GOS 709030

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1092343626927
Annotathon code: GOS_709030
Sample :
  • GPS :15°16'40s; 148°13'28w
  • Polynesia Archipelagos: Tikehau Lagoon - Fr. Polynesia
  • Coral Atoll (-1.2m, 27.8°C, 0.1-0.8 microns)
Authors
Team : BioCell2008
Username : opale
Annotated on : 2009-02-04 21:56:41
  • boussoufa sabbah
  • fiteni betty

Synopsis

  • Taxonomy: Gammaproteobacteria (NCBI info)
    Rank: class - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 1236
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Gammaproteobacteria - Order:
    Bacteria; Proteobacteria; Gammaproteobacteria;

Genomic Sequence

>JCVI_READ_1092343626927 GOS_709030 genomic DNA
ATCGTTACGAAACTTGAGACTCAAGATTGAGCTGGCATGACACATCCCTATGAATCCTTAACGCCAGACTGTGTGGTTGACTGTCTCGAGAGTATTGGTC
TTGTTAGTGATTTGCGTCTTCTTGCGCTTAACAGCTACGAAAATCGTGTCTACCAAGTAGGGATTGAAGGTGATGATCCCCTCATTCTGAAATTTTACCG
TGCCGGACGATGGACTGACGCGCAGATACTCGAGGAGCATGCATTCGCGCGGGAGCTCGTTGATCATGAGATTTCAGTGGTCGCGCCAGAGTCGATTGCT
GGGGACACGCTTCATAACGTTTTGGGGCAGCGATTTTCGGTATTCAAGCGTCGTGGTGGTTATCCGCCTGAGCTCGATAATTTGGATCATCTGTACCGTT
TAGGGCAGACCCTAGGGCGCATTCATCGGGTGGGTGGCGCGACATCGTTTCTTCATCGCCGCGCGCTGTCCCCGACCCGGATGGCAACCGAGTCACGATT
GTTCGTAGAAACTGATTTTGTGCCTGTGGAGCTTCAATCGGCCTACAGGACATTGGCTCATGACTGCGATCAGGCGGCGACCGAGGTTTTGTCGGCAATG
ACAGCCGACGATCTTCAGCGTGTGCACGGTGATTGTCATGTGGGCAACATCTTATGGCGCGATGACACTCCTCACTTTGTAGATCTTGATGACTGTATTT
CCGGGCCTGTGGTTCAGGATATCTGGATGTTCCTAAACGGTGCTCGCGATCAACGCGAGCAACAGCTCGCTGATTTCATTGAAGGTTATGAAGAGTTTAA
CGACTTTGATTCGAGACAGCTGAACTGGATCGAAGCATTACGGACGCTGCGAATCATGCATCATGCCGCGTGGCTGGCACGCCGGTGGAGCGACCCTGCA
TTTCCCAAAGCGTTTCCTTGGTTCGGTAATC

Translation

[37 - 930/931]   direct strand
>GOS_709030 Translation [37-930   direct strand]
MTHPYESLTPDCVVDCLESIGLVSDLRLLALNSYENRVYQVGIEGDDPLILKFYRAGRWTDAQILEEHAFARELVDHEISVVAPESIAGDTLHNVLGQRF
SVFKRRGGYPPELDNLDHLYRLGQTLGRIHRVGGATSFLHRRALSPTRMATESRLFVETDFVPVELQSAYRTLAHDCDQAATEVLSAMTADDLQRVHGDC
HVGNILWRDDTPHFVDLDDCISGPVVQDIWMFLNGARDQREQQLADFIEGYEEFNDFDSRQLNWIEALRTLRIMHHAAWLARRWSDPAFPKAFPWFGN

[ Warning ] 3' incomplete: following codon is not a STOP

Phylogeny

PROTOCOLE:


      A)  Phylogénie.fr/ 'à la carte' ProtDist NJ
      B)  Phylogénie.fr/ 'à la carte' ProtPars 
      C)  Phylogénie.fr/ 'à la carte' PhyML 
---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

     Les arbres obtenus par distance génétique et par parcimonie sont cohérents avec l'arbre
phylogénétique de référence. De plus l'arbre par distance génétique nous montre que notre séquence 
est plus proche de marine 1,corroboré par l'arbre par parcimonie. Les séquences nommées marines
sont plus proches des pseudomonas (notées pseudo) dans l'arbre par distance génétique, mais nous
ne retrouvons pas ce résultat avec l'arbre par parcimonie. Cela pourrait être dû au fait que les 
séquences marines ne sont pas classées à l'intérieur des g-protéobactérie. Nous pouvons donc
simplement conclure que notre séquence pourrait provenir d'une g-protéobactérie.
    La divergence des résultats concernant la proximité des pseudomonas avec les marines, nous a conduit
à faire un nouvel arbre en utilisant la méthode PhyML. Cet arbre corrobore l'arbre obtenu par parcimonie.
D'après ces résultats nous pouvons donc dire que les séquences marines et pseudomonas ne sont pas proches,
comme l'indique l'arbre par distance génétique. 



---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:


    A) arbre par distance génétique



                   +---Burkholderia 3   (b-protéobactérie)
                +-10  
         +-----11  +----Burkholderia 2  (b-protéobactérie
         !      !  
         !      +-------Burkholderia 1  (b-protéobactérie) 
         !  
         !                                     +--------Vibrio 4   (g-protéobactérie)
         !                                   +-3 
         !                               +---5 +--------Vibrio 3   (g-protéobactérie)
         !                               !   ! 
         !                      +--------6   +----------Vibrio 1   (g-protéobactérie)
         !                      !        ! 
         !                      !        +--------------Vibrio 2   (g-protéobactérie)
  +-----13          +-----------9 
  !      !          !           !                 +-------Shewanella 1   (g-protéobactérie)
  !      !          !           !           +-----1 
  !      !          !           !           !     +-------Shewanella 2   (g-protéobactérie)
  !      !          !           +-----------4 
  !      !          !                       !  +----------Shewanella 3   (g-protéobactérie) 
  !      !          !                       +--2 
  !      !          !                          +----------Shewanella 4   (g-protéobactérie) 
  !      !          !  
  !      !          !                      +----------marine 1    (g-protéobactérie non classée)
  !      +---------20        +-------------7 
  !                 !        !             +----------Translation_of_ORF_number_1_in    
  !                 !     +-17  
  !                 !     !  !   +-----------------marine 2   (g-protéobactérie non classée)  
  !                 !     !  +--16  
  !                 !     !      +-----------------marine 3   (g-protéobactérie non classée)  
  !                 !  +-18  
  !                 !  !  !                 +---Pseudo 1     (g-protéobactérie)
  !                 !  !  !          +------8 
  !                 !  !  !          !      +---Pseudo 3     (g-protéobactérie)
  !                 +-19  +---------15  
  !                    !             !  +-------Pseudo 2     (g-protéobactérie)
  !                    !             +-14  
  !                    !                +------Pseudo 4      (g-protéobactérie)
  !                    !  
  !                    +--------------------------- marine 4   (g-protéobactérie non classée)
  !  
 12-Herminiimonas   (b-protéobactérie) 
  !  
  +-- marseille     (b-protéobactérie)



---------------------------------------------------------------------------------------------------





     B) arbre par parcimonie



                                                                 +------Pseudo 3   (g-protéobactérie)
                                                          +--1.0-|
                                                   +--1.0-|      +------Pseudo 1   (g-protéobactérie)
                                                   |      |
                       +-----------------------1.0-|      +-------------Pseudo 2   (g-protéobactérie)
                       |                           |
                       |                           +--------------------Pseudo 4   (g-protéobactérie)
                       |
                       |                                         +------Vibrio 4   (g-protéobactérie)
                       |                                  +--1.0-|
                       |                           +--1.0-|      +------Vibrio 3   (g-protéobactérie)
                       |                           |      |
                       |                    +--1.0-|      +-------------Vibrio 1   (g-protéobactérie)
                       |                    |      |
                +--1.0-|                    |      +--------------------Vibrio 2   (g-protéobactérie)
                |      |                    |
                |      |             +--1.0-|                    +------Shewanella 2   (g-protéobactérie)
                |      |             |      |             +--1.0-|
                |      |             |      |      +--1.0-|      +------Shewanella 1   (g-protéobactérie)
                |      |             |      |      |      |
                |      |      +--1.0-|      +--1.0-|      +-------------Shewanella 3   (g-protéobactérie)
                |      |      |      |             |
                |      |      |      |             +--------------------Shewanella 4   (g-protéobactérie)
                |      |      |      |
         +--1.0-|      +--0.5-|      +---------------------------------- marine 4    (protéobactérie non classée)
         |      |             |
         |      |             |                                  +------ marine 1    (protéobactérie non classée)
         |      |             |                           +--1.0-|
         |      |             |                           |      +------Translation_of_ORF_number_1_in
         |      |             +-----------------------1.0-|
         |      |                                         |      +------ marine 2    (protéobactérie non classée)
         |      |                                         +--1.0-|
  +------|      |                                                +------ marine 3    (protéobactérie non classée)
  |      |      |
  |      |      |                                         +-------------Burkholderia 1   (b-protéobactérie)
  |      |      +-------------------------------------1.0-|
  |      |                                                |      +------Burkholderia 3   (b-protéobactérie)
  |      |                                                +--1.0-|
  |      |                                                       +------Burkholderia 2   (b-protéobactérie)
  |      |
  |      +--------------------------------------------------------------Herminiimonas    (b-protéobactérie)
  |
  +---------------------------------------------------------------------Marseille        (b-protéobactérie)




-----------------------------------------------------------------------------------------------------------




       C) arbre par PhyML


                      +---------marine (protéobactérie non classée)     
                    +-12  
                 +-11  +---------marine (protéobactérie non classée)     
                 |  |  
                 |  +--------------------marine (protéobactérie non classée)     
                 |  
                 |                 +----Burkholderia (b-protéobactérie)    
                 |            +---14  
                 |            |    |  +---Burkholderia (b-protéobactérie)    
              +--5            |    +-15  
              |  |   +-------13       +-Burkholderia (b-protéobactérie)    
              |  |   |        |  
              |  |   |        |   +-Marseille (b-protéobactérie)    
              |  |   |        +--16  
              |  |   |            +Herminiimonas (b-protéobactérie)    
              |  |   |  
              |  +---4                    +------Vibrio_2 (g-protéobactérie)    
              |      |            +------17  
              |      |            |       |  +----Vibrio_1 (g-protéobactérie)   
              |      |            |       +-18  
              |      |            |          |  +---Vibrio_3 (g-protéobactérie)    
              |      |            |          +-19  
  +-----------6      +------------3             +---Vibrio_4 (g-protéobactérie)    
  |           |                   |  
  |           |                   |            +-----Shewanella_4 (g-protéobactérie)   
  |           |                   |        +--20  
  |           |                   |        |   +----Shewanella_3 (g-protéobactérie)    
  |           |                   +--------2  
  |           |                            |   +-Shewanella_2 (g-protéobactérie)    
  |           |                            +---1  
  |           |                                +-Shewanella_1 (g-protéobactérie)    
  |           |  
  |           |           +-----Pseudo_4 (g-protéobactérie)     
  |           |        +--8  
  |           |        |  +--Pseudo_2 (g-protéobactérie)     
  |           +--------7  
  |                    |  +Pseudo_3 (g-protéobactérie)    
  |                    +--9  
  |                       +pseudo_1 (g-protéobactérie)    
  |  
 10-------Translation_of_ORF_number_1_in     
  |  
  +-----marine (protéobactérie non classée)






Annotator commentaries

Les résultats de SMS ORFinder nous ont permis d'observer l'existence d'un ORF sur le brin direct dans le cadre de lecture numéro 1 qui possède 300 AA. Cet ORF coderait potentiellement pour une protéine kinase d'après les résultats d'InterPro Scan. A partir de l'alignement multiple nous pouvons estimer la position de la méthionine initiatrice ainsi que celle du stop de notre séquence. En effet nous observons plusieurs séquences (dont notre séquence) qui possèdent une méthionine à la même position; à partir de cela nous estimons donc que la méthionine initiatrice de notre séquence se situe deux codons après le début de notre ORF. Pour la position du stop, plusieurs séquences se terminent au même endroit; nous estimons donc que le stop de notre séquence se situe 26 codons après le dernier codons de notre ORF.

La recherche de domaine protéique conservée par InterPo Scan nous a révélée l'existence de 3 domaines conservés. Nous avons garder celui à activité protéine kinase car il est le parent du deuxième domaine. Le troisième domaine étant chevauchant (et plus petit) à notre domaine sélectionné, nous ne l'avons pas choisi (de plus il est non intégré). Cependant les résultats obtenus par InterPro Scan ne nous permettent pas d'émettre une hypothèse sur la fonction moléculaire et le processus biologique (pas de termes GO affichés). Suite aux indications du professeur nous avons décider de faire plusieurs recherches en choisissant le domaine aminoglycoside tranférase. Nous pouvons donc dire que la fonction de notre séquence GOS est celle d'une tranférase. Cette fonction étant impliquée dans plusieurs processus biologique, nous n'avons pas réussi à conclure sur ce point avec nos résultats.

Le rapport taxonomique issu du Blastp contre SwissProt ne reflétant pas la diversité biologique du monde vivant, nous avons utiliser celui du Blastp contr NR afin de construire notre arbre phylogénétique. A partir du rapport taxonomique nous pouvons émettre l'hypothèse que notre séquence GOS provient d'une g-protéobactérie car c'est la classe la plus répandue. Nous choisissons donc les gamma-protéobactéries comme groupe d'étude. D'après l'arbre phylogénétique de référence nous pouvons donc déterminer le groupe extérieur de béta-protéobactéries. Les arbres obtenues (par distance génétique et par parcimonie) sont cohérents avec celui de référence. L'observation des arbres obtenus nous permet d'observer que notre séquence GOS appartient au groupe des marines qui sont des protéobactéries non classées. Nous pouvons donc seulement dire que notre séquence GOS provient d'une protéobactérie. Nous remarquons des résultats différents entre l'arbre par distance génétique et celui par parcimonie. Dans le premier, les séquences marines semblent plus proche de celles des pseudomonas (notées pseudo);résultat non observé avec le deuxième arbre où le groupe des marines est éloigné des pseudomonas. Ces résultats différents nous ont conduit à établir un nouvel arbre par une méthode différente (PhyML) qui corrobore les résultats obtenus par la méthode parcimonieuse. En conséquence nous pouvons dire que les pseudomonas et les marines ne sont pas proches, contrairement à ce que nous montre l'arbre par distance génétique.

Multiple Alignement

PROTOCOLE:

  Phylogenie.fr / clustalW /paramètres par defaut 
---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:
  
   
   En observant l'alignement multiple nous pouvons observer que certaines séquences d'acides aminés
sont plus ou moins identiques entre les différentes séquences choisies pour réaliser notre 
arbre phylogénétique. Nous pouvons voir, par exemple, que la 'séquence' LNSYENRVYQ est présente chez toutes les
séquences choisies pour l'alignement. Cela nous montre donc qu'il s'agit bien de séquences homologues.

   Nous pouvons également supposer que notre méthionine initiatrice se trouve deux codons (ou AA) après
le début de notre ORF (nous avons deux codons de plus en 5'), car nous constatons que notre 
séquence possède une méthionine dont la position coïncide avec celle des autres  séquences 
homologues (pseudo 1,2,3 et 4 ainsi que marine 1).
   D'autre part nous avons estimer que la position de notre codon STOP devrait se trouver 26 codons
après le dernier codons de notre ORF. Il manquerait donc 28 AA à notre ORF pour que celui-ci soit complet.
Nous avons donc corrigé la définition de notre ORF qui commence donc à la position 37.
   
---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:

CLUSTAL 2.0.3 multiple sequence alignment


marine_1_gi_119505550_ref_ZP_0      ---MLRIC------CDANAMSHPYDALTPDAVVDCVEAV----GYRCDLR
Translation_of_ORF_number_1_in      -----------------AGMTHPYESLTPDCVVDCLESI----GLVSDLR
pseudo_1_gi_213967745_ref_ZP_0      -------------------MAHPFATLTPDLVLDAVESI----GFLSDAR
Pseudo_3_gi_66047921_ref_YP_23      -------------------MAHPFATLTPDLVLDAVESI----GFLSDAR
Pseudo_2_gi_104784038_ref_YP_6      -------------------MSHPFDTLTPDLVLDAVESL----DFLSDAR
Pseudo_4_gi_107099472_ref_ZP_0      -------------------MSHPFDQLTPDLVLDAVESL----GYLSDAR
marine_2_gi_119475128_ref_ZP_0      ---------------MN--KHHPYELLTPELVIDAVEST----GRLSDLR
marine_3_gi_90415493_ref_ZP_01      -----MVA------PMSESKSHPFDSLSPDLLIDAVESA----GFVSDGR
marine_4_gi_198262297_gb_EDY86      ----------------MSDTQQPFHQLTPSIVADAVESV----GFLCDGR
Herminiimonas_gi_134094119_ref      ---MNEST------------PLSFATLTPDCVLDALESV----GLYSDGR
Marseille_gi_152980917_ref_YP_      ---MNDST------------PLSFSTLTPDCVLDALESV----GLYSDGR
Burkholderia_3_gi_78067891_ref      MRGMKDVT-----SAPASPAGPPFAGLTPECVLDALDSVLIPAGLRTDGR
Burkholderia_2_gi_53717863_ref      MNDATSES-----NAAGACAGLPFAGLTPERVLDALDSVLIPAGSRTDGR
Burkholderia_1_gi_209521322_re      MRGMNDTIPDNFHPQAGADGAVPFARLTPETVLDALDGVLATTGVRTDGR
Vibrio_4_gi_27364470_ref_NP_75      ----------------MSLGAFNFDALTPDFMWYALESI----GIRAESG
Vibrio_3_gi_153834302_ref_ZP_0      ----MEKGSAMSLFIYMSQGTFNFDALTPDFMWYALESI----GIRAESG
Vibrio_1_gi_149190445_ref_ZP_0      ----------------MTDKAFNFDALTPDFMWYALESI----GVRAESG
Vibrio_2_gi_90581166_ref_ZP_01      ----------------MEKNDFCFSNLTPDLLLDALDSI----DVRAESG
Shewanella_1_gi_146294740_ref_      MSPEQLNQSNMPSANQSSGAEFHFQALTPDLILDAIESL----GIYPETG
Shewanella_2_gi_149114298_ref_      -----MSQNMTPPTTSSSGAEFHFQALTPDLILDAIESL----GVYPETG
Shewanella_3_gi_212634987_ref_      --MNREEPSKIITTAVDEDSAFHYQALTPDLILTAIETL----GIYPETG
Shewanella_4_gi_163748589_ref_      ------------MSLVQTGSGFHYQALTPDLILDAIESL----DIFPETG
                                                           :  *:*. :  .::      .   :  

marine_1_gi_119505550_ref_ZP_0      LIGLNSYENRVYQVGIEDEVPVIVKFYRDQRWSDEQILEEHRFALELVEH
Translation_of_ORF_number_1_in      LLALNSYENRVYQVGIEGDDPLILKFYRAGRWTDAQILEEHAFARELVDH
pseudo_1_gi_213967745_ref_ZP_0      ILALNSYENRVYQVGIEDGQPLIAKFYRPQRWTNEAILEEHSFTFELVDV
Pseudo_3_gi_66047921_ref_YP_23      ILALNSYENRVYQVGIEDGQPLIAKFYRPQRWTTEAILEEHSFTAELVEV
Pseudo_2_gi_104784038_ref_YP_6      VLALNSYENRVYQVGIEGEQPLIAKFYRPGRWNDAAILEEHAFTAELAEC
Pseudo_4_gi_107099472_ref_ZP_0      VLALNSYENRVYQVGIEDGEPLIAKFYRPDRWSDAAIREEHAFSAELAEC
marine_2_gi_119475128_ref_ZP_0      IFPLNSYENRVYQVGIEDSEPVIIKFYRPERWTDAQIFEEHQFSLDLHDV
marine_3_gi_90415493_ref_ZP_01      LLALNSYENRVYQVGIEDETPMIAKFYRPDRWRREQILEEHEFCFQLVDQ
marine_4_gi_198262297_gb_EDY86      TFPLNSYENRVYQVGIEDEPPLIAKFYRPQRWSDEQILEEHNFAQTLSDE
Herminiimonas_gi_134094119_ref      LLALNSYENRVYQIGIEDGPPLVAKFYRPARWSDAAILEEHAFVAKLVER
Marseille_gi_152980917_ref_YP_      LLALNSYENRVYQVGMEDGPPLVAKFYRPARWTDAAILEEHAFVHELVES
Burkholderia_3_gi_78067891_ref      LLALNSYENRVYQVGIEDGPPVVAKFYRPARWSDEAILEEHAFVAELAAR
Burkholderia_2_gi_53717863_ref      LLALNSYENRVYQAGIEDGAPIVAKFYRPQRWSNDAILEEHTFVAELAAR
Burkholderia_1_gi_209521322_re      LLPLNSYENRVYQVGVEDGPPVVAKFYRPERWTDAAILEEHAFVAELAER
Vibrio_4_gi_27364470_ref_NP_75      LLPLNSYENRVYQFTDEERRRFVVKFYRPERWTPAQIVEEHQFTQEQVEN
Vibrio_3_gi_153834302_ref_ZP_0      FLALNSYENRVYQFTDEERQRYVVKFYRPERWSNEQIQEEHDFTLELIDN
Vibrio_1_gi_149190445_ref_ZP_0      LLALNSYENRVYQFTDEDRKRFVVKFYRPQRWSREQIQEEHDFSNELVEN
Vibrio_2_gi_90581166_ref_ZP_01      LLALNSYENRVYQFKAEDGARYVTKFYRSERWSDEQIEEEHQFTQELADN
Shewanella_1_gi_146294740_ref_      LLALNSYENRVYQFRSDEGARFVVKFYRPDRWSNAQIQEEHDYALALAAE
Shewanella_2_gi_149114298_ref_      LLALNSYENRVYQFRSDEGLRYVVKFYRPDRWSDAQIQEEHDYALALAAE
Shewanella_3_gi_212634987_ref_      LLALNSYENRVYQFRCDRGQRYVVKFYRPERWTDQQIQEEHDFSAALTEQ
Shewanella_4_gi_163748589_ref_      LLALNSYENRVYQFRCDHGVRYVVKFYRPERWSNAQIQEEHDFSQALFDE
                                     : **********   :     : ****  **    * *** :       

marine_1_gi_119505550_ref_ZP_0      DISVVAPE-VTHGETLHKAFGQRFTVFKRRGGHPPELDNLEHLYQLGNVL
Translation_of_ORF_number_1_in      EISVVAPE-SIAGDTLHNVLGQRFSVFKRRGGYPPELDNLDHLYRLGQTL
pseudo_1_gi_213967745_ref_ZP_0      EVPVVAPM-VHNGETLFEHAGFRFTLFPRRGGRAPEPGNLDQLYRLGQLL
Pseudo_3_gi_66047921_ref_YP_23      EVPVVAPM-VHNGATLFEHAGFRFTLFPRRGGRAPEPGNLDQLYRLGQLL
Pseudo_2_gi_104784038_ref_YP_6      EVPVVAPL-LHEGRSLFEHQGFRFTLFPRRGGHAPEPGNLDQLYRLGQLL
Pseudo_4_gi_107099472_ref_ZP_0      EVPVVAPL-SRDGESLFAFSGFRFALFPRRGGRAPEPGNLDQLYRLGQLL
marine_2_gi_119475128_ref_ZP_0      EIPVVPPM-VIDGKTLLEFEGYRFALYERKGGHAPELDDLDNLLILGRLC
marine_3_gi_90415493_ref_ZP_01      ELPVVPPWRDAEGNSLSEFGGFSFALFQRKGGRAPELDNLDNLFILGRLM
marine_4_gi_198262297_gb_EDY86      GVSAVPAI-QRDGESLLRYGEYRFALFKRQGGHAPEPSLLDQTEILGRSL
Herminiimonas_gi_134094119_ref      EIPVVPAMTLANGKTLHEFSGFRFAVFARHGGRAPELDDPATLEWLGRFI
Marseille_gi_152980917_ref_YP_      EIPVVPATTLANGKTLHEFAGFRFAVFARHGGRAPELDDPATLEWLGRFI
Burkholderia_3_gi_78067891_ref      EIPAVPARTFD-GRTLHAFDGFRFSIFERRGGRAPDLDRSDTLEWLGRFI
Burkholderia_2_gi_53717863_ref      EIPAVPPLAFD-GRTLHEFDGFRFAIFERRGGRAPELDRRDTLEWLGRFI
Burkholderia_1_gi_209521322_re      EIPAVPARVLD-GRTLHTFDGFRFSVFERRGGRAPDLDRRDTLEWLGRFI
Vibrio_4_gi_27364470_ref_NP_75      DIPVAAPV-NINGTTLHHYQGYQFALFNSVGGRQFEVDNLDQLEWVGRFL
Vibrio_3_gi_153834302_ref_ZP_0      EIPVAPPV-LINGETLHHYQGYGFALFESVGGRQYEVDNLDQLEGVGRFL
Vibrio_1_gi_149190445_ref_ZP_0      EVPIAAPL-SINGETIHEYQGYLFTLFNSEGGRQFEVDNLEQLEWVGRFM
Vibrio_2_gi_90581166_ref_ZP_01      EIPVAAPI-NINGKTLHNFNGHRFALFPSVGGRQFEVDNFDQLEWVGRYL
Shewanella_1_gi_146294740_ref_      DIPMAVPV-ILNGNTLHEYQGYRFTLFPSLGGRAFEVDNLEQLELVGRFI
Shewanella_2_gi_149114298_ref_      DIPIAVPV-IIEGHTLHKYQGYRFTLFPSLGGRAFEVDNLEQLELVGRFI
Shewanella_3_gi_212634987_ref_      EVPIATPV-IIDGRSLHEFQGFRFALFPSIGGRAFEVDNLDQLESVGRFI
Shewanella_4_gi_163748589_ref_      EIPIATPL-IINNRSLHEYKGFRFALFPSIGGRAFEVDNLEQLEETGRFI
                                     :. . .     . ::       *:::   **   : .        *.  

marine_1_gi_119505550_ref_ZP_0      GRIHRVGAAQTFEHRIKLDLERMATASR-EFLSEHFIPRDLQAAYTTLAL
Translation_of_ORF_number_1_in      GRIHRVGGATSFLHRRALSPTRMATESR-LFVETDFVPVELQSAYRTLAH
pseudo_1_gi_213967745_ref_ZP_0      GRIHAVGSTKPFAHREALGVKNFGNDSVNYLLENNCIPRSLLPAYESVAR
Pseudo_3_gi_66047921_ref_YP_23      GRLHAVGSTKPFAHREALGVKNFGHDSVNFLLENDCIPRSLLPAYESVAR
Pseudo_2_gi_104784038_ref_YP_6      GRLHAVGATKPFAHRESLAVDNFGHASLKTLLDGDFVPRELLPAYESVAR
Pseudo_4_gi_107099472_ref_ZP_0      GRLHAVGATRPFEHREALAVDNFGHASLATLLEGNFIPRSLLPAYESVAR
marine_2_gi_119475128_ref_ZP_0      GRIHAIGAQTNYLHRPTLDIKSFAEDSY-ALIREEFMPDDLKPAYNSLCE
marine_3_gi_90415493_ref_ZP_01      GRIHGIGAMRPFKYRPKLDSKSFGWDSY-KLISEQFMPKELRPAYDSLAL
marine_4_gi_198262297_gb_EDY86      GRIHRIGSQQDFLHRPRLDPTSYGHRCA-DFLKNWGLPLELESIYTDLLD
Herminiimonas_gi_134094119_ref      GRIHAVGALQTFEHRPALNIATFGEEPRDYLLANNFIPPDLLDAYRSVIA
Marseille_gi_152980917_ref_YP_      GRIHAVGALKNFEHRPALNIQTFGEEPRDYLLAHNFIPPDLLEAYRSVVT
Burkholderia_3_gi_78067891_ref      GRIHAVGATQPYVARPVLDIRTFGYEPRDYLLAHDFIPDDVRPAYETAVT
Burkholderia_2_gi_53717863_ref      GRIHAVGATKPYAARPTLDLRTFGYEPRDFLMSHDFVPDDVRPAYEAAVA
Burkholderia_1_gi_209521322_re      GRIHAIGQTHDYAERPTFDIDTFGYEPRDFLLAHRFVPDDLRTAWETVVN
Vibrio_4_gi_27364470_ref_NP_75      GRIHQVGAKQRFQHRPSIGLDEYLYQPRALLQQCNMIPMHLENSFFQDLD
Vibrio_3_gi_153834302_ref_ZP_0      GRIHKVGSRQAFQHRPTIGLQEYLYQPREILQNANMIPMHLENSFFNDLD
Vibrio_1_gi_149190445_ref_ZP_0      GRIHQVGAQKNFIHRPTIGLEEYVYQPRKLLQSSTFIPAHLENVFFSDLD
Vibrio_2_gi_90581166_ref_ZP_01      GRIHLVGQRQPFQHRPTMGLDEYVYQPRKLLEHSQFIPDHLKNVFFADLD
Shewanella_1_gi_146294740_ref_      GRIHQYAAQEVFSEREPLNPQILGEEPLAWLKQSDLVPTSLRVPFFTVVE
Shewanella_2_gi_149114298_ref_      GRIHQYAAQTVFAEREPLNPQILGAEPLAWLKQSNLVPNSLRLPFFTVVE
Shewanella_3_gi_212634987_ref_      GRIHQFSKQADFVSRDTLSPQLLGDESLKWLKESGHIPSGLALPYFTVVE
Shewanella_4_gi_163748589_ref_      GRIHQYSKQGQFAHRELVNPQVLGDESLLWLKESGHVPSSLVLPYFTIVE
                                    **:*  .    :  *  .            :     :*  :   :     

marine_1_gi_119505550_ref_ZP_0      DCEQAARDLLSGMTASDLQRIHGDCHCGNILWRDDTAHFVDLDDCISGPA
Translation_of_ORF_number_1_in      DCDQAATEVLSAMTADDLQRVHGDCHVGNILWRDDTPHFVDLDDCISGPV
pseudo_1_gi_213967745_ref_ZP_0      DLLKRVEDVYAATPHTNIR-MHGDCHPGNMMCRDEMFHIVDLDDCRLGPA
Pseudo_3_gi_66047921_ref_YP_23      DLLKRVEDVYAATPHTNIR-MHGDCHPGNMMCRDEMFHIVDLDDCRLGPA
Pseudo_2_gi_104784038_ref_YP_6      DLLKRVEDIYARTPHQTIR-LHGDLHPGNLMHRDEVYHVVDLDDCRMGPA
Pseudo_4_gi_107099472_ref_ZP_0      DLLKRLDALFAEVPYQPIR-LHGDCHPGNLLCRDEVYHMVDLDDCRMGPA
marine_2_gi_119475128_ref_ZP_0      DLIRGVKEAFSRVPAS-LIRLHGDCHSGNILWRGDSPHFVDLDDSRMAPA
marine_3_gi_90415493_ref_ZP_01      DIMKKVEAILDDYGEINHIRVHGDCHSGNILWRDDNPHFVDFDDTRMAPA
marine_4_gi_198262297_gb_EDY86      EALAKIDRIYAETNDITYIRCHGDCHIGNILWRDNAPHFVDFDDARMAPA
Herminiimonas_gi_134094119_ref      QALDGVRRCFDRAGDVSILRLHGDCHCGNVLWTDAGPHFVDFDDSRMGPA
Marseille_gi_152980917_ref_YP_      QALDGVRRCYDRAGDVRSTRLHGDCHCGNVLWTDAGPHFVDFDDSRSGPA
Burkholderia_3_gi_78067891_ref      LALEGVEAAFERAGEIRLLRTHGDCHPSNVLWTDAGPHFVDFDDSRMAPA
Burkholderia_2_gi_53717863_ref      LALEGVERAYERAGDVRMLRAHGDCHPSNVLWTDAGPHFVDFDDSRMAPA
Burkholderia_1_gi_209521322_re      LALEGVARAFERAGEIRTLRLHGDCHPSNVLWTDAGPHFVDFDDSRMGPA
Vibrio_4_gi_27364470_ref_NP_75      RLIAAIEAQWPKD-THAIR-LHGDCHPGNILWR-DGPMFVDLDDARNGPA
Vibrio_3_gi_153834302_ref_ZP_0      MLIKSIERHWQEG-FNTIR-LHGDCHPGNILWR-DGPMFVDLDDSRNGPA
Vibrio_1_gi_149190445_ref_ZP_0      LLISQIEAHWQP--SETIR-LHGDCHPGNILWR-DGPMFVDLDDARNGPA
Vibrio_2_gi_90581166_ref_ZP_01      LLIKNLEQHWSTD-WQAIR-LHGDCHPGNILWR-DGPMFVDLDDARNGPA
Shewanella_1_gi_146294740_ref_      QVLAKANAIWKRQAFTSIR-LHGDLHPGNILWTPNGPGFVDLDDARMGPA
Shewanella_2_gi_149114298_ref_      QVLAKANAIWDRQDFAAIR-LHGDLHPGNILWTPDGPGFVDLDDARMGPA
Shewanella_3_gi_212634987_ref_      QILEKASAMWQPKHYKNIR-LHGDLHPSNILWTPQGPGFVDLDDAKMGPA
Shewanella_4_gi_163748589_ref_      QVLDKSKEIWSQQNPKHIR-LHGDLHPGNILWTPDGPGFVDLDDARTGPA
                                                         *** * .*::       .**:**   .*.

marine_1_gi_119505550_ref_ZP_0      IQDLWMFLNGERHHREQQLAELIAGYEEFHDFDPRQLRWVEGLRTLRIMH
Translation_of_ORF_number_1_in      VQDIWMFLNGARDQREQQLADFIEGYEEFNDFDSRQLNWIEALRTLRIMH
pseudo_1_gi_213967745_ref_ZP_0      VQDIWMMLAGDRQERLGQLSELMDGYNEFHDFDPRELALIEPLRALRLMH
Pseudo_3_gi_66047921_ref_YP_23      VQDIWMMLAGDRQERLGQLSELMDGYNEFHDFDPRELALIEPLRALRLMH
Pseudo_2_gi_104784038_ref_YP_6      VQDLWMMLAGSREERLGQLAELIDGYNEFHDFDPRELALIEPLRALRQLH
Pseudo_4_gi_107099472_ref_ZP_0      LQDLWMMLAGERHERLAQIAELVDGYNEFHDFEPRQLPLLEGLRSLRLMH
marine_2_gi_119475128_ref_ZP_0      IQDLWMFLSGDRQRQTAQINELVEGYNEFFDFDPRQLHLVEALRTMRIMH
marine_3_gi_90415493_ref_ZP_01      IQDLWMLLSGDRQEQTLQMAELVEGYREFYDFDVRELKLIEVMRTLRIMH
marine_4_gi_198262297_gb_EDY86      IQDLWMMFSGDDREQRLQLDALLEGYEVFHHLPTQQLHLIEALRTLRVIH
Herminiimonas_gi_134094119_ref      IQDLWMLLSGERRDMVRQLSDLLAGYEDFADFDVRELHLIEALRTLRLIH
Marseille_gi_152980917_ref_YP_      IQDLWMLLSGERRDMVRQFTDLLVGYEDFAEFDTRELHLIEALRTLRLIH
Burkholderia_3_gi_78067891_ref      IQDLWLLLPGDREGASRALADLLAGYEDFCEFEPRELHLVEALRTLRLIH
Burkholderia_2_gi_53717863_ref      VQDLWLLLPGDRPGASRALTDLLAGYEDFCEFDPRELHLIEALRTLRLIH
Burkholderia_1_gi_209521322_re      IQDLWLLLPGERTEASRSLADLLAGYEDFCEFEPRELYLIEALRTLRLIH
Vibrio_4_gi_27364470_ref_NP_75      VQDLWMLLNGDRQEKLMQLDILLESYGEFSDFSHQELKLIEPLRGLRMVH
Vibrio_3_gi_153834302_ref_ZP_0      VQDLWMLLNGERQDKLMQLDIVLEGYQEFCDFNSAELKLIEPLRGLRMVH
Vibrio_1_gi_149190445_ref_ZP_0      IQDLWMLLNGDRQDKMMQLDVLLEGYQEFGDLPNDQLKLIEPLRGLRMVH
Vibrio_2_gi_90581166_ref_ZP_01      IQDLWMLLNGERADQLAQLDTLLEAYGEFADFDQRQLQLIEPLRGLRMVH
Shewanella_1_gi_146294740_ref_      IQDLWMMLTGERQQQLMQLEILLEAYEEFCEFDTRQLVLIEPLRALRMVH
Shewanella_2_gi_149114298_ref_      IQDLWMMLTGDRAQQLMQLEILLEAYEEFCEFDTRQLALIEPLRALRMVH
Shewanella_3_gi_212634987_ref_      VQDIWMMLAGDRPQQILQLEVLLEAYEEFCEFDTRELQLIEPLRAMRMLH
Shewanella_4_gi_163748589_ref_      IQDLWMMITGDGSERQLQLETLLEAYQEFCEFDAQELKLIEPLRAMRMLH
                                    :**:*::: *        :  .: .*  * .:   :*  :* :* :* :*

marine_1_gi_119505550_ref_ZP_0      HAAWLGRRWDDPAFPRAFPWFGQERFWGDHILELREQLAAMNEPPLRLL-
Translation_of_ORF_number_1_in      HAAWLARRWSDPAFPKAFPWFGN---------------------------
pseudo_1_gi_213967745_ref_ZP_0      YSAWLARRWDDPAFPHSFPWFGTERYWGDHILALREQMAALNEEPLKLF-
Pseudo_3_gi_66047921_ref_YP_23      YSAWLARRWDDPAFPHSFPWFGTERYWGDHILALREQMAALNEEPLKLF-
Pseudo_2_gi_104784038_ref_YP_6      YSAWLARRWDDPAFPPSFPWFGQPRYWGDQILALREQIAALDEEPLKLF-
Pseudo_4_gi_107099472_ref_ZP_0      YSAWLARRWDDPAFPPSFPWFGSERYWGEQVLVLREQLAALDEEPLRLF-
marine_2_gi_119475128_ref_ZP_0      HSAWLARRWQDPAFPRNFPWFNSPRYWSDHILELREQLAMLNEPPLQLF-
marine_3_gi_90415493_ref_ZP_01      HSAWIARRWSDPAFPRAFTWFNTPRYWSEHILQLREQFAALQEPPIQLMS
marine_4_gi_198262297_gb_EDY86      HSAWLAQRWQDPAFPHAFPWFNTQRYWEEQVLTLREQLAALDAPALHPIT
Herminiimonas_gi_134094119_ref      YAAWLARRWDDPAFPVAFPWFNTQRYWQDRILELREQVALMDEAPLWTN-
Marseille_gi_152980917_ref_YP_      YAAWLARRWDDPAFPVAFPWFNTQRYWQDRILELREQVALMDEAPLWTN-
Burkholderia_3_gi_78067891_ref      YAAWLARRWDDPAFPAAFPWFNTHRYWEARVLELREQIGAMQEGPLWPV-
Burkholderia_2_gi_53717863_ref      YAAWLARRWDDPAFPAAFPWFNTHRYWEARVLELREQIGAMQEGPLWPV-
Burkholderia_1_gi_209521322_re      YQAWLARRWNDPAFPAAFPWFNTQRYWEDRILEMREQIGAMQEGPLWPV-
Vibrio_4_gi_27364470_ref_NP_75      YMAWLAKRWQDPAFPLAFPWFNEPKYWEGQVLAFKEQIAALEEPPLSLMP
Vibrio_3_gi_153834302_ref_ZP_0      YMAWLAKRWHDPAFPLAFPWFNEPKYWEGQVLAFKEQIASLEEAPLSLMP
Vibrio_1_gi_149190445_ref_ZP_0      YMAWLAKRWHDPAFPQAFPWFNDAKYWEGQVLGFKEQIAALNEKPLSLQP
Vibrio_2_gi_90581166_ref_ZP_01      YMAWLAKRWQDPAFPRAFPWFADAKYWEGQVLAFKEQIASLHDAPLQLMP
Shewanella_1_gi_146294740_ref_      YNAWIGRRWQDPAFPMNFPWFGDEKYWEQQILAFKEQLFALDEPPLSLIP
Shewanella_2_gi_149114298_ref_      YNAWIGRRWDDPAFPMNFPWFGDEKYWEQQILAFKEQLFALGEPPLSLVP
Shewanella_3_gi_212634987_ref_      YNAWLSRRWADPAFPMNFPWFAEDKYWEQQILAFKEQLAALDEPPLSLIP
Shewanella_4_gi_163748589_ref_      YNAWLGRRWEDPAFPMNFPWYAEEKYWEQQILSFKEQLAILNEPALSLIL
                                    : **:.:** *****  *.*:                             

marine_1_gi_119505550_ref_ZP_0      ----
Translation_of_ORF_number_1_in      ----
pseudo_1_gi_213967745_ref_ZP_0      ----
Pseudo_3_gi_66047921_ref_YP_23      ----
Pseudo_2_gi_104784038_ref_YP_6      ----
Pseudo_4_gi_107099472_ref_ZP_0      ----
marine_2_gi_119475128_ref_ZP_0      ----
marine_3_gi_90415493_ref_ZP_01      ----
marine_4_gi_198262297_gb_EDY86      L---
Herminiimonas_gi_134094119_ref      ----
Marseille_gi_152980917_ref_YP_      ----
Burkholderia_3_gi_78067891_ref      ----
Burkholderia_2_gi_53717863_ref      ----
Burkholderia_1_gi_209521322_re      ----
Vibrio_4_gi_27364470_ref_NP_75      QW--
Vibrio_3_gi_153834302_ref_ZP_0      QW--
Vibrio_1_gi_149190445_ref_ZP_0      QW--
Vibrio_2_gi_90581166_ref_ZP_01      QW--
Shewanella_1_gi_146294740_ref_      -Y--
Shewanella_2_gi_149114298_ref_      -Y--
Shewanella_3_gi_212634987_ref_      QY--
Shewanella_4_gi_163748589_ref_      GYGG
                                        


                                        


---------------------------------------------------------------------------------------------------

BLAST

PROTOCOLE:

     A) BlastP contre NR paramètres par défaut sauf 'number of description=500'

     B) Blastp contre Swissprot paralètres par défaut sauf 'number of description=500'
---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:


    Les résultats du Blastp contre nr nous permet d'observer un grand nombre de séquence homologues à notre 
ORF, avec des scores et des E-value significatifs (de 8e-127 à 9.8 pour le Blastp contre nr et de 3e-68 à 9.9 
contre swissprot) pour nous permettre d'intégrer notre ORF dans un groupe d'organismes potentiel, dans notre 
cas les bactéries.
    

    Quand aux résultats du Blastp contre SwissProt, bien qu'ils sont significatifs (bonnes E-value
et bon scores) ils ne sont pas assez nombreux pour nous permettrent de faire une phylogénie significative
et donc d'établir une appartenance hypothétique de notre ORF à un groupe d'organismes.


       
---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:

    A) Blastp contre nr
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_01627622.1|  hypothetical protein MGP2080_04490 [marine...   456    8e-127
ref|ZP_01102893.1|  conserved hypothetical protein [gamma prot...   355    2e-96 
ref|YP_001174333.1|  serine/threonine protein kinase [Pseudomo...   338    2e-91  
ref|ZP_01127928.1|  hypothetical protein NB231_00810 [Nitrococ...   338    3e-91 
ref|ZP_00418343.1|  protein of unknown function DUF954 [Azotob...   335    2e-90 
ref|YP_350908.1|  serine/threonine protein kinase [Pseudomonas...   335    3e-90  
ref|NP_790333.1|  serine/threonine protein kinase [Pseudomonas...   335    3e-90  
ref|YP_001345984.1|  serine/threonine protein kinase [Pseudomo...   334    4e-90  
ref|NP_742526.1|  serine/threonine protein kinase [Pseudomonas...   333    7e-90  
ref|ZP_03395892.1|  conserved hypothetical protein [Pseudomona...   333    1e-89 
ref|YP_610536.1|  serine/threonine protein kinase [Pseudomonas...   333    1e-89  
ref|ZP_01615481.1|  hypothetical protein GP2143_14951 [marine ...   333    1e-89 
ref|YP_001265742.1|  serine/threonine protein kinase [Pseudomo...   332    2e-89  
ref|YP_001666636.1|  serine/threonine protein kinase [Pseudomo...   332    2e-89  
ref|ZP_01223427.1|  hypothetical protein GB2207_09256 [marine ...   330    6e-89 
ref|NP_249177.1|  serine/threonine protein kinase [Pseudomonas...   330    1e-88  
gb|AAT51135.1|  PA0486 [synthetic construct]                        330    1e-88 
ref|YP_001751688.1|  aminoglycoside phosphotransferase [Pseudo...   329    2e-88  
ref|YP_788659.1|  serine/threonine protein kinase [Pseudomonas...   329    2e-88  
ref|YP_001980891.1|  conserved hypothetical protein [Cellvibri...   328    3e-88  
ref|ZP_01363390.1|  hypothetical protein PaerPA_01000484 [Pseu...   327    6e-88 
ref|YP_001189571.1|  serine/threonine protein kinase [Pseudomo...   326    1e-87  
ref|YP_383216.1|  serine/threonine protein kinase [Geobacter m...   322    2e-86  
ref|YP_262755.1|  serine/threonine protein kinase [Pseudomonas...   322    3e-86  
ref|ZP_01166583.1|  hypothetical protein MED92_11039 [Oceanosp...   322    3e-86 
ref|YP_276832.1|  serine/threonine protein kinase [Pseudomonas...   318    5e-85  
ref|YP_358013.1|  serine/threonine protein kinase [Pelobacter ...   317    5e-85  
ref|YP_001099194.1|  serine/threonine protein kinase [Herminii...   317    7e-85  
ref|YP_001352544.1|  serine/threonine protein kinase [Janthino...   316    1e-84  
ref|YP_431463.1|  serine/threonine protein kinase [Hahella che...   316    2e-84  
ref|YP_001229057.1|  serine/threonine protein kinase [Geobacte...   313    2e-83  
ref|YP_237762.1|  serine/threonine protein kinase [Pseudomonas...   310    7e-83  
ref|YP_528610.1|  serine/threonine protein kinase [Saccharopha...   309    2e-82  
ref|NP_900677.1|  serine/threonine protein kinase [Chromobacte...   305    3e-81  
ref|YP_741780.1|  serine/threonine protein kinase [Alkalilimni...   303    1e-80  
ref|YP_001953245.1|  aminoglycoside phosphotransferase [Geobac...   303    1e-80  
ref|ZP_01313383.1|  aminoglycoside phosphotransferase [Desulfu...   301    4e-80 
ref|YP_972589.1|  serine/threonine protein kinase [Acidovorax ...   301    4e-80  
ref|YP_902573.1|  serine/threonine protein kinase [Pelobacter ...   300    8e-80  
ref|YP_545396.1|  serine/threonine protein kinase [Methylobaci...   300    1e-79  
ref|YP_411802.1|  serine/threonine protein kinase [Nitrosospir...   300    1e-79  
ref|YP_521858.1|  serine/threonine protein kinase [Rhodoferax ...   300    1e-79  
ref|ZP_03025917.1|  aminoglycoside phosphotransferase [Geobact...   298    3e-79 
ref|YP_002097157.1|  hypothetical protein BDAG_00324 [Burkhold...   298    4e-79  
ref|YP_313817.1|  serine/threonine protein kinase [Thiobacillu...   298    4e-79  
ref|ZP_01390067.1|  Aminoglycoside phosphotransferase [Geobact...   296    1e-78 
ref|YP_002137030.1|  aminoglycoside phosphotransferase [Geobac...   295    4e-78  
ref|ZP_00943160.1|  Serine protease [Ralstonia solanacearum UW...   293    1e-77 
gb|EDY86579.1|  aminoglycoside phosphotransferase [gamma prote...   293    1e-77 
ref|YP_933628.1|  serine/threonine protein kinase [Azoarcus sp...   292    2e-77  
ref|YP_002256388.1|  hypothetical protein RSMK04391 [Ralstonia...   292    3e-77  
ref|YP_370660.1|  serine/threonine protein kinase [Burkholderi...   291    3e-77  
ref|YP_002092929.1|  Aminoglycoside phosphotransferase [Burkho...   291    3e-77  
ref|YP_547478.1|  serine/threonine protein kinase [Polaromonas...   291    3e-77  
ref|YP_001120983.1|  serine/threonine protein kinase [Burkhold...   291    5e-77  
ref|YP_001944675.1|  putative homoserine kinase type II [Burkh...   291    6e-77  
ref|YP_001581250.1|  serine/threonine protein kinase [Burkhold...   290    7e-77  
ref|YP_001898010.1|  aminoglycoside phosphotransferase [Ralsto...   290    7e-77  
ref|YP_984806.1|  serine/threonine protein kinase [Acidovorax ...   290    7e-77  
ref|ZP_02007446.1|  aminoglycoside phosphotransferase [Ralston...   290    9e-77 
ref|YP_002229678.1|  hosphotransferase enzyme family protein [...   289    2e-76  
ref|YP_983799.1|  serine/threonine protein kinase [Polaromonas...   289    2e-76  
ref|YP_622331.1|  serine/threonine protein kinase [Burkholderi...   288    3e-76  
ref|ZP_02891794.1|  aminoglycoside phosphotransferase [Burkhol...   288    5e-76 
ref|NP_518661.1|  serine/threonine protein kinase [Ralstonia s...   288    5e-76  
ref|YP_001809676.1|  aminoglycoside phosphotransferase [Burkho...   287    6e-76  
ref|ZP_01518182.1|  aminoglycoside phosphotransferase [Comamon...   287    7e-76 
ref|YP_866426.1|  serine/threonine protein kinase [Magnetococc...   287    8e-76  
ref|YP_775009.1|  serine/threonine protein kinase [Burkholderi...   287    9e-76  
ref|ZP_01895256.1|  predicted kinase [Marinobacter algicola DG...   287    9e-76 
ref|YP_960022.1|  serine/threonine protein kinase [Marinobacte...   286    1e-75  
ref|ZP_01737936.1|  Aminoglycoside phosphotransferase [Marinob...   286    2e-75 
ref|YP_001894011.1|  aminoglycoside phosphotransferase [Burkho...   285    3e-75  
ref|YP_001766371.1|  aminoglycoside phosphotransferase [Burkho...   285    3e-75  
ref|ZP_02377528.1|  aminoglycoside phosphotransferase [Burkhol...   285    3e-75 
ref|ZP_03270038.1|  aminoglycoside phosphotransferase [Burkhol...   283    1e-74 
ref|YP_001856328.1|  aminoglycoside phosphotransferase [Burkho...   283    2e-74  
ref|ZP_02885121.1|  aminoglycoside phosphotransferase [Burkhol...   283    2e-74 
ref|ZP_02361217.1|  serine/threonine protein kinase [Burkholde...   281    4e-74 
ref|YP_995286.1|  serine/threonine protein kinase [Verminephro...   281    4e-74  
ref|YP_001003559.1|  serine/threonine protein kinase [Halorhod...   281    6e-74  
ref|YP_556692.1|  serine/threonine protein kinase [Burkholderi...   281    7e-74  
ref|ZP_02354041.1|  serine/threonine protein kinase [Burkholde...   280    7e-74 
ref|ZP_02372291.1|  serine/threonine protein kinase [Burkholde...   280    8e-74 
ref|YP_001057265.1|  serine/threonine protein kinase [Burkhold...   280    1e-73  
ref|YP_331819.1|  serine/threonine protein kinase [Burkholderi...   280    1e-73  
ref|YP_106849.1|  serine/threonine protein kinase [Burkholderi...   280    1e-73  
ref|YP_001064507.1|  serine/threonine protein kinase [Burkhold...   280    1e-73  
ref|YP_001092395.1|  serine/threonine protein kinase [Shewanel...   279    2e-73  
ref|YP_160557.1|  serine/threonine protein kinase [Azoarcus sp...   279    2e-73  
ref|ZP_02461918.1|  serine/threonine protein kinase [Burkholde...   278    3e-73 
ref|ZP_02269110.1|  serine/threonine protein kinase [Burkholde...   277    6e-73 
ref|YP_104744.1|  serine/threonine protein kinase [Burkholderi...   277    7e-73  
ref|YP_001795877.1|  putative aminoglycoside phosphotransferas...   277    7e-73  
ref|ZP_01221757.1|  hypothetical protein P3TCK_23129 [Photobac...   277    9e-73 
ref|ZP_02504184.1|  serine/threonine protein kinase [Burkholde...   276    1e-72 
ref|YP_582612.1|  serine/threonine protein kinase [Ralstonia m...   276    1e-72  
emb|CAG21845.1|  Conserved hypothetical protein [Photobacteriu...   276    1e-72  
ref|YP_131647.2|  serine/threonine protein kinase [Photobacter...   276    2e-72  
ref|YP_294744.1|  serine/threonine protein kinase [Ralstonia e...   276    2e-72  
ref|ZP_02911121.1|  aminoglycoside phosphotransferase [Burkhol...   275    3e-72 
ref|ZP_01450169.1|  hypothetical protein OM2255_02617 [alpha p...   274    5e-72 
ref|ZP_01868716.1|  predicted kinase [Vibrio shilonii AK1] >gb...   274    7e-72 
ref|ZP_01236965.1|  hypothetical protein VAS14_22582 [Vibrio a...   273    9e-72 
ref|YP_001562223.1|  serine/threonine protein kinase [Delftia ...   273    1e-71  
ref|ZP_01814840.1|  predicted kinase [Vibrionales bacterium SW...   273    1e-71 
ref|YP_725050.1|  serine/threonine protein kinase [Ralstonia e...   273    2e-71  
ref|ZP_01677025.1|  conserved hypothetical protein [Vibrio cho...   271    3e-71 
ref|ZP_01982795.1|  conserved hypothetical protein [Vibrio cho...   271    4e-71 
ref|ZP_01948528.1|  conserved hypothetical protein [Vibrio cho...   271    4e-71 
ref|ZP_01161209.1|  hypothetical protein SKA34_17593 [Photobac...   271    5e-71 
ref|NP_229694.2|  serine/threonine protein kinase [Vibrio chol...   271    5e-71  
ref|ZP_02386148.1|  serine/threonine protein kinase [Burkholde...   271    6e-71 
ref|YP_440741.1|  serine/threonine protein kinase [Burkholderi...   270    7e-71  
ref|ZP_00992186.1|  hypothetical protein V12B01_01967 [Vibrio ...   270    8e-71 
ref|ZP_01979103.1|  conserved hypothetical protein [Vibrio cho...   270    1e-70 
ref|YP_858640.1|  serine/threonine protein kinase [Aeromonas h...   270    1e-70  
ref|YP_001140055.1|  serine/threonine protein kinase [Aeromona...   269    2e-70  
ref|ZP_01065457.1|  hypothetical protein MED222_18731 [Vibrio ...   269    2e-70 
ref|ZP_01957371.1|  conserved hypothetical protein [Vibrio cho...   268    3e-70 
ref|YP_002174931.1|  conserved hypothetical protein [Vibrio ch...   268    4e-70  
ref|YP_001475926.1|  serine/threonine protein kinase [Shewanel...   268    5e-70  
ref|NP_936028.1|  serine/threonine protein kinase [Vibrio vuln...   267    7e-70  
ref|YP_001443645.1|  serine/threonine protein kinase [Vibrio h...   266    1e-69  
ref|YP_735764.1|  serine/threonine protein kinase [Shewanella ...   266    1e-69  
gb|EDX89082.1|  Phosphotransferase enzyme family, putative [Al...   266    2e-69 
ref|YP_871463.1|  serine/threonine protein kinase [Shewanella ...   266    2e-69  
ref|ZP_00438284.1|  COG2334: Putative homoserine kinase type I...   266    2e-69 
ref|YP_002157336.1|  phosphotransferase family protein [Vibrio...   266    2e-69  
ref|YP_001789592.1|  aminoglycoside phosphotransferase [Leptot...   266    2e-69  
ref|NP_759998.1|  serine/threonine protein kinase [Vibrio vuln...   265    3e-69  
ref|YP_205935.3|  serine/threonine protein kinase [Vibrio fisc...   265    3e-69  
ref|ZP_01453449.1|  aminoglycoside phosphotransferase [Maripro...   265    3e-69 
ref|YP_663130.1|  serine/threonine protein kinase [Pseudoalter...   265    4e-69  
ref|YP_001022348.1|  serine/threonine protein kinase [Methylib...   265    4e-69  
ref|YP_001758793.1|  aminoglycoside phosphotransferase [Shewan...   265    5e-69  
ref|ZP_01986969.1|  serine protease [Vibrio harveyi HY01] >gb|...   264    7e-69 
ref|YP_692068.1|  serine/threonine protein kinase [Alcanivorax...   264    8e-69  
ref|YP_001185164.1|  serine/threonine protein kinase [Shewanel...   263    9e-69  
ref|ZP_01135688.1|  hypothetical protein PTD2_16691 [Pseudoalt...   263    9e-69 
ref|YP_001052396.1|  serine/threonine protein kinase [Shewanel...   262    2e-68  
ref|YP_749109.1|  serine/threonine protein kinase [Shewanella ...   262    2e-68  
ref|YP_736363.1|  serine/threonine protein kinase [Shewanella ...   262    2e-68  
ref|ZP_01841052.1|  aminoglycoside phosphotransferase [Shewane...   262    2e-68 
ref|ZP_01043612.1|  Homoserine kinase type II-like protein [Id...   262    3e-68 
ref|ZP_01707275.1|  aminoglycoside phosphotransferase [Shewane...   262    3e-68 
ref|YP_002261603.1|  putative phosphotransferase [Aliivibrio s...   261    4e-68 
ref|YP_001556573.1|  serine/threonine protein kinase [Shewanel...   261    5e-68  
ref|YP_002311512.1|  Kinase, putative [Shewanella piezotoleran...   261    6e-68  
ref|YP_965157.1|  serine/threonine protein kinase [Shewanella ...   261    6e-68  
ref|ZP_02155842.1|  hypothetical kinase [Shewanella benthica K...   261    6e-68 
ref|NP_715972.1|  serine/threonine protein kinase [Shewanella ...   261    6e-68  
ref|ZP_01116179.1|  Aminoglycoside phosphotransferase [Reineke...   259    2e-67 
ref|ZP_02197206.1|  hypothetical protein AND4_16919 [Vibrio ca...   259    2e-67 
ref|YP_001676180.1|  serine/threonine protein kinase [Shewanel...   259    2e-67  
ref|YP_410151.1|  serine/threonine protein kinase [Shigella bo...   259    3e-67  
ref|ZP_03065562.1|  protein serine/threonine kinase RdoA [Shig...   258    4e-67 
ref|YP_001004416.1|  serine/threonine protein kinase [Yersinia...   258    5e-67  
ref|YP_002074001.1|  serine protease [Vibrio sp. Ex25] >gb|EDN...   258    5e-67  
ref|NP_290484.1|  serine/threonine protein kinase [Escherichia...   258    5e-67  
ref|YP_929194.1|  serine/threonine protein kinase [Shewanella ...   258    5e-67  
ref|YP_405317.1|  serine/threonine protein kinase [Shigella dy...   258    6e-67  
ref|NP_418296.1|  Thr/Ser kinase implicated in Cpx stress resp...   258    6e-67  
ref|YP_543389.1|  serine/threonine protein kinase [Escherichia...   257    6e-67  
ref|NP_756660.1|  serine/threonine protein kinase [Escherichia...   257    7e-67  
ref|YP_270998.1|  serine/threonine protein kinase [Colwellia p...   257    8e-67  
ref|YP_001727080.1|  aminoglycoside phosphotransferase [Escher...   257    8e-67  
ref|ZP_03031185.1|  protein serine/threonine kinase RdoA [Esch...   257    8e-67 
ref|NP_709658.1|  serine/threonine protein kinase [Shigella fl...   257    9e-67  
ref|ZP_01261131.1|  hypothetical protein V12G01_10496 [Vibrio ...   257    9e-67 
ref|ZP_03047787.1|  protein serine/threonine kinase RdoA [Esch...   256    1e-66 
ref|ZP_01990322.1|  serine protease [Vibrio parahaemolyticus A...   256    2e-66 
ref|YP_001882554.1|  protein serine/threonine kinase RdoA [Shi...   256    2e-66  
ref|ZP_00827674.1|  COG2334: Putative homoserine kinase type I...   256    2e-66 
ref|YP_001746186.1|  protein serine/threonine kinase RdoA [Esc...   256    2e-66  
gb|ACH48390.1|  Hsk [Listonella anguillarum]                        256    2e-66 
ref|YP_312784.1|  serine/threonine protein kinase [Shigella so...   255    2e-66  
ref|ZP_00824363.1|  COG2334: Putative homoserine kinase type I...   255    2e-66 
ref|NP_799432.2|  serine/threonine protein kinase [Vibrio para...   255    3e-66  
ref|ZP_02904074.1|  protein serine/threonine kinase RdoA [Esch...   254    6e-66 
ref|ZP_01307872.1|  hypothetical protein RED65_04580 [Oceanoba...   254    9e-66 
ref|YP_338793.1|  serine/threonine protein kinase [Pseudoalter...   253    1e-65  
ref|ZP_02307605.1|  putative RdoA protein [Yersinia pestis bio...   253    1e-65 










ref|NP_403681.1|  serine/threonine protein kinase [Yersinia pe...   253    1e-65  
gb|ABG15489.1|  hypothetical protein YPA_3527 [Yersinia pestis...   253    1e-65  
ref|YP_001500173.1|  serine/threonine protein kinase [Shewanel...   252    2e-65  
ref|YP_561303.1|  serine/threonine protein kinase [Shewanella ...   252    3e-65  
ref|ZP_01900642.1|  hypothetical protein PE36_15254 [Moritella...   248    5e-64 
ref|YP_455917.1|  serine/threonine protein kinase [Sodalis glo...   248    5e-64  
ref|ZP_01614724.1|  predicted kinase [Alteromonadales bacteriu...   247    9e-64 
ref|ZP_00832257.1|  COG2334: Putative homoserine kinase type I...   247    1e-63 
ref|ZP_03277474.1|  aminoglycoside phosphotransferase [Thioalk...   246    2e-63 
ref|ZP_00820969.1|  COG2334: Putative homoserine kinase type I...   243    1e-62 
ref|YP_001454680.1|  serine/threonine protein kinase [Citrobac...   243    2e-62  
ref|YP_001481110.1|  serine/threonine protein kinase [Serratia...   242    2e-62  
ref|YP_690976.1|  serine/threonine protein kinase [Shigella fl...   242    2e-62  
ref|YP_574344.1|  serine/threonine protein kinase [Chromohalob...   239    2e-61  
ref|YP_156953.1|  serine/threonine protein kinase [Idiomarina ...   239    2e-61  
ref|YP_944901.1|  serine/threonine protein kinase [Psychromona...   238    4e-61  
ref|YP_001905984.1|  Conserved hypothetical protein YihE [Erwi...   238    4e-61  
ref|ZP_01074181.1|  hypothetical protein MED121_14684 [Marinom...   238    5e-61 
emb|CAB56478.1|  hypothetical protein [Pseudomonas stutzeri]        237    7e-61 
gb|AAD47614.1|AF146615_2  YihE [Pectobacterium carotovorum sub...   237    9e-61 
ref|YP_048151.1|  serine/threonine protein kinase [Pectobacter...   237    1e-60  
ref|YP_002152530.1|  phosphotransferase [Proteus mirabilis HI4...   236    1e-60  
ref|YP_001337815.1|  serine/threonine protein kinase [Klebsiel...   236    2e-60  
ref|YP_002241260.1|  protein serine/threonine kinase RdoA [Kle...   236    2e-60  
ref|YP_001440055.1|  serine/threonine protein kinase [Enteroba...   235    3e-60  
ref|NP_462876.1|  serine/threonine protein kinase [Salmonella ...   235    4e-60  
ref|YP_001178809.1|  serine/threonine protein kinase [Enteroba...   234    4e-60  
ref|YP_001572615.1|  serine/threonine protein kinase [Salmonel...   234    4e-60  
ref|NP_458052.1|  serine/threonine protein kinase [Salmonella ...   234    9e-60  
ref|ZP_03283965.1|  hypothetical protein ENTCAN_03781 [Enterob...   233    1e-59 
ref|YP_218876.1|  serine/threonine protein kinase [Salmonella ...   233    1e-59  
ref|ZP_03221247.1|  protein RdoA [Salmonella enterica subsp. e...   233    1e-59 
ref|ZP_02657976.1|  protein RdoA [Salmonella enterica subsp. e...   233    1e-59 
ref|ZP_02685088.1|  protein RdoA [Salmonella enterica subsp. e...   233    2e-59 
ref|ZP_02833674.1|  protein RdoA [Salmonella enterica subsp. e...   233    2e-59 
ref|ZP_02669192.1|  protein RdoA [Salmonella enterica subsp. e...   232    3e-59 
ref|ZP_02701161.1|  protein RdoA [Salmonella enterica subsp. e...   232    3e-59 
ref|ZP_03319678.1|  hypothetical protein PROVALCAL_02624 [Prov...   229    3e-58 
ref|NP_927735.1|  serine/threonine protein kinase [Photorhabdu...   229    3e-58  
ref|ZP_02958561.1|  hypothetical protein PROSTU_00307 [Provide...   228    3e-58 
ref|YP_001340320.1|  serine/threonine protein kinase [Marinomo...   228    5e-58  
ref|ZP_01216976.1|  hypothetical protein PCNPT3_01015 [Psychro...   226    1e-57 
emb|CAA72723.1|  hypothetical protein [Pseudomonas fluorescens]     226    1e-57 
emb|CAR67277.1|  antibiotic resistance protein rdoa; similar t...   223    2e-56 
ref|ZP_03314698.1|  hypothetical protein PROVRUST_01490 [Provi...   222    2e-56 
ref|YP_001613404.1|  serine/threonine protein kinase [Sorangiu...   214    7e-54  
ref|YP_001965051.1|  Homoserine kinase [Leptospira biflexa ser...   210    9e-53  
ref|YP_002070308.1|  serine protease [Vibrio cholerae RC385] >...   193    2e-47  
ref|NP_712733.1|  serine/threonine protein kinase [Leptospira ...   191    5e-47  
ref|NP_970420.1|  serine/threonine protein kinase [Bdellovibri...   181    7e-44  
ref|YP_800467.1|  serine/threonine protein kinase [Leptospira ...   177    7e-43  
ref|YP_797585.1|  serine/threonine protein kinase [Leptospira ...   172    3e-41  
ref|ZP_03371573.1|  serine/threonine protein kinase [Salmonell...   171    8e-41 
ref|YP_002127931.1|  aminoglycoside phosphotransferase [Altero...   160    9e-38  
ref|YP_065800.1|  hypothetical protein DP2064 [Desulfotalea ps...   148    4e-34  
ref|ZP_03380710.1|  serine/threonine protein kinase [Salmonell...   148    6e-34 
ref|ZP_02533845.1|  serine/threonine protein kinase [Endorifti...   143    1e-32 
ref|ZP_03362193.1|  serine/threonine protein kinase [Salmonell...   137    1e-30 
ref|ZP_03351450.1|  serine/threonine protein kinase [Salmonell...   131    5e-29 
ref|ZP_03361971.1|  serine/threonine protein kinase [Salmonell...   111    7e-23 
ref|ZP_03376383.1|  serine/threonine protein kinase [Salmonell...  93.6    2e-17 
ref|ZP_01993303.1|  serine protease [Vibrio parahaemolyticus A...  86.3    3e-15 
ref|ZP_02533844.1|  serine/threonine protein kinase [Endorifti...  59.3    3e-07 
ref|ZP_03370582.1|  serine/threonine protein kinase [Salmonell...  57.8    1e-06 
ref|YP_001560293.1|  aminoglycoside phosphotransferase [Clostr...  55.1    8e-06  
ref|YP_950261.1|  putative homoserine kinase [Arthrobacter aur...  51.6    7e-05  
ref|YP_001780989.1|  hypothetical protein CLD_3202 [Clostridiu...  51.2    1e-04  
ref|YP_085930.1|  homoserine kinase type II (protein kinase fo...  47.8    0.001  
gb|ABA55905.1|  hypothetical protein [Vibrio sp. DAT722]           45.8    0.004 
ref|YP_001420320.1|  YerI [Bacillus amyloliquefaciens FZB42] >...  45.4    0.005  
ref|XP_382592.1|  hypothetical protein FG02416.1 [Gibberella z...  45.1    0.007  
ref|ZP_00236064.1|  hypothetical protein protein [Bacillus cer...  44.7    0.009 
ref|ZP_01172199.1|  hypothetical protein B14911_22127 [Bacillu...  44.7    0.009 
ref|YP_885185.1|  phosphotransferase enzyme family protein [My...  44.7    0.011  
ref|NP_981035.1|  hypothetical protein BCE_4742 [Bacillus cere...  44.3    0.011  
ref|YP_896905.1|  hypothetical protein BALH_4191 [Bacillus thu...  44.3    0.013  
ref|YP_428098.1|  aminoglycoside phosphotransferase [Rhodospir...  44.3    0.013  
ref|NP_700317.1|  hypothetical protein BRA1164 [Brucella suis ...  43.1    0.026  
ref|YP_001932973.1|  hypothetical protein BAbS19_II10470 [Bruc...  43.1    0.027  
ref|ZP_03042413.1|  aminoglycoside phosphotransferase [Geobaci...  43.1    0.028 
ref|YP_001595093.1|  homoserine kinase [Brucella canis ATCC 23...  42.7    0.033  
ref|NP_541109.1|  homoserine kinase [Brucella melitensis 16M] ...  42.4    0.043  
ref|ZP_01859816.1|  hypothetical protein BSG1_05939 [Bacillus ...  42.4    0.046 
ref|ZP_02851028.1|  aminoglycoside phosphotransferase [Paeniba...  42.4    0.050 
ref|YP_630041.1|  phosphotransferase [Myxococcus xanthus DK 16...  42.0    0.059  
ref|YP_038654.1|  hypothetical protein BT9727_4339 [Bacillus t...  41.6    0.078  
ref|ZP_03054774.1|  YerI [Bacillus pumilus ATCC 7061] >gb|EDW2...  41.6    0.089 
ref|YP_001701697.1|  putative aminoglycoside phosphotransferas...  41.2    0.094  
ref|ZP_02033492.1|  hypothetical protein PARMER_03519 [Parabac...  40.8    0.12  
ref|YP_001485892.1|  homoserine kinase type II [Bacillus pumil...  40.8    0.13   
ref|ZP_01961212.1|  hypothetical protein BACCAC_02839 [Bactero...  40.4    0.19  
ref|YP_002028108.1|  aminoglycoside phosphotransferase [Stenot...  40.0    0.25   
gb|EEA92226.1|  putative phosphotransferase enzyme family prot...  40.0    0.26  
ref|YP_864886.1|  aminoglycoside phosphotransferase [Magnetoco...  39.7    0.32   
ref|YP_001971928.1|  putative spectinomycin phosphotransferase...  39.3    0.37   
ref|YP_001668032.1|  aminoglycoside phosphotransferase [Pseudo...  39.3    0.37   
ref|NP_388546.1|  hypothetical protein BSU06640 [Bacillus subt...  39.3    0.38   
ref|YP_316094.1|  hypothetical protein Tbd_2336 [Thiobacillus ...  39.3    0.41   
gb|EEA51739.1|  hypothetical protein BRAFLDRAFT_91350 [Branchi...  38.9    0.45  
ref|YP_001305114.1|  hypothetical protein BDI_3808 [Parabacter...  38.9    0.48   
ref|ZP_02067363.1|  hypothetical protein BACOVA_04370 [Bactero...  38.9    0.56  
ref|XP_001981811.1|  GG12258 [Drosophila erecta] >gb|EDV53681....  38.9    0.57   
gb|EEA47647.1|  hypothetical protein BRAFLDRAFT_267223 [Branch...  38.5    0.61  
gb|AAN85479.1|AF484556_1  putative antibiotic resistance prote...  38.5    0.61  
ref|ZP_01616939.1|  hypothetical protein GP2143_03333 [marine ...  38.5    0.65  
ref|YP_001135575.1|  aminoglycoside phosphotransferase [Mycoba...  38.5    0.68   
ref|YP_001629362.1|  hypothetical protein Bpet0759 [Bordetella...  38.5    0.70   
ref|XP_002104910.1|  GD18208 [Drosophila simulans] >gb|EDX1441...  38.5    0.71   
ref|YP_002205470.1|  conserved hypothetical protein [Streptomy...  38.1    0.78   
ref|NP_627568.1|  hypothetical protein SCO3360 [Streptomyces c...  38.1    0.78   
ref|ZP_02434404.1|  hypothetical protein BACSTE_00630 [Bactero...  38.1    0.85  
ref|NP_840285.1|  hypothetical protein NE0191 [Nitrosomonas eu...  38.1    0.88   
ref|YP_001559653.1|  hypothetical protein Cphy_2553 [Clostridi...  38.1    0.90   
ref|YP_952851.1|  aminoglycoside phosphotransferase [Mycobacte...  38.1    0.97   
ref|ZP_03264374.1|  protein of unknown function DUF227 [Burkho...  37.7    1.1   
ref|NP_810547.1|  hypothetical protein BT_1634 [Bacteroides th...  37.7    1.3    
ref|ZP_02918749.1|  hypothetical protein BIFDEN_02064 [Bifidob...  37.7    1.3   
ref|YP_001299809.1|  hypothetical protein BVU_2530 [Bacteroide...  37.4    1.4    
emb|CAJ88214.1|  putative antibiotic resistance protein [Strep...  37.4    1.4   
ref|YP_572972.1|  aminoglycoside phosphotransferase [Chromohal...  37.4    1.5    
ref|YP_705977.1|  hypothetical protein RHA1_ro06042 [Rhodococc...  37.0    1.7    
ref|ZP_02244602.1|  hypothetical protein Xoryp_18650 [Xanthomo...  37.0    1.8   
ref|NP_651382.1|  CG10559 CG10559-PA [Drosophila melanogaster]...  37.0    1.8    
emb|CAF18498.1|  aldehyde oxidoreductase, ferredoxin-dependent...  37.0    1.8   
ref|YP_199501.1|  hypothetical protein XOO0862 [Xanthomonas or...  37.0    1.9    
gb|AAO32807.1|  conserved hypothetical protein 1 [Xanthomonas ...  37.0    1.9   
ref|YP_449815.1|  hypothetical protein XOO_0786 [Xanthomonas o...  37.0    1.9    
ref|YP_001915507.1|  aminoglycoside phosphotransferase [Xantho...  37.0    2.0    
ref|NP_384143.1|  hypothetical protein SMc02757 [Sinorhizobium...  36.6    2.2    
ref|XP_002120015.1|  PREDICTED: similar to dynein, axonemal, h...  36.6    2.7    
ref|ZP_03302583.1|  hypothetical protein BACDOR_03983 [Bactero...  36.2    3.4   
ref|YP_001409080.1|  hypothetical protein CCV52592_0027 [Campy...  36.2    3.4    
ref|YP_720393.1|  serine/threonine protein kinase [Trichodesmi...  36.2    3.7    
ref|XP_002126881.1|  PREDICTED: similar to dynein, axonemal, h...  36.2    3.7    
ref|XP_001953029.1|  GF17421 [Drosophila ananassae] >gb|EDV416...  35.8    4.0    
ref|XP_001990465.1|  GH19366 [Drosophila grimshawi] >gb|EDV935...  35.8    4.0    
ref|ZP_03188555.1|  hypothetical protein SpriA_11290 [Streptom...  35.8    4.1   
ref|YP_002199350.1|  conserved hypothetical protein [Streptomy...  35.8    4.3    
ref|ZP_02071467.1|  hypothetical protein BACUNI_02906 [Bactero...  35.8    4.4   
ref|ZP_01442698.1|  hypothetical protein R2601_04923 [Roseovar...  35.8    4.5   
ref|XP_001065087.1|  PREDICTED: similar to dynein, axonemal, h...  35.8    4.6    
ref|XP_001201703.1|  PREDICTED: similar to dynein, axonemal, h...  35.8    4.7    
ref|ZP_01125820.1|  hypothetical protein NB231_15823 [Nitrococ...  35.8    4.9   
ref|XP_226891.3|  PREDICTED: similar to dynein, axonemal, heav...  35.4    5.1    
gb|EDL82632.1|  dynein, axonemal, heavy chain 5 [Rattus norveg...  35.4    5.3    
ref|YP_001314516.1|  methylthioribose kinase [Sinorhizobium me...  35.4    5.5    
ref|YP_410827.1|  aminoglycoside phosphotransferase [Nitrososp...  35.4    6.0    
ref|YP_830237.1|  1,4-alpha-glucan branching enzyme [Arthrobac...  35.4    6.1    
ref|ZP_03009168.1|  hypothetical protein BACCOP_01020 [Bactero...  35.0    6.6   
ref|YP_001102349.1|  aminoglycoside phosphotransferase [Saccha...  35.0    6.6    
ref|YP_002316344.1|  Predicted kinase [Anoxybacillus flavither...  35.0    6.8    
ref|YP_001192287.1|  Mn2+-dependent serine/threonine protein k...  35.0    6.8    
ref|XP_002099051.1|  GE10708 [Drosophila yakuba] >gb|EDW98763....  35.0    7.2    
ref|YP_001547799.1|  aminoglycoside phosphotransferase [Herpet...  35.0    7.5    
ref|ZP_02441811.1|  hypothetical protein ANACOL_01092 [Anaerot...  35.0    8.0   
ref|ZP_01441775.1|  putative phosphotransferase [Roseovarius s...  35.0    8.3   
gb|EEA92483.1|  conserved hypothetical protein [Pseudovibrio s...  35.0    8.4   
ref|ZP_00951829.1|  hypothetical protein OA2633_02371 [Oceanic...  34.7    8.8   
ref|XP_001624104.1|  predicted protein [Nematostella vectensis...  34.7    9.4    
ref|YP_208749.1|  hypothetical protein NGO1716 [Neisseria gono...  34.7    9.8    



>ref|ZP_01627622.1|  hypothetical protein MGP2080_04490 [marine gamma proteobacterium 
HTCC2080]
 gb|EAW39762.1|  hypothetical protein MGP2080_04490 [marine gamma proteobacterium 
HTCC2080]
Length=334

 Score =  456 bits (1174),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 212/299 (70%), Positives = 245/299 (81%), Gaps = 0/299 (0%)

Query  2    GMTHPYESLTPDCVVDCLESIGLVSDLRLLALNSYENRVYQVGIEGDDPLILKFYRAGRW  61
             M+HPY++LTPD VVDC+E++G   DLRL+ LNSYENRVYQVGIE + P+I+KFYR  RW
Sbjct  10   AMSHPYDALTPDAVVDCVEAVGYRCDLRLIGLNSYENRVYQVGIEDEVPVIVKFYRDQRW  69

Query  62   TDAQILEEHAFARELVDHEISVVAPESIAGDTLHNVLGQRFSVFKRRGGYPPELDNLDHL  121
            +D QILEEH FA ELV+H+ISVVAPE   G+TLH   GQRF+VFKRRGG+PPELDNL+HL
Sbjct  70   SDEQILEEHRFALELVEHDISVVAPEVTHGETLHKAFGQRFTVFKRRGGHPPELDNLEHL  129

Query  122  YRLGQTLGRIHRVGGATSFLHRRALSPTRMATESRLFVETDFVPVELQSAYRTLAHDCDQ  181
            Y+LG  LGRIHRVG A +F HR  L   RMAT SR F+   F+P +LQ+AY TLA DC+Q
Sbjct  130  YQLGNVLGRIHRVGAAQTFEHRIKLDLERMATASREFLSEHFIPRDLQAAYTTLALDCEQ  189

Query  182  AATEVLSAMTADDLQRVHGDCHVGNILWRDDTPHFVDLDDCISGPVVQDIWMFLNGARDQ  241
            AA ++LS MTA DLQR+HGDCH GNILWRDDT HFVDLDDCISGP +QD+WMFLNG R  
Sbjct  190  AARDLLSGMTASDLQRIHGDCHCGNILWRDDTAHFVDLDDCISGPAIQDLWMFLNGERHH  249

Query  242  REQQLADFIEGYEEFNDFDSRQLNWIEALRTLRIMHHAAWLARRWSDPAFPKAFPWFGN  300
            REQQLA+ I GYEEF+DFD RQL W+E LRTLRIMHHAAWL RRW DPAFP+AFPWFG 
Sbjct  250  REQQLAELIAGYEEFHDFDPRQLRWVEGLRTLRIMHHAAWLGRRWDDPAFPRAFPWFGQ  308


>ref|ZP_01102893.1|  conserved hypothetical protein [gamma proteobacterium KT 71]
 gb|EAQ97380.1|  conserved hypothetical protein [Congregibacter litoralis KT71]
Length=326

 Score =  355 bits (912),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 167/298 (56%), Positives = 216/298 (72%), Gaps = 1/298 (0%)

Query  4    THPYESLTPDCVVDCLESIGLVSDLRLLALNSYENRVYQVGIEGDDPLILKFYRAGRWTD  63
            +HP++ LTPD ++D +E+ G VSD RLLALNSYENRVYQVG+E D P+I+KFYR GRWT+
Sbjct  3    SHPFDVLTPDAIIDAVEAAGFVSDARLLALNSYENRVYQVGVEDDTPVIVKFYRPGRWTE  62

Query  64   AQILEEHAFARELVDHEISVVAP-ESIAGDTLHNVLGQRFSVFKRRGGYPPELDNLDHLY  122
             Q+ EEH+F+ ELV+ EI VVAP +S  G+T+H      ++VF RRGG+ PE DNLD+L 
Sbjct  63   EQLREEHSFSEELVEAEIPVVAPIKSETGETVHRWGNLLYTVFPRRGGHAPEFDNLDNLL  122

Query  123  RLGQTLGRIHRVGGATSFLHRRALSPTRMATESRLFVETDFVPVELQSAYRTLAHDCDQA  182
             LG+TLGRIH +G    F  R  L    +  ESR  +   F+P EL++AY TL +D ++ 
Sbjct  123  VLGRTLGRIHAIGATKPFSFRPRLEGQTIIEESRKLLPDSFIPTELKTAYVTLLNDLEKE  182

Query  183  ATEVLSAMTADDLQRVHGDCHVGNILWRDDTPHFVDLDDCISGPVVQDIWMFLNGARDQR  242
                +  M A    R+HGDCH GNILWRD+T +FVDLDDC++ P +QD+WMFL+G  + +
Sbjct  183  LAPKIQQMEAAGGIRIHGDCHGGNILWRDETANFVDLDDCMTAPAIQDLWMFLSGESNDQ  242

Query  243  EQQLADFIEGYEEFNDFDSRQLNWIEALRTLRIMHHAAWLARRWSDPAFPKAFPWFGN  300
            E QL + I GYEEF +FD R+L+WIE LRTLRI+ +AAWLARRW DPAFPKAFPWF  
Sbjct  243  EIQLGEVIAGYEEFFEFDPRELHWIETLRTLRIIRYAAWLARRWDDPAFPKAFPWFNT  300


>ref|YP_001174333.1|  serine/threonine protein kinase [Pseudomonas stutzeri A1501]
 gb|ABP81491.1|  putative homoserine kinase type II (protein kinase fold) [Pseudomonas 
stutzeri A1501]
Length=324

 GENE ID: 5096829 PST_3868 | serine/threonine protein kinase
[Pseudomonas stutzeri A1501] (10 or fewer PubMed links)

 Score =  338 bits (868),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 169/299 (56%), Positives = 208/299 (69%), Gaps = 2/299 (0%)

Query  3    MTHPYESLTPDCVVDCLESIGLVSDLRLLALNSYENRVYQVGIEGDDPLILKFYRAGRWT  62
            M+HP+++LTPD V+D +ESIG +SD R+LALNSYENRVYQVGIE + PLI KFYR GRW+
Sbjct  1    MSHPFDTLTPDLVLDAVESIGYLSDARVLALNSYENRVYQVGIEDETPLIAKFYRPGRWS  60

Query  63   DAQILEEHAFARELVDHEISVVAPESIAGDTLHNVLGQRFSVFKRRGGYPPELDNLDHLY  122
            DA ILEEH F+ EL +HE+ VVAP    G TL    G RF++F RRGG  PE  NLD LY
Sbjct  61   DAAILEEHQFSLELAEHEVPVVAPLERDGSTLFEHAGFRFALFPRRGGRAPEPGNLDQLY  120

Query  123  RLGQTLGRIHRVGGATSFLHRRALSPTRMATES-RLFVETDFVPVELQSAYRTLAHDCDQ  181
            RLGQ LGR+H VG    F HR  L       +S    +E DFVP  L  AY ++A D  +
Sbjct  121  RLGQLLGRMHAVGANRPFEHRETLGVQNFGHDSLSTLLEGDFVPRSLLPAYESVARDLLK  180

Query  182  AATEVLSAMTADDLQRVHGDCHVGNILWRDDTPHFVDLDDCISGPVVQDIWMFLNGARDQ  241
               +V ++     + R+HGDCH GNIL RDD  + VDLDDC  GP VQD+WM L G R +
Sbjct  181  RVEDVFASTDFTPI-RLHGDCHPGNILARDDAFYLVDLDDCRMGPAVQDLWMMLAGERHE  239

Query  242  REQQLADFIEGYEEFNDFDSRQLNWIEALRTLRIMHHAAWLARRWSDPAFPKAFPWFGN  300
            R  QLA+ ++GY EF+DF  R+L  IEALR LR+MH++AWLARRW DPAFP +FPWFG+
Sbjct  240  RLGQLAELVDGYNEFHDFAPRELPLIEALRALRLMHYSAWLARRWDDPAFPMSFPWFGS  298


>ref|ZP_01127928.1|  hypothetical protein NB231_00810 [Nitrococcus mobilis Nb-231]
 gb|EAR21217.1|  hypothetical protein NB231_00810 [Nitrococcus mobilis Nb-231]
Length=327

 Score =  338 bits (867),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 164/297 (55%), Positives = 210/297 (70%), Gaps = 1/297 (0%)

Query  5    HPYESLTPDCVVDCLESIGLVSDLRLLALNSYENRVYQVGIEGDDPLILKFYRAGRWTDA  64
            HPY +L P+ V+  +E++GL S+ RLLALNSYENRVYQVG++G +PL++KFYR GRW+D 
Sbjct  6    HPYAALAPETVLTAVETLGLTSNGRLLALNSYENRVYQVGLDGAEPLVVKFYRPGRWSDQ  65

Query  65   QILEEHAFARELVDHEISVVAPESIAGDTLHNVLGQRFSVFKRRGGYPPELDNLDHLYRL  124
             ILEEHAFA ELV +EI VVAP    G TLH   G R++VF RRGG  PELD+ D   RL
Sbjct  66   AILEEHAFAAELVGYEIPVVAPLPFTGATLHYHQGFRYAVFPRRGGRSPELDDPDCRVRL  125

Query  125  GQTLGRIHRVGGATSFLHRRALSPTRMATESRLF-VETDFVPVELQSAYRTLAHDCDQAA  183
            G+ LGRIH VG + +F HR AL         R + +E  F+P  L SAY TL+ D   A 
Sbjct  126  GRFLGRIHAVGASRAFAHRPALGIADYGEAPRRYLLEQGFIPAHLVSAYETLSRDLLAAI  185

Query  184  TEVLSAMTADDLQRVHGDCHVGNILWRDDTPHFVDLDDCISGPVVQDIWMFLNGARDQRE  243
                + +      R+HGDCH+GNILW +  PHFVDLDDC+ GP +QD+WM L+G+R +  
Sbjct  186  RRCYARVDGLRQLRLHGDCHLGNILWTEAGPHFVDLDDCLRGPAIQDLWMLLSGSRAEMT  245

Query  244  QQLADFIEGYEEFNDFDSRQLNWIEALRTLRIMHHAAWLARRWSDPAFPKAFPWFGN  300
             QL+D + GYE+F + D R+L  +EALRTLR+M+++AWLARRWSDPAFP AFPWFG+
Sbjct  246  LQLSDLLAGYEDFYELDRRELVLVEALRTLRMMNYSAWLARRWSDPAFPLAFPWFGS  302


>ref|ZP_00418343.1|  protein of unknown function DUF954 [Azotobacter vinelandii AvOP]
 gb|EAM05130.1|  protein of unknown function DUF954 [Azotobacter vinelandii AvOP]
Length=324

 Score =  335 bits (859),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 169/299 (56%), Positives = 208/299 (69%), Gaps = 2/299 (0%)

Query  3    MTHPYESLTPDCVVDCLESIGLVSDLRLLALNSYENRVYQVGIEGDDPLILKFYRAGRWT  62
            M+HP++SLTPD V+D +ES+G +SD R+LALNSYENRVYQVGIEG +PLI KFYR  RW+
Sbjct  1    MSHPFDSLTPDLVLDAVESLGYLSDARVLALNSYENRVYQVGIEGGEPLIAKFYRPQRWS  60

Query  63   DAQILEEHAFARELVDHEISVVAPESIAGDTLHNVLGQRFSVFKRRGGYPPELDNLDHLY  122
            DA I EEHAF+ EL D E+ VVAP S  G+TL    G RF++F RRGG  PE  NLD LY
Sbjct  61   DAAIREEHAFSLELADCEVPVVAPLSRDGETLFEHSGFRFALFPRRGGRAPEPGNLDQLY  120

Query  123  RLGQTLGRIHRVGGATSFLHRRALSPTRMATES-RLFVETDFVPVELQSAYRTLAHDCDQ  181
            RLG  LGR+H VG +  F HR  L+      +S    ++  FVP  L  AY ++A D   
Sbjct  121  RLGGLLGRLHAVGASRPFEHREELTVANFGHDSLSTLLDGGFVPKSLLPAYESVARDL-L  179

Query  182  AATEVLSAMTADDLQRVHGDCHVGNILWRDDTPHFVDLDDCISGPVVQDIWMFLNGARDQ  241
            A  + L   T     R+HGDCH GN+L RD+T H VDLDDC  GP VQD+WM L G R +
Sbjct  180  ARLDALFGATTYRTIRIHGDCHPGNLLCRDETFHIVDLDDCRMGPAVQDLWMMLAGDRQE  239

Query  242  REQQLADFIEGYEEFNDFDSRQLNWIEALRTLRIMHHAAWLARRWSDPAFPKAFPWFGN  300
            R  QLA+ ++GY+EF+DFD RQL  IE LR LR++H++AWLARRW DPAFP +FPWFG 
Sbjct  240  RLAQLAELMDGYQEFHDFDPRQLALIEGLRALRLIHYSAWLARRWDDPAFPPSFPWFGT  298


>ref|YP_350908.1|  serine/threonine protein kinase [Pseudomonas fluorescens Pf0-1]
 gb|ABA76917.1|  Aminoglycoside phosphotransferase [Pseudomonas fluorescens Pf0-1]
Length=324

 GENE ID: 3716770 Pfl01_5180 | serine/threonine protein kinase
[Pseudomonas fluorescens PfO-1]

 Score =  335 bits (859),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 167/299 (55%), Positives = 207/299 (69%), Gaps = 2/299 (0%)

Query  3    MTHPYESLTPDCVVDCLESIGLVSDLRLLALNSYENRVYQVGIEGDDPLILKFYRAGRWT  62
            M HP+E+LTPD V+D +ESIG +SD R+LALNSYENRVYQVGIE  +PLI KFYR  RWT
Sbjct  1    MAHPFETLTPDLVLDAVESIGFLSDARILALNSYENRVYQVGIEDSEPLIAKFYRPQRWT  60

Query  63   DAQILEEHAFARELVDHEISVVAPESIAGDTLHNVLGQRFSVFKRRGGYPPELDNLDHLY  122
            +  ILEEH F  EL D EI VVAP    G+TLH   G RF++F RRGG  PE  NLD LY
Sbjct  61   NEAILEEHQFTFELADVEIPVVAPLIHNGETLHEHAGFRFTLFPRRGGRAPEPGNLDQLY  120

Query  123  RLGQTLGRIHRVGGATSFLHRRALSPTRMATES-RLFVETDFVPVELQSAYRTLAHDCDQ  181
            RLGQ LGR+H VGG   F HR AL+      +S    +E +F+P  L  AY ++A D  +
Sbjct  121  RLGQLLGRMHAVGGTKPFEHREALAVKNFGHDSLTTLLEGNFIPRSLLPAYESVARDLLK  180

Query  182  AATEVLSAMTADDLQRVHGDCHVGNILWRDDTPHFVDLDDCISGPVVQDIWMFLNGARDQ  241
               +V +     ++ R+HGDCH GN++ RD+  H VDLDDC  GP VQDIWM L G R  
Sbjct  181  RVEDVYANTPHQNI-RMHGDCHPGNMMCRDEMFHIVDLDDCRMGPAVQDIWMMLAGDRQD  239

Query  242  REQQLADFIEGYEEFNDFDSRQLNWIEALRTLRIMHHAAWLARRWSDPAFPKAFPWFGN  300
               QL++ ++GY EF+DFD R+L  IE LR LR+MH++AWLARRW DPAFP++FPWFG+
Sbjct  240  CLGQLSELMDGYNEFHDFDPRELALIEPLRALRLMHYSAWLARRWDDPAFPRSFPWFGS  298


>ref|NP_790333.1|  serine/threonine protein kinase [Pseudomonas syringae pv. tomato 
str. DC3000]
 gb|AAO54028.1|  conserved hypothetical protein [Pseudomonas syringae pv. tomato 
str. DC3000]
Length=324

 GENE ID: 1182093 PSPTO_0484 | serine/threonine protein kinase
[Pseudomonas syringae pv. tomato str. DC3000] (10 or fewer PubMed links)

 Score =  335 bits (858),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 167/299 (55%), Positives = 205/299 (68%), Gaps = 2/299 (0%)

Query  3    MTHPYESLTPDCVVDCLESIGLVSDLRLLALNSYENRVYQVGIEGDDPLILKFYRAGRWT  62
            M HP+ +LTPD V+D +ESIG +SD R+LALNSYENRVYQVGIE   PLI KFYR  RWT
Sbjct  1    MAHPFATLTPDLVLDAVESIGFLSDARILALNSYENRVYQVGIEDGQPLIAKFYRPQRWT  60

Query  63   DAQILEEHAFARELVDHEISVVAPESIAGDTLHNVLGQRFSVFKRRGGYPPELDNLDHLY  122
            +  ILEEH+F  ELVD E+ VVAP    G+TL    G RF++F RRGG  PE  NLD LY
Sbjct  61   NEAILEEHSFTFELVDVEVPVVAPMVHNGETLFEHAGFRFTLFPRRGGRAPEPGNLDQLY  120

Query  123  RLGQTLGRIHRVGGATSFLHRRALSPTRMATES-RLFVETDFVPVELQSAYRTLAHDCDQ  181
            RLGQ LGRIH VG    F HR AL       +S    +E + +P  L  AY ++A D  +
Sbjct  121  RLGQLLGRIHAVGSTKPFAHREALGVKNFGNDSVNYLLENNCIPRSLLPAYESVARDLLK  180

Query  182  AATEVLSAMTADDLQRVHGDCHVGNILWRDDTPHFVDLDDCISGPVVQDIWMFLNGARDQ  241
               +V +A    ++ R+HGDCH GN++ RD+  H VDLDDC  GP VQDIWM L G R +
Sbjct  181  RVEDVYAATPHTNI-RMHGDCHPGNMMCRDEMFHIVDLDDCRLGPAVQDIWMMLAGDRQE  239

Query  242  REQQLADFIEGYEEFNDFDSRQLNWIEALRTLRIMHHAAWLARRWSDPAFPKAFPWFGN  300
            R  QL++ ++GY EF+DFDSR+L  IE LR LR+MH++AWLARRW DPAFP +FPWFG 
Sbjct  240  RLGQLSELMDGYNEFHDFDSRELALIEPLRALRLMHYSAWLARRWDDPAFPHSFPWFGT  298


>ref|YP_001345984.1|  serine/threonine protein kinase [Pseudomonas aeruginosa PA7]
 gb|ABR82547.1|  conserved hypothetical protein [Pseudomonas aeruginosa PA7]
Length=324

 GENE ID: 5357176 PSPA7_0589 | serine/threonine protein kinase
[Pseudomonas aeruginosa PA7]

 Score =  334 bits (857),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 163/299 (54%), Positives = 210/299 (70%), Gaps = 2/299 (0%)

Query  3    MTHPYESLTPDCVVDCLESIGLVSDLRLLALNSYENRVYQVGIEGDDPLILKFYRAGRWT  62
            M+HP++SLTPD V+D +ES+G +SD R+LALNSYENRVYQVGIE D+PLI KFYR  RW+
Sbjct  1    MSHPFDSLTPDLVLDAVESLGYLSDARVLALNSYENRVYQVGIEDDEPLIAKFYRPDRWS  60

Query  63   DAQILEEHAFARELVDHEISVVAPESIAGDTLHNVLGQRFSVFKRRGGYPPELDNLDHLY  122
            DA I EEHAF+ EL + E+ VVAP +  G++L    G RF++F RRGG  PE  NLD LY
Sbjct  61   DAAIREEHAFSAELAECEVPVVAPLTREGESLFGFAGFRFALFPRRGGRAPEPGNLDQLY  120

Query  123  RLGQTLGRIHRVGGATSFLHRRALSPTRMATES-RLFVETDFVPVELQSAYRTLAHDCDQ  181
            RLGQ LGR+H VG    F HR AL+       S    +E DF+P  L  AY ++A D  +
Sbjct  121  RLGQLLGRLHAVGATRPFEHREALTVDNFGHASLATLLEGDFIPRSLLPAYESVARDLLR  180

Query  182  AATEVLSAMTADDLQRVHGDCHVGNILWRDDTPHFVDLDDCISGPVVQDIWMFLNGARDQ  241
                + + +    + R+HGDCH GN+L RD+  H VDLDDC  GP +QD+WM L G R +
Sbjct  181  RVDALFAEVPYQPI-RLHGDCHPGNLLCRDEVYHMVDLDDCRMGPALQDLWMMLAGERHE  239

Query  242  REQQLADFIEGYEEFNDFDSRQLNWIEALRTLRIMHHAAWLARRWSDPAFPKAFPWFGN  300
            R  Q+A+ ++GY EF+DFD RQL  +E LR+LR+MH++AWLARRW DPAFP +FPWFG+
Sbjct  240  RLAQIAELVDGYNEFHDFDPRQLPLLEGLRSLRLMHYSAWLARRWDDPAFPPSFPWFGS  298


---------------------------------------------------------------------------------------


     B) BlastP contre swissprot 


                                                                  Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q8X8H9.1|RDOA_ECO57  RecName: Full=Protein rdoA                  258    3e-68
sp|P0C0K4.1|RDOA_ECOL6  RecName: Full=Protein rdoA >sp|P0C0K3....   258    4e-68
sp|Q83IV7.1|RDOA_SHIFL  RecName: Full=Protein rdoA                  257    6e-68
sp|Q8ZKU8.1|RDOA_SALTY  RecName: Full=Protein rdoA                  235    3e-61
sp|Q5PKB8.1|RDOA_SALPA  RecName: Full=Protein rdoA >sp|Q8Z2S0....   234    6e-61
sp|Q57HL7.1|RDOA_SALCH  RecName: Full=Protein rdoA                  233    7e-61
sp|O34640|YERI_BACSU  Uncharacterized protein yerI                 39.3    0.025
sp|P74594|Y1563_SYNY3  Uncharacterized protein slr1563             34.3    0.73  
sp|Q2RPU7.1|KHSE_RHORT  Homoserine kinase (HSK) (HK)               32.3    2.8   
sp|Q8VHE6.1|DYH5_MOUSE  RecName: Full=Dynein heavy chain 5, ax...  32.3    3.1   
sp|P62286.1|ASPM_CANFA  RecName: Full=Abnormal spindle-like mi...  32.3    3.6   
sp|Q5PQM0.1|TM168_RAT  RecName: Full=Transmembrane protein 168     32.0    3.8   
sp|Q3T040|RT07_BOVIN  28S ribosomal protein S7, mitochondrial ...  32.0    4.1   
sp|Q9H0V1.2|TM168_HUMAN  RecName: Full=Transmembrane protein 168   32.0    4.5   
sp|Q5RD28.1|TM168_PONAB  RecName: Full=Transmembrane protein 168   32.0    4.5   
sp|Q91VX9.1|TM168_MOUSE  RecName: Full=Transmembrane protein 168   31.2    6.7   
sp|Q8TE73.3|DYH5_HUMAN  RecName: Full=Dynein heavy chain 5, ax...  31.2    7.2   
sp|A0JNG0.1|TM168_BOVIN  RecName: Full=Transmembrane protein 168   30.8    9.0   
sp|Q8L785.1|SYGM2_ARATH  RecName: Full=Glycyl-tRNA synthetase ...  30.8    9.9  



>sp|Q8X8H9.1|RDOA_ECO57  RecName: Full=Protein rdoA
Length=328

 Score =  258 bits (658),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 134/298 (44%), Positives = 184/298 (61%), Gaps = 14/298 (4%)

Query  7    YESLTPDCVVDCLESIGLVSDLRLLALNSYENRVYQVGIEGDDPLILKFYRAGRWTDAQI  66
            +++L PD ++D L   G+  D  L  LNSYENRVYQ   E     ++KFYR  RWT  QI
Sbjct  8    FQTLHPDTIMDALFEQGIRVDSGLTPLNSYENRVYQFQDEDRRRFVVKFYRPERWTADQI  67

Query  67   LEEHAFARELVDHEISVVAPESIAGDTLHNVLGQRFSVFKRRGGYPPELDNLDHLYRLGQ  126
            LEEH FA +LV+ E+ V AP +  G TL N  G  F+VF   GG   E DN+D +  +G+
Sbjct  68   LEEHQFALQLVNDEVPVAAPVAFNGQTLLNHQGFYFAVFPSVGGRQFEADNIDQMEAVGR  127

Query  127  TLGRIHRVGGATSFLHRRALSPTRMATESR-LFVETDFVPVELQSAYRTLAHDCDQAATE  185
             LGR+H+ G    F+HR  +       E R LF +   +P  L++A+        +A  E
Sbjct  128  YLGRMHQTGRKQLFIHRPTIGLNEYLIEPRKLFEDATLIPSGLKAAFL-------KATDE  180

Query  186  VLSAMTAD-----DLQRVHGDCHVGNILWRDDTPHFVDLDDCISGPVVQDIWMFLNGARD  240
            +++A+TA       + R+HGDCH GNILWRD  P FVDLDD  +GP +QD+WM LNG + 
Sbjct  181  LIAAVTAHWREDFTVLRLHGDCHAGNILWRDG-PMFVDLDDARNGPAIQDLWMLLNGDKA  239

Query  241  QREQQLADFIEGYEEFNDFDSRQLNWIEALRTLRIMHHAAWLARRWSDPAFPKAFPWF  298
            ++  QL   IE YEEF++FD+ ++  IE LR +R++++ AWL RRW+DPAFPK FPW 

Sbjct  240  EQRMQLETIIEAYEEFSEFDTAEIGLIEPLRAMRLVYYLAWLMRRWADPAFPKNFPWL  297


>sp|P0C0K4.1|RDOA_ECOL6  RecName: Full=Protein rdoA
 sp|P0C0K3.1|RDOA_ECOLI  RecName: Full=Protein rdoA
Length=328

 Score =  258 bits (658),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 135/298 (45%), Positives = 184/298 (61%), Gaps = 14/298 (4%)

Query  7    YESLTPDCVVDCLESIGLVSDLRLLALNSYENRVYQVGIEGDDPLILKFYRAGRWTDAQI  66
            +++L PD ++D L   G+  D  L  LNSYENRVYQ   E     ++KFYR  RWT  QI
Sbjct  8    FQTLHPDTIMDALFEHGIRVDSGLTPLNSYENRVYQFQDEDRRRFVVKFYRPERWTADQI  67

Query  67   LEEHAFARELVDHEISVVAPESIAGDTLHNVLGQRFSVFKRRGGYPPELDNLDHLYRLGQ  126
            LEEH FA +LV+ E+ V AP +  G TL N  G  F+VF   GG   E DN+D +  +G+
Sbjct  68   LEEHQFALQLVNDEVPVAAPVAFNGQTLLNHQGFYFAVFPSVGGRQFEADNIDQMEAVGR  127

Query  127  TLGRIHRVGGATSFLHRRALSPTRMATESR-LFVETDFVPVELQSAYRTLAHDCDQAATE  185
             LGR+H+ G    F+HR  +       E R LF +   +P  L++A+        +A  E
Sbjct  128  YLGRMHQTGRKQLFIHRPTIGLNEYLIEPRKLFEDATLIPSGLKAAFL-------KATDE  180

Query  186  VLSAMTAD-----DLQRVHGDCHVGNILWRDDTPHFVDLDDCISGPVVQDIWMFLNGARD  240
            +++A+TA       + R+HGDCH GNILWRD  P FVDLDD  +GP VQD+WM LNG + 
Sbjct  181  LIAAVTAHWREDFTVLRLHGDCHAGNILWRDG-PMFVDLDDARNGPAVQDLWMLLNGDKA  239

Query  241  QREQQLADFIEGYEEFNDFDSRQLNWIEALRTLRIMHHAAWLARRWSDPAFPKAFPWF  298
            ++  QL   IE YEEF++FD+ ++  IE LR +R++++ AWL RRW+DPAFPK FPW 
Sbjct  240  EQRMQLETIIEAYEEFSEFDTAEIGLIEPLRAMRLVYYLAWLMRRWADPAFPKNFPWL  297


>sp|Q83IV7.1|RDOA_SHIFL  RecName: Full=Protein rdoA
Length=328

 Score =  257 bits (656),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 134/298 (44%), Positives = 183/298 (61%), Gaps = 14/298 (4%)

Query  7    YESLTPDCVVDCLESIGLVSDLRLLALNSYENRVYQVGIEGDDPLILKFYRAGRWTDAQI  66
            +++L PD ++D L   G+  D  L  LNSYENRVYQ   E     ++KFYR  RWT  QI
Sbjct  8    FQTLHPDTIMDALFKQGIRVDSGLTPLNSYENRVYQFQDEERRRFVVKFYRPERWTADQI  67

Query  67   LEEHAFARELVDHEISVVAPESIAGDTLHNVLGQRFSVFKRRGGYPPELDNLDHLYRLGQ  126
            LEEH FA +LV+ E+ V AP +  G TL N  G  F+VF   GG   E DN+D +  +G+
Sbjct  68   LEEHQFALQLVNDEVPVAAPVAFNGQTLLNHQGFYFAVFPSVGGRQFEADNIDQMEAVGR  127

Query  127  TLGRIHRVGGATSFLHRRALSPTRMATESR-LFVETDFVPVELQSAYRTLAHDCDQAATE  185
             LGR+H+ G    F+HR  +       E R LF +   +P  L++A+        +A  E
Sbjct  128  YLGRMHQTGRKQLFIHRPTIGLNEYLIEPRKLFEDATLIPSGLKAAFL-------KATDE  180

Query  186  VLSAMTAD-----DLQRVHGDCHVGNILWRDDTPHFVDLDDCISGPVVQDIWMFLNGARD  240
            +++A+TA       + R+HGDCH GNILWRD  P FVDLDD  +GP +QD+WM LNG + 
Sbjct  181  LIAAVTAHWREDFTVLRLHGDCHAGNILWRDG-PMFVDLDDARNGPAIQDLWMLLNGDKA  239

Query  241  QREQQLADFIEGYEEFNDFDSRQLNWIEALRTLRIMHHAAWLARRWSDPAFPKAFPWF  298
            Q+  QL   IE YEEF++FD+ ++  IE LR +R++++ AWL R W+DPAFPK FPW 
Sbjct  240  QQRMQLETIIEAYEEFSEFDTAEIGLIEPLRAMRLVYYLAWLMRHWADPAFPKNFPWL  297


>sp|Q8ZKU8.1|RDOA_SALTY  RecName: Full=Protein rdoA
Length=328

 Score =  235 bits (599),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 124/293 (42%), Positives = 170/293 (58%), Gaps = 4/293 (1%)

Query  7    YESLTPDCVVDCLESIGLVSDLRLLALNSYENRVYQVGIEGDDPLILKFYRAGRWTDAQI  66
            +++L P+ ++D L   G++ D  L  LNSYENRVYQ   E     ++KFYR  RW+  QI
Sbjct  8    FQTLHPETIMDALFEQGIMVDSGLTPLNSYENRVYQFQDEDRRRFVVKFYRPERWSVDQI  67

Query  67   LEEHAFARELVDHEISVVAPESIAGDTLHNVLGQRFSVFKRRGGYPPELDNLDHLYRLGQ  126
             EEH FA ELV  E+ V AP +  G TL    G  +++F   GG   E DN+D +  +G+
Sbjct  68   REEHQFALELVKDEVPVAAPLAFNGQTLLAHQGYHYAIFPSVGGRQFEADNIDQMEAVGR  127

Query  127  TLGRIHRVGGATSFLHRRALSPTRMATESR-LFVETDFVPVELQSAYRTLAHDCDQAATE  185
             LGR+H+ G    F  R  +       E R +F +   +P   ++A+         A TE
Sbjct  128  YLGRLHQTGRKRPFTFRPDIGLAEYLFEPRQVFEDAALIPSGQKAAFLKATDTLLSAVTE  187

Query  186  VLSAMTADDLQRVHGDCHVGNILWRDDTPHFVDLDDCISGPVVQDIWMFLNGARDQREQQ  245
                  A    R+HGDCH GNILWRD  P FVDLDD  +GP +QD+WM LNG + ++  Q
Sbjct  188  CWRTDFAT--LRLHGDCHAGNILWRDG-PLFVDLDDARNGPAIQDLWMLLNGDKAEQRMQ  244

Query  246  LADFIEGYEEFNDFDSRQLNWIEALRTLRIMHHAAWLARRWSDPAFPKAFPWF  298
            L   IE YEE ++FD+ ++  IE LR +R++++ AWL RRW DPAFPK FPW 
Sbjct  245  LETIIEAYEEVSEFDTAEIGLIEPLRAMRLVYYLAWLIRRWGDPAFPKNFPWL  297


>sp|Q5PKB8.1|RDOA_SALPA  RecName: Full=Protein rdoA
 sp|Q8Z2S0.1|RDOA_SALTI  RecName: Full=Protein rdoA
Length=328

 Score =  234 bits (596),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 124/293 (42%), Positives = 169/293 (57%), Gaps = 4/293 (1%)

Query  7    YESLTPDCVVDCLESIGLVSDLRLLALNSYENRVYQVGIEGDDPLILKFYRAGRWTDAQI  66
            +++L P+ ++D L   G+  D  L  LNSYENRVYQ   E     ++KFYR  RW+  QI
Sbjct  8    FQTLHPETIMDALFEQGIRVDSGLTPLNSYENRVYQFQDEDRRRFVVKFYRPERWSVDQI  67

Query  67   LEEHAFARELVDHEISVVAPESIAGDTLHNVLGQRFSVFKRRGGYPPELDNLDHLYRLGQ  126
             EEH FA ELV  E+ V AP +  G TL    G  +++F   GG   E DN+D +  +G+
Sbjct  68   REEHQFALELVKDEVPVAAPLAFNGQTLLAHQGYHYAIFPSVGGRQFEADNIDQMEAVGR  127

Query  127  TLGRIHRVGGATSFLHRRALSPTRMATESR-LFVETDFVPVELQSAYRTLAHDCDQAATE  185
             LGR+H+ G    F  R  +       E R +F +   +P   ++A+         A TE
Sbjct  128  YLGRLHQTGRKRPFTFRPDIGLAEYLFEPRQVFEDAALIPSGQKAAFLKATDTLLSAVTE  187

Query  186  VLSAMTADDLQRVHGDCHVGNILWRDDTPHFVDLDDCISGPVVQDIWMFLNGARDQREQQ  245
                  A    R+HGDCH GNILWRD  P FVDLDD  +GP +QD+WM LNG + ++  Q
Sbjct  188  CWRTDFAT--LRLHGDCHAGNILWRDG-PLFVDLDDARNGPAIQDLWMLLNGNKAEQRMQ  244

Query  246  LADFIEGYEEFNDFDSRQLNWIEALRTLRIMHHAAWLARRWSDPAFPKAFPWF  298
            L   IE YEE ++FD+ ++  IE LR +R++++ AWL RRW DPAFPK FPW 
Sbjct  245  LETIIEAYEEVSEFDTAEIGLIEPLRAMRLVYYLAWLIRRWGDPAFPKNFPWL  297


>sp|Q57HL7.1|RDOA_SALCH  RecName: Full=Protein rdoA
Length=328

 Score =  233 bits (595),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 124/293 (42%), Positives = 169/293 (57%), Gaps = 4/293 (1%)

Query  7    YESLTPDCVVDCLESIGLVSDLRLLALNSYENRVYQVGIEGDDPLILKFYRAGRWTDAQI  66
            +++L P+ ++D L   G+  D  L  LNSYENRVYQ   E     ++KFYR  RW+  QI
Sbjct  8    FQTLHPETIMDALFEQGIRVDSGLTPLNSYENRVYQFQDEDRRRFVVKFYRPERWSVDQI  67

Query  67   LEEHAFARELVDHEISVVAPESIAGDTLHNVLGQRFSVFKRRGGYPPELDNLDHLYRLGQ  126
             EEH FA ELV  E+ V AP +  G TL    G  +++F   GG   E DN+D +  +G+
Sbjct  68   REEHQFALELVKDEVPVAAPLAFNGQTLLAHQGYHYAIFPSVGGRQFEADNIDQMEAVGR  127

Query  127  TLGRIHRVGGATSFLHRRALSPTRMATESR-LFVETDFVPVELQSAYRTLAHDCDQAATE  185
             LGR+H+ G    F  R  +       E R +F +   +P   ++A+         A TE
Sbjct  128  YLGRLHQTGRKRPFTFRPDIGLAEYLFEPRQVFEDAALIPSGQKAAFLKATDTLLSAVTE  187

Query  186  VLSAMTADDLQRVHGDCHVGNILWRDDTPHFVDLDDCISGPVVQDIWMFLNGARDQREQQ  245
                  A    R+HGDCH GNILWRD  P FVDLDD  +GP +QD+WM LNG + ++  Q
Sbjct  188  CWRTDFAT--LRLHGDCHAGNILWRDG-PLFVDLDDARNGPAIQDLWMLLNGDKAEQRMQ  244

Query  246  LADFIEGYEEFNDFDSRQLNWIEALRTLRIMHHAAWLARRWSDPAFPKAFPWF  298
            L   IE YEE ++FD+ ++  IE LR +R++++ AWL RRW DPAFPK FPW 
Sbjct  245  LETIIEAYEEISEFDTAEIGLIEPLRAMRLVYYLAWLIRRWGDPAFPKNFPWL  297


>sp|O34640|YERI_BACSU  Uncharacterized protein yerI
Length=336

 Score = 39.3 bits (90),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 66/260 (25%), Positives = 96/260 (36%), Gaps = 27/260 (10%)

Query  37   ENRVYQVGIEGDDPLILKFYRAGRWTDAQILEEHAFARELVDHEISVVAP-ESIAGDTLH  95
            EN VY+  ++ + P ILK     R +   ++ E  + R L    ISV  P  S+ G  + 
Sbjct  39   ENYVYEC-MKDNQPYILKITHTIRRSSDYMMGEMEWLRHLAIGGISVAKPLPSLNGKDVE  97

Query  96   NVLGQRFSVF------KRRGGYPPELD-NLDHLYRLGQTLGRIHRVGGATSFLHRRALSP  148
             V       F      K  G    E D N    Y LG+  G +H +  +   L   A   
Sbjct  98   AVPDGNGGSFLLRVYEKAPGQKVDESDWNETLFYELGRYTGSMHSLTKSYK-LSNPAFKR  156

Query  149  TRMATESRLFVETDFVPVELQSAYRTLAHDCDQAATEVLS-AMTADDLQRVHGDCHVGNI  207
                 E +L +   +VP +    ++      D    E+     + D+   VH D H GN 
Sbjct  157  QEWDEEEQLKLRK-YVPEDQIKVFQQ----ADSLMNELRRLPKSQDNYGLVHADLHHGNF  211

Query  208  LWRDDTPHFVDLDDCISGPVVQDIWMFLNGA-------RDQR----EQQLADFIEGYEEF  256
             W        D DD      V DI + L           D +    E+ +  F++GY E 
Sbjct  212  NWDHGKITAFDFDDIGYNWFVNDISILLYNVLWYPVVPYDDKAAFTEEFMTHFMKGYWEE  271

Query  257  NDFDSRQLNWIEALRTLRIM  276
            N+ D   L  I     LR M
Sbjct  272  NELDPAWLMIIPDFLRLRHM  291


>sp|P74594|Y1563_SYNY3  Uncharacterized protein slr1563
Length=295

 GENE ID: 952074 slr1563 | hypothetical protein [Synechocystis sp. PCC 6803]
(10 or fewer PubMed links)

 Score = 34.3 bits (77),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 41/98 (41%), Gaps = 13/98 (13%)

Query  45   IEGDDPLILKFYRAGRWTDAQILEEHAFARELVDHEISVVAPESI--AGDTLHNVLGQRF  102
            ++G+    +K  +A +W   Q+ +  A   E +    ++  P  I       H+ L   +
Sbjct  44   VDGEQKYFVKLNQAQQW---QMFQAEALGLEAMAATQTIRVPRPICHGSSAGHSYLVLEW  100

Query  103  SVFKRRGGYPPELDNLDHLYRLGQTLGRIHRVGGATSF  140
              F R         N D  YR+GQ L  +H+ GG+  F
Sbjct  101  LEFGR--------GNHDSWYRMGQNLAALHQAGGSAQF  130


>sp|Q2RPU7.1|KHSE_RHORT  Homoserine kinase (HSK) (HK)
Length=321

 GENE ID: 3836499 Rru_A3053 | homoserine kinase
[Rhodospirillum rubrum ATCC 11170]

 Score = 32.3 bits (72),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 79/210 (37%), Gaps = 34/210 (16%)

Query  83   VVAPESIAG---DTLHNVLGQRFSVFKRRGGYPPELDNLDHLYRLGQTLGRIHRVGGATS  139
            +  P+ +AG     LH +  +  ++     G  P+   + H  +LG+ L R+H  GG  +
Sbjct  77   IPCPQPVAGRDGAVLHTLCDRPAAIVTFLDGVWPKRPEVRHCAQLGEALARLHLAGGDYA  136

Query  140  FLHRRALS-----PTRMATESRLFVETDFVPVELQSAYRTLAHDCDQAATEVLSAMTADD  194
               R +LS     P   A   R     D V   L++   T          + L A+   D
Sbjct  137  PTRRNSLSVDGWRPLFDAAAER----ADSVKPGLRAELET--------ELDALEALWPHD  184

Query  195  LQR--VHGDCHVGNILWRDDT-PHFVDLDDCISGPVVQDIWMFLNGARDQREQQLADFIE  251
            L    +H D    N+ + DDT    +D        +  D+ + LN          A   E
Sbjct  185  LPTGIIHADLFPDNVFFVDDTLSGLIDFYFACDDFLAYDLAVCLN----------AWCFE  234

Query  252  GYEEFNDFDSRQ-LNWIEALRTLRIMHHAA  280
            G  EFN   +R  L   E +R L     AA
Sbjct  235  GEREFNVTKARHMLTRYEKVRPLSDAEFAA  264


>sp|Q8VHE6.1|DYH5_MOUSE  RecName: Full=Dynein heavy chain 5, axonemal; AltName: Full=Axonemal 
beta dynein heavy chain 5; Short=Mdnah5; AltName: Full=Ciliary 
dynein heavy chain 5
Length=4621

 GENE ID: 110082 Dnahc5 | dynein, axonemal, heavy chain 5 [Mus musculus]
(Over 10 PubMed links)

 Score = 32.3 bits (72),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 32/74 (43%), Gaps = 0/74 (0%)

Query  207   ILWRDDTPHFVDLDDCISGPVVQDIWMFLNGARDQREQQLADFIEGYEEFNDFDSRQLNW  266
             + + D   H V +   I  P    + + + G+  Q   +LA FI GY  F    +R  N 
Sbjct  2926  VFFIDAMVHLVKISRVIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTRSYNT  2985

Query  267   IEALRTLRIMHHAA  280
                +  L++++  A
Sbjct  2986  SNLMEDLKVLYRTA  2999


---------------------------------------------------------------------------------------------------

ORF finding

PROTOCOLE:

  A) SMS ORFinder  sens direct/ cadres 1, 2 et 3/ min 60 AA/ initiation 'any codon'/ code génétique bactérien
  B) SMS ORFinder  sens indirect/ cadres 1, 2 et 3/ min 60 AA/ initiation 'any codon'/ code génétique bactérien
---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

    Soumise à ORFinder notre séquence possède au niveau de son brin direct un ORF intéressant  dans le
cadre de lecture n° 1. Notre ORF possède cependant une extrémité 5' et 3' incomplètes. Nous avons choisi 
cet ORF car les autres ORF trouvés ne sont pas assez grand pour contenir un domaine protéique. L'ORF que nous avons
choisi commence à la base 31 et se termine à la base 930. Après observation de l'alignement multiple
nous avons corrigé la définition de notre ORF. Compte tenu de sa taille (298 AA) nous pouvons faire 
l'hypothèse que cet ORF est codant.
---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:

   A) sens direct



>ORF number 1 in reading frame 1 on the direct strand extends from base 31 to base 930.
GCTGGCATGACACATCCCTATGAATCCTTAACGCCAGACTGTGTGGTTGACTGTCTCGAG
AGTATTGGTCTTGTTAGTGATTTGCGTCTTCTTGCGCTTAACAGCTACGAAAATCGTGTC
TACCAAGTAGGGATTGAAGGTGATGATCCCCTCATTCTGAAATTTTACCGTGCCGGACGA
TGGACTGACGCGCAGATACTCGAGGAGCATGCATTCGCGCGGGAGCTCGTTGATCATGAG
ATTTCAGTGGTCGCGCCAGAGTCGATTGCTGGGGACACGCTTCATAACGTTTTGGGGCAG
CGATTTTCGGTATTCAAGCGTCGTGGTGGTTATCCGCCTGAGCTCGATAATTTGGATCAT
CTGTACCGTTTAGGGCAGACCCTAGGGCGCATTCATCGGGTGGGTGGCGCGACATCGTTT
CTTCATCGCCGCGCGCTGTCCCCGACCCGGATGGCAACCGAGTCACGATTGTTCGTAGAA
ACTGATTTTGTGCCTGTGGAGCTTCAATCGGCCTACAGGACATTGGCTCATGACTGCGAT
CAGGCGGCGACCGAGGTTTTGTCGGCAATGACAGCCGACGATCTTCAGCGTGTGCACGGT
GATTGTCATGTGGGCAACATCTTATGGCGCGATGACACTCCTCACTTTGTAGATCTTGAT
GACTGTATTTCCGGGCCTGTGGTTCAGGATATCTGGATGTTCCTAAACGGTGCTCGCGAT
CAACGCGAGCAACAGCTCGCTGATTTCATTGAAGGTTATGAAGAGTTTAACGACTTTGAT
TCGAGACAGCTGAACTGGATCGAAGCATTACGGACGCTGCGAATCATGCATCATGCCGCG
TGGCTGGCACGCCGGTGGAGCGACCCTGCATTTCCCAAAGCGTTTCCTTGGTTCGGTAAT


>Translation of ORF number 1 in reading frame 1 on the direct strand.
AGMTHPYESLTPDCVVDCLESIGLVSDLRLLALNSYENRVYQVGIEGDDPLILKFYRAGR
WTDAQILEEHAFARELVDHEISVVAPESIAGDTLHNVLGQRFSVFKRRGGYPPELDNLDH
LYRLGQTLGRIHRVGGATSFLHRRALSPTRMATESRLFVETDFVPVELQSAYRTLAHDCD
QAATEVLSAMTADDLQRVHGDCHVGNILWRDDTPHFVDLDDCISGPVVQDIWMFLNGARD
QREQQLADFIEGYEEFNDFDSRQLNWIEALRTLRIMHHAAWLARRWSDPAFPKAFPWFGN


>ORF number 1 in reading frame 2 on the direct strand extends from base 191 to base 403.
AATTTTACCGTGCCGGACGATGGACTGACGCGCAGATACTCGAGGAGCATGCATTCGCGC
GGGAGCTCGTTGATCATGAGATTTCAGTGGTCGCGCCAGAGTCGATTGCTGGGGACACGC
TTCATAACGTTTTGGGGCAGCGATTTTCGGTATTCAAGCGTCGTGGTGGTTATCCGCCTG
AGCTCGATAATTTGGATCATCTGTACCGTTTAG

>Translation of ORF number 1 in reading frame 2 on the direct strand.
NFTVPDDGLTRRYSRSMHSRGSSLIMRFQWSRQSRLLGTRFITFWGSDFRYSSVVVVIRL
SSIIWIICTV*

No ORFs were found in reading frame 3.
---------------------------------------------------------------------------------------------------


     B) sens indirect



>ORF number 1 in reading frame 1 on the reverse strand extends from base 157 to base 588.
AATCAGCGAGCTGTTGCTCGCGTTGATCGCGAGCACCGTTTAGGAACATCCAGATATCCT
GAACCACAGGCCCGGAAATACAGTCATCAAGATCTACAAAGTGAGGAGTGTCATCGCGCC
ATAAGATGTTGCCCACATGACAATCACCGTGCACACGCTGAAGATCGTCGGCTGTCATTG
CCGACAAAACCTCGGTCGCCGCCTGATCGCAGTCATGAGCCAATGTCCTGTAGGCCGATT
GAAGCTCCACAGGCACAAAATCAGTTTCTACGAACAATCGTGACTCGGTTGCCATCCGGG
TCGGGGACAGCGCGCGGCGATGAAGAAACGATGTCGCGCCACCCACCCGATGAATGCGCC
CTAGGGTCTGCCCTAAACGGTACAGATGATCCAAATTATCGAGCTCAGGCGGATAACCAC
CACGACGCTTGA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
NQRAVARVDREHRLGTSRYPEPQARKYSHQDLQSEECHRAIRCCPHDNHRAHAEDRRLSL
PTKPRSPPDRSHEPMSCRPIEAPQAQNQFLRTIVTRLPSGSGTARGDEETMSRHPPDECA
LGSALNGTDDPNYRAQADNHHDA*

>ORF number 1 in reading frame 2 on the reverse strand extends from base 659 to base 874.
AATCTCATGATCAACGAGCTCCCGCGCGAATGCATGCTCCTCGAGTATCTGCGCGTCAGT
CCATCGTCCGGCACGGTAAAATTTCAGAATGAGGGGATCATCACCTTCAATCCCTACTTG
GTAGACACGATTTTCGTAGCTGTTAAGCGCAAGAAGACGCAAATCACTAACAAGACCAAT
ACTCTCGAGACAGTCAACCACACAGTCTGGCGTTAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
NLMINELPRECMLLEYLRVSPSSGTVKFQNEGIITFNPYLVDTIFVAVKRKKTQITNKTN
TLETVNHTVWR*

No ORFs were found in reading frame 3.