GOS 670030

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1092351624749
Annotathon code: GOS_670030
Sample :
  • GPS :1°23'21n; 91°49'1w
  • Galapagos Islands: Wolf Island - Ecuador
  • Coastal (-1.7m, 21.8°C, 0.1-0.8 microns)
Authors
Team : BioCell2008
Username : ci_co
Annotated on : 2009-02-07 12:02:03
  • Llopis Cindy
  • Meï Coline

Synopsis

  • Taxonomy: Alphaproteobacteria (NCBI info)
    Rank: class - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 28211
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order:
    Bacteria; Proteobacteria; Alphaproteobacteria;

Genomic Sequence

>JCVI_READ_1092351624749 GOS_670030 genomic DNA
GGAGGTAGATTGGGTTCTTTTCTTAGAGAGCCTCTCTCAAAAATTTGCAATCAACTGGTTTCAACCGACATAAAAAAACATATTGGAAAACTCAATGAAA
ATGAAACCTATATCTCGGCTGATCTATCAAACTTTGATCAAATATATGAAATAACAAAAGATGTGTCACTCATCTGCCATTTTGGAGCTTTAGTAGATGA
GGTGCCCTTCAATGATATGCTTGGTGCAAATTTTATTGGCTCATATAACATATGGGAGGCAGCGCGTCTGAATAACTGTAAGAGAGTAGTTTACTCAAGT
TCAATACATGCAGTTGGAATGTATAAAAGAACAAAGACATTGAGACCAAAGACTGCTCATAGAGCTGATGGTTTTTATGGACTATCAAAGTGTTTTACCG
AAAATTTAGCACGTATGTATTATGATAAATGTGGTATTGAAGCGGTATGCCTGCGAATTGCGACTTGTTCACCTGTTACTACACTAAGAAGTTTAACAAG
TTGGCTTTCATATGACGATTTAGTTCAATTGGTTATGAGAGCAATTGATACCGCACATACCGGTTACTCAGTTGTTTATGGAGTATCTGACAATGATCGC
TCTAATATGAGCAACACAGACTCAGGGCATCTTGGATTCCAGCCTAAGGATAATGCTGAAATTTACGCTGGTAAAATTTTTTCTGAAGACTTAACCGAGG
AATTGGCAGACGAAGGAAATAAACTGCATGGTGGGCCTTTCGCATCAACTGATCTAGGAGTTAGTGCGATGGATAAAATGAAAATAGTTTATTCGCATAA
AGGAGATTAGCCAGATGAAAGATGATAATATGCTTCGAGGGGGGCAACTTTTAGCGACGTCTTTCAAAGAAAAAGGGATAGAGCATGTATTTACACTGGC
GGGTGGTTTTTGTAACCCAGCACTTGAGGGTTTTATGACC

Translation

[1 - 807/940]   direct strand
>GOS_670030 Translation [1-807   direct strand]
GGRLGSFLREPLSKICNQLVSTDIKKHIGKLNENETYISADLSNFDQIYEITKDVSLICHFGALVDEVPFNDMLGANFIGSYNIWEAARLNNCKRVVYSS
SIHAVGMYKRTKTLRPKTAHRADGFYGLSKCFTENLARMYYDKCGIEAVCLRIATCSPVTTLRSLTSWLSYDDLVQLVMRAIDTAHTGYSVVYGVSDNDR
SNMSNTDSGHLGFQPKDNAEIYAGKIFSEDLTEELADEGNKLHGGPFASTDLGVSAMDKMKIVYSHKGD

[ Warning ] 5' incomplete: does not start with a Methionine

Phylogeny

PROTOCOLE:

Site: phylogénie.fr, les paramètres sont par défaut. 


a) arbre avec la méthode de parcimonie (cocher la case ProtPars/DnaPars). On fait un arbre raciné
avec l'euryarchae: HaloquadratumWalsbyi (faisant parti de notre groupe extérieur).

a') arbre avec la méthode NJ (cocher la case ProtDist/DnaDist-Neighbor). On fait un arbre raciné 
avec l'euryarchae: HaloquadratumWalsbyi . 
 
b) arbre avec la méthode de parcimonie (cocher la case ProtPars/DnaPars). On fait un arbre raciné
avec l'euryarchae: HaloquadratumWalsbyi (faisant parti de notre groupe extérieur). (Même méthodologie qu'en a).

b') arbre avec la méthode NJ (cocher la case ProtDist/DnaDist-Neighbor). On fait un arbre raciné 
avec l'euryarchae: HaloquadratumWalsbyi . (Même méthodologie qu'en a').

c) arbre avec la méthode phyML. 
---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

a) Selon la méthode de parcimonie, notre séquence se retrouve nichée au coeur des alpha-protéo
bactéries. 
Résultat étrange pour la cynaobactérie "cyanothece" qui se retrouve à côté des Gram -

a') Quand nous faisons un arbre phylogénique en utilisant la méthode NJ, notre séquence, bien 
qu'étant proche des alpha-protéobactéries, n'est pas à l'intérieur de l'embranchement. 

b) Nous refaisons donc un arbre avec un plus grand nombre d'alphaprotéobactéries pour voir si cela 
suffit pour retrouver notre séquence dans cet embranchement. 
Avec la méthode de parcimonie, notre séquence est toujours nichée au coeur des alphaprotéobactéries. 

b') Pour la méthode NJ, bien qu'on ait rajouté de nombreuses séquences d'alphaprotéobactéries, notre
séquence est plutôt située à l'extérieur du groupe. Tout de même, elle se situe entre Rhizobium et 
Loktanella vestfoldensis (deux alphaprotéobactéries).

c) Nous refaisons un arbre avec la méthode phyML pour pouvoir départager les abres b) et b'). 

On peut donc dire que notre séquence est plutôt apparentée aux alphaprotéobactéries. Les différents arbres 
semblent congruents, malgrès quelques différences. Elles sont notamment dues aux changements de méthode
utilisées pour faire des arbres, parcimonie et NJ ne réagissant pas de la même manière. Dans le cas de notre 
séquence, les changements sont minimes, mais il peut arriver dans certains cas qu'une de ces deux méthodes
se révèle inefficace. Ici dans l'ensemble, à part une anomalie pour la cyanobactérie "cyanothece" qui se
retrouve à côté des Gram - (voir abre a), les arbres respectent la phylogénie de référence.

 
---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:


a)méthode par parcimonie


 
 +-----------------------------------------------------HaloquadratumWalsbyi    [euryarchaeotes] 
  |  
 17  +--------------------------------------------------HalobacteriumSalinarum    [euryarchaeotes] 
  |  |  
  +-16  +-----------------------------------------------HalorubrumLacusprofundi    [euryarchaeotes] 
     |  |  
     |  |                                            +--Cyanothece    [cyanobacteria]
     +-15  +----------------------------------------18  
        |  |                                         +--ArthrobacterChlorophenolicus   [high GC Gram+] 
        |  |  
        |  |                                         +--StreptomycesGriseus    [high GC Gram+]
        +-14     +-----------------------------------9  
           |     |                                   +--StreptomycesCoelicolor     [high GC Gram+]
           |     |  
           |     |                             +--------Jannaschia     [a-proteobacteria]
           +-----8                             |  
                 |     +----------------------12     +--SEQincconue    
                 |     |                       |  +-13  
                 |     |                       +-11  +--Rhodobacterales     [a-proteobacteria]
                 |     |                          |  
                 +----10                          +-----Sulfitobacter     [a-proteobacteria]
                       |  
                       |           +--------------------XanthobacterAutotrophicus    [a-proteobacteria]  
                       |           |  
                       |           |              +-----BurkholderiaDolosa     [b-proteobacteria]
                       +-----------7  +-----------6  
                                   |  |           |  +--Burkholderia     [b-proteobacteria]
                                   |  |           +--5  
                                   +--4              +--BurkholderiaGraminis     [b-proteobacteria]
                                      |  
                                      |        +--------LeptothrixCholodnii     [b-proteobacteria]
                                      +--------3  
                                               |  +-----Burkholderia2     [b-proteobacteria]
                                               +--2  
                                                  |  +--PseudomonasPutida      [g-proteobacteria]
                                                  +--1  
                                                     +--PseudomonasMendocina  [g-proteobacteria]

---------------------------------------------------------------------------------------------------

a') méthode NJ neighbor

       +--HalobacteriumSalinarum     [euryarchaeotes] 
    ! 
    !               +----------------Cyanothece    
    !               ! 
    !               !                            +-----Sulfitobacter    [a-proteobacteria]  
    !               !                          +-5 
    !               !                        +-6 +----Rhodobacterales    [a-proteobacteria]  
  +-2               !                        ! ! 
  ! !               !             +----------7 +-------Jannaschia    [a-proteobacteria]  
  ! !               !             !          ! 
  ! !               !             !          +-------------SEQincconue    
  ! !               !             !  
  ! !               !             !               +---PseudomonasMendocina     [g-proteobacteria]
  ! !               !             !            +-13  
  ! +---------------4          +-12         +-14  +---PseudomonasPutida     [g-proteobacteria]
  !                 !          !  !         !  !  
  !                 !          !  !      +-15  +--------Burkholderia2     [b-proteobacteria]
  !                 !          !  !      !  !  
  !                 !          !  !   +-16  +--------LeptothrixCholodnii     [b-proteobacteria]
  !                 !          !  !   !  !  
  !                 !          !  !   !  +-------------XanthobacterAutotrophicus     [a-proteobacteria]  
  !                 !       +-11  +--17  
  !                 !       !  !      !         +-BurkholderiaGraminis [b-proteobacteria]    
  !                 !       !  !      !       +-8 
  !                 !       !  !      +-------9 +-Burkholderia     [b-proteobacteria]
  !                 !       !  !              ! 
  !                 +------10  !              +--BurkholderiaDolosa     [b-proteobacteria]
  !                         !  !  
  !                         !  !        +--StreptomycesCoelicolor  [high GC Gram+]    
  !                         !  +--------3 
  !                         !           +---StreptomycesGriseus    [high GC Gram+] 
  !                         !  
  !                         +---------------------------ArthrobacterChlorophenolicus    [high GC Gram+] 
  ! 
  1--------HalorubrumLacusprofundi    [euryarchaeotes]  
  ! 
  +-----HaloquadratumWalsbyi     [euryarchaeotes] 


---------------------------------------------------------------------------------------------------

b) méthode par parcimonie. 



  +-----------------------------------------------------------------------------HaloquadratumWalsbyi    [euryarchaeotes]
  |  
  |  +--------------------------------------------------------------------------HalobacteriumSalinarum    [euryarchaeotes]
  |  |  
  |  |  +-----------------------------------------------------------------------HalorubrumLacusprofundi    [euryarchaeotes]
 25  |  |  
  |  |  |                                            +--------------------------MethylobacteriumRadiotolerans    [a-proteobacteria]

  |  |  |                                            |  
  |  |  |        +----------------------------------20  +-----------------------BradyrhizobiumJaponicum    [a-proteobacteria]

  |  |  |        |                                   |  |  
  +-24  |        |                                   +-22  +--------------------Jannaschia    [a-proteobacteria]

     |  |        |                                      |  |  
     |  |        |                                      +-16  +-----------------OctadecabacterAntarcticus    [a-proteobacteria]

     |  |        |                                         |  |  
     |  |        |                                         +-18  +--------------RoseobacterDenitrificans    [a-proteobacteria]

     |  |        |                                            |  |  
     |  |        |                                            +-14  +-----------OceanibulbusIndolifex    [a-proteobacteria]

     |  |        |                                               |  |  
     |  |        |                                               +-13     +-----LoktanellaVestfoldensis    [a-proteobacteria]

     +-23        |                                                  |  +-17  
        |  +----12                                                  |  |  |  +--SEQincconue    
        |  |     |                                                  +-15  +-19  
        |  |     |                                                     |     +--Rhodobacterales    [a-proteobacteria]

        |  |     |                                                     |  
        |  |     |                                                     +--------Sulfitobacter    [a-proteobacteria]

        |  |     |  
        |  |     |                                                        +-----Rhizobium    [a-proteobacteria]

        |  |     |                             +-------------------------11  
        |  |     |                             |                          |  +--SinorhizobiumMedicae    [a-proteobacteria]

        |  |     |                             |                          +-10  
        |  |     |                             |                             +--XanthobacterAutotrophicus    [a-proteobacteria]

        |  |     |                             |  
        |  |     |                             |                          +-----BurkholderiaDolosa      [b-proteobacteria]
        |  |     +-----------------------------9                 +--------8  
        |  |                                   |                 |        |  +--Burkholderia      [b-proteobacteria]
        +--2                                   |                 |        +--7  
           |                                   |        +--------6           +--BurkholderiaGraminis      [b-proteobacteria]
           |                                   |        |        |  
           |                                   |        |        |           +--Cyanothece    [cyanobacteria]
           |                                   |        |        |        +-26  
           |                                   +--------4        +-------21  +--ArthrobacterChlorophenolicus    [high GC Gram+]
           |                                            |                 |  
           |                                            |                 +-----Burkholderia2      [b-proteobacteria]
           |                                            |  
           |                                            |                 +-----LeptothrixCholodnii    [b-proteobacteria] 
           |                                            +-----------------5  
           |                                                              |  +--PseudomonasPutida     [g-proteobacteria]           |                                                              +--3  
           |                                                                 +--PseudomonasMendocina     [g-proteobacteria]
           |  
           |                                                                 +--StreptomycesGriseus     [high GC Gram+]
           +-----------------------------------------------------------------1  
                                                                             +--StreptomycesCoelicolor  [high GC Gram+]  


---------------------------------------------------------------------------------------------------

b') méthode NJ (neighbor). 



      +--HalobacteriumSalinarum    [euryarchaeotes]

    ! 
    !               +----------------Cyanothece    [cyanobacteria]
    !               ! 
    !               !                                        +-Sulfitobacter    [a-proteobacteria]

    !               !                                      +-4 
    !               !                                  +---5 +--OceanibulbusIndolifex   [a-proteobacteria]
 
    !               !                                  !   ! 
    !               !                                +-9   +--RoseobacterDenitrificans   [a-proteobacteria]
 
    !               !                                ! ! 
  +-2               !                             +-10 +------Jannaschia    [a-proteobacteria]

  ! !               !                             !  !  
  ! !               !                          +-11  +-----Rhodobacterales    [a-proteobacteria]

  ! !               !                          !  !  
  ! !               !                       +-12  +-----------OctadecabacterAntarcticus    [a-proteobacteria]

  ! !               !                       !  !  
  ! !               !              +-------13  +--------LoktanellaVestfoldensis    [a-proteobacteria]

  ! !               !              !        !  
  ! !               !              !        +--------------SEQincconue    
  ! !               !           +-18  
  ! !               !           !  !  +------------Rhizobium    [a-proteobacteria]

  ! +---------------6           !  !  !  
  !                 !           !  !  !  +---------------------MethylobacteriumRadiotolerans    [a-proteobacteria]

  !                 !           !  +-19  !  
  !                 !           !     !  !           +---PseudomonasMendocina   [g-proteobacteria]  
  !                 !           !     !  !        +-14  
  !                 !           !     !  !     +-22  +---PseudomonasPutida     [g-proteobacteria]
  !                 !           !     +-21     !  !  
  !                 !           !        !  +-23  +--------Burkholderia2     [b-proteobacteria]
  !                 !           !        !  !  !  
  !                 !           !        !  !  +---------LeptothrixCholodnii     [b-proteobacteria]
  !                 !           !        !  !  
  !                 !        +-17        +-24             +--BurkholderiaGraminis    [b-proteobacteria] 
  !                 !        !  !           !           +-7 
  !                 !        !  !           !  +--------8 +-Burkholderia     [b-proteobacteria]
  !                 !        !  !           !  !        ! 
  !                 !        !  !           +-25        +--BurkholderiaDolosa     [b-proteobacteria]
  !                 !        !  !              !  
  !                 !        !  !              !  +------------XanthobacterAutotrophicus   [a-proteobacteria] 
  !                 !        !  !              +-20  
  !                 +-------16  !                 +-----------SinorhizobiumMedicae    [a-proteobacteria]
  !                          !  !  
  !                          !  !            +--StreptomycesCoelicolor     [high GC Gram+]
  !                          !  !  +---------3 
  !                          !  +-15         +--StreptomycesGriseus     [high GC Gram+]
  !                          !     !  
  !                          !     +---------------------------ArthrobacterChlorophenolicus    [high GC Gram+]
  !                          !  
  !                          +------------------BradyrhizobiumJaponicum    [a-proteobacteria]

  ! 
  1---------HalorubrumLacusprofundi    [euryarchaeotes]

  ! 
  +----HaloquadratumWalsbyi    [euryarchaeotes]

----------------------------------------------------------------------------------------------------------------------

   c) arbre avec la méthode phyML:


                                                                                                     ------0.2----
 
                                                                    +-----------------HaloquadratumWalsbyi   [euryarchaeotes]
                                                              +-----+
                                                              |     +-----------HalobacteriumSalinarum     [euryarchaeotes]
                         +------------------------------------+
   +---------------------+                                    +------HalorubrumLacusprofundi      [euryarchaeotes]
   |                     |
 +-+                     +-----------------------------------Cyanothece       [cyanobacteria]
 | |
 | +-------------------------------------------------------------ArthrobacterChlorophenolicus     [high GC Gram+]
 |
 |
 |         +-------------------------------BradyrhizobiumJaponicum          [a-proteobacteria]

 |         |
 |         |                                                +-----------------------------SEQincconue
 |         |                                                |
 |         |                                                |             +-----Sulfitobacter     [a-proteobacteria]
 |         |                                                |           +-+
 |         |                                                |         +-+ +---OceanibulbusIndolifex    [a-proteobacteria]
 |         |                                           +----+         | |
 |         |                                           |    |       +-+ +------RoseobacterDenitrificans    [a-proteobacteria]
 |         |                                           |    |       | |
 |         |                                           |    |   +---+ +----------------Jannaschia     [a-proteobacteria]
 +---------+                                           |    |   |   |
           |                  +------------------------+    +---+   +--------------------------OctadecabacterAntarcticus    [a-proteobacteria]
           |                  |                        |        |
           |                  |                        |        +------Rhodobacterales      [a-proteobacteria]
           |              +---+                        |
           |              |   |                        |
           |              |   |                        +------------LoktanellaVestfoldensis         [a-proteobacteria]
           |              |   |
           |              |   +-----------------------------Rhizobium    [a-proteobacteria]
           |              |
           |              |           +-----------------------------------------------MethylobacteriumRadiotolerans     [a-proteobacteria]
           +--------------+     +-----+
                          |     |     |                        +-----StreptomycesCoelicolor     [high GC Gram+]
                          |     |     +------------------------+
                          |     |                              +--------StreptomycesGriseus      [high GC Gram+]
                          |     |
                          |     |            +----------------------LeptothrixCholodnii      [b-proteobacteria]
                          |     |          +-+
                          +-----+          | +----------------Burkholderia2         [b-proteobacteria]
                                |     +----+
                                |     |    |     +-------PseudomonasMendocina       [g-proteobacteria]
                                |     |    +-----+
                                |     |          +--------PseudomonasPutida          [g-proteobacteria]
                                |     |
                                +-----+
                                      |         +------------------------------XanthobacterAutotrophicus    [a-proteobacteria]
                                      |    +----+
                                      |    |    +------------------------SinorhizobiumMedicae       [a-proteobacteria]
                                      |    |
                                      +----+                        +------BurkholderiaDolosa        [b-proteobacteria]
                                           |                     +--+
                                           +---------------------+  +---Burkholderia     [b-proteobacteria]
                                                                 |
                                                                 +-BurkholderiaGraminis   [b-proteobacteria]


-------------------------------------------------------------------------------------------------------------

Annotator commentaries

Nous avons obtenu des ORF dans le sens direct et indirect. Nous avons choisi de sélectionner l'ORF numéro 1 dans le sens de lecture direct, car il semble être le meilleur candidat (ORF le plus long). Cet ORF est incomplet en 5': on ne connait pas le codon start, contrairement au codon stop( position 810). Ainsi nous ne pouvons pas calculer le poids moléculaire (séquence incomplète).

Le BLASTp contre nr nous donne beaucoup de résultats. Nous avons poursuivi l'analyse en comparant notre séquence contre swissprot (fiches mieux remplies). Avec swissprot,nous obtenons moins de résultats qu'avec nr, car swissprot est plutôt une banque de séquences eucaryotes. Les séquences trouvées à partir du BLASTp ont des E-value très faibles ( 2e-86 pour le meilleur résultat: ref|ZP_00963177.1|). Les identitées et les substitutions positives sont nombreuses ( respectivement 56% et 73% pour le premier : ref|ZP_00963177.1|). Nous concluons que ces séquences sont sûrement homologues à celle étudiée. Nous les utilisons donc pour nos recherches d'alignements multiples. De plus, ces BLAST nous permettent d'avoir un premier aperçu de la fonction de notre protéine: la plupart des séquences homologues sont des: "NAD-dependent epimerase/dehydratase".

La recherche de domaines protéiques confirme ce résultat: notre protéine correspondrait à un processus "NAD(P)-binding Rossmann-fold domains".

Le rapport taxonomique issu du BLAST est très fourni: nombreux embranchements de bactéries et d'archae. Les scores les plus importants sont pour les alphaprotéobactéries (322), mais les autres bactéries ont aussi un score élevé. Les archae ont un score moins important quoique non négligeable: on s'en sert comme groupe extérieur pour fabriquer nos arbres.

Pour le 1er alignement multiple, nous comparons notre séquence à celles de bactéries et des archae (groupe extérieur). Il existe un bon alignement en 3' des séquences.

Les arbres faits avec la méthode de parcimonie donnent notre séquence au coeur des alphaprotéo, au contraire de la méthode NJ. On refait donc un arbre (méthode NJ) avec plus d'alphaprotéo: notre séquence fait partie de cet embranchement (bien qu'excentrée). Pour trancher avec certitude sur la provenance de notre séquence nous avons complété l'analyse phylogénétique par un arbre avec la méthode PHYML. Le résultat trouvé confirme nos dires, notre séquence se niche dans les alphaprotéo. L'ensemble des arbres se recoupe, on peut dire qu'il y a congruence.

Pour la recherche de fonction moléculaire, nous avons regardé la fonction des domaines protéiques trouvé; il s'agit de "NAD DEPENDENT EPIMERASE/DEHYDRATASE". Nous avons regardé les fonctions des premiers homologues (fiches PubMed) trouvés avec le BLAST, il s'agit majoritairement de "3-beta hydroxysteroid dehydrogenase/isomerase" ou de "Nucleoside-diphosphate-sugar epimerases". Grâce à ses informations et à celles trouvées sur "PATRIC": PathoSystems Resource Intergration Center, nous avons choisi comme fonction moléculaire "enzyme régulator activity", car c'est celle qui se rapproche le plus de notre co-enzyme (qui se trouve dans la voie de dégradation du glucose). Pour le processus biologique, nous avons choisi "generation or precursor metabolites and energy", puisque le glucose est une des sources de carbone principale de la plupart des bactéries.

Multiple Alignement

PROTOCOLE:

a) Après avoir sélectionné les séquences homologues à notre séquence d'interêt, dans le rapport 
taxonomique, les ayant mises au format FASTA et renommées, nous les avons mises dans le logiciel
clustalW du site EBI, avec les paramètres par défaut. 

b) Même protocole que précedemment. 


---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

a) On sélectionne les séquences du BLAST ayant une E-value supérieure à 2e-19 (score de 100). 
Pour notre groupe d'étude, nous avons choisi les "bactéries". Ainsi nous avons pris plusieurs 
familles de bactéries: protéobactéries, bactéries à GRAM +, cyanobactéries, firmicutes. 
Pour notre groupe extérieur, nous avons pris des euryarchae. 
Les résultats de l'alignement multiple confirment ceux trouvés précedemment: notre séquence 
d'interêt est incomplète en 5'. Puis nous avons un bon alignement en 3'.
A partir de cet alignement, on obtient deux arbres (a et a'), qui nous permettent d'affirmer que notre 
séquence se trouve chez les bactéries, mais un doute persiste quand à l'embranchement exact. Il semblerait que notre
séquence se niche dans les alphaprotéobactéries.


b) Comme il existe un doute quand à la nature de l'embranchement dans lequel se niche notre séquence, nous 
refaisons un alignement multiple, cette fois-ci avec un plus grand nombre d'alphaprotéobactéries. 
Comme pour précédemment, les alignements sont corrects.
Cet alignement multiple est utilisé comme matrice pour fabriquer l'arbre b).

L'alignement multiple peut nous aider pour trouver le nombre d'acides aminés manquant dans notre séquence.
En effet, si tous les homologues sont de même environ de même longueur, il y a des chances que leur acide 
aminé de départ (souvent une méthionine) s'aligne plus ou moins. Dans ce cas là, on peux dire que c'est le 
start et dire quel est environ la taille de notre séquence. Cependant, ce n'est pas le cas pour notre séquence!
Toutes les séquences ont des tailles différentes et il n'y a pas de méthionine coincidantes entre la plupart 
des homologues. On peut ainsi penser que notre séquence n'est pas complète en 5'. Il nous manque ainsi des acides 
aminés, mais nous ne pouvons pas donner plus d'indications sur la taille de notre séquence.  
 
---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:

a)

CLUSTAL 2.0.10 multiple sequence alignment


PseudomonasMendocina              --------------------------------------------------
PseudomonasPutida                 --------------------------------------------------
Burkholderia2                     --------------------------------------------------
LeptothrixCholodnii               --------------------------------------------------
BurkholderiaGraminis              --------------------------------------------------
Burkholderia                      --------------------------------------------------
BurkholderiaDolosa                --------------------------------------------------
XanthobacterAutotrophicus         --------------------------------------------------
StreptomycesCoelicolor            --------------------------------------------------
StreptomycesGriseus               --------------------------------------------------
Sulfitobacter                     --------------------------------------------------
Rhodobacterales                   --------------------------------------------------
Jannaschia                        --------------------------------------------------
SEQincconue                       --------------------------------------------------
ArthrobacterChlorophenolicus      --------------------------------------------------
HalorubrumLacusprofundi           --------------------------------------------------
HalobacteriumSalinarum            --------------------------------------------------
HaloquadratumWalsbyi              --------------------------------------------------
Cyanothece                        MLSYAQTILQLLQQLEQLGYSQADKIYIHNAYQFLTKRVVCHYRPSGKTM 50
                                                                                    

PseudomonasMendocina              --------------------------------------------------
PseudomonasPutida                 --------------------------------------------------
Burkholderia2                     --------------------------------------------------
LeptothrixCholodnii               --------------------------------------------------
BurkholderiaGraminis              --------------------------------------------------
Burkholderia                      --------------------------------------------------
BurkholderiaDolosa                --------------------------------------------------
XanthobacterAutotrophicus         --------------------------------------------------
StreptomycesCoelicolor            --------------------------------------------------
StreptomycesGriseus               --------------------------------------------------
Sulfitobacter                     --------------------------------------------------
Rhodobacterales                   --------------------------------------------------
Jannaschia                        --------------------------------------------------
SEQincconue                       --------------------------------------------------
ArthrobacterChlorophenolicus      --------------------------------------------------
HalorubrumLacusprofundi           --------------------------------------------------
HalobacteriumSalinarum            --------------------------------------------------
HaloquadratumWalsbyi              --------------------------------------------------
Cyanothece                        IAHAIGTASILASLKTTKEVIAAGMLHVIYPYGDFGDGTSGISLKKQQQT 100
                                                                                    

PseudomonasMendocina              --------------------------------------------------
PseudomonasPutida                 --------------------------------------------------
Burkholderia2                     --------------------------------------------------
LeptothrixCholodnii               --------------------------------------------------
BurkholderiaGraminis              --------------------------------------------------
Burkholderia                      --------------------------------------------------
BurkholderiaDolosa                --------------------------------------------------
XanthobacterAutotrophicus         --------------------------------------------------
StreptomycesCoelicolor            --------------------------------------------------
StreptomycesGriseus               --------------------------------------------------
Sulfitobacter                     --------------------------------------------------
Rhodobacterales                   --------------------------------------------------
Jannaschia                        --------------------------------------------------
SEQincconue                       --------------------------------------------------
ArthrobacterChlorophenolicus      --------------------------------------------------
HalorubrumLacusprofundi           --------------------------------------------------
HalobacteriumSalinarum            --------------------------------------------------
HaloquadratumWalsbyi              --------------------------------------------------
Cyanothece                        IAVIGKQAEEYVRQYTQFIWTWENLPKLQQRIPIMTPTERNVLLIRLANE 150
                                                                                    

PseudomonasMendocina              --------------------------------------------------
PseudomonasPutida                 --------------------------------------------------
Burkholderia2                     --------------------------------------------------
LeptothrixCholodnii               --------------------------------------------------
BurkholderiaGraminis              --------------------------------------------------
Burkholderia                      --------------------------------------------------
BurkholderiaDolosa                --------------------------------------------------
XanthobacterAutotrophicus         --------------------------------------------------
StreptomycesCoelicolor            --------------------------------------------------
StreptomycesGriseus               --------------------------------------------------
Sulfitobacter                     --------------------------------------------------
Rhodobacterales                   --------------------------------------------------
Jannaschia                        --------------------------------------------------
SEQincconue                       --------------------------------------------------
ArthrobacterChlorophenolicus      --------------------------------------------------
HalorubrumLacusprofundi           --------------------------------------------------
HalobacteriumSalinarum            --------------------------------------------------
HaloquadratumWalsbyi              --------------------------------------------------
Cyanothece                        LEDNLDLGILYCSNAEVRQKGNKLVGHLMVELASALGFPTLADQLSTAFQ 200
                                                                                    

PseudomonasMendocina              --------------------------------------------------
PseudomonasPutida                 --------------------------------------------------
Burkholderia2                     --------------------------------------------------
LeptothrixCholodnii               --------------------------------------------------
BurkholderiaGraminis              --------------------------------------------------
Burkholderia                      --------------------------------------------------
BurkholderiaDolosa                --------------------------------------------------
XanthobacterAutotrophicus         --------------------------------------------------
StreptomycesCoelicolor            --------------------------------------------------
StreptomycesGriseus               --------------------------------------------------
Sulfitobacter                     --------------------------------------------------
Rhodobacterales                   --------------------------------------------------
Jannaschia                        --------------------------------------------------
SEQincconue                       --------------------------------------------------
ArthrobacterChlorophenolicus      ------------------------------------------MGCPSSFA 8
HalorubrumLacusprofundi           --------------------------------------------------
HalobacteriumSalinarum            --------------------------------------------------
HaloquadratumWalsbyi              --------------------------------------------------
Cyanothece                        ASLETRIFREFCHPGFGPVDFAIAPQSYLLKPTIKFHRTLVGVRQATIHS 250
                                                                                    

PseudomonasMendocina              ------------------------------------------------MT 2
PseudomonasPutida                 ------------------------------------------------MT 2
Burkholderia2                     ----------------------------------------------MIMT 4
LeptothrixCholodnii               ------------------------------------------------MP 2
BurkholderiaGraminis              ------------------------------------------------MS 2
Burkholderia                      ------------------------------------------------MS 2
BurkholderiaDolosa                ------------------------------------------------MN 2
XanthobacterAutotrophicus         --------------------------------------------------
StreptomycesCoelicolor            --------------------------------------------------
StreptomycesGriseus               --------------------------------------------------
Sulfitobacter                     --------------------------------------------------
Rhodobacterales                   --------------------------------------------------
Jannaschia                        --------------------------------------------------
SEQincconue                       --------------------------------------------------
ArthrobacterChlorophenolicus      AGVALPLAHPVSSAADATVRATAVRERVINFESTLILLFTYMNACYYVKR 58
HalorubrumLacusprofundi           --------------------------------------------------
HalobacteriumSalinarum            --------------------------------------------------
HaloquadratumWalsbyi              --------------------------------------------------
Cyanothece                        ISKTKQKLRSWVLRAKQKVKRTVRSLIPDQTLSVEKQHSPHPTAQTKLEP 300
                                                                                    

PseudomonasMendocina              TTPSE---------------LRPFNRLLLTGAAGGLGKVLRQRLRPYANV 37
PseudomonasPutida                 TTP--------------------FNRLLLTGAAGGLGKVLRERLKGYAEV 32
Burkholderia2                     DLQHSNQDANAAGDDPLDGVVTHCGRILLTGAAGNLGRVLRERLRRYADV 54
LeptothrixCholodnii               SHPTP----------------LRFDRLLLTGAAGGLGRELRTRLKAYCDV 36
BurkholderiaGraminis              QTISESSTVD----------RKPFRRLLLTGGAGNLGRQLRGALAEWAEV 42
Burkholderia                      QTTTAS--------------LKPFRRLLLTGAAGNLGRQLRGALANWADV 38
BurkholderiaDolosa                ASSTEA--------------RKPFRRVLLTGAAGNLGRQLRGALANWADV 38
XanthobacterAutotrophicus         ----------------------MLKRLLLTGAAGGLGRAIRPHLARFAET 28
StreptomycesCoelicolor            --------------------MPAPRTVLLTGAAGGLGTLMRELLPGHGYE 30
StreptomycesGriseus               --------------------MTAPRTVLLTGAAGGLGTLMRGLLPAYGYD 30
Sulfitobacter                     ----------------------MMKKLVLTGAAGRLGSYLREPLSKMCQE 28
Rhodobacterales                   -----------------------MKKLVLTGAAGRLGSYLREPLSKMCDE 27
Jannaschia                        ----------------------MLKKIVLTGAAGRCGSIVRPMLAAICEE 28
SEQincconue                       --------------------------------GGRLGSFLREPLSKICNQ 18
ArthrobacterChlorophenolicus      TSREYDQDHRLSTTGGILSVESTGAHIAITGGAGMMATLLRPYLAEAGYA 108
HalorubrumLacusprofundi           ----------------------MDEPVLLTGAGGRVGQAILRGIGDDYEW 28
HalobacteriumSalinarum            ----------------------MDEPVLLTGASGRVGQAILGGIGDDYTW 28
HaloquadratumWalsbyi              ----------------------MDEPVLLTGASGRVGEAILRHAGEDFAW 28
Cyanothece                        RKNSTQPIPSFEGQHLQQQTSSKRKTVLLTGAAGEIGRSLRQLLGEQYHF 350
                                                                  .*  .  :          

PseudomonasMendocina              MRLSDIGEMAPAEG---PHEEVVHCDLADKAGVQQLVEGVDAIVHFGG-V 83
PseudomonasPutida                 LRLSDISPMAPAAG---PHEEVITCDLADKAAVHTLVEGVDAIIHFGG-V 78
Burkholderia2                     VRVSDVAPLGDAR----AGEECVRCDLADAAAVDALVRDVDVIVHFGG-V 99
LeptothrixCholodnii               LRLSDISDLGAAA----AGEELMPAPLEDAAAVHALLAGVDAVVHLGG-V 81
BurkholderiaGraminis              VRVTDIASLGEPA----AHEETSVVDLADRAAVMQLVEGVDAIVHLGG-I 87
Burkholderia                      VRVSDIAKLSEPA----PHEETTIVDLADRRAVMQLVEGVDAIVHLGG-I 83
BurkholderiaDolosa                VRVSDITALGDAA----AHEETRVVDLADRPAVMQLVEGVDAIVHLGG-I 83
XanthobacterAutotrophicus         VRVSDIADLGAVA----PHEEAVRCDLSDAAAVRDLVAGCDGIVHLGG-I 73
StreptomycesCoelicolor            LRLLDLLPVEGEP-------DAIVADLADRDALREAVRGVDAIIHLAG-I 72
StreptomycesGriseus               LRLFDLVPVEGAP-------EAITADLNDREALREAVRGVDAVVHLAG-I 72
Sulfitobacter                     LVSTDIVDDIGKLY---EGESYAKADVAVYDQIAPLLESADMVVHFGA-I 74
Rhodobacterales                   LVTTDIAEAPATLL---ANETYVQADIADFDAVFNMLEGADMVVHFGA-I 73
Jannaschia                        LISSDIVESIDALA---ANESYVKADLADYTAIAAMMDDVEMVVHFGA-I 74
SEQincconue                       LVSTDIKKHIGKLN---ENETYISADLSNFDQIYEITKDVSLICHFGA-L 64
ArthrobacterChlorophenolicus      VRLLDLAQAP-RLL---ENESMHVGSVTDPAFMNAALEGVAAVVHLGG-L 153
HalorubrumLacusprofundi           RLLDREPLPAAKVPDGVTDADQYVADITNADAVREAMEGVGAVIHLAGDP 78
HalobacteriumSalinarum            RLFDREP------PTDDPDHEFVVADITDETAVREAASDVGAIVHLAGDP 72
HaloquadratumWalsbyi              RLFDREPVPRDRRPSRVAADDVFISDVTDTNALINAIEGCKAVIHLAGDP 78
Cyanothece                        RCLDRTRIR--------DAQDMVVADIRNFRSVLKAMQGVEAVIHLAANR 392
                                                            :     :     .   : *:..  

PseudomonasMendocina              SVERPFEEILGANICGVFHIYEAARRHGVKRVVFASSNHVIGFYKQ---- 129
PseudomonasPutida                 STEHAFEEILGPNICGVFHVYEAARKHGVKRIIFASSNHTIGFYRQ---- 124
Burkholderia2                     SVEHPFDTVLPANIAGAYHVYEAARRYGVRRIVFASSNHVTGFYEQ---- 145
LeptothrixCholodnii               STEQPWQPILQANIIGTYNLYEAARKHGVKRVVFASSNHVTGFYRQ---- 127
BurkholderiaGraminis              SIDAPFNDLLGANIAGTYNLYEAARKHGVKRIVFASSNHVIGFHPV---- 133
Burkholderia                      SIDAPFEDLLRANIAGTYNVYEAARKHGVKRVVFASSNHAIGFHQV---- 129
BurkholderiaDolosa                SVDAPFDDLVDANITGTYNVYEAARKHGVKRIVFASSNHAIGFHPV---- 129
XanthobacterAutotrophicus         SVEDKFSKIVGANIVGLYNLYEAARAEGQPRILFASSNHTIGFYRQ---- 119
StreptomycesCoelicolor            SLEASFDKILAANIEGTYNLYEAAREEGVGRIVFASSNHAVGYTPRPQGD 122
StreptomycesGriseus               SLESTFDKILRANVQGTHHLYEAAREEGVRRIVAASSNHVIGHTPRPAPG 122
Sulfitobacter                     VDEKPFEELLGPNFVGSYNVWEAAYQHGLQRVVYASSIHAVGMHKK---- 120
Rhodobacterales                   VDEAPFETLLGPNFIGSYNIWESARRHGLRRVVYASSIHAVGMHKK---- 119
Jannaschia                        VDEGPFEELLGPNFIGSYNVWDSAQKAGARRIVYASSIHAVGMHPR---- 120
SEQincconue                       VDEVPFNDMLGANFIGSYNIWEAARLNNCKRVVYSSSIHAVGMYKR---- 110
ArthrobacterChlorophenolicus      HREKTWEEIVLTNITGTQVTLEAARRNGVERVLLASSTHAVGFHPT---- 199
HalorubrumLacusprofundi           RKTAPWDSVLRNNIDGTQVVMRAAVDAGVKKFAFASSNHAVGGYETEERT 128
HalobacteriumSalinarum            RPEAPWESVLRNNIDGTRTVLDAALAAGVDRVVFASSNHAVGHYETD-RK 121
HaloquadratumWalsbyi              RPEAPWKSVLENNINGTQAVYEAAVNADVDRFIFASSNHAVGSYETNERT 128
Cyanothece                        EVNQAWNDVHKSGIQGTYNVFEAARQAGVRQIIYASTIRVSG-WREIMQE 441
                                       :. :   .. *      :*   .  :.  :*: :. *        

PseudomonasMendocina              DERLD-AHSPR-------RPDGYYGLSKSYGEDMASFYFDRYGIETVSIR 171
PseudomonasPutida                 DERID-AHAPR-------RPDSYYGLSKCYGEDVASFYFDRYGIETVSIR 166
Burkholderia2                     GERID-TAAPP-------RPDGYYGLSKAFGEQLARFYQDRYGIESVCIR 187
LeptothrixCholodnii               DEVVS-PKDPM-------RPDGLYGLSKAFGENLAQFYFDRYGIETVSVR 169
BurkholderiaGraminis              TEVID-ADSPQ-------RPDSLYGVSKCFGEALSRYYYDRFGIETVCMR 175
Burkholderia                      TEVLD-TDAPQ-------RPDSLYGVTKCFGEALSRYYYDRFGIETVCMR 171
BurkholderiaDolosa                TEVLD-ADSPQ-------RPDSLYGVTKCFGESLSRYYYDRFGIETVCLR 171
XanthobacterAutotrophicus         DEHLD-AAAPL-------RPDGLYGVSKCFGEALARMYFEKFGQETALVR 161
StreptomycesCoelicolor            DPLIP-IDTPR-------RPDTFYGLSKCFGEDLAQLYWDKHGIETVSVR 164
StreptomycesGriseus               DPPIA-LDAPR-------RPDTFYGLSKCFGEDLAQLYWDRHGLETVSVR 164
Sulfitobacter                     SDFIG-IDAPH-------KPDTFYGLAKCFSEDLASMYWDKRGLEAVCLR 162
Rhodobacterales                   TDFIG-IDAPH-------RPDTFYGLAKCFSEDLGSMYWDKCGLESVCMR 161
Jannaschia                        QSCIG-IDAEH-------RPDTFYGLAKCFTEDLGRMYWEKRGIESVHLR 162
SEQincconue                       TKTLR-PKTAH-------RADGFYGLSKCFTENLARMYYDKCGIEAVCLR 152
ArthrobacterChlorophenolicus      AAAARDAVLSP-------RPDTYYGVSKAAMEALGSLYADKFGMKVVSAR 242
HalorubrumLacusprofundi           PDLYRPDDGYRLDGTELPRPGNLYGVSKAAGESLGRFYHDEHGMSVVCVR 178
HalobacteriumSalinarum            PDLYRSDDDFRLDGTERPRPGNLYGVSKAAGETLGRYYHDEHGLTFAAVR 171
HaloquadratumWalsbyi              PAMYRSDDTYRLDGRELPRPSNLYGVSKATGEIIGRYYHDNHGIAVANVR 178
Cyanothece                        PTITPEQG---------VRPDSLYAVGKVFGEALGQFFADQYGISVVCLR 482
                                                    :..  *.: *   * :.  : :. *   .  *

PseudomonasMendocina              IGSSFPEPA----NRRMLSTWLSYDDLTQLIERALYTA-NVGHTVVYGMS 216
PseudomonasPutida                 IGSSFPQPQ----NLRMLCTWLSYDDLVQLIERGLFTP-GVGHTIVYGAS 211
Burkholderia2                     IGSSFSEPK----DRRMLVTWLGYDDLEQLVRRAMFVP-RVGCTIVYGMS 232
LeptothrixCholodnii               IGSSFPEPK----NRRMLATWMSFDDLERLVMAALTAP-VIGHSVIYGMG 214
BurkholderiaGraminis              IGSSFEEPK----NPRMLVTYLSYRDFIELVRCSLFTN-RVGHVVVYGAS 220
Burkholderia                      IGSSFEEPK----NPRMLVTYLSYRDFIELVRCSLFTN-RVGHVVVYGAS 216
BurkholderiaDolosa                IGSSFEVPK----NPRMLVTFLSYRDFIELVRCSLLTN-RVGHAIVYGVS 216
XanthobacterAutotrophicus         IGSCMEKPT----NYRMLSTWMSYEDFLALIGCIFRAP-RLGCPVIWGVS 206
StreptomycesCoelicolor            IGSCFPEPT----SVRMLSVWMSPADGARLFHAALTAE-NVGHTVVHGSS 209
StreptomycesGriseus               IGSCFPEPT----SVRMLSVWMSPGDGARLFHAALTAE-DVGHTVVYGSS 209
Sulfitobacter                     ILSCAQVN-----NTRALGSWLSYDDLIQLVTRAIDTP-SVGFSVVYGVS 206
Rhodobacterales                   ILSCAQVT-----NPRAVGTWLSYDDLVQLVTRAIDTP-VTGFSIVYGVS 205
Jannaschia                        ILSCAPVK-----NARALGTWLSDDDLVRLVQRAIDTP-TTGFAVIYGVS 206
SEQincconue                       IATCSPVT-----TLRSLTSWLSYDDLVQLVMRAIDTA-HTGYSVVYGVS 196
ArthrobacterChlorophenolicus      IGTGGERPG----NLRSLGSWLSPADSFRLVQATLSDRGAPGHHVVWAVS 288
HalorubrumLacusprofundi           IGNLTKDHPPREY-ERGQAMWLSHRDCGHLFDRCLQ-A-DYGYEIVYGIS 225
HalobacteriumSalinarum            IGNLTAGHPPIDY-ERGQAMWLSPRDCAHLIDRCLS-A-DYDYEVVYGIS 218
HaloquadratumWalsbyi              IGNLTEGHPPIDY-ERGQAMWLSYRDCAHLFSRCID-A-EYEFEIIYGIS 225
Cyanothece                        IGAFWPKPTVYDLNDHLLAAWCSPRDLAQLVERSLERE-NLGFQIFYGIS 531
                                  *              :    : .  *   *.   :         :. . .

PseudomonasMendocina              DNREVWWDNS-QAAHLGFTPKDSSDVFRDKVE-AQPMPAADDPARIYQGG 264
PseudomonasPutida                 DNRTVWWDNR-HAAHLGYVPKDSSETFRAAVE-AQPAPAADDPSMVYQGG 259
Burkholderia2                     ANRDAWWDNA-HAAHLGYRPTQSSEPWRESIERTQPPLADDDPVRRYQGG 281
LeptothrixCholodnii               DNTTTWWDNT-SARHVGYRPQDSSERFRAKVEAADPKPDLSDPAVIYQGG 263
BurkholderiaGraminis              DNPVKWWDNT-KAAFLGFNPRDSSAPFASRFPATAPDDSRDDPAQRFQGG 269
Burkholderia                      NNPVKWWDNT-KASFLGFNPRDSAAQFAERFPATAPGDSHDDPAQRFQGG 265
BurkholderiaDolosa                DNPVKWWDNT-KAGFLGFRPRDSSEQFAHLFPIAAPTADDDDPAQRFQGG 265
XanthobacterAutotrophicus         DNDTRWWDNS-AVSYLGWRPRDNAERFRAELEASLPRPAPDAPMALYQGG 255
StreptomycesCoelicolor            ANTRLWWDLT-SARALGYEPQDDSEPYAGKLVAEQGELDPGNPAHARLGG 258
StreptomycesGriseus               ANTRLWWDLA-PARALGYRPLDDSEPYAAKLIAEQGELAPDNPAHARVGG 258
Sulfitobacter                     NNDRAPVDNA-KASFLGYRPKDNAEQFAEKILAEAPPVDLKDPGQMHHGG 255
Rhodobacterales                   DNDRAPVDNA-KARHLGYRPKDNAEEHAKEIFAQYGPLDPHDTNNACHGG 254
Jannaschia                        DNDRSPVDNS-KAAFLGYRPQDNAEQFAEEILATEGAGDPGDLAQMVHGG 255
SEQincconue                       DNDRSNMSNT-DSGHLGFQPKDNAEIYAGKIFSEDLTEELADEGNKLHGG 245
ArthrobacterChlorophenolicus      ANTRGWANLE-AGRAIGFEPQDDAEVFAAGIDTATEDGFAALLGGAWAG- 336
HalorubrumLacusprofundi           NNDRRYYSIERAREVLGYDPADNSADYTFEGKPKDETGDENDNPTADGGE 275
HalobacteriumSalinarum            DNDRKYYSLARAKDALGYEPRDNSAEWD---------GDEK----LSGGS 255
HaloquadratumWalsbyi              DNDRKYYSIAHAKETLGYNPQDNSAEWQ---------GKER---IVKKGE 263
Cyanothece                        GNTRRYWDISNAQEILGYKPQNDAEDLIM--------------------- 560
                                   *     .       :*: * :.:                          

PseudomonasMendocina              AFVAAGPFGDD-------------- 275
PseudomonasPutida                 AFAVAGPFN---------------- 268
Burkholderia2                     AFVAAGPFGG--------------- 291
LeptothrixCholodnii               PFVRTGPFD---------------- 272
BurkholderiaGraminis              PFVLGEPMESEKPR----------- 283
Burkholderia                      PFVLGEPMQAKR------------- 277
BurkholderiaDolosa                GFVVGEPMERPR------------- 277
XanthobacterAutotrophicus         QFTQDPIFEEK-------------- 266
StreptomycesCoelicolor            HFVTDPPIWPY-------------- 269
StreptomycesGriseus               HFATDPPIWPH-------------- 269
Sulfitobacter                     PFAAVDLGESGVASMNIVNDKKTT- 279
Rhodobacterales                   PFAGIELGNSAMSALNLNKDDTGKA 279
Jannaschia                        PFGPVPLGQGGAAAAAKGDD----- 275
SEQincconue                       PFASTDLGVSAMDKMKIVYSHKGD- 269
ArthrobacterChlorophenolicus      --SGHKVGMDNYPALAAK------- 352
HalorubrumLacusprofundi           TRFDDPPAEPNFPSDPDTPTDGA-- 298
HalobacteriumSalinarum            -------------------------
HaloquadratumWalsbyi              -------------------------
Cyanothece                        -------------------------

---------------------------------------------------------------------------------------------------

b)

CLUSTAL 2.0.10 multiple sequence alignment


StreptomycesCoelicolor             --------------------------------------------------
StreptomycesGriseus                --------------------------------------------------
PseudomonasMendocina               --------------------------------------------------
PseudomonasPutida                  --------------------------------------------------
Burkholderia2                      --------------------------------------------------
LeptothrixCholodnii                --------------------------------------------------
BurkholderiaGraminis               --------------------------------------------------
Burkholderia                       --------------------------------------------------
BurkholderiaDolosa                 --------------------------------------------------
XanthobacterAutotrophicus          --------------------------------------------------
SinorhizobiumMedicae               --------------------------------------------------
Rhizobium                          --------------------------------------------------
Sulfitobacter                      --------------------------------------------------
OceanibulbusIndolifex              --------------------------------------------------
RoseobacterDenitrificans           --------------------------------------------------
Rhodobacterales                    --------------------------------------------------
Jannaschia                         --------------------------------------------------
LoktanellaVestfoldensis            --------------------------------------------------
OctadecabacterAntarcticus          --------------------------------------------------
SEQincconue                        --------------------------------------------------
MethylobacteriumRadiotolerans      --------------------------------------------------
ArthrobacterChlorophenolicus       --------------------------------------------------
BradyrhizobiumJaponicum            --------------------------------------------------
HalorubrumLacusprofundi            --------------------------------------------------
HalobacteriumSalinarum             --------------------------------------------------
HaloquadratumWalsbyi               --------------------------------------------------
Cyanothece                         MLSYAQTILQLLQQLEQLGYSQADKIYIHNAYQFLTKRVVCHYRPSGKTM 50
                                                                                     

StreptomycesCoelicolor             --------------------------------------------------
StreptomycesGriseus                --------------------------------------------------
PseudomonasMendocina               --------------------------------------------------
PseudomonasPutida                  --------------------------------------------------
Burkholderia2                      --------------------------------------------------
LeptothrixCholodnii                --------------------------------------------------
BurkholderiaGraminis               --------------------------------------------------
Burkholderia                       --------------------------------------------------
BurkholderiaDolosa                 --------------------------------------------------
XanthobacterAutotrophicus          --------------------------------------------------
SinorhizobiumMedicae               --------------------------------------------------
Rhizobium                          --------------------------------------------------
Sulfitobacter                      --------------------------------------------------
OceanibulbusIndolifex              --------------------------------------------------
RoseobacterDenitrificans           --------------------------------------------------
Rhodobacterales                    --------------------------------------------------
Jannaschia                         --------------------------------------------------
LoktanellaVestfoldensis            --------------------------------------------------
OctadecabacterAntarcticus          --------------------------------------------------
SEQincconue                        --------------------------------------------------
MethylobacteriumRadiotolerans      --------------------------------------------------
ArthrobacterChlorophenolicus       --------------------------------------------------
BradyrhizobiumJaponicum            --------------------------------------------------
HalorubrumLacusprofundi            --------------------------------------------------
HalobacteriumSalinarum             --------------------------------------------------
HaloquadratumWalsbyi               --------------------------------------------------
Cyanothece                         IAHAIGTASILASLKTTKEVIAAGMLHVIYPYGDFGDGTSGISLKKQQQT 100
                                                                                     

StreptomycesCoelicolor             --------------------------------------------------
StreptomycesGriseus                --------------------------------------------------
PseudomonasMendocina               --------------------------------------------------
PseudomonasPutida                  --------------------------------------------------
Burkholderia2                      --------------------------------------------------
LeptothrixCholodnii                --------------------------------------------------
BurkholderiaGraminis               --------------------------------------------------
Burkholderia                       --------------------------------------------------
BurkholderiaDolosa                 --------------------------------------------------
XanthobacterAutotrophicus          --------------------------------------------------
SinorhizobiumMedicae               --------------------------------------------------
Rhizobium                          --------------------------------------------------
Sulfitobacter                      --------------------------------------------------
OceanibulbusIndolifex              --------------------------------------------------
RoseobacterDenitrificans           --------------------------------------------------
Rhodobacterales                    --------------------------------------------------
Jannaschia                         --------------------------------------------------
LoktanellaVestfoldensis            --------------------------------------------------
OctadecabacterAntarcticus          --------------------------------------------------
SEQincconue                        --------------------------------------------------
MethylobacteriumRadiotolerans      --------------------------------------------------
ArthrobacterChlorophenolicus       --------------------------------------------------
BradyrhizobiumJaponicum            --------------------------------------------------
HalorubrumLacusprofundi            --------------------------------------------------
HalobacteriumSalinarum             --------------------------------------------------
HaloquadratumWalsbyi               --------------------------------------------------
Cyanothece                         IAVIGKQAEEYVRQYTQFIWTWENLPKLQQRIPIMTPTERNVLLIRLANE 150
                                                                                     

StreptomycesCoelicolor             --------------------------------------------------
StreptomycesGriseus                --------------------------------------------------
PseudomonasMendocina               --------------------------------------------------
PseudomonasPutida                  --------------------------------------------------
Burkholderia2                      --------------------------------------------------
LeptothrixCholodnii                --------------------------------------------------
BurkholderiaGraminis               --------------------------------------------------
Burkholderia                       --------------------------------------------------
BurkholderiaDolosa                 --------------------------------------------------
XanthobacterAutotrophicus          --------------------------------------------------
SinorhizobiumMedicae               --------------------------------------------------
Rhizobium                          --------------------------------------------------
Sulfitobacter                      --------------------------------------------------
OceanibulbusIndolifex              --------------------------------------------------
RoseobacterDenitrificans           --------------------------------------------------
Rhodobacterales                    --------------------------------------------------
Jannaschia                         --------------------------------------------------
LoktanellaVestfoldensis            --------------------------------------------------
OctadecabacterAntarcticus          --------------------------------------------------
SEQincconue                        --------------------------------------------------
MethylobacteriumRadiotolerans      --------------------------------------------------
ArthrobacterChlorophenolicus       --------------------------------------------------
BradyrhizobiumJaponicum            --------------------------------------------------
HalorubrumLacusprofundi            --------------------------------------------------
HalobacteriumSalinarum             --------------------------------------------------
HaloquadratumWalsbyi               --------------------------------------------------
Cyanothece                         LEDNLDLGILYCSNAEVRQKGNKLVGHLMVELASALGFPTLADQLSTAFQ 200
                                                                                     

StreptomycesCoelicolor             --------------------------------------------------
StreptomycesGriseus                --------------------------------------------------
PseudomonasMendocina               --------------------------------------------------
PseudomonasPutida                  --------------------------------------------------
Burkholderia2                      --------------------------------------------------
LeptothrixCholodnii                --------------------------------------------------
BurkholderiaGraminis               --------------------------------------------------
Burkholderia                       --------------------------------------------------
BurkholderiaDolosa                 --------------------------------------------------
XanthobacterAutotrophicus          --------------------------------------------------
SinorhizobiumMedicae               --------------------------------------------------
Rhizobium                          --------------------------------------------------
Sulfitobacter                      --------------------------------------------------
OceanibulbusIndolifex              --------------------------------------------------
RoseobacterDenitrificans           --------------------------------------------------
Rhodobacterales                    --------------------------------------------------
Jannaschia                         --------------------------------------------------
LoktanellaVestfoldensis            --------------------------------------------------
OctadecabacterAntarcticus          --------------------------------------------------
SEQincconue                        --------------------------------------------------
MethylobacteriumRadiotolerans      --------------------------------------------------
ArthrobacterChlorophenolicus       ------------------------------------------MGCPSSFA 8
BradyrhizobiumJaponicum            --------------------------------------------------
HalorubrumLacusprofundi            --------------------------------------------------
HalobacteriumSalinarum             --------------------------------------------------
HaloquadratumWalsbyi               --------------------------------------------------
Cyanothece                         ASLETRIFREFCHPGFGPVDFAIAPQSYLLKPTIKFHRTLVGVRQATIHS 250
                                                                                     

StreptomycesCoelicolor             --------------------------------------------------
StreptomycesGriseus                --------------------------------------------------
PseudomonasMendocina               ------------------------------------------------MT 2
PseudomonasPutida                  ------------------------------------------------MT 2
Burkholderia2                      ----------------------------------------------MIMT 4
LeptothrixCholodnii                ------------------------------------------------MP 2
BurkholderiaGraminis               ------------------------------------------------MS 2
Burkholderia                       ------------------------------------------------MS 2
BurkholderiaDolosa                 ------------------------------------------------MN 2
XanthobacterAutotrophicus          --------------------------------------------------
SinorhizobiumMedicae               --------------------------------------------------
Rhizobium                          --------------------------------------------------
Sulfitobacter                      --------------------------------------------------
OceanibulbusIndolifex              --------------------------------------------------
RoseobacterDenitrificans           --------------------------------------------------
Rhodobacterales                    --------------------------------------------------
Jannaschia                         --------------------------------------------------
LoktanellaVestfoldensis            --------------------------------------------------
OctadecabacterAntarcticus          --------------------------------------------------
SEQincconue                        --------------------------------------------------
MethylobacteriumRadiotolerans      --------------------------------------------------
ArthrobacterChlorophenolicus       AGVALPLAHPVSSAADATVRATAVRERVINFESTLILLFTYMNACYYVKR 58
BradyrhizobiumJaponicum            --------------------------------------------------
HalorubrumLacusprofundi            --------------------------------------------------
HalobacteriumSalinarum             --------------------------------------------------
HaloquadratumWalsbyi               --------------------------------------------------
Cyanothece                         ISKTKQKLRSWVLRAKQKVKRTVRSLIPDQTLSVEKQHSPHPTAQTKLEP 300
                                                                                     

StreptomycesCoelicolor             --------------------MPAPRTVLLTGAAGGLGTLMRELLPGHGYE 30
StreptomycesGriseus                --------------------MTAPRTVLLTGAAGGLGTLMRGLLPAYGYD 30
PseudomonasMendocina               TTPSE---------------LRPFNRLLLTGAAGGLGKVLRQRLRPYANV 37
PseudomonasPutida                  TTP--------------------FNRLLLTGAAGGLGKVLRERLKGYAEV 32
Burkholderia2                      DLQHSNQDANAAGDDPLDGVVTHCGRILLTGAAGNLGRVLRERLRRYADV 54
LeptothrixCholodnii                SHPTP----------------LRFDRLLLTGAAGGLGRELRTRLKAYCDV 36
BurkholderiaGraminis               QTISESSTVD----------RKPFRRLLLTGGAGNLGRQLRGALAEWAEV 42
Burkholderia                       QTTTAS--------------LKPFRRLLLTGAAGNLGRQLRGALANWADV 38
BurkholderiaDolosa                 ASSTEA--------------RKPFRRVLLTGAAGNLGRQLRGALANWADV 38
XanthobacterAutotrophicus          ----------------------MLKRLLLTGAAGGLGRAIRPHLARFAET 28
SinorhizobiumMedicae               ----------------------MMTRLLITGAAGSLGGYAREGLKDCAQI 28
Rhizobium                          ---------------------MIYNRILLTGAAGLLGTELRKRLTPKVKF 29
Sulfitobacter                      ----------------------MMKKLVLTGAAGRLGSYLREPLSKMCQE 28
OceanibulbusIndolifex              ---------------------MKFKKLVLTGAAGRLGSYLREPLAAMCEE 29
RoseobacterDenitrificans           -----------------------MKKLVLTGAAGRLGSYLREPLTALCDT 27
Rhodobacterales                    -----------------------MKKLVLTGAAGRLGSYLREPLSKMCDE 27
Jannaschia                         ----------------------MLKKIVLTGAAGRCGSIVRPMLAAICEE 28
LoktanellaVestfoldensis            -----------------------MKKLVLTGAAGRLGSHLREPLTRMCDE 27
OctadecabacterAntarcticus          -------------------MAKLHKKIVLTGACGTLGMEIRATLAALTDQ 31
SEQincconue                        --------------------------------GGRLGSFLREPLSKICNQ 18
MethylobacteriumRadiotolerans      ----------------MSAETVPSKPVLLTGASGALGRVLTRALGAQGWT 34
ArthrobacterChlorophenolicus       TSREYDQDHRLSTTGGILSVESTGAHIAITGGAGMMATLLRPYLAEAGYA 108
BradyrhizobiumJaponicum            -----------------------MPRILMTGASGGIGTSLRKLLPPIYPD 27
HalorubrumLacusprofundi            ----------------------MDEPVLLTGAGGRVGQAILRGIGDDYEW 28
HalobacteriumSalinarum             ----------------------MDEPVLLTGASGRVGQAILGGIGDDYTW 28
HaloquadratumWalsbyi               ----------------------MDEPVLLTGASGRVGEAILRHAGEDFAW 28
Cyanothece                         RKNSTQPIPSFEGQHLQQQTSSKRKTVLLTGAAGEIGRSLRQLLGEQYHF 350
                                                                    *  .             

StreptomycesCoelicolor             LRLLDLLPVE---GEP----DAIVADLADRDALREAVRGVDAIIHLAGIS 73
StreptomycesGriseus                LRLFDLVPVE---GAP----EAITADLNDREALREAVRGVDAVVHLAGIS 73
PseudomonasMendocina               MRLSDIGEMA---PAEGPHEEVVHCDLADKAGVQQLVEGVDAIVHFGGVS 84
PseudomonasPutida                  LRLSDISPMA---PAAGPHEEVITCDLADKAAVHTLVEGVDAIIHFGGVS 79
Burkholderia2                      VRVSDVAPLG---DAR-AGEECVRCDLADAAAVDALVRDVDVIVHFGGVS 100
LeptothrixCholodnii                LRLSDISDLG---AAA-AGEELMPAPLEDAAAVHALLAGVDAVVHLGGVS 82
BurkholderiaGraminis               VRVTDIASLG---EPA-AHEETSVVDLADRAAVMQLVEGVDAIVHLGGIS 88
Burkholderia                       VRVSDIAKLS---EPA-PHEETTIVDLADRRAVMQLVEGVDAIVHLGGIS 84
BurkholderiaDolosa                 VRVSDITALG---DAA-AHEETRVVDLADRPAVMQLVEGVDAIVHLGGIS 84
XanthobacterAutotrophicus          VRVSDIADLG---AVA-PHEEAVRCDLSDAAAVRDLVAGCDGIVHLGGIS 74
SinorhizobiumMedicae               LRLSDVAELS---PAG-KGEEVVRCDLAEREAVDELVRDCDAILHLGAIS 74
Rhizobium                          LRSTDIASMA---DAA-PNEELVQADLGDISAAKNLVRDIEAIVHFGGIS 75
Sulfitobacter                      LVSTDIVDDI---GKLYEGESYAKADVAVYDQIAPLLESADMVVHFGAIV 75
OceanibulbusIndolifex              LVSTDIADDI---GKLYDGERYAKADLAEYDQIAPLMEGADMVVHFGAIV 76
RoseobacterDenitrificans           LVSTDIVDDI---GTLYAGETYVKADLAQMDQIAPVLEGADMVVHFGAIV 74
Rhodobacterales                    LVTTDIAEAP---ATLLANETYVQADIADFDAVFNMLEGADMVVHFGAIV 74
Jannaschia                         LISSDIVESI---DALAANESYVKADLADYTAIAAMMDDVEMVVHFGAIV 75
LoktanellaVestfoldensis            LVSTDIVADI---GKLYDGESYVQADLTDLAAMEAILKDATMVVHFGAIG 74
OctadecabacterAntarcticus          LVSVDIAEAP---KVLLENEVFVQADCAKFDEVLPLMEGANMAVHFASIP 78
SEQincconue                        LVSTDIKKHI---GKLNENETYISADLSNFDQIYEITKDVSLICHFGALV 65
MethylobacteriumRadiotolerans      LRLTDRVPFP---DPLPEGARFQVADLEDGPAILRLAEGCGTILHFGGIS 81
ArthrobacterChlorophenolicus       VRLLDLAQAP---RLL-ENESMHVGSVTDPAFMNAALEGVAAVVHLGGLH 154
BradyrhizobiumJaponicum            LLLSDIKPPA---DLG-ANEKFKAADLADLAQCEAICEGVDGIIHFGGYS 73
HalorubrumLacusprofundi            RLLDREPLPAAKVPDGVTDADQYVADITNADAVREAMEGVGAVIHLAGDP 78
HalobacteriumSalinarum             RLFDREP------PTDDPDHEFVVADITDETAVREAASDVGAIVHLAGDP 72
HaloquadratumWalsbyi               RLFDREPVPRDRRPSRVAADDVFISDVTDTNALINAIEGCKAVIHLAGDP 78
Cyanothece                         RCLDRTRIR--------DAQDMVVADIRNFRSVLKAMQGVEAVIHLAANR 392
                                                                         .     *:..  

StreptomycesCoelicolor             L-EASFDKILAANIEGTYNLYEAAREEGVGRIVFASSNHAVGYTPRPQGD 122
StreptomycesGriseus                L-ESTFDKILRANVQGTHHLYEAAREEGVRRIVAASSNHVIGHTPRPAPG 122
PseudomonasMendocina               V-ERPFEEILGANICGVFHIYEAARRHGVKRVVFASSNHVIGFYKQ---- 129
PseudomonasPutida                  T-EHAFEEILGPNICGVFHVYEAARKHGVKRIIFASSNHTIGFYRQ---- 124
Burkholderia2                      V-EHPFDTVLPANIAGAYHVYEAARRYGVRRIVFASSNHVTGFYEQ---- 145
LeptothrixCholodnii                T-EQPWQPILQANIIGTYNLYEAARKHGVKRVVFASSNHVTGFYRQ---- 127
BurkholderiaGraminis               I-DAPFNDLLGANIAGTYNLYEAARKHGVKRIVFASSNHVIGFHPV---- 133
Burkholderia                       I-DAPFEDLLRANIAGTYNVYEAARKHGVKRVVFASSNHAIGFHQV---- 129
BurkholderiaDolosa                 V-DAPFDDLVDANITGTYNVYEAARKHGVKRIVFASSNHAIGFHPV---- 129
XanthobacterAutotrophicus          V-EDKFSKIVGANIVGLYNLYEAARAEGQPRILFASSNHTIGFYRQ---- 119
SinorhizobiumMedicae               A-EAEFDALLQANILGTYNLYEAARRAGVSRILFASTNHVTGFHPV---- 119
Rhizobium                          K-DADFESIHRVNIAGFHSLYEAARSAGVKRVVFSSSVHAIGFYDQ---- 120
Sulfitobacter                      D-EKPFEELLGPNFVGSYNVWEAAYQHGLQRVVYASSIHAVGMHKK---- 120
OceanibulbusIndolifex              D-EKPFMELLGPNFVGSYNVWEAAYQAGARRVVYASSIHAVGMHKK---- 121
RoseobacterDenitrificans           D-EKPFEELLGPNFVGSYNIWEAGYKAGVKRIVYASSIHAVGMHLK---- 119
Rhodobacterales                    D-EAPFETLLGPNFIGSYNIWESARRHGLRRVVYASSIHAVGMHKK---- 119
Jannaschia                         D-EGPFEELLGPNFIGSYNVWDSAQKAGARRIVYASSIHAVGMHPR---- 120
LoktanellaVestfoldensis            D-EAPWDDILQSNIIGAYNVWEAAYRQGVKRVVYASSVHAVGMHLK---- 119
OctadecabacterAntarcticus          D-ERPFEDLLGPNFMSSYNVWEAGHRHGVQRVIYASSVHAVGMHEN---- 123
SEQincconue                        D-EVPFNDMLGANFIGSYNIWEAARLNNCKRVVYSSSIHAVGMYKR---- 110
MethylobacteriumRadiotolerans      V-EHPFETVIGPNIRGLYHAYEAARREGAR-MIFASSNHAIGFHAR---- 125
ArthrobacterChlorophenolicus       R-EKTWEEIVLTNITGTQVTLEAARRNGVERVLLASSTHAVGFHPT---- 199
BradyrhizobiumJaponicum            V-EGPWDDILQANIIGGYNLFEAAYRKGVKRVVFASSNHAVGFYPR---- 118
HalorubrumLacusprofundi            RKTAPWDSVLRNNIDGTQVVMRAAVDAGVKKFAFASSNHAVGGYETEERT 128
HalobacteriumSalinarum             RPEAPWESVLRNNIDGTRTVLDAALAAGVDRVVFASSNHAVGHYETD-RK 121
HaloquadratumWalsbyi               RPEAPWKSVLENNINGTQAVYEAAVNADVDRFIFASSNHAVGSYETNERT 128
Cyanothece                         EVNQAWNDVHKSGIQGTYNVFEAARQAGVRQIIYASTIRVSG-WREIMQE 441
                                        :  :   .. .      :.   .   .  :*: :. *        

StreptomycesCoelicolor             DPLIPIDTP--------RRPDTFYGLSKCFGEDLAQLYWDKHGIETVSVR 164
StreptomycesGriseus                DPPIALDAP--------RRPDTFYGLSKCFGEDLAQLYWDRHGLETVSVR 164
PseudomonasMendocina               DERLDAHSP--------RRPDGYYGLSKSYGEDMASFYFDRYGIETVSIR 171
PseudomonasPutida                  DERIDAHAP--------RRPDSYYGLSKCYGEDVASFYFDRYGIETVSIR 166
Burkholderia2                      GERIDTAAP--------PRPDGYYGLSKAFGEQLARFYQDRYGIESVCIR 187
LeptothrixCholodnii                DEVVSPKDP--------MRPDGLYGLSKAFGENLAQFYFDRYGIETVSVR 169
BurkholderiaGraminis               TEVIDADSP--------QRPDSLYGVSKCFGEALSRYYYDRFGIETVCMR 175
Burkholderia                       TEVLDTDAP--------QRPDSLYGVTKCFGEALSRYYYDRFGIETVCMR 171
BurkholderiaDolosa                 TEVLDADSP--------QRPDSLYGVTKCFGESLSRYYYDRFGIETVCLR 171
XanthobacterAutotrophicus          DEHLDAAAP--------LRPDGLYGVSKCFGEALARMYFEKFGQETALVR 161
SinorhizobiumMedicae               GERLDHLSP--------RRPDSLYGVSKCFGEDLSRLYFDKYGLETACLR 161
Rhizobium                          TQTIDAGAP--------ARPDSNYGVAKAFGENLAQLFWDKHGLETVSLR 162
Sulfitobacter                      SDFIGIDAP--------HKPDTFYGLAKCFSEDLASMYWDKRGLEAVCLR 162
OceanibulbusIndolifex              SDFIGIDAP--------HKPDTFYGLAKCFTEDLGSMYWDKRQLESVHLR 163
RoseobacterDenitrificans           SDFIGIDAE--------HRPDTFYGLAKCFTEDLGRMYWDKRGLESVHLR 161
Rhodobacterales                    TDFIGIDAP--------HRPDTFYGLAKCFSEDLGSMYWDKCGLESVCMR 161
Jannaschia                         QSCIGIDAE--------HRPDTFYGLAKCFTEDLGRMYWEKRGIESVHLR 162
LoktanellaVestfoldensis            TDTIGLDAP--------HKPDTYYGLAKCFAEDLASLYWDKRGVESVCMR 161
OctadecabacterAntarcticus          AAGIDVDAD--------HAPDTFYGLAKCFAEDLGKLYWAKRGMESVHLR 165
SEQincconue                        TKTLRPKTA--------HRADGFYGLSKCFTENLARMYYDKCGIEAVCLR 152
MethylobacteriumRadiotolerans      SEVLDDDCG--------LAPDGYYGLSKAYGELMGGLYRDKHGVESVFLR 167
ArthrobacterChlorophenolicus       AAAARDAVLS-------PRPDTYYGVSKAAMEALGSLYADKFGMKVVSAR 242
BradyrhizobiumJaponicum            HHKIGTDVT--------PRPDGRYGVSKVFGEAVGALYADKHGLKVTCLR 160
HalorubrumLacusprofundi            PDLYRPDDGYRLDGTELPRPGNLYGVSKAAGESLGRFYHDEHGMSVVCVR 178
HalobacteriumSalinarum             PDLYRSDDDFRLDGTERPRPGNLYGVSKAAGETLGRYYHDEHGLTFAAVR 171
HaloquadratumWalsbyi               PAMYRSDDTYRLDGRELPRPSNLYGVSKATGEIIGRYYHDNHGIAVANVR 178
Cyanothece                         PTITPEQG---------VRPDSLYAVGKVFGEALGQFFADQYGISVVCLR 482
                                                      ..  *.: *   * :.  :  .     .  *

StreptomycesCoelicolor             IGSCFPEPT----SVRMLSVWMSPADGARLFHAALTAENVGHT---VVHG 207
StreptomycesGriseus                IGSCFPEPT----SVRMLSVWMSPGDGARLFHAALTAEDVGHT---VVYG 207
PseudomonasMendocina               IGSSFPEPA----NRRMLSTWLSYDDLTQLIERALYTANVGHT---VVYG 214
PseudomonasPutida                  IGSSFPQPQ----NLRMLCTWLSYDDLVQLIERGLFTPGVGHT---IVYG 209
Burkholderia2                      IGSSFSEPK----DRRMLVTWLGYDDLEQLVRRAMFVPRVGCT---IVYG 230
LeptothrixCholodnii                IGSSFPEPK----NRRMLATWMSFDDLERLVMAALTAPVIGHS---VIYG 212
BurkholderiaGraminis               IGSSFEEPK----NPRMLVTYLSYRDFIELVRCSLFTNRVGHV---VVYG 218
Burkholderia                       IGSSFEEPK----NPRMLVTYLSYRDFIELVRCSLFTNRVGHV---VVYG 214
BurkholderiaDolosa                 IGSSFEVPK----NPRMLVTFLSYRDFIELVRCSLLTNRVGHA---IVYG 214
XanthobacterAutotrophicus          IGSCMEKPT----NYRMLSTWMSYEDFLALIGCIFRAPRLGCP---VIWG 204
SinorhizobiumMedicae               IGSCFAEPT----NRRMLSTWLSPGDFRTLIRQLLAASEIGHL---VLYG 204
Rhizobium                          IGSCEAKPS----TRRHLLTWLSFDDMWQLVERSLTVPRVGHT---IIYG 205
Sulfitobacter                      ILSCAQVN-----NTRALGSWLSYDDLIQLVTRAIDTPSVGFS---VVYG 204
OceanibulbusIndolifex              ILSAAQVN-----NSRALGSWLSYDDLIQLVTRAVDTPSVGFS---VIYG 205
RoseobacterDenitrificans           ILSCAQVN-----NTRALGSWLSYPDLIQLVTRAIDTPSVGFS---IIYG 203
Rhodobacterales                    ILSCAQVT-----NPRAVGTWLSYDDLVQLVTRAIDTPVTGFS---IVYG 203
Jannaschia                         ILSCAPVK-----NARALGTWLSDDDLVRLVQRAIDTPTTGFA---VIYG 204
LoktanellaVestfoldensis            IFSCAQAT-----NARSIGTWLSYGDLIHLVERSIDSPVVGFT---KVWG 203
OctadecabacterAntarcticus          IFSCTKVPQ----NARALRTWLSYDDLRQLVDRAVTATTTGFT---VIFG 208
SEQincconue                        IATCSPVT-----TLRSLTSWLSYDDLVQLVMRAIDTAHTGYS---VVYG 194
MethylobacteriumRadiotolerans      IGSCFPEPT----DARMLATWLSYADLTRLITRATLAPDLGPTGSVVIWG 213
ArthrobacterChlorophenolicus       IGTGGERPG----NLRSLGSWLSPADSFRLVQATLSDR--GAPGHHVVWA 286
BradyrhizobiumJaponicum            IGNFGDLPL----DQRRLSIWLKPDDLVQLCRIGLEHP--DIH-FEVFYG 203
HalorubrumLacusprofundi            IGNLTKDHPPREY-ERGQAMWLSHRDCGHLFDRCLQ-ADYGYE---IVYG 223
HalobacteriumSalinarum             IGNLTAGHPPIDY-ERGQAMWLSPRDCAHLIDRCLS-ADYDYE---VVYG 216
HaloquadratumWalsbyi               IGNLTEGHPPIDY-ERGQAMWLSYRDCAHLFSRCID-AEYEFE---IIYG 223
Cyanothece                         IGAFWPKPTVYDLNDHLLAAWCSPRDLAQLVERSLERENLGFQ---IFYG 529
                                   *              :    :    *   *                 . .

StreptomycesCoelicolor             SSANTRLWWDLTS-ARALGYEPQDDSEPYAGKLVAEQGELDPGNPAHARL 256
StreptomycesGriseus                SSANTRLWWDLAP-ARALGYRPLDDSEPYAAKLIAEQGELAPDNPAHARV 256
PseudomonasMendocina               MSDNREVWWDNSQ-AAHLGFTPKDSSDVFRDKVE-AQPMPAADDPARIYQ 262
PseudomonasPutida                  ASDNRTVWWDNRH-AAHLGYVPKDSSETFRAAVE-AQPAPAADDPSMVYQ 257
Burkholderia2                      MSANRDAWWDNAH-AAHLGYRPTQSSEPWRESIERTQPPLADDDPVRRYQ 279
LeptothrixCholodnii                MGDNTTTWWDNTS-ARHVGYRPQDSSERFRAKVEAADPKPDLSDPAVIYQ 261
BurkholderiaGraminis               ASDNPVKWWDNTK-AAFLGFNPRDSSAPFASRFPATAPDDSRDDPAQRFQ 267
Burkholderia                       ASNNPVKWWDNTK-ASFLGFNPRDSAAQFAERFPATAPGDSHDDPAQRFQ 263
BurkholderiaDolosa                 VSDNPVKWWDNTK-AGFLGFRPRDSSEQFAHLFPIAAPTADDDDPAQRFQ 263
XanthobacterAutotrophicus          VSDNDTRWWDNSA-VSYLGWRPRDNAERFRAELEASLPRPAPDAPMALYQ 253
SinorhizobiumMedicae               VSANRDVWWSNAH-ADFLGWRPQDSSEAYRPAIEAREEEPAKG---VRYQ 250
Rhizobium                          ASNNRASFWDNRL-ASHIGYRPKDSADDYQDDIFAADPQPSREDVVNRLQ 254
Sulfitobacter                      VSNNDRAPVDNAK-ASFLGYRPKDNAEQFAEKILAEAPPVDLKDPGQMHH 253
OceanibulbusIndolifex              VSNNDRAPVDNAK-ASFLGYRPKDNAEQFAEKVLAEEGPVDITDPGQMCH 254
RoseobacterDenitrificans           VSNNDRAPVDNAK-ASFLGYRPIDNAEVYAAEVLAQAEPVDTTDPGQMCH 252
Rhodobacterales                    VSDNDRAPVDNAK-ARHLGYRPKDNAEEHAKEIFAQYGPLDPHDTNNACH 252
Jannaschia                         VSDNDRSPVDNSK-AAFLGYRPQDNAEQFAEEILATEGAGDPGDLAQMVH 253
LoktanellaVestfoldensis            ISNNDRAVVDNSK-AGHLGFRPKDNAEQFAQDVFAKTPPLDNKDLANLCI 252
OctadecabacterAntarcticus          ISNNDRAPVNNAK-ATFLGFRPKDNAENWADSLLASAPPADPSDRAQMYL 257
SEQincconue                        VSDNDRSNMSNTD-SGHLGFQPKDNAEIYAGKIFSEDLTEELADEGNKLH 243
MethylobacteriumRadiotolerans      ASNNSRMTWWRKDGRAVIGWAPQDSADSHAAALEGKTSGNPVVER---YQ 260
ArthrobacterChlorophenolicus       VSANTRGWANLEA-GRAIGFEPQDDAEVFAAGIDTATEDGFAALLGGAWA 335
BradyrhizobiumJaponicum            ASLNERAWWDNHR-AYEFGYRPTGRAEDFREHAMAEQAKLKPDPVGDHYQ 252
HalorubrumLacusprofundi            ISNNDRRYYSIERAREVLGYDPADNSADYTFEGKPKDETGDENDNPTADG 273
HalobacteriumSalinarum             ISDNDRKYYSLARAKDALGYEPRDNSAEWD---------GDEK----LSG 253
HaloquadratumWalsbyi               ISDNDRKYYSIAHAKETLGYNPQDNSAEWQ---------GKER---IVKK 261
Cyanothece                         ISGNTRRYWDISNAQEILGYKPQNDAEDLIM------------------- 560
                                    . *             .*: *   :                        

StreptomycesCoelicolor             GGHFVTDPPIWPY------------------------------------- 269
StreptomycesGriseus                GGHFATDPPIWPH------------------------------------- 269
PseudomonasMendocina               GGAFVAAGPFGDD------------------------------------- 275
PseudomonasPutida                  GGAFAVAGPFN--------------------------------------- 268
Burkholderia2                      GGAFVAAGPFGG-------------------------------------- 291
LeptothrixCholodnii                GGPFVRTGPFD--------------------------------------- 272
BurkholderiaGraminis               GGPFVLGEPMESEKPR---------------------------------- 283
Burkholderia                       GGPFVLGEPMQAKR------------------------------------ 277
BurkholderiaDolosa                 GGGFVVGEPMERPR------------------------------------ 277
XanthobacterAutotrophicus          GGQFTQDPIFEEK------------------------------------- 266
SinorhizobiumMedicae               GGRHAALKLSD--------------------------------------- 261
Rhizobium                          GGIFAKQA------------------------------------------ 262
Sulfitobacter                      GGPFAAVDLGESGVASMNIVNDKKTT------------------------ 279
OceanibulbusIndolifex              GGPFAKVDLGESGLAQMTIVNDKKET------------------------ 280
RoseobacterDenitrificans           GGPFAKVDLGQSGLAQMNVVNDKKQT------------------------ 278
Rhodobacterales                    GGPFAGIELGNSAMSALNLNKDDTGKA----------------------- 279
Jannaschia                         GGPFGPVPLGQGGAAAAAKGDD---------------------------- 275
LoktanellaVestfoldensis            GGPFATVELGNSGVAVLGVVNDKKTT------------------------ 278
OctadecabacterAntarcticus          GGPFATVPLGESGVAGIKAMARAAQTASDASTGTRTDAKKLPSFLTKKGM 307
SEQincconue                        GGPFASTDLGVSAMDKMKIVYSHKGD------------------------ 269
MethylobacteriumRadiotolerans      GGGFTAIDYSRAEPPR---------------------------------- 276
ArthrobacterChlorophenolicus       G---SGHKVGMDNYPALAAK------------------------------ 352
BradyrhizobiumJaponicum            GGAFCSNEFDGDASRIIDWTKR---------------------------- 274
HalorubrumLacusprofundi            GETRFDDPPAEPNFPSDPDTPTDGA------------------------- 298
HalobacteriumSalinarum             GS------------------------------------------------ 255
HaloquadratumWalsbyi               GE------------------------------------------------ 263
Cyanothece                         --------------------------------------------------
                                                                                     

StreptomycesCoelicolor             --
StreptomycesGriseus                --
PseudomonasMendocina               --
PseudomonasPutida                  --
Burkholderia2                      --
LeptothrixCholodnii                --
BurkholderiaGraminis               --
Burkholderia                       --
BurkholderiaDolosa                 --
XanthobacterAutotrophicus          --
SinorhizobiumMedicae               --
Rhizobium                          --
Sulfitobacter                      --
OceanibulbusIndolifex              --
RoseobacterDenitrificans           --
Rhodobacterales                    --
Jannaschia                         --
LoktanellaVestfoldensis            --
OctadecabacterAntarcticus          NP 309
SEQincconue                        --
MethylobacteriumRadiotolerans      --
ArthrobacterChlorophenolicus       --
BradyrhizobiumJaponicum            --
HalorubrumLacusprofundi            --
HalobacteriumSalinarum             --
HaloquadratumWalsbyi               --
Cyanothece                         --

BLAST

PROTOCOLE:

a) BLASTp contre NR, paramètres par défaut au NCBI sauf "Number of descriptions=500"
b) BLASTp contre swissprot, paramètres par défaut au NCBI. 

---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

Comme nous savons dans quel cadre de lecture nous nous trouvons, on fait un BLASTp (comparaison de séquences
protéiques) plutôt qu'un BLASTx (qui est utile quand on est peu sûre de notre ORF, il permet 
ainsi de comparer notre séquence dans les 6 cadres de lecture, ce qui permet de n'exclure
aucun ORF potentiel). 

Dans les deux BLAST, nous avons des E-value très faibles ainsi que des alignements 2 à 2 
importants. 
Le BLAST contre nr est plus complet que le BLAST contre swissprot car nr est une banque plus vaste et contient notamment 
swissprot. (Nous avons quand même poursuivi l'analyse en comparant notre séquence contre swissprot, car nous 
pouvons avoir plus d'indications sachant que les fiches sont mieux remplies). 

Ainsi, les séquences trouvées à partir du BLASTp contre nr ont des E-value très faibles ( 2e-86 pour le meilleur 
résultat: ref|ZP_00963177.1|). Les identitées et les substitutions positives sont très nombreuses
( respectivement 56% et 73% pour le premier : ref|ZP_00963177.1|). 
Nous pouvons en conclure que ces séquences sont sûrement homologues à celle étudiée. On va donc se servir des séquences 
que nr contient pour notre recherche d'alignement multiple.
De plus, les E-value pour les séquences se trouvant à la fin du BLAST sont plus élevées (0,20 pour le dernier: 
ref|NP_614008.1|), et les scores moins important (40 pour la dernière séquence ref|NP_614008.1|). Ces séquences sont
donc moins susceptibles d'être homologues à la notre.
Il sera certainement nécessaire d'établir un seuil pour prélever les séquences que l'on mettra dans 
l'alignement multiple.

---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:

  a)
                                                                 Score     E
Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_00963177.1|  hypothetical protein NAS141_14633 [Sulfito...   322    2e-86
ref|ZP_00956351.1|  hypothetical protein EE36_09625 [Sulfitoba...   322    3e-86
ref|ZP_01741536.1|  3-beta hydroxysteroid dehydrogenase/isomer...   321    4e-86
ref|ZP_01446879.1|  hypothetical protein OM2255_05965 [alpha p...   305    3e-81
ref|YP_682350.1|  hypothetical protein RD1_2062 [Roseobacter d...   305    3e-81 
ref|ZP_02153157.1|  hypothetical protein OIHEL45_09438 [Oceani...   304    4e-81
ref|ZP_02140928.1|  hypothetical protein RLO149_17578 [Roseoba...   301    5e-80
gb|EDZ41018.1|  3-beta hydroxysteroid dehydrogenase/isomerase ...   292    2e-77
ref|ZP_01749088.1|  hypothetical protein RCCS2_04279 [Roseobac...   288    3e-76
ref|ZP_01001842.1|  hypothetical protein SKA53_09669 [Loktanel...   285    3e-75
ref|YP_511439.1|  3-beta hydroxysteroid dehydrogenase/isomeras...   280    7e-74 
ref|ZP_01155501.1|  hypothetical protein OG2516_07882 [Oceanic...   259    1e-67
gb|EDY91862.1|  3-beta hydroxysteroid dehydrogenase/isomerase ...   236    1e-60
gb|EDY77085.1|  3-beta hydroxysteroid dehydrogenase/isomerase ...   228    5e-58
ref|YP_001790149.1|  NAD-dependent epimerase/dehydratase [Lept...   192    3e-47 
ref|YP_001188784.1|  NAD-dependent epimerase/dehydratase [Pseu...   191    5e-47 
ref|YP_001985443.1|  putative nucleoside-diphosphate-sugar epi...   187    8e-46 
ref|YP_233998.1|  hypothetical protein Psyr_0902 [Pseudomonas ...   182    3e-44 
ref|YP_349181.1|  NAD-dependent epimerase/dehydratase [Pseudom...   181    5e-44 
ref|YP_273211.1|  hypothetical protein PSPPH_0937 [Pseudomonas...   181    6e-44 
ref|ZP_03395418.1|  conserved hypothetical protein [Pseudomona...   179    2e-43
ref|YP_001585126.1|  NAD-dependent epimerase/dehydratase [Burk...   179    3e-43 
ref|NP_790889.1|  hypothetical protein PSPTO_1053 [Pseudomonas...   178    4e-43 
ref|YP_996025.1|  NAD-dependent epimerase/dehydratase [Vermine...   177    6e-43 
ref|YP_001748063.1|  NAD-dependent epimerase/dehydratase [Pseu...   177    1e-42 
ref|YP_837085.1|  NAD-dependent epimerase/dehydratase [Burkhol...   176    1e-42 
ref|YP_001777709.1|  NAD-dependent epimerase/dehydratase [Burk...   176    1e-42 
ref|YP_001266550.1|  NAD-dependent epimerase/dehydratase [Pseu...   176    1e-42 
ref|NP_743331.1|  NAD-dependent epimerase/dehydratase [Pseudom...   176    1e-42 
ref|ZP_02884452.1|  NAD-dependent epimerase/dehydratase [Burkh...   176    2e-42
ref|YP_001861526.1|  NAD-dependent epimerase/dehydratase [Burk...   176    2e-42 
ref|YP_373471.1|  NAD-dependent epimerase/dehydratase [Burkhol...   176    2e-42 
ref|YP_001670464.1|  NAD-dependent epimerase/dehydratase [Pseu...   175    3e-42 
ref|YP_549921.1|  NAD-dependent epimerase/dehydratase [Polarom...   174    6e-42 
ref|NP_357458.2|  hypothetical protein Atu3143 [Agrobacterium ...   174    6e-42 
ref|YP_002100913.1|  Nucleoside-diphosphate-sugar epimerase [B...   174    7e-42 
ref|ZP_00945926.1|  dTDP-glucose 4,6-dehydratase [Ralstonia so...   174    8e-42
ref|ZP_02377121.1|  NAD-dependent epimerase/dehydratase [Burkh...   174    8e-42
ref|YP_001861791.1|  NAD-dependent epimerase/dehydratase [Burk...   174    8e-42 
ref|NP_522392.1|  hypothetical protein RS05364 [Ralstonia sola...   172    2e-41 
ref|YP_981826.1|  NAD-dependent epimerase/dehydratase [Polarom...   172    2e-41 
ref|YP_001116435.1|  NAD-dependent epimerase/dehydratase [Burk...   172    2e-41 
ref|ZP_02008544.1|  NAD-dependent epimerase/dehydratase [Ralst...   172    4e-41
ref|ZP_03264153.1|  NAD-dependent epimerase/dehydratase [Burkh...   171    4e-41
ref|YP_777118.1|  NAD-dependent epimerase/dehydratase [Burkhol...   171    4e-41 
ref|YP_553511.1|  hypothetical protein Bxe_B1807 [Burkholderia...   171    6e-41 
ref|YP_002233109.1|  NAD dependent epimerase/dehydratase famil...   171    8e-41 
ref|ZP_03265236.1|  NAD-dependent epimerase/dehydratase [Burkh...   168    5e-40
ref|ZP_02905604.1|  NAD-dependent epimerase/dehydratase [Burkh...   167    6e-40
ref|YP_574520.1|  NAD-dependent epimerase/dehydratase [Chromoh...   167    6e-40 
ref|ZP_02888283.1|  NAD-dependent epimerase/dehydratase [Burkh...   167    6e-40
ref|ZP_02886959.1|  NAD-dependent epimerase/dehydratase [Burkh...   167    8e-40
ref|YP_001888591.1|  NAD-dependent epimerase/dehydratase [Burk...   167    9e-40 
ref|YP_001267207.1|  NAD-dependent epimerase/dehydratase [Pseu...   166    2e-39 
ref|YP_553518.1|  hypothetical protein Bxe_B1800 [Burkholderia...   166    2e-39 
ref|YP_001810085.1|  NAD-dependent epimerase/dehydratase [Burk...   166    2e-39 
ref|ZP_02886970.1|  NAD-dependent epimerase/dehydratase [Burkh...   165    4e-39
ref|ZP_02372301.1|  hypothetical protein BthaT_14864 [Burkhold...   164    5e-39
ref|YP_001767607.1|  NAD-dependent epimerase/dehydratase [Meth...   164    6e-39 
ref|YP_001888601.1|  NAD-dependent epimerase/dehydratase [Burk...   164    7e-39 
ref|YP_970936.1|  NAD-dependent epimerase/dehydratase [Acidovo...   163    2e-38 
ref|ZP_02461926.1|  hypothetical protein Bpse38_01049 [Burkhol...   163    2e-38
ref|ZP_03265225.1|  NAD-dependent epimerase/dehydratase [Burkh...   163    2e-38
ref|NP_626162.1|  hypothetical protein SCO1896 [Streptomyces c...   162    2e-38 
ref|YP_593925.1|  NAD-dependent epimerase/dehydratase [Deinoco...   162    2e-38 
ref|NP_384213.1|  hypothetical protein SMc04145 [Sinorhizobium...   161    5e-38 
ref|YP_001328975.1|  NAD-dependent epimerase/dehydratase [Sino...   160    7e-38 
ref|YP_001985053.1|  putative UDP-glucose 4-epimerase protein ...   160    1e-37 
ref|ZP_02293950.1|  NAD-dependent epimerase/dehydratase [Rhizo...   158    4e-37
ref|ZP_02354049.1|  hypothetical protein BoklE_01149 [Burkhold...   158    5e-37
ref|YP_440749.1|  hypothetical protein BTH_I0191 [Burkholderia...   157    8e-37 
ref|ZP_02386156.1|  hypothetical protein BthaB_14549 [Burkhold...   157    9e-37
ref|YP_001371940.1|  NAD-dependent epimerase/dehydratase [Ochr...   157    9e-37 
ref|YP_001418259.1|  NAD-dependent epimerase/dehydratase [Xant...   156    2e-36 
ref|YP_472853.1|  hypothetical protein RHE_PF00236 [Rhizobium ...   155    2e-36 
ref|YP_002208099.1|  conserved hypothetical protein [Streptomy...   155    2e-36 
ref|NP_285545.1|  TDP-glucose-4,6-dehydratase-related protein ...   155    4e-36 
ref|ZP_02886116.1|  NAD-dependent epimerase/dehydratase [Burkh...   154    5e-36
ref|NP_769458.1|  hypothetical protein blr2818 [Bradyrhizobium...   154    5e-36 
ref|YP_765281.1|  putative dehydratase/epimerase [Rhizobium le...   154    6e-36 
ref|YP_001238868.1|  putative UDP-glucose 4-epimerase [Bradyrh...   153    1e-35 
ref|YP_001204547.1|  putative UDP-glucose 4-epimerase [Bradyrh...   152    3e-35 
ref|ZP_02188817.1|  hypothetical protein BAL199_27846 [alpha p...   152    4e-35
ref|YP_002279364.1|  NAD-dependent epimerase/dehydratase [Rhiz...   151    5e-35 
ref|NP_356669.1|  hypothetical protein Atu3972 [Agrobacterium ...   149    2e-34 
ref|ZP_02361226.1|  hypothetical protein BoklC_00829 [Burkhold...   145    2e-33
ref|ZP_01440880.1|  hypothetical protein FP2506_13479 [Fulvima...   145    2e-33
ref|NP_827535.1|  hypothetical protein SAV_6359 [Streptomyces ...   144    7e-33 
ref|YP_002005267.1|  hypothetical protein RALTA_A1237 [Cupriav...   143    1e-32 
gb|EDZ44505.1|  3-beta hydroxysteroid dehydrogenase/isomerase ...   142    2e-32
ref|YP_001827128.1|  hypothetical protein SGR_5616 [Streptomyc...   141    5e-32 
ref|YP_289201.1|  hypothetical protein Tfu_1140 [Thermobifida ...   141    7e-32 
ref|YP_001683424.1|  NAD-dependent epimerase/dehydratase [Caul...   139    3e-31 
ref|YP_001756074.1|  NAD-dependent epimerase/dehydratase [Meth...   137    1e-30 
ref|YP_001711016.1|  hypothetical protein CMS_2350 [Clavibacte...   125    2e-27 
ref|YP_001221106.1|  putative nucleoside-diphosphate-sugar epi...   124    9e-27 
ref|YP_001710636.1|  hypothetical protein CMS_1943 [Clavibacte...   124    9e-27 
ref|ZP_03276831.1|  NAD-dependent epimerase/dehydratase [Arthr...   122    3e-26
ref|YP_891047.1|  NAD-dependent epimerase/dehydratase [Mycobac...   122    3e-26 
gb|AAL17942.1|  putative UDP glucose epimerase [Mycobacterium ...   122    3e-26
ref|YP_712800.1|  putative UDP glucose epimerase (partial) [Fr...   121    6e-26 
ref|YP_002185189.1|  conserved hypothetical protein [Streptomy...   117    1e-24 
ref|YP_001223154.1|  putative NDP-sugar epimerase [Clavibacter...   117    1e-24 
ref|YP_924710.1|  NAD-dependent epimerase/dehydratase [Nocardi...   116    2e-24 
ref|ZP_03179667.1|  NAD-dependent epimerase/dehydratase [Strep...   114    7e-24
ref|YP_829982.1|  NAD-dependent epimerase/dehydratase [Arthrob...   113    2e-23 
ref|ZP_02838793.1|  NAD-dependent epimerase/dehydratase [Arthr...   112    4e-23
ref|ZP_03136287.1|  NAD-dependent epimerase/dehydratase [Cyano...   111    8e-23
ref|ZP_03040191.1|  NAD-dependent epimerase/dehydratase [Geoba...   101    8e-20
ref|YP_001476363.1|  NAD-dependent epimerase/dehydratase [Serr...   100    2e-19 
ref|ZP_02016112.1|  3-beta hydroxysteroid dehydrogenase/isomer...   100    2e-19
ref|YP_001688361.1|  dehydratase-like protein [Halobacterium s...  98.2    5e-19 
ref|NP_279270.1|  hypothetical protein VNG0128C [Halobacterium...  98.2    7e-19 
ref|YP_656920.1|  sugar epimerase/dehydratase-like protein [Ha...  94.4    8e-18 
ref|YP_261671.1|  TDP-glucose-4,6-dehydratase-related protein ...  94.4    9e-18 
ref|YP_325816.1|  sugar epimerase/dehydratase-like protein [Na...  92.8    3e-17 
ref|YP_136835.1|  hypothetical protein rrnAC2305 [Haloarcula m...  90.1    1e-16 
ref|YP_001157989.1|  3-beta hydroxysteroid dehydrogenase/isome...  83.2    2e-14 
ref|YP_001360973.1|  NAD-dependent epimerase/dehydratase [Kine...  80.1    2e-13 
ref|YP_001645945.1|  NAD-dependent epimerase/dehydratase [Baci...  75.9    3e-12 
ref|NP_693015.1|  hypothetical protein OB2094 [Oceanobacillus ...  71.6    6e-11 
ref|YP_001487885.1|  hypothetical protein BPUM_2667 [Bacillus ...  68.6    5e-10 
ref|YP_001875930.1|  NAD-dependent epimerase/dehydratase [Elus...  67.0    1e-09 
ref|ZP_01853167.1|  hypothetical protein PM8797T_09719 [Planct...  67.0    1e-09
ref|YP_174638.1|  nucleoside-diphosphate-sugar epimerase [Baci...  63.5    1e-08 
ref|ZP_03056408.1|  YtbQ [Bacillus pumilus ATCC 7061] >gb|EDW2...  63.5    1e-08
ref|ZP_02736295.1|  hypothetical protein GobsU_31079 [Gemmata ...  63.2    2e-08
ref|YP_001737199.1|  NAD-dependent epimerase/dehydratase [Cand...  60.8    1e-07 
ref|ZP_02185292.1|  TDP-glucose-4,6-dehydratase-related protei...  59.7    2e-07
gb|EDY35259.1|  NAD dependent epimerase/dehydratase family [Ac...  58.9    4e-07
ref|ZP_01441220.1|  hypothetical protein R2601_03243 [Roseovar...  58.9    4e-07
sp|P53560.1|YTBQ_BACSU  RecName: Full=Uncharacterized protein ...  58.5    5e-07
ref|ZP_02123179.1|  nucleoside-diphosphate-sugar epimerase [Me...  58.5    6e-07
ref|YP_080307.1|  YtbQ [Bacillus licheniformis ATCC 14580] >re...  57.8    8e-07 
gb|EDZ41195.1|  3-beta hydroxysteroid dehydrogenase/isomerase ...  57.4    1e-06
ref|ZP_02014144.1|  NAD-dependent epimerase/dehydratase [Opitu...  57.4    1e-06
ref|YP_001540693.1|  NAD-dependent epimerase/dehydratase [Cald...  57.0    1e-06 
ref|YP_947893.1|  putative UDP-glucose 4-epimerase [Arthrobact...  57.0    2e-06 
gb|EDY35348.1|  NAD dependent epimerase/dehydratase family [Ac...  56.6    2e-06
ref|ZP_03137201.1|  NAD-dependent epimerase/dehydratase [Cyano...  56.6    2e-06
ref|XP_001973498.1|  GG16117 [Drosophila erecta] >gb|EDV52524....  56.2    3e-06 
ref|YP_001278372.1|  NAD-dependent epimerase/dehydratase [Rose...  56.2    3e-06 
ref|NP_103218.1|  UDP-galactose 4-epimerase [Mesorhizobium lot...  56.2    3e-06 
gb|EEB15250.1|  threonine dehydrogenase, putative [Pediculus h...  55.1    6e-06
ref|YP_833534.1|  NAD-dependent epimerase/dehydratase [Arthrob...  54.7    8e-06 
ref|ZP_02848698.1|  NAD-dependent epimerase/dehydratase [Paeni...  54.3    9e-06
ref|XP_001985354.1|  GH14551 [Drosophila grimshawi] >gb|EDV977...  54.3    1e-05 
ref|XP_001957284.1|  GF10346 [Drosophila ananassae] >gb|EDV400...  54.3    1e-05 
ref|NP_110973.1|  UDP-glucose 4-epimerase [Thermoplasma volcan...  54.3    1e-05 
ref|XP_002095450.1|  GE19685 [Drosophila yakuba] >gb|EDW95162....  53.9    1e-05 
ref|XP_002040676.1|  GM22296 [Drosophila sechellia] >gb|EDW442...  53.9    1e-05 
ref|NP_649230.1|  CG5955 CG5955-PA [Drosophila melanogaster] >...  53.9    1e-05 
ref|XP_002086630.1|  GE23237 [Drosophila yakuba] >gb|EDX00032....  53.9    1e-05 
ref|XP_002085663.1|  GD14889 [Drosophila simulans] >gb|EDX1124...  53.9    1e-05 
ref|YP_001541261.1|  NAD-dependent epimerase/dehydratase [Cald...  53.9    1e-05 
gb|EDZ62418.1|  polysaccharide biosynthesis protein [Campyloba...  53.5    2e-05
ref|XP_002069023.1|  GK12293 [Drosophila willistoni] >gb|EDW80...  53.5    2e-05 
ref|YP_359903.1|  hypothetical protein CHY_1057 [Carboxydother...  53.5    2e-05 
ref|NP_001037542.1|  L-threonine dehydrogenase [Bombyx mori] >...  53.1    2e-05 
ref|ZP_01171414.1|  nucleoside-diphosphate-sugar epimerase [Ba...  53.1    2e-05
ref|ZP_03264229.1|  NAD-dependent epimerase/dehydratase [Burkh...  53.1    2e-05
ref|NP_248049.1|  capsular polysaccharide biosynthesis protein...  52.8    3e-05 
ref|ZP_02014696.1|  Fructose-bisphosphate aldolase [Halorubrum...  52.8    3e-05
gb|EDX72406.1|  NAD dependent epimerase/dehydratase family [Mi...  52.8    3e-05
ref|YP_001211645.1|  nucleoside-diphosphate-sugar epimerases [...  52.4    3e-05 
ref|XP_002008271.1|  GI13398 [Drosophila mojavensis] >gb|EDW18...  52.4    4e-05 
ref|YP_746674.1|  NAD-dependent epimerase/dehydratase [Nitroso...  52.4    4e-05 
ref|XP_002026857.1|  GL12790 [Drosophila persimilis] >gb|EDW34...  52.0    4e-05 
ref|NP_390896.1|  hypothetical protein BSU30180 [Bacillus subt...  52.0    4e-05 
ref|YP_298058.1|  NAD-dependent epimerase/dehydratase [Ralston...  52.0    4e-05 
ref|XP_001352985.2|  GA19257 [Drosophila pseudoobscura pseudoo...  52.0    5e-05 
ref|YP_001324613.1|  NAD-dependent epimerase/dehydratase [Meth...  52.0    5e-05 
ref|ZP_03109102.1|  conserved hypothetical protein [Bacillus c...  52.0    5e-05
ref|XP_002048112.1|  GJ11523 [Drosophila virilis] >gb|EDW70454...  52.0    5e-05 
ref|ZP_02168031.1|  pprobable nucleoside-diphosphate-sugar epi...  51.6    6e-05
ref|NP_394570.1|  UDP-glucose 4-epimerase related protein [The...  51.2    7e-05 
ref|XP_001743306.1|  hypothetical protein [Monosiga brevicolli...  51.2    8e-05 
gb|EEA32573.1|  hypothetical protein BRAFLDRAFT_116658 [Branch...  50.8    1e-04
ref|XP_320583.3|  AGAP011948-PA [Anopheles gambiae str. PEST] ...  50.8    1e-04 
ref|YP_001237730.1|  putative UDP-glucose 4-epimerase [Bradyrh...  50.8    1e-04 
ref|ZP_00739488.1|  L-threonine 3-dehydrogenase [Bacillus thur...  50.8    1e-04
ref|ZP_02587759.1|  L-threonine 3-dehydrogenase [Bacillus cere...  50.4    1e-04
ref|YP_001208046.1|  putative UDP-glucose 4-epimerase [Bradyrh...  50.4    1e-04 
ref|XP_001849632.1|  threonine dehydrogenase [Culex quinquefas...  50.4    1e-04 
ref|ZP_02169273.1|  transposase IS66 [Bacillus selenitireducen...  50.4    1e-04
ref|ZP_03239035.1|  conserved hypothetical protein [Bacillus c...  50.4    1e-04
ref|NP_843152.1|  hypothetical protein BA0621 [Bacillus anthra...  50.1    2e-04 
ref|XP_001656812.1|  threonine dehydrogenase [Aedes aegypti] >...  50.1    2e-04 
ref|ZP_03228587.1|  conserved hypothetical protein [Bacillus c...  50.1    2e-04
gb|AAL89661.1|AF411956_2  threonine dehydrogenase [Takifugu ru...  50.1    2e-04
ref|ZP_02467853.1|  NAD-dependent epimerase/dehydratase [Burkh...  50.1    2e-04
ref|YP_034878.1|  NAD-dependent epimerase/dehydratase; L-threo...  50.1    2e-04 
ref|YP_893455.1|  L-threonine 3-dehydrogenase [Bacillus thurin...  50.1    2e-04 
ref|YP_082137.1|  NAD-dependent epimerase; UDP-glucose 4-epime...  50.1    2e-04 
ref|ZP_01158031.1|  probable UDP-glucose 4-epimerase [Oceanico...  49.7    2e-04
ref|NP_830438.1|  L-threonine 3-dehydrogenase [Bacillus cereus...  49.7    2e-04 
ref|NP_977014.1|  hypothetical protein BCE_0689 [Bacillus cere...  49.7    2e-04 
ref|YP_002246576.1|  putative dihydroflavonol 4-reductase [Cop...  49.7    2e-04 
ref|YP_001643429.1|  NAD-dependent epimerase/dehydratase [Baci...  49.7    2e-04 
ref|ZP_02255476.1|  NAD-dependent epimerase/dehydratase family...  49.7    2e-04
ref|YP_001340753.1|  NAD-dependent epimerase/dehydratase [Mari...  49.7    2e-04 
ref|YP_658216.1|  nucleoside-diphosphate-sugar epimerase ( UDP...  49.7    2e-04 
ref|XP_664002.1|  hypothetical protein AN6398.2 [Aspergillus n...  49.7    2e-04 
gb|EDY81046.1|  hypothetical protein VDG1235_663 [Verrucomicro...  49.7    3e-04
ref|NP_693003.1|  UDP-glucose 4-epimerase [Oceanobacillus ihey...  49.7    3e-04 
ref|ZP_02130652.1|  NAD-dependent epimerase/dehydratase [Desul...  49.7    3e-04
ref|ZP_00207811.1|  COG0451: Nucleoside-diphosphate-sugar epim...  49.3    3e-04
ref|ZP_01549327.1|  pprobable nucleoside-diphosphate-sugar epi...  49.3    3e-04
ref|NP_102869.1|  UDP-glucose 4-epimerase [Mesorhizobium loti ...  49.3    4e-04 
ref|ZP_01060856.1|  putative oxidoreductase protein [Flavobact...  48.9    4e-04
ref|ZP_02186903.1|  hypothetical protein BAL199_24099 [alpha p...  48.5    5e-04
gb|ABK95493.1|  unknown [Populus trichocarpa]                      48.1    6e-04
ref|YP_714942.1|  hypothetical protein FRAAL4758 [Frankia alni...  48.1    7e-04 
gb|EDZ59849.1|  UDP-glucose 4-epimerase [Candidatus Pelagibact...  48.1    7e-04
ref|YP_001418446.1|  NAD-dependent epimerase/dehydratase [Xant...  48.1    7e-04 
ref|NP_067455.4|  L-threonine dehydrogenase [Mus musculus] >gb...  47.8    8e-04 
gb|ABB72807.1|  NAD-dependent epimerase/dehydratase family pro...  47.8    8e-04
ref|ZP_00995528.1|  probable UDP-glucose 4-epimerase [Janibact...  47.8    8e-04
ref|NP_841721.1|  epimerase [Nitrosomonas europaea ATCC 19718]...  47.8    9e-04 
gb|EEA31600.1|  hypothetical protein BRAFLDRAFT_256874 [Branch...  47.8    9e-04
ref|ZP_01666376.1|  NAD-dependent epimerase/dehydratase [Therm...  47.8    0.001
ref|NP_001099514.1|  L-threonine dehydrogenase [Rattus norvegi...  47.8    0.001 
ref|YP_429612.1|  NAD-dependent epimerase/dehydratase [Moorell...  47.8    0.001 
gb|EDY36243.1|  NAD dependent epimerase/dehydratase family [Ac...  47.8    0.001
ref|YP_001373879.1|  NAD-dependent epimerase/dehydratase [Baci...  47.8    0.001 
ref|YP_303607.1|  dTDP-glucose 4,6-dehydratase [Methanosarcina...  47.4    0.001 
ref|YP_827132.1|  NAD-dependent epimerase/dehydratase [Solibac...  47.4    0.001 
ref|NP_885684.1|  hypothetical protein BPP3524 [Bordetella par...  47.4    0.001 
ref|NP_890493.1|  hypothetical protein BB3959 [Bordetella bron...  47.4    0.001 
ref|ZP_02848256.1|  NAD-dependent epimerase/dehydratase [Paeni...  47.4    0.001
ref|YP_001417595.1|  NAD-dependent epimerase/dehydratase [Xant...  47.0    0.001 
ref|YP_001513474.1|  NAD-dependent epimerase/dehydratase [Alka...  47.0    0.001 
ref|ZP_01717798.1|  probable nucleoside-diphosphate-sugar epim...  47.0    0.002
ref|ZP_02192493.1|  NAD-dependent epimerase/dehydratase [Metha...  47.0    0.002
ref|ZP_03285434.1|  NAD-dependent epimerase/dehydratase [Dicty...  47.0    0.002
ref|YP_685010.1|  putative UDP-glucose 4-epimerase [uncultured...  46.6    0.002 
sp|A2Z7B3.1|GME1_ORYSI  RecName: Full=GDP-mannose 3,5-epimeras...  46.6    0.002
ref|YP_764622.1|  putative UDP-glucose 4-epimerase [Rhizobium ...  46.6    0.002 
gb|ABG66078.1|  NAD dependent epimerase/dehydratase family pro...  46.6    0.002
ref|XP_001606168.1|  PREDICTED: similar to CG5955-PA [Nasonia ...  46.6    0.002 
ref|ZP_01859543.1|  NAD-dependent epimerase; possible UDP-gluc...  46.6    0.002
gb|ACG32271.1|  unknown [Zea mays]                                 46.6    0.002
ref|XP_534558.2|  PREDICTED: similar to L-threonine dehydrogen...  46.2    0.002 
ref|NP_001064609.1|  Os10g0417600 [Oryza sativa (japonica cult...  46.2    0.002 
ref|YP_304692.1|  dTDP-glucose 4,6-dehydratase [Methanosarcina...  46.2    0.003 
ref|ZP_01690733.1|  L-threonine dehydrogenase [Microscilla mar...  46.2    0.003
ref|ZP_02975192.1|  NAD-dependent epimerase/dehydratase [Cyano...  46.2    0.003
gb|EAY57004.1|  Nucleoside-diphosphate-sugar epimerase [Leptos...  46.2    0.003
sp|Q8K3F7.1|TDH_MOUSE  RecName: Full=L-threonine 3-dehydrogena...  46.2    0.003 
emb|CAO80575.1|  UDP-glucose 4-epimerase (Galactowaldenase) (U...  46.2    0.003
ref|YP_586935.1|  L-threonine 3-dehydrogenase [Ralstonia metal...  45.8    0.003 
ref|YP_001322932.1|  NAD-dependent epimerase/dehydratase [Meth...  45.8    0.003 
ref|YP_001176684.1|  NAD-dependent epimerase/dehydratase [Ente...  45.8    0.003 
gb|ABK24250.1|  unknown [Picea sitchensis]                         45.8    0.003
ref|YP_889972.1|  putative long-chain fatty-acid--CoA ligase [...  45.8    0.003 
ref|YP_002232232.1|  putative nucleotide sugar epimerase/dehyd...  45.8    0.004 
gb|EEC11916.1|  threonine dehydrogenase, putative [Ixodes scap...  45.8    0.004
ref|YP_001807486.1|  NAD-dependent epimerase/dehydratase [Burk...  45.8    0.004 
ref|ZP_02908528.1|  NAD-dependent epimerase/dehydratase [Burkh...  45.8    0.004
gb|EDY41307.1|  NAD dependent epimerase/dehydratase family [Th...  45.8    0.004
ref|YP_001040311.1|  NAD-dependent epimerase/dehydratase [Stap...  45.8    0.004 
ref|XP_393912.2|  PREDICTED: similar to CG5955-PA [Apis mellif...  45.8    0.004 
gb|EDY37109.1|  NAD dependent epimerase/dehydratase family [Ac...  45.8    0.004
ref|NP_001130997.1|  hypothetical protein LOC100192102 [Zea ma...  45.4    0.004 
ref|NP_385447.1|  putative oxidoreductase protein [Sinorhizobi...  45.4    0.004 
ref|YP_419424.1|  UDP-glucose 4-epimerase [Magnetospirillum ma...  45.4    0.004 
ref|YP_002099068.1|  Nucleoside-diphosphate-sugar epimerase [B...  45.4    0.005 
ref|YP_001705436.1|  fatty-acid-coa ligase FadD [Mycobacterium...  45.4    0.005 
ref|YP_606333.1|  NAD-dependent epimerase/dehydratase family p...  45.4    0.005 
ref|XP_001272525.1|  UDP-galactose 4-epimerase, putative [Aspe...  45.4    0.005 
ref|YP_138099.1|  UDP-glucose 4-epimerase [Haloarcula marismor...  45.4    0.005 
ref|ZP_01106218.1|  NAD-dependent epimerase/dehydratase:Short-...  45.1    0.006
ref|ZP_02849609.1|  NAD-dependent epimerase/dehydratase [Paeni...  45.1    0.006
ref|YP_566236.1|  NAD-dependent epimerase/dehydratase [Methano...  45.1    0.006 
ref|YP_503561.1|  NAD-dependent epimerase/dehydratase [Methano...  45.1    0.006 
ref|YP_001747428.1|  NAD-dependent epimerase/dehydratase [Pseu...  45.1    0.006 
ref|YP_658400.1|  nucleoside-diphosphate-sugar epimerase 1 ( U...  45.1    0.006 
ref|NP_001039569.1|  L-threonine dehydrogenase [Bos taurus] >s...  45.1    0.006 
ref|NP_579517.1|  NDP-sugar dehydratase or epimerase [Pyrococc...  45.1    0.007 
ref|ZP_00826197.1|  COG0451: Nucleoside-diphosphate-sugar epim...  44.7    0.007
ref|NP_001092887.1|  hypothetical protein LOC556781 [Danio rer...  44.7    0.007 
ref|ZP_01225091.1|  oxidoreductase [marine gamma proteobacteri...  44.7    0.007
ref|YP_001709264.1|  putative epimerase/dehydratase [Clavibact...  44.7    0.007 
gb|ABD97517.1|  hydroxysteroid dehydrogenase [Cowpox virus]        44.7    0.007
ref|YP_001230453.1|  NAD-dependent epimerase/dehydratase [Geob...  44.7    0.008 
ref|ZP_01043212.1|  UDP-galactose 4-epimerase, putative [Idiom...  44.7    0.008
gb|AAQ93267.1|  hydroxysteroid dehydrogenase [Vaccinia virus] ...  44.7    0.008
gb|ABH08275.1|  HSPV166 [Horsepox virus]                           44.7    0.008
ref|NP_671662.1|  EVM143 [Ectromelia virus] >gb|AAM92448.1|AF5...  44.7    0.008 
ref|ZP_02838500.1|  NAD-dependent epimerase/dehydratase [Arthr...  44.7    0.008
ref|NP_998410.1|  L-threonine dehydrogenase [Danio rerio] >gb|...  44.7    0.008 
gb|EEB16703.1|  UDP-glucose 4-epimerase, putative [Pediculus h...  44.7    0.008
ref|YP_001097025.1|  UDP-glucuronate 5'-epimerase [Methanococc...  44.7    0.008 
gb|AAX78462.1|  unknown [synthetic construct]                      44.7    0.008
ref|YP_982942.1|  NAD-dependent epimerase/dehydratase [Polarom...  44.7    0.008 
ref|YP_001189353.1|  NAD-dependent epimerase/dehydratase [Pseu...  44.7    0.009 
emb|CAD90714.1|  A47L protein [Cowpox virus]                       44.7    0.009
sp|P21097.1|3BHS_VACCC  RecName: Full=3 beta-hydroxysteroid de...  44.7    0.009
gb|ABD52661.1|  3 beta-hydroxysteroid dehydrogenase/delta 5-de...  44.7    0.009
ref|YP_001326659.1|  NAD-dependent epimerase/dehydratase [Sino...  44.3    0.009 
gb|AAW23605.1|  hydroxysteroid dehydrogenase [Vaccinia virus] ...  44.3    0.009
gb|ABD98640.1|  VACV-DUKE-178 [Vaccinia virus]                     44.3    0.009
gb|AAS49866.1|  RPXV153 [Rabbitpox virus]                          44.3    0.009
ref|NP_570554.1|  CMLV164 [Camelpox virus] >gb|AAL73871.1|AF43...  44.3    0.009 
gb|AAF34055.1|  TA55L [Vaccinia virus (strain Tian Tan)] >gb|A...  44.3    0.009
ref|YP_233052.1|  hydroxysteroid dehydrogenase [Vaccinia virus...  44.3    0.009 
ref|YP_566651.1|  NAD-dependent epimerase/dehydratase [Methano...  44.3    0.009 
emb|CAM58342.1|  3 beta-hydroxysteroid dehydrogenase [Vaccinia...  44.3    0.009
gb|AAG37660.1|  CMP161L [Camelpox virus CMS]                       44.3    0.009
ref|NP_619964.1|  CPXV182 protein [Cowpox virus] >gb|AAM13622....  44.3    0.009 
ref|NP_536582.1|  A45L [Monkeypox virus] >gb|AAL40613.1|AF3801...  44.3    0.009 
gb|AAU01359.1|  MPXV-WRAIR149 [Monkeypox virus] >gb|AAW67907.1...  44.3    0.010
sp|O57245.1|3BHS_VACCA  RecName: Full=3 beta-hydroxysteroid de...  44.3    0.010
ref|ZP_02491139.1|  NAD-dependent epimerase/dehydratase [Burkh...  44.3    0.010
gb|ABB53472.1|  GDP-D-mannose-3',5'-epimerase [Malpighia glabra]   44.3    0.010
ref|YP_001221375.1|  putative NDP-sugar epimerase [Clavibacter...  44.3    0.011 
ref|YP_100269.1|  NAD-dependent nucleotide-diphosphate-sugar e...  44.3    0.012 
ref|YP_521718.1|  NAD-dependent epimerase/dehydratase [Rhodofe...  43.9    0.012 
ref|YP_001169627.1|  glutamine amidotransferase [Rhodobacter s...  43.9    0.012 
ref|XP_789391.2|  PREDICTED: similar to ENSANGP00000015264 [St...  43.9    0.012 
ref|YP_001764155.1|  NAD-dependent epimerase/dehydratase [Burk...  43.9    0.013 
ref|ZP_01235954.1|  epimerase/dehydratase, putative [Vibrio an...  43.9    0.013
ref|ZP_01226571.1|  UDP-glucose 4-epimerase [Aurantimonas sp. ...  43.9    0.013
ref|YP_001673618.1|  polysaccharide biosynthesis protein CapD ...  43.9    0.014 
ref|YP_001362595.1|  NAD-dependent epimerase/dehydratase [Kine...  43.9    0.014 
gb|ACG36947.1|  unknown [Zea mays]                                 43.9    0.015
ref|ZP_03267643.1|  NAD-dependent epimerase/dehydratase [Burkh...  43.5    0.015
gb|ABK24746.1|  unknown [Picea sitchensis]                         43.5    0.015
ref|NP_354938.2|  UDP-glucose 4-epimerase [Agrobacterium tumef...  43.5    0.016 
gb|EAY97654.1|  hypothetical protein OsI_018887 [Oryza sativa ...  43.5    0.017
ref|XP_002149892.1|  UDP-galactose 4-epimerase, putative [Peni...  43.5    0.017 
ref|ZP_01126015.1|  probable nucleotide sugar dehydratase [Nit...  43.5    0.017
ref|NP_999169.1|  L-threonine 3-dehydrogenase [Sus scrofa] >sp...  43.5    0.017 
ref|ZP_02889824.1|  NAD-dependent epimerase/dehydratase [Burkh...  43.5    0.018
ref|NP_001068183.1|  Os11g0591100 [Oryza sativa (japonica cult...  43.5    0.018 
ref|ZP_01574546.1|  UDP-glucose 4-epimerase [Clostridium cellu...  43.5    0.018
ref|YP_551154.1|  L-threonine 3-dehydrogenase [Polaromonas sp....  43.5    0.019 
gb|ABA94523.1|  NAD dependent epimerase/dehydratase family pro...  43.5    0.019
ref|YP_411127.1|  NAD-dependent epimerase/dehydratase [Nitroso...  43.5    0.020 
ref|YP_612278.1|  NAD-dependent epimerase/dehydratase [Silicib...  43.5    0.020 
ref|YP_722193.1|  NAD-dependent epimerase/dehydratase [Trichod...  43.5    0.020 
ref|YP_620291.1|  NAD-dependent epimerase/dehydratase [Burkhol...  43.1    0.020 
ref|YP_001433156.1|  NAD-dependent epimerase/dehydratase [Rose...  43.1    0.021 
ref|YP_001931236.1|  ADP-L-glycero-D-manno-heptose-6-epimerase...  43.1    0.022 
ref|ZP_01697323.1|  NAD-dependent epimerase/dehydratase [Bacil...  43.1    0.022
ref|YP_772656.1|  NAD-dependent epimerase/dehydratase [Burkhol...  43.1    0.023 
ref|ZP_03124345.1|  putative L-threonine dehydrogenase [Clostr...  43.1    0.023
ref|ZP_02736702.1|  NAD-dependent epimerase/dehydratase [Gemma...  43.1    0.023
ref|ZP_01467339.1|  UDP-glucose 4-epimerase [Stigmatella auran...  43.1    0.024
ref|YP_001703694.1|  fatty-acid-CoA ligase FadD [Mycobacterium...  43.1    0.024 
emb|CAG09105.1|  unnamed protein product [Tetraodon nigroviridis]  43.1    0.025
ref|ZP_00369511.1|  UDP-glucose 4-epimerase, putative [Campylo...  43.1    0.025
ref|YP_754610.1|  UDP-glucose 4-epimerase [Syntrophomonas wolf...  43.1    0.026 
ref|NP_001084832.1|  hypothetical protein LOC431878 [Xenopus l...  43.1    0.026 
ref|ZP_03195606.1|  putative UDP-glucose 4-epimerase protein [...  42.7    0.027
ref|XP_001915437.1|  PREDICTED: similar to L-threonine dehydro...  42.7    0.027 
ref|YP_002206123.1|  NAD-dependent epimerase/dehydratase [Stre...  42.7    0.027 
ref|YP_947292.1|  putative UDP-galactose 4-epimerase [Arthroba...  42.7    0.028 
ref|ZP_03042035.1|  NAD-dependent epimerase/dehydratase [Geoba...  42.7    0.028
ref|YP_001190275.1|  NAD-dependent epimerase/dehydratase [Meta...  42.7    0.028 
ref|YP_461159.1|  L-threonine 3-dehydrogenase [Syntrophus acid...  42.7    0.028 
ref|ZP_02191560.1|  hypothetical protein BAL199_18431 [alpha p...  42.7    0.029
ref|NP_770306.1|  nucleoside-diphosphate-sugar epimerase [Brad...  42.7    0.029 
ref|ZP_02005365.1|  NAD-dependent epimerase/dehydratase [Ralst...  42.7    0.029
ref|NP_247180.1|  UDP-glucose 4-epimerase (galE) [Methanocaldo...  42.7    0.029 
emb|CAO71271.1|  unnamed protein product [Vitis vinifera]          42.7    0.029
gb|ABQ41112.1|  GDP-mannose-3',5'-epimerase [Vitis vinifera]       42.7    0.030
ref|YP_001274741.1|  NAD-dependent epimerase/dehydratase [Rose...  42.7    0.030 
ref|NP_633186.1|  UDP-N-acetylglucosamine 4-epimerase [Methano...  42.7    0.030 
emb|CAN69149.1|  hypothetical protein [Vitis vinifera]             42.7    0.030
ref|YP_001276722.1|  NAD-dependent epimerase/dehydratase [Rose...  42.7    0.031 
ref|XP_519604.2|  PREDICTED: hypothetical protein [Pan troglod...  42.7    0.032 
ref|NP_810283.1|  NAD dependent nucleotide-diphosphate-sugar e...  42.7    0.032 
ref|NP_294434.1|  UDP-glucose 4-epimerase, putative [Deinococc...  42.7    0.032 
gb|AAF61395.2|AF134346_1  L-threonine 3-dehydrogenase [Mus mus...  42.7    0.032 
ref|YP_631928.1|  short chain dehydrogenase/reductase family o...  42.7    0.033 
emb|CAO43062.1|  unnamed protein product [Vitis vinifera]          42.7    0.033
ref|NP_619325.1|  dTDP-glucose 4,6-dehydratase [Methanosarcina...  42.7    0.034 
ref|XP_001262661.1|  UDP-galactose 4-epimerase, putative [Neos...  42.4    0.036 
gb|EDY75348.1|  NAD dependent epimerase/dehydratase family [Oc...  42.4    0.036
emb|CAJ73315.1|  similar to uridine 5'-diphospho-glucose 4-epi...  42.4    0.036
ref|YP_001265888.1|  NAD-dependent epimerase/dehydratase [Pseu...  42.4    0.039 
ref|ZP_02292790.1|  NAD-dependent epimerase/dehydratase [Rhizo...  42.4    0.039
ref|NP_001120501.1|  hypothetical protein LOC100145626 [Xenopu...  42.4    0.040 
ref|NP_882483.1|  NAD dependent epimerase/dehydratase family p...  42.4    0.040 
ref|YP_001430333.1|  NAD-dependent epimerase/dehydratase [Rose...  42.4    0.041 
ref|YP_304670.1|  dTDP-glucose 4,6-dehydratase [Methanosarcina...  42.4    0.041 
ref|YP_002248436.1|  NAD-dependent epimerase/dehydratase famil...  42.4    0.041 
ref|YP_001666793.1|  NAD-dependent epimerase/dehydratase [Pseu...  42.4    0.042 
ref|XP_001606062.1|  PREDICTED: similar to UDP-glucose 4-epime...  42.4    0.042 
ref|XP_746893.1|  UDP-galactose 4-epimerase [Aspergillus fumig...  42.4    0.042 
ref|ZP_01171298.1|  NAD-dependent epimerase; possible UDP-gluc...  42.4    0.043
ref|ZP_02733654.1|  NAD-dependent epimerase/dehydratase [Gemma...  42.0    0.045
ref|NP_125996.1|  UDP-glucose 4-epimerase [Pyrococcus abyssi G...  42.0    0.045 
ref|ZP_02063267.1|  hypothetical protein BACOVA_00210 [Bactero...  42.0    0.045
ref|YP_469182.1|  p nucleoside-diphosphate-sugar epimerase pro...  42.0    0.045 
ref|YP_001977882.1|  probable nucleoside-diphosphate-sugar epi...  42.0    0.046 
ref|YP_002280837.1|  NAD-dependent epimerase/dehydratase [Rhiz...  42.0    0.047 
ref|YP_001704097.1|  putative fatty-acid-CoA ligase [Mycobacte...  42.0    0.047 
ref|YP_002092147.1|  Nucleoside-diphosphate-sugar epimerase [B...  42.0    0.047 
pdb|2C5E|A  Chain A, Gdp-Mannose-3', 5'-Epimerase (Arabidopsis...  42.0    0.048 
ref|NP_198236.1|  GME (GDP-D-MANNOSE 3',5'-EPIMERASE); GDP-man...  42.0    0.049 
ref|YP_001171355.1|  epimerase [Pseudomonas stutzeri A1501] >g...  42.0    0.049 
ref|NP_001084635.1|  hypothetical protein LOC414592 [Xenopus l...  42.0    0.049 
ref|ZP_03132248.1|  NAD-dependent epimerase/dehydratase [Chtho...  42.0    0.050
pdb|2C59|A  Chain A, Gdp-Mannose-3', 5'-Epimerase (Arabidopsis...  42.0    0.051 
ref|ZP_03057006.1|  NAD dependent epimerase/dehydratase family...  42.0    0.052
gb|EDP47986.1|  UDP-galactose 4-epimerase, putative [Aspergill...  42.0    0.053
ref|YP_001984892.1|  putative UDP-glucose 4-epimerase protein ...  42.0    0.053 
ref|ZP_03177706.1|  NAD-dependent epimerase/dehydratase [Strep...  42.0    0.054
ref|NP_742665.1|  NAD-dependent epimerase/dehydratase [Pseudom...  42.0    0.055 
ref|ZP_01960896.1|  hypothetical protein BACCAC_02516 [Bactero...  42.0    0.055
ref|XP_420039.1|  PREDICTED: similar to MGC83195 protein [Gall...  42.0    0.055 
ref|YP_001319541.1|  NAD-dependent epimerase/dehydratase [Alka...  42.0    0.056 
ref|YP_002008582.1|  putative NAD-dependent epimerase/dehydrat...  41.6    0.058 
ref|YP_767362.1|  putative dehydratase/oxidoreductase [Rhizobi...  41.6    0.059 
ref|XP_001774081.1|  predicted protein [Physcomitrella patens ...  41.6    0.060 
ref|YP_002187381.1|  UDP-galactose 4-epimerase [Streptomyces s...  41.6    0.062 
ref|YP_899047.1|  NAD dependent epimerase [Francisella tularen...  41.6    0.064 
ref|YP_842717.1|  NAD-dependent epimerase/dehydratase [Methano...  41.6    0.065 
ref|YP_331058.1|  nucleoside-diphosphate-sugar epimerase 1 ( U...  41.6    0.067 
ref|XP_001902060.1|  epimerase/reductase [Brugia malayi] >gb|E...  41.6    0.069 
ref|ZP_02295144.1|  NAD-dependent epimerase/dehydratase [Rhizo...  41.6    0.075
ref|ZP_02584348.1|  polysaccharide biosynthesis protein CapD [...  41.2    0.076
gb|AAX77862.1|  unknown protein [synthetic construct]              41.2    0.076
ref|YP_001121465.1|  NAD-dependent epimerase/dehydratase famil...  41.2    0.078 
ref|ZP_01689045.1|  NAD dependent epimerase/dehydratase family...  41.2    0.078
ref|YP_170396.1|  NAD dependent epimerase [Francisella tularen...  41.2    0.080 
ref|ZP_00741534.1|  UDP-N-acetylglucosamine 4,6-dehydratase [B...  41.2    0.080
gb|EDN35020.1|  UDP-glucose 4-epimerase [Francisella tularensi...  41.2    0.081
ref|XP_001027419.1|  cinnamoyl CoA reductase [Tetrahymena ther...  41.2    0.082 
ref|YP_513357.1|  NAD dependent epimerase [Francisella tularen...  41.2    0.084 
ref|ZP_02884364.1|  NAD-dependent epimerase/dehydratase [Burkh...  41.2    0.084
ref|ZP_03307100.1|  hypothetical protein BACFIN_01433 [Bactero...  41.2    0.086
ref|XP_001382015.1|  PREDICTED: hypothetical protein [Monodelp...  41.2    0.086 
gb|ABK81663.1|  WbtF [Francisella tularensis subsp. novicida]      41.2    0.086
gb|EDY38441.1|  putative long-chain fatty-acid--CoA ligase [Cy...  41.2    0.087
ref|XP_001778348.1|  predicted protein [Physcomitrella patens ...  41.2    0.089 
ref|YP_763198.1|  UDP-glucose 4-epimerase [Francisella tularen...  41.2    0.089 
ref|YP_298994.1|  L-threonine 3-dehydrogenase [Ralstonia eutro...  41.2    0.090 
ref|ZP_01803681.1|  hypothetical protein CdifQ_04002073 [Clost...  41.2    0.091
ref|XP_415754.1|  PREDICTED: similar to Hydroxy-delta-5-steroi...  41.2    0.091 
ref|YP_002303651.1|  NAD dependent epimerase/dehydratase famil...  41.2    0.092 
ref|YP_001088298.1|  putative L-threonine dehydrogenase [Clost...  41.2    0.092 
ref|YP_002167253.1|  UDP-glucose 4-epimerase [Francisella tula...  41.2    0.093 
ref|YP_001862204.1|  NAD-dependent epimerase/dehydratase [Burk...  41.2    0.094 
pdb|2C54|A  Chain A, Gdp-Mannose-3', 5'-Epimerase (Arabidopsis...  41.2    0.098 
ref|YP_001703695.1|  fatty-acid-CoA ligase FadD [Mycobacterium...  40.8    0.10  
ref|XP_001506425.1|  PREDICTED: similar to MGC83195 protein [O...  40.8    0.11  
gb|AAR91681.1|  ATP/NADPH-dependent carboxylic acid reductase ...  40.8    0.11 
ref|NP_593981.1|  flavonol reductase/cinnamoyl-CoA reductase f...  40.8    0.11  
ref|NP_111421.1|  dTDP-D-glucose 4,6-dehydratase [Thermoplasma...  40.8    0.11  
ref|ZP_03037398.1|  NAD-dependent epimerase/dehydratase [Geoba...  40.8    0.11 
ref|YP_001356850.1|  NAD-dependent epimerase/dehydratase [Nitr...  40.8    0.11  
ref|ZP_03397408.1|  NAD-dependent epimerase/dehydratase family...  40.8    0.11 
ref|YP_001307053.1|  NAD-dependent epimerase/dehydratase [Ther...  40.8    0.12  
gb|AAP97493.1|  UDP-Glc-4-epimerase [Solanum tuberosum]            40.8    0.12 
ref|YP_566663.1|  NAD-dependent epimerase/dehydratase [Methano...  40.8    0.13  
ref|NP_341721.1|  UDP-glucose 4-epimerase (galE-2) [Sulfolobus...  40.8    0.13  
ref|YP_002170168.1|  conserved hypothetical protein [Francisel...  40.8    0.13  
pdb|2C5A|A  Chain A, Gdp-Mannose-3', 5'-Epimerase (Arabidopsis...  40.8    0.13  
ref|YP_237543.1|  NAD-dependent epimerase/dehydratase [Pseudom...  40.4    0.13  
ref|XP_001389556.1|  hypothetical protein An01g11440 [Aspergil...  40.4    0.13  
ref|ZP_01612083.1|  capsular polysaccharide biosynthesis prote...  40.4    0.14 
gb|ABZ09543.1|  putative NAD dependent epimerase/dehydratase f...  40.4    0.14 
emb|CAO91216.1|  unnamed protein product [Microcystis aerugino...  40.4    0.14 
ref|XP_001767949.1|  predicted protein [Physcomitrella patens ...  40.4    0.15  
ref|ZP_02186495.1|  nucleotide sugar epimerase [alpha proteoba...  40.4    0.15 
ref|YP_001311776.1|  NAD-dependent epimerase/dehydratase [Clos...  40.4    0.15  
ref|YP_001533300.1|  NAD-dependent epimerase/dehydratase [Dino...  40.4    0.15  
ref|NP_790525.1|  NAD-dependent epimerase/dehydratase family p...  40.4    0.15  
ref|NP_693975.1|  UDP-glucose 4-epimerase [Oceanobacillus ihey...  40.4    0.15  
ref|NP_602647.1|  dTDP-4-dehydrorhamnose 3,5-epimerase [Fusoba...  40.4    0.15  
ref|ZP_02326876.1|  UDP-N-acetylglucosamine 4,6-dehydratase [P...  40.4    0.15 
ref|ZP_02294109.1|  NAD-dependent epimerase/dehydratase [Rhizo...  40.4    0.15 
ref|XP_001690522.1|  C-3 sterol dehydrogenase/C-4 decarboxylas...  40.4    0.15  
ref|NP_142353.1|  UDP-glucose 4-epimerase [Pyrococcus horikosh...  40.4    0.15  
ref|ZP_01132770.1|  probable UDP-glucose 4-epimerase [Pseudoal...  40.4    0.15 
ref|YP_468897.1|  UDP-glucose 4-epimerase protein [Rhizobium e...  40.4    0.16  
ref|XP_002025699.1|  GL20702 [Drosophila persimilis] >gb|EDW31...  40.4    0.16  
ref|YP_357218.1|  UDP-glucose 4-epimerase [Pelobacter carbinol...  40.4    0.16  
ref|YP_078029.1|  NAD-dependent epimerase/dehydratase [Bacillu...  40.4    0.16  
ref|YP_765443.1|  putative NAD-dependent epimerase/dehydratase...  40.4    0.16  
ref|YP_713935.1|  putative nucleoside-diphosphate-sugar epimer...  40.4    0.16  
gb|EDZ38508.1|  UDP-glucose 4-epimerase [Leptospirillum sp. Gr...  40.4    0.17 
gb|AAO90363.2|  NAD dependent epimerase/dehydratase family [Co...  40.4    0.17 
ref|YP_001596875.1|  NAD dependent epimerase/dehydratase famil...  40.4    0.17  
ref|NP_819849.1|  NAD dependent epimerase/dehydratase family p...  40.4    0.17  
ref|XP_001352806.2|  GA11351 [Drosophila pseudoobscura pseudoo...  40.0    0.17  
dbj|BAG09236.1|  UDP-galactose 4-epimerase [Pisum sativum]         40.0    0.17 
ref|YP_002305098.1|  NAD dependent epimerase/dehydratase famil...  40.0    0.18  
gb|ABZ10249.1|  putative NAD dependent epimerase/dehydratase f...  40.0    0.18 
ref|ZP_01946554.1|  NAD dependent epimerase/dehydratase family...  40.0    0.18 
ref|NP_001085589.1|  MGC82547 protein [Xenopus laevis] >gb|AAH...  40.0    0.18  
sp|Q43070.1|GALE1_PEA  RecName: Full=UDP-glucose 4-epimerase; ...  40.0    0.18 
ref|ZP_01449593.1|  Nucleoside-diphosphate-sugar epimerase [al...  40.0    0.18 
ref|YP_845166.1|  extracellular ligand-binding receptor [Syntr...  40.0    0.19  
ref|ZP_01053331.1|  NAD-dependent epimerase [Tenacibaculum sp....  40.0    0.19 
ref|ZP_02218994.1|  NAD dependent epimerase/dehydratase family...  40.0    0.19 
ref|NP_614008.1|  nucleoside-diphosphate-sugar epimerase [Meth...  40.0    0.20  




---------------------------------------------------------------------------------------------------

a)

>ref|ZP_00963177.1|  hypothetical protein NAS141_14633 [Sulfitobacter sp. NAS-14.1]
 gb|EAP79921.1|  hypothetical protein NAS141_14633 [Sulfitobacter sp. NAS-14.1]
Length=279

 Score =  322 bits (825),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 150/267 (56%), Positives = 195/267 (73%), Gaps = 0/267 (0%)

Query  1    GGRLGSFLREPLSKICNQLVSTDIKKHIGKLNENETYISADLSNFDQIYEITKDVSLICH  60
             GRLGS+LREPLSK+C +LVSTDI   IGKL E E+Y  AD++ +DQI  + +   ++ H
Sbjct  11   AGRLGSYLREPLSKMCQELVSTDIVDDIGKLYEGESYAKADVAVYDQIAPLLESADMVVH  70

Query  61   FGALVDEVPFNDMLGANFIGSYNIWEAARLNNCKRVVYSSSIHAVGMYKRTKTLRPKTAH  120
            FGA+VDE PF ++LG NF+GSYN+WEAA  +  +RVVY+SSIHAVGM+K++  +     H
Sbjct  71   FGAIVDEKPFEELLGPNFVGSYNVWEAAYQHGLQRVVYASSIHAVGMHKKSDFIGIDAPH  130

Query  121  RADGFYGLSKCFTENLARMYYDKCGIEAVCLRIATCSPVTTLRSLTSWLSYDDLVQLVMR  180
            + D FYGL+KCF+E+LA MY+DK G+EAVCLRI +C+ V   R+L SWLSYDDL+QLV R
Sbjct  131  KPDTFYGLAKCFSEDLASMYWDKRGLEAVCLRILSCAQVNNTRALGSWLSYDDLIQLVTR  190

Query  181  AIDTAHTGYSVVYGVSDNDRSNMSNTDSGHLGFQPKDNAEIYAGKIFSEDLTEELADEGN  240
            AIDT   G+SVVYGVS+NDR+ + N  +  LG++PKDNAE +A KI +E    +L D G 
Sbjct  191  AIDTPSVGFSVVYGVSNNDRAPVDNAKASFLGYRPKDNAEQFAEKILAEAPPVDLKDPGQ  250

Query  241  KLHGGPFASTDLGVSAMDKMKIVYSHK  267
              HGGPFA+ DLG S +  M IV   K
Sbjct  251  MHHGGPFAAVDLGESGVASMNIVNDKK  277


>ref|ZP_00956351.1|  hypothetical protein EE36_09625 [Sulfitobacter sp. EE-36]
 gb|EAP83021.1|  hypothetical protein EE36_09625 [Sulfitobacter sp. EE-36]
Length=279

 Score =  322 bits (824),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 150/267 (56%), Positives = 195/267 (73%), Gaps = 0/267 (0%)

Query  1    GGRLGSFLREPLSKICNQLVSTDIKKHIGKLNENETYISADLSNFDQIYEITKDVSLICH  60
             GRLGS+LREPLSK+C +LVSTDI   IGKL E E+Y  AD++ +DQI  + +   ++ H
Sbjct  11   AGRLGSYLREPLSKMCQELVSTDIVDDIGKLYEGESYAKADVAVYDQIAPLLEGADMVVH  70

Query  61   FGALVDEVPFNDMLGANFIGSYNIWEAARLNNCKRVVYSSSIHAVGMYKRTKTLRPKTAH  120
            FGA+VDE PF ++LG NF+GSYN+WEAA  +  +RVVY+SSIHAVGM+K++  +     H
Sbjct  71   FGAIVDEKPFEELLGPNFVGSYNVWEAAYQHGLQRVVYASSIHAVGMHKKSDFIGIDAPH  130

Query  121  RADGFYGLSKCFTENLARMYYDKCGIEAVCLRIATCSPVTTLRSLTSWLSYDDLVQLVMR  180
            + D FYGL+KCF+E+LA MY+DK G+EAVCLRI +C+ V   R+L SWLSYDDL+QLV R
Sbjct  131  KPDTFYGLAKCFSEDLASMYWDKRGLEAVCLRILSCAQVNNTRALGSWLSYDDLIQLVTR  190

Query  181  AIDTAHTGYSVVYGVSDNDRSNMSNTDSGHLGFQPKDNAEIYAGKIFSEDLTEELADEGN  240
            AIDT   G+SVVYGVS+NDR+ + N  +  LG++PKDNAE +A KI +E    +L D G 
Sbjct  191  AIDTPSVGFSVVYGVSNNDRAPVDNAKASFLGYRPKDNAEQFAEKILAEAPPVDLKDPGQ  250

Query  241  KLHGGPFASTDLGVSAMDKMKIVYSHK  267
              HGGPFA+ DLG S +  M IV   K
Sbjct  251  MHHGGPFAAVDLGESGVASMNIVNDKK  277


>ref|ZP_01741536.1|  3-beta hydroxysteroid dehydrogenase/isomerase [Rhodobacterales 
bacterium HTCC2150]
 gb|EBA03989.1|  3-beta hydroxysteroid dehydrogenase/isomerase [Rhodobacterales 
bacterium HTCC2150]
Length=279

 Score =  321 bits (822),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 145/262 (55%), Positives = 197/262 (75%), Gaps = 0/262 (0%)

Query  1    GGRLGSFLREPLSKICNQLVSTDIKKHIGKLNENETYISADLSNFDQIYEITKDVSLICH  60
             GRLGS+LREPLSK+C++LV+TDI +    L  NETY+ AD+++FD ++ + +   ++ H
Sbjct  10   AGRLGSYLREPLSKMCDELVTTDIAEAPATLLANETYVQADIADFDAVFNMLEGADMVVH  69

Query  61   FGALVDEVPFNDMLGANFIGSYNIWEAARLNNCKRVVYSSSIHAVGMYKRTKTLRPKTAH  120
            FGA+VDE PF  +LG NFIGSYNIWE+AR +  +RVVY+SSIHAVGM+K+T  +     H
Sbjct  70   FGAIVDEAPFETLLGPNFIGSYNIWESARRHGLRRVVYASSIHAVGMHKKTDFIGIDAPH  129

Query  121  RADGFYGLSKCFTENLARMYYDKCGIEAVCLRIATCSPVTTLRSLTSWLSYDDLVQLVMR  180
            R D FYGL+KCF+E+L  MY+DKCG+E+VC+RI +C+ VT  R++ +WLSYDDLVQLV R
Sbjct  130  RPDTFYGLAKCFSEDLGSMYWDKCGLESVCMRILSCAQVTNPRAVGTWLSYDDLVQLVTR  189

Query  181  AIDTAHTGYSVVYGVSDNDRSNMSNTDSGHLGFQPKDNAEIYAGKIFSEDLTEELADEGN  240
            AIDT  TG+S+VYGVSDNDR+ + N  + HLG++PKDNAE +A +IF++    +  D  N
Sbjct  190  AIDTPVTGFSIVYGVSDNDRAPVDNAKARHLGYRPKDNAEEHAKEIFAQYGPLDPHDTNN  249

Query  241  KLHGGPFASTDLGVSAMDKMKI  262
              HGGPFA  +LG SAM  + +
Sbjct  250  ACHGGPFAGIELGNSAMSALNL  271


>ref|ZP_01446879.1|  hypothetical protein OM2255_05965 [alpha proteobacterium HTCC2255]
 gb|EAU53051.1|  hypothetical protein OM2255_05965 [alpha proteobacterium HTCC2255]
Length=278

 Score =  305 bits (781),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 141/267 (52%), Positives = 195/267 (73%), Gaps = 0/267 (0%)

Query  1    GGRLGSFLREPLSKICNQLVSTDIKKHIGKLNENETYISADLSNFDQIYEITKDVSLICH  60
             GRLGS+LREPL ++  +LVS+DI + IG L+ NETY+ ADLS+   + ++ K   ++ H
Sbjct  10   AGRLGSYLREPLLRLAQELVSSDIIESIGTLHPNETYVRADLSDLSAMIDLLKGADMVVH  69

Query  61   FGALVDEVPFNDMLGANFIGSYNIWEAARLNNCKRVVYSSSIHAVGMYKRTKTLRPKTAH  120
            FGA+ DE PF+ +L AN +G+YNIWEAA  N  KRVVY+SSIHAVGM+K+T  +     H
Sbjct  70   FGAIGDEAPFDAILQANIVGAYNIWEAAHQNGVKRVVYASSIHAVGMHKKTDFIGTDVPH  129

Query  121  RADGFYGLSKCFTENLARMYYDKCGIEAVCLRIATCSPVTTLRSLTSWLSYDDLVQLVMR  180
            R D +YGL+KCF E+LA +Y+DK G+E+VC+RI +C+ V+  R++ SWLSYDDL+QLV +
Sbjct  130  RPDTYYGLAKCFAEDLASLYWDKRGLESVCMRILSCAQVSNPRAVGSWLSYDDLIQLVEK  189

Query  181  AIDTAHTGYSVVYGVSDNDRSNMSNTDSGHLGFQPKDNAEIYAGKIFSEDLTEELADEGN  240
            +I T  TG+S+VYGVS+NDR+ + N+ + HLGF+PKDNAE +A KI+SE+   +  D+G 
Sbjct  190  SITTQITGFSIVYGVSNNDRATVDNSMASHLGFKPKDNAEQFAEKIYSEEEKLDPYDQGA  249

Query  241  KLHGGPFASTDLGVSAMDKMKIVYSHK  267
               GGPFAS +LG S +  MKI    K
Sbjct  250  VCQGGPFASVELGHSGVATMKIANDKK  276


>ref|YP_682350.1|  hypothetical protein RD1_2062 [Roseobacter denitrificans OCh 
114]
 gb|ABG31664.1|  conserved hypothetical protein [Roseobacter denitrificans OCh 
114]
Length=278

 GENE ID: 4196689 RD1_2062 | hypothetical protein
[Roseobacter denitrificans OCh 114] (10 or fewer PubMed links)

 Score =  305 bits (780),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 139/266 (52%), Positives = 186/266 (69%), Gaps = 0/266 (0%)

Query  2    GRLGSFLREPLSKICNQLVSTDIKKHIGKLNENETYISADLSNFDQIYEITKDVSLICHF  61
            GRLGS+LREPL+ +C+ LVSTDI   IG L   ETY+ ADL+  DQI  + +   ++ HF
Sbjct  11   GRLGSYLREPLTALCDTLVSTDIVDDIGTLYAGETYVKADLAQMDQIAPVLEGADMVVHF  70

Query  62   GALVDEVPFNDMLGANFIGSYNIWEAARLNNCKRVVYSSSIHAVGMYKRTKTLRPKTAHR  121
            GA+VDE PF ++LG NF+GSYNIWEA      KR+VY+SSIHAVGM+ ++  +     HR
Sbjct  71   GAIVDEKPFEELLGPNFVGSYNIWEAGYKAGVKRIVYASSIHAVGMHLKSDFIGIDAEHR  130

Query  122  ADGFYGLSKCFTENLARMYYDKCGIEAVCLRIATCSPVTTLRSLTSWLSYDDLVQLVMRA  181
             D FYGL+KCFTE+L RMY+DK G+E+V LRI +C+ V   R+L SWLSY DL+QLV RA
Sbjct  131  PDTFYGLAKCFTEDLGRMYWDKRGLESVHLRILSCAQVNNTRALGSWLSYPDLIQLVTRA  190

Query  182  IDTAHTGYSVVYGVSDNDRSNMSNTDSGHLGFQPKDNAEIYAGKIFSEDLTEELADEGNK  241
            IDT   G+S++YGVS+NDR+ + N  +  LG++P DNAE+YA ++ ++    +  D G  
Sbjct  191  IDTPSVGFSIIYGVSNNDRAPVDNAKASFLGYRPIDNAEVYAAEVLAQAEPVDTTDPGQM  250

Query  242  LHGGPFASTDLGVSAMDKMKIVYSHK  267
             HGGPFA  DLG S + +M +V   K
Sbjct  251  CHGGPFAKVDLGQSGLAQMNVVNDKK  276


>ref|ZP_02153157.1|  hypothetical protein OIHEL45_09438 [Oceanibulbus indolifex HEL-45]
 gb|EDQ04953.1|  hypothetical protein OIHEL45_09438 [Oceanibulbus indolifex HEL-45]
Length=280

 Score =  304 bits (779),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/266 (52%), Positives = 189/266 (71%), Gaps = 0/266 (0%)

Query  2    GRLGSFLREPLSKICNQLVSTDIKKHIGKLNENETYISADLSNFDQIYEITKDVSLICHF  61
            GRLGS+LREPL+ +C +LVSTDI   IGKL + E Y  ADL+ +DQI  + +   ++ HF
Sbjct  13   GRLGSYLREPLAAMCEELVSTDIADDIGKLYDGERYAKADLAEYDQIAPLMEGADMVVHF  72

Query  62   GALVDEVPFNDMLGANFIGSYNIWEAARLNNCKRVVYSSSIHAVGMYKRTKTLRPKTAHR  121
            GA+VDE PF ++LG NF+GSYN+WEAA     +RVVY+SSIHAVGM+K++  +     H+
Sbjct  73   GAIVDEKPFMELLGPNFVGSYNVWEAAYQAGARRVVYASSIHAVGMHKKSDFIGIDAPHK  132

Query  122  ADGFYGLSKCFTENLARMYYDKCGIEAVCLRIATCSPVTTLRSLTSWLSYDDLVQLVMRA  181
             D FYGL+KCFTE+L  MY+DK  +E+V LRI + + V   R+L SWLSYDDL+QLV RA
Sbjct  133  PDTFYGLAKCFTEDLGSMYWDKRQLESVHLRILSAAQVNNSRALGSWLSYDDLIQLVTRA  192

Query  182  IDTAHTGYSVVYGVSDNDRSNMSNTDSGHLGFQPKDNAEIYAGKIFSEDLTEELADEGNK  241
            +DT   G+SV+YGVS+NDR+ + N  +  LG++PKDNAE +A K+ +E+   ++ D G  
Sbjct  193  VDTPSVGFSVIYGVSNNDRAPVDNAKASFLGYRPKDNAEQFAEKVLAEEGPVDITDPGQM  252

Query  242  LHGGPFASTDLGVSAMDKMKIVYSHK  267
             HGGPFA  DLG S + +M IV   K
Sbjct  253  CHGGPFAKVDLGESGLAQMTIVNDKK  278


>ref|ZP_02140928.1|  hypothetical protein RLO149_17578 [Roseobacter litoralis Och 
149]
 gb|EDQ17599.1|  hypothetical protein RLO149_17578 [Roseobacter litoralis Och 
149]
Length=278

 Score =  301 bits (770),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 137/266 (51%), Positives = 185/266 (69%), Gaps = 0/266 (0%)

Query  2    GRLGSFLREPLSKICNQLVSTDIKKHIGKLNENETYISADLSNFDQIYEITKDVSLICHF  61
            GRLGS+LREPL+ +C+ LVSTDI   IG L   ETY+ ADL+  DQI  + +   ++ HF
Sbjct  11   GRLGSYLREPLTALCDNLVSTDIVDDIGTLYAGETYVKADLAQMDQIAPVVEGADMVLHF  70

Query  62   GALVDEVPFNDMLGANFIGSYNIWEAARLNNCKRVVYSSSIHAVGMYKRTKTLRPKTAHR  121
            GA+VDE PF ++LG NF+GS+NIWEA      KR+VY+SSIHAVGM+ ++  +     HR
Sbjct  71   GAIVDEKPFEELLGPNFVGSHNIWEAGYQAGVKRIVYASSIHAVGMHLKSDFIGIDAEHR  130

Query  122  ADGFYGLSKCFTENLARMYYDKCGIEAVCLRIATCSPVTTLRSLTSWLSYDDLVQLVMRA  181
             D FYGL+KCF+E+L RMY++K G+E+V LRI +C+ V   R+L SWLSY DL+ LV RA
Sbjct  131  PDTFYGLAKCFSEDLGRMYWEKRGLESVHLRILSCAQVNNTRALGSWLSYPDLIHLVTRA  190

Query  182  IDTAHTGYSVVYGVSDNDRSNMSNTDSGHLGFQPKDNAEIYAGKIFSEDLTEELADEGNK  241
            IDT   G+++VYGVS+NDR+ + N  +  LG++P DNAE+YA ++ ++    +  D G  
Sbjct  191  IDTPSVGFAIVYGVSNNDRAPVDNAKASFLGYRPTDNAEVYAAEVLAQAEPVDTTDPGQM  250

Query  242  LHGGPFASTDLGVSAMDKMKIVYSHK  267
             HGGPFA  DLG S M +M IV   K
Sbjct  251  CHGGPFAKVDLGQSGMAQMNIVNDRK  276


>gb|EDZ41018.1|  3-beta hydroxysteroid dehydrogenase/isomerase [Rhodobacterales 
bacterium HTCC2083]
Length=278

 Score =  292 bits (748),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/262 (52%), Positives = 182/262 (69%), Gaps = 0/262 (0%)

Query  2    GRLGSFLREPLSKICNQLVSTDIKKHIGKLNENETYISADLSNFDQIYEITKDVSLICHF  61
            GRL S+LREPL+++C+ LVSTDI   IG L E ETYI  DL+N D +  + +   ++ H 
Sbjct  11   GRLSSYLREPLTQLCDALVSTDIVDDIGTLYEGETYIKGDLANMDDMMRVLEGADMVVHM  70

Query  62   GALVDEVPFNDMLGANFIGSYNIWEAARLNNCKRVVYSSSIHAVGMYKRTKTLRPKTAHR  121
            GA  DE PF  +LG NFIG+YNIWEAA  +  KRVVY+SSIHAVGM+ +T  +     HR
Sbjct  71   GAYADEGPFEKLLGPNFIGAYNIWEAAHRHGLKRVVYASSIHAVGMHAKTDFIDTNVPHR  130

Query  122  ADGFYGLSKCFTENLARMYYDKCGIEAVCLRIATCSPVTTLRSLTSWLSYDDLVQLVMRA  181
             D FYGL+KCF E+L  +Y+DK G+E+V +RI +C+ V   R+L SWLSYDDL+QLV R 
Sbjct  131  PDTFYGLAKCFAEDLGSLYWDKHGLESVHMRILSCAQVNNPRALGSWLSYDDLIQLVTRC  190

Query  182  IDTAHTGYSVVYGVSDNDRSNMSNTDSGHLGFQPKDNAEIYAGKIFSEDLTEELADEGNK  241
            ID   TG+SVVYGVS+NDR+ + N+ +  LG++PKDNAE +A ++ ++    +  D G+ 
Sbjct  191  IDAPTTGFSVVYGVSNNDRAPVDNSQASFLGYRPKDNAEQFAAEVLAKADPADPQDVGDV  250

Query  242  LHGGPFASTDLGVSAMDKMKIV  263
             HGGPFAS  LG S +  M IV
Sbjct  251  CHGGPFASVALGNSGVASMNIV  272


>ref|ZP_01749088.1|  hypothetical protein RCCS2_04279 [Roseobacter sp. CCS2]
 gb|EBA13071.1|  hypothetical protein RCCS2_04279 [Roseobacter sp. CCS2]
Length=278

 Score =  288 bits (737),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 132/256 (51%), Positives = 185/256 (72%), Gaps = 0/256 (0%)

Query  2    GRLGSFLREPLSKICNQLVSTDIKKHIGKLNENETYISADLSNFDQIYEITKDVSLICHF  61
            G LGS LR PL K+C+ LVSTDI   IG L + ETY+ AD+SN D + +I +   ++ HF
Sbjct  11   GALGSRLRGPLKKMCDALVSTDIVDDIGALQDGETYVQADVSNLDAMLKIIEGADMVIHF  70

Query  62   GALVDEVPFNDMLGANFIGSYNIWEAARLNNCKRVVYSSSIHAVGMYKRTKTLRPKTAHR  121
            GA+ DE  ++D+L +N IG+YN+WEAA     KRVVY+SS+HAVGM+K+T T+     HR
Sbjct  71   GAIADEAAWDDILQSNIIGAYNVWEAAYRCGVKRVVYASSVHAVGMHKKTDTIGLDAPHR  130

Query  122  ADGFYGLSKCFTENLARMYYDKCGIEAVCLRIATCSPVTTLRSLTSWLSYDDLVQLVMRA  181
             D +YGL+KCFTE+LA +Y+DK GIE+VCLRI +C+P T  RS+ +WLSYDDL+ LV R+
Sbjct  131  PDTYYGLAKCFTEDLASLYWDKRGIESVCLRIFSCAPATNARSIGTWLSYDDLIHLVERS  190

Query  182  IDTAHTGYSVVYGVSDNDRSNMSNTDSGHLGFQPKDNAEIYAGKIFSEDLTEELADEGNK  241
            +D+   G+++VYG+S+NDR+ + NT +GHLG++PKDNAE +A  +F+     +  D  N 
Sbjct  191  VDSPVVGFTIVYGISNNDRAVVDNTKAGHLGYRPKDNAEEFAKDVFAGAPPLDNTDLANL  250

Query  242  LHGGPFASTDLGVSAM  257
              GGPFA+ +LG S +
Sbjct  251  CIGGPFATVELGNSGV  266


>ref|ZP_01001842.1|  hypothetical protein SKA53_09669 [Loktanella vestfoldensis SKA53]
 gb|EAQ07982.1|  hypothetical protein SKA53_09669 [Loktanella vestfoldensis SKA53]
Length=278

 Score =  285 bits (729),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/266 (48%), Positives = 191/266 (71%), Gaps = 0/266 (0%)

Query  2    GRLGSFLREPLSKICNQLVSTDIKKHIGKLNENETYISADLSNFDQIYEITKDVSLICHF  61
            GRLGS LREPL+++C++LVSTDI   IGKL + E+Y+ ADL++   +  I KD +++ HF
Sbjct  11   GRLGSHLREPLTRMCDELVSTDIVADIGKLYDGESYVQADLTDLAAMEAILKDATMVVHF  70

Query  62   GALVDEVPFNDMLGANFIGSYNIWEAARLNNCKRVVYSSSIHAVGMYKRTKTLRPKTAHR  121
            GA+ DE P++D+L +N IG+YN+WEAA     KRVVY+SS+HAVGM+ +T T+     H+
Sbjct  71   GAIGDEAPWDDILQSNIIGAYNVWEAAYRQGVKRVVYASSVHAVGMHLKTDTIGLDAPHK  130

Query  122  ADGFYGLSKCFTENLARMYYDKCGIEAVCLRIATCSPVTTLRSLTSWLSYDDLVQLVMRA  181
             D +YGL+KCF E+LA +Y+DK G+E+VC+RI +C+  T  RS+ +WLSY DL+ LV R+
Sbjct  131  PDTYYGLAKCFAEDLASLYWDKRGVESVCMRIFSCAQATNARSIGTWLSYGDLIHLVERS  190

Query  182  IDTAHTGYSVVYGVSDNDRSNMSNTDSGHLGFQPKDNAEIYAGKIFSEDLTEELADEGNK  241
            ID+   G++ V+G+S+NDR+ + N+ +GHLGF+PKDNAE +A  +F++    +  D  N 
Sbjct  191  IDSPVVGFTKVWGISNNDRAVVDNSKAGHLGFRPKDNAEQFAQDVFAKTPPLDNKDLANL  250

Query  242  LHGGPFASTDLGVSAMDKMKIVYSHK  267
              GGPFA+ +LG S +  + +V   K
Sbjct  251  CIGGPFATVELGNSGVAVLGVVNDKK  276

----------------------------------------------------------------------------------------------------

   b)

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|P53560|YTBQ_BACSU  Uncharacterized protein ytbQ                 58.5    3e-08
sp|Q58455.1|Y1055_METJA  RecName: Full=Uncharacterized protein...  52.8    2e-06
sp|A2Z7B3.1|GME1_ORYSI  RecName: Full=GDP-mannose 3,5-epimeras...  46.6    1e-04
sp|A3C4S4.1|GME1_ORYSJ  RecName: Full=GDP-mannose 3,5-epimeras...  46.2    2e-04 
sp|Q8K3F7.1|TDH_MOUSE  RecName: Full=L-threonine 3-dehydrogena...  46.2    2e-04 
sp|Q2KIR8.1|TDH_BOVIN  RecName: Full=L-threonine 3-dehydrogena...  45.1    4e-04 
sp|P21097.1|3BHS_VACCC  RecName: Full=3 beta-hydroxysteroid de...  44.7    6e-04
sp|P26670.1|3BHS_VACCV  RecName: Full=3 beta-hydroxysteroid de...  44.3    6e-04
sp|O57245.1|3BHS_VACCA  RecName: Full=3 beta-hydroxysteroid de...  44.3    6e-04
sp|Q8MIR0.1|TDH_PIG  RecName: Full=L-threonine 3-dehydrogenase...  43.5    0.001 
sp|Q2R1V8.2|GME2_ORYSJ  RecName: Full=GDP-mannose 3,5-epimeras...  43.5    0.001 
sp|Q57664.1|GALE_METJA  RecName: Full=Putative UDP-glucose 4-e...  42.7    0.002
sp|Q93VR3.1|GME_ARATH  RecName: Full=GDP-mannose 3,5-epimerase...  42.0    0.003
sp|Q9UT59.1|YKJ7_SCHPO  RecName: Full=Putative uncharacterized...  40.8    0.007 
sp|Q43070.1|GALE1_PEA  RecName: Full=UDP-glucose 4-epimerase; ...  40.0    0.012
sp|Q8X7P7.1|GNE_ECO57  RecName: Full=UDP-N-acetylglucosamine 4...  37.4    0.076
sp|O65780.1|GALE1_CYATE  UDP-glucose 4-epimerase GEPI42 (UDP-g...  37.4    0.089
sp|Q6GBT4|Y511_STAAS  Uncharacterized epimerase/dehydratase SA...  36.6    0.13  
sp|O65781.1|GALE2_CYATE  UDP-glucose 4-epimerase GEPI48 (UDP-g...  36.6    0.14 
sp|Q6GJB5|Y558_STAAR  Uncharacterized epimerase/dehydratase SA...  36.6    0.14  
sp|P40801.1|GAL10_PACTA  RecName: Full=Bifunctional protein GA...  36.6    0.15 
sp|Q42605.2|GALE1_ARATH  RecName: Full=UDP-glucose 4-epimerase...  36.2    0.19 
sp|Q5HRJ9|Y194_STAEQ  Uncharacterized epimerase/dehydratase SE...  35.0    0.40  
sp|Q2YSA8|Y504_STAAB  Uncharacterized epimerase/dehydratase SA...  35.0    0.41  
sp|Q9W0P5.1|GALE_DROME  RecName: Full=Probable UDP-glucose 4-e...  33.5    1.4  
sp|Q9SN58.3|GALE2_ARATH  RecName: Full=UDP-glucose 4-epimerase...  32.7    1.9  
sp|Q8EUA1|UPP_MYCPE  Uracil phosphoribosyltransferase (UMP pyr...  32.3    2.9  
sp|Q49VA1|Y2164_STAS1  Uncharacterized epimerase/dehydratase S...  32.0    3.2   
sp|P47364.1|GALE_MYCGE  UDP-glucose 4-epimerase (UDP-galactose...  32.0    3.2  
sp|Q9T0A7.1|GALE3_ARATH  RecName: Full=UDP-glucose 4-epimerase...  31.6    4.4  
sp|Q2LT96.1|ARLY_SYNAS  Argininosuccinate lyase (ASAL) (Argino...  31.2    6.0   
sp|Q83017.2|RPOA_LDVP  RecName: Full=Replicase polyprotein 1ab...  30.8    8.4  
sp|P45616.1|COAD_MYCCT  RecName: Full=Probable phosphopantethe...  30.8    8.6   

---------------------------------------------------------------------------------------------------

    b)

>sp|P53560|YTBQ_BACSU  Uncharacterized protein ytbQ
Length=253

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 109/237 (45%), Gaps = 26/237 (10%)

Query  2    GRLGSFLREPLSKICNQLVSTDIKKHIGKLNENETYISADLSNFDQIYE-ITKDVSLICH  60
            G +G  L E L  I +  V+   K H    +   + I AD +N++++ + I KD   I +
Sbjct  11   GVIGRLLAEGL--ISDYEVTVLDKDH---FDGKASSIQADAANYEELLKKIPKDTDAILN  65

Query  61   FGA------LVDEVPFNDMLGANFIGSYNIWEAARLNNCKRVVYSSSIHAVGMYKRT-KT  113
              A      ++D   F  M    +  SY +  AA     +++V++SS H   +Y++  ++
Sbjct  66   LLAVKIKYDIMDIAEFEKMTDVFYRASYYLCRAAAELGIQKLVFASSNHVTDVYEKDGRS  125

Query  114  LRPKTAHRAD-----GFYGLSKCFTENLARMYYDKCGIEAVCLRIATC--SPVTTL----  162
            L  +    +D       YG+ K  +E +  ++Y +  +  + LRI T     + TL    
Sbjct  126  LLGREITTSDYPLSKNLYGVLKLTSEQIGHLFYLENKLSVINLRIGTVVTDEMDTLHEKE  185

Query  163  RSLTSWLSYDDLVQLVMRAIDTAHTGYSVVYGVSDND-RSNMSNTDSGHLGFQPKDN  218
            R+  + LS+ DL+ +   AI+T +  Y   Y VSDN  R     +    LGF P+ N
Sbjct  186  RTKKTLLSHPDLLSIFKAAIET-NIRYGTYYAVSDNPGRPWSIESAVNELGFSPQIN  241


>sp|Q58455.1|Y1055_METJA  RecName: Full=Uncharacterized protein MJ1055
Length=326

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 69/144 (47%), Gaps = 8/144 (5%)

Query  20   VSTDIKKHIGKLNENETYISADLSNFDQIYEITKD--VSLICHFGALVD-----EVPFND  72
            V  + +  I K  EN T+I  D S++D + E  KD  + LI H GA        + P+  
Sbjct  45   VLKEKRNEILKNYENYTFIKLDFSDWDDLVENLKDKEIDLIVHLGAQAGVRYSLQNPWA-  103

Query  73   MLGANFIGSYNIWEAARLNNCKRVVYSSSIHAVGMYKRTKTLRPKTAHRADGFYGLSKCF  132
             + +N +G+ NI+E AR  + ++VVY+SS    G  ++          +    Y  +K  
Sbjct  104  YIKSNEMGTLNIFEFARRFDIEKVVYASSSSVYGGNRKIPFSEDDRVDKPISLYASTKRS  163

Query  133  TENLARMYYDKCGIEAVCLRIATC  156
             E +A +Y+   GI+ + LR  T 
Sbjct  164  NELMAHVYHHLYGIKMIGLRFFTV  187


>sp|A2Z7B3.1|GME1_ORYSI  RecName: Full=GDP-mannose 3,5-epimerase 1; Short=GDP-Man 3,5-epimerase 
1; AltName: Full=OsGME-1
Length=378

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 72/167 (43%), Gaps = 28/167 (16%)

Query  1    GGRLGSFLREPLSKICNQLVSTDIKK--HIGKLNENETYISADLSNFDQIYEITKDVSLI  58
            GG +GS +   L    + ++++D KK  H+ +      +   DL   D   ++T  V  +
Sbjct  38   GGFIGSHIARRLKSEGHYIIASDWKKNEHMTEDMFCHEFHLVDLRVMDNCLKVTNSVDHV  97

Query  59   CHFGALVDEVPFNDMLGANFIGS-------------YNIWEAARLNNCKRVVYSSSIHAV  105
             +  A        DM G  FI S             +N+ EAAR+N  KR  Y+SS    
Sbjct  98   FNLAA--------DMGGMGFIQSNHSVIMYNNTMISFNMLEAARINGVKRFFYASSACIY  149

Query  106  GMYKRTKT---LRPKTAHRADG--FYGLSKCFTENLARMYYDKCGIE  147
              +K+ +T   L+   A  A+    YGL K  TE L + Y    GIE
Sbjct  150  PEFKQLETNVSLKESDAWPAEPQDAYGLEKLATEELCKHYTKDFGIE  196


>sp|A3C4S4.1|GME1_ORYSJ  RecName: Full=GDP-mannose 3,5-epimerase 1; Short=GDP-Man 3,5-epimerase 
1; AltName: Full=OsGME-1
Length=378

 GENE ID: 4348636 Os10g0417600 | Os10g0417600 [Oryza sativa Japonica Group]
(10 or fewer PubMed links)

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 72/167 (43%), Gaps = 28/167 (16%)

Query  1    GGRLGSFLREPLSKICNQLVSTDIKK--HIGKLNENETYISADLSNFDQIYEITKDVSLI  58
            GG +GS +   L    + ++++D KK  H+ +      +   DL   D   ++T  V  +
Sbjct  38   GGFIGSHIARRLKSEGHYIIASDWKKNEHMTEDMFCHEFHLVDLRVMDNCLKVTNGVDHV  97

Query  59   CHFGALVDEVPFNDMLGANFIGS-------------YNIWEAARLNNCKRVVYSSSIHAV  105
             +  A        DM G  FI S             +N+ EAAR+N  KR  Y+SS    
Sbjct  98   FNLAA--------DMGGMGFIQSNHSVIMYNNTMISFNMLEAARINGVKRFFYASSACIY  149

Query  106  GMYKRTKT---LRPKTAHRADG--FYGLSKCFTENLARMYYDKCGIE  147
              +K+ +T   L+   A  A+    YGL K  TE L + Y    GIE
Sbjct  150  PEFKQLETNVSLKESDAWPAEPQDAYGLEKLATEELCKHYTKDFGIE  196


>sp|Q8K3F7.1|TDH_MOUSE  RecName: Full=L-threonine 3-dehydrogenase, mitochondrial; Flags: 
Precursor
Length=373

 GENE ID: 58865 Tdh | L-threonine dehydrogenase [Mus musculus]
(Over 10 PubMed links)

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 71/156 (45%), Gaps = 14/156 (8%)

Query  5    GSFLREPLSKICNQLVSTDIKKHIGKLNENETYISADLSNFDQIYEITKD--VSLICHFG  62
             + LR+   K  + ++ +DI+K    +  +  ++ A++ ++  + EI  +  +S + H+ 
Sbjct  72   ANLLRKRFGK--DNVILSDIRKPPAHVFHSGPFVYANILDYKSLREIVVNHRISWLFHYS  129

Query  63   AL---VDEVPFNDMLGANFIGSYNIWEAARLNNCKRVVYSSSIHAVGMYKRTKTLRPKT-  118
            AL   V E   +     N  G +N+ + A   N +  V S+    +G +  T    P   
Sbjct  130  ALLSAVGEANVSLARDVNITGLHNVLDVAAEYNVRLFVPST----IGAFGPTSPRNPAPD  185

Query  119  --AHRADGFYGLSKCFTENLARMYYDKCGIEAVCLR  152
                R    YG+SK  TE +   YY + G++  CLR
Sbjct  186  LCIQRPRTIYGVSKVHTELMGEYYYYRYGLDFRCLR  221


>sp|Q2KIR8.1|TDH_BOVIN  RecName: Full=L-threonine 3-dehydrogenase, mitochondrial; Flags: 
Precursor
Length=373

 GENE ID: 511957 TDH | L-threonine dehydrogenase [Bos taurus]

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 71/156 (45%), Gaps = 14/156 (8%)

Query  5    GSFLREPLSKICNQLVSTDIKKHIGKLNENETYISADLSNFDQIYEITKD--VSLICHFG  62
             SFLR+   K  + ++ +DI+K    +  +  +I +D+ ++  + EI  +  ++ + H+ 
Sbjct  72   ASFLRKRFGK--DNVILSDIRKPPEHVFLSGPFIYSDILDYKNLREIVVNNRITWLFHYS  129

Query  63   AL---VDEVPFNDMLGANFIGSYNIWEAARLNNCKRVVYSSSIHAVGMYKRTKTLRPKT-  118
            AL   V E   +     N  G +N+ + A  +  +  V S+    +G +  T    P   
Sbjct  130  ALLSAVGEANVSLARAVNITGLHNVLDVAAEHGLRLFVPST----IGAFGPTSPRNPTPD  185

Query  119  --AHRADGFYGLSKCFTENLARMYYDKCGIEAVCLR  152
                R    YG+SK   E +   YY + G++  CLR
Sbjct  186  LCIQRPRTIYGVSKVHAELMGEYYYYRYGLDFRCLR  221


>sp|P21097.1|3BHS_VACCC  RecName: Full=3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase; 
Short=3-beta-HSD; Includes: RecName: Full=3-beta-hydroxy-Delta(5)-steroid 
dehydrogenase; AltName: Full=3-beta-hydroxy-5-ene 
steroid dehydrogenase; AltName: Full=Progesterone 
reductase; Includes: RecName: Full=Steroid Delta-isomerase; 
AltName: Full=Delta-5-3-ketosteroid isomerase
Length=346

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 3/73 (4%)

Query  37   YISADLSNFDQIYEITKDVSLICHFGALVD---EVPFNDMLGANFIGSYNIWEAARLNNC  93
            YI  D+++FD++ E    V+LI H  ALVD   +   N+++  N+ G+  I  A      
Sbjct  51   YIQCDINDFDKVREALDGVNLIIHTAALVDVFGKYTDNEIMKVNYYGTQTILAACVDLGI  110

Query  94   KRVVYSSSIHAVG  106
            K ++Y+SS+ A+G
Sbjct  111  KYLIYTSSMEAIG  123


>sp|P26670.1|3BHS_VACCV  RecName: Full=3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase; 
Short=3-beta-HSD; Includes: RecName: Full=3-beta-hydroxy-Delta(5)-steroid 
dehydrogenase; AltName: Full=3-beta-hydroxy-5-ene 
steroid dehydrogenase; AltName: Full=Progesterone 
reductase; Includes: RecName: Full=Steroid Delta-isomerase; 
AltName: Full=Delta-5-3-ketosteroid isomerase
Length=346

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 3/73 (4%)

Query  37   YISADLSNFDQIYEITKDVSLICHFGALVD---EVPFNDMLGANFIGSYNIWEAARLNNC  93
            YI  D+++FD++ E    V+LI H  ALVD   +   N+++  N+ G+  I  A      
Sbjct  51   YIQCDINDFDKVREALDGVNLIIHTAALVDVFGKYTDNEIMKVNYYGTQTILAACVDLGI  110

Query  94   KRVVYSSSIHAVG  106
            K ++Y+SS+ A+G
Sbjct  111  KYLIYTSSMEAIG  123


>sp|O57245.1|3BHS_VACCA  RecName: Full=3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase; 
Short=3-beta-HSD; Includes: RecName: Full=3-beta-hydroxy-Delta(5)-steroid 
dehydrogenase; AltName: Full=3-beta-hydroxy-5-ene 
steroid dehydrogenase; AltName: Full=Progesterone 
reductase; Includes: RecName: Full=Steroid Delta-isomerase; 
AltName: Full=Delta-5-3-ketosteroid isomerase
Length=346

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 3/73 (4%)

Query  37   YISADLSNFDQIYEITKDVSLICHFGALVD---EVPFNDMLGANFIGSYNIWEAARLNNC  93
            YI  D+++FD++ E    V+LI H  ALVD   +   N+++  N+ G+  I  A      
Sbjct  51   YIQCDINDFDKVREALDGVNLIIHTAALVDVFGKYTDNEIMKVNYYGTQTILAACVDLGI  110

Query  94   KRVVYSSSIHAVG  106
            K ++Y+SS+ A+G
Sbjct  111  KYLIYTSSMEAIG  123


>sp|Q8MIR0.1|TDH_PIG  RecName: Full=L-threonine 3-dehydrogenase, mitochondrial; Flags: 
Precursor
Length=373

 GENE ID: 397065 TDH | L-threonine 3-dehydrogenase [Sus scrofa]
(10 or fewer PubMed links)

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 70/156 (44%), Gaps = 14/156 (8%)

Query  5    GSFLREPLSKICNQLVSTDIKKHIGKLNENETYISADLSNFDQIYEITKD--VSLICHFG  62
             S LR+   K  + ++ +DI+K    +  +  +I +D+ ++  + EI  +  V+ + H+ 
Sbjct  72   ASLLRKRFGK--DNVILSDIRKPPEHVFLSGPFIYSDILDYKNLREIVVNNRVTWLFHYS  129

Query  63   AL---VDEVPFNDMLGANFIGSYNIWEAARLNNCKRVVYSSSIHAVGMYKRTKTLRPKT-  118
            AL   V E   +     N  G +N+ + A  +  +  V S+    +G +  T    P   
Sbjct  130  ALLSAVGEANVSLARAVNITGLHNVLDVAAEHGLRLFVPST----IGAFGPTSPRNPTPD  185

Query  119  --AHRADGFYGLSKCFTENLARMYYDKCGIEAVCLR  152
                R    YG+SK   E +   YY + G++  CLR
Sbjct  186  LCIQRPRTIYGVSKVHAELMGEYYYYRYGLDFRCLR  221



ORF finding

PROTOCOLE:

logiciel: SMS / ORF finder

a) any codon / cadre de lecture 1,2,3 / sens direct / code génétique bactérien
b) any codon / cadre de lecture 1,2,3 / sens indirect / code génétique bactérien


---------------------------------------------------------------------------------------------------
ANALYSE DES RÉSULTATS:

La recherche d'ORF nous donne des cadres de lecture ouverts dans le sens direct et indirect. Nous
obtenons 2 cadres de lecture dans le sens direct ( frame 1 et 2) et 8 cadres de lecture dans le
sens indirect ( 4 dans la frame 1, 1 dans la frame 2 et 3 dans la frame 3).
Nous choississons, pour la suite de notre analyse, l'ORF le plus long : qui est 
le plus susceptible de coder pour un gène. C'est celui correspondant au cadre 
de lecture numéro 1 du sens direct allant du nucléotide 1 à 810. On a le codon stop en position 810 
( c'est-à-dire le 3' du gène) mais pas le début du gène ( c'est-à-dire le 5' du gène).En effet, 
au début du gène, nous n'avons pas de codon start. Soit le gène est incomplet en 5' ( le codon start 
est en amont du début de la séquence que nous avons ici), soit le codon start se situe dans notre 
séquence, plus loin sur l'ORF. Cependant, la recherche d'ORF ne nous permet pas de savoir lequel de ces deux
cas est le bon.   

---------------------------------------------------------------------------------------------------
RÉSULTATS BRUTS:

a)

>ORF number 1 in reading frame 1 on the direct strand extends from base 1 to base 810.
GGAGGTAGATTGGGTTCTTTTCTTAGAGAGCCTCTCTCAAAAATTTGCAATCAACTGGTT
TCAACCGACATAAAAAAACATATTGGAAAACTCAATGAAAATGAAACCTATATCTCGGCT
GATCTATCAAACTTTGATCAAATATATGAAATAACAAAAGATGTGTCACTCATCTGCCAT
TTTGGAGCTTTAGTAGATGAGGTGCCCTTCAATGATATGCTTGGTGCAAATTTTATTGGC
TCATATAACATATGGGAGGCAGCGCGTCTGAATAACTGTAAGAGAGTAGTTTACTCAAGT
TCAATACATGCAGTTGGAATGTATAAAAGAACAAAGACATTGAGACCAAAGACTGCTCAT
AGAGCTGATGGTTTTTATGGACTATCAAAGTGTTTTACCGAAAATTTAGCACGTATGTAT
TATGATAAATGTGGTATTGAAGCGGTATGCCTGCGAATTGCGACTTGTTCACCTGTTACT
ACACTAAGAAGTTTAACAAGTTGGCTTTCATATGACGATTTAGTTCAATTGGTTATGAGA
GCAATTGATACCGCACATACCGGTTACTCAGTTGTTTATGGAGTATCTGACAATGATCGC
TCTAATATGAGCAACACAGACTCAGGGCATCTTGGATTCCAGCCTAAGGATAATGCTGAA
ATTTACGCTGGTAAAATTTTTTCTGAAGACTTAACCGAGGAATTGGCAGACGAAGGAAAT
AAACTGCATGGTGGGCCTTTCGCATCAACTGATCTAGGAGTTAGTGCGATGGATAAAATG
AAAATAGTTTATTCGCATAAAGGAGATTAG

>Translation of ORF number 1 in reading frame 1 on the direct strand.
GGRLGSFLREPLSKICNQLVSTDIKKHIGKLNENETYISADLSNFDQIYEITKDVSLICH
FGALVDEVPFNDMLGANFIGSYNIWEAARLNNCKRVVYSSSIHAVGMYKRTKTLRPKTAH
RADGFYGLSKCFTENLARMYYDKCGIEAVCLRIATCSPVTTLRSLTSWLSYDDLVQLVMR
AIDTAHTGYSVVYGVSDNDRSNMSNTDSGHLGFQPKDNAEIYAGKIFSEDLTEELADEGN
KLHGGPFASTDLGVSAMDKMKIVYSHKGD*

>ORF number 1 in reading frame 2 on the direct strand extends from base 788 to base 940.
TTTATTCGCATAAAGGAGATTAGCCAGATGAAAGATGATAATATGCTTCGAGGGGGGCAA
CTTTTAGCGACGTCTTTCAAAGAAAAAGGGATAGAGCATGTATTTACACTGGCGGGTGGT
TTTTGTAACCCAGCACTTGAGGGTTTTATGACC

>Translation of ORF number 1 in reading frame 2 on the direct strand.
FIRIKEISQMKDDNMLRGGQLLATSFKEKGIEHVFTLAGGFCNPALEGFMT

No ORFs were found in reading frame 3.

---------------------------------------------------------------------------------------------------

b)

>ORF number 1 in reading frame 1 on the reverse strand extends from base 1 to base 90.
GGTCATAAAACCCTCAAGTGCTGGGTTACAAAAACCACCCGCCAGTGTAAATACATGCTC
TATCCCTTTTTCTTTGAAAGACGTCGCTAA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
GHKTLKCWVTKTTRQCKYMLYPFFFERRR*

>ORF number 2 in reading frame 1 on the reverse strand extends from base 91 to base 180.
AAGTTGCCCCCCTCGAAGCATATTATCATCTTTCATCTGGCTAATCTCCTTTATGCGAAT
AAACTATTTTCATTTTATCCATCGCACTAA

>Translation of ORF number 2 in reading frame 1 on the reverse strand.
KLPPSKHIIIFHLANLLYANKLFSFYPSH*

>ORF number 3 in reading frame 1 on the reverse strand extends from base 181 to base 297.
CTCCTAGATCAGTTGATGCGAAAGGCCCACCATGCAGTTTATTTCCTTCGTCTGCCAATT
CCTCGGTTAAGTCTTCAGAAAAAATTTTACCAGCGTAAATTTCAGCATTATCCTTAG

>Translation of ORF number 3 in reading frame 1 on the reverse strand.
LLDQLMRKAHHAVYFLRLPIPRLSLQKKFYQRKFQHYP*

>ORF number 4 in reading frame 1 on the reverse strand extends from base 547 to base 708.
AACACTTTGATAGTCCATAAAAACCATCAGCTCTATGAGCAGTCTTTGGTCTCAATGTCT
TTGTTCTTTTATACATTCCAACTGCATGTATTGAACTTGAGTAAACTACTCTCTTACAGT
TATTCAGACGCGCTGCCTCCCATATGTTATATGAGCCAATAA

>Translation of ORF number 4 in reading frame 1 on the reverse strand.
NTLIVHKNHQLYEQSLVSMSLFFYTFQLHVLNLSKLLSYSYSDALPPICYMSQ*

>ORF number 1 in reading frame 2 on the reverse strand extends from base 2 to base 187.
GTCATAAAACCCTCAAGTGCTGGGTTACAAAAACCACCCGCCAGTGTAAATACATGCTCT
ATCCCTTTTTCTTTGAAAGACGTCGCTAAAAGTTGCCCCCCTCGAAGCATATTATCATCT
TTCATCTGGCTAATCTCCTTTATGCGAATAAACTATTTTCATTTTATCCATCGCACTAAC
TCCTAG

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
VIKPSSAGLQKPPASVNTCSIPFSLKDVAKSCPPRSILSSFIWLISFMRINYFHFIHRTN
S*

>ORF number 1 in reading frame 3 on the reverse strand extends from base 153 to base 278.
ACTATTTTCATTTTATCCATCGCACTAACTCCTAGATCAGTTGATGCGAAAGGCCCACCA
TGCAGTTTATTTCCTTCGTCTGCCAATTCCTCGGTTAAGTCTTCAGAAAAAATTTTACCA
GCGTAA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
TIFILSIALTPRSVDAKGPPCSLFPSSANSSVKSSEKILPA*

>ORF number 2 in reading frame 3 on the reverse strand extends from base 417 to base 521.
ACTAAATCGTCATATGAAAGCCAACTTGTTAAACTTCTTAGTGTAGTAACAGGTGAACAA
GTCGCAATTCGCAGGCATACCGCTTCAATACCACATTTATCATAA

>Translation of ORF number 2 in reading frame 3 on the reverse strand.
TKSSYESQLVKLLSVVTGEQVAIRRHTASIPHLS*

>ORF number 3 in reading frame 3 on the reverse strand extends from base 651 to base 803.
ACTACTCTCTTACAGTTATTCAGACGCGCTGCCTCCCATATGTTATATGAGCCAATAAAA
TTTGCACCAAGCATATCATTGAAGGGCACCTCATCTACTAAAGCTCCAAAATGGCAGATG
AGTGACACATCTTTTGTTATTTCATATATTTGA

>Translation of ORF number 3 in reading frame 3 on the reverse strand.
TTLLQLFRRAASHMLYEPIKFAPSISLKGTSSTKAPKWQMSDTSFVISYI*