GOS 679010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1092963887424
Annotathon code: GOS_679010
Sample :
  • GPS :2°34'55s; 97°51'5w
  • Tropical South Pacific: Tropical South Pacific - International
  • Open Ocean (-1.8m, 28.4°C, 0.1-0.8 microns)
Authors
Team : BioCell2008
Username : bio13
Annotated on : 2009-02-12 18:25:00
  • baldi laura
  • sadou radia

Synopsis

  • Taxonomy: Alphaproteobacteria (NCBI info)
    Rank: class - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 28211
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order:
    Bacteria; Proteobacteria; Alphaproteobacteria;

Genomic Sequence

>JCVI_READ_1092963887424 GOS_679010 genomic DNA
TAAAAAGTTTTTGGAAAGCGATTCCTCCAAAGCTAACTCCTATTTCTCAAAATATTTATAAAAAAATTATTTCTGATGAATTTGATGTAATTATATCTTG
TGGGAGAAAAAGTGTAATACCTTCAATTCATTTAAAAAAAACTTCAAATAAAAAATTATTTAATATTCACATTCAAGATCCAAAAGTAAATTTAAATCAT
TTTGATTTTATTGTTGCTCCAGAACATGACGATTTAGATGGTCAAAACGTAATTACAACAAAAGGTGCTATTCATTATCTTACACAAAGTGAAATTGAGG
AGAATAGAAATTATTTAAATTCGTTTATTAAAAATGATGGAAGAAAAATTTGGACTTTAATTATGGGTGGACCAACTAAGTATTACGATTATTCAACTAA
GAATATGAAACATATTTTTAATATTCTATATAAATTGATAAAAAAACACGACTTTCAATTAGTAGTAATTCCTTCAATGAGAACTCCAATCAATACTATT
CATTATGCTAAAGAATTTTTTGGCGAAAATCATACTATTTTTATGAAGGTTGAAAAAAAAGCATATTTATCAGCCCTTGGAATTGCAGAAAATATAGTAG
TAACTTGCGATTCAAGTTCTATGATTTCAGAAGCAGCTTTAACAGGTAAACCAATTTACGTAGCAAATATTTTACCAAGAAAAAATGATATTAGATTTCA
AAGATTTAGAAATTTATTTAGAGAACTAAAAATTATAAGAAATCTAGGTGAAGAAGTGGAAAATTGGAACTATGAAAAGCTAGATGAAACTAATAGAGTA
GCAGGAATTATAAAAAACAAAATTTTTTCATAATGTCATTTTTAAATTCTATATTAAATAACTCTAAAAAA

Translation

[3 - 830/871]   direct strand
>GOS_679010 Translation [3-830   direct strand]
KSFWKAIPPKLTPISQNIYKKIISDEFDVIISCGRKSVIPSIHLKKTSNKKLFNIHIQDPKVNLNHFDFIVAPEHDDLDGQNVITTKGAIHYLTQSEIEE
NRNYLNSFIKNDGRKIWTLIMGGPTKYYDYSTKNMKHIFNILYKLIKKHDFQLVVIPSMRTPINTIHYAKEFFGENHTIFMKVEKKAYLSALGIAENIVV
TCDSSSMISEAALTGKPIYVANILPRKNDIRFQRFRNLFRELKIIRNLGEEVENWNYEKLDETNRVAGIIKNKIFS

[ Warning ] 5' incomplete: does not start with a Methionine

Phylogeny

PROTOCOLE: INFOBIOGEN 

1)constrction d'un arbre par neighbor joining: données au format phylip, protdist, séquences protéiques,
traitement neighbor, randomization de l'ordre des séquences, arbre sans racine puis avec racine

2)constrction d'un arbre par parcimonie: données au format phylip, protdist, séquences protéiques,
traitement neighbor, randomization de l'ordre des séquences, arbre  avec racine directement.

---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

1)

a)Arbre effectué par l'alignement mutiple de 10 alpha protéobactéries 
10 gamma protéobactéries. Arbre sans racine. On remarque que notre séquence est isolée on ne peut 
donc pas conclure sur le groupe auquel appartient notre séquence.

b)Arbre avec racine en prenant comme groupe extérieur les gamma protéobactéries et comme groupe 
d'étude les alpha protéobactéries. Ceci nous permet de mieux situer notre séquence. On enracine notre arbre en prenant
au hasard une gamma protéobactérie. On remarque que notre séquence fait parti du groupe des alpha proteobactéries
Cependant on note la présence d'une gamma protéo (Acidovorax) parmis les alpha protéo cela pourrait poser
probléme donc on l'élimine de notre arbre.

c)Arbre avec racine en prenant toujours les mémes groupes extérieurs et d'étude.
Arbre final sans Acidovorax.

2) On choisit comme groupe d'étude les alpha protéo et comme groupe extérieur les gamma protéo.
Avec la méthode de parcimonie, notre séquence protéique se trouve également parmi les alpha protéo.
Les 2 méthodes ne se contredisent pas.

---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:

1)
a)
--19 Populations

Neighbor-Joining/UPGMA method version 3.6a2.1


 Neighbor-joining method

 Negative branch lengths allowed


  +--Translatio
  ! 
  !                                              +Smedicae     [alpha protéo]
  !                       +----------------------2 
  !                       !                      +Smeliloti     [alpha protéo]
  !                       !  
  !                       !                  +--------Xfastidiosa  [gamma protéo]
  !                       !                +-6 
  !                    +-13                ! !  +----Xoryzae       [gamma protéo]
  !                    !  !  +-------------7 +--5 
  !                    !  !  !             !    +--Xcampestri      [gamma protéo]
  !                    !  !  !             ! 
  !                    !  !  !             +-------Smaltophil      [gamma protéo]
  !                    !  +-14  
  !                    !     !  +-----------------Mnodulans        [alpha protéo]
  !                    !     !  !  
  !                    !     +-15             +----------------Acidovorax      [gamma protéo]
  !                    !        !  +----------9 
  !                    !        !  !          +------------------Avinelandi     [gamma protéo]
  !                    !        +-16  
  3-------------------12           !  +-------------Rrubrum            [alpha protéo]     
  !                    !           +-17  
  !                    !              !    +-------------Goxydans        [alpha protéo]
  !                    !              +---10  
  !                    !                   +----------Acryptum          [alpha protéo]
  !                    !  
  !                    !                            +----Acinetobac      [gamma protéo]
  !                    !                 +----------1 
  !                    !         +-------4          +------Abaumannii     [gamma protéo]
  !                    !         !       ! 
  !                    !  +------8       +----------------Noceani        [gamma protéo]
  !                    !  !      ! 
  !                    +-11      +--------------------Maquaeolei         [gamma protéo]
  !                       !  
  !                       +------------------------Rafricae              [alpha protéo]
  ! 
  +---CPelagibac       [alpha protéo]
-------------------------------------------------------------------------------------------------
b)

Arbre(s) issus de neighbor :


  19 Populations

Neighbor-Joining/UPGMA method version 3.6a2.1


 Neighbor-joining method

 Negative branch lengths allowed


                  +-----------------Mnodulans        [alpha protéo]
                  !  
               +-15             +----------------Acidovorax     [gamma protéo]
               !  !  +----------9 
               !  !  !          +------------------Avinelandi    [gamma protéo]
               !  +-16  
               !     !  +-------------Rrubrum      [alpha protéo]
               !     +-17  
               !        !    +-------------Goxydans      [alpha protéo]
               !        +---10   
               !             +----------Acryptum          [alpha protéo]
               !  
               !                                  +-----Acinetobac     [gamma protéo]
  +-----------14                       +----------1 
  !            !               +-------4          +------Abaumannii     [gamma protéo]
  !            !               !       ! 
  !            !        +------8       +----------------Noceani        [gamma protéo]
  !            !        !      ! 
  !            !     +-11      +--------------------Maquaeolei        [gamma protéo]
  !            !     !  !  
  !            !  +-12  +------------------------Rafricae          [alpha protéo]
  !            !  !  !  
  !            !  !  !                    +---CPelagibac          [alpha protéo]
  !            +-13  +--------------------3 
  !               !                       +--Translatio  
  !               !  
  !               !                      +Smedicae               [alpha protéo]
  !               +----------------------2 
  !                                      +Smeliloti            [alpha protéo]
  ! 
  ! +--------Xfastidios      [gamma protéo]
  7-6 
  ! !  +----Xoryzae         [gamma protéo]
  ! +--5 
  !    +--Xcampestri        [gamma protéo]
  ! 
  +-------Smaltophil        [gamma protéo]


remember: (although rooted by outgroup) this is an unrooted tree!

Between        And            Length
-------        ---            ------
   7            14            0.89029
  14            15            0.18647
  15          Mnodulans       1.18909
  15            16            0.05265
  16             9            0.74241
   9          Acidovorax      1.12526
   9          Avinelandi      1.27194
  16            17            0.04802
  17          Rrubrum         0.94634
  17            10            0.35831
  10          Goxydans        0.91154
  10          Acryptum        0.74036
  14            13            0.08985
  13            12            0.09946
  12            11            0.21848
  11             8            0.42817
   8             4            0.50258
   4             1            0.74383
   1          Acinetobac      0.35308
   1          Abaumannii      0.46792
   4          Noceani         1.12407
   8          Maquaeolei      1.39777
  11          Rafricae        1.68055
  12             3            1.39991
   3          CPelagibac      0.28680
   3          Translatio      0.17740
  13             2            1.50870
   2          Smedicae        0.06080
   2          Smeliloti       0.05970
   7             6            0.15749
   6          Xfastidios      0.56018
   6             5            0.19787
   5          Xoryzae         0.31618
   5          Xcampestri      0.18932
   7          Smaltophil      0.51786


-----------------------------------------------------------------------------------------------------------------
c)

Arbre(s) issus de neighbor :


  20 Populations

Neighbor-Joining/UPGMA method version 3.6a2.1


 Neighbor-joining method

 Negative branch lengths allowed


                        +--------Rcentenum     [alpha protéo]
                     +-12  
                     !  +---------Rrubrum       [alpha protéo]
                  +-15  
                  !  !   +--------------Goxydans     [alpha protéo]
                  !  +--10  
                  !      +----------Acryptum        [alpha protéo]
                  !  
                  !                        +---CPelagibac      [alpha protéo]
               +-16      +-----------------5 
               !  !      !                 +--Translatio
               !  !  +--11  
               !  !  !   !                        +----Rtyphi      [alpha protéo]  
               !  !  !   +------------------------3 
               !  !  !                            !   +africae      [alpha protéo]
               !  !  !                            +---2 
               !  +-14                                ! +Rsibirica     [alpha protéo]
               !     !                                +-1 
            +-17     !                                  +Rmassiliae     [alpha protéo]
            !  !     !  
            !  !     !                     +Smedicae       [alpha protéo] 
            !  !     +---------------------4 
            !  !                           +Smeliloti      [alpha protéo]
            !  !  
  +--------18  !      +---------Mmaris    [alpha protéo]
  !         !  !  +---9 
  !         !  +-13   +--------Oalexandri     [alpha protéo]
  !         !     !  
  !         !     +------------Pzucineum     [alpha protéo]
  !         !  
  !         +--------------Mnodulans      [alpha protéo]
  ! 
  !     +--Xcampestri    [gamma protéo]
  ! +---6 
  8-7   +---Xoryzae      [gamma protéo]
  ! ! 
  ! +------Xfastidios    [gamma protéo]
  ! 
  +-------Smaltophil     [gamma protéo]


remember: (although rooted by outgroup) this is an unrooted tree!

Between        And            Length
-------        ---            ------
   8            18            0.67777
  18            17            0.09020
  17            16            0.09491
  16            15            0.09208
  15            12            0.12455
  12          Rcentenum       0.60512
  12          Rrubrum         0.66898
  15            10            0.28465
  10          Goxydans        0.95705
  10          Acryptum        0.71555
  16            14            0.12790
  14            11            0.25663
  11             5            1.17265
   5          CPelagibac      0.26497
   5          Translatio      0.19923
  11             3            1.67939
   3          Rtyphi          0.36024
   3             2            0.24626
   2          africae        -0.00362
   2             1            0.00867
   1          Rsibirica      -0.00318
   1          Rmassiliae      0.04418
  14             4            1.47792
   4          Smedicae        0.08035
   4          Smeliloti       0.04015
  17            13            0.15596
  13             9            0.27588
   9          Mmaris          0.64301
   9          Oalexandri      0.62459
  13          Pzucineum       0.83032
  18          Mnodulans       0.98689
   8             7            0.12515
   7             6            0.25896
   6          Xcampestri      0.21924
   6          Xoryzae         0.28626
   7          Xfastidios      0.49909
   8          Smaltophil      0.55020


---------------------------------------------------------------------------------------------------------------
2)

Arbre(s) issus de protpars :


Protein parsimony algorithm, version 3.6a2.1



One most parsimonious tree found:




  +--------------------------------------------------------Smaltophil      [gamma protéo]
  !  
  !                                                  +-----Xfastidios        [gamma protéo]
  !  +-----------------------------------------------6  
  7  !                                               !  +--Xoryzae         [gamma protéo]
  !  !                                               +--5  
  !  !                                                  +--Xcampestri       [gamma protéo]
  !  !  
  !  !                                                  +--Goxydans        [alpha protéo]
  +--4        +----------------------------------------18  
     !        !                                         +--Acryptum          [alpha protéo]
     !        !  
     !        !                             +--------------Mnodulans         [alpha protéo]
     !        !                             !  
     !        !                             !        +-----Pzucineum          [alpha protéo]
     +-------17     +----------------------19  +----16  
              !     !                       !  !     !  +--Rrubrum           [alpha protéo]
              !     !                       !  !     +--9  
              !     !                       +--8        +--Rcentenum         [alpha protéo]
              !     !                          !  
              !     !                          !        +--Mmaris            [alpha protéo]
              !     !                          +--------3   
              +-----2                                   +--Oalexandri         [alpha protéo]
                    !  
                    !                                   +--Smeliloti         [alpha protéo]
                    !                 +----------------11  
                    !                 !                 +--Smedicae          [alpha protéo]
                    !                 !  
                    !                 !           +--------Rtyphi             [alpha protéo]
                    +----------------10     +----15  
                                      !     !     !  +-----Rmassiliae         [alpha protéo]
                                      !     !     +-14  
                                      !     !        !  +--Rsibirica           [alpha protéo]
                                      +----12        +-13  
                                            !           +--africae             [alpha protéo]
                                            !  
                                            !           +--CPelagibac          [alpha protéo]
                                            +-----------1  
                                                        +--Translatio           [alpha protéo]
 
  remember: (although rooted by outgroup) this is an unrooted tree!


requires a total of   3691.000


Annotator commentaries

Notre séquence a été prélevée dans le sud de l'océan pacifique tropical. La recherche d'ORF nous a permis d'identifier un ORF a priori codant, ce dernier semble correct car il comporte plus de 60 codons (notre séquence comporte 830 nucléotides).Il se trouve dans le sens direct dans le cadre de lecture 3 allant du nucléotide 3 au 833. Cependant il parrait incomplet en 5', nous ne pouvons donc pas déterminer le poids moléculaire de la protéine potentiellement correspondant à notre ORF.

La recherche de domaine conservé avec Interpro Scan combinée à l'analyse du blastP contre swissprot ou contre NR ne nous permet pas de définir la fonction de notre séquence protéique. En effet avec Interpro Scan, un seul domaine protéique a été trouvé, nommé DUF, dont la fonction est inconnue. De plus, les homologues obtenus avec le blastP sont également des séquences protéiques dont la fonction est inconnue (ou non caractérisée).

Avec l'alignement multiple, on remarque également de multiples régions conservées (notamment la plus grande région s'étend de l'acide aminé 590 à 710). Ces régions conservées appartiennent cependant à des séquences dont le produit a une fonction encore inconnue. Ce qui réconforte notre résultat avec la recherche de domaines protéiques qui nous donne elle aussi un domaine dont la fonction protéique est inconnue à ce jour.

Le blastP contre swissprot n'a mis en évidence qu'une seule séquence protéique homologue (non caractérisée) avec un correct E-value (7e-10). Les autres séquences peuvent être considérées comme des faux positifs (E-value supèrieur à 3.1). Alors que le blastP contre NR révèle beaucoup plus de séquences homologues avec des scores trés satisfaisants (de 1e-124 à 8e-10). C'est pour cette raison que nous avons choisis ces séquences pour la suite des analyses.

D'aprés le lineage repport avec NR on remarque la présence des alpha et gamma protéobactéries. Notre but était donc de situer notre séquence parmis nos différents groupes.

Notre alignement multiple comprend 10 alpha et 10 gamma protéobactéries. On construit un arbre sans racine qui nous permettra d'identifier notre groupe extérieur et notre groupe d'étude.On remarque que notre séquence est isolée on ne peut rien en déduire. On décide alors d'enraciner notre arbre en prenant au hasard une gamma protéobactérie. D'aprés le second arbre notre séquence semble regroupée avec les alpha protéobactéries. Or on note la présence d'une gamma protéo parmis les alpha protéo ce qui pourait fausser notre arbre.On pourrait expliquer l'emplacement de cette gamma protéo (acidovorax) parmi des alpha protéo par le phénomène de transfert horizontal de gène. Pour cela on construit un 3éme arbre en éliminant notre gamma protéo ( Acidovarax). Notre arbre final semble concluant.

Nous pouvons ainsi conclure que vu les homologies obtenues entre notre échantillon et les séquences alpha et gamma protéobactéries que nous sommes en présence d'une séquence appartenant aux groupes des alpha protéobactéries dont la fonction reste inconnue.


Multiple Alignement

PROTOCOLE:
infobiogen clustalw sequences protéiques format de sortie: phylip
---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

L'alignement met bien en évidence la similarité entre les séquences qui sont sencées être 
homologues d'après les résultats du blast.En effet on remarque la précence de régions
trés similaires entre elles. Notamment il existe des régions bien conservées ( de l'acide aminé 381 à 420, 
mais aussi de l'acide aminé 466 à 565, et enfin de l'acide aminé 590 à 710).
Nous avons cependant effectué 3 alignements multiples qui permettent chacun la construction d'un arbre 
phylogénétique. Ces différents alignements nous ont permis de découvrir progressivement le groupe 
extérieur et le groupe d'étude.

---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:
1) alignement en prenant 10 espéces alpha protéobactéries et 10 espéces gamma protéobactéries
CLUSTAL W (1.82) multiple sequence alignment


Translation        ------------------------------------------------------------
CPelagibacter      ------------------------------------------------------------
Xcampestris        ------------------------------------------------------------
Xoryzae            ------------------------------------------------------------
Xfastidiosa        ------------------------------------------------------------
Smaltophilia       ------------------------------------------------------------
Smedicae           ------------------------------------------------------------
Smeliloti          ------------------------------------------------------------
Acinetobacter      ------------------------------------------------------------
Abaumannii         ------------------------------------------------------------
Noceani            ------------------------------------------------------------
Mnodulans          ------------------------------------------------------------
Rrubrum            ------------------------------------------------------------
Acryptum           ------------------------------------------------------------
Goxydans           ------------------------------------------------------------
Maquaeolei         ------------------------------------------------------------
Acidovorax         ------------------------------------------------------------
Avinelandii        MTFFALKIDKAVRKLLGFHHRSPDSRPQSAASGAAAEGEPPAVPRIVPVVLEARPGAPEA
Rafricae           ------------------------------------------------------------
                                                                               

Translation        ------------------------------------------------------------
CPelagibacter      ------------------------------------------------------------
Xcampestris        ------------------------------------------------------------
Xoryzae            ------------------------------------------------------------
Xfastidiosa        ------------------------------------------------------------
Smaltophilia       ------------------------------------------------------------
Smedicae           ------------------------------------------------------------
Smeliloti          ------------------------------------------------------------
Acinetobacter      ------------------------------------------------------------
Abaumannii         ------------------------------------------------------------
Noceani            ------------------------------------------------------------
Mnodulans          ------------------------------------------------------------
Rrubrum            ------------------------------------------------------------
Acryptum           ------------------------------------------------------------
Goxydans           ------------------------------------------------------------
Maquaeolei         ------------------------------------------------------------
Acidovorax         ------------------------------------------------------------
Avinelandii        PAVRIFLGTEPAQHRAERIFFYSLERVRDPLRRYEVYRMTGLPGFDRKGWRTNFTNFRFA
Rafricae           ------------------------------------------------------------
                                                                               

Translation        ------------------------------------------------------------
CPelagibacter      ------------------------------------------------------------
Xcampestris        ------------------------------------------------------------
Xoryzae            ------------------------------------------------------------
Xfastidiosa        ------------------------------------------------------------
Smaltophilia       ------------------------------------------------------------
Smedicae           ------------------------------------------------------------
Smeliloti          ------------------------------------------------------------
Acinetobacter      ------------------------------------------------------------
Abaumannii         ------------------------------------------------------------
Noceani            ------------------------------------------------------------
Mnodulans          ------------------------------------------------------------
Rrubrum            ------------------------------------------------------------
Acryptum           ------------------------------------------------------------
Goxydans           ------------------------------------------------------------
Maquaeolei         ------------------------------------------------------------
Acidovorax         ------------------------------------------------------------
Avinelandii        IPDLAGRQGRAIYTDVDQIFTADPAELFDQPMGEHGYLALLPEDTAVMLIDCERMIRCWT
Rafricae           ------------------------------------------------------------
                                                                               

Translation        ------------------------------------------------------------
CPelagibacter      ------------------------------------------------------------
Xcampestris        ------------------------------------------------------------
Xoryzae            ------------------------------------------------------------
Xfastidiosa        ------------------------------------------------------------
Smaltophilia       ------------------------------------------------------------
Smedicae           ------------------------------------------------------------
Smeliloti          ------------------------------------------------------------
Acinetobacter      ------------------------------------------------------------
Abaumannii         ------------------------------------------------------------
Noceani            ------------------------------------------------------------
Mnodulans          ------------------------------------------------------------
Rrubrum            ------------------------------------------------------------
Acryptum           ------------------------------------------------------------
Goxydans           ------------------------------------------------------------
Maquaeolei         ------------------------------------------------------------
Acidovorax         ------------------------------------------------------------
Avinelandii        YAKACREPKKALCAEAAAEPGRWGALDPLWHARDFEFRPGETKLLHYTALHLQPWRPTPE
Rafricae           ------------------------------------------------------------
                                                                               

Translation        ------------------------------------------------------------
CPelagibacter      ------------------------------------------------------------
Xcampestris        ------------------------------------------------------------
Xoryzae            ------------------------------------------------------------
Xfastidiosa        ------------------------------------------------------------
Smaltophilia       ------------------------------------------------------------
Smedicae           ------------------------------------------------------------
Smeliloti          ------------------------------------------------------------
Acinetobacter      ------------------------------------------------------------
Abaumannii         ------------------------------------------------------------
Noceani            ------------------------------------------------------------
Mnodulans          ------------------------------------------------------------
Rrubrum            ------------------------------------------------------------
Acryptum           ------------------------------------------------------------
Goxydans           ------------------------------------------------------------
Maquaeolei         ------------------------------------------------------------
Acidovorax         ------------------------------------------------------------
Avinelandii        QYSYQIHPLAEHFLSLEQAADREGYEIYAATSPSPGFAAGCEQAARLPAEPAADLLRQAR
Rafricae           ------------------------------------------------------------
                                                                               

Translation        ------------------------------------------------------------
CPelagibacter      ------------------------------------------------------------
Xcampestris        ------------------------------------------------------------
Xoryzae            ------------------------------------------MTRLPPHAFNLKQIYVGS
Xfastidiosa        ------------------------------------------------------------
Smaltophilia       ----------------------------------------------------------MV
Smedicae           -------------------------------------------------MQDNDDTTVKT
Smeliloti          ------------------------------------------------------------
Acinetobacter      --------------------------------------------------------MMFL
Abaumannii         ------------------------------------------------------------
Noceani            --------------------------------------------------------MQSS
Mnodulans          --------------------------------------MQRRPGLTLGPGRPDAGAVTAL
Rrubrum            -------------------------------------------------------MSDQP
Acryptum           ---------------------------------MSGWHENAAMQAAPTLMAATQAIADGQ
Goxydans           ------------------------------------------------------------
Maquaeolei         --------------------------------------------------------MSNH
Acidovorax         ------------------------------------------------------MATPPD
Avinelandii        ALGAGQAALVGAWSAADEPSLPRWSLEQLGRDDLPVQDAVIANGLERLPVEDLPWLLDRL
Rafricae           ------------------------------------------------------------
                                                                               

Translation        ---------------------------------------KSFWKAIPPKLTPISQN----
CPelagibacter      MTKLKGILLTQGMHGMISQVEGLAKALDID-FTHHTVELNNFWKMVPPKITPISQS----
Xcampestris        --MAVTWAVSDGRAGNARQAEALARALHPDTVHALHLQARAPWRWAAPRRLPGANSA---
Xoryzae            ETMGLTWALSDGRAGNARQAEALARALQSEGFQAIHLQPKAPWRWAAPRRLPGAQQA---
Xfastidiosa        ------MAISDGRTGNTRQAEALASTLVGSLYTTQVLKPRIPWRWTAPYCLPGAKHA---
Smaltophilia       KRSSAPWTVTDGRAGNVRQAVALASALRQGTHRPLVLQPRAPWRWLSPRRLPGDVNG---
Smedicae           SNTSCVWAVAESKAGTLTQCLGVGKQFHREPVVKLISRTRGLRKLFEPRLFR--------
Smeliloti          --------MAESKAGTLTQCLGVGKQFHREPVVKLISRTRGLRKLFEPRLFR--------
Acinetobacter      GKNMHVVYVSDGKAGHRSQALGLYQAMHKLVIHSRFEEIPLQQLPLLTILKGLFTH----
Abaumannii         --------------------------MQRQQANATFEEVSINDLPIFSLIKALFSS----
Noceani            AEPFITWYLTDGKPGHENQSSGLLNALARYVPLQAHGIPVSSGPGTIGWWALKIFP----
Mnodulans          PSGTTAWILTDGKAGDLAPCRGLAHALGLTAQERQVALRPPFSWWAPRGPADPRDR----
Rrubrum            ALAPLTWAVTTGEAGMTNQAIGLAEAIGLPVVAKVIHVPKPWRWLPTHWAAPLGIKT---
Acryptum           AAPVTARVLCTDLAGLRSQALGLAEAAGFRTDFRVIAPKRPWTLFSPMLWPDPRCAI---
Goxydans           ---MKAIIIAEDFAGMRAQGAGLAEKAGLEWDFRPVRIHPFWSRFPARYWPSPLRRV---
Maquaeolei         SQAPVVWLLTDNKPGHKNQLKGLGNRLRVLTGAALYWISAEEYPVPLWRALLGVAP----
Acidovorax         PGAVSVWVLLGARHGDNQQLLAIADALGVPYRTVRLRFNAAAGLPPVLLGPSRLSWR---
Avinelandii        FRLGCQWVFVKAELGAEGSMIGSLDGWRTLVRRVALRYPDRCWQLDCRDRRGRTQRFRAD
Rafricae           ---MKIHVLEDDRTGNTHQAIALAEKLTEEYTTIKLEYNCLAKLPNFLLKYYPIHIKS--
                                                                               

Translation        ----------------------------------------------IYKKIISDEFDVII
CPelagibacter      ----------------------------------------------VYKKIDHENFDVII
Xcampestris        ------------------------------------------FG-PAFAAQLQQPPGLVI
Xoryzae            ------------------------------------------FG-APFDRQLQQPPALAI
Xfastidiosa        ------------------------------------------FG-TTFSHALRYPPFLAI
Smaltophilia       ------------------------------------------YG-EAFASLAAEAPALAI
Smedicae           --------------------------------------------------KKEQRPELVI
Smeliloti          --------------------------------------------------KREQRPELVI
Acinetobacter      -----------------------------------------------QVSQIKQPPDFIL
Abaumannii         -----------------------------------------------KKSLFQQAPDFIF
Noceani            ------------------------------------------------PAKDLPNPHLII
Mnodulans          -------------------------------------------------VLTPPWPDLAL
Rrubrum            ------------------------------------------LCGPGSDAFTPPWPEVLV
Acryptum           ------------------------------------------DA----AALAPPEGDLML
Goxydans           ------------------------------------------DP-----IRIPEDTGLII
Maquaeolei         -----------------------------------------------AMDTALPKPALIV
Acidovorax         ------------------------------------------SK--DPATLQPPWPRVVL
Avinelandii        FAQRTGGGRELPRVWVLQGARAGDNAQLTDIAEALGWPYEIKRADASGFALSPPWPDLVL
Rafricae           --------------------------------------------DLLQYLLDKSPPDMII
                                                                            . .

Translation        SCGRKSVIPSIHLKKTSNKKLFNIHIQDPKVNLNHFDFIVAPEHDDLDGQ----NVITTK
CPelagibacter      SCGRKSVIPSIHLKNNSNKKVFNIHIQDPKVDLKHFDFIVAPEHDSIKGQ----NVISTK
Xcampestris        GCGRQAALATRLLRAR---GSVAVQILDPRLDRRQWDLVVVPEHDALRGE----NVLTLL
Xoryzae            GCGRQAALATRLLRGR---GSRSVQILDPRLDPRHWDLLVVPEHDALRGG----NVLTLL
Xfastidiosa        GCGRQAALATRLLHKQ---GACVVQILDPRLPARHWDLLVVPEHDHIRGH----NVLTLL
Smaltophilia       GCGRQAAGALRVLRAR---GSQVVQILDPRISARHWDVVVVPEHDALRGS----NVLTLL
Smedicae           SCGFRAEPAVLDIKAAY--GGKPVTVHLQRPRIEGYDLVFVSRHDWVDELNRLPNYHSMV
Smeliloti          SCGFRAEPAVLDIKAAY--GGKPLTVHLQRPRIEGYDLVFVSRHDWVEELDQRPNYHSMV
Acinetobacter      GVGSHTHFRVWLLGKIYP-QAKTIILMKPSLPIHWFNYAVIPEHDGVAAS----------
Abaumannii         GVGSHTHFRVWLLGKIFK-KAKTIILMKPNLPTVWFNYAVIPEHDGIPAN----------
Noceani            GAGHGTHIPLLAARRAR--GGRTVVLMRPSLPFSWYDLCLIPEHDGIEAE----------
Mnodulans          ATGRRAVPALRALRRLSGGRTFTVFLRDPRIGAEVADLVWVPEHDRLRGP----TVLTTL
Rrubrum            TSGRRSGALSIALRRASGGRTLTVHIQNPLVPFENFDLVIAPEHDGVAAAN----VVQSL
Acryptum           GAGGAAARVLATLRRPD---LPAVIIQHPRMDTGRFDAVVVAKHDGLTGP----NVIVTR
Goxydans           CIGGTGGVIGRAVARRE--GLPVVQIQNPRMPVSKFDLVIANTHDGISGP----NVLISR
Maquaeolei         AAGTGTHRLLLALRRLG--KAKTLILMKPAFPLGWVDGAIIPAHDEVKPAN---------
Acidovorax         AAGRKSVPAARWIRQRSGGRTQLVHINRPWAPLSWFDLIVTTPQYAVPER---ANVLSHR
Avinelandii        SAGRHTAVVARQIQRQSQGHARLVVLGRPRASLDRFDRVVTTPQYGLPLRG----NVVDL
Rafricae           TAGRRTAVLAFYLKKKFK-DIKLIQIMQPNLPYNAFDAVILPYHDQRHCEATKWLKQSQG
                     *                    : :          :      :                

Translation        GAIHYLTQSEIEENRNYLNSFIKND-----------------------GRKIWTLIMGGP
CPelagibacter      GAIHYLTENEINENKDYLNSFIKKD-----------------------ERIIWTLIMGGP
Xcampestris        GSLHPVDDAWLAAGRAAFPAVGALP-----------------------GPRVALLIGG-P
Xoryzae            GSLHPVDDAWLAAGRAAFPAVAGLP-----------------------GPRLALLIGG-P
Xfastidiosa        GSLHPVNDVWLATGRAQFPELGDLP-----------------------GQRVALLVGA-P
Smaltophilia       GSLNPVDDDWLAWGRAAFAGFSTLP-----------------------GPRTALLVGG-P
Smedicae           GVPHQITWARLAPLRDAARRRFSPD-----------------------GRPIVAVFVG-G
Smeliloti          GVPHQITSARLAPLRDAARRRLSPE-----------------------GRPIVAVFVG-G
Acinetobacter      --------DRVIVTQGALNPIVNEH-----------------------RHDTNRILIALG
Abaumannii         --------NRVIVTRGALNPIRNEK-----------------------RHQASRILIALG
Noceani            --------ANVVLTRGVLNKIASEG-----------------------IHEPSRGLILLG
Mnodulans          AGPHPVSPERLAAARAAPDPRLAAL-----------------------PAPRAAVLVGGD
Rrubrum            GALHKITPAKLAEAAERFRARFAAL-----------------------PRPLVAVLVGGT
Acryptum           TALHRVTPERLALERALWAPHFAGL-----------------------PRPLVAVLVGGS
Goxydans           NALHPVTPQKLAAARTEWEERLKQD-----------------------ARPLLSILVGGA
Maquaeolei         ------NILHTEGVINTITPLARLT-----------------------SKPEALILVGGR
Acidovorax         MPFMPPSDLVEVPLPMALQLQAARM-----------------------PRPWTLVMVGGD
Avinelandii        PAPFIGEHPLDEATLDAWRQRFAHL-----------------------PRPWIALLVGGD
Rafricae           FFTRLLRQYFVFPRNDDFKNIIPINGAINNVTEQFAAANLELQKHYPNLKQFIAVIIGGN
                                                                          .    

Translation        TKYYDYSTKNMKHIFNIL-YKLIKKHDFQLVVIPSMRTPINTIHYAKEFFGENHTIFMK-
CPelagibacter      TKYYDYSTKNIKEIFTTL-SKLSKKHNFQLVIIPSMRTPTSIIQYANDYFGGDHTVIMD-
Xcampestris        TTQVPWTLQALAAQCNAV-QAQVRAAGGSLLITASRRTPPEVVALLRTLQQGNPGLLWCD
Xoryzae            TDQVPWTSQALAALCTRV-SAHLRTLGGSLLVTTSRRTPGDAIAALRAACAGLPHLLWCD
Xfastidiosa        TPQAPWQPAQLEELCTAL-VKGLSCGG-SVLATTSRRTPPELATQLRKHLATIPGLFWNN
Smaltophilia       TPLAPWDETAMVGVFQAL-AGQIRSEGGSLLATTSRRTPPALAEILRATFADLPHVIWGD
Smedicae           SNGAYVYDDRTHQNIKGA-IEQLEKEGWRIVVSVSRRSE-DHTQQALSTLNSESIAVWD-
Smeliloti          SNGAYVYDDKTHQNIKCA-VEQLEKAGWRIVVSASRRSE-DHTQQTLSTLNSESIAVWD-
Acinetobacter      GDSKRHQWNQEKVLTSIQ-NIVRDYPDTHIILTTSRRTPVNFISHLKTLPCAQQLQLFPV
Abaumannii         GSSKRHQWNQEKVLLSVQ-KIVENNPDAEIILTTSRRTPAEFIDILRQQSFAQHLQIFPV
Noceani            GPSRHYNWDPQSILWQVQSLLKQEKKTYQWVLSTSRRTPPSMLTALRN-LQFPNLQVFAG
Mnodulans          SRHGRVRPEAAERFLSAL---DRLGAEASLMITASRRTPSSLREGLRALSLRRGAFLWD-
Rrubrum            SGAYRLEAEDTRRLARQL-ADLVAARGVGLVVTPSRRTGAANAAILRETLEPLGALVWDG
Acryptum           NGRYRLDTAAARTLAEQL-AGMMDRDRVGLMLTPSRRTEPAARAILDEALRPRGAWIWD-
Goxydans           NGRFSLGPGEAERMADGI-ITFTKHNAMQAVLTPSRRTDPAAVAVFRKRLEPHGIAVLTG
Maquaeolei         SEHFDWDEDAILNQISDL---IARYPQWRWTITDSRRTPETTSERLAELQSPKISVVHHT
Acidovorax         SRPFVLDDEAAVGLAHLVNAQVRAQGGSAWVLGSPRTPATAMDVLARTLDVPAHVVRWG-
Avinelandii        TIPYRLDERTATTLGREAGAAARTRGGSLLVSTSPRTSADATDALLAAIDAPLWSYRFGS
Rafricae           NKKFNFHEDEAVLFASLL-NKIYTNQKIPFFISFSRRTPHTVKSIIKNNMPSSTIIYYPN
                                                     .  .                      

Translation        --VEKKAYLSALGIAENIVVTCDSSSMISEAALTGKPIYVANILPRKN------------
CPelagibacter      --VDKKAYLSALAIAQNIIVTCDSSSMISETALTGKPIYIASILPKKN------------
Xcampestris        ARDGANPYAGLLGWADAIVASADSVNLLSEACATPVPVVAACAEFARG------------
Xoryzae            ERDGPNPYAGLLGWADAIVASADSVNLLSEACATRVPVAAAFAEQARG------------
Xfastidiosa        TDKGANPYPGILGWADAIIATADSVNLLSEACATRAPVTAAFANQTRG------------
Smaltophilia       GGDGTNPYGGLLGWANRVVVSPDSVNLLSEACATRMPVMVALAETAQG------------
Smedicae           -RRSENPYLDYMAAADAFVIAKDSITMPCEALATGKPVFTLELTHVAGPRL---------
Smeliloti          -RRSENPYLDYMAAADAFVIAKDSITMPCEALATGKPVFTLELTHVAGPRL---------
Acinetobacter      EETPQGWIFEQMQLAATVWVTEDSVSMIFEALTAGCRVGVIAMDRLKS------------
Abaumannii         EQTPQGWIFEEMQKAEAVWVTEDSVSMVFEALTAGCRVGVIAIDRLKD------------
Noceani            ETTPPGWVTEQLSLAGRVWVSEDSVSMVYEALTCGAAVGVLNVPCKAWGRV---------
Mnodulans          -GSGENPYLALLALADAVVATADSANMVGEAVATGAPVLLFELTDTYLRHR---------
Rrubrum            --VGDNPYFAMLALADVLLVTEESVSMVSEACFSGKPVYTIALQGGSR------------
Acryptum           -MQGENPYFGMLAVADAIVVTGDSVSMVSEAVATDAPVMIARLPGKST------------
Goxydans           -SGDDNPYMGMLASADMIAVTTDSVSMISEAVATSAPVLVFPLPGRSS------------
Maquaeolei         -RTHDDWLSHQLAASRAVWVTPDSISMVCEAATSGVPTGLLNLNARANSRV---------
Acidovorax         --EGENPYAALRQRADRIVVTTDSASMLTEALLTGKPVVPFALPRQPDWRWRLATAWRAA
Avinelandii        --PDDNPYRALLALADAFVVTGESVSMLTEACMTGRPVAVFPLPLQRHRKAR--------
Rafricae           EDAGYNPYIAMLSKAKYIISTADSISMCSEAASSGKPLYIFCPPNFNSSKH---------
                                 :  .  : :* .:  *:                             

Translation        --------D-IRFQRFRNLFRELKIIRNLGEEVENWNYEKLDETNRVAGIIKNKIFS---
CPelagibacter      --------D-KRFQRFRNLFRELNITRNLGEEVENWNYQKLDETNRVAKIIKQKINF---
Xcampestris        ----------RVGAYVQALQQRQRLCAADEVLATTAAMTPVRETERIAAQVRMRLGL---
Xoryzae            ----------RVASYLQALRQRQRLHPVDKVLASAIDIVPVRETERIAMQVRARLLP---
Xfastidiosa        ----------RIRCFIDALG--ARLCTVENLLAIDTLAQPLRETERIANEVRAWFGMV--
Smaltophilia       ----------RLARFQQQLRERGRLQAHWLDWQYDR-IEPLRETARVAAEVKQRLALG--
Smedicae           --------D-KFERYHRDLHETLQLTRPFEGKIEPYSYEPLDETRRIASVIRSKLDLQ--
Smeliloti          --------D-KFERYHRDLHETLQLTRPFEGKIEPYSYEPLDETRRIASVIRSELNRP--
Acinetobacter      ----------DRITQMIDQLPFEQNIGVMRVLQNSAP---LNEASRVASQILDSSSF---
Abaumannii         ----------DRITHSIDQMIESQLISQNTCVVQLPQPYAFKEADRVATYLLAKN-----
Noceani            --------V-RGLDSLAEKGIVTTFTAWRQGQKLAPPRQQFNEADRCAQILVERWFSGP-
Mnodulans          --------P-FFAALRHYGAVHPFNGRLEGSRYEPLDFTPAIAEAVAAAYLRHRDALARL
Rrubrum            ----------RFKRFHALMRDRGYARPFTGTLEPWAPPAPLDETARCAAIVRTLLARRRE
Acryptum           -----------RIGAFMDDMVACGRARNFDGRLQTWATAALNDTPMAAAELRRMLGV---
Goxydans           -----------RISRFVKTLEDAGRVKWFDPAQVLWDVMPLDDTPLVAREMRRRLKL---
Maquaeolei         --------ANGVKRLTERGLIAHWADHASVMAEQAERHERLWEADRAARWVAANYLAAFQ
Acidovorax         AARRPGSMVARSFDVLQDLGLLSSLRDLGLLHRALEAAGAFDGSSRVLDIARQEREATLA
Avinelandii        ----------LQHALERRLGVIERVAGSRGVPRQQNRLGRLYDEVVAAGWVKRERCVEQV
Rafricae           ----------KIFIKQLVEQKIARIFDKSAIALEEYSYKPLNEAERVAEIIKSLIKSW--
                                                                               

Translation        ----------------------------------------------
CPelagibacter      ----------------------------------------------
Xcampestris        ----------------------------------------------
Xoryzae            ----------------------------------------------
Xfastidiosa        ----------------------------------------------
Smaltophilia       ----------------------------------------------
Smedicae           ----------------------------------------------
Smeliloti          ----------------------------------------------
Acinetobacter      ----------------------------------------------
Abaumannii         ----------------------------------------------
Noceani            ----------------------------------------------
Mnodulans          TGP-------------------------------------------
Rrubrum            ALGLTP----------------------------------------
Acryptum           ----------------------------------------------
Goxydans           ----------------------------------------------
Maquaeolei         KSGKEARQ--------------------------------------
Acidovorax         RIRALIDRR-------------------------------------
Avinelandii        HLALGVAPLPEGLDHPPGLSPALLAASRERALQAIREVVQAERPVS
Rafricae           ----------------------------------------------
                                                                 

---------------------------------------------------------------------------------------------------
2) alignement en prenant comme groupe extérieur les gamma protéobactéries et comme groupe d'étude les
alpha protéobactéries

CLUSTAL W (1.82) multiple sequence alignment


Xcampestris        -----------------------------MAVTWAVSDGRAGNARQAEALARALHPDTVH
Xoryzae            ---------MTRLPPHAFNLKQIYVGSETMGLTWALSDGRAGNARQAEALARALQSEGFQ
Xfastidiosa        ---------------------------------MAISDGRTGNTRQAEALASTLVGSLYT
Smaltophilia       -------------------------MVKRSSAPWTVTDGRAGNVRQAVALASALRQGTHR
Oalexandrii        ------------------------MTGMETRSCIVVSDGRRGIENQALGLAEAVGR--LT
Mmaris             ----------------------MSDPASHDTTIWVVSDGRRGIENQALGLAEAVGRGLGT
Rcentenum          ----------------------MTAVPMAAPVCWVMSDGKAGMENQCLGLAEAVGAHPII
Rrubrum            ----------------------MSDQPALAPLTWAVTTGEAGMTNQAIGLAEAIGLPVVA
Smedicae           ----------------MQDNDDTTVKTSNTSCVWAVAESKAGTLTQCLGVGKQFHREPVV
Smeliloti          -----------------------------------MAESKAGTLTQCLGVGKQFHREPVV
Translation        ------------------------------------------------------------
CPelagibacter      ---------------------------MTKLKGILLTQGMHGMISQVEGLAKALDID-FT
africae            ------------------------------MKIHVLEDDRTGNTHQAIALAEKLTEE-YT
Rsibirica          ------------------------------MKIHVLEDDRTGNTHQAIALAEKLTEE-YT
Rmassiliae         -------------MTTSNKLINITFREVFTMKIHILADDRTGNTHQAIALAEKLTEE-YT
Rtyphi             ------------------------------MNIWVITDDRTGNTHQAIALAAQLTGK-YT
Pzucineum          ----------------------MATASPPPLTIWAVSDGRAGIEAQALGLAEAVARRRPA
Acryptum           MSGWHENAAMQAAPTLMAATQAIADGQAAPVTARVLCTDLAGLRSQALGLAEAAGFRTDF
Goxydans           ------------------------------MKAIIIAEDFAGMRAQGAGLAEKAGLEWDF
Mnodulans          -----MQRRPGLTLGPGRPDAGAVTALPSGTTAWILTDGKAGDLAPCRGLAHALGLTAQE
Acidovorax         ---------------------MATPPDPGAVSVWVLLGARHGDNQQLLAIADALGVP--Y
                                                                               

Xcampestris        ALHLQARAPWRWAAPRRLPGANSAFGPAFAAQLQQP-PGLVIGCGRQAALATRLLRARG-
Xoryzae            AIHLQPKAPWRWAAPRRLPGAQQAFGAPFDRQLQQP-PALAIGCGRQAALATRLLRGRG-
Xfastidiosa        TQVLKPRIPWRWTAPYCLPGAKHAFGTTFSHALRYP-PFLAIGCGRQAALATRLLHKQG-
Smaltophilia       PLVLQPRAPWRWLSPRRLPGDVNGYGEAFASLAAEA-PALAIGCGRQAAGALRVLRARG-
Oalexandrii        PLQTLPIHVPRTG--------------ELPDAGMIE-PDLWIGCGRAAVRAASLHRKQWR
Mmaris             PHHIERVTVRKDG--------------FVTLPSHSH-PDFWIGCGRAAIPLARRHRRIFP
Rcentenum          KRIALKTPWRQTTP--YLPISLRLALAPESDPLTPPWPDLLITSGRQAVGLSLLIRRLNG
Rrubrum            KVIHVPKPWRWLPTHWAAPLGIKTLCGPGSDAFTPPWPEVLVTSGRRSGALSIALRRASG
Smedicae           KLISRTRGLRKLFEP-------------RLFRKKEQRPELVISCGFRAEPAVLDIKAAYG
Smeliloti          KLISRTRGLRKLFEP-------------RLFRKREQRPELVISCGFRAEPAVLDIKAAYG
Translation        ------KSFWKAIPPKLTPISQNIYKKIISDEFD-----VIISCGRKSVIPSIHLKKTSN
CPelagibacter      HHTVELNNFWKMVPPKITPISQSVYKKIDHENFD-----VIISCGRKSVIPSIHLKNNSN
africae            TIKLEYNCLAKLPNFLLKYYPIHIKSDLLQYLLDKSPPDMIITAGRRTAVLAFYLKK-KF
Rsibirica          TIKLEYNCLAKLPNFLLKYYPIHIKSELLQYLLDKSPPDMIITAGRRTAVLAFYLKK-KF
Rmassiliae         TIKLEYNCLAKLPNFLLKYYPIHIKSELLQYLLDKSPPDMIITAGRRTAVLAFYLKK-KF
Rtyphi             IITLKYNFLAKLPNFLLQYYPIHIKCELLKDIVDKLPPDMIITAGRRTAVLAFYLKK-KF
Pzucineum          TVVRKHVRWKWGLGR---LPARLIPIAALDGDILPPWPDIWIATGRATLPLSRRMRAWSG
Acryptum           RVIAPKRPWTLFSPMLWP----DPRCAIDAAALAPPEGDLMLGAGGAAARVLATLRRPD-
Goxydans           RPVRIHPFWSRFPARYWP-----SPLRRVDPIRIPEDTGLIICIGGTGGVIGRAVARREG
Mnodulans          RQVALRPPFSWWAPR--------GPADPRDRVLTPPWPDLALATGRRAVPALRALRRLSG
Acidovorax         RTVRLRFNAAAGLPPVLLGPSRLSWRSKDPATLQPPWPRVVLAAGRKSVPAARWIRQRSG
                                                          . :  *               

Xcampestris        --SVAVQILDPRLDRRQWDLVVVPEHDALRGE----------------------------
Xoryzae            --SRSVQILDPRLDPRHWDLLVVPEHDALRGG----------------------------
Xfastidiosa        --ACVVQILDPRLPARHWDLLVVPEHDHIRGH----------------------------
Smaltophilia       --SQVVQILDPRISARHWDVVVVPEHDALRGS----------------------------
Oalexandrii        -RTRFVYVQKPRSHADLFDLIIAPRHDRMSGP----------------------------
Mmaris             -DCHFTYVQDPRTRHDDFDLIVAPTHDRLVKP----------------------------
Rcentenum          GRTFCVHIQNPGVPFSRFDAVILPKHDEKCGP----------------------------
Rrubrum            GRTLTVHIQNPLVPFENFDLVIAPEHDGVAAA----------------------------
Smedicae           GKPVTVHLQRPRIEG--YDLVFVSRHDWVDELN---------------------------
Smeliloti          GKPLTVHLQRPRIEG--YDLVFVSRHDWVEELD---------------------------
Translation        KKLFNIHIQDPKVNLNHFDFIVAPEHDDLD------------------------------
CPelagibacter      KKVFNIHIQDPKVDLKHFDFIVAPEHDSIK------------------------------
africae            KDIKLIQIMQPNLPYNAFDAVILPYHDQR---HCEATKWLKQSQGFFTRLLRQYFVFPRN
Rsibirica          KDIKLIQIMQPNLPYNAFDAVILPYHDQR---HCEATKWLKQSQGFFTRLLRQYFVFPRN
Rmassiliae         KDIKLIQIMQPNLPYNAFDAVILSYHDQR---HCEATKWLKQSQGFFTRLLRQYFVFPRN
Rtyphi             ESIKLVQIMQPNLPYNIFDAIILPYHDYHHLIYCRPATRLSKNIKSHYKIPDYSLHKHDI
Pzucineum          GRTFVVQTQDPRGDLAAFDMVVPPEHDERQGP----------------------------
Acryptum           --LPAVIIQHPRMDTGRFDAVVVAKHDGLTGP----------------------------
Goxydans           --LPVVQIQNPRMPVSKFDLVIANTHDGISGP----------------------------
Mnodulans          GRTFTVFLRDPRIGAEVADLVWVPEHDRLRGP----------------------------
Acidovorax         GRTQLVHINRPWAPLSWFDLIVTTPQYAVPER----------------------------
                             *       * :    :                                  

Xcampestris        ----NVLTLLGSLHPVDDAWLAAGRAAFPA-VGALPGPRVALLIGGPTTQVPWTLQALAA
Xoryzae            ----NVLTLLGSLHPVDDAWLAAGRAAFPA-VAGLPGPRLALLIGGPTDQVPWTSQALAA
Xfastidiosa        ----NVLTLLGSLHPVNDVWLATGRAQFPE-LGDLPGQRVALLVGAPTPQAPWQPAQLEE
Smaltophilia       ----NVLTLLGSLNPVDDDWLAWGRAAFAG-FSTLPGPRTALLVGGPTPLAPWDETAMVG
Oalexandrii        ----KVLNILGSPNRITPQRLNEGASAFAQRLEALPGPQAAILIGGDSKHHRFTDAACTH
Mmaris             ----NAISMTGSPNRVTAEVLATAKDSFSDRLDTLAGRRIAVLIGGNSKRFKLDTASVRY
Rcentenum          ----TLITTRGALHRVTPERLADAAARFAPAVAHLPRPRVAVLIGGSNGVYHLTPTVMGD
Rrubrum            ----NVVQSLGALHKITPAKLAEAAERFRARFAALPRPLVAVLVGGTSGAYRLEAEDTRR
Smedicae           -RLPNYHSMVGVPHQITWARLAPLRDAARRRFSPDGRPIVAVFVGGSNGAYVYDDRTHQN
Smeliloti          -QRPNYHSMVGVPHQITSARLAPLRDAARRRLSPEGRPIVAVFVGGSNGAYVYDDKTHQN
Translation        --GQNVITTKGAIHYLTQSEIEENRNYLNSFIKNDGRKIWTLIMGGPTKYYDYSTKNMKH
CPelagibacter      --GQNVISTKGAIHYLTENEINENKDYLNSFIKKDERIIWTLIMGGPTKYYDYSTKNIKE
africae            DDFKNIIPINGAINNVTEQFAAANLELQKHYPN--LKQFIAVIIGGNNKKFNFHEDEAVL
Rsibirica          DDFKNIIPINGAINNVTEQFAAANLELQKHYPN--LKQFIAVIIGGNNKKFNFHEDEAVL
Rmassiliae         DDFKNIIPINGAINNVTEKFAAANLELQKHYPN--LKQFIAVIIGGNNKKFNFHEDEAVL
Rtyphi             PQMVKIIPINGALNNITAQFSDASLELQKHYPN--LKQFIAVIIGGNNKRFNFNEDAAIL
Pzucineum          ----NVFPILGAPNRLTPQKLADELGAFRAAIDPLPHPRIAVIVGGKSRAHDLPPDRAGA
Acryptum           ----NVIVTRTALHRVTPERLALERALWAPHFAGLPRPLVAVLVGGSNGRYRLDTAAART
Goxydans           ----NVLISRNALHPVTPQKLAAARTEWEERLKQDARPLLSILVGGANGRFSLGPGEAER
Mnodulans          ----TVLTTLAGPHPVSPERLAAARAAPDPRLAALPAPRAAVLVGGDSRHGRVRPEAAER
Acidovorax         ---ANVLSHRMPFMPPSDLVEVPLPMALQLQAARMPRPWTLVMVGGDSRPFVLDDEAAVG
                       .                                    :::*. .            

Xcampestris        QCNAVQAQVRAAGGSLLITASRRTPPEVVALLRTLQQGNPGLLWCDARDGAN-PYAGLLG
Xoryzae            LCTRVSAHLRTLGGSLLVTTSRRTPGDAIAALRAACAGLPHLLWCDERDGPN-PYAGLLG
Xfastidiosa        LCTALVKGLSCGG-SVLATTSRRTPPELATQLRKHLATIPGLFWNNTDKGAN-PYPGILG
Smaltophilia       VFQALAGQIRSEGGSLLATTSRRTPPALAEILRATFADLPHVIWGDGGDGTN-PYGGLLG
Oalexandrii        LLEEVDSIRRQAG-SLMITVSRRTPDALTTALRERYG-QAERVWFHEGDGPN-PYFAFLS
Mmaris             LTDRMDTLIAGGA-SLMVTVSRRTPESARKILREHFG-ADERVWYHDGEGEN-PYFAFLA
Rcentenum          VAEKLSDLARHEGVGLMVTPSRRTGADNEAILRARLAGLPATVWDG--TGEN-PYFGFLG
Rrubrum            LARQLADLVAARGVGLVVTPSRRTGAANAAILRETLEPLGALVWDG--VGDN-PYFAMLA
Smedicae           IKGAIEQLEKEGWRIVVSVSRR--SEDHTQQALSTLNSESIAVWDR--RSEN-PYLDYMA
Smeliloti          IKCAVEQLEKAGWRIVVSASRR--SEDHTQQTLSTLNSESIAVWDR--RSEN-PYLDYMA
Translation        IFNILYKLIKKHDFQLVVIPSMRTPINTIHYAKEFFGENHTIFMKVEKKAYL----SALG
CPelagibacter      IFTTLSKLSKKHNFQLVIIPSMRTPTSIIQYANDYFGGDHTVIMDVDKKAYL----SALA
africae            FASLLNKIYTNQKIPFFISFSRRTPHTVKSIIKNNMPSSTIIYYPNEDAGYN-PYIAMLS
Rsibirica          FASLLNKIYTNQKIPFFISFSRRTPHTVKSIIKNNMPSSTIIYYPNEDAGYN-PYIAMLS
Rmassiliae         FASLLNKIYTNQKIPFFISFSRRTPHTVKSIIKNNTLSSTIIYDPNEDAGYN-PYIAMLS
Rtyphi             LSSLLNKIYSNQAIPFFISFSRRTPQIVKSIIKNNTHSSTMIYDPSKDTDYNNPYIAMLS
Pzucineum          LARDIADAVEASGGSLLLSFTRRTPAEARKILAEALKGLPGIIWDD--RPPN-PYFAFLA
Acryptum           LAEQLAGMMDRDRVGLMLTPSRRTEPAARAILDEALRPRGAWIWDMQ--GEN-PYFGMLA
Goxydans           MADGIITFTKHNAMQAVLTPSRRTDPAAVAVFRKRLEPHGIAVLTG--SGDDNPYMGMLA
Mnodulans          FLSALDRLGAEAS--LMITASRRTPSSLREGLRALSLRRGAFLWDG--SGEN-PYLALLA
Acidovorax         LAHLVNAQVRAQGGSAWVLGSPRTPATAMDVLARTLDVPAHVVRWG--EGEN-PYAALRQ
                       :                                                       

Xcampestris        WADAIVASADSVNLLSEACATPVPVVAACAEFARG----------------------RVG
Xoryzae            WADAIVASADSVNLLSEACATRVPVAAAFAEQARG----------------------RVA
Xfastidiosa        WADAIIATADSVNLLSEACATRAPVTAAFANQTRG----------------------RIR
Smaltophilia       WANRVVVSPDSVNLLSEACATRMPVMVALAETAQG----------------------RLA
Oalexandrii        AADWICVTEDSTNMLCEAAATGAPVYRLGVEGDPG----------------------KFR
Mmaris             AADWIFVTEESTNMLVEASATGAPVYVLPLVGTPG----------------------KFA
Rcentenum          LADAVVVTCDSVSMVSEAASTGKPVYIIELEGGSP----------------------KFR
Rrubrum            LADVLLVTEESVSMVSEACFSGKPVYTIALQGGSR----------------------RFK
Smedicae           AADAFVIAKDSITMPCEALATGKPVFTLELTHVAGPRL------------------DKFE
Smeliloti          AADAFVIAKDSITMPCEALATGKPVFTLELTHVAGPRL------------------DKFE
Translation        IAENIVVTCDSSSMISEAALTGKPIYVANILPRKNDIR------------------FQRF
CPelagibacter      IAQNIIVTCDSSSMISETALTGKPIYIASILPKKNDKR------------------FQRF
africae            KAKYIISTADSISMCSEAASSGKPLYIF-CPPNFNSSK------------------HKIF
Rsibirica          KAKYIISTADSISMCSEAASSGKPLYIF-CPPNFNSSK------------------HKIF
Rmassiliae         KAKYIISTADSISMCSEAASSGKPLYIF-CPPNFNSSK------------------HKIF
Rtyphi             NAKYIISTADSISMCSEAASSGKPLYIF-CPPNFNSLK------------------HKIF
Pzucineum          AADAVLVTEDSTNLATDAAATGKPVHVLAMAGGSG----------------------KFA
Acryptum           VADAIVVTGDSVSMVSEAVATDAPVMIARLPGKST----------------------RIG
Goxydans           SADMIAVTTDSVSMISEAVATSAPVLVFPLPGRSS----------------------RIS
Mnodulans          LADAVVATADSANMVGEAVATGAPVLLFELTDTYLR----------------------HR
Acidovorax         RADRIVVTTDSASMLTEALLTGKPVVPFALPRQPDWRWRLATAWRAAAARRPGSMVARSF
                    *. .  : :* .:  ::  :  *:                                   

Xcampestris        AYVQALQQRQRLCAADEVLATTAAMTPVRETERIAAQVRMRLGL------------
Xoryzae            SYLQALRQRQRLHPVDKVLASAIDIVPVRETERIAMQVRARLLP------------
Xfastidiosa        CFIDALG--ARLCTVENLLAIDTLAQPLRETERIANEVRAWFGMV-----------
Smaltophilia       RFQQQLRERGRLQAHWLDWQYDR-IEPLRETARVAAEVKQRLALG-----------
Oalexandrii        HLYAGLEGVGAVRPYLGRLESWE-YEPLHETDRAAQAVLEILA-------------
Mmaris             LLHAELEACGAVRPYLGRLDHWS-YVPLDETRRVADALLNQYRAQRGAADSEAA--
Rcentenum          RFHEMMYADGIARPFTGVLESWS-YTPLDDTARVAAEVLRRMAVWRHRHGIPG---
Rrubrum            RFHALMRDRGYARPFTGTLEPWAPPAPLDETARCAAIVRTLLARRREALGLTP---
Smedicae           RYHRDLHETLQLTRPFEGKIEPYSYEPLDETRRIASVIRSKLDLQ-----------
Smeliloti          RYHRDLHETLQLTRPFEGKIEPYSYEPLDETRRIASVIRSELNRP-----------
Translation        RNLFRELKIIRNLG---EEVENWNYEKLDETNRVAGIIKNKIFS------------
CPelagibacter      RNLFRELNITRNLG---EEVENWNYQKLDETNRVAKIIKQKINF------------
africae            IKQLVEQKIARIFDKSAIALEEYSYKPLNEAERVAEIIKSLIKSW-----------
Rsibirica          IKQLVEQKIARIFDKSAIALEEYSYKPLNEVERVAKIIKSLIKSW-----------
Rmassiliae         IKQLVEQKIARIFDKSAIALEEYSYKPLNEAERVAEIIKSLIKSW-----------
Rtyphi             IEQLVEKKIARIFNESITILEEYNYKPLNEAKKVAEMIKFAFKINKS---------
Pzucineum          RFHAALRARGIARPFQGRIETWS-YPPLAETDRAAAELLARYDARRISA-------
Acryptum           AFMDDMVACGRARNFDGRLQTWA-TAALNDTPMAAAELRRMLGV------------
Goxydans           RFVKTLEDAGRVKWFDPAQVLWD-VMPLDDTPLVAREMRRRLKL------------
Mnodulans          PFFAALRHYGAVHPFNGRLEGSR-YEPLDFTPAIAEAVAAAYLRHRDALARLTGP-
Acidovorax         DVLQDLGLLSSLRDLGLLHRALEAAGAFDGSSRVLDIARQEREATLARIRALIDRR







------------------------------------------------------------------------------------------------------------

3) réarangement élimination d'une gamma protéobactérie


CLUSTAL W (1.82) multiple sequence alignment


Translation        ------------------------------------------------------------
CPelagibacter      ---------------------------MTKLKGILLTQGMHGMISQVEGLAKALDIDFTH
Oalexandrii        ------------------------MTGMETRSCIVVSDGRRGIENQALGLAEAVGR--LT
Mmaris             ----------------------MSDPASHDTTIWVVSDGRRGIENQALGLAEAVGRGLGT
Xcampestris        -----------------------------MAVTWAVSDGRAGNARQAEALARALHPDTVH
Xoryzae            ---------MTRLPPHAFNLKQIYVGSETMGLTWALSDGRAGNARQAEALARALQSEGFQ
Xfastidiosa        ---------------------------------MAISDGRTGNTRQAEALASTLVGSLYT
Smaltophilia       -------------------------MVKRSSAPWTVTDGRAGNVRQAVALASALRQGTHR
Rcentenum          ----------------------MTAVPMAAPVCWVMSDGKAGMENQCLGLAEAVGAHPII
Rrubrum            ----------------------MSDQPALAPLTWAVTTGEAGMTNQAIGLAEAIGLPVVA
Smedicae           ----------------MQDNDDTTVKTSNTSCVWAVAESKAGTLTQCLGVGKQFHREPVV
Smeliloti          -----------------------------------MAESKAGTLTQCLGVGKQFHREPVV
africae            ------------------------------MKIHVLEDDRTGNTHQAIALAEKLTEEYTT
Rsibirica          ------------------------------MKIHVLEDDRTGNTHQAIALAEKLTEEYTT
Rmassiliae         -------------MTTSNKLINITFREVFTMKIHILADDRTGNTHQAIALAEKLTEEYTT
Rtyphi             ------------------------------MNIWVITDDRTGNTHQAIALAAQLTGKYTI
Pzucineum          ----------------------MATASPPPLTIWAVSDGRAGIEAQALGLAEAVARRRPA
Acryptum           MSGWHENAAMQAAPTLMAATQAIADGQAAPVTARVLCTDLAGLRSQALGLAEAAGFRTDF
Goxydans           ------------------------------MKAIIIAEDFAGMRAQGAGLAEKAGLEWDF
Mnodulans          -----MQRRPGLTLGPGRPDAGAVTALPSGTTAWILTDGKAGDLAPCRGLAHALGLTAQE
                                                                               

Translation        -----KSFWKAIPPK------LTPISQNIYKKIISDEFDVIISCGRKSVIPSIHLKKTSN
CPelagibacter      HTVELNNFWKMVPPK------ITPISQSVYKKIDHENFDVIISCGRKSVIPSIHLKNNSN
Oalexandrii        PLQTLPIHVPRTG--------------ELPDAGMIE-PDLWIGCGRAAVRAASLHRKQWR
Mmaris             PHHIERVTVRKDG--------------FVTLPSHSH-PDFWIGCGRAAIPLARRHRRIFP
Xcampestris        ALHLQARAPWRWAAPRRLPGANSAFGPAFAAQLQQP-PGLVIGCGRQAALATRLLRARG-
Xoryzae            AIHLQPKAPWRWAAPRRLPGAQQAFGAPFDRQLQQP-PALAIGCGRQAALATRLLRGRG-
Xfastidiosa        TQVLKPRIPWRWTAPYCLPGAKHAFGTTFSHALRYP-PFLAIGCGRQAALATRLLHKQG-
Smaltophilia       PLVLQPRAPWRWLSPRRLPGDVNGYGEAFASLAAEA-PALAIGCGRQAAGALRVLRARG-
Rcentenum          KRIALKTPWRQTTP--YLPISLRLALAPESDPLTPPWPDLLITSGRQAVGLSLLIRRLNG
Rrubrum            KVIHVPKPWRWLPTHWAAPLGIKTLCGPGSDAFTPPWPEVLVTSGRRSGALSIALRRASG
Smedicae           KLISRTRGLRKLFEP-------------RLFRKKEQRPELVISCGFRAEPAVLDIKAAYG
Smeliloti          KLISRTRGLRKLFEP-------------RLFRKREQRPELVISCGFRAEPAVLDIKAAYG
africae            IKLEYNCLAKLPNFLLKYYP-IHIKSDLLQYLLDKSPPDMIITAGRRTAVLAFYLKKKFK
Rsibirica          IKLEYNCLAKLPNFLLKYYP-IHIKSELLQYLLDKSPPDMIITAGRRTAVLAFYLKKKFK
Rmassiliae         IKLEYNCLAKLPNFLLKYYP-IHIKSELLQYLLDKSPPDMIITAGRRTAVLAFYLKKKFK
Rtyphi             ITLKYNFLAKLPNFLLQYYP-IHIKCELLKDIVDKLPPDMIITAGRRTAVLAFYLKKKFE
Pzucineum          TVVRKHVRWKWGLGR---LPARLIPIAALDGDILPPWPDIWIATGRATLPLSRRMRAWSG
Acryptum           RVIAPKRPWTLFSPMLWPDP----RCAIDAAALAPPEGDLMLGAGGAAARVLATLRRPD-
Goxydans           RPVRIHPFWSRFPARYWPSP-----LRRVDPIRIPEDTGLIICIGGTGGVIGRAVARREG
Mnodulans          RQVALRPPFSWWAPR--------GPADPRDRVLTPPWPDLALATGRRAVPALRALRRLSG
                                                          . :  *               

Translation        KKLFNIHIQDPKVNLNHFDFIVAPEHDDLDGQ----NVITTKGAIHY-------------
CPelagibacter      KKVFNIHIQDPKVDLKHFDFIVAPEHDSIKGQ----NVISTKGAIHY-------------
Oalexandrii        -RTRFVYVQKPRSHADLFDLIIAPRHDRMSGP----KVLNILGSPNR-------------
Mmaris             -DCHFTYVQDPRTRHDDFDLIVAPTHDRLVKP----NAISMTGSPNR-------------
Xcampestris        --SVAVQILDPRLDRRQWDLVVVPEHDALRGE----NVLTLLGSLHP-------------
Xoryzae            --SRSVQILDPRLDPRHWDLLVVPEHDALRGG----NVLTLLGSLHP-------------
Xfastidiosa        --ACVVQILDPRLPARHWDLLVVPEHDHIRGH----NVLTLLGSLHP-------------
Smaltophilia       --SQVVQILDPRISARHWDVVVVPEHDALRGS----NVLTLLGSLNP-------------
Rcentenum          GRTFCVHIQNPGVPFSRFDAVILPKHDEKCGP----TLITTRGALHR-------------
Rrubrum            GRTLTVHIQNPLVPFENFDLVIAPEHDGVAAA----NVVQSLGALHK-------------
Smedicae           GKPVTVHLQRPRIEG--YDLVFVSRHDWVDELNRLPNYHSMVGVPHQ-------------
Smeliloti          GKPLTVHLQRPRIEG--YDLVFVSRHDWVEELDQRPNYHSMVGVPHQ-------------
africae            -DIKLIQIMQPNLPYNAFDAVILPYHDQR---HCEATKWLKQSQGFFTRLLRQYFVFPRN
Rsibirica          -DIKLIQIMQPNLPYNAFDAVILPYHDQR---HCEATKWLKQSQGFFTRLLRQYFVFPRN
Rmassiliae         -DIKLIQIMQPNLPYNAFDAVILSYHDQR---HCEATKWLKQSQGFFTRLLRQYFVFPRN
Rtyphi             -SIKLVQIMQPNLPYNIFDAIILPYHDYHHLIYCRPATRLSKNIKSHYKIPDYSLHKHDI
Pzucineum          GRTFVVQTQDPRGDLAAFDMVVPPEHDERQGP----NVFPILGAPNR-------------
Acryptum           --LPAVIIQHPRMDTGRFDAVVVAKHDGLTGP----NVIVTRTALHR-------------
Goxydans           --LPVVQIQNPRMPVSKFDLVIANTHDGISGP----NVLISRNALHP-------------
Mnodulans          GRTFTVFLRDPRIGAEVADLVWVPEHDRLRGP----TVLTTLAGPHP-------------
                             *       * :    **                                 

Translation        -------------LTQSEIEENRNYLNSFIKNDGRKIWTLIMGGPTKYYDYSTKNMKHIF
CPelagibacter      -------------LTENEINENKDYLNSFIKKDERIIWTLIMGGPTKYYDYSTKNIKEIF
Oalexandrii        -------------ITPQRLNEGASAFAQRLEALPGPQAAILIGGDSKHHRFTDAACTHLL
Mmaris             -------------VTAEVLATAKDSFSDRLDTLAGRRIAVLIGGNSKRFKLDTASVRYLT
Xcampestris        -------------VDDAWLAAGRAAFPA-VGALPGPRVALLIGGPTTQVPWTLQALAAQC
Xoryzae            -------------VDDAWLAAGRAAFPA-VAGLPGPRLALLIGGPTDQVPWTSQALAALC
Xfastidiosa        -------------VNDVWLATGRAQFPE-LGDLPGQRVALLVGAPTPQAPWQPAQLEELC
Smaltophilia       -------------VDDDWLAWGRAAFAG-FSTLPGPRTALLVGGPTPLAPWDETAMVGVF
Rcentenum          -------------VTPERLADAAARFAPAVAHLPRPRVAVLIGGSNGVYHLTPTVMGDVA
Rrubrum            -------------ITPAKLAEAAERFRARFAALPRPLVAVLVGGTSGAYRLEAEDTRRLA
Smedicae           -------------ITWARLAPLRDAARRRFSPDGRPIVAVFVGGSNGAYVYDDRTHQNIK
Smeliloti          -------------ITSARLAPLRDAARRRLSPEGRPIVAVFVGGSNGAYVYDDKTHQNIK
africae            DDFKNIIPINGAINNVTEQFAAANLELQKHYPNLKQFIAVIIGGNNKKFNFHEDEAVLFA
Rsibirica          DDFKNIIPINGAINNVTEQFAAANLELQKHYPNLKQFIAVIIGGNNKKFNFHEDEAVLFA
Rmassiliae         DDFKNIIPINGAINNVTEKFAAANLELQKHYPNLKQFIAVIIGGNNKKFNFHEDEAVLFA
Rtyphi             PQMVKIIPINGALNNITAQFSDASLELQKHYPNLKQFIAVIIGGNNKRFNFNEDAAILLS
Pzucineum          -------------LTPQKLADELGAFRAAIDPLPHPRIAVIVGGKSRAHDLPPDRAGALA
Acryptum           -------------VTPERLALERALWAPHFAGLPRPLVAVLVGGSNGRYRLDTAAARTLA
Goxydans           -------------VTPQKLAAARTEWEERLKQDARPLLSILVGGANGRFSLGPGEAERMA
Mnodulans          -------------VSPERLAAARAAPDPRLAALPAPRAAVLVGGDSRHGRVRPEAAERFL
                                                         ::::*. .              

Translation        NILYKLIKKHDFQLVVIPSMRTPINTIHYAKEFFGENHTIFMKV---EKK-AYLSALGIA
CPelagibacter      TTLSKLSKKHNFQLVIIPSMRTPTSIIQYANDYFGGDHTVIMDV---DKK-AYLSALAIA
Oalexandrii        EEVDSIRRQAG-SLMITVSRRTPDALTTALRERYG-QAERVWFHEGDGPN-PYFAFLSAA
Mmaris             DRMDTLIAGGA-SLMVTVSRRTPESARKILREHFG-ADERVWYHDGEGEN-PYFAFLAAA
Xcampestris        NAVQAQVRAAGGSLLITASRRTPPEVVALLRTLQQGNPGLLWCDARDGAN-PYAGLLGWA
Xoryzae            TRVSAHLRTLGGSLLVTTSRRTPGDAIAALRAACAGLPHLLWCDERDGPN-PYAGLLGWA
Xfastidiosa        TALVKGLSCGG-SVLATTSRRTPPELATQLRKHLATIPGLFWNNTDKGAN-PYPGILGWA
Smaltophilia       QALAGQIRSEGGSLLATTSRRTPPALAEILRATFADLPHVIWGDGGDGTN-PYGGLLGWA
Rcentenum          EKLSDLARHEGVGLMVTPSRRTGADNEAILRARLAGLPATVWDG--TGEN-PYFGFLGLA
Rrubrum            RQLADLVAARGVGLVVTPSRRTGAANAAILRETLEPLGALVWDG--VGDN-PYFAMLALA
Smedicae           GAIEQLEKEGWRIVVSVSRR--SEDHTQQALSTLNSESIAVWDR--RSEN-PYLDYMAAA
Smeliloti          CAVEQLEKAGWRIVVSASRR--SEDHTQQTLSTLNSESIAVWDR--RSEN-PYLDYMAAA
africae            SLLNKIYTNQKIPFFISFSRRTPHTVKSIIKNNMPSSTIIYYPNEDAGYN-PYIAMLSKA
Rsibirica          SLLNKIYTNQKIPFFISFSRRTPHTVKSIIKNNMPSSTIIYYPNEDAGYN-PYIAMLSKA
Rmassiliae         SLLNKIYTNQKIPFFISFSRRTPHTVKSIIKNNTLSSTIIYDPNEDAGYN-PYIAMLSKA
Rtyphi             SLLNKIYSNQAIPFFISFSRRTPQIVKSIIKNNTHSSTMIYDPSKDTDYNNPYIAMLSNA
Pzucineum          RDIADAVEASGGSLLLSFTRRTPAEARKILAEALKGLPGIIWDD--RPPN-PYFAFLAAA
Acryptum           EQLAGMMDRDRVGLMLTPSRRTEPAARAILDEALRPRGAWIWDMQ--GEN-PYFGMLAVA
Goxydans           DGIITFTKHNAMQAVLTPSRRTDPAAVAVFRKRLEPHGIAVLTG--SGDDNPYMGMLASA
Mnodulans          SALDRLGAEAS--LMITASRRTPSSLREGLRALSLRRGAFLWDG--SGEN-PYLALLALA
                     :           .                                  . .*   :. *

Translation        ENIVVTCDSSSMISEAALTGKPIYVANILPRKNDI--RFQRFRNLFRELKIIRNLGEEVE
CPelagibacter      QNIIVTCDSSSMISETALTGKPIYIASILPKKNDK--RFQRFRNLFRELNITRNLGEEVE
Oalexandrii        DWICVTEDSTNMLCEAAATGAPVYRLGVEGDPG----KFRHLYAGLEGVGAVRPYLGRLE
Mmaris             DWIFVTEESTNMLVEASATGAPVYVLPLVGTPG----KFALLHAELEACGAVRPYLGRLD
Xcampestris        DAIVASADSVNLLSEACATPVPVVAACAEFARG----RVGAYVQALQQRQRLCAADEVLA
Xoryzae            DAIVASADSVNLLSEACATRVPVAAAFAEQARG----RVASYLQALRQRQRLHPVDKVLA
Xfastidiosa        DAIIATADSVNLLSEACATRAPVTAAFANQTRG----RIRCFIDALG--ARLCTVENLLA
Smaltophilia       NRVVVSPDSVNLLSEACATRMPVMVALAETAQG----RLARFQQQLRERGRLQAHWLDWQ
Rcentenum          DAVVVTCDSVSMVSEAASTGKPVYIIELEGGSP----KFRRFHEMMYADGIARPFTGVLE
Rrubrum            DVLLVTEESVSMVSEACFSGKPVYTIALQGGSR----RFKRFHALMRDRGYARPFTGTLE
Smedicae           DAFVIAKDSITMPCEALATGKPVFTLELTHVAGPRLDKFERYHRDLHETLQLTRPFEGKI
Smeliloti          DAFVIAKDSITMPCEALATGKPVFTLELTHVAGPRLDKFERYHRDLHETLQLTRPFEGKI
africae            KYIISTADSISMCSEAASSGKPLYIFCPPNFNSSK-HKIFIKQLVEQKIARIFDKSAIAL
Rsibirica          KYIISTADSISMCSEAASSGKPLYIFCPPNFNSSK-HKIFIKQLVEQKIARIFDKSAIAL
Rmassiliae         KYIISTADSISMCSEAASSGKPLYIFCPPNFNSSK-HKIFIKQLVEQKIARIFDKSAIAL
Rtyphi             KYIISTADSISMCSEAASSGKPLYIFCPPNFNSLK-HKIFIEQLVEKKIARIFNESITIL
Pzucineum          DAVLVTEDSTNLATDAAATGKPVHVLAMAGGSG----KFARFHAALRARGIARPFQGRIE
Acryptum           DAIVVTGDSVSMVSEAVATDAPVMIARLPGKST----RIGAFMDDMVACGRARNFDGRLQ
Goxydans           DMIAVTTDSVSMISEAVATSAPVLVFPLPGRSS----RISRFVKTLEDAGRVKWFDPAQV
Mnodulans          DAVVATADSANMVGEAVATGAPVLLFELTDTYL----RHRPFFAALRHYGAVHPFNGRLE
                   . .  : :* .:  ::  :  *:              :                      

Translation        NWN-YEKLDETNRVAGIIKNKIFS-----------
CPelagibacter      NWN-YQKLDETNRVAKIIKQKINF-----------
Oalexandrii        SWE-YEPLHETDRAAQAVLEILA------------
Mmaris             HWS-YVPLDETRRVADALLNQYRAQRGAADSEAA-
Xcampestris        TTAAMTPVRETERIAAQVRMRLGL-----------
Xoryzae            SAIDIVPVRETERIAMQVRARLLP-----------
Xfastidiosa        IDTLAQPLRETERIANEVRAWFGMV----------
Smaltophilia       YDR-IEPLRETARVAAEVKQRLALG----------
Rcentenum          SWS-YTPLDDTARVAAEVLRRMAVWRHRHGIPG--
Rrubrum            PWAPPAPLDETARCAAIVRTLLARRREALGLTP--
Smedicae           EPYSYEPLDETRRIASVIRSKLDLQ----------
Smeliloti          EPYSYEPLDETRRIASVIRSELNRP----------
africae            EEYSYKPLNEAERVAEIIKSLIKSW----------
Rsibirica          EEYSYKPLNEVERVAKIIKSLIKSW----------
Rmassiliae         EEYSYKPLNEAERVAEIIKSLIKSW----------
Rtyphi             EEYNYKPLNEAKKVAEMIKFAFKINKS--------
Pzucineum          TWS-YPPLAETDRAAAELLARYDARRISA------
Acryptum           TWA-TAALNDTPMAAAELRRMLGV-----------
Goxydans           LWD-VMPLDDTPLVAREMRRRLKL-----------
Mnodulans          GSR-YEPLDFTPAIAEAVAAAYLRHRDALARLTGP
                          :  .   *  :                 

BLAST

PROTOCOLE:

1)blast p contre swissprot paramètres par défauts NCBI.
2)blast p contre NR paramètres par défauts NCBI  


1)

Protein Sequence (277 letters)

Query ID
    lcl|11276
Description
    None
Molecule type
    amino acid
Query Length
    277

Database Name
    swissprot
Description
    Non-redundant SwissProt sequences See details
Program
    BLASTP 2.2.18+ Citation

---------------------------------------------------------------------------------------------------
2)

Protein Sequence (277 letters)

Query ID
    lcl|16069
Description
    None
Molecule type
    amino acid
Query Length
    277

Database Name
    nr
Description
    All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects See details
Program
    BLASTP 2.2.18+ Citation


RESULTATS BRUTS:

Avec swissprot:

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q9ZE28|Y120_RICPR  Uncharacterized protein RP120                64.3    7e-10
sp|Q86VI3|IQGA3_HUMAN  Ras GTPase-activating-like protein IQGAP3   32.3    3.1   Gene info
sp|P52441|UL49_HHV6U  Protein U33                                  31.6    4.9  
sp|Q91YM2|GRLF1_MOUSE  Glucocorticoid receptor DNA-binding fac...  31.2    6.1   Gene info
sp|P81128|GRLF1_RAT  Glucocorticoid receptor DNA-binding facto...  31.2    6.5   Gene info
sp|Q00711.1|DHSA_YEAST  Succinate dehydrogenase [ubiquinone] f...  30.8    8.8   Gene info
sp|Q6A8C7.1|ATPB_PROAC  RecName: Full=ATP synthase subunit bet...  30.8    8.8  
sp|Q8YQL2|CARB_ANASP  Carbamoyl-phosphate synthase large chain...  30.8    8.8   Gene info

>sp|Q9ZE28|Y120_RICPR  Uncharacterized protein RP120
Length=354

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 75/292 (25%), Positives = 121/292 (41%), Gaps = 61/292 (20%)

Query  28   DVIISCGRKSVIPSIHLKKT-SNKKLFNIHIQDPKVNLNHFDFIVAPEHDDLD-------  79
            D+II+ GR++ + + +LKK   N KL  + I  P +  N FD I+ P HD  D       
Sbjct  68   DMIITAGRRTAVLAFYLKKKFENIKL--VQIMQPNLPYNIFDAIILPYHDYRDLLYCGPA  125

Query  80   -------------------------GQNVITTKGAIHYLTQ----SEIEENRNYLNSFIK  110
                                        +I   GA++ +T     + +E  ++Y +    
Sbjct  126  KILSKNIKSHCKVLNYSSRQHDIEKMMKIIPINGALNNITAKFSAASLELQKHYPHL---  182

Query  111  NDGRKIWTLIMGGPTKYYDYSTKNMKHIFNILYKLIKKHDFQLVVIPSMRTPINTIHYAK  170
               ++   +I+GG  K + ++        ++L K+         +  S RTP       K
Sbjct  183  ---KQFTAVIIGGNNKRFSFNEDIAILFSSLLNKIYSNQAIPFFISFSRRTP----QIVK  235

Query  171  EFFGEN-HTIFMKVEKK-------AYLSALGIAENIVVTCDSSSMISEAALTGKPIYVAN  222
                 N H   M  +          Y+  L  A+ I+ T DS SM SEAA +GKP+Y+  
Sbjct  236  SIIKNNTHASTMIYDPSKDTDYNNPYIDMLANAKYIISTADSISMCSEAASSGKPLYIF-  294

Query  223  ILPRKNDIRFQRFRNLFRELKIIRNLGEEV---ENWNYEKLDETNRVAGIIK  271
              P  N ++ + F     E KI R   E +   E ++Y+ L+E  +VA IIK
Sbjct  295  YPPNFNSLKHKIFIEQLVEQKIARIFNESITMLEEYSYKPLNEAKKVAEIIK  346


>sp|Q86VI3|IQGA3_HUMAN Gene info Ras GTPase-activating-like protein IQGAP3
Length=1631

 GENE ID: 128239 IQGAP3 | IQ motif containing GTPase activating protein 3
[Homo sapiens] (10 or fewer PubMed links)

 Score = 32.3 bits (72),  Expect = 3.1, Method: Composition-based stats.
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 5/35 (14%)

Query  72   APEHDDLDGQNVITTKGAIHYLTQSEIEENRNYLN  106
            A  HDD + Q++       HYLTQ+EI+ N N++N
Sbjct  263  ARNHDDRESQDIYD-----HYLTQAEIQGNINHVN  292


>sp|P52441|UL49_HHV6U  Protein U33
Length=470

 Score = 31.6 bits (70),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 8/54 (14%)

Query  4    WKAIPPKLTPISQNIYKKIISD--EFDVIISCGRKSVIPSIHLKKTSNKKLFNI  55
            WKA+      I  N    I++D  +FDVI+ C  +S   ++HL   + KKL  +
Sbjct  381  WKAV------IGTNSACTILNDNVKFDVIVPCSCRSCYSTVHLYNVTVKKLLRL  428


>sp|Q91YM2|GRLF1_MOUSE Gene info Glucocorticoid receptor DNA-binding factor 1
Length=1499

 GENE ID: 232906 Grlf1 | glucocorticoid receptor DNA binding factor 1
[Mus musculus] (Over 10 PubMed links)

 Score = 31.2 bits (69),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 53/112 (47%), Gaps = 6/112 (5%)

Query  162   PINTIHYAKEFFGENHTIFMKV-EKKAYLSALGIAENIVVTCDSSSMISEAALTGKPIYV  220
             P +   +  E F   H  F  V EKK  + A  + +N+   C ++  +  +   G P+  
Sbjct  923   PCSQPQHKLELF---HPFFKDVVEKKNIIEATHMYDNVAEACSTTEEVFNSPRAGSPLCN  979

Query  221   ANILPRKNDIRFQRFRNLFRELKIIRNLGEEVENWNYEKLDETNRVAGIIKN  272
             +N+   + D+    + +LFRE   + +L ++   ++ E L+  + ++ I+ N
Sbjct  980   SNLQDSEEDVEPPSY-HLFREDATLPSLSKDHSKFSME-LEGNDGLSFIMSN  1029


>sp|P81128|GRLF1_RAT Gene info Glucocorticoid receptor DNA-binding factor 1 (GAP-associated 
protein p190)
Length=1513

 GENE ID: 306400 Grlf1 | glucocorticoid receptor DNA binding factor 1
[Rattus norvegicus] (10 or fewer PubMed links)

 Score = 31.2 bits (69),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 20/90 (22%), Positives = 46/90 (51%), Gaps = 2/90 (2%)

Query  183   VEKKAYLSALGIAENIVVTCDSSSMISEAALTGKPIYVANILPRKNDIRFQRFRNLFREL  242
             VEKK  + A  + +N+   C ++  +  +   G P+  +N+   + D+    + +LFRE 
Sbjct  942   VEKKNIIEATHMYDNVAEACSTTEEVFNSPRAGSPLCNSNLQDSEEDVEPPSY-HLFRED  1000

Query  243   KIIRNLGEEVENWNYEKLDETNRVAGIIKN  272
               + +L ++   ++ E L+  + ++ I+ N
Sbjct  1001  ATLPSLSKDHSKFSME-LEGNDGLSFIMSN  1029


>sp|Q00711.1|DHSA_YEAST Gene info Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial 
precursor (Flavoprotein subunit of complex II) (FP)
Length=640

 GENE ID: 853709 SDH1 | Flavoprotein subunit of succinate dehydrogenase (Sdh1p,
Sdh2p, Sdh3p, Sdh4p), which couples the oxidation of succinate to the transfer
of electrons to ubiquinone [Saccharomyces cerevisiae] (Over 10 PubMed links)

 Score = 30.8 bits (68),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 61/165 (36%), Gaps = 29/165 (17%)

Query  75   HDDLDGQNVITTKGAIHYLTQS---EIEENRNYLNSFIKNDGRKIWTLIMGGPTKYYDYS  131
            +D + G + +  + +IHY+T+     I E  +Y   F + +  KI+    GG TK Y   
Sbjct  115  YDTVKGSDWLGDQDSIHYMTREAPKSIIELEHYGVPFSRTENGKIYQRAFGGQTKEYGKG  174

Query  132  TKNMK----------HIFNILYKLIKKHD-------FQLVVIPSMRTPINTIHYAKE---  171
             +  +           + + LY    +HD       F L ++      +  I Y +E   
Sbjct  175  AQAYRTCAVADRTGHALLHTLYGQALRHDTHFFIEYFALDLLTHNGEVVGVIAYNQEDGT  234

Query  172  ---FFGENHTIFMKVEKKAYLSALGIAENIVVTCDSSSMISEAAL  213
               F      I      +AY S          T D ++M+S A  
Sbjct  235  IHRFRAHKTIIATGGYGRAYFSCTSAH---TCTGDGNAMVSRAGF  276


>sp|Q6A8C7.1|ATPB_PROAC  RecName: Full=ATP synthase subunit beta; AltName: Full=F-ATPase 
subunit beta; AltName: Full=ATP synthase F1 sector subunit 
beta
Length=484

 Score = 30.8 bits (68),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 32/74 (43%), Gaps = 14/74 (18%)

Query  154  VVIPSMRTP--INTIHYAKEFFGENHTIFMKVEKKAYLSALGIAENIVVT-----CDSSS  206
            V  P+ + P  +N +H   E  GE H I ++V       AL I EN+V        D   
Sbjct  30   VEFPAGQLPEILNALHVDAEVMGETHAITLEV-------ALHIGENVVRAISLKPTDGMR  82

Query  207  MISEAALTGKPIYV  220
              +E   TG PI V
Sbjct  83   RGTEVRDTGAPISV  96


>sp|Q8YQL2|CARB_ANASP Gene info Carbamoyl-phosphate synthase large chain (Carbamoyl-phosphate 
synthetase ammonia chain)
Length=1104

 GENE ID: 1107407 carB | carbamoyl phosphate synthase large subunit
[Nostoc sp. PCC 7120] (10 or fewer PubMed links)

 Score = 30.8 bits (68),  Expect = 8.8, Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query  194  IAENIVVTCDSSSMISEAALTGKPIYVANILPRK--NDIRFQRFRNLFRELKIIRNLGEE  251
            +A+N+V+ C   ++      TG  I VA   P +   D  +QR R++   +KIIR +G E
Sbjct  225  LADNVVIICSIENIDPMGIHTGDSITVA---PAQTLTDKEYQRLRDM--AIKIIREIGVE  279

Query  252  VENWNYE  258
                N +
Sbjct  280  TGGSNIQ  286


----------------------------------------------------------------------------------------------------


RESULTATS BRUTS: 
Avec NR:

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

gb|EDZ60703.1|  conserved hypothetical protein [Candidatus Pel...   449    1e-124
ref|YP_265503.1|  nucleoside-diphosphate-sugar epimerase [Cand...   428    2e-118 Gene info
ref|ZP_03278450.1|  protein of unknown function DUF1022 [Thioa...   158    4e-37 
ref|YP_002298224.1|  hypothetical protein RC1_2018 [Rhodospiri...   144    5e-33  Gene info
ref|YP_427067.1|  hypothetical protein Rru_A1980 [Rhodospirill...   138    5e-31  Gene info
ref|YP_001413581.1|  hypothetical protein Plav_2310 [Parvibacu...   135    4e-30  Gene info
ref|ZP_02188391.1|  hypothetical protein BAL199_04384 [alpha p...   133    1e-29 
ref|YP_002131432.1|  predicted nucleoside-diphosphate-sugar ep...   114    6e-24  Gene info
ref|YP_001685912.1|  hypothetical protein Caul_4294 [Caulobact...   114    6e-24  Gene info
ref|YP_759371.1|  hypothetical protein HNE_0642 [Hyphomonas ne...   114    9e-24  Gene info
ref|NP_421645.1|  hypothetical protein CC_2849 [Caulobacter cr...   113    2e-23  Gene info
ref|YP_001970389.1|  conserved hypothetical protein [Stenotrop...   113    2e-23  Gene info
ref|YP_002026745.1|  protein of unknown function DUF1022 [Sten...   112    3e-23  Gene info
ref|ZP_01548451.1|  hypothetical protein SIAM614_20361 [Stappi...   111    7e-23 
gb|EDX79665.1|  conserved hypothetical protein [Brevundimonas ...   108    5e-22 
ref|YP_001753258.1|  hypothetical protein Mrad2831_0564 [Methy...   103    1e-20  Gene info
ref|ZP_00952957.1|  hypothetical protein OA2633_13565 [Oceanic...   103    2e-20 
ref|YP_001313737.1|  hypothetical protein Smed_5023 [Sinorhizo...   102    2e-20  Gene info
ref|YP_001638566.1|  hypothetical protein Mext_1091 [Methyloba...   102    4e-20  Gene info
ref|ZP_02058463.1|  protein of unknown function DUF1022 [Methy...   101    5e-20 
ref|NP_437081.1|  hypothetical protein SM_b20562 [Sinorhizobiu...   101    8e-20  Gene info
ref|YP_001923736.1|  protein of unknown function DUF1022 [Meth...  99.8    2e-19  Gene info
ref|NP_638950.1|  hypothetical protein XCC3604 [Xanthomonas ca...  99.4    3e-19  Gene info
ref|YP_192704.1|  hypothetical protein GOX2315 [Gluconobacter ...  99.0    4e-19  Gene info
ref|YP_362317.1|  hypothetical protein XCV0586 [Xanthomonas ca...  99.0    4e-19  Gene info
ref|YP_757373.1|  hypothetical protein Mmar10_2143 [Maricaulis...  98.2    7e-19  Gene info
ref|ZP_02244847.1|  hypothetical protein Xoryp_19930 [Xanthomo...  97.8    9e-19 
ref|YP_202907.6|  hypothetical protein XOO4268 [Xanthomonas or...  97.4    9e-19  Gene info
gb|AAW77522.1|  conserved hypothetical protein [Xanthomonas or...  97.4    1e-18  Gene info
ref|YP_453053.1|  hypothetical protein XOO_4024 [Xanthomonas o...  96.3    2e-18  Gene info
ref|ZP_01018255.1|  hypothetical protein PB2503_12004 [Parvula...  95.9    3e-18 
ref|YP_001911717.1|  conserved hypothetical protein [Xanthomon...  95.9    3e-18  Gene info
ref|XP_001766160.1|  predicted protein [Physcomitrella patens ...  95.1    5e-18  UniGene infoGene info
ref|YP_001235794.1|  hypothetical protein Acry_2684 [Acidiphil...  94.0    1e-17  Gene info
gb|ACF78648.1|  unknown [Zea mays] >gb|ACF83511.1| unknown [Ze...  93.2    2e-17 
ref|YP_744455.1|  hypothetical protein GbCGDNIH1_0634 [Granuli...  92.8    3e-17  Gene info
ref|NP_640906.1|  hypothetical protein XAC0553 [Xanthomonas ax...  91.7    6e-17  Gene info
gb|EAY86162.1|  hypothetical protein OsI_007395 [Oryza sativa ...  90.9    1e-16 
gb|EAZ23323.1|  hypothetical protein OsJ_006806 [Oryza sativa ...  90.9    1e-16 
ref|NP_568417.1|  unknown protein [Arabidopsis thaliana] >gb|A...  89.7    2e-16  UniGene infoGene info
dbj|BAB08333.1|  unnamed protein product [Arabidopsis thaliana]    89.4    3e-16 
emb|CAH66474.1|  OSIGBa0137L20.3 [Oryza sativa (indica cultiva...  88.6    5e-16 
emb|CAO48707.1|  unnamed protein product [Vitis vinifera]          88.2    7e-16 
ref|YP_001603229.1|  hypothetical protein GDI2997 [Gluconaceto...  86.3    3e-15  Gene info
ref|YP_002277700.1|  protein of unknown function DUF1022 [Gluc...  85.9    3e-15  Gene info
ref|NP_568162.1|  unknown protein [Arabidopsis thaliana] >ref|...  85.5    4e-15  UniGene infoGene info
ref|NP_299124.1|  hypothetical protein XF1838 [Xylella fastidi...  84.3    9e-15  Gene info
gb|EAZ30685.1|  hypothetical protein OsJ_014168 [Oryza sativa ...  82.4    4e-14 
gb|EAY94047.1|  hypothetical protein OsI_015280 [Oryza sativa ...  81.6    6e-14 
ref|NP_001052751.1|  Os04g0414000 [Oryza sativa (japonica cult...  81.3    8e-14  UniGene infoGene info
ref|ZP_00680699.1|  Protein of unknown function DUF1022 [Xylel...  80.9    1e-13 
ref|ZP_00651642.1|  Protein of unknown function DUF1022 [Xylel...  80.5    1e-13 
ref|YP_001829795.1|  hypothetical protein XfasM23_1093 [Xylell...  80.5    1e-13  Gene info
ref|NP_779240.1|  hypothetical protein PD1029 [Xylella fastidi...  80.5    1e-13  Gene info
emb|CAN76140.1|  hypothetical protein [Vitis vinifera]             79.7    2e-13 
emb|CAO15868.1|  unnamed protein product [Vitis vinifera]          79.3    3e-13 
ref|YP_001770606.1|  hypothetical protein M446_3794 [Methyloba...  78.6    5e-13  Gene info
ref|YP_001494277.1|  hypothetical protein A1G_00935 [Rickettsi...  78.6    5e-13  Gene info
ref|YP_001649522.1|  hypothetical protein RrIowa_0203 [Rickett...  78.6    6e-13  Gene info
ref|YP_001491855.1|  hypothetical protein A1E_00610 [Rickettsi...  78.2    6e-13  Gene info
ref|YP_987285.1|  nucleoside-diphosphate-sugar epimerase-like ...  78.2    7e-13  Gene info
ref|ZP_02335975.1|  hypothetical protein RafrE_00905 [Ricketts...  77.0    2e-12 
ref|ZP_00142364.1|  hypothetical protein [Rickettsia sibirica ...  76.6    2e-12 
ref|NP_359799.1|  hypothetical protein RC0162 [Rickettsia cono...  75.9    4e-12  Gene info
ref|YP_902422.1|  nucleoside-diphosphate-sugar epimerase-like ...  75.5    4e-12  Gene info
ref|ZP_00208344.1|  COG3660: Predicted nucleoside-diphosphate-...  74.7    8e-12 
ref|YP_421446.1|  nucleoside-diphosphate-sugar epimerase [Magn...  73.9    1e-11  Gene info
ref|ZP_01879512.1|  Predicted nucleoside-diphosphate-sugar epi...  73.6    2e-11 
ref|YP_001499011.1|  putative nucleoside-diphosphate-sugar epi...  72.8    2e-11  Gene info
ref|ZP_01879520.1|  Predicted nucleoside-diphosphate-sugar epi...  70.9    1e-10 
dbj|BAB09683.1|  unnamed protein product [Arabidopsis thaliana]    70.9    1e-10 
ref|YP_342609.1|  hypothetical protein Noc_0559 [Nitrosococcus...  70.5    2e-10  Gene info
ref|ZP_01034184.1|  hypothetical protein ROS217_20102 [Roseova...  70.1    2e-10 
ref|YP_001495711.1|  putative nucleoside-diphosphate-sugar epi...  68.9    4e-10  Gene info
ref|YP_538344.1|  putative nucleoside-diphosphate-sugar epimer...  68.9    4e-10  Gene info
ref|ZP_02120444.1|  protein of unknown function DUF1022 [Methy...  68.2    7e-10 
ref|ZP_01034191.1|  hypothetical protein ROS217_20137 [Roseova...  67.8    8e-10 
ref|YP_067077.1|  hypothetical protein RT0109 [Rickettsia typh...  66.6    2e-09  Gene info
ref|ZP_03278452.1|  nucleoside-diphosphate-sugar epimerase-lik...  65.5    4e-09 
ref|YP_902410.1|  nucleoside-diphosphate-sugar epimerase-like ...  65.1    5e-09  Gene info
ref|NP_220512.1|  hypothetical protein RP120 [Rickettsia prowa...  64.3    1e-08  Gene info
ref|YP_001356908.1|  hypothetical protein NIS_1444 [Nitratirup...  63.9    1e-08  Gene info
ref|YP_247186.1|  hypothetical protein RF_1170 [Rickettsia fel...  58.9    4e-07  Gene info
ref|YP_001493017.1|  hypothetical protein A1C_00895 [Rickettsi...  58.9    5e-07  Gene info
ref|YP_045343.1|  hypothetical protein ACIAD0598 [Acinetobacte...  58.5    5e-07  Gene info
ref|ZP_01103561.1|  conserved hypothetical protein [gamma prot...  57.0    1e-06 
ref|ZP_01879524.1|  Predicted nucleoside-diphosphate-sugar epi...  56.6    2e-06 
dbj|BAD94137.1|  hypothetical protein [Arabidopsis thaliana]       55.1    5e-06 
ref|ZP_01895656.1|  hypothetical protein MDG893_13419 [Marinob...  54.7    8e-06 
ref|ZP_00050821.2|  COG3660: Predicted nucleoside-diphosphate-...  53.9    1e-05 
ref|ZP_01126815.1|  Predicted nucleoside-diphosphate-sugar epi...  53.9    1e-05 
ref|YP_001877060.1|  hypothetical protein Amuc_0441 [Akkermans...  52.8    3e-05  Gene info
ref|ZP_01034195.1|  hypothetical protein ROS217_20157 [Roseova...  52.8    3e-05 
ref|ZP_00418847.1|  similar to nucleoside-diphosphate-sugar ep...  52.0    5e-05 
ref|YP_001847813.1|  hypothetical protein ACICU_03154 [Acineto...  51.6    7e-05  Gene info
ref|YP_001085911.1|  hypothetical protein A1S_2903 [Acinetobac...  47.4    0.001  Gene info
gb|ABO13309.2|  hypothetical protein A1S_2903 [Acinetobacter b...  46.6    0.002 
ref|YP_001712549.1|  hypothetical protein ABAYE0578 [Acinetoba...  46.6    0.002  Gene info
ref|NP_001047040.1|  Os02g0535700 [Oryza sativa (japonica cult...  46.6    0.002  UniGene infoGene info
ref|YP_958083.1|  hypothetical protein Maqu_0799 [Marinobacter...  46.6    0.002  Gene info



>gb|EDZ60703.1|  conserved hypothetical protein [Candidatus Pelagibacter sp. HTCC7211]
Length=314

 Score =  449 bits (1155),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 212/273 (77%), Positives = 241/273 (88%), Gaps = 0/273 (0%)

Query  2    SFWKAIPPKLTPISQNIYKKIISDEFDVIISCGRKSVIPSIHLKKTSNKKLFNIHIQDPK  61
            +FWK +PPK+TPISQ++YKKI  + FDVIISCGRKSVIPSIHLK  SNKK+FNIHIQDPK
Sbjct  40   NFWKMVPPKITPISQSVYKKIDHENFDVIISCGRKSVIPSIHLKNNSNKKVFNIHIQDPK  99

Query  62   VNLNHFDFIVAPEHDDLDGQNVITTKGAIHYLTQSEIEENRNYLNSFIKNDGRKIWTLIM  121
            V+L HFDFIVAPEHD + GQNVI+TKGAIHYLT++EI EN++YLNSFIK D R IWTLIM
Sbjct  100  VDLKHFDFIVAPEHDSIKGQNVISTKGAIHYLTENEINENKDYLNSFIKKDERIIWTLIM  159

Query  122  GGPTKYYDYSTKNMKHIFNILYKLIKKHDFQLVVIPSMRTPINTIHYAKEFFGENHTIFM  181
            GGPTKYYDYSTKN+K IF  L KL KKH+FQLV+IPSMRTP + I YA ++FG +HT+ M
Sbjct  160  GGPTKYYDYSTKNIKEIFTTLSKLSKKHNFQLVIIPSMRTPTSIIQYANDYFGGDHTVIM  219

Query  182  KVEKKAYLSALGIAENIVVTCDSSSMISEAALTGKPIYVANILPRKNDIRFQRFRNLFRE  241
             V+KKAYLSAL IA+NI+VTCDSSSMISE ALTGKPIY+A+ILP+KND RFQRFRNLFRE
Sbjct  220  DVDKKAYLSALAIAQNIIVTCDSSSMISETALTGKPIYIASILPKKNDKRFQRFRNLFRE  279

Query  242  LKIIRNLGEEVENWNYEKLDETNRVAGIIKNKI  274
            L I RNLGEEVENWNY+KLDETNRVA IIK KI
Sbjct  280  LNITRNLGEEVENWNYQKLDETNRVAKIIKQKI  312


>ref|YP_265503.1| Gene info nucleoside-diphosphate-sugar epimerase [Candidatus Pelagibacter 
ubique HTCC1062]
 ref|ZP_01264757.1|  Predicted nucleoside-diphosphate-sugar epimerase [Candidatus 
Pelagibacter ubique HTCC1002]
 gb|AAZ20900.1| Gene info Predicted nucleoside-diphosphate-sugar epimerase [Candidatus 
Pelagibacter ubique HTCC1062]
 gb|EAS85244.1|  Predicted nucleoside-diphosphate-sugar epimerase [Candidatus 
Pelagibacter ubique HTCC1002]
Length=314

 GENE ID: 3516611 SAR11_0076 | nucleoside-diphosphate-sugar epimerase
[Candidatus Pelagibacter ubique HTCC1062] (10 or fewer PubMed links)

 Score =  428 bits (1100),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 208/275 (75%), Positives = 238/275 (86%), Gaps = 0/275 (0%)

Query  2    SFWKAIPPKLTPISQNIYKKIISDEFDVIISCGRKSVIPSIHLKKTSNKKLFNIHIQDPK  61
            +FWK  PPKLTP+S N+YKK+ S +FDVIISCGRKSVIPSIHLKK SNK++ NIHIQ+PK
Sbjct  40   NFWKLFPPKLTPVSSNVYKKVESSDFDVIISCGRKSVIPSIHLKKNSNKRVINIHIQNPK  99

Query  62   VNLNHFDFIVAPEHDDLDGQNVITTKGAIHYLTQSEIEENRNYLNSFIKNDGRKIWTLIM  121
            VN  +FDFIVAPEHD ++GQNVI+TKGAIHYLT+SEI EN++YLNSFIK D RKIW LIM
Sbjct  100  VNFKNFDFIVAPEHDGIEGQNVISTKGAIHYLTESEINENKDYLNSFIKKDERKIWALIM  159

Query  122  GGPTKYYDYSTKNMKHIFNILYKLIKKHDFQLVVIPSMRTPINTIHYAKEFFGENHTIFM  181
            GGPTKYY+YS +N+K IF  L  L K+++FQLVVIPSMRTP N I Y K++FGENHT+  
Sbjct  160  GGPTKYYEYSRENIKAIFENLNNLNKQNNFQLVVIPSMRTPKNIIQYVKDYFGENHTVIE  219

Query  182  KVEKKAYLSALGIAENIVVTCDSSSMISEAALTGKPIYVANILPRKNDIRFQRFRNLFRE  241
             ++KKAYLSAL I+E IVVTCDSSSMISEAALTGKPIYVANI P+KND RFQRFRNLF+E
Sbjct  220  TIDKKAYLSALAISEKIVVTCDSSSMISEAALTGKPIYVANISPKKNDKRFQRFRNLFKE  279

Query  242  LKIIRNLGEEVENWNYEKLDETNRVAGIIKNKIFS  276
            L I RNLGEEVENWNY+KLDETNRVA IIK KI S
Sbjct  280  LNITRNLGEEVENWNYQKLDETNRVANIIKQKINS  314


>ref|ZP_03278450.1|  protein of unknown function DUF1022 [Thioalkalivibrio sp. HL-EbGR7]
 gb|EEA10578.1|  protein of unknown function DUF1022 [Thioalkalivibrio sp. HL-EbGR7]
Length=312

 Score =  158 bits (400),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 85/279 (30%), Positives = 146/279 (52%), Gaps = 8/279 (2%)

Query  4    WKAIPPKLTPISQNI-----YKKIISDEFDVIISCGRKSVIPSIHLKKTSNKKLFNIHIQ  58
            W+ +P  L P +           ++    D++I CGR+S   +I +++ S  K   +++Q
Sbjct  27   WRWLPGHLCPGALRFGLTRQSSPLVPPWPDLLIVCGRRSQAVAIAIRRLSGGKTLTVYVQ  86

Query  59   DPKVNLNHFDFIVAPEHDDLDGQNVITTKGAIHYLTQSEIEENRNYLNSFIKNDGRKIWT  118
            DPK+   +FD +V P HD L+G NV+ T+GA+H +T  ++ E          +  R + T
Sbjct  87   DPKIPARYFDLVVPPRHDGLEGPNVMPTRGALHRITHEKLAEAAARQTGRFAHLSRPLVT  146

Query  119  LIMGGPTKYYDYSTKNMKHIFNILYKLIKKHDFQLVVIPSMRTPINTIHYAKEFFGE-NH  177
            +++GG ++    + +    +   L +L+++ D  L +  S RT    +   +   G+  H
Sbjct  147  VLLGGSSRSSRLTPEISAALGRELARLVREQDVGLAITASRRTGPENLGAFRAALGDVPH  206

Query  178  TIFMKVEKKAYLSALGIAENIVVTCDSSSMISEAALTGKPIYVANILPRKNDIRFQRFRN  237
             ++    +  YL+ LG+A+ IVVT DS SM+SEAA TGKP+YV ++    N  R + F  
Sbjct  207  FLWDGEGENPYLAMLGLADYIVVTGDSVSMVSEAASTGKPVYVVDLEGYSN--RLKVFHQ  264

Query  238  LFRELKIIRNLGEEVENWNYEKLDETNRVAGIIKNKIFS  276
              R   I R     +E W YE +++T RVAG I+  + +
Sbjct  265  ELRREGITRPFPGPLERWVYEPVNDTARVAGRIRQMLAA  303


>ref|YP_002298224.1| Gene info hypothetical protein RC1_2018 [Rhodospirillum centenum SW]
 gb|ACI99411.1| Gene info conserved hypothetical protein [Rhodospirillum centenum SW]
Length=331

 GENE ID: 7006786 RC1_2018 | hypothetical protein [Rhodospirillum centenum SW]

 Score =  144 bits (364),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 85/280 (30%), Positives = 141/280 (50%), Gaps = 9/280 (3%)

Query  1    KSFWKAIPPKLTPISQNIYKKIISDEF-----DVIISCGRKSVIPSIHLKKTSNKKLFNI  55
            K+ W+   P L PIS  +     SD       D++I+ GR++V  S+ +++ +  + F +
Sbjct  44   KTPWRQTTPYL-PISLRLALAPESDPLTPPWPDLLITSGRQAVGLSLLIRRLNGGRTFCV  102

Query  56   HIQDPKVNLNHFDFIVAPEHDDLDGQNVITTKGAIHYLTQSEIEENRNYLNSFIKNDGRK  115
            HIQ+P V  + FD ++ P+HD+  G  +ITT+GA+H +T   + +        + +  R 
Sbjct  103  HIQNPGVPFSRFDAVILPKHDEKCGPTLITTRGALHRVTPERLADAAARFAPAVAHLPRP  162

Query  116  IWTLIMGGPTKYYDYSTKNMKHIFNILYKLIKKHDFQLVVIPSMRTPI-NTIHYAKEFFG  174
               +++GG    Y  +   M  +   L  L +     L+V PS RT   N         G
Sbjct  163  RVAVLIGGSNGVYHLTPTVMGDVAEKLSDLARHEGVGLMVTPSRRTGADNEAILRARLAG  222

Query  175  ENHTIFMKVEKKAYLSALGIAENIVVTCDSSSMISEAALTGKPIYVANILPRKNDIRFQR  234
               T++    +  Y   LG+A+ +VVTCDS SM+SEAA TGKP+Y+  +       +F+R
Sbjct  223  LPATVWDGTGENPYFGFLGLADAVVVTCDSVSMVSEAASTGKPVYIIEL--EGGSPKFRR  280

Query  235  FRNLFRELKIIRNLGEEVENWNYEKLDETNRVAGIIKNKI  274
            F  +     I R     +E+W+Y  LD+T RVA  +  ++
Sbjct  281  FHEMMYADGIARPFTGVLESWSYTPLDDTARVAAEVLRRM  320


>ref|YP_427067.1| Gene info hypothetical protein Rru_A1980 [Rhodospirillum rubrum ATCC 11170]
 gb|ABC22780.1| Gene info Protein of unknown function DUF1022 [Rhodospirillum rubrum ATCC 
11170]
Length=334

 GENE ID: 3835404 Rru_A1980 | hypothetical protein
[Rhodospirillum rubrum ATCC 11170]

 Score =  138 bits (348),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 77/256 (30%), Positives = 127/256 (49%), Gaps = 9/256 (3%)

Query  24   SDEF-----DVIISCGRKSVIPSIHLKKTSNKKLFNIHIQDPKVNLNHFDFIVAPEHDDL  78
            SD F     +V+++ GR+S   SI L++ S  +   +HIQ+P V   +FD ++APEHD +
Sbjct  68   SDAFTPPWPEVLVTSGRRSGALSIALRRASGGRTLTVHIQNPLVPFENFDLVIAPEHDGV  127

Query  79   DGQNVITTKGAIHYLTQSEIEENRNYLNSFIKNDGRKIWTLIMGGPTKYYDYSTKNMKHI  138
               NV+ + GA+H +T +++ E      +      R +  +++GG +  Y    ++ + +
Sbjct  128  AAANVVQSLGALHKITPAKLAEAAERFRARFAALPRPLVAVLVGGTSGAYRLEAEDTRRL  187

Query  139  FNILYKLIKKHDFQLVVIPSMRTPINTIHYAKEFFGE-NHTIFMKVEKKAYLSALGIAEN  197
               L  L+      LVV PS RT        +E        ++  V    Y + L +A+ 
Sbjct  188  ARQLADLVAARGVGLVVTPSRRTGAANAAILRETLEPLGALVWDGVGDNPYFAMLALADV  247

Query  198  IVVTCDSSSMISEAALTGKPIYVANILPRKNDIRFQRFRNLFRELKIIRNLGEEVENWNY  257
            ++VT +S SM+SEA  +GKP+Y   I  +    RF+RF  L R+    R     +E W  
Sbjct  248  LLVTEESVSMVSEACFSGKPVY--TIALQGGSRRFKRFHALMRDRGYARPFTGTLEPWAP  305

Query  258  EK-LDETNRVAGIIKN  272
               LDET R A I++ 
Sbjct  306  PAPLDETARCAAIVRT  321


>ref|YP_001413581.1| Gene info hypothetical protein Plav_2310 [Parvibaculum lavamentivorans 
DS-1]
 gb|ABS63924.1| Gene info protein of unknown function DUF1022 [Parvibaculum lavamentivorans 
DS-1]
Length=335

 GENE ID: 5454320 Plav_2310 | hypothetical protein
[Parvibaculum lavamentivorans DS-1] (10 or fewer PubMed links)

 Score =  135 bits (339),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 123/248 (49%), Gaps = 3/248 (1%)

Query  28   DVIISCGRKSVIPSIHLKKTSNKKLFNIHIQDPKVNLNHFDFIVAPEHDDLDGQNVITTK  87
            D++I+ GR+S+  +  +++ S  K F   +QDP+V  +HFDF+ AP HD L+G NV++T 
Sbjct  80   DLLIASGRQSIPYARMIRRKSGGKTFTAILQDPRVAPSHFDFVWAPAHDRLEGPNVLSTV  139

Query  88   GAIHYLTQSEIEENRNYLNSFIKNDGRKIWTLIMGGPTKYYDYSTKNMKHIFNILYKLIK  147
             + H LT+  +          + +  R    +++GG    Y  +      I   L  L +
Sbjct  140  VSPHRLTRERLATEAAKFAPEVASLPRPRVAVLLGGTNSVYSLTEAVAARIGAQLAGLTE  199

Query  148  KHDFQLVVIPSMRTPINTIHYAKE-FFGENHTIFMKVEKKAYLSALGIAENIVVTCDSSS  206
             +   L+V PS RT        +E   G    ++       Y   LG+A+ +VVTCDS +
Sbjct  200  HYGAGLMVTPSRRTGEAQSRIIREALAGRPALMWDGTGDNPYFGFLGLADAVVVTCDSVN  259

Query  207  MISEAALTGKPIYVANILPRKNDIRFQRFRNLFRELKIIRNLGEEVENWNYEKLDETNRV  266
            M+ EAA TGKP+YV  +       +F+RF +        R    ++E W YE L+ T+ +
Sbjct  260  MVGEAAFTGKPVYVIEL--EGQSPKFRRFLDAVYATGAARPFVGQLERWEYEPLNATDEI  317

Query  267  AGIIKNKI  274
            A  I  ++
Sbjct  318  ARAIAARL  325


>ref|ZP_02188391.1|  hypothetical protein BAL199_04384 [alpha proteobacterium BAL199]
 gb|EDP64667.1|  hypothetical protein BAL199_04384 [alpha proteobacterium BAL199]
Length=337

 Score =  133 bits (335),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/248 (30%), Positives = 122/248 (49%), Gaps = 4/248 (1%)

Query  28   DVIISCGRKSVIPSIHLKKTSNKKLFNIHIQDPKVNLNHFDFIVAPEHDDLDGQNVITTK  87
            DV+ISCGR++   +I +K+ S  + F  HIQDP+++   FD +V PEHD   G NV+TT 
Sbjct  85   DVVISCGRRTAGAAIAVKRLSGGRAFLAHIQDPRLDPRRFDLLVVPEHDPTRGPNVVTTL  144

Query  88   GAIHYLTQSEIEENRNYLNSFIKNDGRKIWTLIMGGPTKYYDYSTKNMKHIFNILYKLIK  147
            GA++    + + +             R    +++GG  K YD+S   +      L + + 
Sbjct  145  GALNPHDPAILADAARQWEIEAAGLPRPYVAVMVGGSNKRYDFSPDAVARFVRQLRQ-VA  203

Query  148  KHDFQLVVIPSMRTPINTIHYAKEFFGENHTIFMKVEKK-AYLSALGIAENIVVTCDSSS  206
                 L+V  S RT   T    K+   +   +    E +  YL  L +A+ ++VT DS +
Sbjct  204  NDGAGLLVATSRRTDAATRAALKDGLADLPALVWDGEGENPYLGFLALADALIVTSDSVN  263

Query  207  MISEAALTGKPIYVANILPRKNDIRFQRFRNLFRELKIIRNLGEEVENWNYEKLDETNRV  266
            M SEA  TGKP++VA +     + R   F    R     R     +E W++  LDET RV
Sbjct  264  MASEACATGKPVHVATV--EAENGRLAAFHERLRMAGHTRAFEGRIEAWSHPPLDETPRV  321

Query  267  AGIIKNKI  274
              +++ ++
Sbjct  322  GAVLRQRL  329


>ref|YP_002131432.1| Gene info predicted nucleoside-diphosphate-sugar epimerase [Phenylobacterium 
zucineum HLK1]
 gb|ACG79003.1| Gene info predicted nucleoside-diphosphate-sugar epimerase [Phenylobacterium 
zucineum HLK1]
Length=326

 GENE ID: 6792116 PHZ_c2594 | predicted nucleoside-diphosphate-sugar epimerase
[Phenylobacterium zucineum HLK1]

 Score =  114 bits (286),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 70/262 (26%), Positives = 122/262 (46%), Gaps = 4/262 (1%)

Query  7    IPPKLTPISQNIYKKIISDEFDVIISCGRKSVIPSIHLKKTSNKKLFNIHIQDPKVNLNH  66
            +P +L PI+  +   I+    D+ I+ GR ++  S  ++  S  + F +  QDP+ +L  
Sbjct  54   LPARLIPIAA-LDGDILPPWPDIWIATGRATLPLSRRMRAWSGGRTFVVQTQDPRGDLAA  112

Query  67   FDFIVAPEHDDLDGQNVITTKGAIHYLTQSEIEENRNYLNSFIKNDGRKIWTLIMGGPTK  126
            FD +V PEHD+  G NV    GA + LT  ++ +      + I         +I+GG ++
Sbjct  113  FDMVVPPEHDERQGPNVFPILGAPNRLTPQKLADELGAFRAAIDPLPHPRIAVIVGGKSR  172

Query  127  YYDYSTKNMKHIFNILYKLIKKHDFQLVVIPSMRTPINTIH-YAKEFFGENHTIFMKVEK  185
             +D        +   +   ++     L++  + RTP       A+   G    I+     
Sbjct  173  AHDLPPDRAGALARDIADAVEASGGSLLLSFTRRTPAEARKILAEALKGLPGIIWDDRPP  232

Query  186  KAYLSALGIAENIVVTCDSSSMISEAALTGKPIYVANILPRKNDIRFQRFRNLFRELKII  245
              Y + L  A+ ++VT DS+++ ++AA TGKP++V  +       +F RF    R   I 
Sbjct  233  NPYFAFLAAADAVLVTEDSTNLATDAAATGKPVHVLAMA--GGSGKFARFHAALRARGIA  290

Query  246  RNLGEEVENWNYEKLDETNRVA  267
            R     +E W+Y  L ET+R A
Sbjct  291  RPFQGRIETWSYPPLAETDRAA  312


>ref|YP_001685912.1| Gene info hypothetical protein Caul_4294 [Caulobacter sp. K31]
 gb|ABZ73414.1| Gene info protein of unknown function DUF1022 [Caulobacter sp. K31]
Length=456

 GENE ID: 5901755 Caul_4294 | hypothetical protein [Caulobacter sp. K31]

 Score =  114 bits (286),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 116/248 (46%), Gaps = 3/248 (1%)

Query  28   DVIISCGRKSVIPSIHLKKTSNKKLFNIHIQDPKVNLNHFDFIVAPEHDDLDGQNVITTK  87
            D+ I+ GR ++  SI  K+ S+ K + + IQDP+V    FD ++ P+HD L G N++   
Sbjct  195  DLWIAAGRATLPLSIRAKRWSSGKTYVVQIQDPRVPATMFDLVIPPKHDRLSGDNILPIT  254

Query  88   GAIHYLTQSEIEENRNYLNSFIKNDGRKIWTLIMGGPTKYYDYSTKNMKHIFNILYKLIK  147
            G+ H +T   +E         I    R    +++GG ++ +D S      + + +   ++
Sbjct  255  GSPHRVTSQRLETEYEKFKDQIDALPRPRVAVLLGGKSRAFDLSALRAAEMAHQIQLPLE  314

Query  148  KHDFQLVVIPSMRTPINTIHYAKEFFGENHTIFMKVEKK-AYLSALGIAENIVVTCDSSS  206
            +    L++  S RTP                I    E    Y + L  A+ I+VT DS++
Sbjct  315  QEGGSLLMTFSRRTPDQAKALLTARLRHLPGIIWDGEGPNPYFAFLAAADYILVTEDSTN  374

Query  207  MISEAALTGKPIYVANILPRKNDIRFQRFRNLFRELKIIRNLGEEVENWNYEKLDETNRV  266
            M +EAA TGKP+++  +      ++F+ F      +   R  G     W YE +DET R 
Sbjct  375  MATEAASTGKPVFILKM--DGQSLKFRLFHQELESMGAARPYGGAFHGWTYEPVDETGRA  432

Query  267  AGIIKNKI  274
            A  +  ++
Sbjct  433  AAEVVARM  440


>ref|YP_759371.1| Gene info hypothetical protein HNE_0642 [Hyphomonas neptunium ATCC 15444]
 gb|ABI77624.1| Gene info conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
Length=354

 GENE ID: 4290159 HNE_0642 | hypothetical protein
[Hyphomonas neptunium ATCC 15444] (10 or fewer PubMed links)

 Score =  114 bits (285),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 68/272 (25%), Positives = 130/272 (47%), Gaps = 7/272 (2%)

Query  7    IPPKLTPISQNIYKKIISDEFDVIISCGRKSVIPSIHLKKTSNKKLFNIHIQDPKVNLNH  66
            +P  L  + +     +++    V I  GR+S   + + +  S  +   + I DP V  ++
Sbjct  67   LPSPLQALPKAQRPSLVAPWPTVWIGAGRRSASLTRYARAASGGQTLTVQILDPHVAPSN  126

Query  67   FDFIVAPEHDDLDGQNVITTKGAIHYLTQSEIEENRNYLNSFIKNDGRKIWTLIMGGPTK  126
            FD +V PEHD + G NVI T G+  Y +   +EE        + ++ R    +++GG ++
Sbjct  127  FDLLVVPEHDAVTGPNVIRTVGSPAYFSPEALEEAAQAFAG-LADETRNSAIVVLGGDSR  185

Query  127  YYDYSTKNMKHIFNILYKLIKKHDFQLVVIPSMRTPINTIHYAKEFFGENHTIFMKVEKK  186
             + ++      +   + +L   + ++L +  S RTP+      ++  G+    F    + 
Sbjct  186  VHTFTQAAADRLEGQMREL-ASYGWRLRLTASRRTPVPIAARFRQMAGDIGAAFWAGPQD  244

Query  187  A---YLSALGIAENIVVTCDSSSMISEAALTGKPIYVANILPRKNDIRFQRFRNLFRELK  243
                YL+ L  +   +VT DS++M+SEAA  G P+++A +  R +  +F R  +   +  
Sbjct  245  GPNPYLAWLLFSNAALVTEDSANMLSEAAWHGLPVHIAKLEGRAD--KFDRLHDSLIQRG  302

Query  244  IIRNLGEEVENWNYEKLDETNRVAGIIKNKIF  275
            + R     ++ W+YE L E  RVA II  ++ 
Sbjct  303  VARWFTGSLDQWSYEPLREAERVADIIVERLL  334

ANALYSES DES RESULTATS:

BLAST contre swissprot: On trouve une séquence homologue dont le E-value est correct (7.10'-10). Les autres séquences 
trouvées sont des faux positifs car leur E-value reste élevé (de 3.1 à 8.8)

Blast contre NR: Beaucoup plus de séquences homologues ont été trouvées avec des E-value trés
significatifs (environ 80 avec un E-value < à 10'-10). Les résultats indiquent des régions bien conservées entre nos séquences
On a de nombreuses substitutions conservatrices et quelques identités absolues.On utilisera ces séquences pour l'alignement multiple
et la construction de l'arbre phylogénétique.

ORF finding

PROTOCOLE:
1)SMS ORF finder "Any codon", cadres 1,2,3 sens direct ; 60 codons min; code gén. bactérien;
2)SMS ORFfinder "Any codon", cadres 1,2,3 sens indirect ; 60 codons min; code gén. bactérien
---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

Dans le sens direct de lecture, seulement un ORF a été trouvé dans le cadre de lecture 3. Dans le
sens indirect, aucun ORF n'a été mis en évidence. Pour la suite des analyses on utilisera donc le 
seul ORF trouvé. On peut qualifier cet ORF de codant car il contient plus de 60 codons allant du 
nucléotide 3 au nucléotide 833 (incluant le codon stop). C'est à dire qu'il comporte 830 nucléotides.
On remarque qu'il n'ya pas de codon start, l'extrémité 5' est incomplète.
Donc on ne peut pas calculer la masse moléculaire de la séquence protéique.




---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:
1)
>ORF number 1 in reading frame 3 on the direct strand extends from base 3 to base 833.

AAAAGTTTTTGGAAAGCGATTCCTCCAAAGCTAACTCCTATTTCTCAAAATATTTATAAA
AAAATTATTTCTGATGAATTTGATGTAATTATATCTTGTGGGAGAAAAAGTGTAATACCT
TCAATTCATTTAAAAAAAACTTCAAATAAAAAATTATTTAATATTCACATTCAAGATCCA
AAAGTAAATTTAAATCATTTTGATTTTATTGTTGCTCCAGAACATGACGATTTAGATGGT
CAAAACGTAATTACAACAAAAGGTGCTATTCATTATCTTACACAAAGTGAAATTGAGGAG
AATAGAAATTATTTAAATTCGTTTATTAAAAATGATGGAAGAAAAATTTGGACTTTAATT
ATGGGTGGACCAACTAAGTATTACGATTATTCAACTAAGAATATGAAACATATTTTTAAT
ATTCTATATAAATTGATAAAAAAACACGACTTTCAATTAGTAGTAATTCCTTCAATGAGA
ACTCCAATCAATACTATTCATTATGCTAAAGAATTTTTTGGCGAAAATCATACTATTTTT
ATGAAGGTTGAAAAAAAAGCATATTTATCAGCCCTTGGAATTGCAGAAAATATAGTAGTA
ACTTGCGATTCAAGTTCTATGATTTCAGAAGCAGCTTTAACAGGTAAACCAATTTACGTA
GCAAATATTTTACCAAGAAAAAATGATATTAGATTTCAAAGATTTAGAAATTTATTTAGA
GAACTAAAAATTATAAGAAATCTAGGTGAAGAAGTGGAAAATTGGAACTATGAAAAGCTA
GATGAAACTAATAGAGTAGCAGGAATTATAAAAAACAAAATTTTTTCATAA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
KSFWKAIPPKLTPISQNIYKKIISDEFDVIISCGRKSVIPSIHLKKTSNKKLFNIHIQDP
KVNLNHFDFIVAPEHDDLDGQNVITTKGAIHYLTQSEIEENRNYLNSFIKNDGRKIWTLI
MGGPTKYYDYSTKNMKHIFNILYKLIKKHDFQLVVIPSMRTPINTIHYAKEFFGENHTIF
MKVEKKAYLSALGIAENIVVTCDSSSMISEAALTGKPIYVANILPRKNDIRFQRFRNLFR
ELKIIRNLGEEVENWNYEKLDETNRVAGIIKNKIFS*

2)

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.



---------------------------------------------------------------------------------------------------