                                    +--M_jannaschii_methanococcales [euryarchaeotes]    
     |                           +--------7  
     |                           |        +-----M_voltae_methanococcales [euryarchaeotes]    
     |                           |  
     |                        +--6         +-------Hydrogenobaculum_sp [aquificales]    
     |                        |  |  +------9  
     |                        |  |  |      |  +----A_aeolicus [aquificales]    
     |                        |  |  |      +-10  
     |                        |  +--8         +-----Hydrogenivirga [aquificales]    
     |                        |     |  
     |                        |     |      +--T_kodakarensis_thermococcales [euryarchaeotes]    
     |                        |     +-----11  
     |                        |            |  +-P_furiosus_thermococcales [euryarchaeotes]     
     |                        |            +-12  
     |                        |               +--P_horikoshii_thermococcales [euryarchaeotes]    
     |                     +--5  
     |                     |  |               +----Synechocystis_sp [cyanobacteria]    
     |                     |  |     +--------15  
     |                     |  |     |         |  +---Lyngbya_sp [cyanobacteria]    
  +--2                     |  |     |         +-16  
  |  |                     |  |  +-14            +---N_spumigena [cyanobacteria]    
  |  |                     |  |  |  |  
  |  |                     |  |  |  |  +----------A_fulgidus_archaeoglobales [euryarchaeotes]    
  |  |                     |  |  |  +-17  
  |  |                     |  |  |     |  +------------C_Methanoregula_methanomicrobia [euryarchaeotes]    
  |  |                     |  |  |     +-18  
  |  |                     |  +-13        |  +---------M_thermophila_methanomicrobia [euryarchaeotes]    
  |  |                     |     |        +-19  
  |  |                     |     |           |     +---H_lacusprofundi_halobacteria [euryarchaeotes]    
  |  |                     |     |           +----20  
  |  |  +------------------4     |                 +---H_marismortui_halobacteria [euryarchaeotes]   
  |  |  |                  |     |  
  |  |  |                  |     +-----------------P_torridus_thermoplasmatales [euryarchaeotes]    
  |  |  |                  |  
  |  |  |                  |              +---------------marine_gamma_proteobacterium [g-proteobacteria]    
  |  |  |                  |           +-24  
  |  |  |                  |           |  |       +----G_bemidjiensis [d-proteobacteria]    
  |  |  |                  |        +-23  +------25  
  |  |  |                  |        |  |          +-----Geobacter_sp [d-proteobacteria]    
  |  |  |                  |        |  |  
  |  |  |                  |  +----22  +-----------------G_obscuriglobus [planctomycetales]    
  |  |  |                  |  |     |  
  |  +--3                  |  |     |  +-------------A_stercorihominis [firmicutes]   
  |     |                  |  |     +-26  
  |     |                  |  |        |     +-----R_lactaris [firmicutes]    
  |     |                  +-21        +----27  
  |     |                     |              +----C_eutactus [firmicutes]   
  |     |                     |  
  |     |                     |    +---------------------S_cerevisiae [eukaryotes]    
  |     |                     +---28  
  |     |                          |           +-------P_tritici-repentis [eukaryotes]    
  |     |                          +----------29  
  |     |                                      +-------V_polyspora [eukaryotes]    
  |     |  
  |     +------C_symbiosum_thermoproteales [crenarchaeotes]     
  |  
 30-GOS_711020     
  |  
  +--N_maritimus_thermoproteales [crenarchaeotes]     

Annotator commentaries

Les recherches d'ORF par ORF Finder ont permis d'identifier 3 ORF. L'ORF le plus long se situe sur le brin indirect dans le cadre 3 de lecture (nucléotides 3 à 377). Au vu de sa taille, on peut supposer que notre ORF est codant. La séquence protéique obtenue à partir de cet ORF contient 225 acides aminés et nous permettra de réaliser la suite des analyses. La masse moléculaire ne peut être déterminée avec exactitude car l'ORF est incomplet. En effet, grâce à l'alignement multiple, on constate que notre séquence est beaucoup plus courte que les séquences homologues étudiées : il manque environ 950 acides aminés en amont de notre ORF. Notre étude se limite donc à une portion restreinte du gène impliqué (notre ORF ne constitue que la partie C-terminale).


L'analyse de notre protéine avec InterProScan a permis l'identification d'un domaine potentiel : le domaine RecF/RecN/SMC protein, N-terminal (e-value : 1.4e-12), qui possède une fonction ATPasique (hydrolyse de l'ATP en ADP). De plus, le BLAST P contre nr confirme ces résultats : on obtient de nombreuses protéines homologues qui sont, pour la plupart, des protéines SMC à fonction ATPasique impliquées dans la réplication et la ségrégation des chromosomes. L'objectif de l'alignement multiple est de vérifier que notre ORF s'intègre correctement dans la famille de ses orthologues présumés et de chercher des régions conservées dans notre ORF. Il sert aussi à faire l'arbre phylogénétique. Grâce à cet alignement multiple, on peut voir que notre ORF présente de très nombreuses régions conservées, notamment entre les acides aminés 90 et 200 de notre séquence ce qui correspond au domaine RecF/RecN/SMC protein, N-terminal. Cette région étant très bien conservée entre notre séquence et les différents homologues, il y a de fortes chances pour que notre protéine possède la même fonction que les homologues, c'est-à-dire la fonction conférée par le domaine RecF/RecN/SMC protein, N-terminal : fonction ATPasique. Ceci montre bien que notre ORF s'intègre correctement dans la famille de ses orthologues.


D'aprés les résultats comparés du BLAST et de la recherche interpro, nous pensons que le fragment protéique issu de notre ORF est la partie C-terminale d'une protéine SMC ATPasique impliquée dans la réplication et la ségrégation des chromosomes lors de la mitose. Nous avons donc choisi "cell cycle" comme "processus biologique". La "fonction ATPasique" impliquant l'hydrolyse de l'ATP en ADP, nous avons choisi "hydrolase activity" comme "fonction moléculaire".


Le rapport taxonomique nous a permis de définir les archaea comme groupe d'étude, et les bacteria et les eukaryotes comme groupe extérieur. Les arbres phylogénétiques obtenus par parcimonie et par distance ne nous donnent pas des résultats pertinents car ils ne sont pas congruents dans leur totalité. En revanche, l'arbre obtenu par PhyML nous permet de conclure quant à l'appartenance de notre séquence à un groupe taxonomique particulier : notre ORF étant niché au sein du groupe des crenarchaeotes, il appartient donc à notre groupe d'étude, et plus précisément au groupe des crenarchaeotes, avec lequel l'homologie est la plus importante (E value très faibles). En outre, on a remarqué qu'il y avait eu des transferts horizontaux de gènes d'archaea vers les aquificales et les cyanobacteria.





Multiple Alignement

PROTOCOLE: EBI, CLUSTAL W2, paramètres par défaut

---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

Pour réaliser cet alignement multiple, nous avons choisi, parmi les meilleurs scores et les 
meilleures E value, 15 séquences appartenant aux archaea (les 4 crenarchaeotes et 11 euryarchaeotes),
13 séquences appartenant aux bacteria (3 cyanobacteria, 3 aquificales, 3 firmicutes, 
2 d-proteobacteria, 1 planctomycetales et 1 g-proteobacteria) et 3 séquences appartenant aux 
eukaryotes (3 fungi).

Les séquences homologues sont relativement bien alignées, en particulier entre les acides aminés 90 
et 200 de notre séquence, ce qui correspond au domaine RecF/RecN/SMC protein, N-terminal. Cette 
région étant très bien conservée entre notre séquence et les différents homologues, il y a de fortes 
chances pour que notre protéine possède la même fonction que les homologues, c'est-à-dire la fonction 
conférée par le domaine RecF/RecN/SMC protein, N-terminal.

D'après l'alignement multiple, il semble que notre orf soit beaucoup plus court que les séquences 
homologues étudiées. Ceci confirme que le codon d'initiation est bien en amont de la séquence. Notre 
Orf constitue donc un très petit fragment du gène (partie C-terminale seulement).

---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:


CLUSTAL 2.0.10 multiple sequence alignment


N.maritimus_thermoproteales_        --------------------------------------------------
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      --------------------------------------------------
uncultured.m.crenarchaeote2_th      --------------------------------------------------
C.symbiosum_thermoproteales_        --------------------------------------------------
P.horikoshii_thermococcales_        --------------------------------------------------
P.furiosus_thermococcales_          --------------------------------------------------
T.kodakarensis_thermococcales_      --------------------------------------------------
M.voltae_methanococcales_           --------------------------------------------------
M.jannaschii_methanococcales_       --------------------------------------------------
Hydrogenivirga_aquificales_         --------------------------------------------------
A.aeolicus_aquificales_             --------------------------------------------------
Hydrogenobaculum.sp_aquificale      --------------------------------------------------
H.marismortui_halobacteria_         --------------------------------------------------
H.lacusprofundi_halobacteria_       --------------------------------------------------
M.thermophila_methanomicrobia_      --------------------------------------------------
C.Methanoregula_methanomicrobi      --------------------------------------------------
A.fulgidus_archaeoglobales_         --------------------------------------------------
N.spumigena_cyanobacteria_          --------------------------------------------------
Lyngbya.sp_cyanobacteria_           --------------------------------------------------
Synechocystis.sp_cyanobacteria      --------------------------------------------------
P.torridus_thermoplasmatales_       --------------------------------------------------
V.polyspora_eukaryotes_             MPKTPLSKRPKLVEANLNANELDHNDDDQ------RYNRQEIKVSPT--- 41
P.tritici-repentis_eukaryotes_      MASESPRKSTRAAATRRRAPVIDSDDENRTPTPEVKNEEEEEEFTPAPAP 50
C.eutactus_firmicutes_              --------------------------------------------------
R.lactaris_firmicutes_              --------------------------------------------------
A.stercorihominis_firmicutes_       --------------------------------------------------
Geobacter.sp_d-proteobacteria_      --------------------------------------------------
G.bemidjiensis_d-proteobacteri      --------------------------------------------------
G.obscuriglobus_planctomycetal      --------------------------------------------------
marine.gamma.proteobacterium_g      --------------------------------------------------
S.cerevisiae_eukaryotes_            --------------------------------------------------
                                                                                      

N.maritimus_thermoproteales_        --------------------------------------------------
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      --------------------------------------------------
uncultured.m.crenarchaeote2_th      --------------------------------------------------
C.symbiosum_thermoproteales_        --------------------------------------------------
P.horikoshii_thermococcales_        --------------------------------------------------
P.furiosus_thermococcales_          --------------------------------------------------
T.kodakarensis_thermococcales_      --------------------------------------------------
M.voltae_methanococcales_           --------------------------------------------------
M.jannaschii_methanococcales_       --------------------------------------------------
Hydrogenivirga_aquificales_         --------------------------------------------------
A.aeolicus_aquificales_             --------------------------------------------------
Hydrogenobaculum.sp_aquificale      --------------------------------------------------
H.marismortui_halobacteria_         --------------------------------------------------
H.lacusprofundi_halobacteria_       --------------------------------------------------
M.thermophila_methanomicrobia_      --------------------------------------------------
C.Methanoregula_methanomicrobi      --------------------------------------------------
A.fulgidus_archaeoglobales_         --------------------------------------------------
N.spumigena_cyanobacteria_          --------------------------------------------------
Lyngbya.sp_cyanobacteria_           --------------------------------------------------
Synechocystis.sp_cyanobacteria      --------------------------------------------------
P.torridus_thermoplasmatales_       --------------------------------------------------
V.polyspora_eukaryotes_             --------------TQDAAAVSHLNFKSQT-------PKKLILRDYDS-- 68
P.tritici-repentis_eukaryotes_      LKTGRGRGRPKKAPAQDAEATPKPAARRRTRVTESAEPTQMFTPAPESSR 100
C.eutactus_firmicutes_              --------------------------------------------------
R.lactaris_firmicutes_              --------------------------------------------------
A.stercorihominis_firmicutes_       --------------------------------------------------
Geobacter.sp_d-proteobacteria_      --------------------------------------------------
G.bemidjiensis_d-proteobacteri      --------------------------------------------------
G.obscuriglobus_planctomycetal      --------------------------------------------------
marine.gamma.proteobacterium_g      --------------------------------------------------
S.cerevisiae_eukaryotes_            --------------------------------------------------
                                                                                      

N.maritimus_thermoproteales_        --------------------------------------------------
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      --------------------------------------------------
uncultured.m.crenarchaeote2_th      --------------------------------------------------
C.symbiosum_thermoproteales_        --------------------------------------------------
P.horikoshii_thermococcales_        --------------------------------------------------
P.furiosus_thermococcales_          --------------------------------------------------
T.kodakarensis_thermococcales_      --------------------------------------------------
M.voltae_methanococcales_           --------------------------------------------------
M.jannaschii_methanococcales_       --------------------------------------------------
Hydrogenivirga_aquificales_         --------------------------------------------------
A.aeolicus_aquificales_             --------------------------------------------------
Hydrogenobaculum.sp_aquificale      --------------------------------------------------
H.marismortui_halobacteria_         --------------------------------------------------
H.lacusprofundi_halobacteria_       --------------------------------------------------
M.thermophila_methanomicrobia_      --------------------------------------------------
C.Methanoregula_methanomicrobi      --------------------------------------------------
A.fulgidus_archaeoglobales_         --------------------------------------------------
N.spumigena_cyanobacteria_          --------------------------------------------------
Lyngbya.sp_cyanobacteria_           --------------------------------------------------
Synechocystis.sp_cyanobacteria      --------------------------------------------------
P.torridus_thermoplasmatales_       --------------------------------------------------
V.polyspora_eukaryotes_             IAITPTAAMP------PSSSLQAP-------------SLHP--------- 90
P.tritici-repentis_eukaryotes_      RAASPSKAVPKKRGRKPRASVAPPPAEETSQLITPEPSVSPEPDQAPEAA 150
C.eutactus_firmicutes_              --------------------------------------------------
R.lactaris_firmicutes_              --------------------------------------------------
A.stercorihominis_firmicutes_       --------------------------------------------------
Geobacter.sp_d-proteobacteria_      --------------------------------------------------
G.bemidjiensis_d-proteobacteri      --------------------------------------------------
G.obscuriglobus_planctomycetal      --------------------------------------------------
marine.gamma.proteobacterium_g      --------------------------------------------------
S.cerevisiae_eukaryotes_            --------------------------------------------------
                                                                                      

N.maritimus_thermoproteales_        --------------------------------------------------
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      --------------------------------------------------
uncultured.m.crenarchaeote2_th      --------------------------------------------------
C.symbiosum_thermoproteales_        --------------------------------------------------
P.horikoshii_thermococcales_        --------------------------------------------------
P.furiosus_thermococcales_          --------------------------------------------------
T.kodakarensis_thermococcales_      --------------------------------------------------
M.voltae_methanococcales_           --------------------------------------------------
M.jannaschii_methanococcales_       --------------------------------------------------
Hydrogenivirga_aquificales_         --------------------------------------------------
A.aeolicus_aquificales_             --------------------------------------------------
Hydrogenobaculum.sp_aquificale      --------------------------------------------------
H.marismortui_halobacteria_         --------------------------------------------------
H.lacusprofundi_halobacteria_       --------------------------------------------------
M.thermophila_methanomicrobia_      --------------------------------------------------
C.Methanoregula_methanomicrobi      --------------------------------------------------
A.fulgidus_archaeoglobales_         --------------------------------------------------
N.spumigena_cyanobacteria_          --------------------------------------------------
Lyngbya.sp_cyanobacteria_           --------------------------------------------------
Synechocystis.sp_cyanobacteria      --------------------------------------------------
P.torridus_thermoplasmatales_       --------------------------------------------------
V.polyspora_eukaryotes_             --------------PTESSSRGRTARTYSQSPPRSPARSP-ARSPTRKLE 125
P.tritici-repentis_eukaryotes_      EVTEATEATITPGSPMEDVVMGNTEEETTPVPEPQPEPQPEPAAEITQIE 200
C.eutactus_firmicutes_              --------------------------------------------------
R.lactaris_firmicutes_              --------------------------------------------------
A.stercorihominis_firmicutes_       --------------------------------------------------
Geobacter.sp_d-proteobacteria_      --------------------------------------------------
G.bemidjiensis_d-proteobacteri      --------------------------------------------------
G.obscuriglobus_planctomycetal      --------------------------------------------------
marine.gamma.proteobacterium_g      --------------------------------------------------
S.cerevisiae_eukaryotes_            --------------------------------------------------
                                                                                      

N.maritimus_thermoproteales_        --------------------------------------------------
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      --------------------------------------------------
uncultured.m.crenarchaeote2_th      --------------------------------------------------
C.symbiosum_thermoproteales_        --------------------------------------------------
P.horikoshii_thermococcales_        --------------------------------------------------
P.furiosus_thermococcales_          --------------------------------------------------
T.kodakarensis_thermococcales_      --------------------------------------------------
M.voltae_methanococcales_           --------------------------------------------------
M.jannaschii_methanococcales_       --------------------------------------------------
Hydrogenivirga_aquificales_         --------------------------------------------------
A.aeolicus_aquificales_             --------------------------------------------------
Hydrogenobaculum.sp_aquificale      --------------------------------------------------
H.marismortui_halobacteria_         --------------------------------------------------
H.lacusprofundi_halobacteria_       --------------------------------------------------
M.thermophila_methanomicrobia_      --------------------------------------------------
C.Methanoregula_methanomicrobi      --------------------------------------------------
A.fulgidus_archaeoglobales_         --------------------------------------------------
N.spumigena_cyanobacteria_          --------------------------------------------------
Lyngbya.sp_cyanobacteria_           --------------------------------------------------
Synechocystis.sp_cyanobacteria      --------------------------------------------------
P.torridus_thermoplasmatales_       --------------------------------------------------
V.polyspora_eukaryotes_             LIQLSPVKNSRIALQ---------KIYESKNEKQ---------------- 150
P.tritici-repentis_eukaryotes_      AKEETPVPEAETEVEPIPNPQPPAKVMEELNTQQTMLEPIDIVVKRRAAA 250
C.eutactus_firmicutes_              --------------------------------------------------
R.lactaris_firmicutes_              --------------------------------------------------
A.stercorihominis_firmicutes_       --------------------------------------------------
Geobacter.sp_d-proteobacteria_      --------------------------------------------------
G.bemidjiensis_d-proteobacteri      --------------------------------------------------
G.obscuriglobus_planctomycetal      --------------------------------------------------
marine.gamma.proteobacterium_g      --------------------------------------------------
S.cerevisiae_eukaryotes_            --------------------------------------------------
                                                                                      

N.maritimus_thermoproteales_        ------------MVHVKKVEIFGFKSFGFKNTTVQFEPGLVSISGPNGSG 38
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      ------------MVHIKKVDIFGFKSFGFKNTSVNFEPGLVSISGPNGSG 38
uncultured.m.crenarchaeote2_th      ------------MVHIKKVDIFGFKSFGFKNTSVNFEPGLVSISGPNGSG 38
C.symbiosum_thermoproteales_        ------------MVHIRKVEIFGFKSFGFRNTSVEFRPGLVSISGPNGSG 38
P.horikoshii_thermococcales_        ------------MPYIERLELKGFKSYGNKKVVILFSRGFTAIVGANGSG 38
P.furiosus_thermococcales_          ------------MPYIEKLELKGFKSYGNKKVVIPFSKGFTAIVGANGSG 38
T.kodakarensis_thermococcales_      -----------MMPYIEKIEMKGFKSYGNKKVVVPLARGFTAIVGANGSG 39
M.voltae_methanococcales_           ------------MISISEIHLKNFKSFKNTKLKIP--DGFTAILGPNGSG 36
M.jannaschii_methanococcales_       ------------MVTLEKIELKNFKSFKKLSLDIP--KGFTAIVGPNGSG 36
Hydrogenivirga_aquificales_         -----------MKAFVEKIVVEGFKSYGRELKEIPIGSGFVAIVGPNGAG 39
A.aeolicus_aquificales_             ---------MEKRAYIEKIVVEGFKSYGTKRKEIPLGEGFIAVVGPNGAG 41
Hydrogenobaculum.sp_aquificale      ----------MENAYIEKIVVTNFKSYGTEKLEIPIGEGFIGIVGPNGAG 40
H.marismortui_halobacteria_         -------------MHIKELVLDNFKSFG-RKTRIPFYEDFTTISGPNGSG 36
H.lacusprofundi_halobacteria_       -------------MHITEVVLDGFKSFG-RTTRIPFYDDFTVVTGPNGSG 36
M.thermophila_methanomicrobia_      -------------MHIKEIELRNFKSFG-RRALVQLKKDFIVVTGPNGSG 36
C.Methanoregula_methanomicrobi      -------------MHITELEIDNFKSFS-KKTKIPFLEGFTVISGPNGSG 36
A.fulgidus_archaeoglobales_         -------------MHIEKIRLKNFKSFG-KKAEIPFFKGFTVITGPNGSG 36
N.spumigena_cyanobacteria_          ------------MVHVKRVELTNFKSFG-GTTSVPLLPGFTVISGPNGSG 37
Lyngbya.sp_cyanobacteria_           ------------MVHIKRVELTNFKSFG-GTTDIPLLPGFTVVSGPNGSG 37
Synechocystis.sp_cyanobacteria      ------------MVYVKRIELSHFKSFG-GTTAIPFLPGFTVVSGPNGSG 37
P.torridus_thermoplasmatales_       -------------MFIESIEIDNFKSYG-KKTKIYFKPGFTVIIGPNGSG 36
V.polyspora_eukaryotes_             ----------IERLCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSG 190
P.tritici-repentis_eukaryotes_      LPAMHEPVAPAQRTVITWLVLNNFKSYAGRQEVGPFHASFSSVVGPNGSG 300
C.eutactus_firmicutes_              -------------MYLKSIEVNGFKSFA-NKIVFKFNHGITCIVGPNGSG 36
R.lactaris_firmicutes_              -------------MYLKSIEVQGFKSFA-NKIKFEFHNGITGIVGPNGSG 36
A.stercorihominis_firmicutes_       -------------MYLKKVEIYGFKSFG-QKVEIIFDNKVTGIVGPNGSG 36
Geobacter.sp_d-proteobacteria_      -------------MKIKRVDIIGFKSFH-DKVSLDFQQCITGIVGPNGCG 36
G.bemidjiensis_d-proteobacteri      -------------MKIKRLEIHGFKSFQ-DKAVLDFNQPITGVVGPNGCG 36
G.obscuriglobus_planctomycetal      --------------MLKRLELVGFKSFA-DKTRFDFAPGVTGVVGPNGSG 35
marine.gamma.proteobacterium_g      -------------MRLKTIKLAGFKSFV-DPTNVSFPSNLGCVVGPNGCG 36
S.cerevisiae_eukaryotes_            ------------MGRLVGLELSNFKSYRGVTKVGFGESNFTSIIGPNGSG 38
                                                                                      

N.maritimus_thermoproteales_        KSNILDAIIFAMGENK-PKVMRVDKLRSLIHDIEGNRR-----GPKMARS 82
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      KSNILDAIVFAMGENK-ARVMRQPNLRSLIHDIDGNRH-----GPKLTRV 82
uncultured.m.crenarchaeote2_th      KSNILDAIVFAMGENK-ARVMRQPNLRSLIHDIDGNRH-----GPKLTRV 82
C.symbiosum_thermoproteales_        KSNILDAIIFALGENR-PKAMRVGRLSGLMHDIEGSRR-----GPKMTRA 82
P.horikoshii_thermococcales_        KSNIGDAILFVLGGLS-AKAMRASRISDLIFAGSKREP-----PAKYAEV 82
P.furiosus_thermococcales_          KSNIGDAILFVLGGLS-AKAMRASRISDLIFAGSKNEP-----PAKYAEV 82
T.kodakarensis_thermococcales_      KSNIGDAVLFVLGGLS-AKAMRASRISDLIFAGSKGEP-----PAKYAEV 83
M.voltae_methanococcales_           KSNTIDGICFVLGKTS-AKSLRAGKFNQLITYHNGKR-------ADYAEV 78
M.jannaschii_methanococcales_       KSNIVDAILFVLGKTS-AKKLRANRFSGLITYHNGKR-------ADFAEV 78
Hydrogenivirga_aquificales_         KSNIGDALSFALGIAT-TKTLRAKNLSYLIFSRDGEK-------APYAYV 81
A.aeolicus_aquificales_             KSNIGDAISFALGLSS-AKALRAKNLSYLIFSKNGQK-------ADHAYV 83
Hydrogenobaculum.sp_aquificale      KSNIGDAISFGLGLST-SKTMRAKNLTHLIYSKQGQR-------EDFAQV 82
H.marismortui_halobacteria_         KSNIIDAILFALGLAR-TSGIRAEKLTDLIYNPGHADEDAEYDGERQASV 85
H.lacusprofundi_halobacteria_       KSNIIDGVLFALGLAR-TRGIRAKKLTDLIYNPGHDGGEAS-DGPNEASV 84
M.thermophila_methanomicrobia_      KSNIIDALLFSLCLTS-SRAMRAERLPDLIYR-GDDG-----RAPDFAEV 79
C.Methanoregula_methanomicrobi      KSNIIDSILFVLALSS-SRNLRAEKLTDLINLNSGKN---------IAEV 76
A.fulgidus_archaeoglobales_         KSNIIDSILFCLGLSTSTKQLRAERLTDLVHN-----------GRSEAEV 75
N.spumigena_cyanobacteria_          KSNILDALLFCLGLSS-SKGMRADRLPDLVNNNQTSRG----RASIEASV 82
Lyngbya.sp_cyanobacteria_           KSNILDALLFALGLSS-SKGMRAERLPDLVNNSQSRK------TTVETRV 80
Synechocystis.sp_cyanobacteria      KSNILDALLFCLGLAT-SKGMRAERLPDLVNNTFKGN-----RGSSEASV 81
P.torridus_thermoplasmatales_       KSNIGDAILFVLGIRS-NKTVRIERLSDLIHKSEKSSR-------NYCYV 78
V.polyspora_eukaryotes_             KSNVIDSMLFVFGFRA--SKMRQDRLSDLIHKSENFPD------LKSCSV 232
P.tritici-repentis_eukaryotes_      KSNVIDSLLFVFGFRA--SKMRQSKLSALIHNSAAFPD------LDYCEV 342
C.eutactus_firmicutes_              KSNVADAVRWVLGEQS-AKSLRGSKMEDVIFSGTQLRK-----PQGSAYV 80
R.lactaris_firmicutes_              KSNVADAVRWVLGEQR-VKQLRGGSMQDVIFSGTENRK-----PLSYASV 80
A.stercorihominis_firmicutes_       KSNIVDAIRWVLGEQR-VKTLRGGKMEDVIFSGTEEKR-----ALGYAFV 80
Geobacter.sp_d-proteobacteria_      KSNVVDAIRWVMGEQS-AKNLRGKQMEDIIFGGSESRK-----PLGMAEV 80
G.bemidjiensis_d-proteobacteri      KSNVVDAIRWVMGEQS-AKNLRGKSMEDIIFGGTEFRK-----PLGMAEV 80
G.obscuriglobus_planctomycetal      KSNVVDAVRWILGEQS-PKSLRGGEMADVIFNGSSSRK-----SLGMAEV 79
marine.gamma.proteobacterium_g      KSNIIDAVRWVMGESS-AKNLRGENMTDVIFNGSINRQ-----PVGQASI 80
S.cerevisiae_eukaryotes_            KSNMMDAISFVLGVRS--NHLRSNILKDLIYRGVLNDE----NSDDYDNE 82
                                                                                      

N.maritimus_thermoproteales_        SVHFDNSDRK---------------------------------------I 93
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      RVQFDNSDRK---------------------------------------I 93
uncultured.m.crenarchaeote2_th      RVQFDNSDRK---------------------------------------I 93
C.symbiosum_thermoproteales_        SVHFDNSDRR---------------------------------------I 93
P.horikoshii_thermococcales_        TIYFNNEDR---------------------------------------GF 93
P.furiosus_thermococcales_          AIYFNNEDR---------------------------------------GF 93
T.kodakarensis_thermococcales_      AMYFNNEDR---------------------------------------GF 94
M.voltae_methanococcales_           TLFFDNINR---------------------------------------EI 89
M.jannaschii_methanococcales_       CLYFTNENN---------------------------------------AF 89
Hydrogenivirga_aquificales_         EVHFRNEG----------------------------------------AF 91
A.aeolicus_aquificales_             EVHFKNLG----------------------------------------AF 93
Hydrogenobaculum.sp_aquificale      DIHFSNPQ----------------------------------------IF 92
H.marismortui_halobacteria_         EVILANDDRT--------------------------LSRSQVVNAAGTED 109
H.lacusprofundi_halobacteria_       TVVLSNEDGT--------------------------LDRSQVVSAAGTEN 108
M.thermophila_methanomicrobia_      TVRLDNSTRT--------------------------MP------------ 91
C.Methanoregula_methanomicrobi      AIAFSDG------------------------------------------- 83
A.fulgidus_archaeoglobales_         AILFSENGK----------------------------------------- 84
N.spumigena_cyanobacteria_          TVTFDLSGE----DVSRRGAEARREEEEEEFPQSPLPTPDSP-------- 120
Lyngbya.sp_cyanobacteria_           TVTFDLSEDNHLWSAMKRNGKFYADEELEELETDHSSETNGSQTTEEAET 130
Synechocystis.sp_cyanobacteria      SVTFELHDG----------------ENLSEPGANHNGNGNGAKIS----- 110
P.torridus_thermoplasmatales_       ELNINDNGN----------------------------------------- 87
V.polyspora_eukaryotes_             EVHFEYVIDK---------------------------------PDGTTII 249
P.tritici-repentis_eukaryotes_      EVHFQEVKDL---------------------------------PNGGHEV 359
C.eutactus_firmicutes_              AITLDNSDHS------------------------------------LPID 94
R.lactaris_firmicutes_              AITLDNSDHK------------------------------------LPVE 94
A.stercorihominis_firmicutes_       SITIDNTTGI------------------------------------LPSE 94
Geobacter.sp_d-proteobacteria_      SLVFSTEDGR------------------------------------VPAK 94
G.bemidjiensis_d-proteobacteri      SLFFSTEDGR------------------------------------VPAK 94
G.obscuriglobus_planctomycetal      TVAFDNARR---------------------------------------LL 90
marine.gamma.proteobacterium_g      ELVFDNSDGTVG------------------------------------GE 94
S.cerevisiae_eukaryotes_            GAASSNPQSAY----------------------------------VKAFY 98
                                                                                      

N.maritimus_thermoproteales_        PVDSDNVEITREMDANGENTYYLNK------------------------- 118
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      PVDSDTVTITREMNDKGESVYHMDS------------------------- 118
uncultured.m.crenarchaeote2_th      PVDSDTVTITREMNDKGESVYHMDS------------------------- 118
C.symbiosum_thermoproteales_        PVDSDTVEVTREMAPQGESVYYLNK------------------------- 118
P.horikoshii_thermococcales_        PIDEDEVIIKRRVYPDGRSHYWLNG------------------------- 118
P.furiosus_thermococcales_          PIDEDEVVIRRRVYPDGRSSYWLNG------------------------- 118
T.kodakarensis_thermococcales_      PIDEDEVVIKRRVYPDGRSTYWLNG------------------------- 119
M.voltae_methanococcales_           PIDSDKVGICRKVKLNGDNNYYVVWYEVEKQNTKINTESSQKKTSKASKV 139
M.jannaschii_methanococcales_       NVNADKVGILRRIKSSGETDYYLVWKENDK-------------------- 119
Hydrogenivirga_aquificales_         PVPDENVVVSRKVTKDGRSTFKVNG------------------------- 116
A.aeolicus_aquificales_             PVEDEEVVISRKVSKDGRSIFKING------------------------- 118
Hydrogenobaculum.sp_aquificale      GY--DEFVVTRIIYKDGKSVYKLNG------------------------- 115
H.marismortui_halobacteria_         VGDVDEIAIKRRVKETEDN-YYSYYYING--------------------- 137
H.lacusprofundi_halobacteria_       VGGVSEITIKRRVKETEDN-YYSYYYLNG--------------------- 136
M.thermophila_methanomicrobia_      -VDSDEVVITRRIKVNGER-YHAQHYLNG--------------------- 118
C.Methanoregula_methanomicrobi      ------TKIRRRIKRTGNG-YYSYNYLND--------------------- 105
A.fulgidus_archaeoglobales_         -----KYEIARKVKITEKG-YYSYYYLNG--------------------- 107
N.spumigena_cyanobacteria_          ----LEWSVTRRLRVTHHGSYTSNYYMNG--------------------- 145
Lyngbya.sp_cyanobacteria_           QAFTPEWSVTRKLRVTKQGTYTSTYYING--------------------- 159
Synechocystis.sp_cyanobacteria      ----KEWTVTRRLKVTKGGNYSSNYYING--------------------- 135
P.torridus_thermoplasmatales_       -----LYSIKREIKK-ENGEYKSNYYINN--------------------- 110
V.polyspora_eukaryotes_             NTVKEKLVITRKAFKNNTSKYYING------------------------- 274
P.tritici-repentis_eukaryotes_      IPGSQ-LVVSRRAFKNNSSKYYINR------------------------- 383
C.eutactus_firmicutes_              YG---EVTVARRVYRSGESEYLING------------------------- 116
R.lactaris_firmicutes_              YG---EVTVTRKLYRSGESEYLING------------------------- 116
A.stercorihominis_firmicutes_       YS---EVNVSRRLYRSGESEYYINK------------------------- 116
Geobacter.sp_d-proteobacteria_      YLTYSEIQVTRRLYRDGESEYLLNK------------------------- 119
G.bemidjiensis_d-proteobacteri      YLNFSEIQVTRRLYRDGDSDYLLNK------------------------- 119
G.obscuriglobus_planctomycetal      AVDADEVQLTRRVYRDGTGEYLING------------------------- 115
marine.gamma.proteobacterium_g      YARFAEISIRRKVTREATSDYYLNG------------------------- 119
S.cerevisiae_eukaryotes_            QKGNKLVELMRIISRNGDTSYKIDG------------------------- 123
                                                                                      

N.maritimus_thermoproteales_        ---KKTNRSHILDLLDMANAGLGQL-NAVQQGTVTRISEFTSEEKR---- 160
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      ---KKINRNRILDIFEVANANLSPL-NAVQQGTVTRISEMSSEEKR---- 160
uncultured.m.crenarchaeote2_th      ---KKINRNRILDIFEVANANLTPL-NAVQQGTVTRISEMSSEEKR---- 160
C.symbiosum_thermoproteales_        ---KKSPRGAILDLLDMAGAGLSQL-NVVQQGTVTRISEFSPEEKR---- 160
P.horikoshii_thermococcales_        ---RRATRSEILDLLSAAMISPEGY-NIILQGDITKFIKMSPLERR---- 160
P.furiosus_thermococcales_          ---RRATRSEILDILTAAMISPDGY-NIVLQGDITKFIKMSPLERR---- 160
T.kodakarensis_thermococcales_      ---KRATRSEIIDLLSAAMISPEGY-NLVLQGDITKFIKMSPIERR---- 161
M.voltae_methanococcales_           EKRRRMKKNEVLDLLSKISLIADGP-NIILQGDLLRIIDTSPNERR---- 184
M.jannaschii_methanococcales_       EKRKKMTKHEIIDLFRRLGLLGD---NVISQGDLLKIINISPIERR---- 162
Hydrogenivirga_aquificales_         ---VTVREKDLKDFLSKAGIYENGY-NVVLQGDIVKFLKMTPVERR---- 158
A.aeolicus_aquificales_             ---QVVRERDLKDFLAKAGIYETAY-NVVYQGDIVKFLKMTPVERR---- 160
Hydrogenobaculum.sp_aquificale      ---KIIREKDLHLILARGGIYKEGY-NIVLQGDIVKFVKITPLERR---- 157
H.marismortui_halobacteria_         ---RSVNLSDIQDLLAQAGVTPEGY-NVVMQGDVTEIINMTAGSRR---- 179
H.lacusprofundi_halobacteria_       ---RSVNLSDVQDLLAAAGVTPEGY-NVVMQGDVTEIINMTPYQRR---- 178
M.thermophila_methanomicrobia_      ---RACTQAELQEHLARAGITPEGY-NVVMQGDVTRIIEMGPTERR---- 160
C.Methanoregula_methanomicrobi      ---RLCKQSDIVDHLSKFGIIPHGY-NVVMQGDVTRIMEMSDFERR---- 147
A.fulgidus_archaeoglobales_         ---KSVSLSEIHSFLSQFGIYSDAY-NVVMQGDVTRIIEMSPFQRR---- 149
N.spumigena_cyanobacteria_          ---LACTLTELHEELNNLRIYPEGY-NVVLQGDVTSIISMNAKERR---- 187
Lyngbya.sp_cyanobacteria_           ---EACTQTELHEQLNHLRVYPEGY-NVVLQGDVTSIITMKPRERR---- 201
Synechocystis.sp_cyanobacteria      ---ETATVTELHEQLNELRIYPEGY-NIVLQGDVTRIITMNSKERR---- 177
P.torridus_thermoplasmatales_       ---NKSKYNDVSNLIDSFHIYLDSY-SFVLQGDINNIITMSGSEKR---- 152
V.polyspora_eukaryotes_             ---KESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPKAENDGDD 321
P.tritici-repentis_eukaryotes_      ---KESTFTIVTNLLKDRGVDLDHKRFLILQGEVESIAQMKPKAQGEHDD 430
C.eutactus_firmicutes_              ---TVSRLKDVYSLFFDTGIGKEGY-SIIGQGQIEKILNGKPEERR---- 158
R.lactaris_firmicutes_              ---TACRLKDINEMFYDTGIGKEGY-SIIGQGQIDKILSGKPEERR---- 158
A.stercorihominis_firmicutes_       ---NAVRLKDVHELFMDTGLSREGY-SIISQGKIESIVNNSAVDRK---- 158
Geobacter.sp_d-proteobacteria_      ---SQCRLLDIAELFMDTGVGARAY-SIIEQGKIGMILHSKPEERR---- 161
G.bemidjiensis_d-proteobacteri      ---TPCRLLDIAELFMDTGIGAKAY-SIIEQGKIGMILHAKPEERR---- 161
G.obscuriglobus_planctomycetal      ---QMSRLKDLKNIFLGSGAGAGGY-TIIAQGRVDEMLQASTKDRR---- 157
marine.gamma.proteobacterium_g      ---TKCRRRDITDIFLGTGLGPRSY-AIIEQGMISRLIESKPEELR---- 161
S.cerevisiae_eukaryotes_            ---KTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVELS---- 166
                                                                                      

N.maritimus_thermoproteales_        ---KTIEDLIGLSYFDEKKAESVKQLDEADRRLEIALAKMGEIKKRIDEL 207
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      ---KTIEDLVGLSYFDEKKTESLKQLTEADQRLEVAMAKMGEVKKQIDEL 207
uncultured.m.crenarchaeote2_th      ---KTIEDLVGLSYFDEKKTESLKQLTEADQRLEVAMAKMGEVKKQIDEL 207
C.symbiosum_thermoproteales_        ---EAIENLIGLSYFDEKKAESVKQLSDADQRLAIALAKMGEIKKRIDEL 207
P.horikoshii_thermococcales_        ---LIIDDISGIAEYDAKKERALQELKQAEENLAKVDILIGEVKKQLDKL 207
P.furiosus_thermococcales_          ---LLIDDISGIAEYDSKKEKALEELKQAEENLARVDLLIKEVKKQLDKL 207
T.kodakarensis_thermococcales_      ---LIIDEISGIAEYDAKKEKALKELKQTEENLARVDLLIREVKAQLDKL 208
M.voltae_methanococcales_           ---KILDEVSGVAEFDEKSEKAKKELSQAREYIEKIDIRINEVRANLEKL 231
M.jannaschii_methanococcales_       ---KIIDEISGIAEFDEKKKKAEEELKKARELIEMIDIRISEVENNLKKL 209
Hydrogenivirga_aquificales_         ---KVIEDVAGISEYEAKKQRAINDLMEVDIKIRELKLLLEEIRIQLDKL 205
A.aeolicus_aquificales_             ---KIIEEISGIGEYERKKEKALEELAEVELKIKEIDLILEEISNQLKRL 207
Hydrogenobaculum.sp_aquificale      ---KIIEDVAGISEYEQKRQFALEELGEADIKIRELKPLVEELEANLEKF 204
H.marismortui_halobacteria_         ---EIIDEIAGVAQFDAKKADAFDELEVVQERIDEAELRIEEKQERLDQL 226
H.lacusprofundi_halobacteria_       ---GIIDEIAGVAEFDEKKEAAYEELETVEDRIEEADLRIGEKQDRLDQL 225
M.thermophila_methanomicrobia_      ---RIIDEIAGVSEFEEKKQRAMAELDVVRERIARVDVILEEVGQQLRRL 207
C.Methanoregula_methanomicrobi      ---KIIDEIAGVSEFDTKKQQALSELDVVRERIEREELLLIELTKRAHEL 194
A.fulgidus_archaeoglobales_         ---KIIDDVAGISEFDEKKEKALEELERVRESIEKLEAVIAEVNDRLQTL 196
N.spumigena_cyanobacteria_          ---EIIDELAGVSAYDRKIIQAKKTLDEVKDKEDSCRIIETELTTQRDRL 234
Lyngbya.sp_cyanobacteria_           ---EIIDELAGVAQFDRKISLAKEKLDTVKEREERSRIVEQELIAQRDRL 248
Synechocystis.sp_cyanobacteria      ---EIIDELAGVAEFDRKIVKTKETLTEVQDREERCQIIATELERTLERL 224
P.torridus_thermoplasmatales_       ---KLFEALAGIESFKEKIENARSDIQGVENNMNTVSALISEISSRLEKL 199
V.polyspora_eukaryotes_             GLLEYLEDIIGTAKYKPLIEKKFEEIEALNEICIEKENRFEIVDREKASL 371
P.tritici-repentis_eukaryotes_      GLLEYLEDIIGTSKYKTPIAESEVEVESLNEVCREKSNRVQHVEKEKSGL 480
C.eutactus_firmicutes_              ---ELFDEAAGIVKFKKNKAATEKALEAERDNLSRVNDILKELEKQVGPL 205
R.lactaris_firmicutes_              ---ELFDEAAGIVKYKRRKNLSLKKLEEERQNLTRVNDILQELEKQLGPL 205
A.stercorihominis_firmicutes_       ---LMIEEAVGIVKYKTRKNEALRKLDKTQSNLYRILDIISELESRLPSL 205
Geobacter.sp_d-proteobacteria_      ---VLIEEAAGVTKFKARKQVALKKIELTRNNLLRITDIITEIRRQLGGL 208
G.bemidjiensis_d-proteobacteri      ---FLIEEAAGVTKFKARKVVAMKKMEATRQNLLRLGDIISEIKRQMNGL 208
G.obscuriglobus_planctomycetal      ---AIFDEAAGISRFKADKNETLRKLASVELNLTRSKDKLDALDGQLRTL 204
marine.gamma.proteobacterium_g      ---VFIEEAAGISKYKERRRETENRMRRTMENLERLTDLRDELERQLQHL 208
S.cerevisiae_eukaryotes_            ---RMFEEVSGSIQYKKEYEELKEKIEKLSKSATESIKNRRRIHGELKTY 213
                                                                                      

N.maritimus_thermoproteales_        EEERNQKLRYDILERELNRYKAIAAANKLKVISSQKESKESTLHSVTAEI 257
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      EVERNLKLRYEFIGRELDRFRAIDAAEKLREIKSEKTVKEEKYNNDSSET 257
uncultured.m.crenarchaeote2_th      EVERNLKLRYEFIGRELDRFRAIDAAEKLREIKSEKTVKEEKYNNDSSET 257
C.symbiosum_thermoproteales_        EVERNHKLRHDMIEEELGRLRAVSAADKLRHLGSQKVEKSAELAEVSASA 257
P.horikoshii_thermococcales_        EKERNDALRYLDLKEKLEKARVGLVLGEIRKIESEIRNNDERIGNIEREI 257
P.furiosus_thermococcales_          EKERNDALRYLDLKDKLEKAKVSLLLGEIKILETQIKEGEKRRAEIEEEI 257
T.kodakarensis_thermococcales_      EKERNDALRYLDLKEKLEKARVTLLLAEIKRLEKFIEEGGSREEEIEGQI 258
M.voltae_methanococcales_           KKEKEDAEKYTVYNKKLKVTKYILTSKKVEFLKMVLDETKDEIEALKETK 281
M.jannaschii_methanococcales_       KKEKEDAEKYIKLNEELKAAKYALILKKVSYLNVLLENIQNDIKNLEELK 259
Hydrogenivirga_aquificales_         KEEKDKLEKYRKLQEEKRDTEIAILSKEIKKFRSEEEKLSEELEGHQGRL 255
A.aeolicus_aquificales_             KEEKEKLEKFKELQRIKRETEAKILLKEKEKLLKERERILNELSSLRESL 257
Hydrogenobaculum.sp_aquificale      EKEKERLHQYKALMEKKHILECVLLLKEKQSLLKDLQKTSEEKEALETKS 254
H.marismortui_halobacteria_         EDERETALKYQDLRDEKEEYEGYRKAAELEDKREELTAVEESIDELESEL 276
H.lacusprofundi_halobacteria_       ADERETALQYQQFRDELEEYRGFLKASELEEKRETLAGVEEDIDDDETEL 275
M.thermophila_methanomicrobia_      QAERDRALRYRACREERKKQEAYLLLARFKEAEAEISALDDEITSITSEK 257
C.Methanoregula_methanomicrobi      KKEREHALEYQKWQKELAFFQGCRSAAQIHDKEKERATLLSSAEEQKIRI 244
A.fulgidus_archaeoglobales_         ERDRNEAIRYKEILSKKEEYEGYLRAHNYLTAVKSKEKVERELERLERQK 246
N.spumigena_cyanobacteria_          SQDRAKAEKYQKLRTEFLAKQSWEAVLSWRSLQAQQEKLIGEIQAGDRTS 284
Lyngbya.sp_cyanobacteria_           NKDRVKAEKYQKLREEFQQKLQWEAVLNYQTLKKQTFRLREQIEAGDRSV 298
Synechocystis.sp_cyanobacteria      AADRQKAEKYQALRQQVQEKQGWAKVIQYKAVEQQRQKLWGQLERDREQS 274
P.torridus_thermoplasmatales_       RIEKETAEKYHELSESINSMENYLRFKEKERLLSELEIFQKNVTDIENKI 249
V.polyspora_eukaryotes_             ESGKDEALEFLEKEKELTLVKSKLYQYKLWQDNKKLSTTLEKLSNIKEEF 421
P.tritici-repentis_eukaryotes_      EEKKNKALAYIRDENELASKQSTLYQIYISEFDDHIQVTQESVGQLQAQL 530
C.eutactus_firmicutes_              KEQSDTARKYLAFKSELKNLDVNAFLLEIEKLRADLERDQARLEIVNDDI 255
R.lactaris_firmicutes_              ERQSETAREYLKKKEELKTYDINMFLLEEERLRERIRDVAGKYELAAAEM 255
A.stercorihominis_firmicutes_       KRNSKKARKYIELSEELKGLELNLFVHKADKYKEELSKLDEDEKIMKDTL 255
Geobacter.sp_d-proteobacteria_      QRQARKAEKFRECREELKEIELLFSVKKYAALMKEKEDLDRQLDLLKKEL 258
G.bemidjiensis_d-proteobacteri      QRQAKKAERFREIRLELKEIELLFAAKGYGSVQKERQGLEREIAELESKL 258
G.obscuriglobus_planctomycetal      RLQATKAQKYKEHSDRLRELRVGLGAREYRELTAALATEQGALAALKAEV 254
marine.gamma.proteobacterium_g      QRQAQAAERYTELKKEERLLKAQLQALQWSTLDGQVKQHEQEIRGLEVKL 258
S.cerevisiae_eukaryotes_            KEGINKNEEYRKQLDKKNELQKFQALWQLYHLEQQKEELTDKLSASNSEI 263
                                                                                      

N.maritimus_thermoproteales_        TTFDDERSILRTEIGTLESEKSKLMAEANDYT---QAKSALDTEIATAME 304
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      ERLEKLRSTLRDEISKIDKEKSAFATKVNAFN---QAKSDIDKGLSTEQE 304
uncultured.m.crenarchaeote2_th      ERLEKLRSTLRDEISKIDKEKSAFATKVNTFN---QAKSDIDKGLSTEQE 304
C.symbiosum_thermoproteales_        AAQRSELDGIREELKSAEGEKAAYMESVEGHG---REKAAFEGELGSALR 304
P.horikoshii_thermococcales_        ERMEKRLEEIAKEIVEKENELRRIEEMIERES--SSEALRLTREIGEVNS 305
P.furiosus_thermococcales_          QKIEKEIEKIGKEIVEKVKVLREIEERIEKES--GEEAIQITKKIGEVTS 305
T.kodakarensis_thermococcales_      KSLEDRLKEIAKEIVAKEKELAEIERQLEEKS--GDGILEITRKISEVKS 306
M.voltae_methanococcales_           NCYIQDISNIDSEIIGLKVKINELVNELNEKG--SEEVMELHKSIKELEV 329
M.jannaschii_methanococcales_       NEFLSKVREIDVEIENLKLRLNNIINELNEKG--NEEVLELHKSIKELEV 307
Hydrogenivirga_aquificales_         AVIKEEIREKEAILSEKEEKLKELSDKLLP----------FRERVGKISS 295
A.aeolicus_aquificales_             EDITFQIQENEKELNERERLLKEVNEKIMP----------FKEKVGKFTA 297
Hydrogenobaculum.sp_aquificale      SKLLETIDIKTKELKDVEQKITNLQETLLP----------YRESSGKLSA 294
H.marismortui_halobacteria_         TELQAELDERQGAVIRLEDELHELNQEIERKG--EDEQLAIKREIEEIKG 324
H.lacusprofundi_halobacteria_       EELRAELDARQGKLTRLEEDLADLNHEIETKG--EDEQIEIRSEIEEVKG 323
M.thermophila_methanomicrobia_      SQLLQSLEAGREELRRLEERLKAVEGEISHKG--EDEQLRVRREIEEIRG 305
C.Methanoregula_methanomicrobi      SRLEADRSIEENELAYLKADLADVDELINQKS--GPDYLKLIADLEEAKS 292
A.fulgidus_archaeoglobales_         DELTSKIPEINARIAELNEKINELAAKISELG--DERSAEIQSRILELSS 294
N.spumigena_cyanobacteria_          TELISQLTTLNSAISQKSAELEELNARVKALG--EEELLAVQSTLATQEA 332
Lyngbya.sp_cyanobacteria_           NELSENLQQQTTQIQKTTTELEQLNARVKAMG--EQELIDLQSTLATQEA 346
Synechocystis.sp_cyanobacteria      QQIQQALDQRSQAIQTQQTELEKLNAQVKALG--EEEQLAVAAQLATQKA 322
P.torridus_thermoplasmatales_       IGLRKKGSENNDELNKTRNDINELEKKINDLS--GNEINKIRSEISSINV 297
V.polyspora_eukaryotes_             EETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERV 471
P.tritici-repentis_eukaryotes_      DEELQKHQGNEGEIKELEKQYKKGVKECEQLEKRNQEFQKEVARIDKETV 580
C.eutactus_firmicutes_              EENRNLYEQTKEEYEQIENTIEQLNSVIDSSK---NEIHEGRLAKERAEG 302
R.lactaris_firmicutes_              DEANVRYEKMKEEYNLIEGQVEEIDLAIETAR---TQMNETGLLKQQLEG 302
A.stercorihominis_firmicutes_       TEQEESISILDDKYSDLKLKINSFDEQINNAN---KEIHDFISTYENSKV 302
Geobacter.sp_d-proteobacteria_      SVQIIDQEKGELAFEQKRLLLVEREERIQKAQ---EEIYRMKGELMAGDS 305
G.bemidjiensis_d-proteobacteri      VDITARLNEAELSIEGKRITLLETERALTAAQ---EEIFRWKSELQGGEN 305
G.obscuriglobus_planctomycetal      SGATSEAEQLEHQAAQLDWQVTRGEEALRHHE---ARLAEARQQLAGFEA 301
marine.gamma.proteobacterium_g      EAVIAEQRSIDTDIEKSRDVHTDLMDKFNAVQ---ARFYGIGAEIARTEQ 305
S.cerevisiae_eukaryotes_            SSLKGKINNEMKSLQRSKSSFVKESAVISKQK---SKLDYIFKDKEKLVS 310
                                                                                      

N.maritimus_thermoproteales_        QYEIDNSAISASKKRIEQIESRIPEIQKELEDVDSARSDIDTQILKI-KE 353
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      KFNDADGQIKTSKKRFTLIEKRLPDITSELEKMSQNQGTVDSELEEV-KR 353
uncultured.m.crenarchaeote2_th      KFNDADGQIKTSKKRFTLIEKRLPDITSELEKMSQNQGTVDSELEEV-KR 353
C.symbiosum_thermoproteales_        SSEEHRSGILTAERRVERINARIPEIDGEAQELRGRLESARSAAAAA-AA 353
P.horikoshii_thermococcales_        KINLARRNIEIARRELDESQLRLAKVKDELKKVMSEIEKSKGAIIRW-GR 354
P.furiosus_thermococcales_          KIELTKRNIEVAKEELEDAQRRLAKTKEELRKVLSEIEKSKGAITRW-KK 354
T.kodakarensis_thermococcales_      KIEVAKRNIENAQKEIEESQARLRKSKEELKHVSEEIEKSKGAIKRW-GK 355
M.voltae_methanococcales_           NLNNDKNALENAIDDLKHTLKMEESKNNDLNETKEKINNIRIDTLKK-EA 378
M.jannaschii_methanococcales_       EIENDKKVLDSSINELKKVEVEIENKKKEIKETQKKIIENRDSIIEK-EQ 356
Hydrogenivirga_aquificales_         DIEHIGKEIDRKEHRREEALLEREKEEKALGYLLKDLENLREELGAL-RE 344
A.aeolicus_aquificales_             EIENAERSIKEKERELKESENRVKNLEELINNLLSDKENLEREVGTL-QL 346
Hydrogenobaculum.sp_aquificale      KIEYIKEQKASKEQELKKELSHKEDIEKKIDFLEKDLLSLEKELLGI-EQ 343
H.marismortui_halobacteria_         DISRLEDKIESAEETVEAAENERRQAFVQIDRKQETIDDLESDIRET-KV 373
H.lacusprofundi_halobacteria_       EISRLEDKIEAAEERAAEAETERRDAFVQIDRKEETIEELESEIREA-KV 372
M.thermophila_methanomicrobia_      KIAREETRIEAADADIEEADRSLSQCFIEMDRVRAEIAAISEQLSDK-AM 354
C.Methanoregula_methanomicrobi      GIKLAEQTIGRLKKDKEANLEGINRVFADTKRAEARVAELSDQIRTL-SI 341
A.fulgidus_archaeoglobales_         ELESLRRAERFYLDEAKRLEEESVKIISEISKIKEEMESLDGELEEY-AI 343
N.spumigena_cyanobacteria_          ERKQLQRRQAELNTAIQETVKRLAQTQQEVQQYQHSLTEFAQTQVLE-QQ 381
Lyngbya.sp_cyanobacteria_           ENRQFQQRQRETETGVQNTQSQIQQTQEERQNYQQTLETIASQREVE-TH 395
Synechocystis.sp_cyanobacteria      QRDQLQQRYNDGDRQITNHQQQVGQIQAEISQSQQQFLHIQQEKSFHNTQ 372
P.torridus_thermoplasmatales_       EIGKIDAIISSEDTELKNIQMKLKTAEEALAFSEKNMKKQIDERDSK-LK 346
V.polyspora_eukaryotes_             SLEEQRKNIMKKKKKMEKELEDCNKTISNTKIKIEDLGKNESEYESQLDE 521
P.tritici-repentis_eukaryotes_      KFEEKKKFLAGKQKKLEKTKETSYYGRSEAESLAKQYGEDLERYNAEIVE 630
C.eutactus_firmicutes_              EINVINQQIITLKMNDKNIHEQIDRINAQIEAGERELAEYTSQKDNL-DD 351
R.lactaris_firmicutes_              QINVLKEQINTARMNDEHYGHRAGVIHTEIESRTAKKKELEKEKQNV-LE 351
A.stercorihominis_firmicutes_       EVEVNKNKIETHLGNIDSLKEGIIRLEEEKENIEDKKEETQALLNEQ-ET 351
Geobacter.sp_d-proteobacteria_      RREFHKKELLNLDRLFERSRQEQDTCALRHTEAQTELAALNEQKISL-IA 354
G.bemidjiensis_d-proteobacteri      KLEFQRRELANQERHGARFEEELQGLRDQLAASERELVSLETQQASF-LE 354
G.obscuriglobus_planctomycetal      SLKHDRAAAQNLGAELLKVGRQRADLGYRLKGLEADSVRAAAESAAA-EG 350
marine.gamma.proteobacterium_g      TIQHQQERSRQLKDDLQQTERNYQESTEHLQLDTEKQQLWNEEIEEI-QP 354
S.cerevisiae_eukaryotes_            DLLLIKVPQQAAGKRISHIEKRIESLQKDLQRQKTYVERFETQLKVV-TR 359
                                                                                      

N.maritimus_thermoproteales_        SIEQTNVKKNKINSDLEIVDSQRNKILDEQSQAAAKKSEIDQKIKELTTQ 403
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      SIQKIKGKQNIINKKIENNDSKTKSVLDHQSELACKKNVIDKKIQVLQDE 403
uncultured.m.crenarchaeote2_th      SIHKIKGKQNIINKKIENNDSKIKSVLDHQSELACKKNVIDKKIQVLQDE 403
C.symbiosum_thermoproteales_        ELAAAGESRQRAEAGVSGVNTERDAALSRQSEAAKKRSAADAQMREVKDR 403
P.horikoshii_thermococcales_        RREALIKQISEKEEERNHLVVRLGEIDRTFAVAREEFDSVVKELENARRL 404
P.furiosus_thermococcales_          RRDALINEIKKKEEERNVLVVKLGEIDKTFGAAREEFDSVVKELEETTRK 404
T.kodakarensis_thermococcales_      RREQLLVQIKERETVRNELVIKLGEIDKRFSEAREEFDKVVAELEEAKKA 405
M.voltae_methanococcales_           EAKVLIKEIEKLNEERQNLEKKVEQSESQVKALKNQESKLSERINDTQKE 428
M.jannaschii_methanococcales_       QIKEIEEKIKNLNYEKERLKEAIAESESIIKHLKESEMEIADEIAKNQNE 406
Hydrogenivirga_aquificales_         ELELKEREYEELKAQEERAYNELRELDDKLKVSIEEAERAEEKEKQLKEY 394
A.aeolicus_aquificales_             ELEKLKEEYKSLKEVEREKLRELEEEEERLKITFDEVKKLEEEKEKLTEK 396
Hydrogenobaculum.sp_aquificale      EKLSKEKEFYSIEELIKEKEKELKSTEEKLNLSPEEIEQIEKKEKELKSI 393
H.marismortui_halobacteria_         AKSNVKADIAEKESELAEVQQRIDEVGEEFQEVKDELEEKRSRLETLKSE 423
H.lacusprofundi_halobacteria_       EKASVKSEIATKRSELADVEAEIEGADTEFDELKAELAEKKEAIESLREE 422
M.thermophila_methanomicrobia_      RRAGIQGELDDQRSQLSSLRANISDADSRFAKYREELAQLIKEIEDTRSQ 404
C.Methanoregula_methanomicrobi      DRTNIAMEVATSKAQVEKIETEIRQYSSDTEEARQQLFALMEEAEAKKGD 391
A.fulgidus_archaeoglobales_         KRIQVGEIVDELAAKMELLRQRLEEVDKKHRELRDRLVSRKEELEMYKER 393
N.spumigena_cyanobacteria_          SILSCQQQRDEAQQALDASRAAAAEIATASEAWVQQQTAFNRQIEALLQT 431
Lyngbya.sp_cyanobacteria_           NLQVRTTERDQIQQSLNQTRQAASQVAQQAEAWMQQQTDLHRKIETLQKN 445
Synechocystis.sp_cyanobacteria      TLPQLEAAVQTSQQQLEQLRHQAQAIASASEAWVQEQTQLSRTVNQLQDE 422
P.torridus_thermoplasmatales_       RLSIIESNVSKAAKELEHFREENLNRSKRLSELNLKLKSIDEKIKIKSDE 396
V.polyspora_eukaryotes_             LNAQLQIERGLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQ 571
P.tritici-repentis_eukaryotes_      LEESMKVEEKELEAVRKSLAGKTQGLSDEIAAKQKTLEPWNAKINEKQSA 680
C.eutactus_firmicutes_              SSSDVENELQEARKQSEKMSRYIEECQQEIENCKTDIIEYVHESGTLQAK 401
R.lactaris_firmicutes_              KLEKARGTDAQARQKLIDTQSLIAEYTDEIEQCKKEIMELLGSRASTTAK 401
A.stercorihominis_firmicutes_       LFDDLTKEYNKLKVEVERLKGISNETENAIQRENINLKTKERLLKDKEGL 401
Geobacter.sp_d-proteobacteria_      ELQRESSQLVEDERLLDESSRTEQGASAKIEEARNGLFQVLSNNAQLNNK 404
G.bemidjiensis_d-proteobacteri      EHARESEALEHREALLEEMAASEAGVTRELDEARRAMFAALSEGAQANNQ 404
G.obscuriglobus_planctomycetal      RLTDERGRADEVSDALAAVVARLADLERAQAEDLQQHMELVRQAASGRST 400
marine.gamma.proteobacterium_g      ELELAQGSEEETGSALQTAEEAMQSWQQHWDEFNQQAQEPRQKAEVQQSK 404
S.cerevisiae_eukaryotes_            SKEAFEEEIKQSARNYDKFKLNENDLKTYNCLHEKYLTEGGSILEEKIAV 409
                                                                                      

N.maritimus_thermoproteales_        LNDAKLKLSKLQHEKEESKIKVESNTAKLQGLEQGIEELTSSKTKLES-- 451
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      LHNATMEKSQAASQTNTIENKINDNTRKHEATDNELTNLKQFSGKLSK-- 451
uncultured.m.crenarchaeote2_th      LHNATMEKSQAASQTNTIENKINDNTRKHEATDNELTNLKQFSGKLSK-- 451
C.symbiosum_thermoproteales_        LGEARLETAQARARLDDAKSKEESNSSKRGEYARDCSALRALQGELAA-- 451
P.horikoshii_thermococcales_        MYEGEAEIKRLDAEKEKLRSRIAVLKAKLPGIRDEILKLRDTLDEKKA-- 452
P.furiosus_thermococcales_          MYEIEGNIRRLQEEKEKLHSRILFLRAKLPGIKEKINEFKAVVEDKRA-- 452
T.kodakarensis_thermococcales_      LYMKESEISKFEEEISRAKARITQFNARRNLLKEKIAEAKASLEAKRS-- 453
M.voltae_methanococcales_           LYGLKNELNQLENTLNNRTFDYQKNNETIENLTNQIAEFSDLEDTKKLYK 478
M.jannaschii_methanococcales_       LYRLKKELNDLDNLINRKNFEIEKNNEMIKKLKEELETVEDVD-TKPLYL 455
Hydrogenivirga_aquificales_         IEKKREEENSIRLKLKEIELKIERTHEDIEKLKEEKEETKRKIEESFG-- 442
A.aeolicus_aquificales_             LNSLNKEKQELEIQRANLKNKIERIKEDINKLISEREEKIKEIKEKEQ-- 444
Hydrogenobaculum.sp_aquificale      LEQKKKQYQQYIDQIQDISQKQNRYKDDIQRLKAD-LQALEQKDFVEE-- 440
H.marismortui_halobacteria_         KNDLQREQDRLLDEARRRSNAEDEKRAAIEEAEAEIPDLEADIEDLQT-- 471
H.lacusprofundi_halobacteria_       KNGLQREKDRLLDEARRRSNAVSEARTDLEDARESIPEHKARISELHS-- 470
M.thermophila_methanomicrobia_      IGERLRERDRLLDAIRRASMEKEEIATEITEALSSISAASTESERLER-- 452
C.Methanoregula_methanomicrobi      RSAILRQQDILIEKSRMRTSELERLTVLQKQLDEEYADKQAQLAENER-- 439
A.fulgidus_archaeoglobales_         RGEILRERDKLIELLRRIDMDVEDIKNEIASIESKLKEFETEKKAKQE-- 441
N.spumigena_cyanobacteria_          LEPQRTEQAQLRERHHQLQQLITEQTQLIATLEPELAAKQTECNRLET-- 479
Lyngbya.sp_cyanobacteria_           LNPQRTERAKLTERVNQLQRQINEQQQSFLSSQQQLETAQTEVNQAQK-- 493
Synechocystis.sp_cyanobacteria      LIPQRSQLAQLEERQQQLLTNLAELTPLLTKVSVELEEKQFAQGQFNF-- 470
P.torridus_thermoplasmatales_       IGSINERKSDYINKKSSLLKESSILEEELKNLRLKENDLKWRIKNSEI-- 444
V.polyspora_eukaryotes_             IQVKESEISLIKEGRVKLENDIENLNSLISVKIEEKISREKEIGSLRN-- 619
P.tritici-repentis_eukaryotes_      IAVAQSELDIMRERENAGAKGIAEVEAKIESLQEAKEAKATELAECKA-- 728
C.eutactus_firmicutes_              VGRYDAMLENINFRKTQLNQRLLQSKSDDAGDRKEFEDLSNQLTELEE-- 449
R.lactaris_firmicutes_              MQHFDTTREQIQTRKAVIARGLLEVATEAEEQNLILKKHEEELQAVQK-- 449
A.stercorihominis_firmicutes_       LSDSLNRIENNKFIKTKLDEENYNLEKNIEELESSLENVDN--SENEE-- 447
Geobacter.sp_d-proteobacteria_      LAADVKRLELLVEKYERNQREIIKLQEQREEAFQAVLKLENSCKKIKE-- 452
G.bemidjiensis_d-proteobacteri      HAAAVKRLASVDERLQASKRERVLLGERLFESNGKVDALKAEREQLAR-- 452
G.obscuriglobus_planctomycetal      ADATLAQVNRLQSEYTRRLAAREHRAAHRATLTHALDGLSQEDADVQAR- 449
marine.gamma.proteobacterium_g      IQHLEQALQRIQQRIEKLEEEKQGLTAGPIEEEIEILGEQLAEAELLH-- 452
S.cerevisiae_eukaryotes_            LNNDKREIQEELERFNKRADISKRRITEELSITGEKLDTQLNDLRVSLNE 459
                                                                                      

N.maritimus_thermoproteales_        MIKNHNATITELKSRIQKLQSKKSKIVSDMDEWGEILEKSNQAATRYESK 501
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      ASSDKHSREIELK--MLKLSEQRKKIENDIVELELILDKSSKAGHRYNEK 499
uncultured.m.crenarchaeote2_th      ASSDKHSREIELK--MLKLSEQRKKIENDIVELELILDKSSKAGHRYNEK 499
C.symbiosum_thermoproteales_        AVEERRASADSLRGKLEGLEAKKIRTGSEVEELGFLLEKSGRAAGQYDAK 501
P.horikoshii_thermococcales_        ELSEIENKLSSVSNKRMKVEEEVEKKTLELQKVSKELEDAERELIRIEAQ 502
P.furiosus_thermococcales_          EISEIEGKLSTIQAKRIKVEKEIEAKSNELEKVSKELESSERELIAAEAQ 502
T.kodakarensis_thermococcales_      ELSQVEGKISKVESRHRKAEKELEEKTRELQKVESELAKAREELIKAEAQ 503
M.voltae_methanococcales_           ELEDIAVELEFSKKKLQEKITERNDSQSKLDNLHSEYVKENARIKTLKDM 528
M.jannaschii_methanococcales_       ELENLNVEIEFSKRGIKELEEKKKELQAKLDELHAEYVKENARIKALKEM 505
Hydrogenivirga_aquificales_         EVEKYRRMRAVEQDTLRQEREYLKRVEQELKETRKKIEEAIRGKAYVESK 492
A.aeolicus_aquificales_             EIKRLKAIKKKEEEELRNLTQELNIYEKRLSEVRKKLEEVLKEKGAIERE 494
Hydrogenobaculum.sp_aquificale      KLKTFQKNIEEARLSIEAIQQTIAKYTSSLTETKKEIEQIISEKARIESQ 490
H.marismortui_halobacteria_         ELEKAKQNKATIGEVVDDLRAEKRELQSDLDDLEDEISAKQQEYAQLEAK 521
H.lacusprofundi_halobacteria_       ELDKATKNEETIEDAVADLFAEKAETSERLEAIEEDLREKQNEYAKLEAA 520
M.thermophila_methanomicrobia_      EVESIASEAMDLDKRREELESRRLSLRRELAELDRSLQRLQSEYARVEAQ 502
C.Methanoregula_methanomicrobi      TVADLTGRKKELDRNLSEIESTLFAQRSSLERLRGEIRDAEQDAFRLEAA 489
A.fulgidus_archaeoglobales_         EVWKQEEELMSAKKMLSSADKKLFDIRAKISDVEDELKKAELELAKVKAT 491
N.spumigena_cyanobacteria_          EFNASSEPIQNLAENLSATEQELQIQQETQKRLLQEQREKQRQLDKIEAQ 529
Lyngbya.sp_cyanobacteria_           ERENARQQTESLAQIVAQAEQELQLQQETQTRLLREQREQQRQLDKLEAQ 543
Synechocystis.sp_cyanobacteria      QGEALTSQIQTLASDLAQLEQERSLLQETQTRLLKEQQEKQRQLDKLEAA 520
P.torridus_thermoplasmatales_       EMNDIENSMKTANKNYELLRTETYNISENIKNNNSKIKSLERELRNLNYR 494
V.polyspora_eukaryotes_             ELNRITKEVSIGDTEYTNAKEKLREMKAVLNQHRQKAIDARTSLSAEENK 669
P.tritici-repentis_eukaryotes_      ERKRVEKDVQKTQAKLEEIIQKEPTLRSKLSGARAKADEARASLSSAQTQ 778
C.eutactus_firmicutes_              SVKSVLADLDNATEQLEDNQSRNKTNRELIHNTNEKLSATRSKMEALRNI 499
R.lactaris_firmicutes_              EIAECNAKISENERELERLQKELREKQEKLKIGQTAYHRESSRLESLKNI 499
A.stercorihominis_firmicutes_       KLDKLDDENNKLLEERYKIEEAKADFREELLDKYNKAKLLKGQKDILLGY 497
Geobacter.sp_d-proteobacteria_      VTQQDVEEMNALVLREGELKSLLSSTETALHDKRNQFTAKSSRLKSLQEL 502
G.bemidjiensis_d-proteobacteri      EKELLDEELTLAGSREAELKQAQEAGDKLLQQLRDQLSSASSRLKSLQEL 502
G.obscuriglobus_planctomycetal      -LAAAREQLDDLTAARDTLTEQLGEGQARLEGLRVEQGALRARMEVLEDL 498
marine.gamma.proteobacterium_g      --EEQQSQLLGHSEQINHHRGKNNTLGDQLDDARNQLQSMRGRFASLEAL 500
S.cerevisiae_eukaryotes_            KNALHTERLHELKKLQSDIESANNQEYDLNFKLRETLVKIDDLSANQRET 509
                                                                                      

N.maritimus_thermoproteales_        IKTVKGFMHEDYTVAKLKEDAEQLG---------IEGLVYEMISWDKQYE 542
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      IKLVKDVMHEDYTISQLKGDAKKLG---------IVGFVYEVFSWNKQYE 540
uncultured.m.crenarchaeote2_th      IKLVKDVMHEDYTISQLKGDAKKLG---------IVGFVYEVFSWNKQYE 540
C.symbiosum_thermoproteales_        LRLVRGMMHEEYSAAKLRESARELG---------ILGQVYELISWDEKDE 542
P.horikoshii_thermococcales_        NETKSNRAVEELKRSGIPGIYG--------------TLLELIRVRDEKYS 538
P.furiosus_thermococcales_          REVRGNRAAEELKRSGIGGIYG--------------TLAELIKVKDEAYA 538
T.kodakarensis_thermococcales_      REVRGNRAVEFLKSQRIEGLYG--------------TLGELISVPKSEYA 539
M.voltae_methanococcales_           ENFSLDRAVKGVLDAKLPGVVD--------------IAGNLAKT-KGEYK 563
M.jannaschii_methanococcales_       EELSMDRAIREILNANLPGIID--------------IVGNLGKT-KIEYK 540
Hydrogenivirga_aquificales_         LASSEP---LDVLFEGIEGVYG--------------TVGDLITVKDPEHI 525
A.aeolicus_aquificales_             VRSFSD---VSDVFKDIKGVYG--------------SVSELIRVKNPEHI 527
Hydrogenobaculum.sp_aquificale      LRYNED---DTYIFQNIKGVYG--------------KVEDLISLKDEEYK 523
H.marismortui_halobacteria_         AGEDGDSS-YGRAVTAILNAGQ----D------GVHGTVGQLGGVDPEYA 560
H.lacusprofundi_halobacteria_       ADQRGDTS-WPRAVTEVKNGGI----D------GVHGAVGELGSVEAEYA 559
M.thermophila_methanomicrobia_      VRAAEERSGYSRAVEAVRSAMKRGILQ------GLCGTIADLGEVDRRYA 546
C.Methanoregula_methanomicrobi      QQARGESG--GKAIEAVKAIEG------------VHGTIMELGRAPPEYA 525
A.fulgidus_archaeoglobales_         LSTLRTYS---KPVEILLDARNRRELP------GIFGTVAQLGEVDEEYV 532
N.spumigena_cyanobacteria_          AQAQQEVQGTQASKVILQSGLP-----------GLCGLVVQLGKVDSRYQ 568
Lyngbya.sp_cyanobacteria_           HQAQQEATGTYATKVITQSGLP-----------GVCGLVCQLGRVEPDFQ 582
Synechocystis.sp_cyanobacteria      SQAQQEVQGTYATKVILQSDLP-----------GVCGLVAQLGQVEPQYQ 559
P.torridus_thermoplasmatales_       PVVSEALKEIYTLKDVLKGIYG---------------QVKDLIDYRDDYS 529
V.polyspora_eukaryotes_             NQVLASLFRLQKSGR-ISGFYG---------------RLGDLGAIDDRYD 703
P.tritici-repentis_eukaryotes_      GNVLTGLMRLKESGR-IDGFHG---------------RLGNLGTIDQKYD 812
C.eutactus_firmicutes_              TERYDGYGNSIRRVMEQKQHNP-----------GIIGVVADIVTVKQQYE 538
R.lactaris_firmicutes_              TERYDGYGNSIRKVMAKKEQEP-----------GLIGVVADIIKVEQEYE 538
A.stercorihominis_firmicutes_       EENKEGYKFAIKKLFEYAKSNNDLK-G------EVYGTLGDLISVEEKYM 540
Geobacter.sp_d-proteobacteria_      EAQFAGYGQGIRTLLSNDDFKS-----------KFNGMVADMVETGEAFE 541
G.bemidjiensis_d-proteobacteri      EAQFAGYGQGVKNLLLADSFKG-----------ASLTMLADAIEVEEEFE 541
G.obscuriglobus_planctomycetal      ERSLEGFGTGVAAVWRRLEAEAADDYTPTELSAAVVGLVADLLTVPREVA 548
marine.gamma.proteobacterium_g      QQAALGQQPGAINDWLQASGLD------------KNKRLAEDLKVQPGWE 538
S.cerevisiae_eukaryotes_            MKERKLRENIAMLKRFFPGVKG--------------LVHDLCHPKKEKYG 545
                                                                                      

N.maritimus_thermoproteales_        RSILAVSSDWIKAIVVKDFATLLGIAEFARSRKLSKLKIIPMDSIPKFK- 591
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      RAVLAACADWIKAVIVPDFETLVSLAQVARNKRLPKLKIIPLNAIPEFR- 589
uncultured.m.crenarchaeote2_th      RAVLAACADWIKAVIVPDFETLVSLAQVARNKRLPKLKIIPLNAIPEFR- 589
C.symbiosum_thermoproteales_        RAVMAAGSDWIKATVVEDLATLAGLAGHMRERGLPKLRIIPLEALPRLR- 591
P.horikoshii_thermococcales_        IAVEVALGNRADNVVVEDEIVAEKAIEFLKRNKLGRLTFLPLNKIKARH- 587
P.furiosus_thermococcales_          LAIEVALGNRADNVVVEDELVAEKAIKYLKEHKLGRLTFLPLNKIKPKH- 587
T.kodakarensis_thermococcales_      LAVEVALGGNYDNVVVEDDRVAEKAIKLLKEKKLGRLTFLPLNKIKPRS- 588
M.voltae_methanococcales_           TAIEVAGGARLNHIVVKKMDDGSRAINYLKQKRLGRATFLPMDRIKGMD- 612
M.jannaschii_methanococcales_       TAIEVAAGNRLNHIVVKRMDDAVRAIKYLKERKLGRATFLPLDRIEGRE- 589
Hydrogenivirga_aquificales_         RAVEVAGGGRLRYVVVEDENVAKRCIDFLRSRNLGRMSFIPLNRIRADVN 575
A.aeolicus_aquificales_             TAIEVAGGGRLKFIVVEDEEVAKECIQLAKRMNLGRFSFIPLNRVRVEER 577
Hydrogenobaculum.sp_aquificale      TAIEAAAGARLSYVVVESEEIAKTCIELLKKNSDKRVSFIPLNRIKTQS- 572
H.marismortui_halobacteria_         TACETAAGGRLAHVVVDDDSVGQRCIEYLKSRSAGRATFLPITQMQNRS- 609
H.lacusprofundi_halobacteria_       EACETAAGGRLANVVVDDDGVGSTCIDYLKQRNAGRATFLPITKMDNRS- 608
M.thermophila_methanomicrobia_      AALEVAAGARLQSVIAESDEDAAVAIDYLKRSQIGRATFLPLNKMEVGS- 595
C.Methanoregula_methanomicrobi      TALNVAAGNKIQFVVCDTDQIATDAIRYLKDERLGRVTFLPLNKLKPPQ- 574
A.fulgidus_archaeoglobales_         AAIEAAAGNALQFVVVETEDDAVSAINFLKAVRGGRATFIPLRRIKSFK- 581
N.spumigena_cyanobacteria_          LALEIAAGGRLGHIVVEDDSVAAAGIELLKQKRAGRATFLPLTKIRASK- 617
Lyngbya.sp_cyanobacteria_           LALEIAAGGRLGHLVVEDDGVAAAGIELLKRQKAGRITFLPLNKIRPNRG 632
Synechocystis.sp_cyanobacteria      LALEIAAGGRLGFLVVEDDGVAAAGIEILKQAKAGRATFLPLNKIRPPK- 608
P.torridus_thermoplasmatales_       NAIIAGAGSRLYNIVVDSDLTAQRCIETLKEKKLGRLTFLPVNKILKPRD 579
V.polyspora_eukaryotes_             IAISTACP-RLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFD- 751
P.tritici-repentis_eukaryotes_      VAISTACP-QLDNMVVDTVESGQQCIEYLRKNNLGRANFILLDRLAKRD- 860
C.eutactus_firmicutes_              VAVETALGGSIQNIVTEDDATAKRMISYLKSNKLGRATFLPLNTITDR-- 586
R.lactaris_firmicutes_              IAIETALGGSIQNIVTDNENTAKRMIEFLKRNKFGRATFLPLTSMRGS-- 586
A.stercorihominis_firmicutes_       DAIQKSLASTIEHVIVKNEITASKAIKALKENKWGRITFLPHSIIKPRE- 589
Geobacter.sp_d-proteobacteria_      AAVEVALGERLQWLVCDQESDALSAVAHLRQVSGGRCSFVLQQPCKQQK- 590
G.bemidjiensis_d-proteobacteri      VALESVLGERLQYLLCGSPDLALDAVRHLKGNSGGRCSFITAPPWHHPG- 590
G.obscuriglobus_planctomycetal      PLVELALGDAAQRFVVRSPE-AVDAVAAAVGELTGRVGFVPLSFSATHAG 597
marine.gamma.proteobacterium_g      TAVETVLGDNLQAVCVDGFDAVAALAESLQQGSVTLVDNMTATTVAGGG- 587
S.cerevisiae_eukaryotes_            LAVSTILGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLDTIETELP 595
                                                                                      

N.maritimus_thermoproteales_        -----LKLPTDSGVIGVLSDFVRCKPAYAELKTFLFGNIILTET---RES 633
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      -----MKMPKTPGLLGILSDCVKCDREYLPIARFLFGNIILAQT---GKD 631
uncultured.m.crenarchaeote2_th      -----MKMPKTPGLLGILSDCVKCDREYLPIARFLFGNIILAQT---GKD 631
C.symbiosum_thermoproteales_        -----PAPPEIEGAAGLLSDRIKCGRRYSALKEFLFGNVVVADS---VES 633
P.horikoshii_thermococcales_        -----VNG--DVGIP--VVSVIEYDPKIENAVSFALGDTVIVS--S-MEE 625
P.furiosus_thermococcales_          -----VDS--SVGLP--AVDVIEYDQKIENAVKFALGDTVIVN--S-MEE 625
T.kodakarensis_thermococcales_      -----MREKPKLGIP--AMDVVSYDPRFRNAVAYALGDTLIVN--D-MDE 628
M.voltae_methanococcales_           -----AKDISDTGIIGKAIDLVEFDIKYTNVFKFIFGNTHIVDNLE-NAK 656
M.jannaschii_methanococcales_       -----AYYIDEDGVIGRAIDLVEFDEKYRRVFEYVFGNTVVVENID-IAK 633
Hydrogenivirga_aquificales_         ----LPPYPRVRGAVDFAINLVEYEDRFERAVRFAFGDTLIVQD---FES 618
A.aeolicus_aquificales_             ----PLRYPRTKGAVDFAVNLVEYDPKFEKVVKFVFGDTLIVEN---FES 620
Hydrogenobaculum.sp_aquificale      ----LPPYPRQRGYIDFAVKLVDYDKALEPAISFVFGDTLVVES---FDV 615
H.marismortui_halobacteria_         -LG---SLPSADGVIDFAYNLVDFDREYAGIFSYVLGDTVVVDS---MDT 652
H.lacusprofundi_halobacteria_       -LP---RKPSVPGVVDFARNLVDYDSEYESIFSYVLGSTLIVED---MAT 651
M.thermophila_methanomicrobia_      -LP---EVPRVPGVIDFALNLIRFDDRFYPAFWYVFRDTLVVED---LDT 638
C.Methanoregula_methanomicrobi      -LP---PIK-EPGIIDYAVNLLDYDPVYDKAFAIALGSTVVVDT---LDR 616
A.fulgidus_archaeoglobales_         -LSLDKSILKEDGVIDFAVNLVRCDKKFQPVFRFILRDTVVVDR---IET 627
N.spumigena_cyanobacteria_          -FTQDATLRYANGFVDYAVNLVECDRRYQDVFSYVFGNTVVFRN---IQE 663
Lyngbya.sp_cyanobacteria_           GMGSMATMRSLEGFVDLAVNLIECDRQYENIFAYVFGNTMVFNH---INN 679
Synechocystis.sp_cyanobacteria      --GQNPNLSYAHGYIDLAVNLIDGDRRYADIFAFIFGNTIVFDT---LVN 653
P.torridus_thermoplasmatales_       -HPKAIDLINSDGILGFLRDFVSYDKEFENIIYYVFSDTLLADS---MET 625
V.polyspora_eukaryotes_             ----MNKISTPNNVPRLFDLVISSDPKFLPAFYSVLRDTLVVNNLK-DAN 796
P.tritici-repentis_eukaryotes_      ----MSPVQTPENVPRLFDLIKPKHDKLKPAFFQVMTNTLVAEDLD-QAE 905
C.eutactus_firmicutes_              GSIRN-DVLKEKGVIGVASDLVDVDPKFSILARNLLGRIIVVDNIDNALA 635
R.lactaris_firmicutes_              GGIRNAEALREPGVIGLANTLVHVESRFSGLAEQLLGKTIVVDQIDHGIA 636
A.stercorihominis_firmicutes_       IYNLNSSITSAKGFEGVGSDLVNYDKKYENIIKNALGTLLIFDNLSNANA 639
Geobacter.sp_d-proteobacteria_      PLLIPEAVCLLDNIS--------IVDPFREYIEPLLAHTYLVDSLEKALI 632
G.bemidjiensis_d-proteobacteri      -ATPSGAAPLLERVT--------VPAKHAQLVEPLLSGAYLARDLAHALE 631
G.obscuriglobus_planctomycetal      SADASGEHGGAGGGPSLAALVTCDRPHCAGLPAQLLGRVLMADTLA-DAR 646
marine.gamma.proteobacterium_g      ------------------GQWLATKVTEGQQALSLLAGIYAAEDLGAALG 619
S.cerevisiae_eukaryotes_            -----TLSLPDSQDYILSINAIDYEPEYEKAMQYVCGDSIICNTLNIAKD 640
                                                                                      

N.maritimus_thermoproteales_        AYNVSQSGYKAVTMDGEYFEAKGGTVVIDIDSKIS--------------- 668
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      AHQLSKAGYKAVSINGEFFESKTNAVTIDINSKIS--------------- 666
uncultured.m.crenarchaeote2_th      AHQLSKAGYKAVSINGEFFESKTNAVTIDINSKIS--------------- 666
C.symbiosum_thermoproteales_        AHRISRAGYRSVTLGGEYYEAGTAAAVIDISSRIS--------------- 668
P.horikoshii_thermococcales_        ARSY-IGKVRMVTLKGELYERSGAITGGHYRPRG---------LLLDTKE 665
P.furiosus_thermococcales_          ARPH-IGKVRMVTIEGELYERSGAITGGHFRARG---------LAVDTTK 665
T.kodakarensis_thermococcales_      AREVGIGKVRMVTLGGELLERSGAITGGHYKPRGK--------LGVNVDE 670
M.voltae_methanococcales_           KLSLKY-KARFVTLEGEVIEPSGAMVGGNIRRNS----------AIKVDI 695
M.jannaschii_methanococcales_       ELAKKYRKVRFVTLDGDVIEPSGAMIGGTFKSKA----------KIKVDV 673
Hydrogenivirga_aquificales_         AKSIGIGNYRMVTLEGELFEKSGVITGGSQRSGG----------ELGRKF 658
A.aeolicus_aquificales_             AKAIGIGNYRMVTLEGELFEKSGVITGGAVKPSG----------ELNKRY 660
Hydrogenobaculum.sp_aquificale      AKSL--QNYRCVTLEGEVFEKSGVITGGKAKQHS----------NIGKKA 653
H.marismortui_halobacteria_         ARELMG-DYRMVTLEGDLVEKSGAMTGGSSSGTR----------YSFS-G 690
H.lacusprofundi_halobacteria_       ARDLMG-DYRMVTLDGDLVEKSGAMTGGSGGGSR----------YAFTKS 690
M.thermophila_methanomicrobia_      ARRMIG-RYRMVTLDGDLIERSGAMTGG-HYTSR----------LKFAAE 676
C.Methanoregula_methanomicrobi      ARKLIG-KYRMVTLEGELLEKSGAMTGGSAKKPA----------RGFGAA 655
A.fulgidus_archaeoglobales_         AKRLMDRGFRFVTLDGDIVEKSGLMTGGSAEKRG----------ILVSRE 667
N.spumigena_cyanobacteria_          ARPNIG-LYRIVTLDGELLETSGAMTGGSSNQRSSLK----FG--QGESA 706
Lyngbya.sp_cyanobacteria_           ARRYIG-QHRMVTLDGELLETSGAMTGGSQSSRSTLH----FGTLDETTS 724
Synechocystis.sp_cyanobacteria      ARNHLG-KHRIVTLEGDLLEASGAMSGGSRNQRSGLR----FG--TMVSE 696
P.torridus_thermoplasmatales_       ARKHMT-GVRIVTLSGEIFEPAGAITGGYLKNDE-----------LIYSK 663
V.polyspora_eukaryotes_             RVAYGNKRFRVVTLSGELIDVSGTMSGGGTQTSRGLMKLTKSGNSGFKSY 846
P.tritici-repentis_eukaryotes_      RIAYGAKRWRVVTLDGKLIDTAGTMSGGGSRVVKGKMSSKLAS-----DV 950
C.eutactus_firmicutes_              VARKNNQSLRLVTIEGELINPGGSLTGG-AFRNSS-----------NLLG 673
R.lactaris_firmicutes_              IARKYRQTLRLVTLEGELINPGGSMTGG-AFKNSS-----------NLLS 674
A.stercorihominis_firmicutes_       FAKKSGHKYKIATLDGEVLFPGGALVGGQNKRGDE-----------GLLS 678
Geobacter.sp_d-proteobacteria_      LGKQS-PHLMFVTSQGDMVHSGSIVNGGSPEAAYQ-----------GLIH 670
G.bemidjiensis_d-proteobacteri      LAASF-PHATFVTVDGDLVHGGGILNGGSAEPAQQ-----------GIIH 669
G.obscuriglobus_planctomycetal      WLVALHPGHRVVTRSGELLEPDGTLTVGPLRGEAG------------LVS 684
marine.gamma.proteobacterium_g      LRATLQSHESVVTPEGLWIGPNWLRVAKDSDEQAG------------VLA 657
S.cerevisiae_eukaryotes_            LKWKKGIRGKLVTIEGALIHKAGLMTGGISGDANNRWD------KEEYQS 684
                                                                                      

N.maritimus_thermoproteales_        KLTKLISMSSDVDGLFQSINAVKKYLLLKKNAIKKLDDSIQLNSERLSIS 718
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      KFAKIISQSSTVEGLLQTITLLRNHVQKKKSNLKKIEEKQRYLMKQLQVS 716
uncultured.m.crenarchaeote2_th      KFAKIISQSSTVEGLLQTITLLCNHVQKKKSNLKKIEEKQRYLMKQLQVS 716
C.symbiosum_thermoproteales_        KLARVISMSSSVEGLVSAVSMLKGHVEKRRGLLKRAEGEILACRDELQSA 718
P.horikoshii_thermococcales_        LKEKVENLRIMKESLEGEVNSLRVKLKALENQSFELRIRMSDVEKEISLI 715
P.furiosus_thermococcales_          LREKVESLRRRKEALEGELNSLKIELRSLENASFELRIKLSDEKKELELA 715
T.kodakarensis_thermococcales_      IRKRVEALEGRKEALEAQVNALKVEVKGLENELFELRMKKSELSKDVQVI 720
M.voltae_methanococcales_           DMKKLTNLSEDIKELEQILSNVKDEIERLNNKINTCSTRKLELDNRLKIA 745
M.jannaschii_methanococcales_       DLSKLNKIADEIIAIESELRKIKEEIERLSKIVKRSSAKKMEIENTLEII 723
Hydrogenivirga_aquificales_         YEEERRKLDIEEQELREKEQDILVKLRAIRSEIAEKEGVLKVLEKKLSEF 708
A.aeolicus_aquificales_             YEEELQRLNAEEEKLKNEESIIQKKIREIRNLISEKTALLKVSERKI--- 707
Hydrogenobaculum.sp_aquificale      LLEKLEFLNEKYNLLKAKEQQLDQNIGKAKSSLIEKEGVIAINTKYIKDL 703
H.marismortui_halobacteria_         GAGKLERVATRINELEDERADVRDDLRDVEERLDDARDRESDATEQVRDI 740
H.lacusprofundi_halobacteria_       GGGKLERLATDISEREDERQALQAEVDELEDDIDDARDRKADAAERVRSL 740
M.thermophila_methanomicrobia_      ESRRLVGISERISATEARRGELLEKLDSVEEEISSISRKLESLDKEISRR 726
C.Methanoregula_methanomicrobi      VDDEIIRIRSHLAELSGEATTLEAAIKRMTEEVDGKRATRGGIDQDLARA 705
A.fulgidus_archaeoglobales_         LLEKERMLSDKIYELQREKEGLFAELNRAESLRKQYKDEVDRLTGMISEL 717
N.spumigena_cyanobacteria_          ESQEVVALKSRLADIERIIERCTEAIATLSARTKEHTQALTEARQGRREQ 756
Lyngbya.sp_cyanobacteria_           ESQAIAGLRQRLDDIERILERCMRAISDATIIVKERSQAMIEARQTLRDN 774
Synechocystis.sp_cyanobacteria      DTAEVKQLRQRLQDIQQVQGRNEELLLERTVRSRQLTQQLMEMRQQQREA 746
P.torridus_thermoplasmatales_       ITKEISNLENENNTLNDELKVKSDELNRISAALINITKKNTALVENIKNY 713
V.polyspora_eukaryotes_             TIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVELEISKF 896
P.tritici-repentis_eukaryotes_      SRDQVAKLEQDRDTLEQAFTEFQQELRELETSLRDLNQQIPELDTKSQKL 1000
C.eutactus_firmicutes_              RKRELDELKEQIEHLKGTAARAAKLDEELKASREQLRQDIDKYNSELQKA 723
R.lactaris_firmicutes_              RRREIEEFEKTVVMLKTEMDTLEEEVRKVKDLRAGIYSSTDEIQQTLRKA 724
A.stercorihominis_firmicutes_       RKNKIDKLEREIKQAVKDYNEYLKKSDSFDEQLKQKDEELKVMAEKINNL 728
Geobacter.sp_d-proteobacteria_      KKREIKELSLEAELLTKQISELEERRTQLKEDVATAGEGLRDIRQKLHQA 720
G.bemidjiensis_d-proteobacteri      KKREIKGLGADVERLTGEVQQLATARETRRVEIAEAEAHRVELRQSLHRL 719
G.obscuriglobus_planctomycetal      RKSELRELREQFRATSELVAGAEVELADLRRRAEAAEGTIEAVEAEIALL 734
marine.gamma.proteobacterium_g      RQQELDTLVEAISSAETAVATLDRDLKDGRQALDKFEAERESLQQEVQTQ 707
S.cerevisiae_eukaryotes_            LMSLKDKLLIQIDELSNGQRSNSIRAREVENSVSLLNSDIANLRTQVTQQ 734
                                                                                      

N.maritimus_thermoproteales_        EQSLAST---NEHYSTLTPRIESALNMKEQITTRIADLTSRDQNIESEVL 765
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      ETERGNA---SHSHSTLQSQIKSRTNMLDKLSQRISELRMQEKHCHPRII 763
uncultured.m.crenarchaeote2_th      ETERGNA---SHSHSTLQSQIKSRTNMLDKLSQRISELRMQEKHCHPRII 763
C.symbiosum_thermoproteales_        ETGLAAT---EGEHRELGEQAARKERVRDQMAERIAELSSERGRLEEEIN 765
P.horikoshii_thermococcales_        SKDLEKL---IKEEESLRSEIEDSERKIAEIDETISKKKDEVAKLKGRIE 762
P.furiosus_thermococcales_          SKDLNRL---LEEENAVKEEIEESERKIQEIEQKIENEKSELAKLRGRIQ 762
T.kodakarensis_thermococcales_      QKELDSY---LAEDRSLKEEIEENERLISELEKRIEESKGEMAKLRGRIE 767
M.voltae_methanococcales_           RDQEFKK---EEITKSNNLKIKELNMLNSKIDDEISELTDEKEILSQKVQ 792
M.jannaschii_methanococcales_       KKNEMRK---REIAEKNTIKIKELELKNKDILEELEELNLKREEILNRIN 770
Hydrogenivirga_aquificales_         EELSKEG---DRKLAEFDQKVSKAEEFIEVLRSQEEELRQRLKELKEDIE 755
A.aeolicus_aquificales_             EELSSEGL--EQYEEKFKEKLENSKEYLKILEEKLLNVEDKLKELAEEIE 755
Hydrogenobaculum.sp_aquificale      ENQKKDT---LLQKSNILERIKSGEEYIEHLENKKKELLEMLEPLKEEIK 750
H.marismortui_halobacteria_         ETSIERK---QTALEDTRERIEQLEADLEEIADEREDVADQMDELEADIE 787
H.lacusprofundi_halobacteria_       EADVERA---EDELADAEDRIDELKAELEDMEAERESVDAEMTELDDEID 787
M.thermophila_methanomicrobia_      TFLLEEK---RALRGRMERYIEERKSRLSEMERESEEWRSRLTVLEQEMQ 773
C.Methanoregula_methanomicrobi      GAVTEEY---TRRFEAITIEKQTIEAAVARQREETSTSAAELSVLEGDLF 752
A.fulgidus_archaeoglobales_         RNRISLL---DEKIRTESGRIEELREKISQKSREKENYISSLKDYNSKLA 764
N.spumigena_cyanobacteria_          QLQLSQL---QKDIQGLTAQLEGTRSQLTQNSEKITVAQSRLSVLDRELL 803
Lyngbya.sp_cyanobacteria_           QQRVSQI---ESKIQTLTTQQESLKTQLNQNIQELNTAQNRLQLLEREIP 821
Synechocystis.sp_cyanobacteria      QLHGEQT---ERDIARLSQQQTQINQQQINQQQKLAELQQNLALLQQSLP 793
P.torridus_thermoplasmatales_       KSSIEET---VISINEKEKKLGEIKNAINEIEKGIQKLSFDEDSLKLDLY 760
V.polyspora_eukaryotes_             ELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYK 946
P.tritici-repentis_eukaryotes_      ALELESFDRNIADCQRRIQELGSEQTSTKTDKGRISSLEKSIASMEKEVS 1050
C.eutactus_firmicutes_              YLMKNTL---TMSLNQVKEKLAESEKMTASIEKEMSELNNQIAEINNNKN 770
R.lactaris_firmicutes_              SVVETTA---RMNVEQTQLKQLEAKQKYDGYQKEQESLLQELQEITDNED 771
A.stercorihominis_firmicutes_       TLIISKE---EDKNRDKEDELETAIKTLEDNKKKILNLKEADKKIHEMNE 775
Geobacter.sp_d-proteobacteria_      EIELLNA---EKDLTRAREEVGRLEERASVGTIENEQLDEEKILLEREIS 767
G.bemidjiensis_d-proteobacteri      EIRVLNA---EKDLQSAQAECRRLEENAAVREMEEEQLSEEQDLVAKEIS 766
G.obscuriglobus_planctomycetal      SDEAGGL---LQRIARQRQQVEHLDADIELIEADCRTLEQQVQEGEAAWS 781
marine.gamma.proteobacterium_g      GNRHSELR---SELSAKQVNVEQISVRRDRINHEIDDGREQFQLEQESLG 754
S.cerevisiae_eukaryotes_            KRSLDENR--LEIKYHNDLIEKEIQPKITELKKKLDDLENTKDNLVKEKE 782
                                                                                      

N.maritimus_thermoproteales_        TNESHVESLLERISIVEENYASG---EQARIANELSRINAKKAEVEKLYT 812
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      RISSSIESLKQRISLMRENYSDV---AQTSVASELSFLNKKKSSLNSEGS 810
uncultured.m.crenarchaeote2_th      RISSSIESLKQRIILMRENYSDV---AQTSVASELSFLNKKKSSLNSEGS 810
C.symbiosum_thermoproteales_        VHETLTASLVAELEQAASAEPGA---DPDAMAAGIDALNAKRSELERLQA 812
P.horikoshii_thermococcales_        RLE-------KRRDKLKKALENP---EAREVTEKIREVEREIAKLREELS 802
P.furiosus_thermococcales_          RLE-------RKKEKLKKALENP---EARELMEKIRIIDGEISSLKEELS 802
T.kodakarensis_thermococcales_      RLE-------KKREKIKKALENP---EARELNSKIREVEAEISKLKEELS 807
M.voltae_methanococcales_           NLDNKLSEVMGQRERIVNEIKSY---ENSELSKRIKEIDHKIRENESSKN 839
M.jannaschii_methanococcales_       EIESKINELIERREKIINELKEY---ESDENLKRMNEIEGELKILEKEKA 817
Hydrogenivirga_aquificales_         YSE-------EKLSNLILKRQDI---INYYRSSGIEENRQEYERIKRRAE 795
A.aeolicus_aquificales_             YYE-------EKLNNLKLKEGDI---KRHYSREGVEEKRREYSKVRKQVS 795
Hydrogenobaculum.sp_aquificale      YIE-------EKLTNLELRKKDI---LSYYTSKEIKELKDTIEYYKKLHL 790
H.marismortui_halobacteria_         AKTEEIDALQRDIDELEAEVEDS---ELPDLTDQRESIKDDIDALEDRQG 834
H.lacusprofundi_halobacteria_       DLNTEIDELDGEIEEIETELADS---KIPELSERADEIRGEISDLEDRMS 834
M.thermophila_methanomicrobia_      ELESALSEKGDLREKLERDMQGS---RIPEMMERAEQLEGEIRRLESRIM 820
C.Methanoregula_methanomicrobi      KVTEGINAITAKIDGIKKKLDDT---NIPALTDQMEKKKKEIEEAERRLR 799
A.fulgidus_archaeoglobales_         EMEEAIGELEAEIEEIERMLRGS---EVPKIVEELDKIKEEHQRNREILI 811
N.spumigena_cyanobacteria_          GQESELQQLRQALAELEDSQTPS---EWQEIQVTIKSKEQQLQQREGELR 850
Lyngbya.sp_cyanobacteria_           IQEVQLQRDRETLSQLEAAHSHS---EWQQLQTILRTQETDLQTQETTLQ 868
Synechocystis.sp_cyanobacteria      PLEQQLASAQQQLTALETSQTHQ---QWQTIQIQIRTVEAEYQRQLQALR 840
P.torridus_thermoplasmatales_       KLNNEKSEIFNELKKISPEDLEI---EKS-MQKNLDELNNEYNNAKNEIS 806
V.polyspora_eukaryotes_             SLQLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDILNGKHK 996
P.tritici-repentis_eukaryotes_      KLRSETEDIEAEIKALQDKIMEIGGVKLRGQKAKVDGLKGQIDTLTEQAS 1100
C.eutactus_firmicutes_              SLADNNKKHEAMRLEAEARVDELE--SHSQENKDKLAAANAKVSELMIKF 818
R.lactaris_firmicutes_              SIQMELETSENMEKELNEKISQLQ--IRLEQTKKEEGSQLKQTEEVHLSL 819
A.stercorihominis_firmicutes_       KSKEEIDKLSKEIEDKKDEISKIS--LGLYKDKYLEMATKLNNEQLKLYK 823
Geobacter.sp_d-proteobacteria_      DLKKAVLQGDERKSVLELELASLQ--QSWEARKEIIADAREAVTARKVKV 815
G.bemidjiensis_d-proteobacteri      QAENRRGEAEERKLALEKNVEALQ--GRLEGSRFEMEEAREMVTSLKVRV 814
G.obscuriglobus_planctomycetal      AARLAAEDAERAAAELESRLAEVK--RALAAGAADRTAREQAHTAAQVAL 829
marine.gamma.proteobacterium_g      ESRMILSEAIESMESDSSQREELL--AERDECRTILDQARQRARHDKDSA 802
S.cerevisiae_eukaryotes_            ALQNNIFKEFTSKIGFTIKEYENHSGELMRQQSKELQQLQKQILTVENKL 832
                                                                                      

N.maritimus_thermoproteales_        TITNEYRDKASQ-LTTLETQDNREKSQSNRLHDEERSLSLEKEELQSKIN 861
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      QILKELSETEAN-ISVVE---DRRRLRKKALLDEQTSITGEKTELESNIT 856
uncultured.m.crenarchaeote2_th      QILKELSETEAN-ISVVE---DRRRLRKKALLDEQTSITGEKTELESNIT 856
C.symbiosum_thermoproteales_        EAVSAFGRASES-KAGADAAASGTESALRVLDTEKSGITAEAGELAAKAA 861
P.horikoshii_thermococcales_        RVEGKLESLNSRLNDELIPRKASLEEEIEGLVNKINALKANINENEEALK 852
P.furiosus_thermococcales_          RIESRIESLESRLNEELLPRKASLEEEIEGLVNKINALKNNISENEKALE 852
T.kodakarensis_thermococcales_      RVESKLESLDSRINEELLPRKADLEEEIEGLVNKINALNAYIEENKNAIT 857
M.voltae_methanococcales_           TLENEIKKGAILVKEVLIPKISELNSNIKSLADKKNMFKNSVEIYKSNIE 889
M.jannaschii_methanococcales_       KLKNEIDKGLTLVKEILIPKIEELNKKVSELINKKVILEKNISFYKESIE 867
Hydrogenivirga_aquificales_         AKRAELEKAKLAFKDKES-EIKSVEEEVQRKRAHLESLEAEAESLNKEVE 844
A.aeolicus_aquificales_             EIEKSLNEIERELNKKTY-ELEYLEKEIQEKEREREYLTERIKSLKKEIE 844
Hydrogenobaculum.sp_aquificale      DKTKELNTIELKKNDISK-NIEYVKSSVDQKKQELIGAHSQIKSLEQELT 839
H.marismortui_halobacteria_         ELDAELNEHQLE-KQYAEEAIEDLHDDIEAAQNRKADHEERIDDLEATVA 883
H.lacusprofundi_halobacteria_       SLDGRRNELELE-KGYTEDAVDDLHDTVETAQNRKAEAEEAIADHEVTID 883
M.thermophila_methanomicrobia_      DLDSEIMRCRLK-EENLRNRLDELARTKELLELKKNDAIQRRSSALSSME 869
C.Methanoregula_methanomicrobi      NKEADMNDASRE-RQHFTARIGELTEERARFDERNKQIDAEVAASNDQIT 848
A.fulgidus_archaeoglobales_         SIEKKIESLEFK-REQLESSMQEKQVYLDEIKDRIDEIRRTIEEGKARVE 860
N.spumigena_cyanobacteria_          DAQQRLKNLEIQ-QLRSQEKIQEAQTKIHQYHEQQSSQQNQLNTLQNQNF 899
Lyngbya.sp_cyanobacteria_           QVQQRLIELDSQ-QQRIEEKIEEGKQRIEDYQQQQQLQNHQIRELKKQIT 917
Synechocystis.sp_cyanobacteria      QGEDHLKDLQNS-SQRLEEKIAQAQEKIAQHQAQDLTLAQEQEQLKIALA 889
P.torridus_thermoplasmatales_       ILMNDIDHLNER--------INDLKSRISSYNNEIASKSSNIKNLNDKKE 848
V.polyspora_eukaryotes_             KDKNDLKKAETE-LKRLSKKQSECSTDLLTSTDKLENTDGQLSKISKSLS 1045
P.tritici-repentis_eukaryotes_      NAEVSKSKEEKQ-RAKHEKAHADAIRELEKLAVDAEKVEEDMASQQRDVS 1149
C.eutactus_firmicutes_              NSIKQRDDFIVENIRRINIDLEKNREELESFTSRVETSFAEITELENKIE 868
R.lactaris_firmicutes_              ASLEQQDNFILENMIRIEEEIQKFCNELEELGESRGNASEEIREKEEKIR 869
A.stercorihominis_firmicutes_       EEEKLRN--YNSSIYDLNKNIRDIESSLINSKKEIDENEENILILNELIE 871
Geobacter.sp_d-proteobacteria_      ASLKEKTDAINQDLLRVESLMTALKKQAGDHAAEVEKSILDREKLVLSIQ 865
G.bemidjiensis_d-proteobacteri      AALKEKGESTQRAYQRVEALCADLASRISSRGNELEGSGAERTRLIDAIA 864
G.obscuriglobus_planctomycetal      SRAAADRDRARERAAQLEADIRKRKIEALDLAAADRNARGRLADCTLAAL 879
marine.gamma.proteobacterium_g      HQLAMRFQSLRAQLDSMNQNIERTRSQVQQLEQRRNSLHEGISGADEPVE 852
S.cerevisiae_eukaryotes_            QFETDRLSTTQRRYEKAQKDLENAQVEMKSLEEQEYAIEMKIGSIESKLE 882
                                                                                      

N.maritimus_thermoproteales_        ELEVQKESKNEVLVKLREKEQELIETSGSSIGQLKEFDDKLKVLSEKDRE 911
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      KSQAEKNASEKNLIELRGKEQELISTSGTSVSQLAGFDEQLDERRNKEKK 906
uncultured.m.crenarchaeote2_th      KSQAEKNASEKNLIELRGKEQELISTSGTSVSQLAGFDEQLDERRNKEKK 906
C.symbiosum_thermoproteales_        ISKEQLAISEEQLVKLRGREQEFIEASAESVGRMKEYDGRLSALNARDRE 911
P.horikoshii_thermococcales_        SLTEKLEKLKKEEGEIYSRIEEQKKKKEELERKVAELREEKEKISRRIQE 902
P.furiosus_thermococcales_          LLNKELEKLKSIEENIKGEIRTLREKRKKLEEDISKLREKKEVLQRKLQE 902
T.kodakarensis_thermococcales_      ELEKELEELKTAEENVKDELKELREGREQIRVEIAELRKEKDELTSKLQE 907
M.voltae_methanococcales_           SNSSILSDKRGKYEELTKGLKDLTDKKECYELEIENLQNNKEELREKATD 939
M.jannaschii_methanococcales_       KNLSILEEKRKRYEELAKNLKELTEKKEQLEKEIETLERERREILRKVRD 917
Hydrogenivirga_aquificales_         ELRAKREELENRVKDIEAQVYQFYKEKDRTEEEVRDLQAELGRLRVEEED 894
A.aeolicus_aquificales_             NLILFKEKTLQEVKEAEVKVYDYIKQKEELEKEILNLKSKLGKLKIKEEE 894
Hydrogenobaculum.sp_aquificale      SLDLELKSAEEELKESNAMFYKLYEEKELLEKEQKNLQSELGGLKLEHER 889
H.marismortui_halobacteria_         EKQELKGEKEQAVADLEEELAELKSEREDLKADLQEAKEARDEQQAAVSE 933
H.lacusprofundi_halobacteria_       EKEETLEAKRESIAELEAELTELKADREDLREAITEATRERDEQRSLVSE 933
M.thermophila_methanomicrobia_      DLRAALDELSRKEKDLDRELHGLKGERGSLMESIIGKEREIGGMERSIER 919
C.Methanoregula_methanomicrobi      SLKSVIVGLEEKQKQFSGELDELRKKRAGISDSIHASETKLIKFDSDKER 898
A.fulgidus_archaeoglobales_         EINSELEELRKEERELGKELKGLRKERDELIKQLRNAEEEKRKIEAEIDR 910
N.spumigena_cyanobacteria_          ELNAQISEIQANLSQMEQNLGAEKQKRDATEQEVRSQLLKQQQLQWEIQK 949
Lyngbya.sp_cyanobacteria_           HWQEQIALTRGSVLKVEARLGEGKRQRDQVETQLRDQHLAKQQLEWQIQK 967
Synechocystis.sp_cyanobacteria      EMNGAIQTTEAQLAKLSEKLGSTKQERDRLETQLNQLRSQQQEQQWQWEK 939
P.torridus_thermoplasmatales_       SMEFELNKKNLMLSRLESSFKEVFNQIESKKRYYYELEKRQKEIDDSINE 898
V.polyspora_eukaryotes_             ETETLLHELEFSREESLQNSENLKDQLKEFEENLNSFKVFQLEHQNKEEK 1095
P.tritici-repentis_eukaryotes_      GIRQQAEEAQEELETKKEELLVVKKELDEKTTELNETRAIEIEMRNKLEE 1199
C.eutactus_firmicutes_              SIRSDIESRSGSITENEDKVAEFSAKREELQQSHKEFFAKREELSEKIAG 918
R.lactaris_firmicutes_              ELQQTIEESKELFEEIRQEIHGQTSKREELNQKNKDFLRLREDLSKHIAD 919
A.stercorihominis_firmicutes_       KAKEIDNDYDRLKQNLDDNYKALMEKKKDSGEEFDRVNTELKNLQEERFN 921
Geobacter.sp_d-proteobacteria_      QSEESLKALLEKQASFELSYSKLKEEYEFEISAHREDEAKQKKLRELVVT 915
G.bemidjiensis_d-proteobacteri      AGEEALRDIVKQQLRSEQALLLVKERYETEAATVQEEELRLKGTRSEASL 914
G.obscuriglobus_planctomycetal      RASAGQADAYGEKESRERLAAELSAKGAADRADRDRVRARLQQLRHGWQE 929
marine.gamma.proteobacterium_g      EMKIELEAQLETRLQVEEELSEARRLVDDVEHKLRELEGRRGSVELRTQA 902
S.cerevisiae_eukaryotes_            EHKNHLDELKEKFVTKQSELNSSEDILEDMNSNLQVLKRESDGIKEDIEK 932
                                                                                      

N.maritimus_thermoproteales_        LTKQINTLERQSDSLNRDLRDLVENETKLQQILSAFG------------- 948
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      ITADANRLAIELGELERDLKEIKTKESSLKKILNAFG------------- 943
uncultured.m.crenarchaeote2_th      VTADVNRLAIELGELERDLKEIKTKESSLKKILNAFG------------- 943
C.symbiosum_thermoproteales_        VSAGAAKAERRRDALERDLSSIEEGMKETQTVLDMFG------------- 948
P.horikoshii_thermococcales_        LRIEVNTLKVRNSQLKSLLMEKNSQLKHFSKEVIKS-------------- 938
P.furiosus_thermococcales_          LEIEANTLKVRDAQLNAQLEEKKYQLTHYDKNLIKS-------------- 938
T.kodakarensis_thermococcales_      LRIEANTLKVRLAQVETTLQEKRAELKHFDPALVRS-------------- 943
M.voltae_methanococcales_           IDNQVNVINVDRAKYETRLEEEERKLYLCDTLENIEDISDE--------- 980
M.jannaschii_methanococcales_       IENRINELMVEKAKYESKLEEEERKLYLCEKVD----VSKE--------- 954
Hydrogenivirga_aquificales_         LHSKVGDVSANLSRVQQKLTDLEQRLEELNFEGELP-------------- 930
A.aeolicus_aquificales_             LKEKIFEKEKNLKVLEEKIENLNEELKEY-EDLKLG-------------- 929
Hydrogenobaculum.sp_aquificale      LLEEIGSLSNDITRIQTKIESINEALKEKEYDGTIY-------------- 925
H.marismortui_halobacteria_         IERDLESEQETQERLEWEIDELEAQVG--DYDPEDVP------------- 968
H.lacusprofundi_halobacteria_       AESDLEDLTDRRDRLAWEIDELESQVG--EYDADEIP------------- 968
M.thermophila_methanomicrobia_      LDARLTAVSGAREEISISMQSLRSEIESAGIDPSEAPP------------ 957
C.Methanoregula_methanomicrobi      FTIQLSALEERATALANEIASLKAIVG-----EVSTDL------------ 931
A.fulgidus_archaeoglobales_         LEERIKLQKERLEIAESEIAEIGEVEVP------ENLP------------ 942
N.spumigena_cyanobacteria_          LQETQEKRREELTTLQNQLRETGAELPNPLPEVPDKVD------------ 987
Lyngbya.sp_cyanobacteria_           LQETQLGRREQLEIKQEQLATQQAELSDPLPEIPENLD------------ 1005
Synechocystis.sp_cyanobacteria      LQTNQQEYQENLTQLQTQLEALEQDLPDPWPEIPLLQDRDE--------- 980
P.torridus_thermoplasmatales_       NNIIIVNMKSRMENISLKINEINSSLNGDIKEYNKS-------------- 934
V.polyspora_eukaryotes_             LNNLLNFIKKDIRSTDSELQSLKIRDITHTLQELDNGNIDQDEEDVSMKD 1145
P.tritici-repentis_eukaryotes_      NQKTLNEFQRKQTYYHEKLSKLAYQSVTDLGDEQE--------------- 1234
C.eutactus_firmicutes_              LEKDSYKLTSIIEKSSEKSDELSSYMWEEYEITYSAAKEL---------- 958
R.lactaris_firmicutes_              LDKETFRLNSQKEGYEEASEKQMNYMWEEYELTYNHAMEL---------- 959
A.stercorihominis_firmicutes_       LSERIQKLENKKDKLSLEFDYLQRGIIEDYNLTYAQAAEF---------- 961
Geobacter.sp_d-proteobacteria_      SKEAISNHTLSATQLSMQLSQLETQVLDKFRTGIADILPK---------- 955
G.bemidjiensis_d-proteobacteri      LRDQLNAKSMRLTEVSMRLSHLEETLREKHRMEIADALLN---------- 954
G.obscuriglobus_planctomycetal      KQAAAHARELAAHDLGARLAALGQRIREDYGIELAELAGGALRPAEGSSA 979
marine.gamma.proteobacterium_g      VRSELERGRVEVQGLQVQRRALEEQLLEAQYDVETVLN------------ 940
S.cerevisiae_eukaryotes_            FDLERVTALKNCKISNINIPISSETTIDDLPISSTDNEAITISNSIDINY 982
                                                                                      

N.maritimus_thermoproteales_        --------------------------------------------------
GOS_711020                          --------------------------------------------------
uncultured.m.crenarchaeote_the      --------------------------------------------------
uncultured.m.crenarchaeote2_th      --------------------------------------------------
C.symbiosum_thermoproteales_        --------------------------------------------------
P.horikoshii_thermococcales_        --------------------------------------------------
P.furiosus_thermococcales_          --------------------------------------------------
T.kodakarensis_thermococcales_      --------------------------------------------------
M.voltae_methanococcales_           --------------------------------------------------
M.jannaschii_methanococcales_       --------------------------------------------------
Hydrogenivirga_aquificales_         --------------------------------------------------
A.aeolicus_aquificales_             --------------------------------------------------
Hydrogenobaculum.sp_aquificale      --------------------------------------------------
H.marismortui_halobacteria_         --------------------------------------------------
H.lacusprofundi_halobacteria_       --------------------------------------------------
M.thermophila_methanomicrobia_      --------------------------------------------------
C.Methanoregula_methanomicrobi      --------------------------------------------------
A.fulgidus_archaeoglobales_         --------------------------------------------------
N.spumigena_cyanobacteria_          --------------------------------------------------
Lyngbya.sp_cyanobacteria_           --------------------------------------------------
Synechocystis.sp_cyanobacteria      --------------------------------------------------
P.torridus_thermoplasmatales_       --------------------------------------------------
V.polyspora_eukaryotes_             NAVSVSANNSLGNSENMEGVEIETNESDVSPDANNDLEMEIDEDNNEISK 1195
P.tritici-repentis_eukaryotes_      -----------GSGE----------------------------------- 1238
C.eutactus_firmicutes_              --------------------------------------------------
R.lactaris_firmicutes_              --------------------------------------------------
A.stercorihominis_firmicutes_       --------------------------------------------------
Geobacter.sp_d-proteobacteria_      --------------------------------------------------
G.bemidjiensis_d-proteobacteri      --------------------------------------------------
G.obscuriglobus_planctomycetal      DISG--------------------------------------TEDARADT 991
marine.gamma.proteobacterium_g      --------------------------------------------------
S.cerevisiae_eukaryotes_            KG------------------------------------------------ 984
                                                                                      

N.maritimus_thermoproteales_        --------FDKDMETFDVESIVQGLSAELASLNA-LNAKAPETYLEVSYG 989
GOS_711020                          ----------DELEDFDVESIIQGLNTEQKSLTA-LNGKAPEQYMDVSYG 39
uncultured.m.crenarchaeote_the      --------FDESIETFDVEPSIEILEKEESSLAASLNAIAPQRYVEVSTG 985
uncultured.m.crenarchaeote2_th      --------FDESIETFDVEPSIEILEKEESSLAASLNAIAPQRYVEVSTG 985
C.symbiosum_thermoproteales_        --------FGGDLEYFDVGPMLRGLEAEQRSLQQ-LNARAPEVYADVTDG 989
P.horikoshii_thermococcales_        -------IRDIPSDLEGLKKEIEKMEEEIKALEP-VNMKAIEDFEVVERR 980
P.furiosus_thermococcales_          -------IKEIPLDLEKVKKEIEKMEEEIRSLEP-VNMKAIEDFEIVERR 980
T.kodakarensis_thermococcales_      -------IKEIPLEVEKLRQDIEKMEEEIRSLEP-VNMKAIEDFEVVERR 985
M.voltae_methanococcales_           -----MIEETYSLEIDDLERNQALLESSIKKLEP-VNMRAIEDYDFINER 1024
M.jannaschii_methanococcales_       -----LEKK----DIEELEIYIGELENEIKSLEP-VNMRAIEDYNYVAER 994
Hydrogenivirga_aquificales_         --------EVK-EGITKLKERLFKIERELEHLGN-VNLKADEDYNEELER 970
A.aeolicus_aquificales_             --------ADE-ESIPKLKEKLKRVTEEIQKLGS-VNFRAEEDYAEELKR 969
Hydrogenobaculum.sp_aquificale      --------EEQNQSASKLKEELERTKKLLESMSD-INLKAEEEYEETLNR 966
H.marismortui_halobacteria_         -------------DHETVEQEIDRLETEMEKLEP-VNMRAIEEYDRVNDD 1004
H.lacusprofundi_halobacteria_       -------------DLDEVESRIEELEEEMAALEP-VNMLAIDEYDEVEEA 1004
M.thermophila_methanomicrobia_      -------------KSETIAAKIRALEEEMASLEP-VNMLAIDEYERVDKR 993
C.Methanoregula_methanomicrobi      -------------TLTEIEGKIADAELALHKIGA-VNMLAIEEYEKIERQ 967
A.fulgidus_archaeoglobales_         -------------PLEKVEKVLDEVLVELSTFGD-VNLKAIQEYEEVKAR 978
N.spumigena_cyanobacteria_          --------------LEELQKELRSLAKRLQAMEP-VNMLALEEYERTQNR 1022
Lyngbya.sp_cyanobacteria_           --------------LASLQRELKALQKQMEALEP-VNMLALEEFQRTQTR 1040
Synechocystis.sp_cyanobacteria      -----A-NLDFANILEELERSIRNGQKRLEAMEP-VNMLALQEYEKTEAR 1023
P.torridus_thermoplasmatales_       --------------ISEIKALVDKYKSEINALGP-INQMAVSEYNETLER 969
V.polyspora_eukaryotes_             GIPRISEDEFKNVDVEELEAQKLQLQDYIDTVN--VNIDVLEEYARRVAE 1243
P.tritici-repentis_eukaryotes_      GLPSYSKDELEDMDKAALKEQIAHLEKKNESTQ--VDLSVLAEYRKRVEE 1286
C.eutactus_firmicutes_              -------RDEKLPELPALKKEITAVKAKIKSLGD-VNVNAIDDYKEVSER 1000
R.lactaris_firmicutes_              -------RNEKLTDLAEMKRQIQVLKNEIRKLGT-VNVNAIEDYKNVSER 1001
A.stercorihominis_firmicutes_       -------KTP-IENMLEIETKVRDLKSSIKKLGN-INVESIEEYKEVKER 1002
Geobacter.sp_d-proteobacteria_      -------YGNIEYNEAEKRSRQNELMKVVDEMGD-VNLTAIEEFQELEKR 997
G.bemidjiensis_d-proteobacteri      -------YSKVEWDEEERAVRQAELQKAINEMGE-VNLMAIEEFKEMEER 996
G.obscuriglobus_planctomycetal      TSSERIEPPLVGVNVLEAQAEIEDLKRKLARLGS-VNMEALEELTRVEGE 1040
marine.gamma.proteobacterium_g      -------NLPDDAREKAWLENLESIGRRVARLGP-INLAAIDEYKSQSER 982
S.cerevisiae_eukaryotes_            -LPKKYKENNTDSARKELEQKIHEVEEILNELQP--NARALERYDEAEGR 1031
                                                                        :             

N.maritimus_thermoproteales_        YRSMSTRKNSLEEERNSIVKFIEDIEKDKRQTFLDAFDKVDKEIKLIFNK 1039
GOS_711020                          YRSMSVRKNSLEGERTSIVNFIEKIERDKKQTFLDAFDIVDKEIRTIFNK 89
uncultured.m.crenarchaeote_the      YHSMSSRKNELEAERNAVVSFIEGIEKNKRQTFLDAFDTVDNEIREIFTK 1035
uncultured.m.crenarchaeote2_th      YHSMSSRKNELEAERNAVVSFIEGIEKNKRQTFLDAFDTVDNEIREIFTK 1035
C.symbiosum_thermoproteales_        YRSMSSRKNSLEGERNRIVGFIEGIEREKKQTFLDAFDKVDREIKNAFSK 1039
P.horikoshii_thermococcales_        YLELKSKRERLEAEKDSIIEFINEIEKEKKNVFMKTFDAIAKNFSELFAR 1030
P.furiosus_thermococcales_          YLELKSKREKLEAEKESIIEFINEIEKEKKNVFMRTFEAISRNFSEIFAK 1030
T.kodakarensis_thermococcales_      YLELSSKREQVLAEKESIEEFIQEIEGQKRQVFLQTLNAIAKNFSELFAK 1035
M.voltae_methanococcales_           YEELFGKRKEYEQEEGKYLQLISEVQKRKKETFMKTYDRVAENYEQIYGE 1074
M.jannaschii_methanococcales_       YKELIEKRKEYERDEKKYLQLMEELENKKKEVFMEVFNKVAKNFEEVYKE 1044
Hydrogenivirga_aquificales_         YQDYEDKHRKLQEERKAIKEMIEEIETKKLRAFTEAFENINKSLKKIFSF 1020
A.aeolicus_aquificales_             FNDYKEKQQKLKEESKAIKKLIEETENKKRKVFLEAFNQINKSLKRIFSF 1019
Hydrogenobaculum.sp_aquificale      LKDYKEKLDQLIKDKQAIKAMIEEIDRKKYSAFMEAFNNIRKNFKEIYAK 1016
H.marismortui_halobacteria_         LQELEDKKATLVEEADGIRDRIDTYEARKKETFMESFTEINDQFQNIFER 1054
H.lacusprofundi_halobacteria_       LETLQERRDVLVEERDAIAERIEGYEAEKKRTFMETFESINDQFEDIFAR 1054
M.thermophila_methanomicrobia_      FRNLSDRREVLHREREGIIEKLERYDQLKKDAFMSCFAAVNQNFREIFHE 1043
C.Methanoregula_methanomicrobi      VQERTERKDTLSKERETLIERIEKYEQMKFEAFMTAFKAIDTNFREIFAR 1017
A.fulgidus_archaeoglobales_         RDELVEKKMVLEKERADILDRIEKYERMKREIFFEVFTAINRNFAEIIRE 1028
N.spumigena_cyanobacteria_          LQELTEKLQTLEAERTELLLRIENFTTLRQRAFKEAFDAVNENFQSIFAI 1072
Lyngbya.sp_cyanobacteria_           LDELSQKLTTLEGERTELLLRIENFTTLRQRAFQEAFDAVNENFQTIFAS 1090
Synechocystis.sp_cyanobacteria      LGELSEKLQTIAGERTELLLRIENFTTLRRRSFQDAFDAVNKNFQIIFAE 1073
P.torridus_thermoplasmatales_       YGENMEKYKKLESERSELMEIENRLINEEKMAFLDLFNNINNEFKDIYSR 1019
V.polyspora_eukaryotes_             YKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQM 1293
P.tritici-repentis_eukaryotes_      HAARSSDLATAISARDAAKNKCEELRRLRKEGFKAGFDIITARLKEMYQM 1336
C.eutactus_firmicutes_              YEFLKGQHDDIVCAETNLVNIIAELEKNMQQQFAEKFKEIQVMFDKVFKE 1050
R.lactaris_firmicutes_              YTFLKGQHDDLVEAEASLVQIIEELDTAMRKQFTEQFARIAKEFNEVFRQ 1051
A.stercorihominis_firmicutes_       FEFLSEQKNDLENSKDELLHIIKDMNSKIEERFIKEFDHINVEFDNVFKK 1052
Geobacter.sp_d-proteobacteria_      FLFLDEQKEDLEDSLSSLQKAIQRINKTTRRRFLETFHLVNEKFQEVFPR 1047
G.bemidjiensis_d-proteobacteri      FSFLSSQKDDLEESMNALQKAIQRINRTTRKRFLETFQMVNEKFQTIFPR 1046
G.obscuriglobus_planctomycetal      FNALQAQHSDLNAARQSLQQIIDAINGDSRKLFLDTLNAVRGYFQELFRK 1090
marine.gamma.proteobacterium_g      KTYLDAQNNDLEEALRTLENAIHKIDKETRQRFKDTFDRVNTSLQELFPK 1032
S.cerevisiae_eukaryotes_            FEVINNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRE 1081
                                                                    *      :          

N.maritimus_thermoproteales_        MT----------GGNAWLELQNEDDIFNSGISYLIQFPNKPKRESTSISG 1079
GOS_711020                          MT----------GGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISG 129
uncultured.m.crenarchaeote_the      MN----------GGNAWLELENEDDIFNAGISYFIQFPNKPKRESTSISG 1075
uncultured.m.crenarchaeote2_th      MN----------GGNAWLELENEDDIFNAGISYFIQFPNKPKRESTSISG 1075
C.symbiosum_thermoproteales_        MT----------GGSAWLELQNEDDIFSSGISYMIQFQNKPKRESTSISG 1079
P.horikoshii_thermococcales_        LSP---------GGSARLILENPDDPFSGGLEIEAKPAGKDVKRIEAMSG 1071
P.furiosus_thermococcales_          LSP---------GGSARLILENPEDPFSGGLEIEAKPAGKDVKRIEAMSG 1071
T.kodakarensis_thermococcales_      LSP---------GGEAKLILENPEDPFSGGLEIEAKPAGKDVKRIEAMSG 1076
M.voltae_methanococcales_           IG-----------GNGKLSLENEEDPFSGGLLIDASPMNKQLQNLDVMSG 1113
M.jannaschii_methanococcales_       IG-----------GIGKLSLENEKNPFEGGILIDASPRGKKLLSLDAMSG 1083
Hydrogenivirga_aquificales_         LSP---------GGRAQMMVENEIDPFSGGISLVVKPRGKDVQYLEAMSG 1061
A.aeolicus_aquificales_             LSP---------GGKAQMFLDNPEDPFSGGVQLTVKPRGKDVQYLEAMSG 1060
Hydrogenobaculum.sp_aquificale      VSY---------QGKADLSLDNEEDPFSGGVSIFVKPRGKDVQYVEAMSG 1057
H.marismortui_halobacteria_         LS----------NGTGHLHLEDEDDPFEGGLTMKAQPGDKPIQRLNAMSG 1094
H.lacusprofundi_halobacteria_       LS----------AGSGELLLENPEDPFEEGLTMKAQPADKPVQRLDAMSG 1094
M.thermophila_methanomicrobia_      LS----------GGDGELVLECPDDPLSGGMTIRARPAGKVFHRLEAMSG 1083
C.Methanoregula_methanomicrobi      LT----------SGSGNLVLENEEDPFTGGLTFAVKPRDKKVHLLSSLSG 1057
A.fulgidus_archaeoglobales_         LA----------NGEGELYLDS-DDPFNSGLYIKVKPNNKPVQKLESMSG 1067
N.spumigena_cyanobacteria_          LS----------DGDGYLQLENPEDIFNSGLNLVAHPKGKPVQRLASMSG 1112
Lyngbya.sp_cyanobacteria_           LS----------DGDGYLQIDDLEDPFNSGLNLIAHPKGKPVQRLASMSG 1130
Synechocystis.sp_cyanobacteria      LS----------DGDGYLQLDDAEDPFNGGLNLVAHPKGKPVRRLSSMSG 1113
P.torridus_thermoplasmatales_       LSD---------GGEATLELSNQNDPLNSEVFIKARPKGKYMIKIESLSG 1060
V.polyspora_eukaryotes_             ITM---------GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSG 1334
P.tritici-repentis_eukaryotes_      ITM---------GGNAELEYEDTLDAFSEGIRFSVMPPKKSWKNISNLSG 1377
C.eutactus_firmicutes_              LFG---------GGRGALELVDSDDLLETGIRIIAQPPGKKLQNMMQLSG 1091
R.lactaris_firmicutes_              LFG---------GGKGTLELMEDEDILEAGIRIIAQPPGKKLQNMMQLSG 1092
A.stercorihominis_firmicutes_       LFN---------GGSAKLILTNPDDIMESGIDIVAQPPKTKLKNISSLSG 1093
Geobacter.sp_d-proteobacteria_      LFC---------GGRAELKLTNEDDLLESGLEIIVQPPGKKLQNVTLLSG 1088
G.bemidjiensis_d-proteobacteri      LFC---------GGHAELRLTDEEDLLNTGLDIVVQPPGKKLQNVSLLSG 1087
G.obscuriglobus_planctomycetal      LFG---------GGQADIVLEDEADVLESGIEITARPPGKELRSLSLLSG 1131
marine.gamma.proteobacterium_g      VFG---------GGTAYLEMTG-DDLLNTGIAIMARPPGKRNSTIHLLSG 1072
S.cerevisiae_eukaryotes_            LTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSG 1131
                                    :            * . :      : :   :        .       :**

N.maritimus_thermoproteales_        GEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSNILE-ERAK 1128
GOS_711020                          GEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILD-ERSQ 178
uncultured.m.crenarchaeote_the      GEKTLAAVVFVLALQRLKPSPFYLFDEIDAHLDAPNAESLAKIVE-ERSK 1124
uncultured.m.crenarchaeote2_th      GEKTLAAVVFVLALQRLKPSPFYLFDEIDAHLDAPNAESLAKIVE-ERSK 1124
C.symbiosum_thermoproteales_        GEKTLAAVVFVLALQKLKPSPFYLFDEVDAHLDAPNSEKLAKILE-ERAR 1128
P.horikoshii_thermococcales_        GEKALTALAFIFAIQKFKPAPFYLFDEIDAHLDDANVKRVADLIK-ESSK 1120
P.furiosus_thermococcales_          GEKALTALAFVFAIQKFKPAPFYLFDEIDAHLDDANVKRVADLIK-ESSK 1120
T.kodakarensis_thermococcales_      GEKAIIALAFVFAIQRYKPAPFYLLDEIDAHLDDANVKRVADLIK-EASQ 1125
M.voltae_methanococcales_           GEKSLTALAFLFAIQRLNPSPFYVLDEVDAALDTKNASLIGDMIS-NASK 1162
M.jannaschii_methanococcales_       GEKSLTALAFLFAIQRLNPSPFYVLDEVDAALDVKNVSLIADMIK-NASK 1132
Hydrogenivirga_aquificales_         GEKTLAALSLIFAIQEYKPSPFYYFDEVDAHLDEANAKKVGELIK-EKSK 1110
A.aeolicus_aquificales_             GEKTLAALSLIFALQEYKPSPFYYFDEVDAHLDEVNAKKVGELIR-EKSK 1109
Hydrogenobaculum.sp_aquificale      GEQTLAAMSLIFAIQEYKPSVFYYFDEIDAHLDEANAYLLGQMIK-EKSK 1106
H.marismortui_halobacteria_         GEKSLTALAFIFAIQRHNPAPFYALDEVDAFLDAANADLVGELVD-ELAG 1143
H.lacusprofundi_halobacteria_       GEKSLTALSFIFAIQRHNPAPFYALDEIDAFLDAVNAERVGEMIE-ELAE 1143
M.thermophila_methanomicrobia_      GEKSLTALSLIFAIQRFRPAPFYAMDEIDMFLDGANVERVAKMIR-RISR 1132
C.Methanoregula_methanomicrobi      GEKSLTTLAFIFSIQHHIPAPFYAFDEVDMSLDGANVERIAAMIQ-ELAP 1106
A.fulgidus_archaeoglobales_         GEKSLVALALIFAIQMYKPAPFYAFDEVDMFLDGVNVGRVAKMIK-KRSK 1116
N.spumigena_cyanobacteria_          GEKSLTALSFIFALQRYRPSPFYAFDEVDMFLDGANVERLARMIK-QEAQ 1161
Lyngbya.sp_cyanobacteria_           GEKSLTALSFIFSLQRYRPSPFYAFDEVDMFLDGANVERLARMIK-RQAQ 1179
Synechocystis.sp_cyanobacteria      GEKSLTALSFIFALQRYRPSPFYGFDEVDMFLDGANVEKLSKMVR-KQAQ 1162
P.torridus_thermoplasmatales_       GEKSLAALSLIMAFQRAKPSPFYYLDEVDMFLDGYNAEHMGSMFK-ENSR 1109
V.polyspora_eukaryotes_             GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK-ERTK 1383
P.tritici-repentis_eukaryotes_      GEKTLSSLALVFALHHYKPTPLYVMDEIDAALDFRNVSIVASYIK-ERTK 1426
C.eutactus_firmicutes_              GEKSLTAIALLFAIQSLKPSPFCLLDEIEAALDDSNVRRFAQYLN-RLTK 1140
R.lactaris_firmicutes_              GEKALTAISLLFAIQNLKPSPFCLLDEIEAALDDNNVDRYAQYLH-KLTK 1141
A.stercorihominis_firmicutes_       GEKSMTAIALIFAILKLKPAPFCVLDEIDAALDDANVARFCNYLK-SIIG 1142
Geobacter.sp_d-proteobacteria_      GEKALSAVALIFSLFLIKPTPFCLLDEVDAPLDDANIGRFNEMVR-EMSA 1137
G.bemidjiensis_d-proteobacteri      GEKALTAVALIFSIFLIKPSPFCLLDEVDAPLDDANIGRFNDMVR-EMSA 1136
G.obscuriglobus_planctomycetal      GEKTLTAVALLLAIFRNKPSPFCILDEVDAALDEANTARLAGVLR-EFLD 1180
marine.gamma.proteobacterium_g      GEKALTAIALVFSIFRLNPAPFCMLDEVDAPLDDANVGRYARLVK-EMSQ 1121
S.cerevisiae_eukaryotes_            GEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNP 1181
                                    **::: :: :::::    *: :  :**::  **  *       .      

N.maritimus_thermoproteales_        ESQFIMVSLKDSVVQKAKLIYGVFPK-NGVSNVVTYKDKR-MPSVRTS-- 1174
GOS_711020                          ESQFIMVSLKDSVVQKAKLIYGVYPK-NGVSQVVTYKDKRNVPSLQTS-- 225
uncultured.m.crenarchaeote_the      GSQFIMVSLKDSVVEKAKLIYGVYPK-NGVSHVVTYKDKR-LPAMTT--- 1169
uncultured.m.crenarchaeote2_th      GSQFIMVSLKDSVVEKAKLIYGVYPK-NGVSHVVTYKDKR-LPAMTT--- 1169
C.symbiosum_thermoproteales_        ESQFIMVSLKDSVVRRASLIYGVFPK-GGVSHVVSYRDKR-LPSMAPST- 1175
P.horikoshii_thermococcales_        ESQFIVITLRDVMMANAEKIIGVSM--RDGVSKVVSLSLEKAMRILEDIR 1168
P.furiosus_thermococcales_          ESQFIVITLRDVMMANADKIIGVSM--RDGVSKVVSLSLEKAMKILEEIR 1168
T.kodakarensis_thermococcales_      NSQFIVITHRDVMMAQADRIIGVSM--RNGVSKVVSLSLEKARKILEEIR 1173
M.voltae_methanococcales_           ESQFIVISHREQMISKSNVMYGVCM--ENGLSKIVSVKL----------- 1199
M.jannaschii_methanococcales_       DSQFIVISHREQMVSKADVVYGVYM--ENGLSKVVGIRL----------- 1169
Hydrogenivirga_aquificales_         EAQFIVVTLREVLATFADRLIGVSA--RGGISRVFPVEN--LSSLVRQES 1156
A.aeolicus_aquificales_             EAQFIVVTLREVVTSFADKIVGVSA--RGGISEVFFLKNEGLEEIIKEA- 1156
Hydrogenobaculum.sp_aquificale      NVQFIVVTLRENLANFADKLIGVTN--KDGISKTLTFKS--LKEVS---- 1148
H.marismortui_halobacteria_         DAQFVVVSHRSAMLERSERAIGVMMQ-GDNVSAVTGIDLSGEGDGDEEVP 1192
H.lacusprofundi_halobacteria_       EAQFVVVGHRSALLERSDRAIGVTMQ-GDNLSAVTGMQFGD--DGDEEVT 1190
M.thermophila_methanomicrobia_      DAQFIVVSLRRPMIQQASYTIGVSMQ-EKNISSVTGICLS---------- 1171
C.Methanoregula_methanomicrobi      SSQFVIVSLRKPMIEAAQRIMGVTIR-PDKSTLVTGVKVNG--------- 1146
A.fulgidus_archaeoglobales_         DAQFIVVSLRKPMLEQADAIVGITLG-RDNVSQVTGIKLKT--------- 1156
N.spumigena_cyanobacteria_          QAQFIVVSLRRPMIESAERTIGVTQA-RGAYTQVLGIKLKSSHTSA---- 1206
Lyngbya.sp_cyanobacteria_           QAQFIVVSLRRPMMEASERTIGVTQA-RGAYTQVLGIQL----------- 1217
Synechocystis.sp_cyanobacteria      QAQFIVVSLRRPMIEAAERTIGVTQA-RGAHTQVLGIKL----------- 1200
P.torridus_thermoplasmatales_       HAQIIMVSLKGAVSKYADHIIGVTTY-DKENTEIIEKSLDDE-------- 1150
V.polyspora_eukaryotes_             NAQFIVISLRNNMFELAEQLVGIYKS-NNQTKSATLQNNDIINRD----- 1427
P.tritici-repentis_eukaryotes_      NAQFIVISLRNNMFELASRLVGVYKV-NHMTKSVTIENKDYITGRA---- 1471
C.eutactus_firmicutes_              DTQFIVISHRKGTMEAADILYGITMQ-EKGVSTLVSVNLIENDLDK---- 1185
R.lactaris_firmicutes_              HTQFIVITHRRGTMAAADRLYGITMQ-EKGVSTLVSVDLLEDQLEK---- 1186
A.stercorihominis_firmicutes_       DNQFIIVTHRKITMGIADVLYGATMG-SEGITRIVSVKLKDIHEGGQIKN 1191
Geobacter.sp_d-proteobacteria_      FSQFIIITHNKTTMAVVDTLYGVTME-EPGVSKLVSVKLN---------- 1176
G.bemidjiensis_d-proteobacteri      NSQFIIITHNRATMAVADTLYGVTME-EPGVSKLVSVRLNR--------- 1176
G.obscuriglobus_planctomycetal      RSQFIVITHKKRTMAAADRLWGVTMQ-ESGISRLLPMRFEDWNDEGGEAQ 1229
marine.gamma.proteobacterium_g      QVQFIYITHNKIAMEMADQLLGVTMH-EPGVSRLVTVDVDEAAELAAI-- 1168
S.cerevisiae_eukaryotes_            DLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIITLDLSNYAE------ 1225
                                      *:: :  .       .   *                            

N.maritimus_thermoproteales_        ----------------
GOS_711020                          ----------------
uncultured.m.crenarchaeote_the      ----------------
uncultured.m.crenarchaeote2_th      ----------------
C.symbiosum_thermoproteales_        ----------------
P.horikoshii_thermococcales_        RRGEYGGNYPS----- 1179
P.furiosus_thermococcales_          KKQGWEHGN------- 1177
T.kodakarensis_thermococcales_      KKDEAEHREMFGRLEA 1189
M.voltae_methanococcales_           ----------------
M.jannaschii_methanococcales_       ----------------
Hydrogenivirga_aquificales_         TS-------------- 1158
A.aeolicus_aquificales_             ----------------
Hydrogenobaculum.sp_aquificale      ----------------
H.marismortui_halobacteria_         ADD------------- 1195
H.lacusprofundi_halobacteria_       ADD------------- 1193
M.thermophila_methanomicrobia_      ----------------
C.Methanoregula_methanomicrobi      ----------------
A.fulgidus_archaeoglobales_         ----------------
N.spumigena_cyanobacteria_          ----------------
Lyngbya.sp_cyanobacteria_           ----------------
Synechocystis.sp_cyanobacteria      ----------------
P.torridus_thermoplasmatales_       ----------------
V.polyspora_eukaryotes_             ----------------
P.tritici-repentis_eukaryotes_      ----------------
C.eutactus_firmicutes_              ----------------
R.lactaris_firmicutes_              ----------------
A.stercorihominis_firmicutes_       A--------------- 1192
Geobacter.sp_d-proteobacteria_      ----------------
G.bemidjiensis_d-proteobacteri      ----------------
G.obscuriglobus_planctomycetal      AA-------------- 1231
marine.gamma.proteobacterium_g      ----------------
S.cerevisiae_eukaryotes_            ----------------
                                                    



---------------------------------------------------------------------------------------------------

BLAST

PROTOCOLE: NCBI, BLAST P contre Swissprot et nr ; paramètres par défaut sauf "number of description = 5000" contre nr

---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

Le BLAST P contre swissprot (gamme E value : 4e-31 à 3e-09) donne peu de résultats. En effet, les 
E value ne sont pas très faibles et on obtient peu d'homologues à notre séquence. Par contre, tous 
les homologues obtenus présentent la même fonction : SMC (Structural Maintenance of Chromosomes). 

Nous avons ensuite effectué un BLAST P contre nr afin de vérifier s'il n'existait pas d'autres 
homologues possédant plus de similarités avec notre séquence.

Le BLAST P contre nr à 100 résultats s'arrêtant à une E value encore très faible, nous avons réalisé
un BLAST à 5000 résultats allant jusqu'à des E value élevées (gamme de E value de 2e-108 à 0,023). 
Ce BLAST montre de fortes similarités entre notre séquence et la banque protéique : on observe 
notamment de très fortes identités avec les 4 premières séquences de la banque (84%, 75% et 73% 
d'identités). Bien que la majorité des E value soient faibles et que la majorité des scores soient
élevés, on observe une cassure dans les E value et dans les scores entre la 4ème séquence et la 5ème 
(on passe d'une E value de 3e-94 à 3e-37 et d'une score de 347 à 158). Ce BLAST permet de dire qu'il
existe de nombreux homologues de notre ORF. 

Notre ORF présentant de nombreux homologues (avec d'excellentes E value et d'excellents scores),
il n'est pas nécessaire de réaliser un BLAST X car il y a peu de chance qu'un ORF plus petit soit 
plus pertinent. 

Comme on obtient une meilleure gamme de E value contre nr que contre swissprot, on utilisera ces 
résultats pour la suite de notre recherche. 

---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:

BLAST P contre SWISSPROT ; paramètres par défaut

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q59037|SMC_METJA  Chromosome partition protein smc homolog       134    4e-31
sp|P32908.1|SMC1_YEAST  RecName: Full=Structural maintenance o...   116    1e-25 
sp|Q12267.1|SMC4_YEAST  RecName: Full=Structural maintenance o...   110    8e-24 
sp|Q54LV0.1|SMC4_DICDI  RecName: Full=Structural maintenance o...   109    1e-23
sp|Q20060.1|SMC4_CAEEL  RecName: Full=Structural maintenance o...   104    3e-22 
sp|P41004.2|SMC4_SCHPO  Structural maintenance of chromosomes ...   101    3e-21 
sp|P51834|SMC_BACSU  Chromosome partition protein smc               100    7e-21
sp|Q9CBT5|SMC_MYCLE  Chromosome partition protein smc               100    8e-21
sp|P50533.1|SMC2_XENLA  RecName: Full=Structural maintenance o...  99.0    2e-20 
sp|Q9FJL0.1|SMC4_ARATH  RecName: Full=Structural maintenance o...  99.0    2e-20
sp|Q10970|SMC_MYCTU  Chromosome partition protein smc              97.8    4e-20
sp|P50532.1|SMC4_XENLA  RecName: Full=Structural maintenance o...  95.5    2e-19 
sp|Q920F6.1|SMC1B_MOUSE  RecName: Full=Structural maintenance ...  93.6    6e-19 
sp|Q8CG48.1|SMC2_MOUSE  RecName: Full=Structural maintenance o...  92.0    2e-18 
sp|Q9NTJ3.2|SMC4_HUMAN  RecName: Full=Structural maintenance o...  92.0    2e-18 
sp|O95347.1|SMC2_HUMAN  RecName: Full=Structural maintenance o...  91.7    3e-18 
sp|Q9UQE7.2|SMC3_HUMAN  RecName: Full=Structural maintenance o...  91.3    4e-18 
sp|Q9CW03.2|SMC3_MOUSE  RecName: Full=Structural maintenance o...  91.3    4e-18 
sp|Q9ERA5|SMC4_MICAR  Structural maintenance of chromosomes pr...  90.5    6e-18
sp|O93308.1|SMC1A_XENLA  RecName: Full=Structural maintenance ...  90.1    8e-18
sp|Q9Z1M9.1|SMC1A_RAT  RecName: Full=Structural maintenance of...  90.1    8e-18 
sp|O97593|SMC1A_BOVIN  Structural maintenance of chromosomes p...  90.1    8e-18 
sp|Q14683.2|SMC1A_HUMAN  RecName: Full=Structural maintenance ...  90.1    8e-18 
sp|O97594|SMC3_BOVIN  Structural maintenance of chromosomes pr...  89.7    1e-17 
sp|Q9CU62.3|SMC1A_MOUSE  RecName: Full=Structural maintenance ...  89.7    1e-17 
sp|O94383.1|SMC1_SCHPO  Structural maintenance of chromosomes ...  89.4    1e-17 
sp|Q8CG47.1|SMC4_MOUSE  RecName: Full=Structural maintenance o...  89.4    1e-17 
sp|O93309.1|SMC3_XENLA  RecName: Full=Structural maintenance o...  87.8    4e-17 
sp|Q8NDV3.2|SMC1B_HUMAN  RecName: Full=Structural maintenance ...  87.0    6e-17 
sp|Q00737.1|SUDA_EMENI  RecName: Full=Chromosome segregation p...  85.5    2e-16
sp|Q90988.1|SMC2_CHICK  RecName: Full=Structural maintenance o...  84.0    5e-16 
sp|Q9C5Y4.2|SMC21_ARATH  RecName: Full=Structural maintenance ...  83.6    7e-16
sp|P47037.1|SMC3_YEAST  RecName: Full=Structural maintenance o...  83.6    8e-16 
sp|Q9SN90.1|SMC22_ARATH  RecName: Full=Structural maintenance ...  82.0    2e-15
sp|P41508.2|P115_MYCHR  RecName: Full=Protein P115                 80.5    6e-15
sp|P48996.1|DPY27_CAEEL  RecName: Full=Chromosome condensation...  79.7    1e-14 
sp|P41003.2|SMC2_SCHPO  Structural maintenance of chromosomes ...  79.0    2e-14 
sp|P97690.1|SMC3_RAT  Structural maintenance of chromosomes pr...  78.2    3e-14 
sp|O42649|SMC3_SCHPO  Structural maintenance of chromosomes pr...  77.8    5e-14 
sp|P38989.1|SMC2_YEAST  RecName: Full=Structural maintenance o...  77.0    6e-14 
sp|Q54PK4.1|SMC2_DICDI  RecName: Full=Structural maintenance o...  77.0    7e-14
sp|P15016.1|YAT3_RHORU  Uncharacterized protein in ATPase CF(0...  76.6    8e-14
sp|Q09591.2|MIX1_CAEEL  RecName: Full=Mitotic chromosome and X...  72.4    2e-12 
sp|P75361.1|P115_MYCPN  RecName: Full=Protein P115 homolog         65.5    2e-10
sp|P47540|P115_MYCGE  Protein P115 homolog                         61.6    3e-09



>sp|Q59037|SMC_METJA  Chromosome partition protein smc homolog
Length=1169

 Score =  134 bits (336),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/215 (36%), Positives = 130/215 (60%), Gaps = 8/215 (3%)

Query  2     ELEDFDVESI---IQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIV  58
             ELE  D+E +   I  L  E KSL  +N +A E Y  V+  Y+ +  ++   E +    +
Sbjct  954   ELEKKDIEELEIYIGELENEIKSLEPVNMRAIEDYNYVAERYKELIEKRKEYERDEKKYL  1013

Query  59    NFIEKIERDKKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPN  118
               +E++E  KK+ F++ F+ V K    ++ K  GG   L ++NE + F  G+  LI    
Sbjct  1014  QLMEELENKKKEVFMEVFNKVAKNFEEVY-KEIGGIGKLSLENEKNPFEGGI--LIDASP  1070

Query  119   KPKREST--SISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDER  176
             + K+  +  ++SGGEK+L A+ F+ A+Q+L PSPFY+ DEVDA LD  N   ++ ++   
Sbjct  1071  RGKKLLSLDAMSGGEKSLTALAFLFAIQRLNPSPFYVLDEVDAALDVKNVSLIADMIKNA  1130

Query  177   SQESQFIMVSLKDSVVQKAKLIYGVYPKNGVSQVV  211
             S++SQFI++S ++ +V KA ++YGVY +NG+S+VV
Sbjct  1131  SKDSQFIVISHREQMVSKADVVYGVYMENGLSKVV  1165


>sp|P32908.1|SMC1_YEAST  RecName: Full=Structural maintenance of chromosomes protein 1; 
AltName: Full=DA-box protein SMC1
Length=1225

 GENE ID: 850540 SMC1 | Smc1p [Saccharomyces cerevisiae] (Over 10 PubMed links)

 Score =  116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/200 (33%), Positives = 115/200 (57%), Gaps = 13/200 (6%)

Query  26    NGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQTFLDAFDIVDKEIRT  85
             N +A E+Y +    +  ++     L+ E   I+N   KI++ +K+ F   FD V   +  
Sbjct  1018  NARALERYDEAEGRFEVINNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDA  1077

Query  86    IFNKMT----------GGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISGGEKTLA  135
             I+ ++T          GGNA L I++ED+ FN+G+ Y    P K  ++   +SGGEKT+A
Sbjct  1078  IYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVA  1137

Query  136   AIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSK-ILDERSQESQFIMVSLKDSVVQK  194
             A+  + A+   +PSPF++ DEVDA LD  N +R++  I   R+ + QFI++SLK+++ +K
Sbjct  1138  ALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEK  1197

Query  195   AKLIYGVY--PKNGVSQVVT  212
             +  + GVY   +   S+++T
Sbjct  1198  SDALVGVYRQQQENSSKIIT  1217


>sp|Q12267.1|SMC4_YEAST  RecName: Full=Structural maintenance of chromosomes protein 4
Length=1418

 GENE ID: 850775 SMC4 | Smc4p [Saccharomyces cerevisiae] (Over 10 PubMed links)

 Score =  110 bits (274),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 95/145 (65%), Gaps = 1/145 (0%)

Query  72    FLDAFDIVDKEIRTIFNKMT-GGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISGG  130
             F+  F+I+   ++ ++  +T GGNA LE+ +  D F+ G+++ +  P K  R  T++SGG
Sbjct  1267  FMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGG  1326

Query  131   EKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKDS  190
             EKTL+++  V AL K KP+P Y+ DE+DA LD  N   ++  + ER++ +QFI++SL+++
Sbjct  1327  EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNN  1386

Query  191   VVQKAKLIYGVYPKNGVSQVVTYKD  215
             + + A+ + GVY ++  ++  T K+
Sbjct  1387  MFELAQQLVGVYKRDNRTKSTTIKN  1411


>sp|Q54LV0.1|SMC4_DICDI  RecName: Full=Structural maintenance of chromosomes protein 4
Length=1415

 Score =  109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 104/174 (59%), Gaps = 1/174 (0%)

Query  40    YRSMSVRKNSLEGERTSIVNFIEKIERDKKQTFLDAFDIVDKEIRTIFNKMT-GGNAWLE  98
             Y S     + +E ER ++    E + +++   F+  F I+  +++ I+  +T GG+A LE
Sbjct  1202  YHSRKAEFDEIEKERDNLSKRYESLRKNRLDEFMAGFTIITMKLKEIYQMITLGGDAELE  1261

Query  99    IQNEDDIFNSGLSYLIQFPNKPKRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVD  158
             I + +D F  G+S+ ++ P K  +  +++SGGEKTL+++  V AL   KP+  Y+ DE+D
Sbjct  1262  IIDREDPFQEGISFSVRPPKKSWKNISNLSGGEKTLSSLALVFALHHYKPNALYVMDEID  1321

Query  159   AHLDAPNSERLSKILDERSQESQFIMVSLKDSVVQKAKLIYGVYPKNGVSQVVT  212
             A LD  N   ++  + ER++ +QFI++SL++ + + A  + G+Y  +  ++ VT
Sbjct  1322  AALDFKNVSIIANYIKERTKNAQFIIISLRNYMFELADRLVGIYKTDNCTKSVT  1375


>sp|Q20060.1|SMC4_CAEEL  RecName: Full=Structural maintenance of chromosomes protein 4; 
Short=Protein smc-4
Length=1549

 GENE ID: 175603 smc-4 | SMC (structural maintenance of chromosomes) family
[Caenorhabditis elegans] (Over 10 PubMed links)

 Score =  104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 100/153 (65%), Gaps = 1/153 (0%)

Query  61    IEKIERDKKQTFLDAFDIVDKEIRTIFNKMT-GGNAWLEIQNEDDIFNSGLSYLIQFPNK  119
             +++I++ + + F  AF+ + K +  +F  +T GG+A LE  ++DD F  G+S++++   K
Sbjct  1211  LQRIKQMRLEEFHSAFEFIGKHLVAVFKMLTDGGDAKLEYIDKDDPFRQGISFMVRPAKK  1270

Query  120   PKRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQE  179
               ++   +SGGEKTL+++  + AL   +P+PFY+ DE+DA LD  N   +++ + ++++ 
Sbjct  1271  AWKQIQFLSGGEKTLSSLALIFALHMFRPTPFYVMDEIDAALDYRNVSIIAQYVRQKTEN  1330

Query  180   SQFIMVSLKDSVVQKAKLIYGVYPKNGVSQVVT  212
             +QFI++SL++++ + A  + G+Y  +G ++ V 
Sbjct  1331  AQFIIISLRNNMFELANRLVGIYKVDGCTRNVA  1363


>sp|P41004.2|SMC4_SCHPO  Structural maintenance of chromosomes protein 4 (Cell untimely 
torn protein 3) (Chromosome segregation protein cut3)
Length=1324

 GENE ID: 2539817 cut3 | condensin subunit Cut3 [Schizosaccharomyces pombe]
(10 or fewer PubMed links)

 Score =  101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 98/164 (59%), Gaps = 1/164 (0%)

Query  54    RTSIVNFIEKIERDKKQTFLDAFDIVDKEIRTIFNKMT-GGNAWLEIQNEDDIFNSGLSY  112
             RT +   +  ++  +   F+  F I+  +++ ++  +T GGNA LE+ +  D F+ G+ +
Sbjct  1156  RTDLKKVVTDLQSQRLDEFMYGFGIISMKLKEMYQIITMGGNAELELVDSLDPFSEGVLF  1215

Query  113   LIQFPNKPKRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKI  172
              +  P K  +  +++SGGEKTL+++  V AL   KP+P Y+ DE+DA LD  N   ++  
Sbjct  1216  SVMPPKKSWKNISNLSGGEKTLSSLALVFALHNYKPTPLYVMDEIDAALDFKNVSIVANY  1275

Query  173   LDERSQESQFIMVSLKDSVVQKAKLIYGVYPKNGVSQVVTYKDK  216
             + ER++ +QFI++SL+ ++ + +  + G+Y    +++ VT  +K
Sbjct  1276  IKERTKNAQFIVISLRSNMFELSSRLVGIYKTANMTKSVTINNK  1319


>sp|P51834|SMC_BACSU  Chromosome partition protein smc
Length=1186

 Score =  100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 112/195 (57%), Gaps = 2/195 (1%)

Query  22    LTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQTFLDAFDIVDK  81
             L  +N  + +++  V+  Y+ +S +K  L   + ++   IE+++ +  + F D F  +  
Sbjct  983   LGTVNLGSIDEFERVNERYKFLSEQKEDLTEAKNTLFQVIEEMDEEMTKRFNDTFVQIRS  1042

Query  82    EIRTIFNKM-TGGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISGGEKTLAAIVFV  140
                 +F  +  GG A L + + +D+ +SG+  + Q P K  +    +SGGE+ L AI  +
Sbjct  1043  HFDQVFRSLFGGGRAELRLTDPNDLLHSGVEIIAQPPGKKLQNLNLLSGGERALTAIALL  1102

Query  141   LALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKDSVVQKAKLIYG  200
              ++ K++P PF + DEV+A LD  N  R ++ L + S ++QFI+++ +   +++A ++YG
Sbjct  1103  FSILKVRPVPFCVLDEVEAALDEANVFRFAQYLKKYSSDTQFIVITHRKGTMEEADVLYG  1162

Query  201   V-YPKNGVSQVVTYK  214
             V   ++GVS+V++ K
Sbjct  1163  VTMQESGVSKVISVK  1177


>sp|Q9CBT5|SMC_MYCLE  Chromosome partition protein smc
Length=1203

 Score =  100 bits (248),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 62/211 (29%), Positives = 117/211 (55%), Gaps = 3/211 (1%)

Query  18    EQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQTFLDAFD  77
             E   L  +N  A E++  +   Y  +S +   ++G R  +++ + +++    Q F DAF 
Sbjct  991   ELAELGRVNPLALEEFAALEERYNFLSTQLEDVKGARKDLLDVVAEVDARILQVFSDAFV  1050

Query  78    IVDKEIRTIFNKM-TGGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISGGEKTLAA  136
              V++E R +F  +  GG   L + + DD+  +G+    +   K     + +SGGEK+L A
Sbjct  1051  DVEREFRGVFTSLFPGGEGRLRLTDPDDMLTTGIEVEARPSGKKVSRLSLLSGGEKSLIA  1110

Query  137   IVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKDSVVQKAK  196
             +  ++A+ K +PSPFY+ DEV+A LD  N  RL  + ++   +SQ I+++ +   ++ A 
Sbjct  1111  VAMLVAIFKARPSPFYIMDEVEAALDDVNLCRLIGVFEQLRGQSQLIIITHQKPTMEVAD  1170

Query  197   LIYGVYPK-NGVSQVVTYKDK-RNVPSLQTS  225
              +YGV  + +G++ V++ + + + V SL TS
Sbjct  1171  TLYGVTMQGDGITAVISQRMRGQQVESLVTS  1201


>sp|P50533.1|SMC2_XENLA  RecName: Full=Structural maintenance of chromosomes protein 2; 
AltName: Full=Chromosome-associated protein E; AltName: Full=Chromosome 
assembly protein XCAP-E
Length=1203

 GENE ID: 397800 XCAP-E | (XCAP-E) [Xenopus laevis] (10 or fewer PubMed links)

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 113/209 (54%), Gaps = 10/209 (4%)

Query  14    GLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQTFL  73
             G N   +++  L  +A E+Y D       +  RK  +E +++ I+  IE++++ K +   
Sbjct  981   GRNVNMRAMNMLT-QAEERYND-------LMKRKRIVENDKSKILTTIEELDQKKNEALN  1032

Query  74    DAFDIVDKEIRTIFNKMT-GGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISGGEK  132
              A+  V+K+  +IF+ +  G NA L       + + GL + +   N  K   T +SGG++
Sbjct  1033  IAWQKVNKDFGSIFSTLLPGANAMLAPPEGQSVLD-GLEFKVALGNTWKENLTELSGGQR  1091

Query  133   TLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKDSVV  192
             +L A+  +LA+   KP+P Y+ DEVDA LD  +++ + ++L    + SQFI+VSLKD + 
Sbjct  1092  SLVALSLILAMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFRHSQFIVVSLKDGMF  1151

Query  193   QKAKLIYGVYPKNGVSQVVTYKDKRNVPS  221
               A +++     +GVS V  +   +N  S
Sbjct  1152  NNANVLFKTKFVDGVSTVARFAQNQNGGS  1180


>sp|Q9FJL0.1|SMC4_ARATH  RecName: Full=Structural maintenance of chromosomes protein 4; 
Short=AtSMC4; AltName: Full=Chromosome-associated protein 
C; Short=AtCAP-C
Length=1241

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 100/166 (60%), Gaps = 1/166 (0%)

Query  48    NSLEGERTSIVNFIEKIERDKKQTFLDAFDIVDKEIRTIFNKMT-GGNAWLEIQNEDDIF  106
             NS+  ER       +++ + +   F+  F+ +  +++ ++  +T GG+A LE+ +  D F
Sbjct  1062  NSVTQERDDTRKQYDELRKRRLDEFMAGFNTISLKLKEMYQMITLGGDAELELVDSLDPF  1121

Query  107   NSGLSYLIQFPNKPKRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNS  166
             + G+ + ++ P K  +   ++SGGEKTL+++  V AL   KP+P Y+ DE+DA LD  N 
Sbjct  1122  SEGVVFSVRPPKKSWKNIANLSGGEKTLSSLALVFALHHYKPTPLYVMDEIDAALDFKNV  1181

Query  167   ERLSKILDERSQESQFIMVSLKDSVVQKAKLIYGVYPKNGVSQVVT  212
               +   + +R++++QFI++SL++++ + A  + G+Y  +  ++ +T
Sbjct  1182  SIVGHYVKDRTKDAQFIIISLRNNMFELADRLVGIYKTDNCTKSIT  1227


>sp|Q10970|SMC_MYCTU  Chromosome partition protein smc
Length=1205

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 56/195 (28%), Positives = 106/195 (54%), Gaps = 2/195 (1%)

Query  22    LTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQTFLDAFDIVDK  81
             L  +N  A E++  +   Y  +S +   ++  R  ++  +  ++    Q F DAF  V++
Sbjct  997   LGRVNPLALEEFAALEERYNFLSTQLEDVKAARKDLLGVVADVDARILQVFNDAFVDVER  1056

Query  82    EIRTIFNKM-TGGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISGGEKTLAAIVFV  140
             E R +F  +  GG   L +   DD+  +G+    + P K     + +SGGEK L A+  +
Sbjct  1057  EFRGVFTALFPGGEGRLRLTEPDDMLTTGIEVEARPPGKKITRLSLLSGGEKALTAVAML  1116

Query  141   LALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKDSVVQKAKLIYG  200
             +A+ + +PSPFY+ DEV+A LD  N  RL  + ++  ++SQ I+++ +   ++ A  +YG
Sbjct  1117  VAIFRARPSPFYIMDEVEAALDDVNLRRLLSLFEQLREQSQIIIITHQKPTMEVADALYG  1176

Query  201   VYPKN-GVSQVVTYK  214
             V  +N G++ V++ +
Sbjct  1177  VTMQNDGITAVISQR  1191


>sp|P50532.1|SMC4_XENLA  RecName: Full=Structural maintenance of chromosomes protein 4; 
AltName: Full=Chromosome-associated protein C; AltName: Full=Chromosome 
assembly protein XCAP-C
Length=1290

 GENE ID: 397799 XCAP-C | (XCAP-C) [Xenopus laevis] (10 or fewer PubMed links)

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 98/166 (59%), Gaps = 1/166 (0%)

Query  48    NSLEGERTSIVNFIEKIERDKKQTFLDAFDIVDKEIRTIFNKMT-GGNAWLEIQNEDDIF  106
             + +  ER S     E + + +   F+  F+I+  +++  +  +T GG+A LE+ +  D F
Sbjct  1105  DEITNERDSFRRAYEDLRKQRLNEFMAGFNIITNKLKENYQMLTLGGDAELELVDSLDPF  1164

Query  107   NSGLSYLIQFPNKPKRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNS  166
             + G+ + ++ P K  ++  ++SGGEKTL+++  V AL   KP+P Y  DE+DA LD  N 
Sbjct  1165  SEGIMFSVRPPKKSWKKIFNLSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNV  1224

Query  167   ERLSKILDERSQESQFIMVSLKDSVVQKAKLIYGVYPKNGVSQVVT  212
               ++  + E+++ +QFI++SL++++ + A  + G+Y  +  ++ V 
Sbjct  1225  SIVAFYIYEQTKNAQFIIISLRNNMFEIADRLIGIYKTHNTTKSVA  1270


>sp|Q920F6.1|SMC1B_MOUSE  RecName: Full=Structural maintenance of chromosomes protein 1B; 
AltName: Full=SMC1beta protein
Length=1248

 GENE ID: 140557 Smc1b | structural maintenance of chromosomes 1B [Mus musculus]
(Over 10 PubMed links)

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 114/213 (53%), Gaps = 12/213 (5%)

Query  11    IIQGLNTEQKSL---TALNGKAPEQYMDVSYGYR-SMSVRKNSLEGERTSIVNFIEKIER  66
             ++Q + +++ +L   TA N +A E    V   ++ S  V + S +  R     F E+++R
Sbjct  1001  LLQQVASQENTLLKTTAPNLRAQENLKTVRDKFQESADVFEASRKEARICRQEF-EQVKR  1059

Query  67    DKKQTFLDAFDIVDKEIRTIFNKMTGGN---AWLEIQNEDDIFNSGLSYLIQFPNKPKRE  123
              +   F   F+ +   I  I+ K+   N   A+L  +N ++ +  G+SY    P K    
Sbjct  1060  RRYDAFSQCFEHISVSIDQIYKKLCRNNSAQAFLSPENPEEPYLDGISYNCVAPGKRFMP  1119

Query  124   STSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQES-QF  182
               ++SGGEK +AA+  + A+   +P+PF++ DEVDA LD  N  ++S  + E+SQE  Q 
Sbjct  1120  MDNLSGGEKCVAALALLFAVHSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQSQEQFQM  1179

Query  183   IMVSLKDSVVQKAKLIYGVYPKNG---VSQVVT  212
             I++SLK+    KA  + GVYP++     S V+T
Sbjct  1180  IIISLKEEFYSKADALIGVYPEHNECMFSHVLT  1212


>sp|O95347.2|SMC2_HUMAN  RecName: Full=Structural maintenance of chromosomes protein 2; 
AltName: Full=Chromosome-associated protein E; Short=hCAP-E; 
AltName: Full=XCAP-E homolog
Length=1197

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 110/206 (53%), Gaps = 10/206 (4%)

Query  14    GLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQTFL  73
             G N   +++  L  +A E+Y D       +  +K  +E +++ I+  IE +++ K Q   
Sbjct  980   GRNVNMRAMNVLT-EAEERYND-------LMKKKRIVENDKSKILTTIEDLDQKKNQALN  1031

Query  74    DAFDIVDKEIRTIFNKMT-GGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISGGEK  132
              A+  V+K+  +IF+ +  G NA L       + + GL + +   N  K   T +SGG++
Sbjct  1032  IAWQKVNKDFGSIFSTLLPGANAMLAPPEGQTVLD-GLEFKVALGNTWKENLTELSGGQR  1090

Query  133   TLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKDSVV  192
             +L A+  +L++   KP+P Y+ DEVDA LD  +++ + ++L      SQFI+VSLK+ + 
Sbjct  1091  SLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFIVVSLKEGMF  1150

Query  193   QKAKLIYGVYPKNGVSQVVTYKDKRN  218
               A +++     +GVS V  +   +N
Sbjct  1151  NNANVLFKTKFVDGVSTVARFTQCQN  1176


>sp|Q8CG48.1|SMC2_MOUSE  RecName: Full=Structural maintenance of chromosomes protein 2; 
AltName: Full=Chromosome-associated protein E; AltName: Full=XCAP-E 
homolog; AltName: Full=FGF-inducible protein 16
Length=1191

 GENE ID: 14211 Smc2 | structural maintenance of chromosomes 2 [Mus musculus]
(Over 10 PubMed links)

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 97/175 (55%), Gaps = 2/175 (1%)

Query  40    YRSMSVRKNSLEGERTSIVNFIEKIERDKKQTFLDAFDIVDKEIRTIFNKMT-GGNAWLE  98
             Y  +  +K  +E +++ I+  IE +++ K Q    A+  V+K+  +IF+ +  G NA L 
Sbjct  998   YNDLMKKKRIVENDKSKILATIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLA  1057

Query  99    IQNEDDIFNSGLSYLIQFPNKPKRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVD  158
                   + + GL + +   N  K   T +SGG+++L A+  +L++   KP+P Y+ DEVD
Sbjct  1058  PPEGQTVLD-GLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVD  1116

Query  159   AHLDAPNSERLSKILDERSQESQFIMVSLKDSVVQKAKLIYGVYPKNGVSQVVTY  213
             A LD  +++ + ++L      SQFI+VSLK+ +   A +++     +GVS V  +
Sbjct  1117  AALDLSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVSTVARF  1171


>sp|Q9NTJ3.2|SMC4_HUMAN  RecName: Full=Structural maintenance of chromosomes protein 4; 
AltName: Full=Chromosome-associated polypeptide C; Short=hCAP-C; 
AltName: Full=XCAP-C homolog
Length=1288

 GENE ID: 10051 SMC4 | structural maintenance of chromosomes 4 [Homo sapiens]
(Over 10 PubMed links)

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 96/165 (58%), Gaps = 1/165 (0%)

Query  53    ERTSIVNFIEKIERDKKQTFLDAFDIVDKEIRTIFNKMT-GGNAWLEIQNEDDIFNSGLS  111
             ER S     E + + +   F+  F I+  +++  +  +T GG+A LE+ +  D F+ G+ 
Sbjct  1116  ERDSFRQAYEDLRKQRLNEFMAGFYIITNKLKENYQMLTLGGDAELELVDSLDPFSEGIM  1175

Query  112   YLIQFPNKPKRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSK  171
             + ++ P K  ++  ++SGGEKTL+++  V AL   KP+P Y  DE+DA LD  N   ++ 
Sbjct  1176  FSVRPPKKSWKKIFNLSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNVSIVAF  1235

Query  172   ILDERSQESQFIMVSLKDSVVQKAKLIYGVYPKNGVSQVVTYKDK  216
              + E+++ +QFI++SL++++ + +  + G+Y    +++ V    K
Sbjct  1236  YIYEQTKNAQFIIISLRNNMFEISDRLIGIYKTYNITKSVAVNPK  1280


>sp|Q9UQE7.2|SMC3_HUMAN  RecName: Full=Structural maintenance of chromosomes protein 3; 
AltName: Full=Chondroitin sulfate proteoglycan 6; AltName: 
Full=Chromosome-associated polypeptide; Short=hCAP; AltName: 
Full=Basement membrane-associated chondroitin proteoglycan; 
Short=Bamacan
 sp|Q5R4K5.1|SMC3_PONAB  RecName: Full=Structural maintenance of chromosomes protein 3; 
AltName: Full=Chondroitin sulfate proteoglycan 6
Length=1217

 GENE ID: 9126 SMC3 | structural maintenance of chromosomes 3 [Homo sapiens]
(Over 10 PubMed links)

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 109/231 (47%), Gaps = 33/231 (14%)

Query  12    IQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQT  71
             ++  NTE K  + +N KA +Q+++ S     +  R+  L+    SI+  +  +E  K + 
Sbjct  969   LEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNVLELRKYEA  1028

Query  72    FLDAFDIVDKEIRTIFNKMT-GGNAWLEIQNED---------------------------  103
                 F  V K    +F K+  GG A L ++  D                           
Sbjct  1029  IQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVP  1088

Query  104   --DIFNSGLSYLIQFPNK--PKRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDA  159
               D F +G+   + F  K    RE   +SGG+K+L A+  + A+QK  P+PFYLFDE+D 
Sbjct  1089  SVDQF-TGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQ  1147

Query  160   HLDAPNSERLSKILDERSQESQFIMVSLKDSVVQKAKLIYGVYPKNGVSQV  210
              LDA + + +S ++ E +  +QFI  + +  +++ A   YGV  +N VS +
Sbjct  1148  ALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHI  1198


>sp|Q9CW03.2|SMC3_MOUSE  RecName: Full=Structural maintenance of chromosomes protein 3; 
AltName: Full=Chondroitin sulfate proteoglycan 6; AltName: 
Full=Chromosome segregation protein SmcD; AltName: Full=Basement 
membrane-associated chondroitin proteoglycan; Short=Bamacan; 
AltName: Full=Mad member-interacting protein 1
Length=1217

 GENE ID: 13006 Smc3 | structural maintenace of chromosomes 3 [Mus musculus]
(Over 10 PubMed links)

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 109/231 (47%), Gaps = 33/231 (14%)

Query  12    IQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQT  71
             ++  NTE K  + +N KA +Q+++ S     +  R+  L+    SI+  +  +E  K + 
Sbjct  969   LEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNVLELRKYEA  1028

Query  72    FLDAFDIVDKEIRTIFNKMT-GGNAWLEIQNED---------------------------  103
                 F  V K    +F K+  GG A L ++  D                           
Sbjct  1029  IQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVP  1088

Query  104   --DIFNSGLSYLIQFPNK--PKRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDA  159
               D F +G+   + F  K    RE   +SGG+K+L A+  + A+QK  P+PFYLFDE+D 
Sbjct  1089  SVDQF-TGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQ  1147

Query  160   HLDAPNSERLSKILDERSQESQFIMVSLKDSVVQKAKLIYGVYPKNGVSQV  210
              LDA + + +S ++ E +  +QFI  + +  +++ A   YGV  +N VS +
Sbjct  1148  ALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHI  1198


>sp|Q9ERA5|SMC4_MICAR  Structural maintenance of chromosomes protein 4 (Chromosome-associated 
polypeptide C) (XCAP-C homolog)
Length=1243

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 97/166 (58%), Gaps = 1/166 (0%)

Query  48    NSLEGERTSIVNFIEKIERDKKQTFLDAFDIVDKEIRTIFNKMT-GGNAWLEIQNEDDIF  106
             + +  ER +     E + + +   F+  F I+  +++  +  +T GG+A LE+ +  D F
Sbjct  1066  DKITSERDNFRQAYEDLRKQRLNEFMAGFYIITNKLKENYQMLTLGGDAELELVDSLDPF  1125

Query  107   NSGLSYLIQFPNKPKRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNS  166
             + G+ + ++ P K  ++  ++SGGEKTL+++  V AL   KP+P Y  DE+DA LD  N 
Sbjct  1126  SEGIMFSVRPPKKSWKKIFNLSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNV  1185

Query  167   ERLSKILDERSQESQFIMVSLKDSVVQKAKLIYGVYPKNGVSQVVT  212
               ++  + E+++ +QFI++SL++++ + +  + G+Y    +++ V 
Sbjct  1186  SIVAFYIYEQTKNAQFIIISLRNNMFEISDRLIGIYKTYNITKSVA  1231


>sp|O93308.1|SMC1A_XENLA  RecName: Full=Structural maintenance of chromosomes protein 1A; 
Short=xSMC1
Length=1232

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 116/217 (53%), Gaps = 10/217 (4%)

Query  7     DVESIIQGLNTEQ---KSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEK  63
             ++ ++ Q +N +Q   + ++A N KA E+   V   ++  S    +            E+
Sbjct  1002  EMSALHQKINEQQSILQRISAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQ  1061

Query  64    IERDKKQTFLDAFDIVDKEIRTIFNKMT---GGNAWLEIQNEDDIFNSGLSYLIQFPNKP  120
              ++++   F   F+ V   I  I+  ++      A+L  +N ++ +  G++Y    P K 
Sbjct  1062  TKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKR  1121

Query  121   KRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQES  180
              R   ++SGGEKT+AA+  + A+   KPSPF++ DE+DA LD  N  +++  + E+S  +
Sbjct  1122  FRPMDNLSGGEKTVAALALLFAIHSYKPSPFFVLDEIDAALDNTNIGKVANYIKEQSMSN  1181

Query  181   -QFIMVSLKDSVVQKAKLIYGVYPKNG---VSQVVTY  213
              Q I++SLK+    KA+ + GVYP+ G   +S+V+T+
Sbjct  1182  FQAIVISLKEEFYTKAESLIGVYPEQGDCVISKVLTF  1218


>sp|Q9Z1M9.1|SMC1A_RAT  RecName: Full=Structural maintenance of chromosomes protein 1A; 
Short=SMC-protein
Length=1233

 GENE ID: 63996 Smc1a | structural maintenance of chromosomes 1A
[Rattus norvegicus] (10 or fewer PubMed links)

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 116/217 (53%), Gaps = 10/217 (4%)

Query  7     DVESIIQGLNTEQ---KSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEK  63
             ++ ++ Q LN +Q   + + A N KA E+   V   ++  S    +            E+
Sbjct  1002  EMNTLQQKLNEQQSVLQRIAAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQ  1061

Query  64    IERDKKQTFLDAFDIVDKEIRTIFNKMT---GGNAWLEIQNEDDIFNSGLSYLIQFPNKP  120
             I++++   F   F+ V   I  I+  ++      A+L  +N ++ +  G++Y    P K 
Sbjct  1062  IKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKR  1121

Query  121   KRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQES  180
              R   ++SGGEKT+AA+  + A+   KP+PF++ DE+DA LD  N  +++  + E+S  +
Sbjct  1122  FRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKEQSTCN  1181

Query  181   -QFIMVSLKDSVVQKAKLIYGVYPKNG---VSQVVTY  213
              Q I++SLK+    KA+ + GVYP+ G   +S+V+T+
Sbjct  1182  FQAIVISLKEEFYTKAESLIGVYPEQGDCVISKVLTF  1218


>sp|O97593|SMC1A_BOVIN  Structural maintenance of chromosomes protein 1A (SMC-protein)
Length=1233

 GENE ID: 282370 SMC1A | structural maintenance of chromosomes 1A [Bos taurus]
(10 or fewer PubMed links)

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 116/217 (53%), Gaps = 10/217 (4%)

Query  7     DVESIIQGLNTEQ---KSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEK  63
             ++ ++ Q LN +Q   + + A N KA E+   V   ++  S    +            E+
Sbjct  1002  EMNTLQQKLNEQQSVLQRIAAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQ  1061

Query  64    IERDKKQTFLDAFDIVDKEIRTIFNKMT---GGNAWLEIQNEDDIFNSGLSYLIQFPNKP  120
             I++++   F   F+ V   I  I+  ++      A+L  +N ++ +  G++Y    P K 
Sbjct  1062  IKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKR  1121

Query  121   KRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQES  180
              R   ++SGGEKT+AA+  + A+   KP+PF++ DE+DA LD  N  +++  + E+S  +
Sbjct  1122  FRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKEQSTCN  1181

Query  181   -QFIMVSLKDSVVQKAKLIYGVYPKNG---VSQVVTY  213
              Q I++SLK+    KA+ + GVYP+ G   +S+V+T+
Sbjct  1182  FQAIVISLKEEFYTKAESLIGVYPEQGDCVISKVLTF  1218


>sp|Q14683.2|SMC1A_HUMAN  RecName: Full=Structural maintenance of chromosomes protein 1A; 
AltName: Full=SMC1alpha protein; AltName: Full=Sb1.8
Length=1233

 GENE ID: 8243 SMC1A | structural maintenance of chromosomes 1A [Homo sapiens]
(Over 10 PubMed links)

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 116/217 (53%), Gaps = 10/217 (4%)

Query  7     DVESIIQGLNTEQ---KSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEK  63
             ++ ++ Q LN +Q   + + A N KA E+   V   ++  S    +            E+
Sbjct  1002  EMNTLQQKLNEQQSVLQRIAAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQ  1061

Query  64    IERDKKQTFLDAFDIVDKEIRTIFNKMT---GGNAWLEIQNEDDIFNSGLSYLIQFPNKP  120
             I++++   F   F+ V   I  I+  ++      A+L  +N ++ +  G++Y    P K 
Sbjct  1062  IKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKR  1121

Query  121   KRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQES  180
              R   ++SGGEKT+AA+  + A+   KP+PF++ DE+DA LD  N  +++  + E+S  +
Sbjct  1122  FRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKEQSTCN  1181

Query  181   -QFIMVSLKDSVVQKAKLIYGVYPKNG---VSQVVTY  213
              Q I++SLK+    KA+ + GVYP+ G   +S+V+T+
Sbjct  1182  FQAIVISLKEEFYTKAESLIGVYPEQGDCVISKVLTF  1218


>sp|O97594|SMC3_BOVIN  Structural maintenance of chromosomes protein 3 (Chondroitin 
sulfate proteoglycan 6)
Length=1218

 GENE ID: 281729 SMC3 | structural maintenance of chromosomes 3 [Bos taurus]
(10 or fewer PubMed links)

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 106/231 (45%), Gaps = 32/231 (13%)

Query  12    IQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQT  71
             ++  NTE K  + +N KA +Q+++ S     +  R+  L+    SI+  +  +E  K + 
Sbjct  969   LEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNVLELRKYEA  1028

Query  72    FLDAFDIVDKEIRTIFNKMT-GGNAWLEIQNEDDIFNSGLSY------------------  112
                 F  V K    +F K+  GG A L ++       SGL                    
Sbjct  1029  IQLTFKQVSKNFSEVFQKLVPGGKATLVMKKRRXERQSGLRMKEKGVVKGERGSGPQSSV  1088

Query  113   -----------LIQFPNK--PKRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDA  159
                         + F  K    RE   +SGG+K+L A+  + A+QK  P+PFYLFDE+D 
Sbjct  1089  PSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQ  1148

Query  160   HLDAPNSERLSKILDERSQESQFIMVSLKDSVVQKAKLIYGVYPKNGVSQV  210
              LDA + + +S ++ E +  +QFI  + +  +++ A   YGV  +N VS +
Sbjct  1149  ALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHI  1199


>sp|Q9CU62.3|SMC1A_MOUSE  RecName: Full=Structural maintenance of chromosomes protein 1A; 
AltName: Full=SMC1alpha protein; AltName: Full=Chromosome 
segregation protein SmcB; AltName: Full=Sb1.8
Length=1233

 GENE ID: 24061 Smc1a | structural maintenance of chromosomes 1A [Mus musculus]
(Over 10 PubMed links)

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/222 (29%), Positives = 114/222 (51%), Gaps = 17/222 (7%)

Query  9     ESIIQGLNTEQKSL----------TALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIV  58
             E I Q +NT Q+ L           A N KA E+   V   ++  S    +         
Sbjct  997   EEIKQEMNTLQQKLNERQSVLQRIAAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAK  1056

Query  59    NFIEKIERDKKQTFLDAFDIVDKEIRTIFNKMT---GGNAWLEIQNEDDIFNSGLSYLIQ  115
                E+I++++   F   F+ V   I  I+  ++      A+L  +N ++ +  G++Y   
Sbjct  1057  QAFEQIKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCV  1116

Query  116   FPNKPKRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDE  175
              P K  R   ++SGGEKT+AA+  + A+   KP+PF++ DE+DA LD  N  +++  + E
Sbjct  1117  APGKRFRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKE  1176

Query  176   RSQES-QFIMVSLKDSVVQKAKLIYGVYPKNG---VSQVVTY  213
             +S  + Q I++SLK+    KA+ + GVYP+ G   +S+V+T+
Sbjct  1177  QSTCNFQAIVISLKEEFYTKAESLIGVYPEQGDCVISKVLTF  1218


>sp|O94383.1|SMC1_SCHPO  Structural maintenance of chromosomes protein 1 (Chromosome segregation 
protein smc1) (Cohesin complex subunit psm1)
Length=1233

 GENE ID: 2540557 psm1 | mitotic cohesin complex subunit Psm1 (PMID 11069892)
[Schizosaccharomyces pombe] (10 or fewer PubMed links)

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 86/147 (58%), Gaps = 8/147 (5%)

Query  64    IERDKKQTFLDAFDIVDKEIRTIFNKMT-------GGNAWLEIQNEDDIFNSGLSYLIQF  116
             +++ + Q F  AF  + ++I  I+ ++T       GG A+L + + D+ +  G+ +    
Sbjct  1062  VKQKRLQKFQAAFSHISEQIDPIYKELTKSPAFPLGGTAYLTLDDLDEPYLGGIKFHAMP  1121

Query  117   PNKPKRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDER  176
             P K  R+   +SGGEKT+AA+  + A+   +PSPF++ DE+DA LD  N  +++  + + 
Sbjct  1122  PMKRFRDMDQLSGGEKTMAALALLFAIHSYQPSPFFVLDEIDAALDQTNVTKIANYIRQH  1181

Query  177   SQES-QFIMVSLKDSVVQKAKLIYGVY  202
             +    QF+++SLK+ +  K++ + G+Y
Sbjct  1182  ASSGFQFVVISLKNQLFSKSEALVGIY  1208


>sp|Q8CG47.1|SMC4_MOUSE  RecName: Full=Structural maintenance of chromosomes protein 4; 
AltName: Full=Chromosome-associated polypeptide C; AltName: 
Full=XCAP-C homolog
Length=1286

 GENE ID: 70099 Smc4 | structural maintenance of chromosomes 4 [Mus musculus]
(Over 10 PubMed links)

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 93/156 (59%), Gaps = 1/156 (0%)

Query  48    NSLEGERTSIVNFIEKIERDKKQTFLDAFDIVDKEIRTIFNKMT-GGNAWLEIQNEDDIF  106
             + +  ER +     E + + +   F+  F ++  +++  +  +T GG+A LE+ +  D F
Sbjct  1109  DKITSERDNFRQAYEDLRKQRLNEFMAGFYVITNKLKENYQMLTLGGDAELELVDSLDPF  1168

Query  107   NSGLSYLIQFPNKPKRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNS  166
             + G+ + ++ P K  ++  ++SGGEKTL+++  V AL   KP+P Y  DE+DA LD  N 
Sbjct  1169  SEGIMFSVRPPKKSWKKIFNLSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNV  1228

Query  167   ERLSKILDERSQESQFIMVSLKDSVVQKAKLIYGVY  202
               ++  + E+++ +QFI++SL++++ + +  + G+Y
Sbjct  1229  SIVAFYIYEQTKNAQFIIISLRNNMFEISDRLIGIY  1264


>sp|O93309.1|SMC3_XENLA  RecName: Full=Structural maintenance of chromosomes protein 3
Length=234

 GENE ID: 100137611 LOC100137611 | 14S cohesin SMC3 subunit [Xenopus laevis]
(10 or fewer PubMed links)

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 100/214 (46%), Gaps = 23/214 (10%)

Query  20   KSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQTFLDAFDIV  79
            K  + +N KA +Q+++ S     +  R+  L+    SI+  +  +E  K +     F  V
Sbjct  2    KKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGHKSIMELMNVLELRKYEAIQLTFKQV  61

Query  80   DKEIRTIFNKMTGGNAWLEIQNEDDIFNS---------------------GLSYLIQFPN  118
             K    +F K+  G   L +  + D+  S                     G+   + F  
Sbjct  62   SKNFSEVFQKLVPGGRPLLVMKKGDVEGSQSQDEGEGSAQSSVPSFDQFTGVGIRVSFTG  121

Query  119  KPK--RESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDER  176
            K    RE   +S G+K+L A+  + A+QK  P+PFYLFDE+D  LDA + + +S ++ E 
Sbjct  122  KQAEMREMQQLSRGQKSLVALRLIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMEL  181

Query  177  SQESQFIMVSLKDSVVQKAKLIYGVYPKNGVSQV  210
            +  +QFI  + +  +++ A   YGV  +N VS +
Sbjct  182  ASHAQFITTTFRPELLESADKFYGVKFRNKVSHI  215


>sp|Q8NDV3.2|SMC1B_HUMAN  RecName: Full=Structural maintenance of chromosomes protein 1B; 
AltName: Full=SMC1beta protein
Length=1235

 GENE ID: 27127 SMC1B | structural maintenance of chromosomes 1B [Homo sapiens]
(10 or fewer PubMed links)

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 83/146 (56%), Gaps = 4/146 (2%)

Query  62    EKIERDKKQTFLDAFDIVDKEIRTIFNKMTGGN---AWLEIQNEDDIFNSGLSYLIQFPN  118
             E++++ +   F   F+ V   I  I+ K+   N   A+L  +N ++ +  G+SY    P 
Sbjct  1056  EQVKKRRYDLFTQCFEHVSISIDQIYKKLCRNNSAQAFLSPENPEEPYLEGISYNCVAPG  1115

Query  119   KPKRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQ  178
             K      ++SGGEK +AA+  + A+   +P+PF++ DEVDA LD  N  ++S  + E++Q
Sbjct  1116  KRFMPMDNLSGGEKCVAALALLFAVHSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQTQ  1175

Query  179   ES-QFIMVSLKDSVVQKAKLIYGVYP  203
             +  Q I++SLK+    +A  + G+YP
Sbjct  1176  DQFQMIVISLKEEFYSRADALIGIYP  1201


>sp|Q00737.1|SUDA_EMENI  RecName: Full=Chromosome segregation protein sudA; AltName: Full=DA-box 
protein sudA
Length=1211

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/224 (26%), Positives = 101/224 (45%), Gaps = 25/224 (11%)

Query  12    IQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQT  71
             +  +N   K    +N KA EQY + +    +++ R+  L+  + SI + I  ++  K + 
Sbjct  971   LHKVNEALKKYAHVNKKAFEQYNNFTKQRETLTSRREELDASQKSIDDLISVLDHRKDEA  1030

Query  72    FLDAFDIVDKEIRTIFNKMT-GGNAWLEIQNEDD----------------------IFNS  108
                 F  V +E  TIF K+   G   L IQ + D                          
Sbjct  1031  IERTFKQVSREFATIFEKLVPAGRGRLIIQRKTDRTQRAEDDLESEDEEAKHSVENYVGV  1090

Query  109   GLSYLIQFPNKPKRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSER  168
             G+S      +  ++    +SGG+K+L A+  V A+Q   P+PFYLFDE+DA+LDA     
Sbjct  1091  GISVSFNSKHDDQQRIQQLSGGQKSLCALALVFAIQACDPAPFYLFDEIDANLDAQYRTA  1150

Query  169   LSKILD--ERSQESQFIMVSLKDSVVQKAKLIYGVYPKNGVSQV  210
             ++++L     S   QFI  + +  ++  A+  YGV  +   S +
Sbjct  1151  VAQMLKTISDSTNGQFICTTFRPEMLHVAEKCYGVSFRQKASTI  1194


>sp|Q90988.1|SMC2_CHICK  RecName: Full=Structural maintenance of chromosomes protein 2; 
AltName: Full=Chromosome scaffold protein ScII
Length=1189

 GENE ID: 396156 SMC2 | structural maintenance of chromosomes 2 [Gallus gallus]
(10 or fewer PubMed links)

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 116/204 (56%), Gaps = 3/204 (1%)

Query  12    IQGLNTEQKSL-TALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQ  70
             +Q L T+++ L  +LN +A     +    Y  +  +K  +E ++  I+  IE+++R K +
Sbjct  969   LQKLLTKKEKLEKSLNMRAMNLLSEAEERYNDLMKKKRMVENDKIKILATIEELDRKKNK  1028

Query  71    TFLDAFDIVDKEIRTIFNKMT-GGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISG  129
                 A++ V+K+  +IF+ +  G  A L    + +I + GL + +   +  K   T +SG
Sbjct  1029  ALHIAWEKVNKDFGSIFSMLLPGAKAMLVPSKKQNILD-GLEFRVGLGDIWKENLTELSG  1087

Query  130   GEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKD  189
             G+++LAA+  +LA+   KP+P Y+ DEVDA LD  +++ + ++L    ++SQF++VSLKD
Sbjct  1088  GQRSLAALSLILAILLFKPAPIYILDEVDAALDLSHTQNIGQMLHAHFKQSQFLVVSLKD  1147

Query  190   SVVQKAKLIYGVYPKNGVSQVVTY  213
              +   A ++Y     +G+S V  +
Sbjct  1148  GMFNNANVLYRTKFVDGISTVSRH  1171


>sp|Q9C5Y4.2|SMC21_ARATH  RecName: Full=Structural maintenance of chromosomes protein 2-1; 
Short=AtSMC2-1; AltName: Full=Chromosome-associated protein 
E-1; Short=AtCAP-E1; AltName: Full=Protein TITAN 3
Length=1175

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 116/216 (53%), Gaps = 11/216 (5%)

Query  5     DFDVESI--------IQGLNTEQKSLTA-LNGKAPEQYMDVSYGYRSMSVRKNSLEGERT  55
             D+D ES         ++ L ++Q  L   +N K    +      Y ++  +KN++E +++
Sbjct  952   DYDFESCDPYVAREKLEKLQSDQSGLEKRVNKKVMAMFEKAEDEYNALISKKNTIENDKS  1011

Query  56    SIVNFIEKIERDKKQTFLDAFDIVDKEIRTIFNKMTGGN-AWLEIQNEDDIFNSGLSYLI  114
              I   IE+++  KK+T    +  V+++  +IF+ +  G  A LE   ED  F  GL   +
Sbjct  1012  KITKVIEELDEKKKETLKVTWVKVNQDFGSIFSTLLPGTMAKLE-PPEDGNFLDGLEVRV  1070

Query  115   QFPNKPKRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILD  174
              F    K+  + +SGG+++L A+  +LAL   KP+P Y+ DEVDA LD  +++ + +++ 
Sbjct  1071  AFGKVWKQSLSELSGGQRSLLALSLILALLLFKPAPLYILDEVDAALDLSHTQNIGRMIR  1130

Query  175   ERSQESQFIMVSLKDSVVQKAKLIYGVYPKNGVSQV  210
                  SQFI+VSLK+ +   A +++     +GVS V
Sbjct  1131  AHFPHSQFIVVSLKEGMFNNANVLFRTKFVDGVSTV  1166


>sp|P47037.1|SMC3_YEAST  RecName: Full=Structural maintenance of chromosomes protein 3; 
AltName: Full=DA-box protein SMC3
Length=1230

 GENE ID: 853371 SMC3 | Smc3p [Saccharomyces cerevisiae] (Over 10 PubMed links)

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 108/230 (46%), Gaps = 30/230 (13%)

Query  12    IQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQT  71
             +  +NTE   L  +N +A E +   +   + ++ R + L+  + SI + I K+++ K   
Sbjct  981   LNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERASELDESKDSIQDLIVKLKQQKVNA  1040

Query  72    FLDAFDIVDKEIRTIFNKMT-GGNAWLEIQNEDD--------------------------  104
                 F  V +    +F ++   G A L I  ++D                          
Sbjct  1041  VDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNANDHDESIDVDMDAESNESQNGKDS  1100

Query  105   -IFNSGLSYLIQFPNKPKRE--STSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHL  161
              I  +G+S  + F +K   +     +SGG+KT+ AI  +LA+Q + P+ FYLFDE+DA L
Sbjct  1101  EIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAAL  1160

Query  162   DAPNSERLSKILDERSQESQFIMVSLKDSVVQKAKLIYGVYPKNGVSQVV  211
             D      ++ +L E S+ +QFI  + +  ++Q A   + V  +N +S V+
Sbjct  1161  DKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKFFRVKYENKISTVI  1210


---------------------------------------------------------------------------------------------------


BLAST P contre NR ; paramètres par défaut (max target = 5000)
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|YP_001581985.1|  SMC domain-containing protein [Nitrosopum...   395    2e-108 Gene info
ref|YP_875318.1|  chromosome segregation ATPase [Cenarchaeum s...   360    4e-98  Gene info
gb|ABZ09946.1|  putative SMC family, C-terminal domain protein...   347    3e-94 
gb|ABZ08695.1|  putative SMC family, C-terminal domain protein...   347    3e-94 
ref|NP_143635.1|  chromosome assembly protein [Pyrococcus hori...   158    3e-37  Gene info
emb|CAD66602.1|  SMC protein [Pyrococcus furiosus]                  158    4e-37 
ref|NP_579572.1|  chromosome segregation protein smc [Pyrococc...   157    5e-37  Gene info
ref|NP_126050.1|  chromosome segregation protein smc1 [Pyrococ...   157    5e-37  Gene info
ref|ZP_01631730.1|  chromosome segregation protein [Nodularia ...   147    7e-34 
ref|YP_183430.1|  chromosome segregation ATPase [Thermococcus ...   146    9e-34  Gene info
ref|NP_485171.1|  chromosome segregation protein [Nostoc sp. P...   146    1e-33  Gene info
ref|ZP_01622284.1|  Chromosome segregation protein SMC [Lyngby...   145    2e-33 
ref|YP_721304.1|  condensin subunit Smc [Trichodesmium erythra...   145    2e-33  Gene info
ref|YP_001868984.1|  chromosome segregation protein SMC [Nosto...   145    3e-33  Gene info
ref|YP_325181.1|  condensin subunit Smc [Anabaena variabilis A...   143    1e-32  Gene info
ref|NP_440691.1|  chromosome segregation protein SMC1 [Synecho...   143    1e-32  Gene info
ref|ZP_02177592.1|  citrate synthase [Hydrogenivirga sp. 128-5...   140    6e-32 
ref|ZP_03137228.1|  chromosome segregation protein SMC [Cyanot...   140    7e-32 
emb|CAO88586.1|  unnamed protein product [Microcystis aerugino...   140    7e-32 
ref|YP_001656122.1|  chromosome segregation protein [Microcyst...   139    2e-31  Gene info
ref|YP_001517121.1|  chromosome segregation protein SMC [Acary...   139    2e-31  Gene info
ref|ZP_03143913.1|  SMC domain protein [Cyanothece sp. PCC 880...   138    4e-31 
ref|ZP_02941982.1|  chromosome segregation protein SMC [Cyanot...   137    4e-31 
ref|ZP_03156153.1|  chromosome segregation protein SMC [Cyanot...   137    5e-31 
ref|ZP_03274797.1|  chromosome segregation protein SMC [Arthro...   137    8e-31 
ref|NP_213438.1|  chromosome assembly protein [Aquifex aeolicu...   136    9e-31  Gene info
ref|YP_001405342.1|  chromosome segregation protein SMC [Candi...   135    2e-30  Gene info
gb|EDX71268.1|  chromosome segregation protein SMC [Microcoleu...   135    2e-30 
ref|NP_248653.1|  chromosome segretation protein (smc1) [Metha...   134    6e-30  Gene info
ref|NP_070387.1|  chromosome segregation protein (smc1) [Archa...   134    6e-30  Gene info
ref|YP_001804711.1|  chromosome segregation protein SMC [Cyano...   134    7e-30  Gene info
ref|YP_136259.1|  chromosome segregation protein [Haloarcula m...   133    1e-29  Gene info
ref|YP_479122.1|  putative chromosome segregation protein SMC ...   133    1e-29  Gene info
ref|ZP_02016864.1|  chromosome segregation protein SMC [Haloru...   132    2e-29 
gb|AAQ22369.1|  chromosomal segregation protein [Methanococcus...   132    2e-29 
ref|ZP_01726588.1|  hypothetical protein CY0110_16097 [Cyanoth...   131    4e-29 
ref|YP_001325175.1|  chromosome segregation protein SMC [Metha...   131    4e-29  Gene info
pdb|1XEW|Y  Chain Y, Structural Biochemistry Of Atp-Driven Dim...   131    5e-29  Related structures
ref|YP_326268.1|  chromosome partition protein [Natronomonas p...   130    6e-29  Gene info
pdb|1XEX|B  Chain B, Structural Biochemistry Of Atp-Driven Dim...   129    1e-28  Related structures
ref|NP_279433.1|  Smc1 [Halobacterium sp. NRC-1] >ref|YP_00168...   129    2e-28  Gene info
ref|YP_843583.1|  chromosome segregation protein SMC [Methanos...   129    2e-28  Gene info
ref|YP_002121150.1|  chromosome segregation protein SMC [Hydro...   129    2e-28  Gene info
ref|YP_001010382.1|  SMC ATPase superfamily chromosome segrega...   129    2e-28  Gene info
ref|YP_401062.1|  condensin subunit Smc [Synechococcus elongat...   127    5e-28  Gene info
ref|YP_476264.1|  chromosome segregation protein SMC [Synechoc...   127    5e-28  Gene info
ref|YP_172758.1|  chromosome segregation protein SMC1 [Synecho...   127    5e-28  Gene info
ref|ZP_00517770.1|  GTP-binding [Crocosphaera watsonii WH 8501...   127    6e-28 
ref|NP_682715.1|  chromosome segregation SMC protein [Thermosy...   127    8e-28  Gene info
ref|ZP_02193181.1|  chromosome segregation protein SMC [Methan...   126    1e-27 
ref|YP_001734374.1|  chromosome segregation protein SMC [Synec...   126    1e-27  Gene info
ref|YP_002307457.1|  chromosome segregation ATPase [Thermococc...   125    2e-27  Gene info
ref|YP_657044.1|  chromosome partition protein [Haloquadratum ...   125    3e-27  Gene info
ref|NP_892178.1|  SMC ATPase superfamily chromosome segregatio...   124    6e-27  Gene info
ref|YP_001047739.1|  chromosome segregation protein SMC [Metha...   124    6e-27  Gene info
ref|YP_001329860.1|  chromosome segregation protein SMC [Metha...   124    7e-27  Gene info
ref|YP_501522.1|  chromosome segregation protein SMC [Methanos...   124    7e-27  Gene info
ref|ZP_02205437.1|  hypothetical protein COPEUT_00198 [Coproco...   124    7e-27 
ref|YP_001549321.1|  chromosome segregation protein SMC [Metha...   123    1e-26  Gene info
ref|NP_926268.1|  chromosome segregation SMC protein [Gloeobac...   123    1e-26  Gene info
ref|YP_001096713.1|  condensin subunit Smc [Methanococcus mari...   122    1e-26  Gene info
gb|EDX87554.1|  chromosome segregation protein SMC [Synechococ...   122    2e-26 
ref|YP_396556.1|  condensin subunit Smc [Prochlorococcus marin...   122    3e-26  Gene info
ref|NP_988517.1|  structural maintenance of chromosome protein...   120    1e-25  Gene info
ref|YP_001090292.1|  SMC ATPase superfamily chromosome segrega...   119    1e-25  Gene info
ref|YP_001008464.1|  SMC ATPase superfamily chromosome segrega...   119    1e-25  Gene info
ref|YP_292611.1|  condensin subunit Smc [Prochlorococcus marin...   119    2e-25  Gene info
ref|NP_633055.1|  chromosome partition protein [Methanosarcina...   119    2e-25  Gene info
ref|ZP_01389380.1|  Chromosome segregation protein SMC [Geobac...   119    2e-25 
ref|YP_001013950.1|  SMC ATPase superfamily chromosome segrega...   119    2e-25  Gene info
ref|NP_874465.1|  chromosome segregation ATPase [Prochlorococc...   119    2e-25  Gene info
ref|YP_001483274.1|  SMC ATPase superfamily chromosome segrega...   118    3e-25  Gene info
ref|ZP_02862528.1|  hypothetical protein ANASTE_01747 [Anaerof...   118    4e-25 
ref|YP_001323226.1|  chromosome segregation protein SMC [Metha...   117    5e-25  Gene info
ref|ZP_03168120.1|  hypothetical protein RUMLAC_01799 [Ruminoc...   117    7e-25 
ref|ZP_01471061.1|  chromosome segregation protein SMC [Synech...   117    7e-25 
ref|ZP_03026665.1|  SMC domain protein [Geobacter sp. M21] >gb...   116    1e-24 
ref|YP_304152.1|  condensin subunit Smc [Methanosarcina barker...   116    1e-24  Gene info
ref|YP_002137779.1|  chromosome segregation protein SMC [Geoba...   116    1e-24  Gene info
ref|NP_619197.1|  chromosome segregation protein [Methanosarci...   116    1e-24  Gene info
gb|EDZ72426.1|  YFL008Wp-like protein [Saccharomyces cerevisia...   116    1e-24 
gb|EDV09833.1|  structural maintenance of chromosome 1 [Saccha...   116    1e-24 
gb|EDN59142.1|  stability of minichromosomes [Saccharomyces ce...   116    1e-24 
ref|NP_116647.1|  Subunit of the multiprotein cohesin complex,...   116    1e-24  UniGene infoGene info
ref|YP_686699.1|  chromosome segregation/partition protein [un...   116    2e-24  Gene info
ref|YP_023634.1|  chromosome partition protein smc [Picrophilu...   115    2e-24  Gene info
ref|YP_566156.1|  condensin subunit Smc [Methanococcoides burt...   115    2e-24  Gene info
ref|XP_001642899.1|  hypothetical protein Kpol_392p8 [Vanderwa...   115    2e-24  Gene info
ref|YP_384137.1|  condensin subunit Smc [Geobacter metalliredu...   115    2e-24  Gene info
ref|ZP_02430418.1|  hypothetical protein CLOSCI_00629 [Clostri...   115    3e-24 
ref|YP_001549950.1|  SMC ATPase superfamily chromosome segrega...   115    3e-24  Gene info
ref|NP_896436.1|  SMC ATPase superfamily chromosome segregatio...   114    4e-24  Gene info
ref|XP_001933640.1|  condensin subunit Cut3 [Pyrenophora triti...   114    5e-24  Gene info
ref|YP_376439.1|  chromosome segregation protein SMC [Synechoc...   114    5e-24  Gene info
ref|ZP_01468647.1|  Chromosome segregation protein SMC [Synech...   114    5e-24 
ref|ZP_02026028.1|  hypothetical protein EUBVEN_01284 [Eubacte...   114    6e-24 
ref|YP_001665270.1|  chromosome segregation protein SMC [Therm...   113    8e-24  Gene info
ref|NP_952183.1|  chromosome segregation SMC protein, putative...   113    9e-24  Gene info
ref|YP_001930372.1|  chromosome segregation protein SMC [Sulfu...   113    1e-23  Gene info
ref|YP_001663338.1|  chromosome segregation protein SMC [Therm...   113    1e-23  Gene info
ref|NP_111326.1|  chromosome segregation ATPase [Thermoplasma ...   113    1e-23  Gene info
ref|XP_455936.1|  unnamed protein product [Kluyveromyces lacti...   112    2e-23  UniGene infoGene info
ref|ZP_01576863.1|  chromosome segregation protein SMC [Clostr...   112    2e-23 
ref|NP_623083.1|  chromosome segregation ATPase [Thermoanaerob...   112    2e-23  Gene info
ref|ZP_01994661.1|  hypothetical protein DORLON_00646 [Dorea l...   112    2e-23 
ref|XP_449298.1|  unnamed protein product [Candida glabrata] >...   112    2e-23  Gene info
ref|ZP_02731263.1|  chromosome partition protein Smc [Gemmata ...   112    2e-23 
ref|YP_804345.1|  condensin subunit Smc [Pediococcus pentosace...   112    2e-23  Gene info
pdb|1W1W|A  Chain A, Sc Smc1hd:scc1-C Complex, Atpgs >pdb|1W1W...   112    2e-23  Related structures
ref|ZP_01616628.1|  hypothetical protein GP2143_07499 [marine ...   112    3e-23 
ref|ZP_02914614.1|  chromosome segregation protein SMC [Geobac...   112    3e-23 
ref|ZP_01171566.1|  Smc [Bacillus sp. NRRL B-14911] >gb|EAR657...   112    3e-23 
ref|YP_001229873.1|  chromosome segregation protein SMC [Geoba...   111    3e-23  Gene info
ref|ZP_01084177.1|  Chromosome segregation protein SMC [Synech...   111    3e-23 
ref|ZP_02085362.1|  hypothetical protein CLOBOL_02898 [Clostri...   111    3e-23 
emb|CAR65469.1|  DEHA2B07920p [Debaryomyces hansenii]               111    3e-23 
ref|ZP_03289367.1|  hypothetical protein CLONEX_01569 [Clostri...   111    4e-23 
ref|NP_584776.1|  CHROMOSOME SEGREGATION PROTEIN [Encephalitoz...   111    5e-23  Gene info
ref|YP_001513000.1|  chromosome segregation protein SMC [Alkal...   110    6e-23  Gene info
ref|YP_382547.1|  condensin subunit Smc [Synechococcus sp. CC9...   110    6e-23  Gene info
ref|ZP_01968830.1|  hypothetical protein RUMTOR_02410 [Ruminoc...   110    7e-23 
ref|ZP_02234603.1|  hypothetical protein DORFOR_01475 [Dorea f...   110    7e-23 
ref|XP_001643193.1|  hypothetical protein Kpol_1011p5 [Vanderw...   110    9e-23  Gene info
gb|EDZ70675.1|  YLR086Wp-like protein [Saccharomyces cerevisia...   110    1e-22 
ref|XP_396862.3|  PREDICTED: similar to SMC4 structural mainte...   110    1e-22  UniGene infoGene info
ref|NP_895411.1|  SMC ATPase superfamily chromosome segregatio...   110    1e-22  Gene info
gb|EDV09389.1|  structural maintenance of chromosome 4 [Saccha...   110    1e-22 
ref|YP_175793.1|  chromosome segregation protein SMC [Bacillus...   110    1e-22  Gene info
emb|CAA97648.1|  unnamed protein product [Saccharomyces cerevi...   110    1e-22 
gb|EDN59631.1|  structural maintenance of chromosomes [Sacchar...   110    1e-22 
ref|YP_001838801.1|  chromosome segregation ATPase [Leptospira...   110    1e-22  Gene info
ref|NP_013187.1|  Subunit of the condensin complex, which reor...   110    1e-22  UniGene infoGene info
ref|ZP_02073475.1|  hypothetical protein CLOL250_00215 [Clostr...   110    1e-22 
ref|ZP_01081163.1|  putative chromosome segregation protein, S...   109    1e-22 
ref|YP_855768.1|  chromosome segregation protein SMC [Aeromona...   109    1e-22  Gene info
ref|YP_001016344.1|  hypothetical protein P9303_03271 [Prochlo...   109    1e-22  Gene info
ref|YP_001559543.1|  chromosome segregation protein SMC [Clost...   109    1e-22  Gene info
ref|YP_001141074.1|  chromosome segregation protein SMC [Aerom...   109    2e-22  Gene info
ref|XP_637730.1|  structural maintenance of chromosome protein...   109    2e-22  UniGene infoGene info
ref|ZP_01122742.1|  putative chromosome segregation protein, S...   109    2e-22 
emb|CAO40626.1|  unnamed protein product [Vitis vinifera]           108    2e-22 
ref|YP_902969.1|  chromosome segregation protein SMC [Pelobact...   108    2e-22  Gene info
gb|EDY39497.1|  chromosome segregation protein SMC [Cyanobium ...   108    3e-22 
ref|YP_001113410.1|  chromosome segregation protein SMC [Desul...   108    3e-22  Gene info
ref|YP_001226593.1|  chromosome segregation ATPase [Synechococ...   108    4e-22  Gene info
ref|NP_001030859.1|  TTN8 (TITAN8); ATP binding [Arabidopsis t...   108    4e-22  UniGene infoGene info
ref|YP_731649.1|  chromosome segregation protein SMC [Synechoc...   108    4e-22  Gene info
ref|XP_715143.1|  potential nuclear cohesin complex SMC ATPase...   108    4e-22  Gene info
ref|ZP_01190109.1|  GTP-binding:Chromosome segregation protein...   108    4e-22 
gb|EAZ21378.1|  hypothetical protein OsJ_035587 [Oryza sativa ...   108    4e-22 
ref|XP_001665682.1|  hypothetical protein CBG18034 [Caenorhabd...   108    4e-22  Gene info
gb|EAY84062.1|  hypothetical protein OsI_038021 [Oryza sativa ...   108    4e-22 
ref|YP_800429.1|  chromosome segregation ATPase [Leptospira bo...   108    4e-22  Gene info
gb|ACI65666.1|  predicted protein [Phaeodactylum tricornutum C...   108    4e-22 
ref|YP_001225847.1|  chromosome segregation ATPase [Synechococ...   108    4e-22  Gene info
ref|YP_798352.1|  chromosome segregation ATPase [Leptospira bo...   108    4e-22  Gene info
ref|YP_002343.1|  chromosome segregation protein [Leptospira i...   107    5e-22  Gene info
ref|YP_001320560.1|  chromosome segregation protein SMC [Alkal...   107    5e-22  Gene info
ref|NP_711490.1|  chromosome segregation protein [Leptospira i...   107    5e-22  Gene info
ref|YP_001245153.1|  chromosome segregation protein SMC [Therm...   107    5e-22  Gene info
ref|XP_716862.1|  potential nuclear condensin complex SMC ATPa...   107    5e-22  Gene info
ref|ZP_02417773.1|  hypothetical protein ANACAC_00338 [Anaeros...   107    6e-22 
ref|XP_502000.1|  YALI0C19129p [Yarrowia lipolytica] >emb|CAG8...   107    6e-22  Gene info
gb|AAS68515.1|  structural maintenance of chromosomes 1 protei...   107    7e-22 
ref|ZP_02042085.1|  hypothetical protein RUMGNA_02862 [Ruminoc...   107    7e-22 
ref|XP_002116280.1|  hypothetical protein TRIADDRAFT_50834 [Tr...   107    9e-22  Gene info
ref|YP_045568.1|  putative chromosome segregation ATPase [Acin...   107    9e-22  Gene info
ref|ZP_02081807.1|  hypothetical protein CLOLEP_03293 [Clostri...   107    9e-22 
ref|NP_692449.1|  chromosome segregation SMC protein [Oceanoba...   107    9e-22  Gene info
ref|XP_001486512.1|  hypothetical protein PGUG_02183 [Pichia g...   107    9e-22  Gene info
ref|NP_986754.1|  AGR089Cp [Ashbya gossypii ATCC 10895] >gb|AA...   107    1e-21  UniGene infoGene info
ref|ZP_02437616.1|  hypothetical protein CLOSS21_00046 [Clostr...   107    1e-21 
ref|ZP_02077526.1|  hypothetical protein EUBDOL_01322 [Eubacte...   107    1e-21 
ref|NP_228987.1|  chromosome segregation SMC protein, putative...   107    1e-21  Gene info
ref|YP_001739655.1|  chromosome segregation protein SMC [Therm...   106    1e-21  Gene info
ref|ZP_03146369.1|  chromosome segregation protein SMC [Geobac...   106    1e-21 
ref|YP_001125167.1|  SMC protein (chromosome partition protein...   106    1e-21  Gene info
emb|CAP85764.1|  Pc20g04350 [Penicillium chrysogenum Wisconsin...   106    1e-21 
ref|ZP_01852432.1|  chromosome segregation SMC protein [Planct...   106    1e-21 
ref|ZP_02583044.1|  Chromosome partition protein smc [Bacillus...   106    1e-21 
ref|NP_243353.1|  chromosome segregation SMC protein [Bacillus...   106    1e-21  Gene info
ref|YP_001982385.1|  chromosome segregation protein SMC [Cellv...   106    1e-21  Gene info
ref|XP_002090524.1|  GE13167 [Drosophila yakuba] >gb|EDW90236....   106    1e-21  Gene info
ref|XP_360835.2|  hypothetical protein MGG_03378 [Magnaporthe ...   106    1e-21  UniGene infoGene info
ref|XP_731250.1|  chromosome assembly protein [Plasmodium yoel...   106    1e-21  Gene info
ref|XP_002132616.1|  GA25922 [Drosophila pseudoobscura pseudoo...   106    1e-21  Gene info
ref|YP_527351.1|  condensin subunit Smc [Saccharophagus degrad...   106    1e-21  Gene info
ref|XP_001826122.1|  hypothetical protein [Aspergillus oryzae ...   106    2e-21  Gene info
ref|ZP_00681981.1|  SMC protein, N-terminal:Structural mainten...   106    2e-21 
ref|YP_001761219.1|  chromosome segregation protein SMC [Shewa...   106    2e-21  Gene info
ref|XP_446063.1|  unnamed protein product [Candida glabrata] >...   106    2e-21  Gene info
ref|ZP_00240930.1|  reticulocyte binding protein [Bacillus cer...   106    2e-21 
ref|YP_085189.1|  chromosome segregation SMC protein [Bacillus...   106    2e-21  Gene info
ref|ZP_02394958.1|  chromosome segregation SMC protein [Bacill...   106    2e-21 
ref|YP_001776617.1|  chromosome segregation protein [Xylella f...   105    2e-21  Gene info
ref|NP_780123.1|  chromosome segregation protein [Xylella fast...   105    2e-21  Gene info
ref|ZP_00651480.1|  SMC protein, N-terminal:Structural mainten...   105    2e-21 
ref|XP_001391750.1|  hypothetical protein An07g06730 [Aspergil...   105    2e-21  Gene info
ref|NP_846228.1|  chromosome segregation SMC protein [Bacillus...   105    2e-21  Gene info
ref|YP_896221.1|  condensin subunit Smc [Bacillus thuringiensi...   105    2e-21  Gene info
ref|ZP_00680447.1|  SMC protein, N-terminal:Structural mainten...   105    2e-21 
ref|ZP_03109600.1|  chromosome segregation SMC protein [Bacill...   105    2e-21 
ref|NP_980187.1|  chromosome segregation SMC protein [Bacillus...   105    2e-21  Gene info
emb|CAQ40501.1|  chromosome condensation protein, putative [Pl...   105    2e-21 
ref|XP_001976251.1|  GG20110 [Drosophila erecta] >gb|EDV56651....   105    2e-21  Gene info
ref|YP_037909.1|  chromosome segregation SMC protein [Bacillus...   105    2e-21  Gene info
ref|ZP_01861663.1|  Smc [Bacillus sp. SG-1] >gb|EDL63286.1| Sm...   105    2e-21 
ref|YP_001646470.1|  chromosome segregation protein SMC [Bacil...   105    2e-21  Gene info
ref|XP_797583.2|  PREDICTED: similar to XCAP-C [Strongylocentr...   105    2e-21  UniGene infoGene info
ref|YP_429812.1|  condensin subunit Smc [Moorella thermoacetic...   105    2e-21  Gene info
ref|XP_001613264.1|  chromosome condensation protein [Plasmodi...   105    2e-21  Gene info
ref|NP_299835.1|  chromosome segregation protein [Xylella fast...   105    2e-21  Gene info
ref|XP_001351649.1|  chromosome condensation protein [Plasmodi...   105    3e-21  UniGene infoGene info
ref|XP_001418410.1|  predicted protein [Ostreococcus lucimarin...   105    3e-21  Gene info
ref|YP_001956535.1|  chromosome segregation protein SMC [uncul...   105    3e-21  Gene info
ref|YP_001486736.1|  chromosome segregation protein Smc [Bacil...   105    3e-21  Gene info
ref|XP_002038851.1|  GM17160 [Drosophila sechellia] >gb|EDW554...   105    3e-21  Gene info
ref|ZP_03053122.1|  chromosome segregation protein SMC [Bacill...   105    3e-21 
ref|XP_001948250.1|  PREDICTED: similar to AGAP007826-PA [Acyr...   105    3e-21  UniGene infoGene info
ref|XP_001272992.1|  nuclear condensin complex subunit Smc4, p...   105    3e-21  Gene info
ref|YP_001674792.1|  chromosome segregation protein SMC [Shewa...   105    3e-21  Gene info
ref|NP_723996.1|  gluon CG11397-PA [Drosophila melanogaster] >...   105    3e-21  UniGene infoGene info
ref|XP_391120.1|  hypothetical protein FG10944.1 [Gibberella z...   105    3e-21  Gene info
gb|AAF13306.1|AF185287_1  XCAP-C/SMC4 homolog Gluon [Drosophil...   105    3e-21 
gb|AAK93154.1|  LD25919p [Drosophila melanogaster]                  105    4e-21 
gb|EEB05847.1|  conserved hypothetical protein [Schizosaccharo...   104    4e-21 
ref|NP_497935.1|  SMC (structural maintenance of chromosomes) ...   104    4e-21  UniGene infoGene info
ref|XP_001842620.1|  structural maintenance of chromosomes smc...   104    4e-21  UniGene infoGene info
ref|YP_737628.1|  chromosome segregation protein SMC [Shewanel...   104    4e-21  Gene info
ref|YP_001820790.1|  chromosome segregation protein SMC [Opitu...   104    4e-21  Gene info
ref|YP_733641.1|  chromosome segregation protein SMC [Shewanel...   104    4e-21  Gene info
gb|EDY85975.1|  chromosome segregation protein SMC [gamma prot...   104    5e-21 
ref|XP_001214876.1|  hypothetical protein ATEG_05698 [Aspergil...   104    5e-21  Gene info
ref|YP_001473475.1|  chromosome segregation protein SMC [Shewa...   104    5e-21  Gene info
ref|ZP_02169554.1|  putative proton-coupled thiamine transport...   104    5e-21 
gb|EDY36659.1|  SMC proteins Flexible Hinge Domain [Acidulipro...   104    5e-21 
gb|EDY35835.1|  SMC proteins Flexible Hinge Domain [Acidulipro...   104    5e-21 
ref|YP_001612382.1|  hypothetical protein sce1744 [Sorangium c...   104    5e-21  Gene info
emb|CAJ72472.1|  similar to structural maintenance of chromoso...   104    5e-21 
ref|ZP_02328765.1|  chromosome segregation SMC protein [Paenib...   104    5e-21 
ref|ZP_01665626.1|  chromosome segregation protein SMC [Thermo...   104    5e-21 
ref|XP_453397.1|  unnamed protein product [Kluyveromyces lacti...   104    6e-21  UniGene infoGene info
ref|XP_968011.1|  PREDICTED: similar to structural maintenance...   104    6e-21  UniGene infoGene info
ref|XP_001246077.1|  hypothetical protein CIMG_05518 [Coccidio...   104    6e-21  Gene info
ref|ZP_02159144.1|  SMC family protein [Shewanella benthica KT...   104    6e-21 
ref|YP_814610.1|  chromosome segregation ATPase [Lactobacillus...   104    7e-21  Gene info
ref|YP_001471609.1|  chromosome segregation protein SMC [Therm...   103    7e-21  Gene info
emb|CAL53402.1|  putative SMC protein (ISS) [Ostreococcus tauri]    103    7e-21 
ref|XP_001587785.1|  hypothetical protein SS1G_11025 [Scleroti...   103    7e-21  Gene info
emb|CAD59409.1|  SMC1 protein [Oryza sativa]                        103    7e-21 
ref|NP_965322.1|  chromosome partitioning protein Smc [Lactoba...   103    7e-21  Gene info
ref|XP_001965286.1|  GF24329 [Drosophila ananassae] >gb|EDV334...   103    7e-21  Gene info
ref|YP_001953717.1|  chromosome segregation protein SMC [Geoba...   103    8e-21  Gene info
ref|YP_001030448.1|  condensin subunit Smc [Methanocorpusculum...   103    8e-21  Gene info
ref|YP_016107.1|  segregation of chromosomes protein [Mycoplas...   103    8e-21  Gene info
ref|NP_001067404.1|  Os12g0641500 [Oryza sativa (japonica cult...   103    9e-21  UniGene infoGene info
ref|ZP_01115582.1|  hypothetical protein MED297_17912 [Reineke...   103    9e-21 
emb|CAB77587.1|  structural maintenance of chromosomes (SMC)-l...   103    9e-21 
ref|XP_749352.2|  nuclear condensin complex subunit Smc4 [Aspe...   103    9e-21  Gene info
ref|ZP_02038998.1|  hypothetical protein BACCAP_04646 [Bactero...   103    9e-21 
gb|EDP53880.1|  nuclear condensin complex subunit Smc4, putati...   103    9e-21 
ref|XP_317674.2|  AGAP007826-PA [Anopheles gambiae str. PEST] ...   103    9e-21  UniGene infoGene info
ref|ZP_02429006.1|  hypothetical protein CLORAM_02428 [Clostri...   103    9e-21 
ref|YP_357765.1|  chromosome segregation SMC protein [Pelobact...   103    9e-21  Gene info
ref|NP_191027.3|  TTN8 (TITAN8); ATP binding [Arabidopsis thal...   103    9e-21  UniGene infoGene info
ref|XP_001446773.1|  hypothetical protein [Paramecium tetraure...   103    1e-20  UniGene infoGene info
ref|NP_833567.1|  chromosome partition protein smc [Bacillus c...   103    1e-20  Gene info
ref|ZP_02580144.1|  Chromosome partition protein smc [Bacillus...   103    1e-20 
emb|CAD59406.1|  SMC4 protein [Anopheles gambiae]                   103    1e-20 
ref|XP_001265784.1|  nuclear condensin complex subunit Smc4, p...   103    1e-20  Gene info
ref|YP_001814373.1|  chromosome segregation protein SMC [Exigu...   103    1e-20  Gene info
ref|NP_585996.1|  CUT3-LIKE CHROMOSOME SEGREGATION PROTEIN [En...   103    1e-20  Gene info
gb|EDY80665.1|  chromosome segregation protein SMC [Verrucomic...   103    1e-20 
ref|XP_759280.1|  hypothetical protein UM03133.1 [Ustilago may...   103    1e-20  Gene info
ref|YP_001377916.1|  chromosome segregation protein SMC [Anaer...   103    1e-20  Gene info
ref|XP_002069286.1|  GK21116 [Drosophila willistoni] >gb|EDW80...   103    1e-20  Gene info
ref|XP_001328078.1|  SMC family, C-terminal domain containing ...   103    1e-20  Gene info
ref|YP_869207.1|  chromosome segregation protein SMC [Shewanel...   103    1e-20  Gene info
gb|EEA18598.1|  nuclear condensin complex subunit Smc4, putati...   103    1e-20 
ref|YP_001692154.1|  chromosome segregation SMC protein [Fineg...   103    1e-20  Gene info
ref|XP_001802346.1|  hypothetical protein SNOG_12112 [Phaeosph...   103    1e-20  Gene info
ref|XP_656581.1|  structural maintenance of chromosomes protei...   103    1e-20  Gene info
ref|ZP_01305875.1|  hypothetical protein RED65_11124 [Oceanoba...   102    1e-20 
gb|ABO11235.2|  putative chromosome segregation ATPase [Acinet...   102    2e-20 
ref|ZP_01224454.1|  hypothetical protein GB2207_04957 [marine ...   102    2e-20 
ref|YP_563519.1|  chromosome segregation protein SMC [Shewanel...   102    2e-20  Gene info
ref|YP_001845415.1|  chromosome segregation ATPase [Acinetobac...   102    2e-20  Gene info
ref|YP_001707870.1|  putative chromosome segregation ATPases [...   102    2e-20  Gene info
ref|YP_001714804.1|  putative chromosome segregation ATPases [...   102    2e-20  Gene info
ref|XP_001989144.1|  GH10207 [Drosophila grimshawi] >gb|EDW040...   102    2e-20  Gene info
ref|XP_001227624.1|  hypothetical protein CHGG_09697 [Chaetomi...   102    2e-20  Gene info
ref|ZP_03293223.1|  hypothetical protein CLOHIR_01171 [Clostri...   102    2e-20 
ref|YP_001083837.1|  putative chromosome segregation ATPases [...   102    2e-20  Gene info
emb|CAI39060.1|  Structural maintenance of chromosomes 3 [Para...   102    2e-20 
ref|NP_718470.1|  SMC family protein [Shewanella oneidensis MR...   102    2e-20  Gene info
ref|YP_001501546.1|  chromosome segregation protein SMC [Shewa...   102    2e-20  Gene info
ref|YP_699003.1|  chromosome segregation protein SMC [Clostrid...   102    2e-20  Gene info
ref|YP_001421171.1|  hypothetical protein RBAM_015770 [Bacillu...   102    2e-20  Gene info
ref|ZP_01844665.1|  SMC domain protein [Shewanella baltica OS2...   102    2e-20 
ref|XP_001524664.1|  conserved hypothetical protein [Lodderomy...   102    2e-20  Gene info
ref|YP_958443.1|  chromosome segregation protein SMC [Marinoba...   102    2e-20  Gene info
emb|CAD66599.1|  SMC protein [Geobacillus stearothermophilus]       102    3e-20 
ref|XP_668505.1|  stable maintenance of chromosomes; Smc4p [Cr...   102    3e-20  Gene info
ref|XP_628362.1|  SMC4'SMC4, chromosomal ATpase with giant coi...   102    3e-20  Gene info
ref|YP_078988.1|  chromosome segregation SMC protein homolg [B...   102    3e-20  Gene info
ref|XP_001536154.1|  conserved hypothetical protein [Ajellomyc...   102    3e-20  Gene info
ref|XP_001653748.1|  structural maintenance of chromosomes smc...   102    3e-20  UniGene infoGene info
ref|YP_518888.1|  hypothetical protein DSY2655 [Desulfitobacte...   102    3e-20  Gene info
ref|XP_001416713.1|  predicted protein [Ostreococcus lucimarin...   102    3e-20  Gene info
ref|NP_816707.1|  chromosome partition protein SMC [Enterococc...   101    3e-20  Gene info
ref|XP_001745611.1|  hypothetical protein [Monosiga brevicolli...   101    4e-20  Gene info
gb|ABZ09605.1|  putative RecF/RecN/SMC N terminal domain prote...   101    4e-20 
ref|XP_001735438.1|  structural maintenance of chromosomes pro...   101    4e-20  Gene info
ref|YP_075284.1|  putative chromosome segregation SMC protein ...   101    4e-20  Gene info
ref|YP_002181567.1|  chromosome associated protein [Streptomyc...   101    4e-20  Gene info
dbj|BAA06454.1|  cut3 protein [Schizosaccharomyces pombe]           101    4e-20 
ref|ZP_03171849.1|  chromosome associated protein [Streptomyce...   101    4e-20 
ref|XP_001527771.1|  conserved hypothetical protein [Lodderomy...   101    4e-20  Gene info
ref|NP_595392.1|  condensin subunit Cut3 [Schizosaccharomyces ...   101    4e-20  UniGene infoGene info
ref|XP_958567.2|  hypothetical protein NCU09063 [Neurospora cr...   101    4e-20  UniGene infoGene info
ref|ZP_02867139.1|  hypothetical protein CLOSPI_00945 [Clostri...   101    4e-20 
ref|XP_001386531.2|  Structural maintenance of chromosome prot...   101    4e-20  Gene info
ref|ZP_03210563.1|  Chromosome segregation ATPase [Lactobacill...   101    4e-20 
ref|YP_001555187.1|  chromosome segregation protein SMC [Shewa...   101    4e-20  Gene info
ref|XP_002051987.1|  GJ24094 [Drosophila virilis] >gb|EDW64142...   101    4e-20  Gene info
ref|YP_001366879.1|  chromosome segregation protein SMC [Shewa...   101    4e-20  Gene info
ref|YP_001051017.1|  chromosome segregation protein SMC [Shewa...   101    5e-20  Gene info
ref|YP_963034.1|  chromosome segregation protein SMC [Shewanel...   101    5e-20  Gene info
ref|ZP_01707313.1|  chromosome segregation protein SMC [Shewan...   101    5e-20 
ref|YP_001670066.1|  chromosome segregation protein SMC [Pseud...   101    5e-20  Gene info
ref|ZP_01697850.1|  GTP-binding [Bacillus coagulans 36D1] >gb|...   101    5e-20 
ref|YP_002028969.1|  chromosome segregation protein SMC [Steno...   101    5e-20  Gene info
ref|XP_001708534.1|  SMC4-like protein [Giardia lamblia ATCC 5...   101    5e-20  Gene info
ref|XP_001729894.1|  hypothetical protein MGL_2880 [Malassezia...   101    5e-20  Gene info
ref|YP_001035500.1|  structural maintenance of chromosome prot...   101    6e-20  Gene info
ref|YP_001138850.1|  hypothetical protein cgR_1952 [Corynebact...   100    6e-20  Gene info
ref|NP_601267.1|  chromosome segregation ATPase [Corynebacteri...   100    6e-20  Gene info
ref|ZP_03131528.1|  chromosome segregation protein SMC [Chthon...   100    6e-20 
ref|XP_001328834.1|  SMC family, C-terminal domain containing ...   100    6e-20  Gene info
ref|ZP_02242782.1|  chromosome segregation protein [Xanthomona...   100    6e-20 
ref|YP_416579.1|  chromosome segregation SMC protein [Staphylo...   100    6e-20  Gene info
ref|ZP_02443683.1|  hypothetical protein ANACOL_03002 [Anaerot...   100    7e-20 
ref|YP_002126146.1|  Chromosome segregation ATPase, sms [Alter...   100    7e-20  Gene info
ref|NP_348377.1|  chromosome segregation SMC protein, ATPase [...   100    7e-20  Gene info
ref|ZP_01136022.1|  putative SMC family protein [Pseudoalterom...   100    7e-20 
ref|YP_001904098.1|  Chromosome segregation protein [Xanthomon...   100    7e-20  Gene info
ref|XP_002141353.1|  structural maintenance of chromosomes pro...   100    7e-20  Gene info
ref|YP_201052.1|  chromosome segregation protein [Xanthomonas ...   100    7e-20  Gene info
dbj|BAA10977.1|  ORF4 [Bacillus subtilis]                           100    8e-20 
ref|YP_001972881.1|  putative chromosome partition protein [St...   100    8e-20  Gene info
ref|ZP_01892748.1|  chromosome segregation SMC protein [Marino...   100    9e-20 
ref|NP_641955.1|  chromosome segregation protein [Xanthomonas ...   100    9e-20  Gene info
ref|XP_001176817.1|  PREDICTED: similar to Structural maintena...   100    9e-20  UniGene infoGene info
ref|XP_001818375.1|  hypothetical protein [Aspergillus oryzae ...   100    1e-19  Gene info
ref|YP_001266932.1|  chromosome segregation protein SMC [Pseud...   100    1e-19  Gene info
ref|YP_001375731.1|  chromosome segregation protein SMC [Bacil...   100    1e-19  Gene info
ref|NP_746392.1|  chromosome segregation protein SMC [Pseudomo...   100    1e-19  Gene info
ref|NP_389476.1|  chromosome segregation SMC protein homolg [B...   100    1e-19  Gene info
ref|ZP_00416405.1|  SMC protein, N-terminal:Structural mainten...   100    1e-19 
ref|YP_001854906.1|  chromosome partition protein SMC [Kocuria...   100    1e-19  Gene info
ref|ZP_01044371.1|  Chromosome segregation ATPase, sms [Idioma...   100    1e-19 
ref|YP_673333.1|  condensin subunit Smc [Mesorhizobium sp. BNC...   100    1e-19  Gene info
ref|YP_001736686.1|  SMC domain-containing protein [Candidatus...   100    1e-19  Gene info
ref|YP_147046.1|  chromosome segregation ATPase (SMC) [Geobaci...   100    1e-19  Gene info
ref|NP_302121.1|  cell division protein [Mycobacterium leprae ...   100    1e-19  Gene info
ref|YP_001917536.1|  chromosome segregation protein SMC [Natra...   100    1e-19  Gene info
ref|YP_001070212.1|  condensin subunit Smc [Mycobacterium sp. ...   100    1e-19  Gene info
ref|YP_639118.1|  condensin subunit Smc [Mycobacterium sp. MCS...   100    1e-19  Gene info
ref|YP_633058.1|  chromosome segregation protein SMC [Myxococc...   100    1e-19  Gene info
emb|CAD66601.1|  SMC protein [Methylococcus capsulatus]             100    1e-19 
ref|YP_363395.1|  chromosome segregation protein [Xanthomonas ...   100    1e-19  Gene info
ref|YP_806822.1|  chromosome segregation ATPase [Lactobacillus...   100    1e-19  Gene info
gb|EAY98554.1|  hypothetical protein OsI_019787 [Oryza sativa ...  99.8    1e-19 
ref|XP_001546567.1|  hypothetical protein BC1G_14916 [Botryoti...  99.8    1e-19  Gene info
ref|XP_001023403.2|  SMC family, C-terminal domain containing ...  99.8    1e-19  UniGene infoGene info
ref|ZP_01717807.1|  chromosome segregation protein SMC [Algori...  99.8    1e-19 
emb|CAD32690.1|  SMC4 protein [Oryza sativa]                       99.8    1e-19 
ref|XP_001893036.1|  SMC family, C-terminal domain containing ...  99.8    1e-19  Gene info
ref|XP_001008623.1|  SMC family, C-terminal domain containing ...  99.8    1e-19  UniGene infoGene info
ref|ZP_02759730.1|  SMC superfamily ATP-binding chromosome seg...  99.8    1e-19 
gb|AAT07581.1|  putative SMC protein [Oryza sativa (japonica c...  99.8    1e-19 
gb|AAS90118.1|  condensin subunit [Tetrahymena thermophila]        99.8    1e-19 
gb|EEA62348.1|  hypothetical protein BRAFLDRAFT_80430 [Branchi...  99.8    1e-19 
ref|YP_001424868.1|  chromosome partition protein smc [Coxiell...  99.8    1e-19  Gene info
ref|YP_001913280.1|  chromosome segregation protein SMC [Xanth...  99.8    1e-19  Gene info
ref|YP_451320.1|  chromosome segregation protein [Xanthomonas ...  99.8    1e-19  Gene info
ref|YP_696403.1|  chromosome segregation protein SMC [Clostrid...  99.8    1e-19  Gene info
ref|ZP_01364876.1|  hypothetical protein PaerPA_01001988 [Pseu...  99.8    1e-19 
ref|YP_002085888.1|  conserved hypothetical protein [Pseudomon...  99.8    1e-19  Gene info
ref|YP_002080635.1|  conserved hypothetical protein [Pseudomon...  99.8    1e-19  Gene info
ref|YP_001172371.1|  chromosome segregation SMC protein, putat...  99.8    2e-19  Gene info
gb|EEA63757.1|  hypothetical protein BRAFLDRAFT_280475 [Branch...  99.8    2e-19 
ref|XP_001632709.1|  predicted protein [Nematostella vectensis...  99.8    2e-19  UniGene infoGene info
ref|YP_819029.1|  condensin subunit Smc [Leuconostoc mesentero...  99.8    2e-19  Gene info
ref|ZP_01900350.1|  Chromosome segregation ATPase, sms [Morite...  99.8    2e-19 
ref|NP_250218.1|  hypothetical protein PA1527 [Pseudomonas aer...  99.8    2e-19  Gene info
ref|XP_001700568.1|  structural maintenance of chromosomes pro...  99.8    2e-19  UniGene infoGene info
ref|ZP_02219714.1|  chromosome segregation protein SMC [Coxiel...  99.8    2e-19 
emb|CAD66596.2|  SMC protein [Desulfitobacterium hafniense]        99.8    2e-19 
ref|ZP_01369659.1|  chromosome segregation protein SMC [Desulf...  99.8    2e-19 
ref|XP_660567.1|  hypothetical protein AN2963.2 [Aspergillus n...  99.4    2e-19  Gene info
ref|XP_002001812.1|  GI14952 [Drosophila mojavensis] >gb|EDW11...  99.4    2e-19  Gene info
ref|YP_001450083.1|  chromosome segregation protein SMC [Strep...  99.4    2e-19  Gene info
ref|ZP_01946423.1|  chromosome segregation protein SMC [Coxiel...  99.4    2e-19 
ref|ZP_02953607.1|  chromosome segregation protein SMC [Clostr...  99.4    2e-19 
ref|YP_002303901.1|  chromosome partition protein [Coxiella bu...  99.4    2e-19  Gene info
ref|YP_001094504.1|  chromosome segregation protein SMC [Shewa...  99.4    2e-19  Gene info
ref|NP_972102.1|  chromosome partition protein SmC, putative [...  99.4    2e-19  Gene info
ref|NP_819572.1|  chromosome segregation protein SMC [Coxiella...  99.4    2e-19  Gene info
ref|NP_764464.1|  chromosome segregation SMC protein [Staphylo...  99.4    2e-19  Gene info
ref|YP_001596471.1|  chromosome segregation protein SMC [Coxie...  99.4    2e-19  Gene info
ref|NP_629712.1|  chromosome associated protein [Streptomyces ...  99.4    2e-19  Gene info
ref|ZP_02636276.1|  chromosome segregation protein SMC [Clostr...  99.4    2e-19 
ref|NP_636938.1|  chromosome segregation protein [Xanthomonas ...  99.4    2e-19  Gene info
ref|YP_188383.1|  chromosome segregation SMC protein, putative...  99.4    2e-19  Gene info
ref|YP_114854.1|  chromosome segregation SMC protein [Methyloc...  99.4    2e-19  Gene info
ref|YP_347531.1|  condensin subunit Smc [Pseudomonas fluoresce...  99.4    2e-19  Gene info
ref|ZP_02325678.1|  chromosome segregation protein SMC [Anaero...  99.4    2e-19 
ref|YP_002133076.1|  chromosome segregation protein SMC [Anaer...  99.4    2e-19  Gene info
ref|YP_661349.1|  chromosome segregation protein SMC [Pseudoal...  99.4    2e-19  Gene info
ref|YP_435854.1|  chromosome segregation protein SMC [Hahella ...  99.0    2e-19  Gene info
ref|ZP_01154840.1|  Chromosome segregation protein [Oceanicola...  99.0    2e-19 
ref|YP_274011.1|  chromosome segregation protein SMC [Pseudomo...  99.0    2e-19  Gene info
ref|YP_234902.1|  SMC protein, N-terminal:structural maintenan...  99.0    2e-19  Gene info
ref|NP_645934.1|  chromosome segregation SMC protein [Staphylo...  99.0    2e-19  Gene info
ref|NP_371758.1|  chromosome segregation SMC protein [Staphylo...  99.0    2e-19  Gene info
ref|NP_001081372.1|  (XCAP-E) [Xenopus laevis] >sp|P50533.1|SM...  99.0    3e-19  UniGene infoGene info
ref|ZP_02044601.1|  hypothetical protein ACTODO_01475 [Actinom...  99.0    3e-19 
ref|YP_186109.1|  chromosome segregation SMC protein, putative...  99.0    3e-19  Gene info
ref|NP_199671.1|  ATSMC3 (ARABIDOPSIS THALIANA STRUCTURAL MAIN...  99.0    3e-19  UniGene infoGene info
ref|YP_753468.1|  chromosome segregation SMC protein [Syntroph...  99.0    3e-19  Gene info
ref|ZP_03151909.1|  SMC domain protein [Clostridium thermocell...  99.0    3e-19 
ref|ZP_01101196.1|  chromosome segregation SMC protein [gamma ...  99.0    3e-19 
ref|ZP_02863769.1|  chromosome segregation protein SMC [Clostr...  99.0    3e-19 
ref|ZP_01803974.1|  hypothetical protein CdifQ_04001378 [Clost...  99.0    3e-19 
ref|XP_002120882.1|  PREDICTED: similar to XCAP-C [Ciona intes...  98.6    3e-19  UniGene infoGene info
ref|ZP_02639818.1|  chromosome segregation protein SMC [Clostr...  98.6    3e-19 
ref|YP_791726.1|  putative chromosome segregation protein [Pse...  98.6    3e-19  Gene info
ref|XP_001900116.1|  SMC proteins Flexible Hinge Domain contai...  98.6    3e-19  Gene info
ref|YP_692667.1|  chromosome segregation SMC protein [Alcanivo...  98.6    3e-19  Gene info
ref|YP_002205910.1|  chromosome associated protein [Streptomyc...  98.6    3e-19  Gene info
ref|ZP_01908719.1|  Chromosome segregation protein SMC [Plesio...  98.6    3e-19 
ref|YP_463887.1|  condensin subunit Smc [Anaeromyxobacter deha...  98.6    3e-19  Gene info
ref|ZP_02633938.1|  chromosome segregation protein SMC [Clostr...  98.6    3e-19 
ref|XP_001752135.1|  condensin complex component SMC4 [Physcom...  98.6    3e-19  UniGene infoGene info
ref|XP_001486913.1|  hypothetical protein PGUG_00290 [Pichia g...  98.6    3e-19  Gene info
ref|NP_793432.1|  chromosome segregation SMC protein, putative...  98.6    3e-19  Gene info
gb|EDK36192.2|  hypothetical protein PGUG_00290 [Pichia guilli...  98.6    3e-19 
ref|YP_607417.1|  chromosome segregation SMC protein. [Pseudom...  98.6    3e-19  Gene info
gb|EDX90760.1|  chromosome segregation protein SMC [Alcanivora...  98.2    4e-19 
ref|XP_754788.1|  cohesin complex subunit  (Psm1) [Aspergillus...  98.2    4e-19  Gene info
ref|YP_040621.1|  putative chromosome partition protein [Staph...  98.2    4e-19  Gene info
ref|YP_751146.1|  chromosome segregation protein SMC [Shewanel...  98.2    4e-19  Gene info
ref|NP_986643.1|  AGL023Wp [Ashbya gossypii ATCC 10895] >gb|AA...  98.2    4e-19  UniGene infoGene info
ref|NP_856591.1|  chromosome partition protein Smc [Mycobacter...  98.2    4e-19  Gene info
ref|YP_001703976.1|  chromosome partition protein Smc [Mycobac...  98.2    4e-19  Gene info
ref|XP_396284.2|  PREDICTED: similar to structural maintenance...  98.2    4e-19  UniGene infoGene info
gb|EDP52912.1|  cohesin complex subunit  (Psm1), putative [Asp...  98.2    4e-19 
ref|XP_001263613.1|  cohesin complex subunit (Psm1), putative ...  98.2    4e-19  Gene info
ref|ZP_02642628.1|  chromosome segregation protein SMC [Clostr...  98.2    4e-19 
ref|XP_461216.1|  hypothetical protein DEHA0F21296g [Debaryomy...  98.2    4e-19  Gene info
ref|YP_933507.1|  chromosome segregation protein [Azoarcus sp....  98.2    4e-19  Gene info
ref|XP_822332.1|  structural maintenance of chromosome 4 [Tryp...  98.2    4e-19  Gene info
emb|CAR66374.1|  DEHA2F20020p [Debaryomyces hansenii]              98.2    4e-19 
ref|XP_001829506.1|  hypothetical protein CC1G_00685 [Coprinop...  98.2    4e-19  Gene info
emb|CAG90057.2|  DEHA2G01606p [Debaryomyces hansenii]              98.2    5e-19 
ref|YP_001349160.1|  chromosome segregation protein SMC [Pseud...  98.2    5e-19  Gene info
ref|YP_259010.1|  chromosome segregation SMC protein [Pseudomo...  98.2    5e-19  Gene info
ref|ZP_02094674.1|  hypothetical protein PEPMIC_01441 [Peptost...  97.8    5e-19 
ref|YP_001750453.1|  chromosome segregation protein SMC [Pseud...  97.8    5e-19  Gene info
ref|YP_001592357.1|  chromosome segregation protein SMC [Bruce...  97.8    5e-19  Gene info
ref|NP_540356.1|  chromosome segregation protein SMC2 [Brucell...  97.8    5e-19  Gene info
ref|NP_697525.1|  SMC family protein [Brucella suis 1330] >gb|...  97.8    5e-19  Gene info
ref|YP_221271.1|  SMC family protein [Brucella abortus bv. 1 s...  97.8    5e-19  Gene info
ref|YP_001288865.1|  chromosome partitioning protein smc [Myco...  97.8    5e-19  Gene info
ref|NP_337503.1|  chromosome segregation SMC protein, putative...  97.8    5e-19  Gene info
ref|YP_001410724.1|  chromosome segregation protein SMC [Fervi...  97.8    5e-19  Gene info
ref|YP_001258510.1|  chromosome segregation protein SMC [Bruce...  97.8    5e-19  Gene info
ref|XP_461610.1|  hypothetical protein DEHA0G01958g [Debaryomy...  97.8    5e-19  Gene info
ref|ZP_02423601.1|  hypothetical protein EUBSIR_02470 [Eubacte...  97.8    5e-19 
ref|NP_823834.1|  chromosome segregation protein [Streptomyces...  97.8    6e-19  Gene info
ref|NP_885521.1|  putative chromosome partition protein [Borde...  97.8    6e-19  Gene info
ref|ZP_02995428.1|  hypothetical protein CLOSPO_02550 [Clostri...  97.8    6e-19 
ref|XP_001270846.1|  cohesin complex subunit  (Psm1), putative...  97.8    6e-19  Gene info
ref|ZP_02093228.1|  hypothetical protein FAEPRAM212_03535 [Fae...  97.8    6e-19 
ref|XP_002079669.1|  GD21899 [Drosophila simulans] >gb|EDX0525...  97.8    6e-19  Gene info
ref|YP_001536080.1|  chromosome segregation protein SMC [Salin...  97.4    6e-19  Gene info
emb|CAO15461.1|  unnamed protein product [Vitis vinifera]          97.4    6e-19 
ref|YP_001545406.1|  chromosome segregation protein SMC [Herpe...  97.4    6e-19  Gene info
ref|YP_353960.1|  chromosome segregation protein SMC2 [Rhodoba...  97.4    7e-19  Gene info
ref|ZP_02711075.1|  chromosome segregation protein SMC [Strept...  97.4    7e-19 
ref|NP_882071.1|  putative chromosome partition protein [Borde...  97.4    7e-19  Gene info
ref|YP_001306135.1|  chromosome segregation protein SMC [Therm...  97.4    7e-19  Gene info
ref|YP_001087743.1|  chromosome partition protein [Clostridium...  97.4    7e-19  Gene info
ref|ZP_01963291.1|  hypothetical protein RUMOBE_01007 [Ruminoc...  97.4    7e-19 
gb|EEA19109.1|  cohesin complex subunit  (Psm1), putative [Pen...  97.4    7e-19 
ref|ZP_02747102.1|  chromosome partition protein [Clostridium ...  97.4    7e-19 
ref|YP_250984.1|  chromosome segregation protein [Corynebacter...  97.4    7e-19  Gene info
ref|YP_001037354.1|  condensin subunit Smc [Clostridium thermo...  97.4    7e-19  Gene info
ref|ZP_01614601.1|  putative SMC family protein [Alteromonadal...  97.4    7e-19 
ref|ZP_02728698.1|  chromosome partition protein [Clostridium ...  97.4    7e-19 
ref|NP_345712.1|  hypothetical protein SP_1247 [Streptococcus ...  97.4    7e-19  Gene info
ref|ZP_02965064.1|  SMC domain protein [bacterium Ellin514] >g...  97.4    8e-19 
ref|XP_001240439.1|  hypothetical protein CIMG_07602 [Coccidio...  97.4    8e-19  Gene info
ref|YP_001044410.1|  chromosome segregation protein SMC [Rhodo...  97.4    8e-19  Gene info
ref|ZP_01834600.1|  glucose-6-phosphate 1-dehydrogenase [Strep...  97.4    8e-19 
ref|ZP_01453435.1|  chromosome segregation SMC protein, putati...  97.4    8e-19 
ref|YP_001835773.1|  hypothetical protein SPCG_1056 [Streptoco...  97.1    9e-19  Gene info
ref|YP_253595.1|  chromosome segregation SMC protein [Staphylo...  97.1    9e-19  Gene info
ref|YP_001158139.1|  chromosome segregation protein SMC [Salin...  97.1    9e-19  Gene info
ref|XP_001600657.1|  PREDICTED: similar to structural maintena...  97.1    1e-18  Gene info
ref|XP_001374808.1|  PREDICTED: similar to SMC2 protein [Monod...  97.1    1e-18  UniGene infoGene info
ref|NP_562632.1|  chromosome segregation protein SMC [Clostrid...  97.1    1e-18  Gene info
ref|YP_001823413.1|  putative chromosome segregation protein [...  97.1    1e-18  Gene info
ref|YP_339599.1|  SMC protein [Pseudoalteromonas haloplanktis ...  97.1    1e-18  Gene info
ref|YP_001198556.1|  chromosome segregation ATPase [Streptococ...  97.1    1e-18  Gene info
ref|YP_927391.1|  SMC family protein [Shewanella amazonensis S...  96.7    1e-18  Gene info
ref|YP_301625.1|  chromosome segregation SMC protein [Staphylo...  96.7    1e-18  Gene info
gb|AAH94474.1|  Smc3 protein [Xenopus laevis]                      96.7    1e-18  Gene info
ref|YP_265541.1|  SMC family chromosome segregation protein [C...  96.7    1e-18  Gene info
ref|ZP_02910923.1|  SMC domain protein [Burkholderia ambifaria...  96.7    1e-18 
ref|ZP_01830759.1|  chromosome segregation protein SMC [Strept...  96.7    1e-18 
ref|YP_001630312.1|  putative chromosome partition protein [Bo...  96.7    1e-18  Gene info
ref|ZP_01264720.1|  chromosome segregation protein SMC family ...  96.7    1e-18 
ref|NP_358719.1|  chromosome condensation and segregation SMC ...  96.7    1e-18  Gene info
gb|EEA43328.1|  hypothetical protein BRAFLDRAFT_129060 [Branch...  96.7    1e-18 
ref|ZP_01826118.1|  glucose-6-phosphate 1-dehydrogenase [Strep...  96.7    1e-18 
ref|YP_002037847.1|  chromosome segregation protein smc, putat...  96.7    1e-18  Gene info
ref|ZP_02379234.1|  Chromosome segregation protein SMC [Burkho...  96.7    1e-18 
ref|XP_001540451.1|  hypothetical protein HCAG_04291 [Ajellomy...  96.7    1e-18  Gene info
ref|YP_001875306.1|  chromosome segregation protein SMC [Elusi...  96.7    1e-18  Gene info
ref|NP_775360.1|  structural maintenance of chromosomes 4 [Dan...  96.7    1e-18  UniGene infoGene info
ref|XP_759390.1|  hypothetical protein UM03243.1 [Ustilago may...  96.7    1e-18  Gene info
ref|YP_001800186.1|  chromosome segregation protein [Corynebac...  96.7    1e-18  Gene info
ref|ZP_00603812.1|  SMC protein, N-terminal:Structural mainten...  96.7    1e-18 
ref|YP_766694.1|  putative structural maintenance of chromosom...  96.7    1e-18  Gene info
emb|CAP86028.1|  Pc20g06990 [Penicillium chrysogenum Wisconsin...  96.7    1e-18 
gb|EEA42997.1|  hypothetical protein BRAFLDRAFT_129192 [Branch...  96.3    1e-18 
ref|YP_288716.1|  condensin subunit Smc [Thermobifida fusca YX...  96.3    1e-18  Gene info
ref|XP_001504048.1|  PREDICTED: structural maintenance of chro...  96.3    1e-18  UniGene infoGene info
ref|YP_001135445.1|  chromosome segregation protein SMC [Mycob...  96.3    1e-18  Gene info
ref|ZP_01129939.1|  chromosome segregation protein [marine act...  96.3    1e-18 
ref|ZP_02411955.1|  chromosome segregation protein SMC [Burkho...  96.3    1e-18 
ref|XP_001767264.1|  condensin complex component SMC1 [Physcom...  96.3    2e-18  UniGene infoGene info
ref|NP_353825.2|  chromosome segregation protein [Agrobacteriu...  96.3    2e-18  Gene info
ref|XP_001894059.1|  SMC family, C-terminal domain containing ...  96.3    2e-18  Gene info
ref|YP_813248.1|  chromosome segregation ATPase [Lactobacillus...  96.3    2e-18  Gene info
gb|EDZ60831.1|  smc protein [Candidatus Pelagibacter sp. HTCC7...  96.3    2e-18 
ref|ZP_02356113.1|  chromosome segregation protein SMC [Burkho...  96.3    2e-18 
ref|YP_999184.1|  chromosome segregation protein SMC [Verminep...  96.3    2e-18  Gene info
ref|NP_867048.1|  chromosome partition protein Smc [Rhodopirel...  96.3    2e-18  Gene info
ref|ZP_02448072.1|  chromosome segregation protein SMC [Burkho...  96.3    2e-18 
ref|YP_523454.1|  chromosome segregation protein SMC [Rhodofer...  96.3    2e-18  Gene info
ref|ZP_01916438.1|  Chromosome segregation protein SMC [Limnob...  96.3    2e-18 
ref|ZP_02456243.1|  chromosome segregation protein SMC [Burkho...  95.9    2e-18 
ref|ZP_03126138.1|  chromosome partition protein [Clostridium ...  95.9    2e-18 
ref|ZP_02482287.1|  chromosome segregation protein SMC [Burkho...  95.9    2e-18 
ref|YP_314986.1|  condensin subunit Smc [Thiobacillus denitrif...  95.9    2e-18  Gene info
ref|XP_002125440.1|  PREDICTED: similar to Smc3 protein, parti...  95.9    2e-18  UniGene infoGene info
ref|YP_873328.1|  condensin subunit Smc [Acidothermus cellulol...  95.9    2e-18  Gene info
ref|XP_001400318.1|  hypothetical protein An02g11900 [Aspergil...  95.9    2e-18  Gene info
ref|YP_535519.1|  chromosome partition protein [Lactobacillus ...  95.9    2e-18  Gene info
ref|YP_156084.1|  chromosome segregation ATPase, sms [Idiomari...  95.9    2e-18  Gene info
ref|ZP_01312645.1|  Chromosome segregation protein SMC [Desulf...  95.9    2e-18 
ref|XP_001647333.1|  hypothetical protein Kpol_1018p2 [Vanderw...  95.9    2e-18  Gene info
ref|YP_924462.1|  condensin subunit Smc [Nocardioides sp. JS61...  95.9    2e-18  Gene info
ref|NP_968079.1|  chromosome segregation SMC protein [Bdellovi...  95.9    2e-18  Gene info
ref|XP_393700.2|  PREDICTED: similar to Chromosome-associated ...  95.9    2e-18  UniGene infoGene info
ref|XP_001664944.1|  hypothetical protein CBG13206 [Caenorhabd...  95.9    2e-18  Gene info
ref|YP_002249782.1|  chromosome segregation SMC protein, putat...  95.9    2e-18  Gene info
gb|EDZ64566.1|  chromosome segregation protein SMC [beta prote...  95.5    2e-18 
ref|YP_001531513.1|  chromosome segregation protein SMC [Dinor...  95.5    2e-18  Gene info
gb|EEB06777.1|  mitotic cohesin complex subunit Psm1 [Schizosa...  95.5    2e-18 
ref|XP_775376.1|  hypothetical protein CNBE0920 [Cryptococcus ...  95.5    2e-18  UniGene infoGene info
ref|ZP_03119052.1|  chromosome partition protein [Clostridium ...  95.5    3e-18 
ref|YP_948190.1|  chromosome segregation protein SMC [Arthroba...  95.5    3e-18  Gene info
ref|ZP_02403414.1|  chromosome segregation protein SMC [Burkho...  95.5    3e-18 
ref|XP_571168.1|  hypothetical protein [Cryptococcus neoforman...  95.5    3e-18  UniGene infoGene info
ref|ZP_02363254.1|  chromosome segregation protein SMC [Burkho...  95.5    3e-18 
ref|ZP_01823258.1|  glucose-6-phosphate 1-dehydrogenase [Strep...  95.5    3e-18 
gb|AAZ57432.1|  structural maintenance of chromosome 4 [Toxopl...  95.5    3e-18 
ref|YP_001728561.1|  Barmotin [Leuconostoc citreum KM20] >gb|A...  95.5    3e-18  Gene info
ref|NP_001081371.1|  (XCAP-C) [Xenopus laevis] >sp|P50532.1|SM...  95.5    3e-18  UniGene infoGene info
ref|NP_107823.1|  chromosome segregation SMC protein [Mesorhiz...  95.5    3e-18  Gene info
ref|ZP_02292934.1|  SMC domain protein [Rhizobium leguminosaru...  95.1    3e-18 
ref|XP_966409.1|  PREDICTED: similar to structural maintenance...  95.1    3e-18  UniGene infoGene info
ref|YP_001791544.1|  chromosome segregation protein SMC [Lepto...  95.1    3e-18  Gene info
ref|ZP_02692212.1|  chromosome segregation protein SMC [Epulop...  95.1    3e-18 
ref|ZP_02992030.1|  chromosome segregation protein SMC [Exiguo...  95.1    3e-18 
ref|ZP_01749562.1|  chromosome segregation protein, putative [...  95.1    4e-18 
ref|XP_764686.1|  hypothetical protein [Theileria parva strain...  95.1    4e-18  Gene info
ref|XP_001209009.1|  conserved hypothetical protein [Aspergill...  95.1    4e-18  Gene info
gb|EEB00878.1|  chromosome condensation protein, putative [Tox...  95.1    4e-18 
ref|YP_120380.1|  putative chromosome segregation protein [Noc...  95.1    4e-18  Gene info
ref|ZP_01904063.1|  chromosome segregation protein, putative [...  95.1    4e-18 
ref|XP_629977.1|  structural maintenance of chromosome protein...  95.1    4e-18  UniGene infoGene info
ref|ZP_00874982.1|  SMC protein, N-terminal:Structural mainten...  95.1    4e-18 
ref|YP_001787764.1|  chromosome segregation protein SMC [Clost...  94.7    4e-18  Gene info
ref|ZP_01820649.1|  hypothetical protein CGSSp6BS73_03122 [Str...  94.7    4e-18 
ref|ZP_01045247.1|  Chromosome segregation protein SMC [Nitrob...  94.7    4e-18 
ref|XP_001612154.1|  SMC family, C-terminal domain containing ...  94.7    4e-18  Gene info
ref|NP_218807.1|  chromosome segregation protein, putative [Tr...  94.7    4e-18  Gene info
ref|YP_002280179.1|  chromosome segregation protein SMC [Rhizo...  94.7    4e-18  Gene info
ref|YP_001781995.1|  chromosome segregation protein SMC [Clost...  94.7    5e-18  Gene info
ref|NP_385037.1|  putative chromosome partition protein [Sinor...  94.7    5e-18  Gene info
ref|XP_316422.3|  AGAP006388-PA [Anopheles gambiae str. PEST] ...  94.7    5e-18  UniGene infoGene info
ref|YP_549408.1|  chromosome segregation protein SMC [Polaromo...  94.7    5e-18  Gene info
ref|ZP_03279514.1|  chromosome segregation protein SMC [Thioal...  94.7    5e-18 
ref|YP_001391750.1|  chromosome segregation protein SMC [Clost...  94.7    5e-18  Gene info
ref|ZP_01827547.1|  glucose-6-phosphate 1-dehydrogenase [Strep...  94.7    5e-18 
ref|ZP_02619322.1|  chromosome segregation protein SMC [Clostr...  94.7    5e-18 
ref|YP_001384627.1|  chromosome segregation protein SMC [Clost...  94.7    5e-18  Gene info
ref|ZP_02615331.1|  chromosome segregation protein SMC [Clostr...  94.7    5e-18 
ref|YP_785593.1|  chromosome partition protein [Bordetella avi...  94.7    5e-18  Gene info
ref|YP_001254951.1|  chromosome segregation protein SMC [Clost...  94.7    5e-18  Gene info
ref|XP_001452329.1|  hypothetical protein [Paramecium tetraure...  94.7    5e-18  Gene info
ref|XP_568851.1|  cohesin complex subunit psm1 [Cryptococcus n...  94.7    5e-18  UniGene infoGene info
ref|XP_777072.1|  hypothetical protein CNBB3040 [Cryptococcus ...  94.7    5e-18  UniGene infoGene info
ref|ZP_02717311.1|  chromosome segregation protein SMC [Strept...  94.4    5e-18 
ref|ZP_02709948.1|  chromosome segregation protein SMC [Strept...  94.4    5e-18 
ref|YP_619232.1|  chromosome partition protein SMC [Lactobacil...  94.4    5e-18  Gene info
dbj|BAE02412.1|  unnamed protein product [Macaca fascicularis]     94.4    5e-18 
ref|ZP_00378151.1|  COG1196: Chromosome segregation ATPases [B...  94.4    5e-18 
ref|YP_001021004.1|  putative chromosome partition protein [Me...  94.4    5e-18  Gene info
ref|ZP_01818381.1|  glucose-6-phosphate 1-dehydrogenase [Strep...  94.4    5e-18 
ref|YP_001188235.1|  condensin subunit Smc [Pseudomonas mendoc...  94.4    5e-18  Gene info
ref|XP_001952075.1|  PREDICTED: similar to structural maintena...  94.4    6e-18  UniGene infoGene info
ref|YP_001694677.1|  chromosome segregation protein SMC [Strep...  94.4    6e-18  Gene info
ref|YP_160674.1|  chromosome segregation ATPase [Azoarcus sp. ...  94.4    6e-18  Gene info
ref|ZP_02167443.1|  putative structural maintenance of chromos...  94.4    6e-18 
ref|YP_168431.1|  SMC protein [Silicibacter pomeroyi DSS-3] >g...  94.4    6e-18  Gene info
ref|XP_370397.2|  hypothetical protein MGG_06894 [Magnaporthe ...  94.4    6e-18  UniGene infoGene info
ref|YP_001326238.1|  chromosome segregation protein SMC [Sinor...  94.4    6e-18  Gene info
dbj|BAG50923.1|  unnamed protein product [Homo sapiens]            94.4    6e-18  Gene info
ref|ZP_02948594.1|  chromosome segregation protein SMC [Clostr...  94.4    6e-18 
ref|YP_001977257.1|  chromosome partition protein [Rhizobium e...  94.4    7e-18  Gene info
ref|YP_591713.1|  chromosome segregation protein SMC [Acidobac...  94.4    7e-18  Gene info
ref|YP_319213.1|  chromosome segregation protein SMC [Nitrobac...  94.0    7e-18  Gene info
pdb|1E69|A  Chain A, Smc Head Domain From Thermotoga Maritima ...  94.0    7e-18  Related structures
ref|ZP_01878382.1|  SMC protein [Roseovarius sp. TM1035] >gb|E...  94.0    7e-18 
ref|YP_545510.1|  condensin subunit Smc [Methylobacillus flage...  94.0    7e-18  Gene info
ref|YP_741523.1|  chromosome segregation protein SMC [Alkalili...  94.0    7e-18  Gene info
ref|YP_916518.1|  chromosome segregation protein SMC [Paracocc...  94.0    7e-18  Gene info
gb|ACI64866.1|  smc1 [Thalassiosira pseudonana CCMP1335]           94.0    7e-18 
ref|YP_001166360.1|  chromosome segregation protein SMC [Rhodo...  94.0    7e-18  Gene info
ref|YP_952996.1|  chromosome segregation protein SMC [Mycobact...  94.0    7e-18  Gene info
ref|ZP_00630442.1|  SMC protein, N-terminal:Structural mainten...  94.0    8e-18 
ref|NP_989849.1|  structural maintenance of chromosomes 4 [Gal...  94.0    8e-18  UniGene infoGene info
ref|XP_001372430.1|  PREDICTED: similar to chromosome-associat...  94.0    8e-18  UniGene infoGene info
ref|XP_382086.1|  hypothetical protein FG01910.1 [Gibberella z...  94.0    8e-18  Gene info
ref|XP_538759.2|  PREDICTED: similar to Structural maintenance...  94.0    8e-18  UniGene infoGene info
ref|YP_468538.1|  chromosome partition protein [Rhizobium etli...  94.0    9e-18  Gene info
ref|YP_001108169.1|  chromosome segregation ATPase [Saccharopo...  94.0    9e-18  Gene info
ref|NP_536718.1|  SMC (structural maintenace of chromosomes 1)...  93.6    9e-18  UniGene infoGene info
ref|YP_681656.1|  chromosome segregation protein, putative [Ro...  93.6    9e-18  Gene info
ref|NP_001102136.2|  structural maintenance of chromosomes 2-l...  93.6    1e-17  UniGene infoGene info
ref|XP_001443869.1|  hypothetical protein [Paramecium tetraure...  93.6    1e-17  UniGene infoGene info
ref|XP_001447973.1|  hypothetical protein [Paramecium tetraure...  93.6    1e-17  UniGene infoGene info
ref|ZP_01521366.1|  chromosome segregation protein SMC [Comamo...  93.6    1e-17 
ref|XP_001899737.1|  SMC proteins Flexible Hinge Domain contai...  93.6    1e-17  Gene info
ref|YP_808836.1|  condensin subunit Smc [Lactococcus lactis su...  93.6    1e-17  Gene info
ref|ZP_02141341.1|  chromosome segregation protein, putative [...  93.6    1e-17 
ref|YP_484687.1|  chromosome segregation protein SMC [Rhodopse...  93.6    1e-17  Gene info
ref|NP_001083742.1|  structural maintenance of chromosomes pro...  93.6    1e-17  UniGene infoGene info
ref|YP_001577670.1|  chromosome segregation protein Smc [Lacto...  93.6    1e-17  Gene info
ref|XP_952594.1|  smc protein [Theileria annulata strain Ankar...  93.6    1e-17  Gene info
ref|NP_001027927.1|  SMC4 protein [Takifugu rubripes] >emb|CAD...  93.6    1e-17  UniGene infoGene info
ref|XP_001600842.1|  PREDICTED: similar to structural maintena...  93.2    1e-17  Gene info
ref|YP_886763.1|  chromosome segregation protein SMC [Mycobact...  93.2    1e-17  Gene info
ref|NP_006435.2|  structural maintenance of chromosomes 2-like...  93.2    1e-17  UniGene infoGene info
dbj|BAF85288.1|  unnamed protein product [Homo sapiens]            93.2    1e-17  Gene info
ref|XP_001137286.1|  PREDICTED: structural maintenance of chro...  93.2    1e-17  UniGene infoGene info
ref|YP_578425.1|  chromosome segregation protein SMC [Nitrobac...  93.2    1e-17  Gene info
ref|YP_986338.1|  chromosome segregation protein SMC [Acidovor...  93.2    1e-17  Gene info
ref|XP_001137218.1|  PREDICTED: structural maintenance of chro...  93.2    1e-17  Gene info
ref|YP_333984.1|  chromosome segregation protein SMC [Burkhold...  93.2    1e-17  Gene info
ref|XP_001510551.1|  PREDICTED: similar to chromosome-associat...  93.2    1e-17  UniGene infoGene info
ref|YP_678202.1|  chromosome segregation protein, Smc family p...  93.2    1e-17  Gene info
gb|EAW58974.1|  SMC2 structural maintenance of chromosomes 2-l...  93.2    1e-17  Gene info
ref|NP_939882.1|  putative chromosome partition protein [Coryn...  93.2    1e-17  Gene info
ref|ZP_00234938.1|  chromosome segregation SMC protein [Lister...  93.2    1e-17 
ref|NP_465329.1|  hypothetical protein lmo1804 [Listeria monoc...  93.2    1e-17  Gene info
dbj|BAE43202.1|  unnamed protein product [Mus musculus]            92.8    2e-17  Gene info
ref|ZP_01552143.1|  Chromosome segregation protein SMC [Methyl...  92.8    2e-17 
ref|XP_827441.1|  structural maintenance of chromosome 1 [Tryp...  92.8    2e-17  Gene info
ref|ZP_02842617.1|  chromosome segregation protein SMC [Thauer...  92.8    2e-17 
ref|YP_706459.1|  chromosome partition protein [Rhodococcus sp...  92.8    2e-17  Gene info
ref|NP_989848.1|  structural maintenance of chromosomes 3 [Gal...  92.8    2e-17  UniGene infoGene info
ref|ZP_02893904.1|  chromosome segregation protein SMC [Burkho...  92.8    2e-17 
dbj|BAD32186.1|  mKIAA0178 protein [Mus musculus]                  92.8    2e-17  Gene info
ref|ZP_03297718.1|  hypothetical protein COLSTE_01631 [Collins...  92.8    2e-17 
ref|NP_781876.1|  chromosome segregation protein smc2 [Clostri...  92.8    2e-17  Gene info
gb|EDM00911.1|  rCG63395 [Rattus norvegicus]                       92.8    2e-17 
ref|YP_001119771.1|  chromosome segregation protein SMC [Burkh...  92.8    2e-17  Gene info
ref|YP_001579435.1|  chromosome segregation protein SMC [Burkh...  92.8    2e-17  Gene info
ref|ZP_01037767.1|  SMC protein [Roseovarius sp. 217] >gb|EAQ2...  92.8    2e-17 
ref|XP_001137043.1|  PREDICTED: structural maintenance of chro...  92.8    2e-17  Gene info
ref|YP_411344.1|  chromosome segregation protein SMC [Nitrosos...  92.8    2e-17  Gene info
gb|AAB08867.1|  FIN16 gene product                                 92.8    2e-17  Gene info
ref|YP_002212762.1|  chromosome segregation protein SMC [Oligo...  92.8    2e-17  Gene info
ref|YP_783347.1|  chromosome segregation protein SMC [Rhodopse...  92.8    2e-17  Gene info
ref|YP_905941.1|  chromosome partition protein Smc [Mycobacter...  92.8    2e-17  Gene info
emb|CAK04581.1|  chondroitin sulfate proteoglycan 6 (bamacan) ...  92.8    2e-17  Gene info
ref|XP_961409.2|  hypothetical protein NCU01323 [Neurospora cr...  92.4    2e-17  UniGene infoGene info
ref|XP_001911019.1|  unnamed protein product [Podospora anseri...  92.4    2e-17  Gene info
ref|YP_001850089.1|  chromosome partition protein Smc [Mycobac...  92.4    2e-17  Gene info
emb|CAC18213.1|  related to SMC1 protein [Neurospora crassa]       92.4    2e-17 
ref|XP_626475.1|  SMC1 structural maintenance of chromosomes 1...  92.4    2e-17  Gene info
gb|AAH55477.1|  Smc1a protein [Mus musculus]                       92.4    2e-17  Gene info
ref|YP_568333.1|  chromosome segregation protein SMC [Rhodopse...  92.4    2e-17  Gene info
ref|XP_001562063.1|  structural maintenance of chromosome 3 pr...  92.4    2e-17  Gene info
ref|XP_001098806.1|  PREDICTED: SMC4 structural maintenance of...  92.4    2e-17  UniGene infoGene info
ref|XP_001099331.1|  PREDICTED: SMC4 structural maintenance of...  92.4    2e-17  UniGene infoGene info
emb|CAD38803.1|  hypothetical protein [Homo sapiens]               92.4    2e-17  Gene info
dbj|BAE26376.1|  unnamed protein product [Mus musculus]            92.4    2e-17  Gene info
ref|YP_971185.1|  chromosome segregation protein SMC [Acidovor...  92.4    2e-17  Gene info
gb|AAC72361.1|  chromosome-associated protein-C [Homo sapiens]     92.4    3e-17  Gene info
ref|YP_001080888.1|  chromosome segregation protein SMC [Burkh...  92.4    3e-17  Gene info
ref|YP_014424.1|  chromosome segregation SMC protein [Listeria...  92.4    3e-17  Gene info
ref|XP_001099428.1|  PREDICTED: SMC4 structural maintenance of...  92.4    3e-17  UniGene infoGene info
ref|YP_773949.1|  chromosome segregation protein SMC [Burkhold...  92.0    3e-17  Gene info
dbj|BAG54637.1|  unnamed protein product [Homo sapiens]            92.0    3e-17  Gene info
ref|YP_993381.1|  chromosome segregation protein SMC [Burkhold...  92.0    3e-17  Gene info
ref|YP_001946450.1|  chromosome segregation protein [Burkholde...  92.0    3e-17  Gene info
ref|YP_001808626.1|  chromosome segregation protein SMC [Burkh...  92.0    3e-17  Gene info
ref|YP_002098060.1|  SMC protein [Burkholderia dolosa AUO158] ...  92.0    3e-17  Gene info
ref|ZP_02506615.1|  chromosome segregation protein SMC [Burkho...  92.0    3e-17 
ref|XP_001098705.1|  PREDICTED: SMC4 structural maintenance of...  92.0    3e-17  Gene info
ref|XP_666991.1|  Xenopus 14s cohesin smc1 subunit [Cryptospor...  92.0    3e-17  Gene info
emb|CAB66811.1|  hypothetical protein [Homo sapiens]               92.0    3e-17  Gene info
ref|ZP_02269845.1|  chromosome segregation protein SMC [Burkho...  92.0    3e-17 
ref|XP_001136901.1|  PREDICTED: structural maintenance of chro...  92.0    3e-17  UniGene infoGene info
ref|XP_001098604.1|  PREDICTED: SMC4 structural maintenance of...  92.0    3e-17  Gene info
ref|ZP_01763990.1|  chromosome segregation protein SMC [Burkho...  92.0    3e-17 
ref|YP_103203.1|  chromosome segregation protein SMC [Burkhold...  92.0    3e-17  Gene info
gb|EAW78642.1|  SMC4 structural maintenance of chromosomes 4-l...  92.0    3e-17  Gene info
sp|Q8CG48.1|SMC2_MOUSE  RecName: Full=Structural maintenance o...  92.0    3e-17  Gene info
ref|NP_001002800.1|  SMC4 structural maintenance of chromosome...  92.0    3e-17  UniGene infoGene info
ref|ZP_01013364.1|  SMC protein [Rhodobacterales bacterium HTC...  92.0    3e-17 
ref|NP_001123970.1|  structural maintenance of chromosomes 1B ...  92.0    3e-17  UniGene infoGene info
ref|NP_032043.3|  structural maintenance of chromosomes 2-like...  92.0    3e-17  UniGene infoGene info
dbj|BAB24167.1|  unnamed protein product [Mus musculus]            92.0    3e-17  Gene info
ref|YP_279451.1|  putative ABC transporter ATP-binding protein...  92.0    3e-17  Gene info
ref|YP_001066761.1|  chromosome segregation protein SMC [Burkh...  92.0    3e-17  Gene info
ref|YP_001029182.1|  chromosome segregation protein SMC [Burkh...  92.0    3e-17  Gene info
ref|YP_001059478.1|  chromosome segregation protein SMC [Burkh...  92.0    3e-17  Gene info
ref|YP_116186.1|  p115 protein [Mycoplasma hyopneumoniae 232] ...  92.0    3e-17  Gene info
emb|CAL61499.2|  Chromosome segregation protein SMC [Herminiim...  92.0    3e-17 
dbj|BAG53807.1|  unnamed protein product [Homo sapiens]            92.0    3e-17  Gene info
ref|XP_001362224.1|  PREDICTED: similar to SMC1 protein [Monod...  92.0    3e-17  UniGene infoGene info
ref|XP_001137129.1|  PREDICTED: structural maintenance of chro...  92.0    3e-17  UniGene infoGene info
emb|CAQ48406.1|  C. elegans protein Y47D3A.26b, partially conf...  92.0    3e-17 
ref|NP_499453.3|  SMC (structural maintenance of chromosomes) ...  92.0    3e-17  UniGene infoGene info
gb|AAD32447.1|AF067163_1  bamacan homolog [Homo sapiens] >gb|A...  92.0    3e-17  Gene info
ref|YP_108761.1|  putative chromosome partition protein [Burkh...  92.0    3e-17  Gene info
ref|XP_001229115.1|  hypothetical protein CHGG_02599 [Chaetomi...  92.0    3e-17  Gene info
ref|ZP_02113509.1|  chromosome segregation protein SMC [Burkho...  92.0    3e-17 
ref|NP_842284.1|  chromosome segregation ATPase [Nitrosomonas ...  92.0    3e-17  Gene info
ref|YP_062411.1|  chromosome segregation protein [Leifsonia xy...  92.0    3e-17  Gene info
ref|ZP_00438346.1|  COG1196: Chromosome segregation ATPases [B...  92.0    3e-17 
ref|ZP_02463932.1|  chromosome segregation protein SMC [Burkho...  92.0    3e-17 
ref|YP_002129425.1|  chromosome segregation SMC protein [Pheny...  92.0    3e-17  Gene info
ref|YP_288042.1|  ABC transporter ATP-binding protein P115-lik...  92.0    3e-17  Gene info
emb|CAA06289.1|  SMC-like protein [Homo sapiens]                   92.0    3e-17  Gene info
gb|AAH36330.1|  Smc3 protein [Mus musculus]                        91.7    3e-17  Gene info
ref|NP_955836.2|  structural maintenance of chromosomes 2 [Dan...  91.7    3e-17  UniGene infoGene info
ref|ZP_02929650.1|  Chromosome segregation protein SMC [Verruc...  91.7    3e-17 
ref|XP_001078687.1|  PREDICTED: similar to Structural maintena...  91.7    3e-17  UniGene infoGene info
gb|AAI65249.1|  Smc3 protein [Danio rerio]                         91.7    3e-17  Gene info
ref|ZP_02185234.1|  chromosome partition protein SMC [Carnobac...  91.7    3e-17 
ref|NP_999854.1|  chondroitin sulfate proteoglycan 6 [Danio re...  91.7    3e-17  UniGene infoGene info
ref|YP_442543.1|  chromosome segregation protein SMC [Burkhold...  91.7    3e-17  Gene info
ref|ZP_02388210.1|  chromosome segregation protein SMC [Burkho...  91.7    3e-17 
ref|ZP_02374344.1|  chromosome segregation protein SMC [Burkho...  91.7    3e-17 
ref|XP_662201.1|  hypothetical protein AN4597.2 [Aspergillus n...  91.7    4e-17  Gene info
gb|EAY98552.1|  hypothetical protein OsI_019785 [Oryza sativa ...  91.7    4e-17 
ref|XP_002070850.1|  GK25447 [Drosophila willistoni] >gb|EDW81...  91.7    4e-17  Gene info
ref|NP_419192.1|  smc protein [Caulobacter crescentus CB15] >g...  91.7    4e-17  Gene info
ref|YP_001099626.1|  putative chromosome segregation ATPases [...  91.7    4e-17  Gene info
ref|NP_785222.1|  cell division protein Smc [Lactobacillus pla...  91.7    4e-17  Gene info
gb|EAW78641.1|  SMC4 structural maintenance of chromosomes 4-l...  91.7    4e-17  Gene info
sp|O95347.1|SMC2_HUMAN  RecName: Full=Structural maintenance o...  91.7    4e-17  Gene info
ref|NP_001027798.1|  SMC3 protein [Takifugu rubripes] >emb|CAD...  91.7    4e-17  UniGene infoGene info
ref|YP_001238397.1|  condensin subunit Smc [Bradyrhizobium sp....  91.7    4e-17  Gene info
ref|YP_001885440.1|  chromosome segregation protein SMC [Clost...  91.7    4e-17  Gene info
ref|XP_001368555.1|  PREDICTED: similar to chromosome-associat...  91.7    4e-17  UniGene infoGene info
ref|XP_001098208.1|  PREDICTED: SMC4 structural maintenance of...  91.7    4e-17  UniGene infoGene info
gb|AAT68048.1|  chromosome adhesion protein SMC1-like [Danio r...  91.7    4e-17  Gene info
gb|EDY77188.1|  chromosome segregation protein SMC [Octadecaba...  91.7    4e-17 
ref|ZP_02301074.1|  chromosome segregation protein SMC [Rhodop...  91.7    4e-17 
ref|XP_544016.2|  PREDICTED: similar to Structural maintenance...  91.7    4e-17  UniGene infoGene info
ref|NP_949825.1|  chromosome segregation protein SMC [Rhodopse...  91.7    4e-17  Gene info
ref|XP_851818.1|  PREDICTED: similar to Structural maintenance...  91.7    4e-17  UniGene infoGene info
ref|YP_625889.1|  chromosome segregation protein SMC [Burkhold...  91.3    4e-17  Gene info
ref|ZP_01443115.1|  SMC protein [Roseovarius sp. HTCC2601] >gb...  91.3    4e-17 
ref|ZP_00954033.1|  SMC protein [Sulfitobacter sp. EE-36] >gb|...  91.3    5e-17 
ref|XP_386930.1|  hypothetical protein FG06754.1 [Gibberella z...  91.3    5e-17  Gene info
ref|YP_369574.1|  chromosome segregation protein SMC [Burkhold...  91.3    5e-17  Gene info
ref|YP_001765329.1|  chromosome segregation protein SMC [Burkh...  91.3    5e-17  Gene info
ref|ZP_01548184.1|  Chromosome segregation ATPase [Stappia agg...  91.3    5e-17 
gb|EAW49558.1|  chondroitin sulfate proteoglycan 6 (bamacan), ...  91.3    5e-17  Gene info
ref|YP_001993947.1|  chromosome segregation protein SMC [Rhodo...  91.3    5e-17  Gene info
gb|EAW93149.1|  SMC1 structural maintenance of chromosomes 1-l...  91.3    5e-17  Gene info
ref|YP_835670.1|  chromosome segregation protein SMC [Burkhold...  91.3    5e-17  Gene info
tpe|CAD59554.1|  TPA: SMC3 protein [Bos taurus]                    91.3    5e-17  Gene info
ref|XP_001110075.1|  PREDICTED: structural maintenance of chro...  91.3    5e-17  UniGene infoGene info
gb|AAH05507.1|  Smc4l1 protein [Mus musculus]                      91.3    5e-17  Gene info
dbj|BAF98736.1|  unnamed protein product [Homo sapiens]            91.3    5e-17  Gene info
ref|YP_001003446.1|  chromosome segregation protein SMC [Halor...  91.3    5e-17  Gene info
ref|YP_002231224.1|  putative chromosome partition protein [Bu...  91.3    5e-17  Gene info
ref|NP_005436.1|  structural maintenance of chromosomes 3 [Hom...  91.3    5e-17  UniGene infoGene info
ref|XP_001914824.1|  PREDICTED: similar to SMC1 protein, parti...  91.3    5e-17  UniGene infoGene info
gb|AAH62935.1|  Structural maintenace of chromosomes 3 [Mus mu...  91.3    5e-17  Gene info
ref|ZP_02863219.1|  chromosome segregation protein SMC [Clostr...  91.3    5e-17 
ref|YP_001857574.1|  chromosome segregation protein SMC [Burkh...  91.3    5e-17  Gene info
gb|AAH47324.1|  Structural maintenance of chromosomes 3 [Homo ...  91.3    5e-17  Gene info
ref|NP_031816.2|  chondroitin sulfate proteoglycan 6 [Mus musc...  91.3    5e-17  UniGene infoGene info
ref|XP_001551375.1|  hypothetical protein BC1G_10201 [Botryoti...  91.3    5e-17  Gene info
ref|XP_001512488.1|  PREDICTED: hypothetical protein [Ornithor...  91.3    5e-17  UniGene infoGene info
ref|XP_688120.2|  PREDICTED: similar to chromosome adhesion pr...  91.3    5e-17  UniGene infoGene info
ref|YP_831974.1|  condensin subunit Smc [Arthrobacter sp. FB24...  91.3    5e-17  Gene info
ref|XP_001512851.1|  PREDICTED: similar to SMCD [Ornithorhynch...  91.3    5e-17  UniGene infoGene info
ref|YP_395323.1|  chromosome seggregation Smc protein [Lactoba...  91.3    6e-17  Gene info
ref|XP_508031.2|  PREDICTED: structural maintenance of chromos...  91.3    6e-17  UniGene infoGene info
ref|YP_748309.1|  chromosome segregation protein SMC [Nitrosom...  90.9    6e-17  Gene info
ref|YP_850020.1|  chromosome segregation SMC protein [Listeria...  90.9    6e-17  Gene info
ref|NP_471252.1|  hypothetical protein lin1918 [Listeria innoc...  90.9    6e-17  Gene info
ref|XP_001157529.1|  PREDICTED: hypothetical protein isoform 4...  90.9    6e-17  UniGene infoGene info
gb|AAC15582.1|  mitosis-specific chromosome segregation protei...  90.9    6e-17 
gb|AAH71232.1|  Smc2 protein [Mus musculus]                        90.9    6e-17  Gene info
ref|XP_001157803.1|  PREDICTED: SMC4 structural maintenance of...  90.9    6e-17  UniGene infoGene info
ref|XP_001157759.1|  PREDICTED: SMC4 structural maintenance of...  90.9    6e-17  UniGene infoGene info
ref|ZP_00948578.1|  SMC protein [Sulfitobacter sp. NAS-14.1] >...  90.9    7e-17 
ref|NP_989847.1|  SMC1 protein cohesin subunit [Gallus gallus]...  90.9    7e-17  UniGene infoGene info
ref|YP_878289.1|  chromosome segregation protein SMC [Clostrid...  90.9    7e-17  Gene info
ref|YP_795116.1|  chromosome segregation ATPase [Lactobacillus...  90.9    7e-17  Gene info
ref|XP_535848.2|  PREDICTED: similar to Structural maintenance...  90.9    7e-17  UniGene infoGene info
ref|XP_001488501.1|  PREDICTED: similar to Structural maintena...  90.9    7e-17  UniGene infoGene info
ref|XP_861587.1|  PREDICTED: similar to Structural maintenance...  90.9    7e-17  UniGene infoGene info
ref|ZP_01687608.1|  chromosome segregation protein SMC [Micros...  90.9    7e-17 
ref|XP_585705.4|  PREDICTED: similar to structural maintenance...  90.5    8e-17  UniGene infoGene info
ref|XP_001564859.1|  hypothetical protein [Leishmania brazilie...  90.5    8e-17  Gene info
ref|ZP_01748167.1|  SMC protein [Sagittula stellata E-37] >gb|...  90.5    8e-17 
ref|XP_001157707.1|  PREDICTED: SMC4 structural maintenance of...  90.5    8e-17  Gene info
ref|XP_001157958.1|  PREDICTED: SMC4 structural maintenance of...  90.5    8e-17  UniGene infoGene info
ref|XP_861558.1|  PREDICTED: similar to Structural maintenance...  90.5    8e-17  UniGene infoGene info
ref|XP_001591684.1|  hypothetical protein SS1G_07130 [Scleroti...  90.5    8e-17  Gene info
ref|YP_559333.1|  chromosome segregation protein SMC [Burkhold...  90.5    8e-17  Gene info
ref|XP_001378464.1|  PREDICTED: similar to structural maintena...  90.5    8e-17  UniGene infoGene info
ref|XP_001869924.1|  structural maintenance of chromosomes pro...  90.5    8e-17  UniGene infoGene info
ref|NP_663774.1|  Bartomin [Rattus norvegicus] >dbj|BAC02935.1...  90.5    8e-17  UniGene infoGene info
ref|YP_001353757.1|  chromosome segregation protein [Janthinob...  90.5    8e-17  Gene info
ref|XP_538049.2|  PREDICTED: similar to Structural maintenance...  90.5    8e-17  UniGene infoGene info
emb|CAD10419.2|  SMC protein [Burkholderia cepacia]                90.5    8e-17 
sp|Q9ERA5|SMC4_MICAR  Structural maintenance of chromosomes pr...  90.5    8e-17 
ref|ZP_03295298.1|  hypothetical protein COLINT_00995 [Collins...  90.5    8e-17 
ref|YP_001204095.1|  putative chromosome segregation SMC prote...  90.5    8e-17  Gene info
ref|YP_001361142.1|  chromosome segregation protein SMC [Kineo...  90.5    9e-17  Gene info
ref|XP_001482708.1|  hypothetical protein PGUG_04663 [Pichia g...  90.5    9e-17  Gene info
emb|CAJ84824.1|  structural maintenance of chromosome 4 protei...  90.5    9e-17 
ref|NP_738582.1|  putative chromosome segregation SMC protein ...  90.5    9e-17  Gene info
ref|NP_394249.1|  chromosome segregation protein related ptote...  90.5    9e-17  Gene info
gb|EDK40565.2|  hypothetical protein PGUG_04663 [Pichia guilli...  90.5    9e-17 
ref|YP_127872.1|  hypothetical protein lpl2543 [Legionella pne...  90.5    1e-16  Gene info
ref|YP_534216.1|  chromosome segregation protein SMC [Rhodopse...  90.5    1e-16  Gene info
ref|YP_124978.1|  hypothetical protein lpp2673 [Legionella pne...  90.1    1e-16  Gene info
ref|YP_001564609.1|  chromosome segregation protein SMC [Delft...  90.1    1e-16  Gene info
ref|YP_508316.1|  chromosome segregation protein SMC [Jannasch...  90.1    1e-16  Gene info
ref|XP_001229681.1|  hypothetical protein CHGG_03165 [Chaetomi...  90.1    1e-16  Gene info
gb|EDZ46322.1|  chromosome segregation protein SMC [Rhodobacte...  90.1    1e-16 
ref|XP_516851.2|  PREDICTED: SMC4 structural maintenance of ch...  90.1    1e-16  UniGene infoGene info
ref|NP_273590.1|  hypothetical protein NMB0545 [Neisseria meni...  90.1    1e-16  Gene info
emb|CAM23830.1|  structural maintenance of chromosomes 1A [Mus...  90.1    1e-16  Gene info
ref|YP_982045.1|  chromosome segregation protein SMC [Polaromo...  90.1    1e-16  Gene info
ref|XP_001937425.1|  structural maintenance of chromosomes pro...  90.1    1e-16  Gene info
ref|YP_096625.1|  chromosome segregation SMC protein [Legionel...  90.1    1e-16  Gene info
ref|XP_001066172.1|  PREDICTED: similar to SMC4 structural mai...  90.1    1e-16  UniGene infoGene info
ref|ZP_01125883.1|  hypothetical protein NB231_16138 [Nitrococ...  90.1    1e-16 
gb|EDX81766.1|  chromosome segregation protein SMC [Brevundimo...  90.1    1e-16 
ref|XP_001927540.1|  PREDICTED: similar to Structural maintena...  90.1    1e-16  UniGene infoGene info
sp|O93308.1|SMC1A_XENLA  RecName: Full=Structural maintenance ...  90.1    1e-16 
gb|EDL86308.1|  structural maintenance of chromosomes 1 like 1...  90.1    1e-16  Gene info
ref|YP_001249852.1|  chromosome segregation SMC protein [Legio...  90.1    1e-16  Gene info
ref|NP_113871.1|  SMC1 structural maintenance of chromosomes 1...  90.1    1e-16  UniGene infoGene info
ref|NP_777039.1|  structural maintenance of chromosomes 1A [Bo...  90.1    1e-16  UniGene infoGene info
ref|XP_001908056.1|  unnamed protein product [Podospora anseri...  90.1    1e-16  Gene info
ref|YP_001697253.1|  chromosome partition protein smc [Lysinib...  90.1    1e-16  Gene info
ref|NP_006297.2|  structural maintenance of chromosomes 1A [Ho...  90.1    1e-16  UniGene infoGene info
gb|AAB34405.1|  mitosis-specific chromosome segregation protei...  90.1    1e-16  Gene info
ref|YP_001994926.1|  chromosome segregation protein SMC [Chlor...  90.1    1e-16  Gene info
ref|NP_001080490.1|  SMC-like 1 [Xenopus laevis] >gb|AAH46691....  90.1    1e-16  UniGene infoGene info
ref|YP_001271752.1|  condensin subunit Smc [Lactobacillus reut...  90.1    1e-16  Gene info
ref|NP_001032262.2|  structural maintenance of chromosomes 4 [...  90.1    1e-16  Gene info
gb|EDY41648.1|  hypothetical protein TERMP_1496 [Thermococcus ...  90.1    1e-16 
ref|XP_861529.1|  PREDICTED: similar to Structural maintenance...  90.1    1e-16  UniGene infoGene info
ref|YP_001680740.1|  chromosome partition protein smc, putativ...  90.1    1e-16  Gene info
emb|CAC09587.1|  SMC4 protein [Microtus arvalis]                   90.1    1e-16 
ref|YP_001369173.1|  chromosome segregation protein SMC [Ochro...  89.7    1e-16  Gene info
ref|YP_001033025.1|  chromosome segregation protein smc [Lacto...  89.7    1e-16  Gene info
ref|YP_001896083.1|  chromosome segregation protein SMC [Burkh...  89.7    1e-16  Gene info
ref|ZP_02883297.1|  chromosome segregation protein SMC [Burkho...  89.7    1e-16 
gb|EDY90168.1|  chromosome segregation protein SMC [Octadecaba...  89.7    1e-16 
ref|NP_769136.1|  chromosome segregation protein [Bradyrhizobi...  89.7    1e-16  Gene info
ref|ZP_03270311.1|  chromosome segregation protein SMC [Burkho...  89.7    1e-16 
ref|XP_001952378.1|  PREDICTED: similar to structural maintena...  89.7    1e-16  UniGene infoGene info
emb|CAG31166.1|  hypothetical protein [Gallus gallus]              89.7    1e-16  Gene info
ref|XP_001463342.1|  structural maintenance of chromosome 3 pr...  89.7    1e-16  Gene info
ref|ZP_01739281.1|  chromosome segregation protein [Marinobact...  89.7    1e-16 
ref|NP_776720.1|  structural maintenance of chromosomes 3 [Bos...  89.7    1e-16  UniGene infoGene info
ref|NP_062684.1|  SMC1 structural maintenance of chromosomes 1...  89.7    1e-16  UniGene infoGene info
ref|XP_967679.1|  PREDICTED: similar to structural maintenance...  89.7    2e-16  UniGene infoGene info
gb|AAL32275.1|  chromosome segregation protein [Arcanobacteriu...  89.7    2e-16 
ref|YP_208497.1|  hypothetical protein NGO1443 [Neisseria gono...  89.7    2e-16  Gene info
ref|XP_001681030.1|  structural maintenance of chromosome 3 pr...  89.7    2e-16  Gene info
gb|EAW93151.1|  SMC1 structural maintenance of chromosomes 1-l...  89.4    2e-16  Gene info
ref|XP_001511311.1|  PREDICTED: similar to structural maintena...  89.4    2e-16  UniGene infoGene info
ref|XP_001832128.1|  hypothetical protein CC1G_10710 [Coprinop...  89.4    2e-16  Gene info
ref|ZP_01447201.1|  SMC protein [alpha proteobacterium HTCC225...  89.4    2e-16 
ref|YP_001156235.1|  chromosome segregation protein SMC [Polyn...  89.4    2e-16  Gene info
ref|YP_002000193.1|  chromosome segregation ATPase Smc [Mycopl...  89.4    2e-16  Gene info
ref|YP_002002328.1|  hypothetical protein NGK_1703 [Neisseria ...  89.4    2e-16  Gene info
ref|NP_596049.1|  mitotic cohesin complex subunit Psm1 (PMID 1...  89.4    2e-16  UniGene infoGene info
ref|XP_001904694.1|  unnamed protein product [Podospora anseri...  89.4    2e-16  Gene info
dbj|BAC76893.1|  SMC1 alpha [Oryzias latipes]                      89.4    2e-16  Gene info
ref|YP_614581.1|  chromosome segregation protein SMC [Siliciba...  89.4    2e-16  Gene info
ref|XP_001652359.1|  structural maintenance of chromosomes smc...  89.4    2e-16  UniGene infoGene info
ref|XP_001791407.1|  hypothetical protein SNOG_00730 [Phaeosph...  89.4    2e-16  Gene info
ref|XP_001319034.1|  SMC flexible hinge domain protein [Tricho...  89.4    2e-16  Gene info
ref|NP_598547.1|  structural maintenance of chromosomes 4 [Mus...  89.4    2e-16  UniGene infoGene info
gb|AAH61481.1|  Smc4 protein [Mus musculus]                        89.4    2e-16  Gene info
ref|ZP_02188942.1|  Chromosome segregation ATPase [alpha prote...  89.0    2e-16 
gb|EDZ40844.1|  chromosome segregation protein SMC [Rhodobacte...  89.0    2e-16 
ref|YP_974585.1|  hypothetical protein NMC0484 [Neisseria meni...  89.0    2e-16  Gene info
ref|YP_001411979.1|  chromosome segregation protein SMC [Parvi...  89.0    2e-16  Gene info
ref|XP_001310542.1|  SMC family, C-terminal domain containing ...  89.0    2e-16  Gene info
ref|XP_001738713.1|  structural maintenance of chromosomes pro...  89.0    2e-16  Gene info
ref|YP_757429.1|  condensin subunit Smc [Maricaulis maris MCS1...  89.0    3e-16  Gene info
ref|ZP_00945827.1|  Smc [Ralstonia solanacearum UW551] >ref|YP...  89.0    3e-16 
ref|XP_538328.2|  PREDICTED: similar to SMC1 structural mainte...  89.0    3e-16  UniGene infoGene info
ref|XP_002054950.1|  GJ19101 [Drosophila virilis] >gb|EDW65151...  89.0    3e-16  Gene info
ref|NP_283523.1|  hypothetical protein NMA0724 [Neisseria meni...  89.0    3e-16  Gene info
ref|XP_001245836.1|  hypothetical protein CIMG_05277 [Coccidio...  89.0    3e-16  Gene info
ref|ZP_03072479.1|  chromosome segregation protein SMC [Lactob...  88.6    3e-16 
ref|XP_002011631.1|  GI10989 [Drosophila mojavensis] >gb|EDW05...  88.6    3e-16  Gene info
ref|YP_001920587.1|  chromosome segregation protein SMC [Clost...  88.6    3e-16  Gene info
gb|EDL07476.1|  structural maintenance of chromosomes 1A, isof...  88.6    3e-16  Gene info
ref|NP_266960.1|  hypothetical protein L12942 [Lactococcus lac...  88.6    3e-16  Gene info
ref|XP_001354674.2|  GA22046 [Drosophila pseudoobscura pseudoo...  88.6    3e-16  Gene info
ref|ZP_01726069.1|  Smc [Bacillus sp. B14905] >gb|EAZ83417.1| ...  88.6    3e-16 
ref|XP_002100825.1|  GE15959 [Drosophila yakuba] >gb|EDX01933....  88.6    3e-16  Gene info
ref|YP_001308310.1|  chromosome segregation protein SMC [Clost...  88.6    3e-16  Gene info
ref|YP_572757.1|  chromosome segregation protein SMC [Chromoha...  88.6    3e-16  Gene info
ref|NP_606790.1|  putative chromosome segregation SMC [Strepto...  88.6    4e-16  Gene info
ref|NP_268806.1|  putative chromosome segregation SMC protein ...  88.6    4e-16  Gene info
ref|YP_059791.1|  chromosome partition protein smc [Streptococ...  88.6    4e-16  Gene info
ref|YP_343697.1|  chromosome segregation protein SMC [Nitrosoc...  88.6    4e-16  Gene info
gb|AAC47078.1|  Cap                                                88.2    4e-16 
ref|YP_001128952.1|  putative chromosome partition protein [St...  88.2    4e-16  Gene info
ref|YP_598049.1|  chromosome partition protein smc [Streptococ...  88.2    4e-16  Gene info
ref|YP_601953.1|  Chromosome partition protein smc [Streptococ...  88.2    4e-16  Gene info
ref|YP_284949.1|  chromosome segregation protein SMC [Dechloro...  88.2    4e-16  Gene info
ref|NP_961924.1|  hypothetical protein MAP2990c [Mycobacterium...  88.2    4e-16  Gene info
pir||T34063  chromosome segregation protein smc1 F28B3.7 [simi...  88.2    4e-16 
ref|ZP_01055822.1|  SMC protein [Roseobacter sp. MED193] >gb|E...  88.2    4e-16 
ref|XP_001995612.1|  GH17849 [Drosophila grimshawi] >gb|EDV952...  88.2    4e-16  Gene info
ref|XP_001977456.1|  GG18245 [Drosophila erecta] >gb|EDV46383....  88.2    4e-16  Gene info
ref|ZP_01741982.1|  Chromosome segregation protein SMC2 [Rhodo...  88.2    4e-16 
ref|ZP_01001921.1|  SMC protein [Loktanella vestfoldensis SKA5...  88.2    4e-16 
ref|NP_001040658.2|  High Incidence of Males (increased X chro...  88.2    4e-16  UniGene infoGene info
ref|XP_001256619.2|  PREDICTED: similar to SMC1 structural mai...  88.2    4e-16  UniGene infoGene info
ref|XP_001488422.2|  PREDICTED: structural maintenance of chro...  88.2    4e-16  UniGene infoGene info
ref|XP_002042264.1|  GM13388 [Drosophila sechellia] >gb|EDW461...  88.2    4e-16  Gene info
ref|XP_001851491.1|  structural maintenance of chromosomes smc...  88.2    5e-16  UniGene infoGene info
ref|NP_523374.2|  Chromosome-associated protein CG9802-PA, iso...  88.2    5e-16  UniGene infoGene info
ref|YP_825673.1|  condensin subunit Smc [Solibacter usitatus E...  88.2    5e-16  Gene info
gb|AAZ41776.1|  RE14758p [Drosophila melanogaster]                 87.8    5e-16 
ref|ZP_00366640.1|  COG1196: Chromosome segregation ATPases [S...  87.8    5e-16 
ref|YP_001598641.1|  hypothetical protein NMCC_0486 [Neisseria...  87.8    5e-16  Gene info
ref|YP_002285475.1|  Putative chromosome segregation SMC [Stre...  87.8    5e-16  Gene info
emb|CAL55371.1|  putative chromosome associated protein (ISS) ...  87.8    5e-16 
ref|YP_279896.1|  chromosome partition protein smc [Streptococ...  87.8    5e-16  Gene info
ref|YP_002250664.1|  chromosome segregation SMC protein, putat...  87.8    5e-16  Gene info
gb|AAT12296.1|  chromosome segregation protein [Antonospora lo...  87.8    5e-16 
ref|XP_001260867.1|  chromosome segregation protein SudA, puta...  87.8    5e-16  Gene info
ref|XP_808025.1|  structural maintenance of chromosome protein...  87.8    6e-16  Gene info
ref|ZP_00997125.1|  putative chromosome associated protein [Ja...  87.8    6e-16 
ref|YP_194157.1|  chromosome segregation protein Smc [Lactobac...  87.8    6e-16  Gene info
ref|YP_882949.1|  chromosome segregation protein SMC [Mycobact...  87.8    6e-16  Gene info
ref|XP_755741.1|  chromosome segregation protein SudA [Aspergi...  87.8    6e-16  Gene info
ref|ZP_01514193.1|  Chromosome segregation protein SMC [Chloro...  87.8    6e-16 
ref|XP_843456.1|  structural maintenance of chromosome (SMC) f...  87.8    6e-16  Gene info
sp|O93309.1|SMC3_XENLA  RecName: Full=Structural maintenance o...  87.8    6e-16  Gene info
ref|YP_296097.1|  chromosome segregation protein SMC [Ralstoni...  87.4    6e-16  Gene info
ref|XP_002129062.1|  PREDICTED: similar to structural maintena...  87.4    6e-16  UniGene infoGene info
ref|ZP_00144637.1|  Chromosome partition protein smc [Fusobact...  87.4    7e-16 
emb|CAQ09092.1|  structural maintenance of chromosomes 1B [Hom...  87.4    7e-16 
ref|XP_001465422.1|  hypothetical protein [Leishmania infantum...  87.4    7e-16  Gene info
dbj|BAC86266.1|  unnamed protein product [Homo sapiens]            87.4    7e-16  Gene info
ref|ZP_01998047.1|  chromosome segregation protein SMC [Beggia...  87.4    7e-16 
ref|XP_001683086.1|  hypothetical protein [Leishmania major st...  87.4    7e-16  Gene info
ref|ZP_02009026.1|  chromosome segregation protein SMC [Ralsto...  87.4    7e-16 
ref|NP_664180.1|  putative chromosome condensation and segrega...  87.4    8e-16  Gene info
ref|NP_727988.1|  Chromosome-associated protein CG9802-PB, iso...  87.4    8e-16  UniGene infoGene info
ref|YP_001222102.1|  putative chromosome segregation ATPase [C...  87.4    8e-16  Gene info
ref|XP_654748.1|  SMC4 protein [Entamoeba histolytica HM-1:IMS...  87.4    8e-16  Gene info
ref|XP_001946952.1|  PREDICTED: similar to SMC2 protein [Acyrt...  87.4    8e-16  UniGene infoGene info
ref|YP_001898846.1|  chromosome segregation protein SMC [Ralst...  87.4    8e-16  Gene info
ref|XP_001802873.1|  hypothetical protein SNOG_12652 [Phaeosph...  87.4    8e-16  Gene info
ref|NP_604026.1|  chromosome partition protein smc [Fusobacter...  87.4    8e-16  Gene info
gb|EAW73381.1|  SMC1 structural maintenance of chromosomes 1-l...  87.0    8e-16  Gene info
ref|YP_596170.1|  chromosome partition protein [Streptococcus ...  87.0    8e-16  Gene info
ref|XP_001109647.1|  PREDICTED: similar to SMC1 structural mai...  87.0    9e-16  UniGene infoGene info
sp|Q8NDV3.2|SMC1B_HUMAN  RecName: Full=Structural maintenance ...  87.0    9e-16  Gene info
emb|CAD43404.2|  SMC1beta protein [Homo sapiens]                   87.0    9e-16  Gene info
ref|ZP_01753752.1|  SMC protein [Roseobacter sp. SK209-2-6] >g...  87.0    9e-16 
ref|XP_001656789.1|  structural maintenance of chromosomes smc...  87.0    9e-16  UniGene infoGene info
ref|ZP_02145626.1|  Chromosome segregation protein SMC [Phaeob...  87.0    9e-16 
gb|EAW73383.1|  SMC1 structural maintenance of chromosomes 1-l...  87.0    9e-16  Gene info
ref|XP_001964287.1|  GF21472 [Drosophila ananassae] >gb|EDV347...  87.0    9e-16  Gene info
ref|ZP_00998591.1|  SMC protein [Oceanicola batsensis HTCC2597...  87.0    9e-16 
ref|YP_002164913.1|  chromosome segregation ATPase [Fusobacter...  87.0    1e-15  Gene info
gb|AAL23959.1|AF426167_1  SMC protein [Lactococcus lactis] >em...  87.0    1e-15 
ref|NP_001027796.1|  SMC2 protein [Takifugu rubripes] >emb|CAD...  87.0    1e-15  UniGene infoGene info
ref|NP_683515.3|  SMC1 structural maintenance of chromosomes 1...  87.0    1e-15  UniGene infoGene info
ref|XP_820569.1|  structural maintenance of chromosome protein...  87.0    1e-15  Gene info
ref|XP_503989.1|  YALI0E15620p [Yarrowia lipolytica] >emb|CAG7...  87.0    1e-15  Gene info
ref|ZP_01771131.1|  Hypothetical protein COLAER_00104 [Collins...  86.7    1e-15 
ref|ZP_02152105.1|  chromosome segregation protein, putative [...  86.7    1e-15 
ref|ZP_02151177.1|  SMC protein [Phaeobacter gallaeciensis 2.1...  86.7    1e-15 
ref|XP_808655.1|  structural maintenance of chromosome (SMC) f...  86.7    1e-15  Gene info
ref|XP_001275744.1|  chromosome segregation protein SudA, puta...  86.7    1e-15  Gene info
ref|ZP_03285912.1|  SMC domain protein [Dictyoglomus turgidum ...  86.7    1e-15 
ref|YP_001709512.1|  putative chromosome structure maintenance...  86.7    1e-15  Gene info
ref|XP_001941501.1|  condensin subunit [Pyrenophora tritici-re...  86.7    1e-15  Gene info
ref|XP_817950.1|  structural maintenance of chromosome (SMC) f...  86.7    1e-15  Gene info
ref|XP_001883374.1|  condensin complex subunit SMC2 [Laccaria ...  86.3    1e-15  Gene info
ref|XP_786064.2|  PREDICTED: hypothetical protein [Strongyloce...  86.3    2e-15  UniGene infoGene info
ref|YP_579617.1|  SMC protein-like [Psychrobacter cryohalolent...  86.3    2e-15  Gene info
gb|EEA27333.1|  chromosome segregation protein SudA, putative ...  86.3    2e-15 
ref|XP_446916.1|  unnamed protein product [Candida glabrata] >...  86.3    2e-15  Gene info
ref|XP_001943757.1|  PREDICTED: similar to structural maintena...  86.3    2e-15  UniGene infoGene info
ref|XP_002107124.1|  GD15741 [Drosophila simulans] >gb|EDX1810...  86.3    2e-15  Gene info
ref|ZP_00960348.1|  SMC protein [Roseovarius nubinhibens ISM] ...  86.3    2e-15 
ref|XP_001948129.1|  PREDICTED: similar to structural maintena...  85.9    2e-15  UniGene infoGene info
ref|YP_002005706.1|  Chromosome segregation protein SMC [Cupri...  85.9    2e-15  Gene info
ref|YP_002093888.1|  conserved hypothetical protein [Burkholde...  85.9    2e-15  Gene info
ref|YP_726530.1|  chromosome segregation ATPase [Ralstonia eut...  85.9    2e-15  Gene info
ref|XP_760536.1|  hypothetical protein UM04389.1 [Ustilago may...  85.9    2e-15  Gene info
ref|XP_395059.2|  PREDICTED: similar to SMC1 CG6057-PA isoform...  85.9    2e-15  UniGene infoGene info
ref|ZP_01016290.1|  chromosome segregation protein [Parvularcu...  85.9    2e-15 
ref|NP_696518.1|  chromosome partitioning protein Smc [Bifidob...  85.9    2e-15  Gene info
ref|XP_001469160.1|  structural maintenance of chromosome (SMC...  85.9    2e-15  Gene info
emb|CAM75626.1|  Chromosome segregation protein SMC [Magnetosp...  85.9    2e-15 
ref|XP_957879.2|  hypothetical protein NCU07554 [Neurospora cr...  85.9    2e-15  UniGene infoGene info
ref|ZP_00957683.1|  smc protein [Oceanicaulis alexandrii HTCC2...  85.9    2e-15 
ref|XP_001135642.1|  PREDICTED: SMC1 structural maintenance of...  85.9    2e-15  UniGene infoGene info
ref|YP_583578.1|  condensin subunit Smc [Ralstonia metallidura...  85.9    2e-15  Gene info
ref|XP_515195.2|  PREDICTED: SMC1 structural maintenance of ch...  85.5    2e-15  UniGene infoGene info
ref|YP_001568377.1|  SMC domain-containing protein [Petrotoga ...  85.5    3e-15  Gene info
ref|XP_663968.1|  hypothetical protein AN6364.2 [Aspergillus n...  85.5    3e-15  Gene info
ref|XP_955001.1|  chromosome segregation (SMC) protein [Theile...  85.5    3e-15  Gene info
ref|YP_001831884.1|  chromosome segregation protein SMC [Beije...  85.5    3e-15  Gene info
sp|Q00737.1|SUDA_EMENI  RecName: Full=Chromosome segregation p...  85.5    3e-15 
ref|XP_764044.1|  condensin subunit [Theileria parva strain Mu...  85.5    3e-15  Gene info
ref|XP_001838399.1|  hypothetical protein CC1G_12491 [Coprinop...  85.5    3e-15  Gene info
ref|XP_001885795.1|  condensin complex subunit SMC1 [Laccaria ...  85.5    3e-15  Gene info
ref|YP_263621.1|  condensin subunit Smc [Psychrobacter arcticu...  85.5    3e-15  Gene info
ref|ZP_02062438.1|  chromosome segregation protein SMC [Ricket...  85.5    3e-15 
ref|YP_002123739.1|  chromosome partition protein Smc [Strepto...  85.1    3e-15  Gene info
ref|ZP_03226146.1|  chromosome segregation protein Smc [Bacill...  85.1    3e-15 
ref|YP_001529600.1|  chromosome segregation protein SMC [Desul...  85.1    3e-15  Gene info
ref|ZP_01625247.1|  chromosome segregation protein [marine gam...  85.1    3e-15 
ref|XP_001603761.1|  PREDICTED: similar to Smc1l1 protein [Nas...  85.1    4e-15  Gene info
ref|XP_001399622.1|  hypothetical protein An02g04840 [Aspergil...  85.1    4e-15  Gene info
ref|XP_385281.1|  hypothetical protein FG05105.1 [Gibberella z...  85.1    4e-15  Gene info
ref|YP_001624922.1|  chromosome segregation protein [Renibacte...  85.1    4e-15  Gene info
emb|CAD59410.1|  SMC2 protein [Oryza sativa]                       85.1    4e-15 
ref|XP_393523.3|  PREDICTED: similar to Collagen alpha-1(II) c...  85.1    4e-15  UniGene infoGene info
ref|NP_001045123.1|  Os01g0904400 [Oryza sativa (japonica cult...  84.7    4e-15  UniGene infoGene info
ref|NP_721858.1|  putative chromosome segregation ATPase; SMC ...  84.7    4e-15  Gene info
ref|XP_953074.1|  chromosome segregation protein (SMC homologu...  84.7    4e-15  Gene info
ref|XP_001932326.1|  structural maintenance of chromosomes pro...  84.7    4e-15  Gene info
emb|CAG07438.1|  unnamed protein product [Tetraodon nigroviridis]  84.7    5e-15 
ref|XP_002116802.1|  hypothetical protein TRIADDRAFT_64300 [Tr...  84.7    5e-15  Gene info
ref|XP_002119958.1|  PREDICTED: similar to XCAP-E [Ciona intes...  84.7    5e-15  UniGene infoGene info
ref|YP_820650.1|  chromosome segregation SMC protein [Streptoc...  84.7    5e-15  Gene info
ref|ZP_03040885.1|  SMC domain protein [Geobacillus sp. Y412MC...  84.7    5e-15 
ref|XP_002074875.1|  GK23290 [Drosophila willistoni] >gb|EDW85...  84.7    5e-15  Gene info
ref|XP_001568450.1|  structural maintenance of chromosome (SMC...  84.7    5e-15  Gene info
emb|CAP80909.1|  Pc12g12820 [Penicillium chrysogenum Wisconsin...  84.7    5e-15 
ref|YP_001797379.1|  chromosome segregation protein SMC [Polyn...  84.3    6e-15  Gene info
ref|YP_139741.1|  chromosome segregation SMC protein [Streptoc...  84.3    6e-15  Gene info
ref|ZP_00120652.1|  COG1196: Chromosome segregation ATPases [B...  84.3    6e-15  Gene info
ref|XP_001484608.1|  hypothetical protein PGUG_02337 [Pichia g...  84.3    6e-15  Gene info
ref|YP_141653.1|  chromosome segregation SMC protein [Streptoc...  84.3    6e-15  Gene info
gb|EDK38239.2|  hypothetical protein PGUG_02337 [Pichia guilli...  84.3    7e-15 
ref|YP_001394788.1|  hypothetical protein CKL_1398 [Clostridiu...  84.3    7e-15  Gene info
ref|YP_360275.1|  chromosome segregation protein SMC [Carboxyd...  84.3    7e-15  Gene info
ref|YP_008486.1|  putative chromosome segregation SMC protein ...  84.3    7e-15  Gene info
ref|NP_903578.1|  chromosome segregation protein [Chromobacter...  84.3    7e-15  Gene info
ref|XP_974026.1|  PREDICTED: similar to SMC2 protein [Triboliu...  84.0    7e-15  UniGene infoGene info
emb|CAB10595.1|  hypothetical protein MLCB250.01 [Mycobacteriu...  84.0    7e-15 
ref|NP_990561.1|  structural maintenance of chromosomes 2-like...  84.0    8e-15  UniGene infoGene info
ref|YP_053473.1|  structural maintenance of chromosomes smc su...  84.0    8e-15  Gene info
ref|YP_496234.1|  chromosome segregation protein SMC [Novosphi...  84.0    8e-15  Gene info
ref|YP_445024.1|  chromosome segregation protein SMC [Saliniba...  84.0    9e-15  Gene info
ref|YP_001279372.1|  SMC domain-containing protein [Psychrobac...  83.6    1e-14  Gene info
gb|EDZ71291.1|  YJL074Cp-like protein [Saccharomyces cerevisia...  83.6    1e-14 
ref|XP_359789.1|  hypothetical protein MGG_04988 [Magnaporthe ...  83.6    1e-14  UniGene infoGene info
gb|EDN63502.1|  structural maintenance of chromosomes [Sacchar...  83.6    1e-14 
ref|NP_201047.1|  SMC2 (STRUCTURAL MAINTENANCE OF CHROMOSOMES ...  83.6    1e-14  UniGene infoGene info
gb|EDV12690.1|  structural maintenance of chromosome 3 [Saccha...  83.6    1e-14 
gb|AAK58634.1|AF271731_1  SMC2-like condensin [Arabidopsis tha...  83.6    1e-14 
gb|AAG53093.1|AF306547_1  SMC2-1 [Arabidopsis thaliana]            83.6    1e-14 
emb|CAP37488.1|  C. briggsae CBR-HIM-1 protein [Caenorhabditis...  83.6    1e-14 
ref|NP_012461.1|  Subunit of the multiprotein cohesin complex ...  83.6    1e-14  UniGene infoGene info
ref|XP_001821632.1|  hypothetical protein [Aspergillus oryzae ...  83.2    1e-14  Gene info
ref|YP_001527174.1|  chromosome segregation protein [Azorhizob...  83.2    1e-14  Gene info
ref|XP_001384551.2|  Chromosome segregation and condensation [...  83.2    1e-14  Gene info
ref|YP_001773610.1|  chromosome segregation protein SMC [Methy...  83.2    1e-14  Gene info
ref|XP_001762053.1|  condensin complex component SMC2 [Physcom...  83.2    1e-14  UniGene infoGene info
ref|XP_962321.1|  hypothetical protein NCU07679 [Neurospora cr...  83.2    1e-14  UniGene infoGene info
emb|CAQ41959.1|  chromosome segregation protein, putative [Pla...  83.2    1e-14 
ref|ZP_00780442.1|  SMC protein [Streptococcus agalactiae 18RS...  83.2    2e-14 
ref|YP_001636511.1|  chromosome segregation protein SMC [Chlor...  82.8    2e-14  Gene info
ref|XP_570201.1|  chromosome associated protein [Cryptococcus ...  82.8    2e-14  Gene info
ref|YP_001233543.1|  chromosome segregation protein SMC [Acidi...  82.8    2e-14  Gene info
ref|XP_001527295.1|  conserved hypothetical protein [Lodderomy...  82.8    2e-14  Gene info
emb|CAG01298.1|  unnamed protein product [Tetraodon nigroviridis]  82.8    2e-14 
ref|ZP_01302699.1|  Chromosome segregation protein SMC [Sphing...  82.4    2e-14 
ref|YP_001209519.1|  chromosome segregation SMC family protein...  82.4    2e-14  Gene info
ref|XP_001581334.1|  SMC flexible hinge domain protein [Tricho...  82.4    2e-14  Gene info
ref|XP_001617111.1|  structural maintenance of chromosome 2 [P...  82.4    2e-14  Gene info
ref|ZP_02117884.1|  chromosome segregation protein SMC [Methyl...  82.4    2e-14 
ref|YP_001685991.1|  chromosome segregation protein SMC [Caulo...  82.4    2e-14  Gene info
ref|XP_001208764.1|  chromosome segregation protein sudA [Aspe...  82.4    3e-14  Gene info
ref|XP_001561855.1|  structural maintenance of chromosome (SMC...  82.0    3e-14  Gene info
ref|XP_445638.1|  unnamed protein product [Candida glabrata] >...  82.0    3e-14  Gene info
ref|XP_001399441.1|  hypothetical protein An02g03010 [Aspergil...  82.0    3e-14  Gene info
ref|XP_643274.1|  structural maintenance of chromosome protein...  82.0    3e-14  UniGene infoGene info
gb|ABK95236.1|  unknown [Populus trichocarpa]                      82.0    3e-14 
gb|AAS38749.1|  similar to Arabidopsis thaliana (Mouse-ear cre...  82.0    3e-14 
ref|XP_761982.1|  hypothetical protein UM05835.1 [Ustilago may...  82.0    3e-14  Gene info
ref|NP_190330.1|  ATSMC2 (Arabidopsis thaliana structural main...  82.0    3e-14  UniGene infoGene info
ref|ZP_01092552.1|  chromosome partition protein Smc [Blastopi...  81.6    4e-14 
ref|XP_001240817.1|  hypothetical protein CIMG_07980 [Coccidio...  81.6    4e-14  Gene info
ref|YP_001844053.1|  chromosome segregation protein [Lactobaci...  81.6    4e-14  Gene info
ref|XP_001223915.1|  conserved hypothetical protein [Chaetomiu...  81.6    4e-14  Gene info
gb|AAN77000.1|  condensin subunit [Aspergillus nidulans]           81.3    5e-14 
ref|XP_001329543.1|  SMC family, C-terminal domain containing ...  81.3    5e-14  Gene info
ref|YP_001130975.1|  chromosome segregation protein SMC [Prost...  81.3    5e-14  Gene info
ref|YP_002219356.1|  chromosome segregation protein SMC [Acidi...  81.3    5e-14  Gene info
emb|CAD66591.1|  SMC protein [Acidithiobacillus ferrooxidans]      81.3    5e-14 
ref|XP_001986535.1|  GH20475 [Drosophila grimshawi] >gb|EDW014...  81.3    5e-14  Gene info
ref|XP_572171.1|  nuclear condensin complex protein [Cryptococ...  81.3    5e-14  UniGene infoGene info
ref|YP_617312.1|  chromosome segregation protein SMC [Sphingop...  81.3    6e-14  Gene info
ref|XP_001349920.1|  chromosome segregation protein [Plasmodiu...  81.3    6e-14  UniGene infoGene info
gb|EEA94091.1|  chromosome segregation protein SMC [Pseudovibr...  81.3    6e-14 
ref|XP_001546997.1|  hypothetical protein BC1G_14462 [Botryoti...  81.3    6e-14  Gene info
ref|XP_774556.1|  hypothetical protein CNBG0520 [Cryptococcus ...  81.3    6e-14  UniGene infoGene info
ref|XP_001334257.1|  PREDICTED: similar to meiosis-specific co...  80.9    6e-14  UniGene infoGene info
ref|XP_001592183.1|  hypothetical protein SS1G_06422 [Scleroti...  80.9    6e-14  Gene info
ref|YP_375574.1|  chromosome segregation protein SMC [Pelodict...  80.9    6e-14  Gene info
ref|YP_945059.1|  chromosome partition protein Smc [Borrelia t...  80.9    7e-14  Gene info
ref|ZP_00785828.1|  chromosome segregation SMC protein [Strept...  80.9    7e-14 
ref|XP_001541765.1|  chromosome segregation protein sudA [Ajel...  80.9    7e-14  Gene info
ref|XP_802184.1|  structural maintenance of chromosome 3 prote...  80.9    8e-14  Gene info
emb|CAF89403.1|  unnamed protein product [Tetraodon nigroviridis]  80.9    8e-14 
ref|XP_741083.1|  hypothetical protein [Plasmodium chabaudi ch...  80.5    8e-14  Gene info
ref|ZP_01040214.1|  SMC protein [Erythrobacter sp. NAP1] >gb|E...  80.5    8e-14 
ref|NP_687739.1|  chromosome segregation SMC protein [Streptoc...  80.5    8e-14  Gene info
gb|ABV27312.1|  chromosome segregation protein SMC [Candidatus...  80.5    8e-14 
ref|XP_416467.2|  PREDICTED: similar to OTTHUMP00000028953 [Ga...  80.5    9e-14  UniGene infoGene info
emb|CAP82954.1|  Pc15g00680 [Penicillium chrysogenum Wisconsin...  80.5    9e-14 
ref|XP_663503.1|  hypothetical protein AN5899.2 [Aspergillus n...  80.5    9e-14  Gene info
sp|P41508.2|P115_MYCHR  RecName: Full=Protein P115 >gb|AAA2542...  80.5    9e-14 
ref|XP_367173.1|  hypothetical protein MGG_07098 [Magnaporthe ...  80.1    1e-13  UniGene infoGene info
ref|ZP_00783470.1|  reticulocyte binding protein [Streptococcu...  80.1    1e-13 
ref|XP_729582.1|  hypothetical protein [Plasmodium yoelii yoel...  80.1    1e-13  Gene info
ref|XP_780691.2|  PREDICTED: similar to chondroitin sulfate pr...  80.1    1e-13  UniGene infoGene info
ref|YP_745685.1|  chromosome partition protein smc [Granulibac...  80.1    1e-13  Gene info
emb|CAI39061.1|  Structural maintenance of chromosomes 1 [Para...  80.1    1e-13 
ref|XP_001426830.1|  hypothetical protein [Paramecium tetraure...  80.1    1e-13  Gene info
ref|XP_001347988.1|  structural maintenance of chromosome prot...  80.1    1e-13  Gene info
ref|XP_001821985.1|  hypothetical protein [Aspergillus oryzae ...  80.1    1e-13  Gene info
ref|XP_655216.2|  hypothetical protein [Entamoeba histolytica ...  80.1    1e-13  Gene info
ref|XP_499623.1|  YALI0A00616p [Yarrowia lipolytica] >emb|CAG8...  80.1    1e-13  Gene info
ref|ZP_02921021.1|  hypothetical protein STRINF_01905 [Strepto...  80.1    1e-13 
ref|XP_676012.1|  chromosome segregation protein [Plasmodium b...  80.1    1e-13  Gene info
ref|YP_001883489.1|  chromosome partition protein Smc [Borreli...  80.1    1e-13  Gene info
ref|XP_001793818.1|  hypothetical protein SNOG_03248 [Phaeosph...  80.1    1e-13  Gene info
emb|CAD59411.1|  SMC3 protein [Oryza sativa]                       80.1    1e-13 
ref|XP_554796.1|  AGAP011425-PA [Anopheles gambiae str. PEST] ...  79.7    1e-13  UniGene infoGene info
ref|YP_428330.1|  condensin subunit Smc [Rhodospirillum rubrum...  79.7    1e-13  Gene info
ref|XP_001647619.1|  structural maintenance of chromosomes smc...  79.7    1e-13  UniGene infoGene info
ref|NP_497771.1|  DumPY : shorter than wild-type family member...  79.7    1e-13  UniGene infoGene info
ref|XP_002006386.1|  GI21017 [Drosophila mojavensis] >gb|EDW10...  79.7    1e-13  Gene info
ref|YP_760618.1|  chromosome segregation protein SMC [Hyphomon...  79.7    1e-13  Gene info
ref|XP_001158758.1|  PREDICTED: hypothetical protein [Pan trog...  79.7    1e-13  UniGene infoGene info
gb|ABQ22510.1|  structural maintenance of chromosomes protein ...  79.7    2e-13 
ref|YP_192395.1|  chromosome partition protein Smc [Gluconobac...  79.7    2e-13  Gene info
gb|AAO85524.1|  putative structural maintenance of chromosome ...  79.7    2e-13 
ref|XP_002050077.1|  GJ21940 [Drosophila virilis] >gb|EDW61270...  79.7    2e-13  Gene info
ref|XP_001384254.1|  hypothetical protein PICST_44736 [Pichia ...  79.7    2e-13  Gene info
ref|XP_001862294.1|  structural maintenance of chromosomes pro...  79.7    2e-13  UniGene infoGene info
ref|XP_001419553.1|  predicted protein [Ostreococcus lucimarin...  79.3    2e-13  Gene info
ref|XP_001641659.1|  predicted protein [Nematostella vectensis...  79.3    2e-13  UniGene infoGene info
ref|XP_001208831.1|  hypothetical protein ATEG_01466 [Aspergil...  79.3    2e-13  Gene info
ref|YP_002221713.1|  P115 protein [Borrelia duttonii Ly] >ref|...  79.3    2e-13  Gene info
ref|XP_001887574.1|  structural maintenance of chromosome prot...  79.3    2e-13  Gene info
gb|AAZ38324.1|  unknown [Schistosoma japonicum]                    79.3    2e-13 
ref|YP_001505505.1|  chromosome segregation protein SMC [Frank...  79.3    2e-13  Gene info
dbj|BAD08001.1|  putative SMC3 protein [Oryza sativa Japonica ...  79.0    2e-13 
ref|NP_596180.1|  condensin subunit Cut14 [Schizosaccharomyces...  79.0    2e-13  UniGene infoGene info
ref|XP_714514.1|  potential nuclear condensin complex SMC ATPa...  79.0    2e-13  Gene info
ref|XP_001975577.1|  GG22392 [Drosophila erecta] >gb|EDV55977....  79.0    2e-13  Gene info
ref|XP_001836099.1|  hypothetical protein CC1G_12258 [Coprinop...  79.0    2e-13  Gene info
ref|NP_982360.1|  AAL182Wp [Ashbya gossypii ATCC 10895] >gb|AA...  79.0    2e-13  UniGene infoGene info
ref|XP_002091365.1|  GE12281 [Drosophila yakuba] >gb|EDW91077....  79.0    3e-13  Gene info
ref|XP_720093.1|  potential nuclear cohesin complex SMC ATPase...  79.0    3e-13  Gene info
ref|XP_557814.2|  AGAP008672-PA [Anopheles gambiae str. PEST] ...  79.0    3e-13  Gene info
ref|XP_001651465.1|  structural maintenance of chromosomes smc...  79.0    3e-13  UniGene infoGene info
ref|XP_001275402.1|  nuclear condensin complex subunit Smc2, p...  79.0    3e-13  Gene info
ref|YP_001265169.1|  chromosome segregation protein SMC [Sphin...  79.0    3e-13  Gene info
ref|NP_001045803.1|  Os02g0133300 [Oryza sativa (japonica cult...  79.0    3e-13  UniGene infoGene info
ref|YP_482678.1|  chromosome segregation protein SMC [Frankia ...  79.0    3e-13  Gene info
ref|XP_001741701.1|  DNA double-strand break repair Rad50 ATPa...  79.0    3e-13  Gene info
gb|ABD83934.1|  mitosis-specific chromosome segregation protei...  79.0    3e-13 
ref|NP_326545.1|  ABC transporter ATP-binding protein [Mycopla...  79.0    3e-13  Gene info
ref|XP_678444.1|  structural maintenance of chromosome protein...  79.0    3e-13  Gene info
ref|XP_815055.1|  structural maintenance of chromosome 3 prote...  78.6    3e-13  Gene info
ref|XP_755444.1|  nuclear condensin complex subunit Smc2 [Aspe...  78.6    3e-13  Gene info
ref|XP_001260582.1|  nuclear condensin complex subunit Smc2, p...  78.6    3e-13  Gene info
ref|XP_001737430.1|  structural maintenance of chromosomes pro...  78.6    3e-13  Gene info
ref|ZP_01544929.1|  chromosome segregation SMC protein [Oenoco...  78.6    3e-13 
ref|YP_810076.1|  condensin subunit Smc [Oenococcus oeni PSU-1...  78.6    3e-13  Gene info
ref|YP_002274481.1|  SMC domain protein [Gluconacetobacter dia...  78.6    3e-13  Gene info
ref|YP_001602082.1|  putative chromosome segregation protein S...  78.6    3e-13  Gene info
ref|XP_001914031.1|  hypothetical protein [Entamoeba histolyti...  78.6    4e-13  Gene info
dbj|BAD08303.1|  cohesin subunit SMC3 [Oryzias latipes]            78.6    4e-13  Gene info
ref|YP_458609.1|  chromosome segregation protein [Erythrobacte...  78.2    4e-13  Gene info
ref|YP_001958942.1|  chromosome segregation protein SMC [Chlor...  78.2    4e-13  Gene info
sp|P97690.1|SMC3_RAT  Structural maintenance of chromosomes pr...  78.2    4e-13  Gene info
gb|AAX30716.2|  SJCHGC07135 protein [Schistosoma japonicum]        78.2    5e-13 
ref|XP_002141943.1|  structural maintenance of chromosomes pro...  78.2    5e-13  Gene info
ref|XP_845021.1|  structural maintenance of chromosome 3 [Tryp...  78.2    5e-13  Gene info
ref|XP_001643267.1|  hypothetical protein Kpol_1063p20 [Vander...  78.2    5e-13  Gene info
emb|CAO42737.1|  unnamed protein product [Vitis vinifera]          77.8    5e-13 
emb|CAR65500.1|  DEHA2B15136p [Debaryomyces hansenii]              77.8    5e-13 
ref|ZP_02004518.1|  chromosome segregation SMC protein [Beggia...  77.8    6e-13 
gb|EEA21031.1|  nuclear condensin complex subunit Smc2, putati...  77.8    6e-13 
ref|NP_593260.1|  mitotic cohesin complex subunit Psm3 [Schizo...  77.8    7e-13  UniGene infoGene info
ref|XP_311953.3|  AGAP002947-PA [Anopheles gambiae str. PEST] ...  77.4    7e-13  UniGene infoGene info
ref|XP_001537520.1|  hypothetical protein HCAG_07829 [Ajellomy...  77.4    7e-13  Gene info
emb|CAD59403.1|  SMC1 protein [Anopheles gambiae]                  77.4    7e-13 
ref|XP_001589120.1|  hypothetical protein SS1G_09753 [Scleroti...  77.4    8e-13  Gene info
ref|XP_457607.1|  hypothetical protein DEHA0B15268g [Debaryomy...  77.4    8e-13  Gene info
ref|XP_745594.1|  structural maintenance of chromosome protein...  77.4    8e-13  Gene info
ref|XP_001360588.2|  GA10161 [Drosophila pseudoobscura pseudoo...  77.4    8e-13  Gene info
ref|XP_002016148.1|  GL10652 [Drosophila persimilis] >gb|EDW32...  77.4    8e-13  Gene info
ref|NP_116687.1|  Component of the condensin complex, essentia...  77.0    9e-13  UniGene infoGene info
gb|EDN59179.1|  structural maintenance of chromosomes [Sacchar...  77.0    9e-13 
ref|XP_726100.1|  chromosome segregation protein Smc1 [Plasmod...  77.0    9e-13  Gene info
ref|XP_001729715.1|  hypothetical protein MGL_3259 [Malassezia...  77.0    9e-13  Gene info
ref|XP_001744991.1|  hypothetical protein [Monosiga brevicolli...  77.0    1e-12  Gene info
emb|CAQ40084.1|  structural maintenance of chromosome protein,...  77.0    1e-12 
ref|XP_638528.1|  structural maintenance of chromosome protein...  77.0    1e-12  UniGene infoGene info
gb|EEB09795.1|  conserved hypothetical protein [Schizosaccharo...  77.0    1e-12 
ref|ZP_02955576.1|  SMC domain protein [Methylocella silvestri...  77.0    1e-12 
gb|AAS44543.1|  structural maintenance of chromosome protein 2...  77.0    1e-12 
sp|P15016.1|YAT3_RHORU  Uncharacterized protein in ATPase CF(0...  76.6    1e-12 
ref|XP_809565.1|  structural maintenance of chromosome (SMC) [...  76.6    1e-12  Gene info
ref|XP_001615421.1|  structural maintenance of chromosome prot...  76.6    1e-12  Gene info
gb|EAW73382.1|  SMC1 structural maintenance of chromosomes 1-l...  76.6    1e-12  Gene info
ref|ZP_00789260.1|  reticulocyte binding protein [Streptococcu...  76.6    1e-12 
emb|CAC12695.1|  putative structural maintenance of chromosome...  76.3    1e-12 
emb|CAD66598.2|  SMC protein [Fibrobacter succinogenes]            76.3    2e-12 
ref|XP_001664638.1|  hypothetical protein CBG20143 [Caenorhabd...  76.3    2e-12  Gene info
ref|XP_002033905.1|  GM20175 [Drosophila sechellia] >gb|EDW479...  75.9    2e-12  Gene info
gb|AAL26977.1|AF380672_1  putative chromosome segregation prot...  75.9    2e-12 
ref|YP_278794.1|  putative ABC transporter ATP-binding protein...  75.9    2e-12  Gene info
ref|XP_002112813.1|  hypothetical protein TRIADDRAFT_25083 [Tr...  75.9    2e-12  Gene info
ref|XP_657185.2|  mitotic chromosome and X-chromosome-associat...  75.9    2e-12  Gene info
ref|XP_002081556.1|  GD25652 [Drosophila simulans] >gb|EDX0714...  75.9    2e-12  Gene info
ref|NP_610995.1|  SMC2 CG10212-PA [Drosophila melanogaster] >g...  75.9    2e-12  UniGene infoGene info
ref|XP_001784554.1|  condensin complex component SMC3 [Physcom...  75.9    2e-12  UniGene infoGene info
ref|XP_001358804.2|  GA19328 [Drosophila pseudoobscura pseudoo...  75.9    2e-12  Gene info
gb|AAY84898.1|  LD32453p [Drosophila melanogaster]                 75.9    2e-12 
ref|YP_002015164.1|  chromosome segregation protein SMC [Prost...  75.9    2e-12  Gene info
ref|XP_001712302.1|  smc2 [Hemiselmis andersenii] >gb|ABW97977...  75.9    2e-12  Gene info
ref|XP_001712642.1|  smc4 [Hemiselmis andersenii] >gb|ABW98317...  75.5    3e-12  Gene info
ref|YP_001416882.1|  chromosome segregation protein SMC [Xanth...  75.5    3e-12  Gene info
ref|NP_975462.1|  P115-like protein [Mycoplasma mycoides subsp...  75.5    3e-12  Gene info
gb|AAL39489.2|  LD05471p [Drosophila melanogaster]                 75.5    3e-12 
ref|XP_001959970.1|  GF19780 [Drosophila ananassae] >gb|EDV367...  75.5    3e-12  Gene info
ref|YP_001998107.1|  chromosome segregation protein SMC [Chlor...  75.1    4e-12  Gene info
ref|YP_001180402.1|  chromosome segregation protein SMC [Caldi...  75.1    4e-12  Gene info
ref|XP_002058648.1|  GJ14197 [Drosophila virilis] >gb|EDW58616...  75.1    4e-12  Gene info
ref|XP_001989991.1|  GH18490 [Drosophila grimshawi] >gb|EDV930...  75.1    4e-12  Gene info
ref|XP_001998793.1|  GI24164 [Drosophila mojavensis] >gb|EDW14...  74.7    5e-12  Gene info
ref|XP_955745.1|  chromosome segregation protein [Encephalitoz...  74.7    5e-12  Gene info
gb|ABQ22409.1|  structural maintenance of chromosomes 1A-like ...  74.7    5e-12 
ref|YP_424468.1|  structural maintenance of chromosomes (SMC) ...  74.7    5e-12  Gene info
ref|XP_002013454.1|  GL23399 [Drosophila persimilis] >gb|EDW24...  74.7    5e-12  Gene info
ref|XP_002070216.1|  GK11152 [Drosophila willistoni] >gb|EDW81...  74.3    6e-12  Gene info
ref|YP_001274713.1|  chromosome segregation protein SMC [Rosei...  74.3    7e-12  Gene info
ref|XP_002099298.1|  GE23444 [Drosophila yakuba] >gb|EDW99010....  73.9    9e-12  Gene info
dbj|BAA06453.2|  cut14 protein [Schizosaccharomyces pombe]         73.9    9e-12 
ref|ZP_02931893.1|  p115 protein [Ureaplasma urealyticum serov...  73.9    9e-12 
ref|XP_001679291.1|  Hypothetical protein CBG03006 [Caenorhabd...  73.9    9e-12  Gene info
ref|XP_001731321.1|  hypothetical protein MGL_1504 [Malassezia...  73.9    9e-12  Gene info
ref|ZP_01864372.1|  chromosome segregation protein [Erythrobac...  73.6    1e-11 
gb|AAX24251.2|  SJCHGC04631 protein [Schistosoma japonicum]        73.6    1e-11 
ref|YP_715949.1|  chromosome partition protein smc [Frankia al...  73.6    1e-11  Gene info
ref|NP_001027867.1|  SMC1 beta protein [Takifugu rubripes] >em...  73.6    1e-11  UniGene infoGene info
emb|CAD21530.1|  putative chromosome segregation protein [Taen...  73.2    1e-11 
ref|ZP_02840031.1|  SMC domain protein [Arthrobacter chlorophe...  73.2    1e-11 
ref|XP_001319807.1|  SMC family, C-terminal domain containing ...  73.2    1e-11  Gene info
ref|XP_002104654.1|  GD21062 [Drosophila simulans] >gb|EDX1415...  73.2    1e-11  Gene info
ref|XP_001982050.1|  GG11251 [Drosophila erecta] >gb|EDV53920....  73.2    1e-11  Gene info
ref|XP_002032440.1|  GM26555 [Drosophila sechellia] >gb|EDW434...  73.2    1e-11  Gene info
gb|AAF43149.1|AF225909_1  cohesin subunit [Drosophila melanoga...  73.2    1e-11 
ref|NP_651211.2|  SMC1 CG6057-PA [Drosophila melanogaster] >gb...  73.2    2e-11  UniGene infoGene info
ref|ZP_01385480.1|  Chromosome segregation protein SMC [Chloro...  73.2    2e-11 
ref|ZP_03004177.1|  p115 protein [Ureaplasma urealyticum serov...  73.2    2e-11 
ref|ZP_02964597.1|  p115 protein [Ureaplasma urealyticum serov...  73.2    2e-11 
emb|CAH02600.2|  KLLA0A00286p [Kluyveromyces lactis]               72.8    2e-11 
ref|ZP_03079741.1|  p115 protein [Ureaplasma urealyticum serov...  72.8    2e-11 
ref|XP_451012.1|  unnamed protein product [Kluyveromyces lactis]   72.8    2e-11  UniGene infoGene info
emb|CAK98630.1|  hypothetical chromosome segregation smc prote...  72.8    2e-11 
ref|NP_001045804.1|  Os02g0133400 [Oryza sativa (japonica cult...  72.8    2e-11  UniGene infoGene info
ref|XP_001964527.1|  GF23004 [Drosophila ananassae] >gb|EDV303...  72.8    2e-11  Gene info
ref|NP_662589.1|  Smc family protein [Chlorobium tepidum TLS] ...  72.8    2e-11  Gene info
ref|YP_001943997.1|  chromosome segregation protein SMC [Chlor...  72.8    2e-11  Gene info
ref|XP_001709980.1|  SMC3-like protein [Giardia lamblia ATCC 5...  72.4    2e-11  Gene info
ref|YP_002296757.1|  SMC family protein [Rhodospirillum centen...  72.4    2e-11  Gene info
ref|XP_001687517.1|  structural maintenance of chromosome (SMC...  72.4    2e-11  Gene info
ref|XP_001013113.1|  SMC family, C-terminal domain containing ...  72.4    3e-11  UniGene infoGene info
ref|NP_496331.1|  MItosis and X associated family member (mix-...  72.4    3e-11  UniGene infoGene info
ref|XP_823255.1|  structural maintenance of chromosome 2 [Tryp...  72.4    3e-11  Gene info
ref|NP_077971.1|  p115 protein [Ureaplasma parvum serovar 3 st...  72.0    3e-11  Gene info
gb|EEB08668.1|  conserved hypothetical protein [Schizosaccharo...  72.0    3e-11 
dbj|BAD08002.1|  putative SMC3 protein [Oryza sativa Japonica ...  72.0    3e-11 
ref|XP_001701741.1|  structural maintenance of chromosomes pro...  72.0    3e-11  UniGene infoGene info
gb|EAZ21644.1|  hypothetical protein OsJ_005127 [Oryza sativa ...  72.0    3e-11 
ref|XP_665922.1|  SMC2 protein [Cryptosporidium hominis TU502]...  72.0    3e-11  Gene info
emb|CAD43403.2|  SMC3 protein [Arabidopsis thaliana]               71.6    4e-11 
gb|AAM15423.1|  putative chromosome associated protein [Arabid...  71.6    4e-11 
ref|NP_001077968.1|  TTN7 (TITAN7) [Arabidopsis thaliana] >ref...  71.6    4e-11  UniGene infoGene info
gb|AAS09910.1|  SMC3 [Arabidopsis thaliana]                        71.6    4e-11 
dbj|BAE98460.1|  putative chromosome associated protein [Arabi...  71.6    4e-11 
gb|EAY84367.1|  hypothetical protein OsI_005600 [Oryza sativa ...  71.6    4e-11 
ref|NP_001040659.1|  High Incidence of Males (increased X chro...  71.6    4e-11  UniGene infoGene info
ref|XP_001425210.1|  hypothetical protein [Paramecium tetraure...  71.6    4e-11  Gene info
ref|XP_001609698.1|  smc family/structural maintenance of chro...  71.2    5e-11  Gene info
gb|AAP58947.1|  chromosome segregation ATPase [Spiroplasma kun...  71.2    5e-11 
ref|XP_505843.1|  YALI0F24783p [Yarrowia lipolytica] >emb|CAG7...  71.2    5e-11  Gene info
ref|NP_757869.1|  structural maintenance of chromosomes SMC su...  70.9    6e-11  Gene info
emb|CAO63143.1|  unnamed protein product [Vitis vinifera]          70.5    9e-11 
emb|CAF91830.1|  unnamed protein product [Tetraodon nigroviridis]  70.5    1e-10 
ref|XP_001388064.1|  SMC2 protein [Cryptosporidium parvum Iowa...  70.5    1e-10  Gene info
ref|XP_001525975.1|  conserved hypothetical protein [Lodderomy...  70.1    1e-10  Gene info
ref|YP_423344.1|  chromosome segregation ATPase [Magnetospiril...  70.1    1e-10  Gene info
ref|ZP_00055919.1|  COG1196: Chromosome segregation ATPases [M...  70.1    1e-10 
gb|EEB04060.1|  structural maintenance of chromosomes protein,...  69.7    1e-10 
ref|XP_001626235.1|  predicted protein [Nematostella vectensis...  69.7    2e-10  UniGene infoGene info
ref|YP_001430989.1|  chromosome segregation protein SMC [Rosei...  68.9    3e-10  Gene info
ref|XP_001417140.1|  predicted protein [Ostreococcus lucimarin...  68.6    4e-10  Gene info
ref|XP_001611424.1|  RecF/RecN/SMC N terminal domain containin...  68.2    4e-10  Gene info
ref|XP_965954.1|  chromosome segregation protein [Encephalitoz...  68.2    4e-10  Gene info
ref|YP_910985.1|  chromosome segregation protein SMC [Chlorobi...  67.8    5e-10  Gene info
ref|XP_001091228.1|  PREDICTED: SMC1 structural maintenance of...  67.8    6e-10  UniGene infoGene info
ref|XP_001708709.1|  hypothetical protein [Giardia lamblia ATC...  67.8    6e-10  Gene info
ref|NP_212179.1|  P115 protein [Borrelia burgdorferi B31] >gb|...  67.4    9e-10  Gene info
ref|ZP_01833367.1|  chromosome segregation protein SMC [Strept...  67.0    9e-10 
ref|ZP_03094947.1|  P115 protein [Borrelia sp. SV1]                67.0    9e-10 
ref|ZP_02530916.1|  P115 protein [Borrelia burgdorferi Bol26]      67.0    1e-09 
ref|YP_378735.1|  chromosome segregation protein SMC [Chlorobi...  67.0    1e-09  Gene info
ref|ZP_02518946.1|  P115 protein [Borrelia burgdorferi 156a] >...  67.0    1e-09 
ref|ZP_03098799.1|  P115 protein [Borrelia spielmanii A14S]        67.0    1e-09 
ref|ZP_03090397.1|  P115 protein [Borrelia burgdorferi WI91-23]    67.0    1e-09 
ref|ZP_02520734.1|  P115 protein [Borrelia burgdorferi ZS7]        67.0    1e-09 
ref|ZP_03096846.1|  P115 protein [Borrelia burgdorferi 64b]        67.0    1e-09 
ref|ZP_02719870.1|  P115 protein [Borrelia burgdorferi 118a] >...  67.0    1e-09 
ref|XP_002140316.1|  structural maintenance of chromosomes pro...  67.0    1e-09  Gene info
ref|XP_001025504.1|  SMC family, C-terminal domain containing ...  66.6    1e-09  UniGene infoGene info
emb|CAD10418.1|  SMC protein [Deinococcus radiodurans]             66.2    2e-09 
ref|XP_453765.1|  unnamed protein product [Kluyveromyces lacti...  65.9    2e-09  UniGene infoGene info
ref|ZP_02725330.1|  P115 protein [Borrelia burgdorferi 94a]        65.5    3e-09 
ref|YP_072495.1|  P115 protein [Borrelia garinii PBi] >gb|AAU0...  65.5    3e-09  Gene info
ref|YP_001256577.1|  ABC transporter ATP-binding protein [Myco...  65.5    3e-09  Gene info
gb|AAZ57431.1|  structural maintenance of chromosome 2 [Toxopl...  65.5    3e-09 
ref|NP_110114.1|  SMC family chromosome/DNA binding/protecting...  65.5    3e-09  Gene info
ref|NP_852952.1|  Smc-like [Mycoplasma gallisepticum R] >gb|AA...  65.5    3e-09  Gene info
ref|NP_986902.1|  AGR236Wp [Ashbya gossypii ATCC 10895] >gb|AA...  65.1    4e-09  UniGene infoGene info
ref|ZP_02368681.1|  P115 protein [Borrelia valaisiana VS116]       65.1    4e-09 
ref|NP_295194.1|  Smc1/Cut3/Cut14 family protein [Deinococcus ...  65.1    4e-09  Gene info
ref|XP_001712597.1|  smc1 [Hemiselmis andersenii] >gb|ABW98272...  64.7    5e-09  Gene info
ref|YP_709485.1|  P115 protein [Borrelia afzelii PKo] >gb|ABH0...  64.7    5e-09  Gene info
ref|YP_604293.1|  SMC protein-like protein [Deinococcus geothe...  64.7    5e-09  Gene info
ref|XP_719961.1|  potential nuclear cohesin complex SMC ATPase...  64.7    6e-09  Gene info
ref|XP_001910131.1|  unnamed protein product [Podospora anseri...  64.3    7e-09  Gene info
emb|CAA03959.1|  unnamed protein product [Hordeum vulgare subs...  64.3    7e-09 
ref|ZP_02529870.1|  P115 protein [Borrelia afzelii ACA-1]          64.3    7e-09 
ref|NP_586506.1|  putative NUCLEAR PROTEIN OF THE SMC FAMILY [...  64.3    7e-09  Gene info
emb|CAG05600.1|  unnamed protein product [Tetraodon nigroviridis]  63.9    9e-09 
gb|EAZ14533.1|  hypothetical protein OsJ_004358 [Oryza sativa ...  63.9    9e-09 
gb|EAY76872.1|  hypothetical protein OsI_004719 [Oryza sativa ...  63.9    1e-08 
ref|XP_001328416.1|  SMC flexible hinge domain protein [Tricho...  63.5    1e-08  Gene info
ref|XP_001746006.1|  hypothetical protein [Monosiga brevicolli...  63.5    1e-08  Gene info
ref|ZP_03274795.1|  chromosome segregation protein SMC [Arthro...  63.5    1e-08 
ref|XP_954442.1|  SMC (structural maintenance of chromosome) p...  62.8    2e-08  Gene info
ref|XP_665748.1|  involved in sister chromatid cohesion; Smc3p...  62.8    2e-08  Gene info
emb|CAO14971.1|  unnamed protein product [Vitis vinifera]          62.4    2e-08 
ref|ZP_03089286.1|  P115 protein [Borrelia garinii PBr]            62.4    3e-08 
ref|XP_628440.1|  SMC3'SMC type chromosomal ABC ATpase' [Crypt...  62.0    3e-08  Gene info
emb|CAL51464.1|  SMC2 protein (ISS) [Ostreococcus tauri]           62.0    4e-08 
ref|NP_072965.1|  chromosome segregation protein SMC [Mycoplas...  61.6    5e-08  Gene info
gb|AAU83643.1|  chromosome assembly protein homolog [unculture...  60.5    9e-08 
ref|XP_002014747.1|  GL19336 [Drosophila persimilis] >gb|EDW28...  59.7    1e-07  Gene info
gb|EEB01170.1|  chromosome segregation protein smc1, putative ...  59.7    2e-07 
gb|AAZ43084.1|  structural maintenance of chromosome protein 1...  59.7    2e-07 
ref|XP_975667.1|  PREDICTED: similar to structural maintenance...  58.9    3e-07  UniGene infoGene info
ref|YP_002253744.1|  chromosome segregation protein smc [Ralst...  58.9    3e-07  Gene info
ref|ZP_02532077.1|  chromosome segregation protein SMC [Endori...  58.9    3e-07 
ref|XP_001705653.1|  SMC1 beta-like protein [Giardia lamblia A...  58.5    3e-07  Gene info
ref|XP_001698278.1|  structural maintenance of chromosomes pro...  58.2    4e-07  UniGene infoGene info
ref|XP_002141442.1|  structural maintenance of chromosomes pro...  57.8    6e-07  Gene info
emb|CAC09585.1|  putative SMC1 protein [Microtus arvalis]          57.8    6e-07 
ref|XP_001615022.1|  chromosome associated protein [Plasmodium...  57.4    8e-07  Gene info
emb|CAC09584.1|  putative SMC3 protein [Microtus arvalis]          57.4    8e-07 
ref|XP_763330.1|  hypothetical protein [Theileria parva strain...  57.4    9e-07  Gene info
ref|YP_144165.1|  chromosome segregation SMC protein [Thermus ...  57.0    1e-06  Gene info
emb|CAQ38727.1|  chromosome associated protein, putative [Plas...  57.0    1e-06 
ref|YP_644160.1|  SMC protein-like protein [Rubrobacter xylano...  57.0    1e-06  Gene info
ref|XP_759573.1|  hypothetical protein UM03426.1 [Ustilago may...  56.6    1e-06  Gene info
ref|XP_001351448.1|  chromosome associated protein [Plasmodium...  56.6    1e-06  Gene info
ref|ZP_02212594.1|  hypothetical protein CLOBAR_02211 [Clostri...  56.6    1e-06 
ref|XP_679286.1|  hypothetical protein [Plasmodium berghei str...  56.2    2e-06  Gene info
ref|XP_738658.1|  hypothetical protein [Plasmodium chabaudi ch...  55.8    2e-06  Gene info
gb|ABO07414.1|  SMC3 [Solanum lycopersicum]                        55.8    2e-06  Gene info
ref|YP_004518.1|  chromosome partition protein smc [Thermus th...  55.8    2e-06  Gene info
gb|EDY41770.1|  SMC proteins Flexible Hinge Domain [Thermococc...  55.8    3e-06 
ref|ZP_03135085.1|  SMC domain protein [Thermus aquaticus Y51M...  55.8    3e-06 
ref|XP_001610390.1|  structural maintenance of chromosome 1-li...  55.5    3e-06  Gene info
ref|ZP_02851187.1|  chromosome segregation protein SMC [Paenib...  55.1    4e-06 
ref|XP_673157.1|  hypothetical protein [Plasmodium berghei str...  55.1    4e-06  Gene info
ref|XP_671032.1|  hypothetical protein [Plasmodium berghei str...  54.7    5e-06  Gene info
ref|XP_001593826.1|  hypothetical protein SS1G_05254 [Scleroti...  54.7    5e-06  Gene info
gb|EDL41598.1|  mCG5312, isoform CRA_a [Mus musculus]              53.9    9e-06 
gb|EDM13016.1|  SMC5 structural maintenance of chromosomes 5-l...  53.9    9e-06  Gene info
sp|Q8CG46.1|SMC5_MOUSE  RecName: Full=Structural maintenance o...  53.9    9e-06  Gene info
ref|NP_001099827.1|  structural maintenance of chromosomes 5 [...  53.9    9e-06  UniGene infoGene info
gb|AAH07174.1|  Smc5 protein [Mus musculus]                        53.5    1e-05  Gene info
dbj|BAC65603.3|  mKIAA0594 protein [Mus musculus]                  53.5    1e-05  Gene info
ref|XP_001700607.1|  structural maintenance of chromosomes pro...  53.5    1e-05  UniGene infoGene info
ref|XP_725206.1|  hypothetical protein [Plasmodium yoelii yoel...  53.5    1e-05  Gene info
gb|EDL24363.1|  mCG1031254 [Mus musculus]                          53.1    2e-05 
ref|NP_722503.1|  structural maintenance of chromosomes 5 [Mus...  52.8    2e-05  UniGene infoGene info
gb|EDL41599.1|  mCG5312, isoform CRA_b [Mus musculus]              52.8    2e-05 
ref|XP_001604641.1|  PREDICTED: similar to KIAA0594 protein [N...  52.8    2e-05  Gene info
ref|XP_001463003.1|  structural maintenance of chromosome (SMC...  52.4    2e-05  Gene info
ref|XP_001643812.1|  hypothetical protein Kpol_1044p13 [Vander...  52.4    3e-05  Gene info
ref|NP_001098324.1|  meiosis-specific cohesin subunit SMC1 bet...  52.4    3e-05  UniGene infoGene info
dbj|BAG50839.1|  unnamed protein product [Homo sapiens]            51.2    6e-05  Gene info
ref|XP_001804718.1|  hypothetical protein SNOG_14536 [Phaeosph...  51.2    6e-05  Gene info
ref|NP_001034424.1|  SMC5 protein [Gallus gallus] >emb|CAH6518...  50.8    7e-05  UniGene infoGene info
gb|AAH38225.1|  Structural maintenance of chromosomes 5 [Homo ...  50.8    7e-05  Gene info
ref|NP_055925.2|  SMC5 protein [Homo sapiens] >sp|Q8IY18.2|SMC...  50.8    7e-05  UniGene infoGene info
ref|XP_001505381.1|  PREDICTED: similar to U1 small nuclear ri...  50.8    7e-05  UniGene infoGene info
dbj|BAA25520.2|  KIAA0594 protein [Homo sapiens]                   50.8    7e-05  Gene info
ref|XP_520066.2|  PREDICTED: SMC5 protein [Pan troglodytes]        50.8    7e-05  UniGene infoGene info
emb|CAC39247.1|  SMC5 protein [Homo sapiens]                       50.8    7e-05  Gene info
ref|XP_001123268.1|  PREDICTED: similar to SMC6 protein, parti...  50.8    7e-05  UniGene infoGene info
sp|Q5ZJY5.1|SMC5_CHICK  RecName: Full=Structural maintenance o...  50.8    7e-05  Gene info
ref|XP_001090492.1|  PREDICTED: similar to SMC5 protein [Macac...  50.8    8e-05  UniGene infoGene info
ref|XP_001233557.1|  PREDICTED: hypothetical protein, partial ...  50.8    8e-05  UniGene infoGene info
ref|YP_001785927.1|  putative ABC transporter, ATP-binding pro...  50.4    9e-05  Gene info
ref|YP_001780225.1|  putative ABC transporter, ATP-binding pro...  50.4    1e-04  Gene info
ref|ZP_02616193.1|  putative ABC transporter, ATP-binding prot...  50.4    1e-04 
ref|YP_001253125.1|  ABC transporter permease/ATP-binding prot...  50.4    1e-04  Gene info
ref|XP_002116406.1|  hypothetical protein TRIADDRAFT_60486 [Tr...  50.4    1e-04  Gene info
ref|YP_001389947.1|  putative ABC transporter, ATP-binding pro...  50.4    1e-04  Gene info
ref|ZP_02612617.1|  putative ABC transporter, ATP-binding prot...  50.4    1e-04 
ref|ZP_02994149.1|  hypothetical protein CLOSPO_01268 [Clostri...  50.4    1e-04 
ref|XP_002116408.1|  hypothetical protein TRIADDRAFT_60489 [Tr...  50.4    1e-04  Gene info
ref|XP_001337776.1|  PREDICTED: similar to structural maintena...  50.1    1e-04  UniGene infoGene info
ref|XP_765813.1|  hypothetical protein [Theileria parva strain...  50.1    1e-04  Gene info
gb|EEA39934.1|  hypothetical protein BRAFLDRAFT_286107 [Branch...  50.1    1e-04 
ref|XP_001489272.2|  PREDICTED: similar to Structural maintena...  49.3    2e-04  UniGene infoGene info
ref|YP_250213.1|  putative ABC transport system [Corynebacteri...  49.3    2e-04  Gene info
ref|XP_001924981.1|  PREDICTED: similar to SMC5 structural mai...  49.3    2e-04  UniGene infoGene info
ref|XP_533529.2|  PREDICTED: similar to SMC5 protein isoform 1...  48.9    3e-04  UniGene infoGene info
ref|XP_001582071.1|  RecF/RecN/SMC N terminal domain containin...  48.5    3e-04  Gene info
ref|XP_786593.2|  PREDICTED: similar to Structural maintenance...  48.5    4e-04  UniGene infoGene info
emb|CAN68529.1|  hypothetical protein [Vitis vinifera]             48.5    4e-04 
ref|XP_001197461.1|  PREDICTED: similar to Structural maintena...  48.5    4e-04  UniGene infoGene info
ref|XP_001679859.1|  Hypothetical protein CBG02311 [Caenorhabd...  48.1    4e-04  Gene info
ref|XP_585794.4|  PREDICTED: structural maintenance of chromos...  48.1    4e-04  UniGene infoGene info
ref|ZP_02975713.1|  chromosome segregation protein SMC [Cyanot...  48.1    5e-04 
emb|CAO70149.1|  unnamed protein product [Vitis vinifera]          48.1    5e-04 
emb|CAG07476.1|  unnamed protein product [Tetraodon nigroviridis]  48.1    5e-04 
ref|NP_494935.1|  C27A2.1 [Caenorhabditis elegans] >gb|AAK3146...  47.8    6e-04  UniGene infoGene info
ref|XP_859146.1|  PREDICTED: similar to SMC5 protein isoform 3...  47.8    6e-04  UniGene infoGene info
ref|XP_001326352.1|  SMC family, C-terminal domain containing ...  47.8    7e-04  Gene info
pir||T15650  hypothetical protein C27A2.1 - Caenorhabditis ele...  47.8    7e-04 
ref|XP_973544.2|  PREDICTED: similar to structural maintenance...  47.4    8e-04  UniGene infoGene info
ref|XP_002139866.1|  hypothetical protein [Cryptosporidium mur...  47.4    8e-04  Gene info
ref|XP_001936006.1|  structural maintenance of chromosomes pro...  47.4    8e-04  Gene info
gb|EEA64186.1|  hypothetical protein BRAFLDRAFT_219461 [Branch...  47.4    0.001 
gb|EDK37800.2|  hypothetical protein PGUG_01898 [Pichia guilli...  47.0    0.001 
ref|XP_001486227.1|  hypothetical protein PGUG_01898 [Pichia g...  47.0    0.001  Gene info
ref|ZP_03142418.1|  ATPase [Cyanothece sp. PCC 8802] >gb|EDY03...  47.0    0.001 
ref|XP_001347920.1|  hypothetical protein [Plasmodium falcipar...  46.2    0.002  Gene info
ref|XP_388878.1|  hypothetical protein FG08702.1 [Gibberella z...  46.2    0.002  Gene info
ref|XP_001690370.1|  structural maintenance of chromosomes pro...  46.2    0.002  UniGene infoGene info
ref|XP_001527727.1|  conserved hypothetical protein [Lodderomy...  46.2    0.002  Gene info
ref|XP_001797757.1|  hypothetical protein SNOG_07424 [Phaeosph...  46.2    0.002  Gene info
ref|XP_001615353.1|  SMC family, C-terminal domain containing ...  45.8    0.002  Gene info
emb|CAQ40013.1|  hypothetical protein, conserved in Apicomplex...  45.8    0.002 
ref|XP_743315.1|  hypothetical protein [Plasmodium chabaudi ch...  45.8    0.002  Gene info
dbj|BAB23051.1|  unnamed protein product [Mus musculus]            45.8    0.002  Gene info
ref|XP_001731268.1|  hypothetical protein MGL_1451 [Malassezia...  45.8    0.002  Gene info
ref|XP_001742605.1|  hypothetical protein [Monosiga brevicolli...  45.8    0.003  Gene info
ref|NP_196383.1|  structural maintenance of chromosomes (SMC) ...  45.8    0.003  UniGene infoGene info
ref|XP_320881.2|  AGAP011623-PA [Anopheles gambiae str. PEST] ...  45.4    0.003  UniGene infoGene info
emb|CAD59407.1|  SMC5 protein [Anopheles gambiae]                  45.4    0.003 
ref|XP_627199.1|  Smc ABC ATpase [Cryptosporidium parvum Iowa ...  45.4    0.003  Gene info
ref|XP_731102.1|  hypothetical protein [Plasmodium yoelii yoel...  45.4    0.003  Gene info
emb|CAO62311.1|  unnamed protein product [Vitis vinifera]          45.4    0.004 
ref|XP_570159.1|  DNA repair-related protein [Cryptococcus neo...  45.1    0.004  UniGene infoGene info
ref|XP_775824.1|  hypothetical protein CNBD2340 [Cryptococcus ...  45.1    0.004  Gene info
ref|XP_001239047.1|  hypothetical protein CIMG_10069 [Coccidio...  45.1    0.004  Gene info
ref|XP_499658.1|  YALI0A01562p [Yarrowia lipolytica] >emb|CAG8...  45.1    0.004  Gene info
ref|YP_001827873.1|  putative ABC transporter ATP-binding prot...  45.1    0.004  Gene info
gb|AAH26429.1|  Smc6 protein [Mus musculus]                        45.1    0.004  Gene info
ref|XP_504054.1|  YALI0E17193p [Yarrowia lipolytica] >emb|CAG7...  45.1    0.004  Gene info
ref|XP_675950.1|  hypothetical protein [Plasmodium berghei str...  45.1    0.004  Gene info
ref|NP_200954.1|  MIM (HYPERSENSITIVE TO MMS, IRRADIATION AND ...  45.1    0.004  UniGene infoGene info
ref|XP_713303.1|  potential nuclear DNA repair complex SMC ATP...  45.1    0.004  Gene info
gb|AAD54769.1|AF120932_1  SMC-like protein [Arabidopsis thalia...  45.1    0.004 
gb|EDZ69438.1|  YOL034Wp-like protein [Saccharomyces cerevisia...  45.1    0.005 
gb|EDN63838.1|  structural maintenance of chromosomes [Sacchar...  45.1    0.005 
ref|XP_764135.1|  hypothetical protein [Theileria parva strain...  45.1    0.005  Gene info
gb|EDV10576.1|  structural maintenance of chromosome 5 [Saccha...  45.1    0.005 
ref|NP_079971.2|  SMC6 protein [Mus musculus] >sp|Q924W5.1|SMC...  45.1    0.005  UniGene infoGene info
ref|XP_001748465.1|  hypothetical protein [Monosiga brevicolli...  44.7    0.005  Gene info
ref|NP_014608.1|  Structural maintenance of chromosomes (SMC) ...  44.7    0.005  UniGene infoGene info
ref|NP_613974.1|  SMC1-family ATPase [Methanopyrus kandleri AV...  44.7    0.005  Gene info
gb|EEB08290.1|  conserved hypothetical protein [Schizosaccharo...  44.7    0.005 
dbj|BAD90287.1|  mKIAA4103 protein [Mus musculus]                  44.7    0.005  Gene info
gb|EDX76379.1|  RecF/RecN/SMC N terminal domain, putative [Mic...  44.7    0.005 
emb|CAD59413.1|  SMC6 protein [Oryza sativa]                       44.7    0.006 
ref|XP_001823906.1|  hypothetical protein [Aspergillus oryzae ...  44.7    0.006  Gene info
ref|XP_001587761.1|  hypothetical protein SS1G_11001 [Scleroti...  44.7    0.006  Gene info
ref|NP_001062596.1|  Os09g0121000 [Oryza sativa (japonica cult...  44.7    0.006  UniGene infoGene info
gb|AAI65244.1|  Zgc:152845 protein [Danio rerio]                   44.7    0.006  Gene info
ref|NP_001071040.1|  hypothetical protein LOC566749 [Danio rer...  44.3    0.006  UniGene infoGene info
ref|XP_001630433.1|  predicted protein [Nematostella vectensis...  44.3    0.006  UniGene infoGene info
gb|EEA22700.1|  structural maintenance of chromosome complex s...  44.3    0.006 
gb|EAZ43788.1|  hypothetical protein OsJ_027271 [Oryza sativa ...  44.3    0.006 
ref|XP_001395875.1|  hypothetical protein An12g08240 [Aspergil...  44.3    0.007  Gene info
ref|NP_001101484.1|  SMC6 structural maintenance of chromosome...  44.3    0.007  UniGene infoGene info
gb|EDX76447.1|  RecF/RecN/SMC N terminal domain, putative [Mic...  44.3    0.007 
ref|XP_667068.1|  hypothetical protein [Cryptosporidium homini...  44.3    0.007  Gene info
ref|XP_001550595.1|  hypothetical protein BC1G_11368 [Botryoti...  44.3    0.007  Gene info
gb|EAZ08159.1|  hypothetical protein OsI_029391 [Oryza sativa ...  44.3    0.007 
dbj|BAB29353.2|  unnamed protein product [Mus musculus]            44.3    0.007  Gene info
ref|XP_001936593.1|  structural maintenance of chromosomes pro...  44.3    0.007  Gene info
ref|XP_455442.1|  unnamed protein product [Kluyveromyces lacti...  44.3    0.008  UniGene infoGene info
ref|XP_446024.1|  unnamed protein product [Candida glabrata] >...  44.3    0.008  Gene info
ref|XP_953158.1|  chromosome maintenance protein (SMC5 homolog...  43.9    0.009  Gene info
ref|XP_002065498.1|  GK15482 [Drosophila willistoni] >gb|EDW76...  43.9    0.009  Gene info
ref|XP_001608033.1|  PREDICTED: hypothetical protein [Nasonia ...  43.9    0.009  Gene info
ref|XP_311902.3|  AGAP002985-PA [Anopheles gambiae str. PEST] ...  43.9    0.010  UniGene infoGene info
ref|ZP_00953010.1|  ABC transporter ATP-binding protein [Ocean...  43.9    0.010 
emb|CAR65408.1|  DEHA2A12606p [Debaryomyces hansenii]              43.9    0.010 
dbj|BAC56937.1|  structural maintenance of chromosomes protein...  43.9    0.010  Gene info
ref|NP_001082472.1|  structural maintenance of chromosomes pro...  43.9    0.010  UniGene infoGene info
ref|XP_001548568.1|  hypothetical protein BC1G_12963 [Botryoti...  43.5    0.011  Gene info
ref|XP_001257460.1|  structural maintenance of chromosomes 5 s...  43.5    0.011  Gene info
ref|XP_001209871.1|  hypothetical protein ATEG_07185 [Aspergil...  43.5    0.011  Gene info
gb|AAL82734.1|  structural maintenance of chromosome protein [...  43.5    0.011 
ref|XP_747807.1|  structural maintenance of chromosome complex...  43.5    0.012  Gene info
ref|XP_419962.1|  PREDICTED: hypothetical protein [Gallus gallus]  43.5    0.012  UniGene infoGene info
ref|NP_001027801.1|  SMC5 protein [Takifugu rubripes] >sp|Q802...  43.5    0.012  UniGene infoGene info
ref|XP_001270263.1|  structural maintenance of chromosomes 5 s...  43.5    0.012  Gene info
ref|YP_001566753.1|  ABC transporter related [Delftia acidovor...  43.5    0.012  Gene info
ref|XP_001539600.1|  hypothetical protein HCAG_05067 [Ajellomy...  43.5    0.013  Gene info
ref|XP_002048007.1|  GJ11591 [Drosophila virilis] >gb|EDW70349...  43.5    0.013  Gene info
ref|XP_001501978.1|  PREDICTED: similar to SMC6 structural mai...  43.5    0.013  UniGene infoGene info
ref|XP_001697007.1|  structural maintenance of chromosomes pro...  43.5    0.013  UniGene infoGene info
ref|XP_682011.1|  hypothetical protein AN8742.2 [Aspergillus n...  43.5    0.014  Gene info
ref|YP_001920011.1|  cobalt import ATP-binding protein CbiO [C...  43.1    0.014  Gene info
ref|XP_002121540.1|  PREDICTED: similar to SMC5 protein [Ciona...  43.1    0.014  UniGene infoGene info
ref|XP_001505487.1|  PREDICTED: similar to structural maintena...  43.1    0.014  UniGene infoGene info
ref|XP_001948837.1|  PREDICTED: similar to predicted protein [...  43.1    0.015  Gene info
emb|CAP99695.1|  Pc22g24070 [Penicillium chrysogenum Wisconsin...  43.1    0.017 
ref|XP_001949538.1|  PREDICTED: similar to structural maintena...  43.1    0.017  Gene info
ref|XP_001120037.1|  PREDICTED: similar to SMC5 protein [Apis ...  42.7    0.018  UniGene infoGene info
ref|XP_001907397.1|  unnamed protein product [Podospora anseri...  42.7    0.018  Gene info
ref|ZP_01732746.1|  excinuclease ABC, subunit A [Flavobacteria...  42.7    0.018 
ref|XP_001655676.1|  structural maintenance of chromosomes 6 s...  42.7    0.018  UniGene infoGene info
emb|CAO40770.1|  unnamed protein product [Vitis vinifera]          42.7    0.020 
dbj|BAB15236.1|  unnamed protein product [Homo sapiens]            42.7    0.020  Gene info
gb|EEA46048.1|  hypothetical protein BRAFLDRAFT_283349 [Branch...  42.7    0.020 
ref|XP_587519.2|  PREDICTED: similar to Structural maintenance...  42.7    0.021  UniGene infoGene info
ref|NP_594907.1|  Smc5-6 complex SMC subunit Smc5 (PMID 107470...  42.7    0.021  UniGene infoGene info
ref|YP_001884855.1|  cobalt import ATP-binding protein CbiO 2 ...  42.7    0.022  Gene info
gb|EEA36919.1|  hypothetical protein BRAFLDRAFT_131216 [Branch...  42.7    0.023 
ref|XP_001135970.1|  PREDICTED: SMC6 protein isoform 2 [Pan tr...  42.7    0.023  UniGene infoGene info
ref|YP_001046443.1|  cobalt ABC transporter, ATPase subunit [M...  42.7    0.023  Gene info
ref|NP_001083550.1|  hypothetical protein LOC398986 [Xenopus l...  42.7    0.023  UniGene infoGene info
emb|CAG03568.1|  unnamed protein product [Tetraodon nigroviridis]  42.7    0.023 
ref|YP_001791692.1|  ABC transporter-related protein [Leptothr...  42.7    0.023  Gene info



>ref|YP_001581985.1| Gene info SMC domain-containing protein [Nitrosopumilus maritimus SCM1]
 gb|ABX12547.1| Gene info SMC domain protein [Nitrosopumilus maritimus SCM1]
Length=1174

 GENE ID: 5774382 Nmar_0651 | SMC domain-containing protein
[Nitrosopumilus maritimus SCM1]

 Score =  395 bits (1014),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 189/224 (84%), Positives = 207/224 (92%), Gaps = 1/224 (0%)

Query  2     ELEDFDVESIIQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFI  61
             ++E FDVESI+QGL+ E  SL ALN KAPE Y++VSYGYRSMS RKNSLE ER SIV FI
Sbjct  952   DMETFDVESIVQGLSAELASLNALNAKAPETYLEVSYGYRSMSTRKNSLEEERNSIVKFI  1011

Query  62    EKIERDKKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKPK  121
             E IE+DK+QTFLDAFD VDKEI+ IFNKMTGGNAWLE+QNEDDIFNSG+SYLIQFPNKPK
Sbjct  1012  EDIEKDKRQTFLDAFDKVDKEIKLIFNKMTGGNAWLELQNEDDIFNSGISYLIQFPNKPK  1071

Query  122   RESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQ  181
             RESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLS IL+ER++ESQ
Sbjct  1072  RESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSNILEERAKESQ  1131

Query  182   FIMVSLKDSVVQKAKLIYGVYPKNGVSQVVTYKDKRNVPSLQTS  225
             FIMVSLKDSVVQKAKLIYGV+PKNGVS VVTYKDKR +PS++TS
Sbjct  1132  FIMVSLKDSVVQKAKLIYGVFPKNGVSNVVTYKDKR-MPSVRTS  1174


>ref|YP_875318.1| Gene info chromosome segregation ATPase [Cenarchaeum symbiosum A]
 gb|ABK77014.1| Gene info chromosome segregation ATPase [Cenarchaeum symbiosum A]
Length=1175

 GENE ID: 6370558 CENSYa_0378 | chromosome segregation ATPase
[Cenarchaeum symbiosum A] (10 or fewer PubMed links)

 Score =  360 bits (925),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 169/224 (75%), Positives = 198/224 (88%), Gaps = 1/224 (0%)

Query  2     ELEDFDVESIIQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFI  61
             +LE FDV  +++GL  EQ+SL  LN +APE Y DV+ GYRSMS RKNSLEGER  IV FI
Sbjct  952   DLEYFDVGPMLRGLEAEQRSLQQLNARAPEVYADVTDGYRSMSSRKNSLEGERNRIVGFI  1011

Query  62    EKIERDKKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKPK  121
             E IER+KKQTFLDAFD VD+EI+  F+KMTGG+AWLE+QNEDDIF+SG+SY+IQF NKPK
Sbjct  1012  EGIEREKKQTFLDAFDKVDREIKNAFSKMTGGSAWLELQNEDDIFSSGISYMIQFQNKPK  1071

Query  122   RESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQ  181
             RESTSISGGEKTLAA+VFVLALQKLKPSPFYLFDEVDAHLDAPNSE+L+KIL+ER++ESQ
Sbjct  1072  RESTSISGGEKTLAAVVFVLALQKLKPSPFYLFDEVDAHLDAPNSEKLAKILEERARESQ  1131

Query  182   FIMVSLKDSVVQKAKLIYGVYPKNGVSQVVTYKDKRNVPSLQTS  225
             FIMVSLKDSVV++A LIYGV+PK GVS VV+Y+DKR +PS+  S
Sbjct  1132  FIMVSLKDSVVRRASLIYGVFPKGGVSHVVSYRDKR-LPSMAPS  1174


>gb|ABZ09946.1|  putative SMC family, C-terminal domain protein [uncultured marine 
crenarchaeote HF4000_APKG9P22]
Length=1169

 Score =  347 bits (891),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 165/225 (73%), Positives = 195/225 (86%), Gaps = 2/225 (0%)

Query  1     DELEDFDVESIIQGLNTEQKSLTA-LNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVN  59
             + +E FDVE  I+ L  E+ SL A LN  AP++Y++VS GY SMS RKN LE ER ++V+
Sbjct  946   ESIETFDVEPSIEILEKEESSLAASLNAIAPQRYVEVSTGYHSMSSRKNELEAERNAVVS  1005

Query  60    FIEKIERDKKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNK  119
             FIE IE++K+QTFLDAFD VD EIR IF KM GGNAWLE++NEDDIFN+G+SY IQFPNK
Sbjct  1006  FIEGIEKNKRQTFLDAFDTVDNEIREIFTKMNGGNAWLELENEDDIFNAGISYFIQFPNK  1065

Query  120   PKRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQE  179
             PKRESTSISGGEKTLAA+VFVLALQ+LKPSPFYLFDE+DAHLDAPN+E L+KI++ERS+ 
Sbjct  1066  PKRESTSISGGEKTLAAVVFVLALQRLKPSPFYLFDEIDAHLDAPNAESLAKIVEERSKG  1125

Query  180   SQFIMVSLKDSVVQKAKLIYGVYPKNGVSQVVTYKDKRNVPSLQT  224
             SQFIMVSLKDSVV+KAKLIYGVYPKNGVS VVTYKDKR +P++ T
Sbjct  1126  SQFIMVSLKDSVVEKAKLIYGVYPKNGVSHVVTYKDKR-LPAMTT  1169


>gb|ABZ08695.1|  putative SMC family, C-terminal domain protein [uncultured marine 
crenarchaeote HF4000_APKG3K8]
Length=1169

 Score =  347 bits (890),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 165/225 (73%), Positives = 195/225 (86%), Gaps = 2/225 (0%)

Query  1     DELEDFDVESIIQGLNTEQKSLTA-LNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVN  59
             + +E FDVE  I+ L  E+ SL A LN  AP++Y++VS GY SMS RKN LE ER ++V+
Sbjct  946   ESIETFDVEPSIEILEKEESSLAASLNAIAPQRYVEVSTGYHSMSSRKNELEAERNAVVS  1005

Query  60    FIEKIERDKKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNK  119
             FIE IE++K+QTFLDAFD VD EIR IF KM GGNAWLE++NEDDIFN+G+SY IQFPNK
Sbjct  1006  FIEGIEKNKRQTFLDAFDTVDNEIREIFTKMNGGNAWLELENEDDIFNAGISYFIQFPNK  1065

Query  120   PKRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQE  179
             PKRESTSISGGEKTLAA+VFVLALQ+LKPSPFYLFDE+DAHLDAPN+E L+KI++ERS+ 
Sbjct  1066  PKRESTSISGGEKTLAAVVFVLALQRLKPSPFYLFDEIDAHLDAPNAESLAKIVEERSKG  1125

Query  180   SQFIMVSLKDSVVQKAKLIYGVYPKNGVSQVVTYKDKRNVPSLQT  224
             SQFIMVSLKDSVV+KAKLIYGVYPKNGVS VVTYKDKR +P++ T
Sbjct  1126  SQFIMVSLKDSVVEKAKLIYGVYPKNGVSHVVTYKDKR-LPAMTT  1169


>ref|NP_143635.1| Gene info chromosome assembly protein [Pyrococcus horikoshii OT3]
 dbj|BAA30917.1| Gene info 1179aa long hypothetical chromosome assembly protein [Pyrococcus 
horikoshii OT3]
Length=1179

 GENE ID: 1442642 PH1798 | chromosome assembly protein
[Pyrococcus horikoshii OT3] (10 or fewer PubMed links)

 Score =  158 bits (399),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/193 (40%), Positives = 126/193 (65%), Gaps = 1/193 (0%)

Query  21    SLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQTFLDAFDIVD  80
             +L  +N KA E +  V   Y  +  ++  LE E+ SI+ FI +IE++KK  F+  FD + 
Sbjct  962   ALEPVNMKAIEDFEVVERRYLELKSKRERLEAEKDSIIEFINEIEKEKKNVFMKTFDAIA  1021

Query  81    KEIRTIFNKMT-GGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISGGEKTLAAIVF  139
             K    +F +++ GG+A L ++N DD F+ GL    +   K  +   ++SGGEK L A+ F
Sbjct  1022  KNFSELFARLSPGGSARLILENPDDPFSGGLEIEAKPAGKDVKRIEAMSGGEKALTALAF  1081

Query  140   VLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKDSVVQKAKLIY  199
             + A+QK KP+PFYLFDE+DAHLD  N +R++ ++ E S+ESQFI+++L+D ++  A+ I 
Sbjct  1082  IFAIQKFKPAPFYLFDEIDAHLDDANVKRVADLIKESSKESQFIVITLRDVMMANAEKII  1141

Query  200   GVYPKNGVSQVVT  212
             GV  ++GVS+VV+
Sbjct  1142  GVSMRDGVSKVVS  1154


>emb|CAD66602.1|  SMC protein [Pyrococcus furiosus]
Length=1177

 Score =  158 bits (399),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 126/194 (64%), Gaps = 1/194 (0%)

Query  20    KSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQTFLDAFDIV  79
             +SL  +N KA E +  V   Y  +  ++  LE E+ SI+ FI +IE++KK  F+  F+ +
Sbjct  961   RSLEPVNMKAIEDFEIVERRYLELKSKREKLEAEKESIIEFINEIEKEKKNVFMRTFEAI  1020

Query  80    DKEIRTIFNKMT-GGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISGGEKTLAAIV  138
              +    IF K++ GG+A L ++N +D F+ GL    +   K  +   ++SGGEK L A+ 
Sbjct  1021  SRNFSEIFAKLSPGGSARLILENPEDPFSGGLEIEAKPAGKDVKRIEAMSGGEKALTALA  1080

Query  139   FVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKDSVVQKAKLI  198
             FV A+QK KP+PFYLFDE+DAHLD  N +R++ ++ E S+ESQFI+++L+D ++  A  I
Sbjct  1081  FVFAIQKFKPAPFYLFDEIDAHLDDANVKRVADLIKESSKESQFIVITLRDVMMANADKI  1140

Query  199   YGVYPKNGVSQVVT  212
              GV  ++GVS+VV+
Sbjct  1141  IGVSMRDGVSKVVS  1154


>ref|NP_579572.1| Gene info chromosome segregation protein smc [Pyrococcus furiosus DSM 3638]
 gb|AAL81967.1| Gene info chromosome segregation protein smc [Pyrococcus furiosus DSM 3638]
Length=1291

 GENE ID: 1469722 PF1843 | chromosome segregation protein smc
[Pyrococcus furiosus DSM 3638] (10 or fewer PubMed links)

 Score =  157 bits (397),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 126/194 (64%), Gaps = 1/194 (0%)

Query  20    KSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQTFLDAFDIV  79
             +SL  +N KA E +  V   Y  +  ++  LE E+ SI+ FI +IE++KK  F+  F+ +
Sbjct  1075  RSLEPVNMKAIEDFEIVERRYLELKSKREKLEAEKESIIEFINEIEKEKKNVFMRTFEAI  1134

Query  80    DKEIRTIFNKMT-GGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISGGEKTLAAIV  138
              +    IF K++ GG+A L ++N +D F+ GL    +   K  +   ++SGGEK L A+ 
Sbjct  1135  SRNFSEIFAKLSPGGSARLILENPEDPFSGGLEIEAKPAGKDVKRIEAMSGGEKALTALA  1194

Query  139   FVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKDSVVQKAKLI  198
             FV A+QK KP+PFYLFDE+DAHLD  N +R++ ++ E S+ESQFI+++L+D ++  A  I
Sbjct  1195  FVFAIQKFKPAPFYLFDEIDAHLDDANVKRVADLIKESSKESQFIVITLRDVMMANADKI  1254

Query  199   YGVYPKNGVSQVVT  212
              GV  ++GVS+VV+
Sbjct  1255  IGVSMRDGVSKVVS  1268


>ref|NP_126050.1| Gene info chromosome segregation protein smc1 [Pyrococcus abyssi GE5]
 emb|CAB49281.1| Gene info smc1 chromosome segregation protein [Pyrococcus abyssi GE5]
Length=1177

 GENE ID: 1495249 PAB2109 | chromosome segregation protein smc1
[Pyrococcus abyssi GE5] (10 or fewer PubMed links)

 Score =  157 bits (397),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/194 (40%), Positives = 127/194 (65%), Gaps = 1/194 (0%)

Query  20    KSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQTFLDAFDIV  79
             +SL  +N KA E +  V   Y  +  ++  LE E+ SI+ FI +IE++KK  F+  F+ +
Sbjct  961   RSLEPVNMKAIEDFEVVERRYLELKSKREKLEAEKESIIEFINEIEKEKKNVFMRTFEAI  1020

Query  80    DKEIRTIFNKMT-GGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISGGEKTLAAIV  138
              K    +F K++ GG+A L ++N +D F+ GL    +   K  +   ++SGGEK L A+ 
Sbjct  1021  AKNFSELFAKLSPGGSARLILENPEDPFSGGLEIEAKPAGKDVKRIEAMSGGEKALTALA  1080

Query  139   FVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKDSVVQKAKLI  198
             F+ A+QK KP+PFYLFDE+DAHLD  N +R++ ++ E S+ESQFI+++L+D ++  A+ I
Sbjct  1081  FIFAIQKFKPAPFYLFDEIDAHLDDANVKRVADLIKESSKESQFIVITLRDVMMANAEKI  1140

Query  199   YGVYPKNGVSQVVT  212
              GV  ++GVS+VV+
Sbjct  1141  IGVSMRDGVSKVVS  1154


>ref|ZP_01631730.1|  chromosome segregation protein [Nodularia spumigena CCY9414]
 gb|EAW43634.1|  chromosome segregation protein [Nodularia spumigena CCY9414]
Length=1206

 Score =  147 bits (371),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 133/214 (62%), Gaps = 4/214 (1%)

Query  7     DVESIIQGLNTEQKSLTAL---NGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEK  63
             D+E + + L +  K L A+   N  A E+Y       + ++ +  +LE ERT ++  IE 
Sbjct  987   DLEELQKELRSLAKRLQAMEPVNMLALEEYERTQNRLQELTEKLQTLEAERTELLLRIEN  1046

Query  64    IERDKKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRE  123
                 +++ F +AFD V++  ++IF  ++ G+ +L+++N +DIFNSGL+ +     KP + 
Sbjct  1047  FTTLRQRAFKEAFDAVNENFQSIFAILSDGDGYLQLENPEDIFNSGLNLVAHPKGKPVQR  1106

Query  124   STSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFI  183
               S+SGGEK+L A+ F+ ALQ+ +PSPFY FDEVD  LD  N ERL++++ + +Q++QFI
Sbjct  1107  LASMSGGEKSLTALSFIFALQRYRPSPFYAFDEVDMFLDGANVERLARMIKQEAQQAQFI  1166

Query  184   MVSLKDSVVQKAKLIYGVYPKNGV-SQVVTYKDK  216
             +VSL+  +++ A+   GV    G  +QV+  K K
Sbjct  1167  VVSLRRPMIESAERTIGVTQARGAYTQVLGIKLK  1200


>ref|YP_183430.1| Gene info chromosome segregation ATPase [Thermococcus kodakarensis KOD1]
 dbj|BAD85206.1| Gene info chromosome segregation ATPase [Thermococcus kodakarensis KOD1]
Length=1189

 GENE ID: 3233793 TK1017 | chromosome segregation ATPase
[Thermococcus kodakarensis KOD1] (10 or fewer PubMed links)

 Score =  146 bits (369),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 78/202 (38%), Positives = 125/202 (61%), Gaps = 1/202 (0%)

Query  12    IQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQT  71
             I+ +  E +SL  +N KA E +  V   Y  +S ++  +  E+ SI  FI++IE  K+Q 
Sbjct  958   IEKMEEEIRSLEPVNMKAIEDFEVVERRYLELSSKREQVLAEKESIEEFIQEIEGQKRQV  1017

Query  72    FLDAFDIVDKEIRTIFNKMT-GGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISGG  130
             FL   + + K    +F K++ GG A L ++N +D F+ GL    +   K  +   ++SGG
Sbjct  1018  FLQTLNAIAKNFSELFAKLSPGGEAKLILENPEDPFSGGLEIEAKPAGKDVKRIEAMSGG  1077

Query  131   EKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKDS  190
             EK + A+ FV A+Q+ KP+PFYL DE+DAHLD  N +R++ ++ E SQ SQFI+++ +D 
Sbjct  1078  EKAIIALAFVFAIQRYKPAPFYLLDEIDAHLDDANVKRVADLIKEASQNSQFIVITHRDV  1137

Query  191   VVQKAKLIYGVYPKNGVSQVVT  212
             ++ +A  I GV  +NGVS+VV+
Sbjct  1138  MMAQADRIIGVSMRNGVSKVVS  1159


>ref|NP_485171.1| Gene info chromosome segregation protein [Nostoc sp. PCC 7120]
 dbj|BAB73085.1| Gene info chromosome segregation protein [Nostoc sp. PCC 7120]
Length=1208

 GENE ID: 1104722 alr1128 | chromosome segregation protein [Nostoc sp. PCC 7120]
(10 or fewer PubMed links)

 Score =  146 bits (369),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/212 (37%), Positives = 130/212 (61%), Gaps = 4/212 (1%)

Query  7     DVESIIQGLNTEQKSLTAL---NGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEK  63
             D+E + + L +  K L A+   N  A E+Y         +S +  +LEGERT ++  IE 
Sbjct  989   DLEELQKELRSLAKRLQAMEPVNMLALEEYERTQKRLEELSQKLQTLEGERTELLLRIEN  1048

Query  64    IERDKKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRE  123
                 ++  F +AFD V++  ++IF  ++ G+ +L++ N +D FNSGL+ +     KP + 
Sbjct  1049  FTTLRQIAFKEAFDAVNENFQSIFATLSDGDGYLQLDNPEDPFNSGLNLVAHPKGKPVQR  1108

Query  124   STSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFI  183
               S+SGGEK+L A+ F+ ALQ+ +PSPFY FDEVD  LD  N ERLS+++ +++Q++QFI
Sbjct  1109  LASMSGGEKSLTALSFIFALQRYRPSPFYAFDEVDMFLDGANVERLSRMIKQQAQQAQFI  1168

Query  184   MVSLKDSVVQKAKLIYGVYPKNGV-SQVVTYK  214
             +VSL+  +++ A+   GV    G  +QV+  K
Sbjct  1169  VVSLRRPMIESAERTIGVTQARGAYTQVLGIK  1200


>ref|ZP_01622284.1|  Chromosome segregation protein SMC [Lyngbya sp. PCC 8106]
 gb|EAW35749.1|  Chromosome segregation protein SMC [Lyngbya sp. PCC 8106]
Length=1217

 Score =  145 bits (366),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 127/207 (61%), Gaps = 3/207 (1%)

Query  4     EDFDVESIIQGLNTEQKSLTAL---NGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNF  60
             E+ D+ S+ + L   QK + AL   N  A E++         +S +  +LEGERT ++  
Sbjct  1002  ENLDLASLQRELKALQKQMEALEPVNMLALEEFQRTQTRLDELSQKLTTLEGERTELLLR  1061

Query  61    IEKIERDKKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKP  120
             IE     +++ F +AFD V++  +TIF  ++ G+ +L+I + +D FNSGL+ +     KP
Sbjct  1062  IENFTTLRQRAFQEAFDAVNENFQTIFASLSDGDGYLQIDDLEDPFNSGLNLIAHPKGKP  1121

Query  121   KRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQES  180
              +   S+SGGEK+L A+ F+ +LQ+ +PSPFY FDEVD  LD  N ERL++++  ++Q++
Sbjct  1122  VQRLASMSGGEKSLTALSFIFSLQRYRPSPFYAFDEVDMFLDGANVERLARMIKRQAQQA  1181

Query  181   QFIMVSLKDSVVQKAKLIYGVYPKNGV  207
             QFI+VSL+  +++ ++   GV    G 
Sbjct  1182  QFIVVSLRRPMMEASERTIGVTQARGA  1208


>ref|YP_721304.1| Gene info condensin subunit Smc [Trichodesmium erythraeum IMS101]
 gb|ABG50831.1| Gene info condensin subunit Smc [Trichodesmium erythraeum IMS101]
Length=1219

 GENE ID: 4242030 Tery_1551 | condensin subunit Smc
[Trichodesmium erythraeum IMS101]

 Score =  145 bits (366),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 132/209 (63%), Gaps = 1/209 (0%)

Query  7     DVESIIQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIER  66
             ++E  ++ L  + ++L  +N  A E+Y         +S +  +LE ERT+++  IE    
Sbjct  1007  ELEKEVRSLQKQLQALEPVNMLALEEYEQTQKRLEELSQKLGTLEEERTALLLRIENFTT  1066

Query  67    DKKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTS  126
              ++++F +AF+ V+K  +TIF  ++ G+ +L++ N++D FNSGL+ +     KP +   S
Sbjct  1067  MRQRSFFEAFNAVNKNFQTIFAALSEGDGYLQLDNQEDPFNSGLNLVAHPKGKPVQRLAS  1126

Query  127   ISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVS  186
             +SGGEK+L A+ F+ ALQ+ +PSPFY FDEVD  LD  N ERL+K++ ++++ +QFI+VS
Sbjct  1127  MSGGEKSLTALSFIFALQRYRPSPFYAFDEVDMFLDGANVERLAKMIKQQAEGAQFIVVS  1186

Query  187   LKDSVVQKAKLIYGVYPKNGV-SQVVTYK  214
             L+  +++ ++   GV    G  +QV+  K
Sbjct  1187  LRRPMMELSERTIGVTQARGAYTQVLGIK  1215


>ref|YP_001868984.1| Gene info chromosome segregation protein SMC [Nostoc punctiforme PCC 73102]
 gb|ACC84041.1| Gene info chromosome segregation protein SMC [Nostoc punctiforme PCC 73102]
Length=1223

 GENE ID: 6255087 Npun_R5741 | chromosome segregation protein SMC
[Nostoc punctiforme PCC 73102]

 Score =  145 bits (365),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 132/212 (62%), Gaps = 4/212 (1%)

Query  7     DVESIIQGLNTEQKSLTAL---NGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEK  63
             D+E + + L +  K L A+   N  A E+Y       + ++ +  +LEGERT ++  IE 
Sbjct  1004  DLEELQKELRSLTKRLQAMEPVNMLALEEYERTQNRLQELTQKLETLEGERTELLLRIEN  1063

Query  64    IERDKKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRE  123
                 ++  F +AFD V++  ++IF  ++ G+ +L+++N +D F+SGL+ +     KP + 
Sbjct  1064  FTTLRQLAFKEAFDAVNENFQSIFAILSDGDGYLQLENPEDPFSSGLNLVAHPKGKPVQR  1123

Query  124   STSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFI  183
               S+SGGEK+L A+ F+ ALQ+ +PSPFY FDEVD  LD  N ERL+K++ ++SQ++QFI
Sbjct  1124  LASMSGGEKSLTALSFIFALQRYRPSPFYAFDEVDMFLDGANVERLAKMIKQQSQQAQFI  1183

Query  184   MVSLKDSVVQKAKLIYGVYPKNGV-SQVVTYK  214
             +VSL+  +++ A+   GV    G  +QV+  K
Sbjct  1184  VVSLRRPMIESAERTIGVTQARGAYTQVLGIK  1215


>ref|YP_325181.1| Gene info condensin subunit Smc [Anabaena variabilis ATCC 29413]
 gb|ABA24286.1| Gene info condensin subunit Smc [Anabaena variabilis ATCC 29413]
Length=1208

 GENE ID: 3679806 Ava_4689 | condensin subunit Smc
[Anabaena variabilis ATCC 29413]

 Score =  143 bits (360),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 129/212 (60%), Gaps = 4/212 (1%)

Query  7     DVESIIQGLNTEQKSLTAL---NGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEK  63
             D+E + + L +  K L A+   N  A E+Y         ++ +  +LE ERT ++  IE 
Sbjct  989   DLEELQKELRSLSKRLQAMEPVNMLALEEYERTQKRLEELTQKLETLEAERTELLLRIEN  1048

Query  64    IERDKKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRE  123
                 ++  F +AFD V++  ++IF  ++ G+ +L++ N +D FNSGL+ +     KP + 
Sbjct  1049  FTTLRQIAFKEAFDAVNENFQSIFATLSDGDGYLQLDNPEDPFNSGLNLVAHPKGKPVQR  1108

Query  124   STSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFI  183
               S+SGGEK+L A+ F+ ALQ+ +PSPFY FDEVD  LD  N ERLS+++ +++Q++QFI
Sbjct  1109  LASMSGGEKSLTALSFIFALQRYRPSPFYAFDEVDMFLDGANVERLSRMIKQQAQQAQFI  1168

Query  184   MVSLKDSVVQKAKLIYGVYPKNGV-SQVVTYK  214
             +VSL+  +++ A+   GV    G  +QV+  K
Sbjct  1169  VVSLRRPMIESAERTIGVTQARGAYTQVLGIK  1200


>ref|NP_440691.1| Gene info chromosome segregation protein SMC1 [Synechocystis sp. PCC 6803]
 dbj|BAA17371.1| Gene info chromosome segregation protein SMC1 [Synechocystis sp. PCC 6803]
Length=1200

 GENE ID: 953994 sll1120 | chromosome segregation protein SMC1
[Synechocystis sp. PCC 6803] (10 or fewer PubMed links)

 Score =  143 bits (360),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 130/211 (61%), Gaps = 4/211 (1%)

Query  8     VESIIQGLNTEQKSLTAL---NGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKI  64
             +E + + +   QK L A+   N  A ++Y         +S +  ++ GERT ++  IE  
Sbjct  989   LEELERSIRNGQKRLEAMEPVNMLALQEYEKTEARLGELSEKLQTIAGERTELLLRIENF  1048

Query  65    ERDKKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRES  124
                ++++F DAFD V+K  + IF +++ G+ +L++ + +D FN GL+ +     KP R  
Sbjct  1049  TTLRRRSFQDAFDAVNKNFQIIFAELSDGDGYLQLDDAEDPFNGGLNLVAHPKGKPVRRL  1108

Query  125   TSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIM  184
             +S+SGGEK+L A+ F+ ALQ+ +PSPFY FDEVD  LD  N E+LSK++ +++Q++QFI+
Sbjct  1109  SSMSGGEKSLTALSFIFALQRYRPSPFYGFDEVDMFLDGANVEKLSKMVRKQAQQAQFIV  1168

Query  185   VSLKDSVVQKAKLIYGVYPKNGV-SQVVTYK  214
             VSL+  +++ A+   GV    G  +QV+  K
Sbjct  1169  VSLRRPMIEAAERTIGVTQARGAHTQVLGIK  1199


>ref|ZP_02177592.1|  citrate synthase [Hydrogenivirga sp. 128-5-R1-1]
 gb|EDP75675.1|  citrate synthase [Hydrogenivirga sp. 128-5-R1-1]
Length=1158

 Score =  140 bits (354),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 127/197 (64%), Gaps = 1/197 (0%)

Query  15    LNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQTFLD  74
             +  E + L  +N KA E Y +    Y+    +   L+ ER +I   IE+IE  K + F +
Sbjct  946   IERELEHLGNVNLKADEDYNEELERYQDYEDKHRKLQEERKAIKEMIEEIETKKLRAFTE  1005

Query  75    AFDIVDKEIRTIFNKMT-GGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISGGEKT  133
             AF+ ++K ++ IF+ ++ GG A + ++NE D F+ G+S +++   K  +   ++SGGEKT
Sbjct  1006  AFENINKSLKKIFSFLSPGGRAQMMVENEIDPFSGGISLVVKPRGKDVQYLEAMSGGEKT  1065

Query  134   LAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKDSVVQ  193
             LAA+  + A+Q+ KPSPFY FDEVDAHLD  N++++ +++ E+S+E+QFI+V+L++ +  
Sbjct  1066  LAALSLIFAIQEYKPSPFYYFDEVDAHLDEANAKKVGELIKEKSKEAQFIVVTLREVLAT  1125

Query  194   KAKLIYGVYPKNGVSQV  210
              A  + GV  + G+S+V
Sbjct  1126  FADRLIGVSARGGISRV  1142


>ref|ZP_03137228.1|  chromosome segregation protein SMC [Cyanothece sp. PCC 7425]
 gb|EDY11940.1|  chromosome segregation protein SMC [Cyanothece sp. PCC 7425]
Length=1198

 Score =  140 bits (353),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 80/212 (37%), Positives = 132/212 (62%), Gaps = 4/212 (1%)

Query  4     EDFDVESIIQGLNTEQKSLTAL---NGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNF  60
             E+ D+E + Q L ++QK L A+   N  A E+Y         +S + N+LE ERT ++  
Sbjct  978   ENLDLEQLRQELRSQQKRLQAMEPVNMLAIEEYERTQTRLEELSEKLNTLEEERTELLLR  1037

Query  61    IEKIERDKKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKP  120
             IE     + Q F +AFD V+   +TIF +++ G+ +L+++N +D F  GL+ +     KP
Sbjct  1038  IENFTTLRHQAFREAFDAVNANFQTIFAELSDGDGYLQLENPEDPFQGGLNLVAHPKGKP  1097

Query  121   KRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQES  180
              +   S+SGGEK+L A+ F+ ALQ+ +PSPFY FDEVD  LD  N E+LS+++ +++Q++
Sbjct  1098  VQRLASMSGGEKSLTALSFIFALQRYRPSPFYAFDEVDMFLDGANVEKLSRMIQKQAQQA  1157

Query  181   QFIMVSLKDSVVQKAKLIYGVYPKNGV-SQVV  211
             QFI+VSL+  +++ ++   GV    G  +QV+
Sbjct  1158  QFIVVSLRRPMIEASERTIGVTQARGTHTQVI  1189


>ref|NP_213438.1| Gene info chromosome assembly protein [Aquifex aeolicus VF5]
 gb|AAC06839.1| Gene info chromosome assembly protein homolog [Aquifex aeolicus VF5]
Length=1156

 GENE ID: 1193940 xcpC | chromosome assembly protein [Aquifex aeolicus VF5]
(10 or fewer PubMed links)

 Score =  136 bits (343),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 129/205 (62%), Gaps = 1/205 (0%)

Query  12    IQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQT  71
             ++ +  E + L ++N +A E Y +    +     ++  L+ E  +I   IE+ E  K++ 
Sbjct  942   LKRVTEEIQKLGSVNFRAEEDYAEELKRFNDYKEKQQKLKEESKAIKKLIEETENKKRKV  1001

Query  72    FLDAFDIVDKEIRTIFNKMT-GGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISGG  130
             FL+AF+ ++K ++ IF+ ++ GG A + + N +D F+ G+   ++   K  +   ++SGG
Sbjct  1002  FLEAFNQINKSLKRIFSFLSPGGKAQMFLDNPEDPFSGGVQLTVKPRGKDVQYLEAMSGG  1061

Query  131   EKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKDS  190
             EKTLAA+  + ALQ+ KPSPFY FDEVDAHLD  N++++ +++ E+S+E+QFI+V+L++ 
Sbjct  1062  EKTLAALSLIFALQEYKPSPFYYFDEVDAHLDEVNAKKVGELIREKSKEAQFIVVTLREV  1121

Query  191   VVQKAKLIYGVYPKNGVSQVVTYKD  215
             V   A  I GV  + G+S+V   K+
Sbjct  1122  VTSFADKIVGVSARGGISEVFFLKN  1146


>ref|YP_001405342.1| Gene info chromosome segregation protein SMC [Candidatus Methanoregula 
boonei 6A8]
 gb|ABS56699.1| Gene info chromosome segregation protein SMC [Candidatus Methanoregula 
boonei 6A8]
Length=1146

 GENE ID: 5412218 Mboo_2185 | chromosome segregation protein SMC
[Candidatus Methanoregula boonei 6A8]

 Score =  135 bits (341),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 117/191 (61%), Gaps = 0/191 (0%)

Query  22    LTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQTFLDAFDIVDK  81
             + A+N  A E+Y  +    +  + RK++L  ER +++  IEK E+ K + F+ AF  +D 
Sbjct  950   IGAVNMLAIEEYEKIERQVQERTERKDTLSKERETLIERIEKYEQMKFEAFMTAFKAIDT  1009

Query  82    EIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISGGEKTLAAIVFVL  141
               R IF ++T G+  L ++NE+D F  GL++ ++  +K     +S+SGGEK+L  + F+ 
Sbjct  1010  NFREIFARLTSGSGNLVLENEEDPFTGGLTFAVKPRDKKVHLLSSLSGGEKSLTTLAFIF  1069

Query  142   ALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKDSVVQKAKLIYGV  201
             ++Q   P+PFY FDEVD  LD  N ER++ ++ E +  SQF++VSL+  +++ A+ I GV
Sbjct  1070  SIQHHIPAPFYAFDEVDMSLDGANVERIAAMIQELAPSSQFVIVSLRKPMIEAAQRIMGV  1129

Query  202   YPKNGVSQVVT  212
               +   S +VT
Sbjct  1130  TIRPDKSTLVT  1140


>ref|NP_248653.1| Gene info chromosome segretation protein (smc1) [Methanocaldococcus jannaschii 
DSM 2661]
 sp|Q59037|SMC_METJA  Chromosome partition protein smc homolog
 gb|AAB99663.1| Gene info chromosome segretation protein (smc1) [Methanocaldococcus jannaschii 
DSM 2661]
Length=1169

 GENE ID: 1452552 MJ1643 | chromosome segretation protein (smc1)
[Methanocaldococcus jannaschii DSM 2661] (10 or fewer PubMed links)

 Score =  134 bits (336),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/215 (36%), Positives = 130/215 (60%), Gaps = 8/215 (3%)

Query  2     ELEDFDVESI---IQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIV  58
             ELE  D+E +   I  L  E KSL  +N +A E Y  V+  Y+ +  ++   E +    +
Sbjct  954   ELEKKDIEELEIYIGELENEIKSLEPVNMRAIEDYNYVAERYKELIEKRKEYERDEKKYL  1013

Query  59    NFIEKIERDKKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPN  118
               +E++E  KK+ F++ F+ V K    ++ K  GG   L ++NE + F  G+  LI    
Sbjct  1014  QLMEELENKKKEVFMEVFNKVAKNFEEVY-KEIGGIGKLSLENEKNPFEGGI--LIDASP  1070

Query  119   KPKREST--SISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDER  176
             + K+  +  ++SGGEK+L A+ F+ A+Q+L PSPFY+ DEVDA LD  N   ++ ++   
Sbjct  1071  RGKKLLSLDAMSGGEKSLTALAFLFAIQRLNPSPFYVLDEVDAALDVKNVSLIADMIKNA  1130

Query  177   SQESQFIMVSLKDSVVQKAKLIYGVYPKNGVSQVV  211
             S++SQFI++S ++ +V KA ++YGVY +NG+S+VV
Sbjct  1131  SKDSQFIVISHREQMVSKADVVYGVYMENGLSKVV  1165


>ref|NP_070387.1| Gene info chromosome segregation protein (smc1) [Archaeoglobus fulgidus 
DSM 4304]
 gb|AAB89690.1| Gene info chromosome segregation protein (smc1) [Archaeoglobus fulgidus 
DSM 4304]
Length=1156

 GENE ID: 1484786 smc1 | chromosome segregation protein (smc1)
[Archaeoglobus fulgidus DSM 4304] (10 or fewer PubMed links)

 Score =  134 bits (336),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 125/208 (60%), Gaps = 2/208 (0%)

Query  8     VESIIQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERD  67
             VE ++  +  E  +   +N KA ++Y +V      +  +K  LE ER  I++ IEK ER 
Sbjct  947   VEKVLDEVLVELSTFGDVNLKAIQEYEEVKARRDELVEKKMVLEKERADILDRIEKYERM  1006

Query  68    KKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSI  127
             K++ F + F  +++    I  ++  G   L + + DD FNSGL   ++  NKP ++  S+
Sbjct  1007  KREIFFEVFTAINRNFAEIIRELANGEGELYLDS-DDPFNSGLYIKVKPNNKPVQKLESM  1065

Query  128   SGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSL  187
             SGGEK+L A+  + A+Q  KP+PFY FDEVD  LD  N  R++K++ +RS+++QFI+VSL
Sbjct  1066  SGGEKSLVALALIFAIQMYKPAPFYAFDEVDMFLDGVNVGRVAKMIKKRSKDAQFIVVSL  1125

Query  188   KDSVVQKAKLIYGV-YPKNGVSQVVTYK  214
             +  ++++A  I G+   ++ VSQV   K
Sbjct  1126  RKPMLEQADAIVGITLGRDNVSQVTGIK  1153


>ref|YP_136259.1| Gene info chromosome segregation protein [Haloarcula marismortui ATCC 43049]
 gb|AAV46553.1| Gene info chromosome segregation protein [Haloarcula marismortui ATCC 43049]
Length=1195

 GENE ID: 3128252 smc2 | chromosome segregation protein
[Haloarcula marismortui ATCC 43049] (10 or fewer PubMed links)

 Score =  133 bits (335),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/205 (33%), Positives = 125/205 (60%), Gaps = 0/205 (0%)

Query  8     VESIIQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERD  67
             VE  I  L TE + L  +N +A E+Y  V+   + +  +K +L  E   I + I+  E  
Sbjct  973   VEQEIDRLETEMEKLEPVNMRAIEEYDRVNDDLQELEDKKATLVEEADGIRDRIDTYEAR  1032

Query  68    KKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSI  127
             KK+TF+++F  ++ + + IF +++ G   L +++EDD F  GL+   Q  +KP +   ++
Sbjct  1033  KKETFMESFTEINDQFQNIFERLSNGTGHLHLEDEDDPFEGGLTMKAQPGDKPIQRLNAM  1092

Query  128   SGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSL  187
             SGGEK+L A+ F+ A+Q+  P+PFY  DEVDA LDA N++ + +++DE + ++QF++VS 
Sbjct  1093  SGGEKSLTALAFIFAIQRHNPAPFYALDEVDAFLDAANADLVGELVDELAGDAQFVVVSH  1152

Query  188   KDSVVQKAKLIYGVYPKNGVSQVVT  212
             + +++++++   GV  +      VT
Sbjct  1153  RSAMLERSERAIGVMMQGDNVSAVT  1177


>ref|ZP_02016864.1|  chromosome segregation protein SMC [Halorubrum lacusprofundi 
ATCC 49239]
 gb|EDN48336.1|  chromosome segregation protein SMC [Halorubrum lacusprofundi 
ATCC 49239]
Length=1193

 Score =  132 bits (332),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 128/202 (63%), Gaps = 1/202 (0%)

Query  1     DELEDFD-VESIIQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVN  59
             DE+ D D VES I+ L  E  +L  +N  A ++Y +V     ++  R++ L  ER +I  
Sbjct  965   DEIPDLDEVESRIEELEEEMAALEPVNMLAIDEYDEVEEALETLQERRDVLVEERDAIAE  1024

Query  60    FIEKIERDKKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNK  119
              IE  E +KK+TF++ F+ ++ +   IF +++ G+  L ++N +D F  GL+   Q  +K
Sbjct  1025  RIEGYEAEKKRTFMETFESINDQFEDIFARLSAGSGELLLENPEDPFEEGLTMKAQPADK  1084

Query  120   PKRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQE  179
             P +   ++SGGEK+L A+ F+ A+Q+  P+PFY  DE+DA LDA N+ER+ ++++E ++E
Sbjct  1085  PVQRLDAMSGGEKSLTALSFIFAIQRHNPAPFYALDEIDAFLDAVNAERVGEMIEELAEE  1144

Query  180   SQFIMVSLKDSVVQKAKLIYGV  201
             +QF++V  + ++++++    GV
Sbjct  1145  AQFVVVGHRSALLERSDRAIGV  1166


>ref|YP_001325175.1| Gene info chromosome segregation protein SMC [Methanococcus aeolicus Nankai-3]
 gb|ABR56563.1| Gene info chromosome segregation protein SMC [Methanococcus aeolicus Nankai-3]
Length=1191

 GENE ID: 5326307 Maeo_0985 | chromosome segregation protein SMC
[Methanococcus aeolicus Nankai-3]

 Score =  131 bits (329),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 127/216 (58%), Gaps = 5/216 (2%)

Query  1     DELEDFDVESIIQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNF  60
             +E+ D ++E +   L+   K L  +N +A E Y  +   Y  +  ++   E +    +  
Sbjct  978   NEMNDTELEQLTIKLDNSIKRLEPINMRAIEDYEYIEQRYNELFDKRKEYEQDEKKYIQL  1037

Query  61    IEKIERDKKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKP  120
             IE++E+ KK+ FLD ++ V K    ++ K  GG   L ++N D+ F  GL  LI    + 
Sbjct  1038  IEEVEKRKKEVFLDVYEKVAKNYEEMY-KNIGGTGKLSLENPDNPFEGGL--LIDASPRG  1094

Query  121   KREST--SISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQ  178
             K   T   +SGGEK+L A+ F+ A+Q+L P+PFY+ DEVDA LD  N+  + +++   S+
Sbjct  1095  KSLQTLDVMSGGEKSLTALAFLFAIQRLTPAPFYVLDEVDAALDTKNAGLIGEMVANASK  1154

Query  179   ESQFIMVSLKDSVVQKAKLIYGVYPKNGVSQVVTYK  214
             ESQF+++S ++ ++ KA  +YGVY ++G+S++V  K
Sbjct  1155  ESQFVVISHREQMIAKANTLYGVYMEDGLSKIVGVK  1190


>ref|NP_279433.1| Gene info Smc1 [Halobacterium sp. NRC-1]
 ref|YP_001688521.1| Gene info chromosome segregation protein [Halobacterium salinarum R1]
 gb|AAG18913.1| Gene info chromosome segregation [Halobacterium sp. NRC-1]
 emb|CAP13170.1| Gene info chromosome segregation protein [Halobacterium salinarum R1]
Length=1190

 GENE ID: 1447220 smc1 | Smc1 [Halobacterium sp. NRC-1]
(10 or fewer PubMed links)

 Score =  129 bits (324),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/201 (31%), Positives = 120/201 (59%), Gaps = 0/201 (0%)

Query  12    IQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQT  71
             ++ L    ++L  +N  A ++Y  V+    S+  ++ +L  E   I   I + +  KK T
Sbjct  977   VERLGARMEALEPVNMLAIDEYESVADTLDSLEAQRATLTEEADGIRERIARYDEQKKST  1036

Query  72    FLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISGGE  131
             F+ AF+ ++     IF++++ G   LE++  DD F+ GL+   Q  +KP +   ++SGGE
Sbjct  1037  FMAAFEAINDHFHRIFSRLSAGTGGLELETPDDPFDGGLTMKAQPGDKPVQRLDAMSGGE  1096

Query  132   KTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKDSV  191
             K+L A+ F+ A+Q+  P+PFY  DEVDA LDA N++R+ +++DE + ++QF++VS + ++
Sbjct  1097  KSLTALAFIFAIQRHTPAPFYALDEVDAFLDAVNADRVGELVDELAGDAQFVVVSHRSAM  1156

Query  192   VQKAKLIYGVYPKNGVSQVVT  212
             + +++   GV  +     +VT
Sbjct  1157  LDRSERAIGVTMQADNRSIVT  1177


>ref|YP_843583.1| Gene info chromosome segregation protein SMC [Methanosaeta thermophila 
PT]
 gb|ABK14943.1| Gene info condensin subunit Smc [Methanosaeta thermophila PT]
Length=1171

 GENE ID: 4462964 Mthe_1161 | chromosome segregation protein SMC
[Methanosaeta thermophila PT]

 Score =  129 bits (324),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 114/190 (60%), Gaps = 0/190 (0%)

Query  12    IQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQT  71
             I+ L  E  SL  +N  A ++Y  V   +R++S R+  L  ER  I+  +E+ ++ KK  
Sbjct  966   IRALEEEMASLEPVNMLAIDEYERVDKRFRNLSDRREVLHREREGIIEKLERYDQLKKDA  1025

Query  72    FLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISGGE  131
             F+  F  V++  R IF++++GG+  L ++  DD  + G++   +   K      ++SGGE
Sbjct  1026  FMSCFAAVNQNFREIFHELSGGDGELVLECPDDPLSGGMTIRARPAGKVFHRLEAMSGGE  1085

Query  132   KTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKDSV  191
             K+L A+  + A+Q+ +P+PFY  DE+D  LD  N ER++K++   S+++QFI+VSL+  +
Sbjct  1086  KSLTALSLIFAIQRFRPAPFYAMDEIDMFLDGANVERVAKMIRRISRDAQFIVVSLRRPM  1145

Query  192   VQKAKLIYGV  201
             +Q+A    GV
Sbjct  1146  IQQASYTIGV  1155


>ref|YP_002121150.1| Gene info chromosome segregation protein SMC [Hydrogenobaculum sp. Y04AAS1]
 gb|ACG57172.1| Gene info chromosome segregation protein SMC [Hydrogenobaculum sp. Y04AAS1]
Length=1148

 GENE ID: 6743278 HY04AAS1_0484 | chromosome segregation protein SMC
[Hydrogenobaculum sp. Y04AAS1]

 Score =  129 bits (323),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 125/200 (62%), Gaps = 1/200 (0%)

Query  21    SLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQTFLDAFDIVD  80
             S++ +N KA E+Y +     +    + + L  ++ +I   IE+I+R K   F++AF+ + 
Sbjct  948   SMSDINLKAEEEYEETLNRLKDYKEKLDQLIKDKQAIKAMIEEIDRKKYSAFMEAFNNIR  1007

Query  81    KEIRTIFNKMT-GGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISGGEKTLAAIVF  139
             K  + I+ K++  G A L + NE+D F+ G+S  ++   K  +   ++SGGE+TLAA+  
Sbjct  1008  KNFKEIYAKVSYQGKADLSLDNEEDPFSGGVSIFVKPRGKDVQYVEAMSGGEQTLAAMSL  1067

Query  140   VLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKDSVVQKAKLIY  199
             + A+Q+ KPS FY FDE+DAHLD  N+  L +++ E+S+  QFI+V+L++++   A  + 
Sbjct  1068  IFAIQEYKPSVFYYFDEIDAHLDEANAYLLGQMIKEKSKNVQFIVVTLRENLANFADKLI  1127

Query  200   GVYPKNGVSQVVTYKDKRNV  219
             GV  K+G+S+ +T+K  + V
Sbjct  1128  GVTNKDGISKTLTFKSLKEV  1147


>ref|YP_001010382.1| Gene info SMC ATPase superfamily chromosome segregation protein [Prochlorococcus 
marinus str. MIT 9515]
 gb|ABM71275.1| Gene info putative chromosome segregation protein, SMC ATPase superfamily 
[Prochlorococcus marinus str. MIT 9515]
Length=1194

 GENE ID: 4719942 smc | SMC ATPase superfamily chromosome segregation protein
[Prochlorococcus marinus str. MIT 9515]

 Score =  129 bits (323),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 120/205 (58%), Gaps = 1/205 (0%)

Query  8     VESIIQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERD  67
             ++S I  LNT+ +SL  +N  A ++  +++    ++  R   L  ER+ ++  IE +   
Sbjct  984   LQSEIVILNTKLESLEPVNMLALDELEELTERLNNLIERLEVLSNERSELLLRIETVSTM  1043

Query  68    KKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSI  127
             +++ F+ AF  VDK  R IF  ++ G+ +L+++N D     GL+ +     K  R   S+
Sbjct  1044  RQEAFMQAFKEVDKHFREIFANLSDGDGFLQLENSDAPLEGGLTLVAHPKGKNVRRLASM  1103

Query  128   SGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSL  187
             SGGEK+L A+ F+ ALQK KPSPFY  DEVD+ LD  N ERLSK++  +S  +QFI+VS 
Sbjct  1104  SGGEKSLTALSFLFALQKYKPSPFYALDEVDSFLDGINVERLSKLITSQSSNAQFIVVSH  1163

Query  188   KDSVVQKAKLIYGVYPKNGV-SQVV  211
             +  ++  ++   GV    G  +QVV
Sbjct  1164  RRPMISASERTIGVAQARGANTQVV  1188


>ref|YP_401062.1| Gene info condensin subunit Smc [Synechococcus elongatus PCC 7942]
 gb|ABB58075.1| Gene info condensin subunit Smc [Synechococcus elongatus PCC 7942]
Length=1195

 GENE ID: 3774264 Synpcc7942_2045 | condensin subunit Smc
[Synechococcus elongatus PCC 7942]

 Score =  127 bits (320),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 65/195 (33%), Positives = 118/195 (60%), Gaps = 0/195 (0%)

Query  12    IQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQT  71
             ++ L    +++  +N  A E+Y         +S +  ++E ERT ++  IE     +++ 
Sbjct  990   LRSLAKRIQAMEPVNMLALEEYERTQARLEELSEKLTTIEAERTELLLRIENFTTLRRRA  1049

Query  72    FLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISGGE  131
             F+++F+ +D+  + IF  ++ G+  L++ N +D F+SGL+ +     KP R   S+SGGE
Sbjct  1050  FMESFEAIDRNFQEIFAHLSDGDGSLQLDNPEDPFSSGLNLIAHPKGKPVRRLASMSGGE  1109

Query  132   KTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKDSV  191
             K+L A+ F+ ALQ+ +PSPFY  DEVD+ LD  N ERL++++ +++Q +QFI+VS +  +
Sbjct  1110  KSLTALSFIFALQRYRPSPFYALDEVDSFLDGANVERLARVIRQQAQAAQFIVVSHRRPM  1169

Query  192   VQKAKLIYGVYPKNG  206
             ++ A+   GV    G
Sbjct  1170  IEAAERTIGVTQARG  1184


>ref|YP_476264.1| Gene info chromosome segregation protein SMC [Synechococcus sp. JA-3-3Ab]
 gb|ABD01001.1| Gene info chromosome segregation protein SMC [Synechococcus sp. JA-3-3Ab]
Length=1180

 GENE ID: 3898671 smc | chromosome segregation protein SMC
[Synechococcus sp. JA-3-3Ab] (10 or fewer PubMed links)

 Score =  127 bits (320),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 68/198 (34%), Positives = 121/198 (61%), Gaps = 1/198 (0%)

Query  15    LNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQTFLD  74
             +  + +SL  +N  A  +Y  +      ++ +  +L  ERT ++  IE     ++Q FLD
Sbjct  973   IEEQLRSLEPVNMLAIAEYEQIQARLGDLNAKLETLHQERTELLLRIENFSTLRRQAFLD  1032

Query  75    AFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISGGEKTL  134
             AF  ++   +TIF +++ G  +LE++N +D    GL+ + +   KP R  +++SGGEK+L
Sbjct  1033  AFHAINGHFQTIFAQLSEGEGYLELENPEDPLAGGLTLVARPKGKPVRRLSAMSGGEKSL  1092

Query  135   AAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKDSVVQK  194
              A+ F+ ALQ+ +PS FY FDEVD  LD  N E+L+ ++ ++S+++QF++VSL+  +++K
Sbjct  1093  TALSFIFALQRYRPSSFYAFDEVDMFLDGANVEKLADMIWQQSRQAQFLVVSLRRPMLEK  1152

Query  195   AKLIYGVYPKNGV-SQVV  211
             A+   GV    G  +QV+
Sbjct  1153  AERTIGVTQARGAYTQVI  1170


>ref|YP_172758.1| Gene info chromosome segregation protein SMC1 [Synechococcus elongatus 
PCC 6301]
 dbj|BAD80238.1| Gene info chromosome segregation protein SMC1 [Synechococcus elongatus 
PCC 6301]
Length=1167

 GENE ID: 3198669 syc2048_d | chromosome segregation protein SMC1
[Synechococcus elongatus PCC 6301] (10 or fewer PubMed links)

 Score =  127 bits (320),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 65/195 (33%), Positives = 118/195 (60%), Gaps = 0/195 (0%)

Query  12    IQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKIERDKKQT  71
             ++ L    +++  +N  A E+Y         +S +  ++E ERT ++  IE     +++ 
Sbjct  962   LRSLAKRIQAMEPVNMLALEEYERTQARLEELSEKLTTIEAERTELLLRIENFTTLRRRA  1021

Query  72    FLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRESTSISGGE  131
             F+++F+ +D+  + IF  ++ G+  L++ N +D F+SGL+ +     KP R   S+SGGE
Sbjct  1022  FMESFEAIDRNFQEIFAHLSDGDGSLQLDNPEDPFSSGLNLIAHPKGKPVRRLASMSGGE  1081

Query  132   KTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIMVSLKDSV  191
             K+L A+ F+ ALQ+ +PSPFY  DEVD+ LD  N ERL++++ +++Q +QFI+VS +  +
Sbjct  1082  KSLTALSFIFALQRYRPSPFYALDEVDSFLDGANVERLARVIRQQAQAAQFIVVSHRRPM  1141

Query  192   VQKAKLIYGVYPKNG  206
             ++ A+   GV    G
Sbjct  1142  IEAAERTIGVTQARG  1156


>ref|ZP_00517770.1|  GTP-binding [Crocosphaera watsonii WH 8501]
 gb|EAM49149.1|  GTP-binding [Crocosphaera watsonii WH 8501]
Length=1221

 Score =  127 bits (319),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 129/211 (61%), Gaps = 4/211 (1%)

Query  8     VESIIQGLNTEQKSLTAL---NGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFIEKI  64
             +E + + +   QK L A+   N  A E++         ++ +  +++GER  ++  IE  
Sbjct  1010  IEQLQKDIRNGQKRLEAMEPVNMLALEEHEKTQERLNELTEKLTTIQGERRELLLRIENF  1069

Query  65    ERDKKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKPKRES  124
                + ++F ++FD V++  + IF  ++ G+ +L+++NE+D F  GL+ +     KP +  
Sbjct  1070  TTLRFRSFKESFDAVNENFKNIFATLSQGDGYLKLENEEDPFQGGLNLVAHPKGKPVQRL  1129

Query  125   TSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQFIM  184
             +S+SGGEK+L A+ F+ ALQ+ +PSPFY FDEVD  LD  N ERLSK++ +++Q++QFI+
Sbjct  1130  SSMSGGEKSLTALSFIFALQRYRPSPFYAFDEVDMFLDGANVERLSKMIQQQAQQAQFIV  1189

Query  185   VSLKDSVVQKAKLIYGVYPKNGV-SQVVTYK  214
             VSL+  +++ ++   GV    G  +QV+  K
Sbjct  1190  VSLRRPMIEASQRTIGVTQARGAYTQVLGIK  1220


>ref|NP_682715.1| Gene info chromosome segregation SMC protein [Thermosynechococcus elongatus 
BP-1]
 dbj|BAC09477.1| Gene info chromosome segregation SMC protein [Thermosynechococcus elongatus 
BP-1]
Length=1168

 GENE ID: 1012436 tlr1925 | chromosome segregation SMC protein
[Thermosynechococcus elongatus BP-1] (10 or fewer PubMed links)

 Score =  127 bits (318),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 71/205 (34%), Positives = 122/205 (59%), Gaps = 0/205 (0%)

Query  2     ELEDFDVESIIQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNFI  61
             EL   D++   Q L    +++  +N  A +++ +     + +  +   L  ERT I+  I
Sbjct  950   ELSLRDIQQQCQALEQRLRAMEPVNMLAIQEFEETQARLKELQEKLAVLAAERTEILLRI  1009

Query  62    EKIERDKKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKPK  121
             E     + Q+F +AFD ++   +TIF  ++ G+ +L++++ +D F  GL+ +     KP 
Sbjct  1010  ENFTTLRHQSFREAFDAINANFQTIFATLSDGDGYLQLESPEDPFAGGLNLVAHPKGKPV  1069

Query  122   RESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQESQ  181
             +   S+SGGEK+L A+ F+ ALQ+ +PSPFY FDEVD  LD  N ERL+K++ ++SQ++Q
Sbjct  1070  QRLASMSGGEKSLTALSFIFALQRYRPSPFYAFDEVDMFLDGANVERLAKMIQQQSQQAQ  1129

Query  182   FIMVSLKDSVVQKAKLIYGVYPKNG  206
             FI+VSL+  +++ A+   GV    G
Sbjct  1130  FIVVSLRRPMIEAAQRTIGVTQARG  1154


ORF finding

PROTOCOLE: SMS ORF FINDER, paramètres : "any codon", cadre 1,2,3 sens direct et indirect, 60 codons minimum, code génétique bactérien

---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS: 

Nous avons fait la recherche d'ORF avec les mêmes paramètres mais en utilisant le code standard : 
nous avons obtenu les mêmes résultats qu'avec le code bactérien.

On obtient 2 ORF sur le brin direct dans le cadre 3 de lecture : un qui va du nucléotide 3 au 
nucléotide 317 (en incluant le codon "STOP") et un qui va du nucléotide 651 au nucléotide 881 (en 
incluant le codon "STOP"). 

On obtient un ORF sur le brin indirect dans le cadre 3 de lecture, qui va du nucléotide 3 au 
nucléotide 680 (en incluant le codon "STOP"). C'est à partir de cet ORF que nous ferons les diverses 
analyses car c'est le plus grand de tous les ORF obtenus. 

Cet ORF est assez grand pour dire qu'il s'agit d'une séquence codante (225 acides aminés).

La traduction de cet ORF ne commence pas par une méthionine. L'alignement multiple nous permettra 
de déterminer si cet ORF est complet ou si le début de la séquence codante se situe en 5' de la 
séquence analysée. 

---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:

SMS ORF FINDER, paramètres : "any codon", cadre 1,2,3 sens direct, 60 codons minimum, code génétique bactérien

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 3 to base 317.
GCTAGATATTTTGGACAAAGTATTGGCATATTATATTTAGGAAAGATTGTAGAGTTTGGA
CCAATCAATGAAGTATTGCTAAAACCAAAGCATCCCTATACTCAAGCACTCATTGATGCA
ATATCAGAACCAGATCCAGAAAATCTTTACAAAGAAAAGAAAATTCGAATTAATGAGCCA
TTAGAGATAGATATCTACAAGGGATGTAGGTTCAGAGCAAGATGCCCATATGCTATTGAA
AAATGCATAGAAGAGCCAAAATTAGTTAACATAGGTGACGAGCATCATGTTTCATGTTTT
GTGGAATTAGATTAA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
ARYFGQSIGILYLGKIVEFGPINEVLLKPKHPYTQALIDAISEPDPENLYKEKKIRINEP
LEIDIYKGCRFRARCPYAIEKCIEEPKLVNIGDEHHVSCFVELD*

>ORF number 2 in reading frame 3 on the direct strand extends from base 651 to base 881.
ATTAGATATGACAAACCTGAATTAAAGATATCATCTTCATTTTGTATTTCAAGCCATGCG
TTTCCTCCAGTCATCTTATTGAATATAGTACGAATTTCTTTATCTACAATATCAAATGCA
TCCAAGAATGTTTGTTTTTTATCCCTTTCAATTTTTTCAATAAAGTTAACTATTGATGTA
CGTTCTCCTTCAAGGGAGTTCTTTCTTACAGACATGGAGCGATATCCATAA

>Translation of ORF number 2 in reading frame 3 on the direct strand.
IRYDKPELKISSSFCISSHAFPPVILLNIVRISLSTISNASKNVCFLSLSIFSIKLTIDV
RSPSREFFLTDMERYP*

---------------------------------------------------------------------------------------------------

SMS ORF FINDER, paramètres : "any codon", cadre 1,2,3 sens indirect, 60 codons minimum, code génétique bactérien

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 3 to base 680.
GATGAACTTGAAGACTTTGATGTAGAGTCAATCATACAGGGACTTAACACAGAGCAAAAA
TCCCTCACTGCACTTAATGGCAAAGCCCCAGAGCAATACATGGATGTTTCTTATGGATAT
CGCTCCATGTCTGTAAGAAAGAACTCCCTTGAAGGAGAACGTACATCAATAGTTAACTTT
ATTGAAAAAATTGAAAGGGATAAAAAACAAACATTCTTGGATGCATTTGATATTGTAGAT
AAAGAAATTCGTACTATATTCAATAAGATGACTGGAGGAAACGCATGGCTTGAAATACAA
AATGAAGATGATATCTTTAATTCAGGTTTGTCATATCTAATTCAATTCCCCAATAAACCA
AAAAGAGAATCAACCTCAATTAGTGGTGGTGAAAAGACACTAGCTGCAATAGTCTTTGTT
TTGGCACTGCAAAAACTCAAACCTTCACCATTTTATCTATTTGATGAAGTTGATGCTCAC
CTTGATGCTCCAAACTCTGAACGCCTATCAAAAATTCTAGATGAAAGATCCCAAGAAAGC
CAATTCATTATGGTATCATTGAAGGATTCTGTTGTTCAAAAAGCCAAATTAATTTATGGT
GTATATCCAAAAAATGGTGTTTCACAAGTAGTTACATACAAAGACAAACGTAACGTACCA
TCATTACAAACAAGTTAA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
DELEDFDVESIIQGLNTEQKSLTALNGKAPEQYMDVSYGYRSMSVRKNSLEGERTSIVNF
IEKIERDKKQTFLDAFDIVDKEIRTIFNKMTGGNAWLEIQNEDDIFNSGLSYLIQFPNKP
KRESTSISGGEKTLAAIVFVLALQKLKPSPFYLFDEVDAHLDAPNSERLSKILDERSQES
QFIMVSLKDSVVQKAKLIYGVYPKNGVSQVVTYKDKRNVPSLQTS*