GOS 4051020

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1092343591114
Annotathon code: GOS_4051020
Sample :
  • GPS :18°2'12n; 83°47'5w
  • Caribbean Sea: Rosario Bank - Honduras
  • Open Ocean (-1.7m, 27.4°C, 0.1-0.8 microns)
Authors
Team : BioCell2013
Username : Broutin-Vongue
Annotated on : 2014-01-16 22:40:34
  • Broutin Melanie
  • Vongue Helene

Synopsis

  • Taxonomy: Rickettsiales (NCBI info)
    Rank: order - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 766
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order: Rickettsiales
    Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales;

Genomic Sequence

>JCVI_READ_1092343591114 GOS_4051020 Genomic DNA
CTCAAAGAAATATTCTTATAGACACATCACCAGACATTAAATTTCAATTATTGAAAAATAAAGTTAAAAATATAAATAATGTTTTTTATACGCATGCGCA
TGCTGATCAAACACATGGTATTAATGAAATGAGAGCTTTTTATATTATAAATAAAAAAAAATTACCTGTTTATGGTGACAAAATAACTAAAAAGCTATTA
TTTTCAACCTTTAAATATTGTTTTAAGGGTACATCATCATATCCAGCAACTTTAAAGTTTATCAATTTAAGTAGAATTCATAAATTTGATAATGGTAAAG
ATAAAATTGTTATAAAAAATATTACAGTTGAACATGGTTTAATCGATAGTAAATGTTACATTATTAATAATAAATGTGCTTATGTAAGTGATGTAAGTAA
AATTTATAATAAAGATATAATTAAATTAAAAAACCTTAAATATTTTGTAGTTGATTGTTTAAGATTTAAGCAACATCCATCACATTTTAATTTATCTGAT
GTTTTTAAAATAATAAAAAAAATAGGGCCTAAAAAAACTATTTTGACAAACCTTCACAGTGATATTGATTACAATTATTTAAAACATAAATTACCAAAAA
ATATTATTCCAGCATATGATGGATTAAATTTCTTAATTTAATATTTTTTCAATTTTTAAAATGACTTTTTTAGACATAGGATTTGTAAATGAAGCAAATG
TATCTACAATAGTTCCTTCTTTATTAATTAATATTTTGTGAAAATTCCATTTGGGAATGGCACTTTTCCCATATGAGATTTTAGCCCATTTGTAAATTTC
GTGAGCATTTTCACCTTTAACATCATTTTTTGAAGTCATTAAAAATTATATTAAAATTTGTTTCGCAAAATCTTTAAT

Translation

[3 - 638/878]   direct strand
>GOS_4051020 Translation [3-638   direct strand]
QRNILIDTSPDIKFQLLKNKVKNINNVFYTHAHADQTHGINEMRAFYIINKKKLPVYGDKITKKLLFSTFKYCFKGTSSYPATLKFINLSRIHKFDNGKD
KIVIKNITVEHGLIDSKCYIINNKCAYVSDVSKIYNKDIIKLKNLKYFVVDCLRFKQHPSHFNLSDVFKIIKKIGPKKTILTNLHSDIDYNYLKHKLPKN
IIPAYDGLNFLI

[ Warning ] 5' incomplete: does not start with a Methionine

Annotator commentaries

Après avoir réalisé plusieurs analyses sur notre séquence d'intérêt, on peut répondre à plusieurs questions concernant cette séquence : est ce qu'elle est codante ?; quelle est sa fonction ? ; quelle est sa taxonomie ?


Pour la première question, nous avons réalisé une recherche d'ORF avec ORF Finder. Nous avons alors sélectionné parmi les ORFs potentiels , un ORF de 639pb sur le brin direct qui ne commence pas par un codon start mais qui se termine par un codon stop. De plus l'analyse faite par Blast nous a permis de trouver de nombreux homologues à cette séquence avec des e value allant de 3e-80 à 10 ce qui peut donc signifier que notre séquence est bien codante. Après alignement multiple effectué par MUSCLE et Gblocks, on a constaté que notre séquence était tronquée car elle ne commençait l’alignement qu'au 67ème acides aminés et qu'elle se terminait en même temps que les autres.


En ce qui concerne la fonction, nous avons soumis notre séquence à une recherche de domaines protéiques avec Interpro. Nous avons alors mis en évidence une forte similarité avec un domaine béta lactamase like (evalue de 1.1e-35.). Pour confirmer cette hypothèse, nous l'avons ensuite soumise à l'analyse de Blast contre les banques de données de nr ou swissprot. Grâce au blast contre swissprot, on a pu détecter un domaine hydrolase en Nter car la plupart des hits (avec faible e value) sont localisés sur les 70 premiers acides aminés. Grâce au blast contre nr, on a détecter de nombreux résultats correspondant pour la plupart à des métallo-béta-lactamases ou à des Phnp (protéine avec un domaine metallo-dépendent hydrolases d'une béta-lactamase).

Pour déterminer le processus biologique et la fonction moléculaire, nous avons regarder sur la fiche interprosan de la protéine : nous avons alors trouvé qu'elle avait pour fonction une activité hydrolase. Il n'était cependant pas spécifié le processus biologique auquel elle appartenait.


Pour savoir à quel taxon elle appartient, nous avons déterminé un seuil d'homologie (1e-6) puis avons choisi notre groupe d'étude (alphaprotéobactérie) et externe (les autres protéobactéries), en fonction de leur scores, des evalues et de leur nombre. Après avoir effectué deux arbres avec deux méthodes différentes, nous avons pu constater qu'ils se ressemblaient au niveau de la séparation des groupes externe et d'études (groupes monophylétiques) mais qui étaient dissemblables au niveau des sous groupes des alphaprotéobactéries. Cependant dans les deux cas, notre séquence d’intérêt était bien intégré dans le groupe des Rickettsiales.


En conclusion, on peut supposer après nos différentes analyses, que notre séquence d'intérêt code pour une beta-lactamase (qui permet la résistance à certains antibiotiques comme la penicilline). Cette protéine a une activité hydrolase. Cependant notre séquence est incomplète puisque elle ne possède pas de codon d'initiation.

Cette séquence provient probablement d'une Rickettsiale, un sous groupe d'alpha protéobactéries.

ORF finding

PROTOCOLE:

SMS ORF Finder paramètres :

a) any codon, phases 1+2+3 brin direct, min 60 aa, code genet. "standard"

b) any codon, phases 1+2+3 brin reverse, min 60 aa, code genet. "standard"



ANALYSE DES RÉSULTATS:


Après analyse de la séquence, on a trouvé 2 ORFs hypothétiques : un sur le brin direct dans le 3 cadre de lecture qui s'étend de 3 à 641 (639pb) et l'autre sur le brin inverse sur le 1 cadre de lecture qui s’étend de 34 à 246 (213pb). Le deuxième ORF peut coder aussi une protéine car il se termine par un codon stop et possède une méthionine à la 3e place.

Cependant on décide de prendre ORF 3 du brin direct car c'est l'ORF le plus grand et qui s'étend sur presque toute la séquence (3 à 641).

Cet ORF ne commence pas par un codon start et on trouve la première méthionine à la 43e place. Il se termine par un codon stop. On peut donc en penser que notre séquence est incomplète au niveau 5'.

RÉSULTATS BRUTS:
__________________________________________________________________________________________________________________
a)brin direct
No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 3 to base 641.
CAAAGAAATATTCTTATAGACACATCACCAGACATTAAATTTCAATTATTGAAAAATAAA
GTTAAAAATATAAATAATGTTTTTTATACGCATGCGCATGCTGATCAAACACATGGTATT
AATGAAATGAGAGCTTTTTATATTATAAATAAAAAAAAATTACCTGTTTATGGTGACAAA
ATAACTAAAAAGCTATTATTTTCAACCTTTAAATATTGTTTTAAGGGTACATCATCATAT
CCAGCAACTTTAAAGTTTATCAATTTAAGTAGAATTCATAAATTTGATAATGGTAAAGAT
AAAATTGTTATAAAAAATATTACAGTTGAACATGGTTTAATCGATAGTAAATGTTACATT
ATTAATAATAAATGTGCTTATGTAAGTGATGTAAGTAAAATTTATAATAAAGATATAATT
AAATTAAAAAACCTTAAATATTTTGTAGTTGATTGTTTAAGATTTAAGCAACATCCATCA
CATTTTAATTTATCTGATGTTTTTAAAATAATAAAAAAAATAGGGCCTAAAAAAACTATT
TTGACAAACCTTCACAGTGATATTGATTACAATTATTTAAAACATAAATTACCAAAAAAT
ATTATTCCAGCATATGATGGATTAAATTTCTTAATTTAA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
QRNILIDTSPDIKFQLLKNKVKNINNVFYTHAHADQTHGINEMRAFYIINKKKLPVYGDK
ITKKLLFSTFKYCFKGTSSYPATLKFINLSRIHKFDNGKDKIVIKNITVEHGLIDSKCYI
INNKCAYVSDVSKIYNKDIIKLKNLKYFVVDCLRFKQHPSHFNLSDVFKIIKKIGPKKTI
LTNLHSDIDYNYLKHKLPKNIIPAYDGLNFLI*

______________________________________________________________________________________________________________________
b)brin reverse
>ORF number 1 in reading frame 1 on the reverse strand extends from base 34 to base 246.
TTTTTAATGACTTCAAAAAATGATGTTAAAGGTGAAAATGCTCACGAAATTTACAAATGG
GCTAAAATCTCATATGGGAAAAGTGCCATTCCCAAATGGAATTTTCACAAAATATTAATT
AATAAAGAAGGAACTATTGTAGATACATTTGCTTCATTTACAAATCCTATGTCTAAAAAA
GTCATTTTAAAAATTGAAAAAATATTAAATTAA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
FLMTSKNDVKGENAHEIYKWAKISYGKSAIPKWNFHKILINKEGTIVDTFASFTNPMSKK
VILKIEKILN*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOLE:

Phylogeny.fr


a)Alignement multiple (MUSCLE) avec paramètre par défaut

b)Alignement curration (Gblocks) avec paramètre par défaut



ANALYSE DES RÉSULTATS:


a) On peut remarquer que notre séquence ne commence à s'aligner avec les autres qu'à l'acide aminé 67 et elle se termine avec toutes les autres. Ca nous confirme bien que notre séquence est tronquée à son début. On peut aussi remarquer après avoir observé l'alignement multiple qu'il y a une légère démarcation entre le groupe externe et le groupe interne, même si celle ci n'est pas extrêmement voyante.

La longueur des séquences est pratiquement la même sauf pour notre séquence (qui est plus courte en n-ter) et les séquence 15 et 19. Les indels sont aussi pratiquement absents et situés aux même endroits dans les séquences.


b) On peut remarquer que dans nos alignements multiples, on a deux grands blocs qui sont très conservés ([70 139] et [196 260] ). Le premier grand domaine conservé peut correspondre au domaine hydrolase que l'on avait constaté dans les résultats de blast contre swissprot car ce domaine était au début de notre séquence et faisait environ 40 aa. Le deuxième blocs quant à lui, serait peut être plus spécifique à l'action de la beta lactamase car dans les résultats d'interproscan et de blast on ne trouve pas de domaine uniquement restreint à cette partie de notre protéine cible.


On peut aussi dire qu'un seul alignement multiple n'est pas suffisant car les domaines conservés ne sont pas suffisamment visibles avec juste l'alignement multiple de MUSCLE.



RÉSULTATS BRUTS:

a)Alignement multiple 

B.P.Alp_5       ---------MLQVTILGCGASIGVPVIGCDCSTCTSPSKYNKRTRSAIYIN--------D
B.P.Alp_4       -------MTKNFIKILGCGSSQGVPKIDGDWGQCK-KNIKNIRTRCSIFVQ--------I
GOS_405102      ------------------------------------------------------------
B.P.Alp_1       --------MSLKFIILGSGSSMGVPRADGYSGDCDLKNKKNFRTRCSALIK--------F
B.P.Alp_2       ----------MKFIILGCGSSMGVPRPDGFFGNCDPNEKKNYRTRCSALIK--------T
B.P.Alp_3       ----------MKFIILGCGSSMGVPRADGNFGNCNPNNKKNYRTRCSALLK--------T
B.P.Alp_24      -------MSDARIILLGTGSSGGVPRVGGDWGACDPAEPKNRRRRCCALVQR-----FGA
B.P.Alp_27      -------MRRLRTTILGSGCSTGVPRADGFWGRCDPCNPKNRRSRCSALFQA-----FDP
B.P.Alp_25      ------MSASLEFTILGSGSSGGVPRADGNWGDCDPDEPKNHRSRCSLLVRR-----LGE
B.P.Alp_26      ------MTGRLEFTILGSGSSGGVPRADGNWGDCDPAEPRNLRTRCSMLVRR-----LGG
B.P.Alp_16      --------MTVILTILGSGSSAGVPRPALGWGACDPNNPKNRRRRCSLLAEK-----GGA
B.P.Alp_17      --------MTVTLTILGSGSSAGVPRPALGWGACDPNNPKNRRRRCSLLAEK-----AGP
B.P.Alp_14      --------MSLVFTILGSGSSAGVPRPALGWGACDPTNPKNRRRRCSAMVER-----TSD
B.P.Alp_13      --------MTLTLTILGCGSSAGVPRPAMGWGACDPKNPKNRRRRCSLMAER-----ASK
B.P.Alp_22      -------MARLRCTILGCGSSGGVPRLGGLWGACDPAEPKNRRRRCSLLIER-----IAE
B.P.Alp_21      -------MAELRLTILGCGSSGGVPRLGGHWGDCDPDNPKNRRRRCSVLVER-----ETD
B.P.Alp_20      -------MGVLRFTILGCGSSGGVPRLGGHWGDCDPDNPRNRRRRCSLLVER-----DGP
B.P.Alp_23      -------MGVLRFTILGCGSSGGVPRLGGHWGDCDPDNPRNRRRRCSLLVER-----DGP
B.P.Alp_12      --------MTLKVTILGCGSSAGVPRVGVGWGACDPANPKNRRHRCSILVER-----IGP
B.P.Alp_15      MPLPSETGASLTFTILGCGSSGGVPRVGQGWGACDPLNPRNRRRRCSMLVER-----VGP
B.P.Alp_6       -------MASLTLRILGCGSSGGVPRVGSGWGACDPEEPRNRRRRCSILVER-----ASG
B.P.Alp_7       MTVSVDAPASLTLRILGCGSSGGVPRVASGWGACNPEDPRNRRRRCSILVER-----VSG
B.P.Alp_9       -------MPSLSLRILGCGSSGGVPRVGYGWGACDPAEPRNRRRRCSLLVERR----DGG
B.P.Alp_11      -------MPSLSLRILGCGSSGGVPRVGYGWGACDPAEPRNRRRRCSLLVERRQGDGNGG
B.P.Alp_8       -------MSALTLRILGCGSSGGVPRVGSGWGACDPAEPRNRRGRCSILVEGR----QDH
B.P.Alp_10      -------MATLTLRILGCGSSGGVPRVGSGWGACDPAEPKNRRRRCSLLVEGRR---AGP
B.P.Alp_19      --------MTLTLTILGCGSSGGVPRVGNDWGDCDPTEPKNRRGRCALLVEK-----RVD
B.P.Alp_18      ------MSRPLEVTILGCGSSGGVPRIGNDWGQCDSNEPKNRRLRCSILVEQ-----RGP
B.P.Del_2       ----------MKIIVLGSGTSTGVPMVGCSCPVCSSSDPRDRRSRASLLIR--------H
B.P.Del_4       ----------MKITILGSGTSTGVPMVGCHCQVCGSSDPRDKRTRASILVE--------S
B.P.Del_1       ----------MKITILGSGTSTGVPMVGCSCPVCSSEDPRDKRTRASIIVE--------C
B.P.Del_3       ----------MKLTILGSGTSTGVPMVGCHCPVCSSGDRRDKRTRASIIIE--------N
B.P.Bet_3       -------MSSVELTVLGCGSSSGTPAIGCDCPTCTSPDPRNRRSRASAYLR--------V
B.P.Bet_4       -------MSSVELTVLGCGSSSGTPAIGCDCPTCTSPDLRNRRSRASAYLR--------V
B.P.Gam_1       --------MSVRVRFLGTGSSAGTPQVGCDCAVCRSDDPRNRRSRASILVE--------A
B.P.Gam_2       ----------MKVVFLGTGSSAGTPVIACHCPVCCSDDPRNHRLRASILVR--------D
B.P.Gam_3       ----------MKVIFLGTGSSAGTPAIACHCPVCCSVDPRNHRLRASILVQ--------D
B.P.Bet_1       ----------MRVTVLGAGSSAGTPVIGCQCAVCHSDNPKNKRSRCSSLITM-------D
B.P.Bet_2       ----------MQLTMLGVGSSAGTPMIGCQCSTCISTDKRNHRTRCSSAITL-------D
                                                                            

B.P.Alp_5       EN----SQILVDFGYDIKYQLVREKISKLDCAILTHDHSDHVNGIEDLRVFSFTSKKPLE
B.P.Alp_4       KN----IKFIIDTSPDIRFQLLKNKIDNIDFALFTHAHADHILGINELRTFYIKQKKKFN
GOS_405102      ---Q--RNILIDTSPDIKFQLLKNKVKNINNVFYTHAHADQTHGINEMRAFYIINKKKLP
B.P.Alp_1       ND----QNILIDTSPDLRSQLLKNKIKSISKVFYTHLHADQTHGINDLRPFFLINKKQIP
B.P.Alp_2       EK----ENVLIDTSPDLRQQLLRHKIKKINKVFYSHMHADQTHGINDLRSFYLSNKKPIE
B.P.Alp_3       DN----KNILIDTSPDLRQQLINNKINNIDYVLFSHMHADQTHGINDLRVFYIKNKKTIP
B.P.Alp_24      GDAL--TNILIDTSPDLREQLLEAEVMHLDAVIYTHDHADQSHGIDDVRALAIRQRRAIP
B.P.Alp_27      LSPEQTTNVVVDTSPDFRTQIMQTGINHLDAVLWTHDHADQTHGIDDMRAFALLRKMQVP
B.P.Alp_25      GGRTHQTTVIIDTSPDLRLQTVAAGVRRMDAALFTHDHADQAHGIDDLRPFFLNQRVRIP
B.P.Alp_26      GDPAADTTVVVDTAPDFRLQAVRAGVRRLDACLFTHDHADQAHGIDDLRPFFLNARRRVP
B.P.Alp_16      NG-L--TRVLIDTSPDLREQLIDANVDHLEATFLTHEHADQTHGIDDLRSVVLHQRKRIP
B.P.Alp_17      NG-I--TRVLIDTSPDLREQLIDANVDHLDATFLTHEHADQTHGIDDLRSVVLHQRRRIP
B.P.Alp_14      TG-I--TRVVIDTSPDLREQLIDANVGHIDAVFLTHEHADQTHGMDDLRSVVMHQRSRIP
B.P.Alp_13      EG-M--TRVVIDTSPDLREQLIDANVDHIDAVFLSHEHADQTHGIDDLRSVVLHQRRRIP
B.P.Alp_22      GG-T--TRVLIDTSPDMHPQLLDAGVGELDAVAWTHAHADHVHGIDDLRQIVFNMQKRLP
B.P.Alp_21      AG-T--TRVLIDTSPDLRNQLLDAGIGELNAVAYTHGHADHVHGIDDLRMIVFNMRERLP
B.P.Alp_20      EG-T--TTVLIDTSPDMRSQLLDSGTGRLDGVVYTHSHADHVHGIDDLRMIVFNMRDRIP
B.P.Alp_23      EG-T--TTVLIDTSPDMRSQLLDTGTGRLDGVVYTHSHADHVHGIDDLRMIVFNMRDRIP
B.P.Alp_12      GGAK--TTVLVDTGPDLREQLLGADVRHLDAVLITHEHADHIHGIDDLRPLALVQRQRIP
B.P.Alp_15      NG-K--TTVLVDTSPDLREQLIGEGVTHIDAVLYTHEHADHTHGIDDLRPLAIHNRARVD
B.P.Alp_6       TG-R--TTLLVDTSPDLREQLIDAGVTRLDGVLYTHAHADHTHGIDDLRPLVIAMRARIP
B.P.Alp_7       GG-R--TTVLVDTSPDLREQLLDADVQRLDAVLYTHAHADHTHGIDDLRPLVITMRARIP
B.P.Alp_9       GG-A--TTVLVDTSPDLREQLIDAGVTRLDALLYTHAHADHTHGIDDVRPLVIHMHRRIP
B.P.Alp_11      GG-A--TTVLVDTSPDLREQLIDAGVTRLDALLYTHAHADHTHGIDDVRPLVIHMHRRIP
B.P.Alp_8       SGPA--TMVLVDTSPDLREQLLDAGVMRLDAVLFTHAHADHTHGIDDLRPLVIQMRRRIP
B.P.Alp_10      GP-A--TTILVDTSPDLREQLLDAAAERLDAVLFTHAHADHTHGIDDVRAMVIHMRRRIP
B.P.Alp_19      NK-C--TTVLIDSGPDIRSQLLVANVEHLDAVLYTHSHADHLHGIDDLRAFWVQSGKRVP
B.P.Alp_18      NG-A--TQVLIDTGPDLRQQMLNANIQDLDAVLYTHAHADHLHGIDDLRVFTIRNRKRMP
B.P.Del_2       AG----KNILVDSSTDLRSQMLREMVPQIDAVLFTHAHADHVNGIDDLRGFYFLHRQVIP
B.P.Del_4       CG----QRILVDTSTDLRVQALREGIPQIDAVLLTHTHADHIHGIDDLRGFHFIHRRVIP
B.P.Del_1       SG----KYILVDTSTDLRKQAIRERIPHIDAVLFTHSHADHIHGIDDLRGFHFIHHRVIP
B.P.Del_3       NG----KYILVDTSTDLRKQVIREHIPHIDAVLFTHSHADHIHGIDDLRGFHFIHKRIIP
B.P.Bet_3       GD----TAFLIDTGPDLRHQALREGITRVDAVLYTHPHADHLNGIDDLRAFCYVKKGAIT
B.P.Bet_4       GD----TAFLIDTGPDLRHQALREGITRVDAVLYTHPHADHLNGIDDLRAFCYVKKGAIT
B.P.Gam_1       EG----VALLVDTGPDLRQQLLRENVRALTAVLYTHFHADHINGIDDLRAFNFLQKQVLD
B.P.Gam_2       EG----VDLLVDTGPDLRQQMLRAGVQSLTAVLYTHFHADHINGVDDLRAFNFAQEVVIP
B.P.Gam_3       GG----TNLLVDTGPDLRQQMLRAGVQVLSAVLYTHFHADHINGVDDLRAFNFAQKIVIP
B.P.Bet_1       DG----TNILIDTSPDFKMQAMRESIDKIDAVLYTHHHADHCHGMDDLRAYCQKYKKAIP
B.P.Bet_2       NG----KVILIDTGPDLRQQALRERLMNVDAVLYTHTHADHLHGIDDLRAYCQRQRCQIP
                        .::* . *:. * :      :     :* *:*:  *::::*         . 

B.P.Alp_5       IYTNYNTVAKLHKKFDYLFKPASVMPWQ-VLDTKPIDF-FDKIKI----STIEIQFFRQH
B.P.Alp_4       IYLTKFTEKSLKKMFKYLFINQKN--YPAVLKSNII---LNKKKV----RNLNIQAINVI
GOS_405102      VYGDKITKKLLFSTFKYCFKGTSS--YPATLKFINL---SRIHKFDNGKDKIVIKNITVE
B.P.Alp_1       VYADSNTKKYLLSTFKYCFKSSFG--YPSTLNIYSL---KKKHEFIIKDKKIKIESIPVQ
B.P.Alp_2       VFADKSTSQYLKDNFSFCFKS-YSKEYPATLKLNKINT-KNNLFVNSSIKKIEVKPISVI
B.P.Alp_3       AYADAATTKYLKKSFSYCFKS-FNKEYPAIIQLNKT---KNIMKIKDKQKTIKINSFPVP
B.P.Alp_24      VYFDPYARNSLMTRFEYCFIGGKG--YPAILSPHTTVNEGQAFSVTGAGGTVEFLPVSMI
B.P.Alp_27      GYMDEATRQTLLSRFDYIFAGKFG--YPPICAPMALPLFGETFHLTGEGGEVPVVTFDQI
B.P.Alp_25      TYMDQATHDGLLRRFEYVFRSQGG--YPAICEPLLLPPLGHDFEISGPSGDILVHTFDVD
B.P.Alp_26      TYMDAYTTQSLGRRFDYVFQSRGG--YPAICDAHSIPPHGQPWEIDGPSGAIPVTTFDVD
B.P.Alp_16      VYLNKSTGKDILLRFSYCFEQAPGSDYPAILEKRSIEA-GETKSIEGKGGSLALTAFLVQ
B.P.Alp_17      VYLNKSTGKDILTRFAYCFEQAPGSDYPAILEKRSIEA-GETQSVEGKGGALALTAFILQ
B.P.Alp_14      TYMNQCTANDVDQRFSYCFRSPLGSDYPPILERRSVEA-GESHTIDGKGGPITLTAFWVD
B.P.Alp_13      VYLNKSTAVDVMQRFSYCFVTPEGSYYPPILEQRSIEA-GESRTIDGSGGALTLSAFLVQ
B.P.Alp_22      VWADPVTQDALLTRFGYAFAQPAGSLYPPILDLNTI---EGPFEVEGAGGPIRLQPFQVS
B.P.Alp_21      VWADGATQTDLISRFGYAFVQPAGSSYPPICNLHSI---TGSFTISGAGGDITLTPFEVE
B.P.Alp_20      VYADGDTQNALLSRFGYAFVQPAGSPYPPILDLRSI---DGPLTISGPGGDITLRPFEVN
B.P.Alp_23      VYADGDTQNALLSRFGYAFVQPAGSPYPPILDLRSI---DGPLTISGPGGDIILRPFEVN
B.P.Alp_12      VYADRMTSELLQMRFGYCFETPAGSSYPPILKMRHLLP-GTMTAIQGAGGTVEALPFRMI
B.P.Alp_15      IYADEDTSRMLHQRFGYCFSTPPGSAYPPILTEHRFRE-GREIVVDG-------------
B.P.Alp_6       VYADALTRSLLTARFGYCFETPPGSAYPPILDLRDLAA-GRDLALEGEGGAITVEALPVE
B.P.Alp_7       VYADTLTRSLLTTRFGYCFETPPGSAYPPILDLRDL---PPALTLDGPGGPIPVESLPVE
B.P.Alp_9       VHADPLTRTMLIKRFGYAFETPPGSAYPPILDLHEMRE-GEVLTIDGAGGPVAAEAFRME
B.P.Alp_11      VHADPLTHALLMKRFGYAFETPPGSLYPPILDLHEMRA-DEPLTIAGAGGPIVADAFRME
B.P.Alp_8       VYADATTQALLKLRFGYCFETAPGSQYPPILDLHELPD-GIPLSLAGPGGPVTASSFRME
B.P.Alp_10      VYADATTRALLETRFAYCFATPPGSQYPPILDLHDLPD-GAPLGLDGPGGPVTATSFRME
B.P.Alp_19      VYMDDATAARALTAFSYCFETPPGSNYPPILERHDLQP-GTPVTINGDGGAITFEPFEVV
B.P.Alp_18      VYMDAVTTQRAHEAFGYCFKQPEGSSYPPILDHHMLEA-GRNCEIDGAGGTISFLPITVH
B.P.Del_2       CYACPATMERLLSGFGYVFHQEKGATHPPLLEARVT---GGPFDLFG----LQVLPVPLE
B.P.Del_4       CYASRDTMDKVRANFSYIFEGLSSEGYSPLLESFPV---EDPFDLFG----CRITPVPIS
B.P.Del_1       CYGSEDSIETIARNFSYIFKGMETAGYSPLLEPHVV---NDRIELFG----CAIDPIPLL
B.P.Del_3       CYGSEESMKVIARNFSYIFKGMEAAGYAPLMEQNII---SGPMDLFG----CRVEPIPLM
B.P.Bet_3       LFGNSFTLANVRSRFDYALHAPSKAWDKPVLLTEEV---GGPFGF----GGVTVTPIPLM
B.P.Bet_4       LFGNSFTLANVRSRFDYALHAPSKAWDKPVLLTEEV---GGPFGF----GGVTVTPIPLM
B.P.Gam_1       CYGDVRTGKELEERFRYCFLPPDPAWAKPSLRMHHL---DGPREF----GPLRVTPVPVL
B.P.Gam_2       CYADERTAAELESRFRYCFLPPDPAWAKPSLSMHRI---VSPQTF----GGVRVTPIPVL
B.P.Gam_3       CHADERTAIELETRFRYCFLPPDITWAKPSLSMHRI---ASPQTF----GGVEVTPIPVL
B.P.Bet_1       IFANQNTMSELKLKFQYAIREETKFWETPVLHAQIV---NQLFNI----GSHEVIPLPVI
B.P.Bet_2       LYGSPDAMRHIADKFGYTLREAGDFWDLPILKVNPV---ISSFSL----FEQTITPIPIK
                      :       * : :                         .               

B.P.Alp_5       HGSIDSLGLRIGD-FVYSPDVIDFPLESEKFLKDIKIWILDCMDYKSNPNHAGLDKVLEW
B.P.Alp_4       HGTMKTIGYRINN-FAYIPDFKKINNSELKKLQNLDVLIIDCFRYKEHNTHVNLTECLHY
GOS_405102      HGLIDSKCYIINNKCAYVSDVSKIYNKDIIKLKNLKYFVVDCLRFKQHPSHFNLSDVFKI
B.P.Alp_1       HGKIKSICYLINNKLAYASDISLFFKKDYKKLKNLEYLIIDCLWCRNHSAHFNLDQVLEI
B.P.Alp_2       HGNVNSICYIINRELAYISDVSEILKKDLKYFKNLKYLIVDCLWYNFHPSHLNLEKSLNL
B.P.Alp_3       HGKVKSICYIFDQKLAYISDVSNIEKKYFKYFKNLKYLVIDCLWYRYHPSHLNLEKVLEL
B.P.Alp_24      HGPIPCTGYRIGN-VAYCNDVNELPATALRQLGGLDVLIIDALRHTPHPSHAHLELALEW
B.P.Alp_27      HGPIRSVGYRIGD-VAYSSDISDLPEDSFAHLYGLKVWVVDALRYSPHPTHAHLDLALEW
B.P.Alp_25      HGEVRAVGYRIGD-VAYTPDVRAIPESSWADLADLEVWIVDALRWTPHPTHAHVELALEW
B.P.Alp_26      HGEIRAVGYRFGN-VAYTPDAIGFPEESWAALADLDVWIVDALRWTPHPTHAHVGLALEW
B.P.Alp_16      HGNIPALGYRIGN-AAYTPDLHDIPPESFHALENLDLWIIDALRYAPHPSHFSLDDALSW
B.P.Alp_17      HGNIPALGYRIGN-AAYTPDLNDIPPESFHALEGLDLWIVDALRYAPHPSHFSLDDALAW
B.P.Alp_14      HGKIPALGYRIGN-AAYTPDLNGIPPESFAALENLDLWVVDGLRYKPHSSHFCVDDALAS
B.P.Alp_13      HGQITALGYRIGD-AAYTPDLCDIPPESWPALENLDLWIIDGLRYEQHPTHFSVADALSW
B.P.Alp_22      HGPTEALGFRVEG-MAYLPDVVAIPEEAWPHLEGLEMWVLDTLRRKPHPTHAHLALALDW
B.P.Alp_21      HGNIDALGFRIGD-VAYLPDVSDIPEDVWPQLENLDTWIVDCLRRTPHPSHAHLERTFEW
B.P.Alp_20      HGSMDALGFRIGD-LAYLPDVAKIPDSALVELQDLDCWILDALRRKPHPTHLSLDEALEW
B.P.Alp_23      HGSMDALGFRIGD-LAYLPDVAKIPDSALAELQDLNCWILDALRRKPHPTHLSLDEALEW
B.P.Alp_12      HGDIDALGFRFGK-IAYAPDVSRMPEESLPSLEGLDVLILDALRYTPHPTHFSVSEALEL
B.P.Alp_15      -----AVGFRFGD-VAYSSDVNGISENSLAHLHNLDVWVIDALRETPHPSHFTLQEALDH
B.P.Alp_6       HGNEAALGFRFGA-AAYMPDVSLIPEASLARLRGLDLLIIDALRDTPHPTHFSVSDALAL
B.P.Alp_7       HGTEAALGFRFGS-AAYMPDVSLIPAASRARLHGLDLLIIDALRDTPHPTHFSVSDALAL
B.P.Alp_9       HGNEIAHGFRFGP-AAYAPDVSLMPEAAKARLHGLDLLIIDALRETPHPSHYSVSDALAL
B.P.Alp_11      HGNEIAHGFRFGP-AAYAPDVSLMPEAAKARLHGLDLLIIDALRETPHPSHYSVSDALAL
B.P.Alp_8       HGDEEALGFRFAD-AAYAPDVSTMPEAAKAHLRGLDLLIIDALRDTPHPTHYSVSDALAL
B.P.Alp_10      HGNEEALGFRFAD-AAYAPDVSLMPEAAKAHLRDLDLLILDALRDTPHPTHFSVSDALAL
B.P.Alp_19      HGEINALGFRIGD-TAYIPDVSDIPENSLNQLKDLDILILDCLRRRPHPSHFCLAEALTW
B.P.Alp_18      HGDIDALAFRFNG-IGYMPDVSDLSSDAIHSLSDLDTLIIDALRRTPHPSHFSLDDALGW
B.P.Del_2       HGVDGSCGYRIGS-FAYLTDCSAIPPASLALLQGVATVVVDGLRWSPHPFHFNIEGAIAA
B.P.Del_4       HGSFLATGYRFDN-AAYLTDCSEIPEQSLPLLQGLDLMIIDALRFSPHPNHFNIEGALKM
B.P.Del_1       HGTMPATGYRFND-MAYLTDCSAIPDHSRAKLGGLKLLIIDALRYTPHPNHFNIEGALQV
B.P.Del_3       HGHMPTTGYRFDD-VAYLTDCSSIADTSRAKLAGLRLLILDALRYTPHPNHYNIEGALKV
B.P.Bet_3       HGSWPCLGWRIGD-VAWLTDLSDIPEHSLEKLQGLEVLFLDCLRREPYPSHLCVADSLRW
B.P.Bet_4       HGNWPCLGWRIGD-VAWLTDLSDIPEHSLEKLQGLEVLFLDCLRREPYPSHLCVADSLRW
B.P.Gam_1       HGHLQIFGYRFND-VAYLTDLKRIPESSMALLQKLDILILDCLREEEHPTHINVTEAIAL
B.P.Gam_2       HGDLPILGYRFND-VAYLTDLKTIPDASLELLRGLKVLVLDCLRYEYHPTHLHVEEARYW
B.P.Gam_3       HGQLPILGYRFND-VAYLTDLKTIPDSSLMLLQGLKVLILDCLHYAEHPAHLNVEEALYW
B.P.Bet_1       HGRMEILGYRIGR-FAYITDVSEIPDSTLELLQGIDTLMLDCLRFEPHFSHYGFKQSLAM
B.P.Bet_2       HGHSDIYGYRIGN-LVYLTDVSAVPASSMEFLNDVDVLLLDCLRITPHYTHVNLEQSLAL
                          .     :  *   .       :  :   .:* :       *  .      

B.P.Alp_5       REKYKPEEILLTNMRHTIDYHEITKMLPS-DVKPLYDGYKF-------------TV----
B.P.Alp_4       IKNINPKKAYLTNLNQDLDYFKLKKKIKKNNINPSYDGLKI-------------KLN---
GOS_405102      IKKIGPKKTILTNLHSDIDYNYLKHKLPK-NIIPAYDGLNF-------------LI----
B.P.Alp_1       VKILTPKKTILTNMHSDLDYAKLKKKLPK-NIIPGFDGLTV-------------SLKN--
B.P.Alp_2       INYLKPKKAILTNLSPVLDYKVLKKLVPK-NVIPAHDGLTL-------------NL----
B.P.Alp_3       TKILKPKKTILTNLHSDLDYKELLKRLPK-KIIPAYDGLTL-------------NL----
B.P.Alp_24      IKELRPKRAVLTNLHVDMDYQTLRRTLPA-NVEPGFDGMTI-------------SIES--
B.P.Alp_27      IARVKPELAVLTNLHQEMDYEELRANLPD-GVVPAYDQMVI-------------DTEF--
B.P.Alp_25      IARVKPKRAILTNLHIDLDYHALAAKLPP-GVEPAYDGLRF-------------QLRAPA
B.P.Alp_26      IARARPRRAILTNLHIDLDFNALAAKLPV-GVEPAYDGMSF-------------EI----
B.P.Alp_16      IAKFKPRRAVLTNLHSDLDYDVLQAKLPP-GVEAGYDGMRL-------------AIEA--
B.P.Alp_17      IAKFKPRRAVLTNLHSDLDYDVLRSKLPP-GIEVGYDGMRL-------------EIEA--
B.P.Alp_14      IARFKPRRAVITNMHADIDYEDLRHRLPA-GVVPGYDGMRL-------------DITPGS
B.P.Alp_13      IDRFKPARAVITNMHSDLDYEILRHELPE-NVMPAYDGMRL-------------TIDPA-
B.P.Alp_22      IARARPERAILTNMHIDLDYATLAAELPP-HIVPAYDGLTF-------------DLAA--
B.P.Alp_21      IARAKPKSAVLTNMHIDLDYAVLEAETAD-HITPAYDGMVL-------------RFEG--
B.P.Alp_20      IERMAPKRAVLTNMHIDLDYAEVAAETPD-HIDPAYDGMVI-------------EYPI--
B.P.Alp_23      IDRMAPKRAVLTNMHIDLDYAQVAAETPD-HIDPAYDGMVI-------------EYPI--
B.P.Alp_12      IGRVKPKRAILTNLHTDLDYEILRSKLPR-HIDPAYDGLQI-------------EVA---
B.P.Alp_15      VALMKPKRTILTNLHTDLDYAALEARLPD-GIVPAYDGLKFESHSCSHAASADTVASG--
B.P.Alp_6       IRAVRPRRAVLTNLHTDLDYAALAARLPE-GIVPAYDGMSL-------------SLDG--
B.P.Alp_7       IAETKPRRAVLTNLHTDLDYAALTERLPA-GVVPAYDGMVL-------------TLDA--
B.P.Alp_9       IEEVAPRRAILTNLHTDLDYATLAGKLPP-GVVPAYDGLTA-------------TVDL--
B.P.Alp_11      IEEVAPRRAILTNLHTDLDYATLAKKLPG-HVVPAYDGLTA-------------TVDL--
B.P.Alp_8       IEEVRPRRAILTNLHTDLDYEALRRRLPE-GVVPAYDGLTV-------------TVDG--
B.P.Alp_10      IEEVRPRRAILTNLHTDLDYESLRRRLPK-GVVPAYDGLTV-------------TVEG--
B.P.Alp_19      TRKIAPARAVFTNLHNDLDYHVLSAELPE-TIEPAYDGMILTAEIAGTGKETVLSTDGW-
B.P.Alp_18      IEKLRPIKAVLTNMHVDMDYQSLLSELPD-GVIPAFDGMKL--------------LG---
B.P.Del_2       LRELGVRRMILTHLTHEVRHAD-ERRLPN-GVEFAYDGMNF-------------ELER--
B.P.Del_4       SEILKPRRTLLTHLTHEVHHSD-GQRLPQ-GVEFAYDGLTV-------------EL----
B.P.Del_1       VEKLRPERAVLTHLTHEVPYRD-GEKLPA-GVEFAYDGMTI-------------DM----
B.P.Del_3       VEDLRPEHAILTHLTHEVSYSD-GAKLPS-GVEFAYDGMSF-------------AL----
B.P.Bet_3       AERIGARRTILIHMTHGLEYHALSAECPP-GVEVGYDGLKV-------------SVPLA-
B.P.Bet_4       AERIGARRTILIHMTHGLEYHALSAECPP-GVEVGYDGLKV-------------SVPLA-
B.P.Gam_1       AKEIGARYTYFTHMTHDLGFASLAERLPE-GMAPAYDGLQI-------------RSAG--
B.P.Gam_2       ARRIGAERTILTHMTHDVDYATLAAELPE-GVIPASDGMVL-------------DL----
B.P.Gam_3       ARRIDAERTIFTHMTHDVDYATLAAELPE-TVIPAYDGMVV-------------DL----
B.P.Bet_1       AEKINPKRTFLIHMTHDIEYDAVSDSLPE-HVFLAYDGLKL-------------QINN--
B.P.Bet_2       ASQIGAKATYLIHMTHDLEYAELSAQLPA-NVFVGYDGLKI-------------KI----
                          : ::   : .           :    *                       

B.P.Alp_5       ---
B.P.Alp_4       ---
GOS_405102      ---
B.P.Alp_1       ---
B.P.Alp_2       ---
B.P.Alp_3       ---
B.P.Alp_24      ---
B.P.Alp_27      ---
B.P.Alp_25      R--
B.P.Alp_26      ---
B.P.Alp_16      ---
B.P.Alp_17      ---
B.P.Alp_14      DQA
B.P.Alp_13      ---
B.P.Alp_22      ---
B.P.Alp_21      ---
B.P.Alp_20      ---
B.P.Alp_23      ---
B.P.Alp_12      ---
B.P.Alp_15      ---
B.P.Alp_6       ---
B.P.Alp_7       ---
B.P.Alp_9       ---
B.P.Alp_11      ---
B.P.Alp_8       ---
B.P.Alp_10      ---
B.P.Alp_19      ---
B.P.Alp_18      ---
B.P.Del_2       ---
B.P.Del_4       ---
B.P.Del_1       ---
B.P.Del_3       ---
B.P.Bet_3       ---
B.P.Bet_4       ---
B.P.Gam_1       ---
B.P.Gam_2       ---
B.P.Gam_3       ---
B.P.Bet_1       ---
B.P.Bet_2       ---
========================================================================================================================

b)Curation
Processed file: input.fasta
Number of sequences: 39
Alignment assumed to be: Protein
New number of positions: 135 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Alp_5_[  ---------MLQVTILGCGASIGVPVIGCDCSTCTSPSKYNKRTRSAIYIN--------D
Bac_Pro_Alp_4_[  -------MTKNFIKILGCGSSQGVPKIDGDWGQCK-KNIKNIRTRCSIFVQ--------I
GOS_4051020_Tra  ------------------------------------------------------------
Bac_Pro_Alp_1_[  --------MSLKFIILGSGSSMGVPRADGYSGDCDLKNKKNFRTRCSALIK--------F
Bac_Pro_Alp_2_[  ----------MKFIILGCGSSMGVPRPDGFFGNCDPNEKKNYRTRCSALIK--------T
Bac_Pro_Alp_3_[  ----------MKFIILGCGSSMGVPRADGNFGNCNPNNKKNYRTRCSALLK--------T
Bac_Pro_Alp_24   -------MSDARIILLGTGSSGGVPRVGGDWGACDPAEPKNRRRRCCALVQR-----FGA
Bac_Pro_Alp_27   -------MRRLRTTILGSGCSTGVPRADGFWGRCDPCNPKNRRSRCSALFQA-----FDP
Bac_Pro_Alp_25   ------MSASLEFTILGSGSSGGVPRADGNWGDCDPDEPKNHRSRCSLLVRR-----LGE
Bac_Pro_Alp_26   ------MTGRLEFTILGSGSSGGVPRADGNWGDCDPAEPRNLRTRCSMLVRR-----LGG
Bac_Pro_Alp_16   --------MTVILTILGSGSSAGVPRPALGWGACDPNNPKNRRRRCSLLAEK-----GGA
Bac_Pro_Alp_17   --------MTVTLTILGSGSSAGVPRPALGWGACDPNNPKNRRRRCSLLAEK-----AGP
Bac_Pro_Alp_14   --------MSLVFTILGSGSSAGVPRPALGWGACDPTNPKNRRRRCSAMVER-----TSD
Bac_Pro_Alp_13   --------MTLTLTILGCGSSAGVPRPAMGWGACDPKNPKNRRRRCSLMAER-----ASK
Bac_Pro_Alp_22   -------MARLRCTILGCGSSGGVPRLGGLWGACDPAEPKNRRRRCSLLIER-----IAE
Bac_Pro_Alp_21   -------MAELRLTILGCGSSGGVPRLGGHWGDCDPDNPKNRRRRCSVLVER-----ETD
Bac_Pro_Alp_20   -------MGVLRFTILGCGSSGGVPRLGGHWGDCDPDNPRNRRRRCSLLVER-----DGP
Bac_Pro_Alp_23   -------MGVLRFTILGCGSSGGVPRLGGHWGDCDPDNPRNRRRRCSLLVER-----DGP
Bac_Pro_Alp_12   --------MTLKVTILGCGSSAGVPRVGVGWGACDPANPKNRRHRCSILVER-----IGP
Bac_Pro_Alp_15   MPLPSETGASLTFTILGCGSSGGVPRVGQGWGACDPLNPRNRRRRCSMLVER-----VGP
Bac_Pro_Alp_6_[  -------MASLTLRILGCGSSGGVPRVGSGWGACDPEEPRNRRRRCSILVER-----ASG
Bac_Pro_Alp_7_[  MTVSVDAPASLTLRILGCGSSGGVPRVASGWGACNPEDPRNRRRRCSILVER-----VSG
Bac_Pro_Alp_9_[  -------MPSLSLRILGCGSSGGVPRVGYGWGACDPAEPRNRRRRCSLLVERR----DGG
Bac_Pro_Alp_11   -------MPSLSLRILGCGSSGGVPRVGYGWGACDPAEPRNRRRRCSLLVERRQGDGNGG
Bac_Pro_Alp_8_[  -------MSALTLRILGCGSSGGVPRVGSGWGACDPAEPRNRRGRCSILVEGR----QDH
Bac_Pro_Alp_10   -------MATLTLRILGCGSSGGVPRVGSGWGACDPAEPKNRRRRCSLLVEGRR---AGP
Bac_Pro_Alp_19   --------MTLTLTILGCGSSGGVPRVGNDWGDCDPTEPKNRRGRCALLVEK-----RVD
Bac_Pro_Alp_18   ------MSRPLEVTILGCGSSGGVPRIGNDWGQCDSNEPKNRRLRCSILVEQ-----RGP
Bac_Pro_Del_2_[  ----------MKIIVLGSGTSTGVPMVGCSCPVCSSSDPRDRRSRASLLIR--------H
Bac_Pro_Del_4_[  ----------MKITILGSGTSTGVPMVGCHCQVCGSSDPRDKRTRASILVE--------S
Bac_Pro_Del_1_[  ----------MKITILGSGTSTGVPMVGCSCPVCSSEDPRDKRTRASIIVE--------C
Bac_Pro_Del_3_[  ----------MKLTILGSGTSTGVPMVGCHCPVCSSGDRRDKRTRASIIIE--------N
Bac_Pro_Bet_3_[  -------MSSVELTVLGCGSSSGTPAIGCDCPTCTSPDPRNRRSRASAYLR--------V
Bac_Pro_Bet_4_[  -------MSSVELTVLGCGSSSGTPAIGCDCPTCTSPDLRNRRSRASAYLR--------V
Bac_Pro_Gam_1_[  --------MSVRVRFLGTGSSAGTPQVGCDCAVCRSDDPRNRRSRASILVE--------A
Bac_Pro_Gam_2_[  ----------MKVVFLGTGSSAGTPVIACHCPVCCSDDPRNHRLRASILVR--------D
Bac_Pro_Gam_3_[  ----------MKVIFLGTGSSAGTPAIACHCPVCCSVDPRNHRLRASILVQ--------D
Bac_Pro_Bet_1_[  ----------MRVTVLGAGSSAGTPVIGCQCAVCHSDNPKNKRSRCSSLITM-------D
Bac_Pro_Bet_2_[  ----------MQLTMLGVGSSAGTPMIGCQCSTCISTDKRNHRTRCSSAITL-------D
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Alp_5_[  EN----SQILVDFGYDIKYQLVREKISKLDCAILTHDHSDHVNGIEDLRVFSFTSKKPLE
Bac_Pro_Alp_4_[  KN----IKFIIDTSPDIRFQLLKNKIDNIDFALFTHAHADHILGINELRTFYIKQKKKFN
GOS_4051020_Tra  ---Q--RNILIDTSPDIKFQLLKNKVKNINNVFYTHAHADQTHGINEMRAFYIINKKKLP
Bac_Pro_Alp_1_[  ND----QNILIDTSPDLRSQLLKNKIKSISKVFYTHLHADQTHGINDLRPFFLINKKQIP
Bac_Pro_Alp_2_[  EK----ENVLIDTSPDLRQQLLRHKIKKINKVFYSHMHADQTHGINDLRSFYLSNKKPIE
Bac_Pro_Alp_3_[  DN----KNILIDTSPDLRQQLINNKINNIDYVLFSHMHADQTHGINDLRVFYIKNKKTIP
Bac_Pro_Alp_24   GDAL--TNILIDTSPDLREQLLEAEVMHLDAVIYTHDHADQSHGIDDVRALAIRQRRAIP
Bac_Pro_Alp_27   LSPEQTTNVVVDTSPDFRTQIMQTGINHLDAVLWTHDHADQTHGIDDMRAFALLRKMQVP
Bac_Pro_Alp_25   GGRTHQTTVIIDTSPDLRLQTVAAGVRRMDAALFTHDHADQAHGIDDLRPFFLNQRVRIP
Bac_Pro_Alp_26   GDPAADTTVVVDTAPDFRLQAVRAGVRRLDACLFTHDHADQAHGIDDLRPFFLNARRRVP
Bac_Pro_Alp_16   NG-L--TRVLIDTSPDLREQLIDANVDHLEATFLTHEHADQTHGIDDLRSVVLHQRKRIP
Bac_Pro_Alp_17   NG-I--TRVLIDTSPDLREQLIDANVDHLDATFLTHEHADQTHGIDDLRSVVLHQRRRIP
Bac_Pro_Alp_14   TG-I--TRVVIDTSPDLREQLIDANVGHIDAVFLTHEHADQTHGMDDLRSVVMHQRSRIP
Bac_Pro_Alp_13   EG-M--TRVVIDTSPDLREQLIDANVDHIDAVFLSHEHADQTHGIDDLRSVVLHQRRRIP
Bac_Pro_Alp_22   GG-T--TRVLIDTSPDMHPQLLDAGVGELDAVAWTHAHADHVHGIDDLRQIVFNMQKRLP
Bac_Pro_Alp_21   AG-T--TRVLIDTSPDLRNQLLDAGIGELNAVAYTHGHADHVHGIDDLRMIVFNMRERLP
Bac_Pro_Alp_20   EG-T--TTVLIDTSPDMRSQLLDSGTGRLDGVVYTHSHADHVHGIDDLRMIVFNMRDRIP
Bac_Pro_Alp_23   EG-T--TTVLIDTSPDMRSQLLDTGTGRLDGVVYTHSHADHVHGIDDLRMIVFNMRDRIP
Bac_Pro_Alp_12   GGAK--TTVLVDTGPDLREQLLGADVRHLDAVLITHEHADHIHGIDDLRPLALVQRQRIP
Bac_Pro_Alp_15   NG-K--TTVLVDTSPDLREQLIGEGVTHIDAVLYTHEHADHTHGIDDLRPLAIHNRARVD
Bac_Pro_Alp_6_[  TG-R--TTLLVDTSPDLREQLIDAGVTRLDGVLYTHAHADHTHGIDDLRPLVIAMRARIP
Bac_Pro_Alp_7_[  GG-R--TTVLVDTSPDLREQLLDADVQRLDAVLYTHAHADHTHGIDDLRPLVITMRARIP
Bac_Pro_Alp_9_[  GG-A--TTVLVDTSPDLREQLIDAGVTRLDALLYTHAHADHTHGIDDVRPLVIHMHRRIP
Bac_Pro_Alp_11   GG-A--TTVLVDTSPDLREQLIDAGVTRLDALLYTHAHADHTHGIDDVRPLVIHMHRRIP
Bac_Pro_Alp_8_[  SGPA--TMVLVDTSPDLREQLLDAGVMRLDAVLFTHAHADHTHGIDDLRPLVIQMRRRIP
Bac_Pro_Alp_10   GP-A--TTILVDTSPDLREQLLDAAAERLDAVLFTHAHADHTHGIDDVRAMVIHMRRRIP
Bac_Pro_Alp_19   NK-C--TTVLIDSGPDIRSQLLVANVEHLDAVLYTHSHADHLHGIDDLRAFWVQSGKRVP
Bac_Pro_Alp_18   NG-A--TQVLIDTGPDLRQQMLNANIQDLDAVLYTHAHADHLHGIDDLRVFTIRNRKRMP
Bac_Pro_Del_2_[  AG----KNILVDSSTDLRSQMLREMVPQIDAVLFTHAHADHVNGIDDLRGFYFLHRQVIP
Bac_Pro_Del_4_[  CG----QRILVDTSTDLRVQALREGIPQIDAVLLTHTHADHIHGIDDLRGFHFIHRRVIP
Bac_Pro_Del_1_[  SG----KYILVDTSTDLRKQAIRERIPHIDAVLFTHSHADHIHGIDDLRGFHFIHHRVIP
Bac_Pro_Del_3_[  NG----KYILVDTSTDLRKQVIREHIPHIDAVLFTHSHADHIHGIDDLRGFHFIHKRIIP
Bac_Pro_Bet_3_[  GD----TAFLIDTGPDLRHQALREGITRVDAVLYTHPHADHLNGIDDLRAFCYVKKGAIT
Bac_Pro_Bet_4_[  GD----TAFLIDTGPDLRHQALREGITRVDAVLYTHPHADHLNGIDDLRAFCYVKKGAIT
Bac_Pro_Gam_1_[  EG----VALLVDTGPDLRQQLLRENVRALTAVLYTHFHADHINGIDDLRAFNFLQKQVLD
Bac_Pro_Gam_2_[  EG----VDLLVDTGPDLRQQMLRAGVQSLTAVLYTHFHADHINGVDDLRAFNFAQEVVIP
Bac_Pro_Gam_3_[  GG----TNLLVDTGPDLRQQMLRAGVQVLSAVLYTHFHADHINGVDDLRAFNFAQKIVIP
Bac_Pro_Bet_1_[  DG----TNILIDTSPDFKMQAMRESIDKIDAVLYTHHHADHCHGMDDLRAYCQKYKKAIP
Bac_Pro_Bet_2_[  NG----KVILIDTGPDLRQQALRERLMNVDAVLYTHTHADHLHGIDDLRAYCQRQRCQIP
                          ###################################################


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Alp_5_[  IYTNYNTVAKLHKKFDYLFKPASVMPWQ-VLDTKPIDF-FDKIKI----STIEIQFFRQH
Bac_Pro_Alp_4_[  IYLTKFTEKSLKKMFKYLFINQKN--YPAVLKSNII---LNKKKV----RNLNIQAINVI
GOS_4051020_Tra  VYGDKITKKLLFSTFKYCFKGTSS--YPATLKFINL---SRIHKFDNGKDKIVIKNITVE
Bac_Pro_Alp_1_[  VYADSNTKKYLLSTFKYCFKSSFG--YPSTLNIYSL---KKKHEFIIKDKKIKIESIPVQ
Bac_Pro_Alp_2_[  VFADKSTSQYLKDNFSFCFKS-YSKEYPATLKLNKINT-KNNLFVNSSIKKIEVKPISVI
Bac_Pro_Alp_3_[  AYADAATTKYLKKSFSYCFKS-FNKEYPAIIQLNKT---KNIMKIKDKQKTIKINSFPVP
Bac_Pro_Alp_24   VYFDPYARNSLMTRFEYCFIGGKG--YPAILSPHTTVNEGQAFSVTGAGGTVEFLPVSMI
Bac_Pro_Alp_27   GYMDEATRQTLLSRFDYIFAGKFG--YPPICAPMALPLFGETFHLTGEGGEVPVVTFDQI
Bac_Pro_Alp_25   TYMDQATHDGLLRRFEYVFRSQGG--YPAICEPLLLPPLGHDFEISGPSGDILVHTFDVD
Bac_Pro_Alp_26   TYMDAYTTQSLGRRFDYVFQSRGG--YPAICDAHSIPPHGQPWEIDGPSGAIPVTTFDVD
Bac_Pro_Alp_16   VYLNKSTGKDILLRFSYCFEQAPGSDYPAILEKRSIEA-GETKSIEGKGGSLALTAFLVQ
Bac_Pro_Alp_17   VYLNKSTGKDILTRFAYCFEQAPGSDYPAILEKRSIEA-GETQSVEGKGGALALTAFILQ
Bac_Pro_Alp_14   TYMNQCTANDVDQRFSYCFRSPLGSDYPPILERRSVEA-GESHTIDGKGGPITLTAFWVD
Bac_Pro_Alp_13   VYLNKSTAVDVMQRFSYCFVTPEGSYYPPILEQRSIEA-GESRTIDGSGGALTLSAFLVQ
Bac_Pro_Alp_22   VWADPVTQDALLTRFGYAFAQPAGSLYPPILDLNTI---EGPFEVEGAGGPIRLQPFQVS
Bac_Pro_Alp_21   VWADGATQTDLISRFGYAFVQPAGSSYPPICNLHSI---TGSFTISGAGGDITLTPFEVE
Bac_Pro_Alp_20   VYADGDTQNALLSRFGYAFVQPAGSPYPPILDLRSI---DGPLTISGPGGDITLRPFEVN
Bac_Pro_Alp_23   VYADGDTQNALLSRFGYAFVQPAGSPYPPILDLRSI---DGPLTISGPGGDIILRPFEVN
Bac_Pro_Alp_12   VYADRMTSELLQMRFGYCFETPAGSSYPPILKMRHLLP-GTMTAIQGAGGTVEALPFRMI
Bac_Pro_Alp_15   IYADEDTSRMLHQRFGYCFSTPPGSAYPPILTEHRFRE-GREIVVDG-------------
Bac_Pro_Alp_6_[  VYADALTRSLLTARFGYCFETPPGSAYPPILDLRDLAA-GRDLALEGEGGAITVEALPVE
Bac_Pro_Alp_7_[  VYADTLTRSLLTTRFGYCFETPPGSAYPPILDLRDL---PPALTLDGPGGPIPVESLPVE
Bac_Pro_Alp_9_[  VHADPLTRTMLIKRFGYAFETPPGSAYPPILDLHEMRE-GEVLTIDGAGGPVAAEAFRME
Bac_Pro_Alp_11   VHADPLTHALLMKRFGYAFETPPGSLYPPILDLHEMRA-DEPLTIAGAGGPIVADAFRME
Bac_Pro_Alp_8_[  VYADATTQALLKLRFGYCFETAPGSQYPPILDLHELPD-GIPLSLAGPGGPVTASSFRME
Bac_Pro_Alp_10   VYADATTRALLETRFAYCFATPPGSQYPPILDLHDLPD-GAPLGLDGPGGPVTATSFRME
Bac_Pro_Alp_19   VYMDDATAARALTAFSYCFETPPGSNYPPILERHDLQP-GTPVTINGDGGAITFEPFEVV
Bac_Pro_Alp_18   VYMDAVTTQRAHEAFGYCFKQPEGSSYPPILDHHMLEA-GRNCEIDGAGGTISFLPITVH
Bac_Pro_Del_2_[  CYACPATMERLLSGFGYVFHQEKGATHPPLLEARVT---GGPFDLFG----LQVLPVPLE
Bac_Pro_Del_4_[  CYASRDTMDKVRANFSYIFEGLSSEGYSPLLESFPV---EDPFDLFG----CRITPVPIS
Bac_Pro_Del_1_[  CYGSEDSIETIARNFSYIFKGMETAGYSPLLEPHVV---NDRIELFG----CAIDPIPLL
Bac_Pro_Del_3_[  CYGSEESMKVIARNFSYIFKGMEAAGYAPLMEQNII---SGPMDLFG----CRVEPIPLM
Bac_Pro_Bet_3_[  LFGNSFTLANVRSRFDYALHAPSKAWDKPVLLTEEV---GGPFGF----GGVTVTPIPLM
Bac_Pro_Bet_4_[  LFGNSFTLANVRSRFDYALHAPSKAWDKPVLLTEEV---GGPFGF----GGVTVTPIPLM
Bac_Pro_Gam_1_[  CYGDVRTGKELEERFRYCFLPPDPAWAKPSLRMHHL---DGPREF----GPLRVTPVPVL
Bac_Pro_Gam_2_[  CYADERTAAELESRFRYCFLPPDPAWAKPSLSMHRI---VSPQTF----GGVRVTPIPVL
Bac_Pro_Gam_3_[  CHADERTAIELETRFRYCFLPPDITWAKPSLSMHRI---ASPQTF----GGVEVTPIPVL
Bac_Pro_Bet_1_[  IFANQNTMSELKLKFQYAIREETKFWETPVLHAQIV---NQLFNI----GSHEVIPLPVI
Bac_Pro_Bet_2_[  LYGSPDAMRHIADKFGYTLREAGDFWDLPILKVNPV---ISSFSL----FEQTITPIPIK
                 ###################                                         


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Alp_5_[  HGSIDSLGLRIGD-FVYSPDVIDFPLESEKFLKDIKIWILDCMDYKSNPNHAGLDKVLEW
Bac_Pro_Alp_4_[  HGTMKTIGYRINN-FAYIPDFKKINNSELKKLQNLDVLIIDCFRYKEHNTHVNLTECLHY
GOS_4051020_Tra  HGLIDSKCYIINNKCAYVSDVSKIYNKDIIKLKNLKYFVVDCLRFKQHPSHFNLSDVFKI
Bac_Pro_Alp_1_[  HGKIKSICYLINNKLAYASDISLFFKKDYKKLKNLEYLIIDCLWCRNHSAHFNLDQVLEI
Bac_Pro_Alp_2_[  HGNVNSICYIINRELAYISDVSEILKKDLKYFKNLKYLIVDCLWYNFHPSHLNLEKSLNL
Bac_Pro_Alp_3_[  HGKVKSICYIFDQKLAYISDVSNIEKKYFKYFKNLKYLVIDCLWYRYHPSHLNLEKVLEL
Bac_Pro_Alp_24   HGPIPCTGYRIGN-VAYCNDVNELPATALRQLGGLDVLIIDALRHTPHPSHAHLELALEW
Bac_Pro_Alp_27   HGPIRSVGYRIGD-VAYSSDISDLPEDSFAHLYGLKVWVVDALRYSPHPTHAHLDLALEW
Bac_Pro_Alp_25   HGEVRAVGYRIGD-VAYTPDVRAIPESSWADLADLEVWIVDALRWTPHPTHAHVELALEW
Bac_Pro_Alp_26   HGEIRAVGYRFGN-VAYTPDAIGFPEESWAALADLDVWIVDALRWTPHPTHAHVGLALEW
Bac_Pro_Alp_16   HGNIPALGYRIGN-AAYTPDLHDIPPESFHALENLDLWIIDALRYAPHPSHFSLDDALSW
Bac_Pro_Alp_17   HGNIPALGYRIGN-AAYTPDLNDIPPESFHALEGLDLWIVDALRYAPHPSHFSLDDALAW
Bac_Pro_Alp_14   HGKIPALGYRIGN-AAYTPDLNGIPPESFAALENLDLWVVDGLRYKPHSSHFCVDDALAS
Bac_Pro_Alp_13   HGQITALGYRIGD-AAYTPDLCDIPPESWPALENLDLWIIDGLRYEQHPTHFSVADALSW
Bac_Pro_Alp_22   HGPTEALGFRVEG-MAYLPDVVAIPEEAWPHLEGLEMWVLDTLRRKPHPTHAHLALALDW
Bac_Pro_Alp_21   HGNIDALGFRIGD-VAYLPDVSDIPEDVWPQLENLDTWIVDCLRRTPHPSHAHLERTFEW
Bac_Pro_Alp_20   HGSMDALGFRIGD-LAYLPDVAKIPDSALVELQDLDCWILDALRRKPHPTHLSLDEALEW
Bac_Pro_Alp_23   HGSMDALGFRIGD-LAYLPDVAKIPDSALAELQDLNCWILDALRRKPHPTHLSLDEALEW
Bac_Pro_Alp_12   HGDIDALGFRFGK-IAYAPDVSRMPEESLPSLEGLDVLILDALRYTPHPTHFSVSEALEL
Bac_Pro_Alp_15   -----AVGFRFGD-VAYSSDVNGISENSLAHLHNLDVWVIDALRETPHPSHFTLQEALDH
Bac_Pro_Alp_6_[  HGNEAALGFRFGA-AAYMPDVSLIPEASLARLRGLDLLIIDALRDTPHPTHFSVSDALAL
Bac_Pro_Alp_7_[  HGTEAALGFRFGS-AAYMPDVSLIPAASRARLHGLDLLIIDALRDTPHPTHFSVSDALAL
Bac_Pro_Alp_9_[  HGNEIAHGFRFGP-AAYAPDVSLMPEAAKARLHGLDLLIIDALRETPHPSHYSVSDALAL
Bac_Pro_Alp_11   HGNEIAHGFRFGP-AAYAPDVSLMPEAAKARLHGLDLLIIDALRETPHPSHYSVSDALAL
Bac_Pro_Alp_8_[  HGDEEALGFRFAD-AAYAPDVSTMPEAAKAHLRGLDLLIIDALRDTPHPTHYSVSDALAL
Bac_Pro_Alp_10   HGNEEALGFRFAD-AAYAPDVSLMPEAAKAHLRDLDLLILDALRDTPHPTHFSVSDALAL
Bac_Pro_Alp_19   HGEINALGFRIGD-TAYIPDVSDIPENSLNQLKDLDILILDCLRRRPHPSHFCLAEALTW
Bac_Pro_Alp_18   HGDIDALAFRFNG-IGYMPDVSDLSSDAIHSLSDLDTLIIDALRRTPHPSHFSLDDALGW
Bac_Pro_Del_2_[  HGVDGSCGYRIGS-FAYLTDCSAIPPASLALLQGVATVVVDGLRWSPHPFHFNIEGAIAA
Bac_Pro_Del_4_[  HGSFLATGYRFDN-AAYLTDCSEIPEQSLPLLQGLDLMIIDALRFSPHPNHFNIEGALKM
Bac_Pro_Del_1_[  HGTMPATGYRFND-MAYLTDCSAIPDHSRAKLGGLKLLIIDALRYTPHPNHFNIEGALQV
Bac_Pro_Del_3_[  HGHMPTTGYRFDD-VAYLTDCSSIADTSRAKLAGLRLLILDALRYTPHPNHYNIEGALKV
Bac_Pro_Bet_3_[  HGSWPCLGWRIGD-VAWLTDLSDIPEHSLEKLQGLEVLFLDCLRREPYPSHLCVADSLRW
Bac_Pro_Bet_4_[  HGNWPCLGWRIGD-VAWLTDLSDIPEHSLEKLQGLEVLFLDCLRREPYPSHLCVADSLRW
Bac_Pro_Gam_1_[  HGHLQIFGYRFND-VAYLTDLKRIPESSMALLQKLDILILDCLREEEHPTHINVTEAIAL
Bac_Pro_Gam_2_[  HGDLPILGYRFND-VAYLTDLKTIPDASLELLRGLKVLVLDCLRYEYHPTHLHVEEARYW
Bac_Pro_Gam_3_[  HGQLPILGYRFND-VAYLTDLKTIPDSSLMLLQGLKVLILDCLHYAEHPAHLNVEEALYW
Bac_Pro_Bet_1_[  HGRMEILGYRIGR-FAYITDVSEIPDSTLELLQGIDTLMLDCLRFEPHFSHYGFKQSLAM
Bac_Pro_Bet_2_[  HGHSDIYGYRIGN-LVYLTDVSAVPASSMEFLNDVDVLLLDCLRITPHYTHVNLEQSLAL
                                #############################################


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
Bac_Pro_Alp_5_[  REKYKPEEILLTNMRHTIDYHEITKMLPS-DVKPLYDGYKF-------------TV----
Bac_Pro_Alp_4_[  IKNINPKKAYLTNLNQDLDYFKLKKKIKKNNINPSYDGLKI-------------KLN---
GOS_4051020_Tra  IKKIGPKKTILTNLHSDIDYNYLKHKLPK-NIIPAYDGLNF-------------LI----
Bac_Pro_Alp_1_[  VKILTPKKTILTNMHSDLDYAKLKKKLPK-NIIPGFDGLTV-------------SLKN--
Bac_Pro_Alp_2_[  INYLKPKKAILTNLSPVLDYKVLKKLVPK-NVIPAHDGLTL-------------NL----
Bac_Pro_Alp_3_[  TKILKPKKTILTNLHSDLDYKELLKRLPK-KIIPAYDGLTL-------------NL----
Bac_Pro_Alp_24   IKELRPKRAVLTNLHVDMDYQTLRRTLPA-NVEPGFDGMTI-------------SIES--
Bac_Pro_Alp_27   IARVKPELAVLTNLHQEMDYEELRANLPD-GVVPAYDQMVI-------------DTEF--
Bac_Pro_Alp_25   IARVKPKRAILTNLHIDLDYHALAAKLPP-GVEPAYDGLRF-------------QLRAPA
Bac_Pro_Alp_26   IARARPRRAILTNLHIDLDFNALAAKLPV-GVEPAYDGMSF-------------EI----
Bac_Pro_Alp_16   IAKFKPRRAVLTNLHSDLDYDVLQAKLPP-GVEAGYDGMRL-------------AIEA--
Bac_Pro_Alp_17   IAKFKPRRAVLTNLHSDLDYDVLRSKLPP-GIEVGYDGMRL-------------EIEA--
Bac_Pro_Alp_14   IARFKPRRAVITNMHADIDYEDLRHRLPA-GVVPGYDGMRL-------------DITPGS
Bac_Pro_Alp_13   IDRFKPARAVITNMHSDLDYEILRHELPE-NVMPAYDGMRL-------------TIDPA-
Bac_Pro_Alp_22   IARARPERAILTNMHIDLDYATLAAELPP-HIVPAYDGLTF-------------DLAA--
Bac_Pro_Alp_21   IARAKPKSAVLTNMHIDLDYAVLEAETAD-HITPAYDGMVL-------------RFEG--
Bac_Pro_Alp_20   IERMAPKRAVLTNMHIDLDYAEVAAETPD-HIDPAYDGMVI-------------EYPI--
Bac_Pro_Alp_23   IDRMAPKRAVLTNMHIDLDYAQVAAETPD-HIDPAYDGMVI-------------EYPI--
Bac_Pro_Alp_12   IGRVKPKRAILTNLHTDLDYEILRSKLPR-HIDPAYDGLQI-------------EVA---
Bac_Pro_Alp_15   VALMKPKRTILTNLHTDLDYAALEARLPD-GIVPAYDGLKFESHSCSHAASADTVASG--
Bac_Pro_Alp_6_[  IRAVRPRRAVLTNLHTDLDYAALAARLPE-GIVPAYDGMSL-------------SLDG--
Bac_Pro_Alp_7_[  IAETKPRRAVLTNLHTDLDYAALTERLPA-GVVPAYDGMVL-------------TLDA--
Bac_Pro_Alp_9_[  IEEVAPRRAILTNLHTDLDYATLAGKLPP-GVVPAYDGLTA-------------TVDL--
Bac_Pro_Alp_11   IEEVAPRRAILTNLHTDLDYATLAKKLPG-HVVPAYDGLTA-------------TVDL--
Bac_Pro_Alp_8_[  IEEVRPRRAILTNLHTDLDYEALRRRLPE-GVVPAYDGLTV-------------TVDG--
Bac_Pro_Alp_10   IEEVRPRRAILTNLHTDLDYESLRRRLPK-GVVPAYDGLTV-------------TVEG--
Bac_Pro_Alp_19   TRKIAPARAVFTNLHNDLDYHVLSAELPE-TIEPAYDGMILTAEIAGTGKETVLSTDGW-
Bac_Pro_Alp_18   IEKLRPIKAVLTNMHVDMDYQSLLSELPD-GVIPAFDGMKL--------------LG---
Bac_Pro_Del_2_[  LRELGVRRMILTHLTHEVRHAD-ERRLPN-GVEFAYDGMNF-------------ELER--
Bac_Pro_Del_4_[  SEILKPRRTLLTHLTHEVHHSD-GQRLPQ-GVEFAYDGLTV-------------EL----
Bac_Pro_Del_1_[  VEKLRPERAVLTHLTHEVPYRD-GEKLPA-GVEFAYDGMTI-------------DM----
Bac_Pro_Del_3_[  VEDLRPEHAILTHLTHEVSYSD-GAKLPS-GVEFAYDGMSF-------------AL----
Bac_Pro_Bet_3_[  AERIGARRTILIHMTHGLEYHALSAECPP-GVEVGYDGLKV-------------SVPLA-
Bac_Pro_Bet_4_[  AERIGARRTILIHMTHGLEYHALSAECPP-GVEVGYDGLKV-------------SVPLA-
Bac_Pro_Gam_1_[  AKEIGARYTYFTHMTHDLGFASLAERLPE-GMAPAYDGLQI-------------RSAG--
Bac_Pro_Gam_2_[  ARRIGAERTILTHMTHDVDYATLAAELPE-GVIPASDGMVL-------------DL----
Bac_Pro_Gam_3_[  ARRIDAERTIFTHMTHDVDYATLAAELPE-TVIPAYDGMVV-------------DL----
Bac_Pro_Bet_1_[  AEKINPKRTFLIHMTHDIEYDAVSDSLPE-HVFLAYDGLKL-------------QINN--
Bac_Pro_Bet_2_[  ASQIGAKATYLIHMTHDLEYAELSAQLPA-NVFVGYDGLKI-------------KI----
                 ####################                                        


                 
                 ===
Bac_Pro_Alp_5_[  ---
Bac_Pro_Alp_4_[  ---
GOS_4051020_Tra  ---
Bac_Pro_Alp_1_[  ---
Bac_Pro_Alp_2_[  ---
Bac_Pro_Alp_3_[  ---
Bac_Pro_Alp_24   ---
Bac_Pro_Alp_27   ---
Bac_Pro_Alp_25   R--
Bac_Pro_Alp_26   ---
Bac_Pro_Alp_16   ---
Bac_Pro_Alp_17   ---
Bac_Pro_Alp_14   DQA
Bac_Pro_Alp_13   ---
Bac_Pro_Alp_22   ---
Bac_Pro_Alp_21   ---
Bac_Pro_Alp_20   ---
Bac_Pro_Alp_23   ---
Bac_Pro_Alp_12   ---
Bac_Pro_Alp_15   ---
Bac_Pro_Alp_6_[  ---
Bac_Pro_Alp_7_[  ---
Bac_Pro_Alp_9_[  ---
Bac_Pro_Alp_11   ---
Bac_Pro_Alp_8_[  ---
Bac_Pro_Alp_10   ---
Bac_Pro_Alp_19   ---
Bac_Pro_Alp_18   ---
Bac_Pro_Del_2_[  ---
Bac_Pro_Del_4_[  ---
Bac_Pro_Del_1_[  ---
Bac_Pro_Del_3_[  ---
Bac_Pro_Bet_3_[  ---
Bac_Pro_Bet_4_[  ---
Bac_Pro_Gam_1_[  ---
Bac_Pro_Gam_2_[  ---
Bac_Pro_Gam_3_[  ---
Bac_Pro_Bet_1_[  ---
Bac_Pro_Bet_2_[  ---
                    
Parameters used
Minimum Number Of Sequences For A Conserved Position: 20
Minimum Number Of Sequences For A Flanking Position: 33
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes

Flank positions of the 2 selected block(s)
Flanks: [70  139]  [196  260]  

New number of positions in input.fasta-gb:  135  (44% of the original 303 positions)

Protein Domains

PROTOCOLE:


Interproscan (paramètre par défaut)


ANALYSE DES RÉSULTATS:


On obtient après analyse, 5 résultats : un domaine de beta-lactamase-like (evalue de 1.1e-35), un domaine de ribonucléase Z (1.8e-05), un domaine arysulfatase (1.8e-05), un domaine lactamase b2 (6.5e-12) et un domaine de metallo-hydrolase/oxidoreductase (1.2e-29). Cependant les 4 derniers résultats ne sont pas totalement fiables car ils n'ont pas été vérifiés in vivo/in vitro.


Tous les domaines protéiques obtenus ont des activités hydrolases : on peut donc en déduire que notre séquence est probablement une hydrolase.


Les e-value du domaine de beta-lactamase-like et du domaine de metallo-hydrolase/oxidoreductase sont plus significatives que celles des autres. En effet leur evalue étant plus faibles ( 1.1e-35 et 1.2e-29 ) la probabilité d'avoir ces résultats au hasard est très petite.


D'après les e-value et la position des domaines sur notre séquence, on peut supposer que notre séquence possède un domaine Beta-lactamase-like (hydrolase) puisque ce domaine couvre les acides aminés de la position 2 à 211 sur 212 aa avec une e-value de 1.1e-35.


Avec les résultats de Blast, on peut confirmer que notre séquence est probablement une béta-lactamase car la grande majorités des hits obtenues avec les plus grandes e-values correspondent à des béta-lactamases.

RÉSULTATS BRUTS:

InterPro       IPR001279      Beta-lactamase-like
Molecular Function: hydrolase activity (GO:0016787)
method         AccNumber      shortName                               location
Gene3D         G3DSA:3.60.15.10no description                          T[2-211] 1.1e-35

InterPro       NULL           NULL
method         AccNumber      shortName                               location
HMMPanther     PTHR12553      RIBONUCLEASE Z                          T[1-79] 1.8e-05
HMMPanther     PTHR12553:SF7  ARYLSULFATASE                           T[1-79] 1.8e-05
HMMPfam        PF12706        Lactamase_B_2                           T[2-182] 6.5e-12
superfamily    SSF56281       Metallo-hydrolase/oxidoreductase        T[1-212] 1.2e-29

Phylogeny

PROTOCOLE:

Phylogeny.fr

a)BioNJ paramètre par défaut

b)PhyML paramètre par défaut


ANALYSE DES RÉSULTATS:


a) On a un arbre enraciné avec un groupe externe monophylétique et un groupe d'étude monophylétique. Dans le groupe externe on a bien l'organisation avec les différents sous groupes (béta et gamma sont plus proches entre eux qu'avec les delta). Dans le groupe d'étude, on remarque que les différents sous groupes d'alphaprotéobactéries forment des groupes monophylétiques ( [Rhizobiales] 1; [Caulobacterales] 2; [Rickettsiales] 3) sauf les rhodobactérales.


b)On a un arbre enraciné avec un groupe externe monophylétique et un groupe d'étude monophylétique. Dans le groupe externe on a bien l'organisation avec les différents sous groupes (béta et gamma sont plus proches entre eux qu'avec les delta). Dans le groupe d'étude, on remarque que les différents sous groupes d'alphaprotéobactéries sont regroupés mais ne forment plus de groupes monophylétiques excepté les caulobacterales.


On peut donc conclure que nos deux arbres sont cohérents au niveau de la démarcation du groupe externe et d'étude ainsi que au niveau des différents sous groupes du groupe externe (groupes monophylétiques). Par contre, ils ne sont pas cohérents au niveau des sous groupes des alphaprotéobactéries car l'un est en accord en taxonomie de référence et l'autre ne fait que les regrouper sans en faire des groupe monophylétiques.


Notre séquence est proche de la séquence de l'alphaprotéobactérie 1. De plus dans l'arbre BioNJ, elle fait partie du groupe monophylétique des Rickettsiales et avec PhyML elle est regroupé près des Rickettsiales.

On peut donc supposer que notre séquence provient d'une alpha-protéobactérie, et plus particulièrement des Rickettsiales.



RÉSULTATS BRUTS:
a)BioNJ
      -----0.2----
 
                           +--Bac_Pro_Alp_16_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhizobiales]
                       +---+
                       |   +Bac_Pro_Alp_17_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhizobiales]
            +----------+
            |          |  +-------Bac_Pro_Alp_14_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhizobiales]
            |          +--+
            |             +------Bac_Pro_Alp_13_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhizobiales]
          +1+
          | |+---------------Bac_Pro_Alp_15_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhizobiales]
          | ||
          | || +---------Bac_Pro_Alp_12_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhizobiales]
          | ++ |
          |  | |     +----Bac_Pro_Alp_6_Bacteria_Proteobacteria_Alphaproteobacteria_E-valu [Rhizobiales]
          |  | |     |
          |  +-+    ++
          |    |    |+---Bac_Pro_Alp_7_Bacteria_Proteobacteria_Alphaproteobacteria_E-valu [Rhizobiales]
          |    |    |
          |    +----+      +-Bac_Pro_Alp_9_Bacteria_Proteobacteria_Alphaproteobacteria_E-valu [Rhizobiales]
       +--+         |+-----+
       |  |         ||     +-Bac_Pro_Alp_11_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhizobiales]
       |  |         ++
       |  |          |+---Bac_Pro_Alp_8_Bacteria_Proteobacteria_Alphaproteobacteria_E-valu [Rhizobiales]
       |  |          ++
       |  |           +----Bac_Pro_Alp_10_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhizobiales]
       |  |
       |  |-----------------Bac_Pro_Alp_24_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhodobacterales]
       |  |
       |  |     +-----------------Bac_Pro_Alp_27_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Caulobacterales]
       |  |     |
       |  | +-2-+     +------Bac_Pro_Alp_25_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Caulobacterales]
    +--+  | |   +-----+
    |  |  | |         +---------Bac_Pro_Alp_26_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Caulobacterales]
    |  |  +-+
    |  |    |         +----------Bac_Pro_Alp_22_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhodobacterales]
    |  |    |       +-+
    |  |    |       | +----------Bac_Pro_Alp_21_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhodobacterales]
    |  |    +-------+
    |  |            |       +-Bac_Pro_Alp_20_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhodobacterales]
    |  |            +-------+
 +--+  |                    +-Bac_Pro_Alp_23_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhodobacterales]
 |  |  |
 |  |  |
 |  |  |   +---------------Bac_Pro_Alp_19_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhodobacterales]
 |  |  +---+
 |  |      +--------------Bac_Pro_Alp_18_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhodobacterales]
 |  |
 |  |    +----------------------------------------------Bac_Pro_Alp_5_Bacteria_Proteobacteria_Alphaproteobacteria_E-valu [Rickettsiales]
 |  |    |
 |  +--3-+     +--------------------------Bac_Pro_Alp_4_Bacteria_Proteobacteria_Alphaproteobacteria_E-valu [Rickettsiales]
 |       |     |
 |       +-----+      +------------GOS_4051020_Traduction_3-638_sens_direct
 |             |   +--+
 |             |   |  +------------Bac_Pro_Alp_1_Bacteria_Proteobacteria_Alphaproteobacteria_E-valu [Rickettsiales]
 |             +---+
 |                 |    +------------Bac_Pro_Alp_2_Bacteria_Proteobacteria_Alphaproteobacteria_E-valu [Rickettsiales]
 |                 +----+
 |                      +--------Bac_Pro_Alp_3_Bacteria_Proteobacteria_Alphaproteobacteria_E-valu [Rickettsiales]
 |
 |            +-----------------Bac_Pro_Del_2_Bacteria_Proteobacteria_Deltaproteobacteria_E-valu 
 |            |
 |  +---------+ +---------Bac_Pro_Del_4_Bacteria_Proteobacteria_Deltaproteobacteria_E-valu 
 |  |         | |
 |  |         +-+     +----Bac_Pro_Del_1_Bacteria_Proteobacteria_Deltaproteobacteria_E-valu
 |  |           +-----+
 |  |                 +-----Bac_Pro_Del_3_Bacteria_Proteobacteria_Deltaproteobacteria_E-valu
 |  |
 +--+
    |            +--------------Bac_Pro_Gam_1_Bacteria_Proteobacteria_Gammaproteobacteria_E-valu
    |  +---------+
    |  |         |    +----Bac_Pro_Gam_2_Bacteria_Proteobacteria_Gammaproteobacteria_E-valu
    |  |         +----+
    |  |              +-----Bac_Pro_Gam_3_Bacteria_Proteobacteria_Gammaproteobacteria_E-valu
    +--+
       |                      +Bac_Pro_Bet_3_Bacteria_Proteobacteria_Betaproteobacteria_E-value
       |    +-----------------+
       |    |                 +Bac_Pro_Bet_4_Bacteria_Proteobacteria_Betaproteobacteria_E-value
       +----+
            | +------------------Bac_Pro_Bet_1_Bacteria_Proteobacteria_Betaproteobacteria_E-value
            +-+
              +-------------------Bac_Pro_Bet_2_Bacteria_Proteobacteria_Betaproteobacteria_E-value

b)PhyML
                                                                                                      ----0.2--
 
     +--------------------------------------------------Bac_Pro_Alp_5_Bacteria_Proteobacteria_Alphaproteobacteria_E-valu [Rickettsiales]
     |
     |                +--------------------Bac_Pro_Alp_4_Bacteria_Proteobacteria_Alphaproteobacteria_E-valu [Rickettsiales]
     |                |
     |                |                 +----------Bac_Pro_Alp_2_Bacteria_Proteobacteria_Alphaproteobacteria_E-valu [Rickettsiales]
     |    +-----------+           +-----+
     |    |           |           |     +-------Bac_Pro_Alp_3_Bacteria_Proteobacteria_Alphaproteobacteria_E-valu [Rickettsiales]
 +---+    |           |      +----+
 |   |    |           |      |    +---------Bac_Pro_Alp_1_Bacteria_Proteobacteria_Alphaproteobacteria_E-valu [Rickettsiales]
 |   |    |           +------+
 |   |    |                  +----------GOS_4051020_Traduction_3-638_sens_direct
 |   |    |
 |   |    |          +-----------Bac_Pro_Alp_19_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhodobacterales]
 |   +----+          |
 |        |     +----+
 |        |     |    +---------------Bac_Pro_Alp_18_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhodobacterales]
 |        |     |
 |        |     |                    +-Bac_Pro_Alp_16_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhizobiales] 
 |        |     |                   ++
 |        |     |                   |+-Bac_Pro_Alp_17_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhizobiales] 
 |        |     |      +------------+
 |        +-----+      |            |  +--------Bac_Pro_Alp_14_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhizobiales] 
 |              |      |            +--+
 |              |      |               +----Bac_Pro_Alp_13_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhizobiales] 
 |              |      |
 |              |      |   +---------------Bac_Pro_Alp_15_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhizobiales] 
 |              |      |   |
 |              |      |   |   +--------Bac_Pro_Alp_12_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhizobiales] 
 |              |      |+--+   |
 |              +------+|  |   |         +---Bac_Pro_Alp_6_Bacteria_Proteobacteria_Alphaproteobacteria_E-valu [Rhizobiales] 
 |                     ||  +---+       +-+
 |                     ||      |       | +---Bac_Pro_Alp_7_Bacteria_Proteobacteria_Alphaproteobacteria_E-valu [Rhizobiales] 
 |                     ||      |       |
 |                     ||      +-------+     +-Bac_Pro_Alp_9_Bacteria_Proteobacteria_Alphaproteobacteria_E-valu [Rhizobiales] 
 |                     ||              | +---+
 |                     ||              | |   +-Bac_Pro_Alp_11_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhizobiales] 
 |                     ||              +-+
 |                     ||                |+--Bac_Pro_Alp_8_Bacteria_Proteobacteria_Alphaproteobacteria_E-valu [Rhizobiales] 
 |                     ++                ++
 |                      |                 +----Bac_Pro_Alp_10_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhizobiales] 
 |                      |
 |                      |
 |                      |               +----------Bac_Pro_Alp_22_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhodobacterales]
 |                      |            +--+
 |                      |            |  +-------Bac_Pro_Alp_21_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhodobacterales]
 |                      | +----------+
 |                      | |          |        +-Bac_Pro_Alp_20_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhodobacterales]
 |                      | |          +--------+
 |                      | |                   +-Bac_Pro_Alp_23_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhodobacterales]
 |                      +-+
 |                        |     +-----------------Bac_Pro_Alp_27_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Caulobacterales]
 |                        | +---+
 |                        | |   |         +----Bac_Pro_Alp_25_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Caulobacterales]
 |                        | |   +---------+
 |                        +-+             +-----------Bac_Pro_Alp_26_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Caulobacterales]
 |                          |
 |                          +----------------Bac_Pro_Alp_24_Bacteria_Proteobacteria_Alphaproteobacteria_E-val [Rhodobacterales]
 |
 |                            +Bac_Pro_Bet_3_Bacteria_Proteobacteria_Betaproteobacteria_E-value
 |             +--------------+
 |             |              +Bac_Pro_Bet_4_Bacteria_Proteobacteria_Betaproteobacteria_E-value
 |      +------+
 |      |      |     +---------------Bac_Pro_Bet_1_Bacteria_Proteobacteria_Betaproteobacteria_E-value
 |      |      +-----+
 |      |            +------------------Bac_Pro_Bet_2_Bacteria_Proteobacteria_Betaproteobacteria_E-value
 |   +--+
 |   |  |
 |   |  |         +------------Bac_Pro_Gam_1_Bacteria_Proteobacteria_Gammaproteobacteria_E-valu
 |   |  +---------+
 |   |            |    +---Bac_Pro_Gam_2_Bacteria_Proteobacteria_Gammaproteobacteria_E-valu
 +---+            +----+
     |                 +---Bac_Pro_Gam_3_Bacteria_Proteobacteria_Gammaproteobacteria_E-valu
     |
     |                        +--Bac_Pro_Del_1_Bacteria_Proteobacteria_Deltaproteobacteria_E-valu
     |               +--------+
     |               |        +------Bac_Pro_Del_3_Bacteria_Proteobacteria_Deltaproteobacteria_E-valu
     +---------------+
                     | +-----Bac_Pro_Del_4_Bacteria_Proteobacteria_Deltaproteobacteria_E-valu
                     +-+
                       +--------------------Bac_Pro_Del_2_Bacteria_Proteobacteria_Deltaproteobacteria_E-valu

Taxonomy report

PROTOCOLE:

TaxReport

paramètres par défaut


ANALYSE DES RÉSULTATS:


On prend comme seuil d'homologie une e-value de 1e-6 car à partir de cette valeur on trouve des résultats avec des protéines avec une fonction différente (ribonucléase, lipoate-protein ligase B ) et beaucoup de protéines hypothétiques. De plus les alignements à cette valeur sont aussi très courts et comportent de longs gaps (ex : 13% , 27%). Les pourcentages d'identités et de similarités tournent autour de 25% et 40% respectivement.


On prend comme groupe d'étude les alphabactéries car dans ce groupe ci on a des scores entre 251 et 53 alors que pour les autres protéobactéries on a des scores plus faibles (entre 143 et 58.5). De plus on possède beaucoup plus de résultats provenant d'alphaprotéobactéries que pour les autres bactéries, et ce avec des evalue plus faibles et donc plutôt significatives.

On prend donc comme groupe externe les autres protéobactéries.

Dans notre groupe externe, on a pas pu mettre des epsilon protéobactéries car on avait pas de séquences homologues à notre séquence provenant de ces bactéries.


Groupe d'étude :


>Bac_Pro_Alp_1 [Bacteria Proteobacteria Alphaproteobacteria] E-value_4e-80 Bacteria;Proteobacteria;Alphaproteobacteria;Rickettsiales;SAR11 cluster;Candidatus Pelagibacter; gi|494054820|ref|WP_006996917.1| metallo-beta-lactamase [Candidatus Pelagibacter ubique]


>Bac_Pro_Alp_2 [Bacteria Proteobacteria Alphaproteobacteria] E-value_8e-64 Bacteria;Proteobacteria;Alphaproteobacteria;Rickettsiales;SAR11 cluster;Candidatus Pelagibacter; gi|495820682|ref|WP_008545261.1| metallo-beta-lactamase [Candidatus Pelagibacter sp. HTCC7211]



>Bac_Pro_Alp_3 [Bacteria Proteobacteria Alphaproteobacteria] E-value_3e-65 Bacteria;Proteobacteria;Alphaproteobacteria;Rickettsiales;SAR11 cluster; gi|406706245|ref|YP_006756598.1| metallo-beta-lactamase family protein [alpha proteobacterium HIMB5]



>Bac_Pro_Alp_4 [Bacteria Proteobacteria Alphaproteobacteria] E-value_9e-44 Bacteria;Proteobacteria;Alphaproteobacteria;Rickettsiales;SAR11 cluster; gi|496747187|ref|WP_009360657.1| metal-dependent hydrolase, beta-lactamase superfamily I [alpha proteobacterium HIMB114]


>Bac_Pro_Alp_5 [Bacteria Proteobacteria Alphaproteobacteria] E-value_2e-24 Bacteria;Proteobacteria;Alphaproteobacteria;Rickettsiales;Rickettsiaceae;Rickettsieae;Rickettsia;typhus group; gi|157804260|ref|YP_001492809.1| hypothetical protein A1E_05565 [Rickettsia canadensis str. McKiel]


>Bac_Pro_Alp_6 [Bacteria Proteobacteria Alphaproteobacteria] E-value_3e-55 Bacteria;Proteobacteria;Alphaproteobacteria;Rhizobiales;Methylobacteriaceae;Methylobacterium; gi|170747934|ref|YP_001754194.1| beta-lactamase domain-containing protein [Methylobacterium radiotolerans JCM 2831]


>Bac_Pro_Alp_7 [Bacteria Proteobacteria Alphaproteobacteria] E-value_1e-54 Bacteria;Proteobacteria;Alphaproteobacteria;Rhizobiales;Methylobacteriaceae;Methylobacterium; gi|494836887|ref|WP_007562987.1| PhnP [Methylobacterium sp. GXF4]


>Bac_Pro_Alp_8 [Bacteria Proteobacteria Alphaproteobacteria] E-value_1e-48 Bacteria;Proteobacteria;Alphaproteobacteria;Rhizobiales;Methylobacteriaceae;Methylobacterium; gi|220926665|ref|YP_002501967.1| beta-lactamase domain-containing protein [Methylobacterium nodulans ORS 2060]


>Bac_Pro_Alp_9 [Bacteria Proteobacteria Alphaproteobacteria] E-value_9e-47 Bacteria;Proteobacteria;Alphaproteobacteria;Rhizobiales;Methylobacteriaceae;Methylobacterium; gi|188583887|ref|YP_001927332.1| beta-lactamase domain-containing protein [Methylobacterium populi BJ001]


>Bac_Pro_Alp_10 [Bacteria Proteobacteria Alphaproteobacteria] E-value_2e-44 Bacteria;Proteobacteria;Alphaproteobacteria;Rhizobiales;Methylobacteriaceae;Methylobacterium; gi|170744504|ref|YP_001773159.1| beta-lactamase-like protein [Methylobacterium sp. 4-46]


>Bac_Pro_Alp_11 [Bacteria Proteobacteria Alphaproteobacteria] E-value_3e-44 Bacteria;Proteobacteria;Alphaproteobacteria;Rhizobiales;Methylobacteriaceae;Methylobacterium; gi|218532444|ref|YP_002423260.1| beta-lactamase-like protein [Methylobacterium extorquens CM4]


>Bac_Pro_Alp_12 [Bacteria Proteobacteria Alphaproteobacteria] E-value_7e-51 Bacteria;Proteobacteria;Alphaproteobacteria;Rhizobiales;Methylobacteriaceae;Microvirga; gi|497160083|ref|WP_009491201.1| PhnP [Microvirga sp. WSM3557]


>Bac_Pro_Alp_13 [Bacteria Proteobacteria Alphaproteobacteria] E-value_9e-50 Bacteria;Proteobacteria;Alphaproteobacteria;Rhizobiales;Bradyrhizobiaceae;Nitrobacter; gi|497483322|ref|WP_009797520.1| PhnP [Nitrobacter sp. Nb-311A]


>Bac_Pro_Alp_14 [Bacteria Proteobacteria Alphaproteobacteria] E-value_9e-48 Bacteria;Proteobacteria;Alphaproteobacteria;Rhizobiales;Bradyrhizobiaceae;Oligotropha; gi|209885246|ref|YP_002289103.1| hydrolase [Oligotropha carboxidovorans OM5]


>Bac_Pro_Alp_15 [Bacteria Proteobacteria Alphaproteobacteria] E-value_1e-47 Bacteria;Proteobacteria;Alphaproteobacteria;Rhizobiales;Xanthobacteraceae;Xanthobacter; gi|154248309|ref|YP_001419267.1| beta-lactamase domain-containing protein [Xanthobacter autotrophicus Py2]


>Bac_Pro_Alp_16 [Bacteria Proteobacteria Alphaproteobacteria] E-value_1e-47 Bacteria;Proteobacteria;Alphaproteobacteria;Rhizobiales;Bradyrhizobiaceae;Afipia; gi|492879622|ref|WP_006020564.1| hypothetical protein [Afipia broomeae]


>Bac_Pro_Alp_17 [Bacteria Proteobacteria Alphaproteobacteria] E-value_1e-47 Bacteria;Proteobacteria;Alphaproteobacteria;Rhizobiales;Bradyrhizobiaceae;Afipia; gi|488799413|ref|WP_002711819.1| hypothetical protein [Afipia clevelandensis]


>Bac_Pro_Alp_18 [Bacteria Proteobacteria Alphaproteobacteria] E-value_6e-51 Bacteria;Proteobacteria;Alphaproteobacteria;Rhodobacterales;Rhodobacteraceae;Roseibium; gi|497090720|ref|WP_009466112.1| PhnP [Roseibium sp. TrichSKD4]


>Bac_Pro_Alp_19 [Bacteria Proteobacteria Alphaproteobacteria] E-value_8e-48 Bacteria;Proteobacteria;Alphaproteobacteria;Rhodobacterales;Rhodobacteraceae;Labrenzia; gi|493991748|ref|WP_006934473.1| PhnP [Labrenzia aggregata]


>Bac_Pro_Alp_20 [Bacteria Proteobacteria Alphaproteobacteria] E-value_2e-45 Bacteria;Proteobacteria;Alphaproteobacteria;Rhodobacterales;Rhodobacteraceae;Phaeobacter; gi|400753669|ref|YP_006562037.1| metallo beta-lactamase-like protein [Phaeobacter gallaeciensis 2.10]


>Bac_Pro_Alp_21 [Bacteria Proteobacteria Alphaproteobacteria] E-value_4e-45 Bacteria;Proteobacteria;Alphaproteobacteria;Rhodobacterales;Rhodobacteraceae;Thalassobium; gi|496448551|ref|WP_009157396.1| PhnP [Thalassiobium sp. R2A62]


>Bac_Pro_Alp_22 [Bacteria Proteobacteria Alphaproteobacteria] E-value_8e-45 Bacteria;Proteobacteria;Alphaproteobacteria;Rhodobacterales;Rhodobacteraceae;Rhodobacter; gi|488808451|ref|WP_002720857.1| PhnP [Rhodobacter sphaeroides]


>Bac_Pro_Alp_23 [Bacteria Proteobacteria Alphaproteobacteria] E-value_1e-44 Bacteria;Proteobacteria;Alphaproteobacteria;Rhodobacterales;Rhodobacteraceae;Phaeobacter; gi|399992005|ref|YP_006572245.1| metallo beta-lactamase domain-containing protein [Phaeobacter gallaeciensis DSM 17395 _ CIP 105210]


>Bac_Pro_Alp_24 [Bacteria Proteobacteria Alphaproteobacteria] E-value_4e-48 Bacteria;Proteobacteria;Alphaproteobacteria;Rhodobacterales;Hyphomonadaceae;Hyphomonas; gi|114798446|ref|YP_760514.1| metallo-beta-lactamase family protein [Hyphomonas neptunium ATCC 15444]


>Bac_Pro_Alp_25 [Bacteria Proteobacteria Alphaproteobacteria] E-value_7e-47 Bacteria;Proteobacteria;Alphaproteobacteria;Caulobacterales;Caulobacteraceae;Caulobacter; gi|295689510|ref|YP_003593203.1| metal-dependent hydrolase [Caulobacter segnis ATCC 21756]


>Bac_Pro_Alp_26 [Bacteria Proteobacteria Alphaproteobacteria] E-value_2e-42 Bacteria;Proteobacteria;Alphaproteobacteria;Caulobacterales;Caulobacteraceae;Caulobacter; gi|167646658|ref|YP_001684321.1| hypothetical protein Caul_2696 [Caulobacter sp. K31]


>Bac_Pro_Alp_27 [Bacteria Proteobacteria Alphaproteobacteria] E-value_1e-44 Bacteria;Proteobacteria;Alphaproteobacteria;Caulobacterales;Caulobacteraceae;Asticcacaulis; gi|315499859|ref|YP_004088662.1| metal-dependent hydrolase [Asticcacaulis excentricus CB 48]


_

Groupe externe


>Bac_Pro_Gam_1 [Bacteria Proteobacteria Gammaproteobacteria] E-value_2e-38 Bacteria;Proteobacteria;Gammaproteobacteria;Acidithiobacillales;Acidithiobacillaceae;Acidithiobacillus; gi|340782697|ref|YP_004749304.1| metal-dependent hydrolase of the beta-lactamase superfamily I; PhnP protein [Acidithiobacillus caldus SM-1]


>Bac_Pro_Gam_2 [Bacteria Proteobacteria Gammaproteobacteria] E-value_2e-37 Bacteria;Proteobacteria;Gammaproteobacteria;Acidithiobacillales;Acidithiobacillaceae;Acidithiobacillus; gi|198283235|ref|YP_002219556.1| beta-lactamase domain-containing protein [Acidithiobacillus ferrooxidans ATCC 53993]


>Bac_Pro_Gam_3 [Bacteria Proteobacteria Gammaproteobacteria] E-value_3e-37 Bacteria;Proteobacteria;Gammaproteobacteria;Acidithiobacillales;Acidithiobacillaceae;Acidithiobacillus;


>Bac_Pro_Del_1 [Bacteria Proteobacteria Deltaproteobacteria] E-value_2e-34 Bacteria;Proteobacteria;Deltaproteobacteria;Desulfuromonadales;Geobacteraceae;Geobacter; gi|148262634|ref|YP_001229340.1| beta-lactamase domain-containing protein [Geobacter uraniireducens Rf4]


>Bac_Pro_Del_2 [Bacteria Proteobacteria Deltaproteobacteria] E-value_1e-33 Bacteria;Proteobacteria;Deltaproteobacteria;Desulfuromonadales;Geobacteraceae;Geobacter; gi|189426379|ref|YP_001953556.1| beta-lactamase [Geobacter lovleyi SZ]


>Bac_Pro_Del_3 [Bacteria Proteobacteria Deltaproteobacteria] E-value_4e-33 Bacteria;Proteobacteria;Deltaproteobacteria;Desulfuromonadales;Geobacteraceae;Geobacter; gi|222054482|ref|YP_002536844.1| beta-lactamase [Geobacter daltonii FRC-32]


>Bac_Pro_Del_4 [Bacteria Proteobacteria Deltaproteobacteria] E-value_3e-32 Bacteria;Proteobacteria;Deltaproteobacteria;Desulfuromonadales;Geobacteraceae;Geobacter; gi|322417951|ref|YP_004197174.1| beta-lactamase domain-containing protein [Geobacter sp. M18]


>Bac_Pro_Bet_1 [Bacteria Proteobacteria Betaproteobacteria] E-value_1e-32 Bacteria;Proteobacteria;Betaproteobacteria; gi|497538838|ref|WP_009853036.1| beta-lactamase [beta proteobacterium KB13]


>Bac_Pro_Bet_2 [Bacteria Proteobacteria Betaproteobacteria] E-value_8e-29 Bacteria;Proteobacteria;Betaproteobacteria;Methylophilales;Methylophilaceae;Methylotenera; gi|253996503|ref|YP_003048567.1| beta-lactamase domain-containing protein [Methylotenera mobilis JLW8]


>Bac_Pro_Bet_3 [Bacteria Proteobacteria Betaproteobacteria] E-value_2e-28 Bacteria;Proteobacteria;Betaproteobacteria;Neisseriales;Neisseriaceae;Lutiella; gi|496239948|ref|WP_008953333.1| beta-lactamase [Pseudogulbenkiania ferrooxidans]


>Bac_Pro_Bet_4 [Bacteria Proteobacteria Betaproteobacteria] E-value_5e-28 Bacteria;Proteobacteria;Betaproteobacteria;Neisseriales;Neisseriaceae;Pseudogulbenkiania; gi|347538567|ref|YP_004845991.1| beta-lactamase domain containing protein [Pseudogulbenkiania sp. NH8B]



RÉSULTATS BRUTS:

Lineage report

.LUCA
. Bacteria
. .Proteobacteria
. . Alphaproteobacteria
. . .Rickettsiales
. . . SAR11 cluster
. . . .Candidatus Pelagibacter
. . . . Candidatus Pelagibacter ubique............... 251  4e-80  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] metallo-beta-lactamase [Candidatus Pelagi...   
. . . . Candidatus Pelagibacter sp. HTCC7211......... 209  8e-64  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] metallo-beta-lactamase [Candidatus Pelagi...   
. . . . Candidatus Pelagibacter sp. IMCC9063......... 57.8 4e-08  3 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] metal-dependent hydrolases of the beta-la... 
. . . .alpha proteobacterium HIMB5................... 213  3e-65  3 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] metallo-beta-lactamase family protein [al...   
. . . .alpha proteobacterium HIMB114................. 157  9e-44  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] metal-dependent hydrolase, beta-lactamase...   
. . . .alpha proteobacterium HIMB59.................. 147  1e-39  3 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] metallo-beta-lactamase family protein [al...   
. . . Candidatus Odyssella thessalonicensis.......... 138  2e-36  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] hypothetical protein [Candidatus Odyssell...   
. . . Candidatus Midichloria mitochondrii IricVA..... 117  1e-28  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] metal-dependent hydrolases of the beta-la...   
. . . Anaplasma marginale............................ 109  4e-25  4 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] PhnP protein [Anaplasma marginale]             
. . . Anaplasma marginale str. Florida............... 108  5e-25  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] PhnP protein [Anaplasma marginale str. Fl...   
. . . Ehrlichia chaffeensis str. Arkansas............ 94.7 4e-20  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] metallo-beta-lactamase family protein [Ehrli... 
. . . Neorickettsia risticii str. Illinois........... 93.6 1e-19  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] metallo-beta-lactamase [Neorickettsia ris... 
. . . Rickettsia canadensis str. McKiel.............. 106  2e-24  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] hypothetical protein A1E_05565 [Rickettsi...   
. . . Rickettsia endosymbiont of Ixodes scapularis... 101  1e-22  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] beta-lactamase [Rickettsia endosymbiont o...   
. . . Rickettsia australis str. Cutlack.............. 101  2e-22  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] beta-lactamase [Rickettsia australis str....   
. . . Candidatus Rickettsia amblyommii str. GAT-30V.. 100  2e-22  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] PhnP protein [Candidatus Rickettsia ambly...   
. . . Rickettsia massiliae MTU5...................... 100  4e-22  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] beta-lactamase superfamily hydrolase [Ric...   
. . . Rickettsia rhipicephali str. 3-7-female6-CWPP.. 100  4e-22  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] beta-lactamase superfamily hydrolase [Ric...   
. . . Rickettsia rickettsii str. 'Sheila Smith'...... 99.8 5e-22  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] PhnP protein [Rickettsia rickettsii str. ... 
. . . Rickettsia heilongjiangensis 054............... 99.8 6e-22  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] beta-lactamase superfamily hydrolase [Ric... 
. . . Rickettsia bellii RML369-C..................... 99.4 7e-22  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] beta-lactamase superfamily hydrolase [Ricket... 
. . . Rickettsia philipii str. 364D.................. 99.0 1e-21  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] beta-lactamase superfamily hydrolase [Ric... 
. . . Rickettsia peacockii str. Rustic............... 99.0 1e-21  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] beta-lactamase superfamily hydrolase [Ric... 
. . . Rickettsia helvetica........................... 98.2 2e-21  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] beta-lactamase [Rickettsia helvetica]        
. . . Rickettsia akari str. Hartford................. 98.2 2e-21  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] beta-lactamase superfamily hydrolase [Ric... 
. . . Rickettsia massiliae str. AZT80................ 98.2 2e-21  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] beta-lactamase superfamily hydrolase [Ric... 
. . . Rickettsia sibirica............................ 97.8 3e-21  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] beta-lactamase [Rickettsia sibirica] >gb|... 
. . . Rickettsia japonica YH......................... 97.4 4e-21  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] metal-dependent hydrolase [Rickettsia jap... 
. . . Rickettsia africae ESF-5....................... 97.1 6e-21  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] beta-lactamase [Rickettsia africae ESF-5]... 
. . . Rickettsia montanensis str. OSU 85-930......... 95.9 2e-20  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] beta-lactamase [Rickettsia montanensis st... 
. . . Orientia tsutsugamushi str. Ikeda.............. 94.4 5e-20  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] PhnP protein [Orientia tsutsugamushi str.... 
. . . Orientia tsutsugamushi str. Boryong............ 93.6 9e-20  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rickettsiales] hypothetical protein OTBS_1916 [Orientia ... 
. . .Methylobacterium radiotolerans JCM 2831......... 187  3e-55  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] beta-lactamase domain-containing protein ...   
. . .Methylobacterium sp. GXF4....................... 186  1e-54  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Methylobacterium sp. GXF4] >gb|EIZ8...   
. . .Methylobacterium nodulans ORS 2060.............. 170  1e-48  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] beta-lactamase domain-containing protein ...   
. . .Methylobacterium populi BJ001................... 166  9e-47  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] beta-lactamase domain-containing protein ...   
. . .Methylobacterium sp. 4-46....................... 159  2e-44  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] beta-lactamase-like protein [Methylobacte...   
. . .Methylobacterium chloromethanicum CM4........... 159  3e-44  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] beta-lactamase-like protein [Methylobacte...   
. . .Methylobacterium extorquens AM1................. 159  4e-44  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] metal-dependent hydrolase [Methylobacteri...   
. . .Methylobacterium extorquens PA1................. 157  1e-43  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] beta-lactamase-like protein [Methylobacte...   
. . .Methylobacterium extorquens DM4................. 157  2e-43  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] metal-dependent hydrolase [Methylobacteri...   
. . .Microvirga sp. WSM3557.......................... 176  7e-51  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Microvirga sp. WSM3557] >gb|EIM2973...   
. . .Nitrobacter sp. Nb-311A......................... 173  9e-50  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Nitrobacter sp. Nb-311A] >gb|EAQ356...   
. . .Oligotropha carboxidovorans OM5................. 168  9e-48  4 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] hydrolase [Oligotropha carboxidovorans OM...   
. . .Xanthobacter autotrophicus Py2.................. 168  1e-47  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] beta-lactamase domain-containing protein ...   
. . .Afipia broomeae................................. 167  1e-47  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] hypothetical protein [Afipia broomeae] >g...   
. . .Afipia clevelandensis........................... 167  1e-47  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] hypothetical protein [Afipia clevelandens...   
. . .Rhodopseudomonas palustris BisB18............... 167  3e-47  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] putative hydrolase [Rhodopseudomonas palustr...   
. . .Bradyrhizobium sp. STM 3843..................... 166  5e-47  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Bradyrhizobium sp. STM 3843] >emb|C...   
. . .Afipia sp. 1NLS2................................ 165  1e-46  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Afipia sp. 1NLS2] >gb|EFI51923.1| h...   
. . .Rhodopseudomonas palustris DX-1................. 164  2e-46  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] hypothetical protein [Rhodopseudomonas pa...   
. . .Rhodopseudomonas palustris BisA53............... 164  3e-46  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] putative hydrolase [Rhodopseudomonas palustr...   
. . .Bradyrhizobium sp. S23321....................... 164  3e-46  3 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] hypothetical protein S23_36160 [Bradyrhiz...   
. . .Afipia felis.................................... 163  8e-46  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] hypothetical protein [Afipia felis] >gb|E...   
. . .Rhodopseudomonas palustris TIE-1................ 163  1e-45  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] hypothetical protein Rpal_3118 [Rhodopseu...   
. . .Bradyrhizobium sp. YR681........................ 162  2e-45  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Bradyrhizobium sp. YR681] >gb|EJN14...   
. . .Bradyrhizobium sp. ORS 285...................... 162  2e-45  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Bradyrhizobium sp. ORS 285] >emb|CC...   
. . .Bradyrhizobium sp. BTAi1........................ 162  3e-45  3 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] hypothetical protein BBta_4098 [Bradyrhiz...   
. . .Rhodopseudomonas palustris BisB5................ 160  8e-45  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] putative hydrolase [Rhodopseudomonas palustr...   
. . .Bradyrhizobium japonicum USDA 6................. 160  1e-44  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] hypothetical protein BJ6T_52170 [Bradyrhi...   
. . .Bradyrhizobium sp. ORS 375...................... 160  1e-44  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Bradyrhizobium sp. ORS 375] >emb|CC...   
. . .Bradyrhizobium sp. WSM1253...................... 160  1e-44  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Bradyrhizobium sp. WSM1253] >gb|EIG...   
. . .Bradyrhizobium sp. ORS 278...................... 160  1e-44  3 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] hypothetical protein BRADO3831 [Bradyrhiz...   
. . .Bradyrhizobium sp. WSM471....................... 160  1e-44  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Bradyrhizobium sp. WSM471] >gb|EHR0...   
. . .Bradyrhizobium sp. STM 3809..................... 160  1e-44  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Bradyrhizobium sp. STM 3809] >emb|C...   
. . .Azorhizobium caulinodans ORS 571................ 159  2e-44  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] metal-dependent hydrolase [Azorhizobium c...   
. . .Rhodopseudomonas palustris HaA2................. 159  3e-44  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] putative hydrolase [Rhodopseudomonas palustr...   
. . .Bradyrhizobium diazoefficiens USDA 110.......... 157  1e-43  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] hypothetical protein bll4514 [Bradyrhizobium...   
. . .Bradyrhizobium sp. CCGE-LA001................... 153  4e-42  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] hypothetical protein [Bradyrhizobium sp. ...   
. . .Mesorhizobium alhagi............................ 153  6e-42  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Mesorhizobium alhagi] >gb|EHK55240....   
. . .Agrobacterium vitis S4.......................... 153  6e-42  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] metal dependent hydrolase [Agrobacterium ...   
. . .Hyphomicrobium denitrificans 1NES1.............. 152  1e-41  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] metal-dependent hydrolase [Hyphomicrobium...   
. . .Starkeya novella DSM 506........................ 152  2e-41  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] metal-dependent hydrolase [Starkeya novel...   
. . .Hoeflea phototrophica........................... 151  4e-41  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Hoeflea phototrophica] >gb|EDQ32831...   
. . .Ochrobactrum intermedium........................ 150  5e-41  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] beta-lactamase [Ochrobactrum intermedium]...   
. . .Methylocystis sp. SC2........................... 150  5e-41  3 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] beta-lactamase domain-containing protein ...   
. . .Ochrobactrum anthropi ATCC 49188................ 150  5e-41  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] beta-lactamase domain-containing protein ...   
. . .Beijerinckia indica subsp. indica ATCC 9039..... 149  2e-40  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] metal-dependent hydrolase [Beijerinckia i...   
. . .Ochrobactrum anthropi........................... 149  2e-40  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] beta-lactamase [Ochrobactrum anthropi]         
. . .Agrobacterium tumefaciens....................... 149  2e-40  4 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Agrobacterium tumefaciens] >gb|EHH0...   
. . .Methylocella silvestris BL2..................... 149  3e-40  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] beta-lactamase domain-containing protein ...   
. . .Methylosinus trichosporium...................... 148  3e-40  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Methylosinus trichosporium] >gb|EFH...   
. . .Pelagibacterium halotolerans B2................. 148  6e-40  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] metal-dependent hydrolase [Pelagibacteriu...   
. . .Brucella melitensis NI.......................... 147  1e-39  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] hypothetical protein [Brucella melitensis...   
. . .Agrobacterium sp. H13-3......................... 147  1e-39  3 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] metal dependent hydrolase [Agrobacterium ...   
. . .Agrobacterium fabrum str. C58................... 147  1e-39  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] metal dependent hydrolase [Agrobacterium fab...   
. . .Brucella melitensis biovar Abortus 2308......... 147  2e-39  6 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] Chain A, Crystal Structure Of A Beta-Lactamase-Lik...   
. . .Brucella suis 1330.............................. 146  2e-39  4 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] hypothetical protein BR0997 [Brucella suis 1...   
. . .Agrobacterium sp. ATCC 31749.................... 146  2e-39  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Agrobacterium sp. ATCC 31749] >gb|E...   
. . .Mesorhizobium amorphae.......................... 146  2e-39  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Mesorhizobium amorphae] >gb|EHH1379...   
. . .Brucella........................................ 146  2e-39  3 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] beta-lactamase [Brucella] >gb|EEZ32918.1|...   
. . .Brucella ceti M13/05/1.......................... 146  3e-39  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] beta-lactamase [Brucella] >gb|EEX90318.1|...   
. . .Agrobacterium tumefaciens F2.................... 146  3e-39  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Agrobacterium tumefaciens] >gb|EGP5...   
. . .Brucella neotomae............................... 145  4e-39  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] beta-lactamase [Brucella neotomae] >gb|EE...   
. . .Rhodomicrobium vannielii ATCC 17100............. 145  5e-39  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] metal-dependent hydrolase [Rhodomicrobium...   
. . .Hyphomicrobium denitrificans ATCC 51888......... 145  5e-39  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] metal-dependent hydrolase [Hyphomicrobium...   
. . .Bartonella tamiae............................... 145  7e-39  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Bartonella tamiae] >gb|EJF88834.1| ...   
. . .Rhizobium sp. CF080............................. 144  1e-38  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Rhizobium sp. CF080] >gb|EJL72506.1...   
. . .Sinorhizobium fredii HH103...................... 144  2e-38  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] Metal dependent hydrolase [Sinorhizobium ...   
. . .Phyllobacterium sp. YR531....................... 144  2e-38  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Phyllobacterium sp. YR531] >gb|EJM9...   
. . .Hyphomicrobium sp. MC1.......................... 143  4e-38  3 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] metal-dependent hydrolase [Hyphomicrobium...   
. . .Aurantimonas manganoxydans...................... 143  4e-38  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Aurantimonas manganoxydans] >gb|EAS...   
. . .Chelativorans sp. BNC1.......................... 143  4e-38  3 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] beta-lactamase-like protein [Chelativorans s...   
. . .Sinorhizobium fredii NGR234..................... 142  9e-38  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] metal dependent hydrolase [Sinorhizobium ...   
. . .Mesorhizobium loti MAFF303099................... 142  1e-37  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] hydrolase [Mesorhizobium loti MAFF303099] >r...   
. . .Agrobacterium radiobacter K84................... 141  1e-37  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] metal-dependent hydrolase [Agrobacterium ...   
. . .Sinorhizobium fredii USDA 257................... 141  2e-37  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] octanoyltransferase LipB [Sinorhizobium f...   
. . .Rhizobium sp. AP16.............................. 141  2e-37  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Rhizobium sp. AP16] >gb|EJK81816.1|...   
. . .Fulvimarina pelagi.............................. 141  2e-37  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Fulvimarina pelagi] >gb|EAU42528.1|...   
. . .Rhizobium sp. CCGE 510.......................... 141  2e-37  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Rhizobium sp. CCGE 510] >gb|EJT0528...   
. . .Rhizobium sp. CF142............................. 140  3e-37  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Rhizobium sp. CF142] >gb|EJJ29513.1...   
. . .Candidatus Liberibacter asiaticus str. psy62.... 140  3e-37  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] metal-dependent hydrolase protein [Candid...   
. . .Rhizobium mesoamericanum........................ 140  4e-37  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Rhizobium mesoamericanum] >emb|CCM7...   
. . .Rhizobium leguminosarum......................... 140  6e-37  7 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Rhizobium leguminosarum] >gb|EJB026...   
. . .Rhizobium leguminosarum bv. trifolii WSM2012.... 139  9e-37  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Rhizobium leguminosarum] >gb|EJC726...   
. . .Rhizobium sp. Pop5.............................. 139  1e-36  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Rhizobium sp. Pop5] >gb|EJZ21597.1|...   
. . .Rhizobium leguminosarum bv. viciae 3841......... 139  1e-36  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] hypothetical protein RL2471 [Rhizobium legum...   
. . .Rhizobium leguminosarum bv. viciae WSM1455...... 139  1e-36  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Rhizobium leguminosarum] >gb|EJC664...   
. . .Rhizobium etli CIAT 652......................... 139  2e-36  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] metal-dependent hydrolase [Rhizobium etli...   
. . .Rhizobium leguminosarum bv. trifolii WSM1325.... 139  2e-36  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] beta-lactamase [Rhizobium leguminosarum b...   
. . .Nitratireductor indicus......................... 138  2e-36  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Nitratireductor indicus] >gb|EKF436...   
. . .Bartonella quintana RM-11....................... 138  3e-36  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] hypothetical protein RM11_0579 [Bartonell...   
. . .Rhizobium leguminosarum bv. trifolii WSM2304.... 138  3e-36  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] beta-lactamase [Rhizobium leguminosarum b...   
. . .Rhizobium sp. CF122............................. 138  3e-36  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Rhizobium sp. CF122] >gb|EJL54395.1...   
. . .Nitratireductor aquibiodomus.................... 138  3e-36  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Nitratireductor aquibiodomus] >gb|E...   
. . .Bartonella doshiae.............................. 138  3e-36  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Bartonella doshiae] >gb|EJF82205.1|...   
. . .Rhizobium sp. PDO-076........................... 137  5e-36  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Rhizobium sp. PDO1-076] >gb|EHS4975...   
. . .Candidatus Liberibacter solanacearum CLso-ZC1... 137  5e-36  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] metal-dependent hydrolase protein [Candid...   
. . .Mesorhizobium ciceri biovar biserrulae WSM1271.. 137  6e-36  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] hydrolase [Mesorhizobium ciceri biovar bi...   
. . .Rhizobium leguminosarum bv. trifolii WSM2297.... 137  6e-36  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Rhizobium leguminosarum] >gb|EJC793...   
. . .Rhizobium etli.................................. 137  9e-36  4 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] probable metal-dependent hydrolase protei...   
. . .Mesorhizobium australicum WSM2073............... 137  9e-36  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] metal-dependent hydrolase, beta-lactamase...   
. . .Mesorhizobium opportunistum WSM2075............. 137  1e-35  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] hydrolase [Mesorhizobium opportunistum WS...   
. . .Agrobacterium albertimagni...................... 137  1e-35  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Agrobacterium albertimagni] >gb|EKF...   
. . .Bartonella birtlesii............................ 136  2e-35  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Bartonella birtlesii] >gb|EJF76973....   
. . .Bartonella grahamii as4aup...................... 135  3e-35  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] putative PhnP protein [Bartonella grahami...   
. . .Sinorhizobium medicae WSM419.................... 135  6e-35  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] beta-lactamase domain-containing protein ...   
. . .Bartonella alsatica............................. 134  9e-35  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Bartonella alsatica] >gb|EJF75877.1...   
. . .Bartonella taylorii............................. 134  9e-35  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Bartonella taylorii] >gb|EJF94139.1...   
. . .Bartonella rochalimae ATCC BAA-1498............. 134  1e-34  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] conserved hypothetical protein [Bartonella ro...   
. . .Sinorhizobium meliloti.......................... 134  2e-34  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Sinorhizobium meliloti] >gb|EHK7813...   
. . .Bartonella vinsonii............................. 133  2e-34  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Bartonella vinsonii] >gb|EJF87909.1...   
. . .Bartonella schoenbuchensis R1................... 133  2e-34  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] conserved hypothetical protein [Bartonella sc...   
. . .Bartonella vinsonii subsp. arupensis Pm136co.... 133  3e-34  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Bartonella vinsonii] >gb|EJF98533.1...   
. . .Bartonella washoensis........................... 133  3e-34  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Bartonella washoensis] >gb|EJF77965...   
. . .Bartonella tribocorum CIP 105476................ 132  3e-34  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] hypothetical protein Btr_1169 [Bartonella...   
. . .Bartonella washoensis 085-0475.................. 132  4e-34  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Bartonella washoensis] >gb|EJF85979...   
. . .Bartonella clarridgeiae 73...................... 132  4e-34  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] hypothetical protein BARCL_0764 [Bartonel...   
. . .Bartonella bacilliformis KC583.................. 132  4e-34  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] metallo-beta-lactamase family protein [Barto...   
. . .Bartonella sp. AR 15-3.......................... 132  4e-34  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] conserved hypothetical protein [Bartonella sp...   
. . .Bartonella sp. 1-1C............................. 132  5e-34  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] conserved hypothetical protein [Bartonella sp...   
. . .Bartonella elizabethae.......................... 132  7e-34  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Bartonella elizabethae] >gb|EJF8483...   
. . .Parvibaculum lavamentivorans DS-1............... 131  1e-33  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] beta-lactamase-like protein [Parvibaculum...   
. . .Bartonella rattimassiliensis.................... 131  1e-33  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Bartonella rattimassiliensis] >gb|E...   
. . .Bartonella melophagi............................ 129  1e-32  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Bartonella melophagi] >gb|EJF90204....   
. . .Bartonella sp. DB5-6............................ 128  2e-32  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhizobiales] PhnP [Bartonella sp. DB5-6] >gb|EJF77364....   
. . .Roseibium sp. TrichSKD4......................... 176  6e-51  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Roseibium sp. TrichSKD4] >gb|EFO337...   
. . .Labrenzia aggregata............................. 169  8e-48  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Labrenzia aggregata] >gb|EAV43997.1...   
. . .Phaeobacter gallaeciensis 2.10.................. 162  2e-45  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] metallo beta-lactamase-like protein [Phae...   
. . .Thalassiobium sp. R2A62......................... 161  4e-45  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Thalassiobium sp. R2A62] >gb|EET463...   
. . .Rhodobacter sphaeroides......................... 160  8e-45  3 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Rhodobacter sphaeroides] >gb|EGJ221...   
. . .Phaeobacter gallaeciensis DSM 17395............. 160  1e-44  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] metallo beta-lactamase domain-containing ...   
. . .Rhodobacter sphaeroides KD131................... 159  2e-44  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP-like protein [Rhodobacter sphaeroide...   
. . .Ruegeria sp. TM1040............................. 158  5e-44  3 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] beta-lactamase-like protein [Ruegeria sp. TM...   
. . .Sulfitobacter sp. EE-36......................... 157  1e-43  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Sulfitobacter sp. EE-36] >gb|EAP839...   
. . .Jannaschia sp. CCS1............................. 157  1e-43  3 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] beta-lactamase-like protein [Jannaschia sp. ...   
. . .Rhodobacter sphaeroides ATCC 17025.............. 157  2e-43  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] beta-lactamase domain-containing protein ...   
. . .Roseobacter sp. SK209-2-6....................... 156  2e-43  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Roseobacter sp. SK209-2-6] >gb|EBA1...   
. . .Sulfitobacter sp. NAS-14.1...................... 156  2e-43  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Sulfitobacter sp. NAS-14.1] >gb|EAP...   
. . .Roseobacter sp. GAI101.......................... 156  3e-43  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Roseobacter sp. GAI101] >gb|EEB8651...   
. . .Pseudovibrio sp. JE062.......................... 156  4e-43  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Pseudovibrio sp. JE062] >gb|EEA9649...   
. . .Ruegeria sp. R11................................ 155  5e-43  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Ruegeria sp. R11] >gb|EEB71139.1| b...   
. . .Roseobacter sp. MED193.......................... 155  6e-43  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Roseobacter sp. MED193] >gb|EAQ4722...   
. . .Oceanicola granulosus........................... 154  1e-42  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Oceanicola granulosus] >gb|EAR50317...   
. . .Pseudovibrio sp. FO-BEG1........................ 154  1e-42  3 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] metal dependent hydrolase [Pseudovibrio s...   
. . .Loktanella vestfoldensis........................ 154  2e-42  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Loktanella vestfoldensis] >gb|EAQ05...   
. . .Roseobacter sp. AzwK-3b......................... 154  2e-42  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Roseobacter sp. AzwK-3b] >gb|EDM715...   
. . .Rhodobacteraceae bacterium KLH11................ 153  6e-42  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Rhodobacteraceae bacterium KLH11] >...   
. . .Octadecabacter antarcticus 307.................. 152  1e-41  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] metallo-beta-lactamase-like protein [Octa...   
. . .Maritimibacter alkaliphilus..................... 152  1e-41  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Maritimibacter alkaliphilus] >gb|EA...   
. . .Silicibacter sp. TrichCH4B...................... 152  2e-41  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Silicibacter sp. TrichCH4B] >gb|EEW...   
. . .Roseovarius sp. TM1035.......................... 151  2e-41  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Roseovarius sp. TM1035] >gb|EDM3289...   
. . .Octadecabacter antarcticus 238.................. 151  2e-41  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] metallo-beta-lactamase-like protein [Octa...   
. . .Roseobacter denitrificans OCh 114............... 151  3e-41  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] hypothetical protein RD1_3469 [Roseobacter d...   
. . .Citreicella sp. 357............................. 151  3e-41  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Citreicella sp. 357] >gb|EIE49927.1...   
. . .Dinoroseobacter shibae DFL 12................... 150  5e-41  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] beta-lactamase domain-containing protein ...   
. . .Roseobacter sp. CCS2............................ 150  5e-41  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Roseobacter sp. CCS2] >gb|EBA10685....   
. . .Oceanibulbus indolifex.......................... 150  8e-41  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Oceanibulbus indolifex] >gb|EDQ0435...   
. . .Rhodovulum sp. PH10............................. 150  1e-40  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Rhodovulum sp. PH10] >gb|EJW12120.1...   
. . .Rhodobacteraceae bacterium HTCC2083............. 149  2e-40  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Rhodobacteraceae bacterium HTCC2083...   
. . .Roseobacter litoralis Och 149................... 149  2e-40  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] metallo-beta-lactamase-like protein [Rose...   
. . .Sagittula stellata.............................. 148  5e-40  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Sagittula stellata] >gb|EBA09282.1|...   
. . .Ruegeria lacuscaerulensis....................... 147  8e-40  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Ruegeria lacuscaerulensis] >gb|EEX1...   
. . .Rhodobacteraceae bacterium HTCC2150............. 146  2e-39  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Rhodobacteraceae bacterium HTCC2150...   
. . .Roseovarius nubinhibens......................... 145  4e-39  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Roseovarius nubinhibens] >gb|EAP767...   
. . .Roseovarius sp. 217............................. 145  5e-39  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Roseovarius sp. 217] >gb|EAQ23944.1...   
. . .Pelagibaca bermudensis.......................... 145  6e-39  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Pelagibaca bermudensis] >gb|EAU4734...   
. . .Rhodobacter sp. SW2............................. 145  7e-39  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Rhodobacter sp. SW2] >gb|EEW25499.1...   
. . .Ruegeria sp. TW15............................... 144  8e-39  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Ruegeria sp. TW15]                       
. . .Oceanicola sp. S124............................. 144  2e-38  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Oceanicola sp. S124]                     
. . .Celeribacter sp. L-6............................ 144  2e-38  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Celeribacter baekdonensis] >gb|EKE7...   
. . .Citreicella sp. SE45............................ 142  1e-37  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Citreicella sp. SE45] >gb|EEX15881....   
. . .Oceanicola batsensis............................ 142  1e-37  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Oceanicola batsensis] >gb|EAQ04172....   
. . .Ahrensia sp. R2A130............................. 141  2e-37  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Ahrensia sp. R2A130] >gb|EFL90266.1...   
. . .Ketogulonicigenium vulgare Y25.................. 139  2e-36  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] beta-lactamase [Ketogulonicigenium vulgar...   
. . .Paracoccus sp. TRP.............................. 138  2e-36  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Paracoccus sp. TRP]                      
. . .Rhodobacter capsulatus SB 1003.................. 138  2e-36  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] metallo-beta-lactamase [Rhodobacter capsu...   
. . .Paracoccus denitrificans PD1222................. 135  3e-35  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] beta-lactamase domain-containing protein [Pa...   
. . .Hyphomonas neptunium ATCC 15444................. 169  4e-48  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] metallo-beta-lactamase family protein [Hypho...   
. . .Hirschia baltica ATCC 49814..................... 166  6e-47  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] beta-lactamase [Hirschia baltica ATCC 498...   
. . .Rhodobacterales bacterium HTCC2255.............. 157  2e-43  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Rhodobacterales bacterium HTCC2255]...   
. . .Rhodobacterales bacterium Y4I................... 155  7e-43  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] PhnP [Rhodobacterales bacterium Y4I] >gb|...   
. . .Maricaulis maris MCS10.......................... 146  4e-39  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] beta-lactamase-like protein [Maricaulis mari...   
. . .Oceanicaulis sp. HTCC2633....................... 142  4e-38  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodobacterales] hypothetical protein [Oceanicaulis sp. HT...   
. . .Polymorphum gilvum SL003B-26A1.................. 167  2e-47  2 hits  [Proteobacteria] [Alphaproteobacteria]   Lipoyltransferase [Polymorphum gilvum SL0...   
. . .Caulobacter segnis ATCC 21756................... 166  7e-47  2 hits  [Proteobacteria] [Alphaproteobacteria] [Caulobacterales] metal-dependent hydrolase [Caulobacter se...   
. . .Caulobacter sp. K31............................. 154  2e-42  3 hits  [Proteobacteria] [Alphaproteobacteria] [Caulobacterales] hypothetical protein Caul_2696 [Caulobact...   
. . .Caulobacter sp. AP07............................ 149  1e-40  2 hits  [Proteobacteria] [Alphaproteobacteria] [Caulobacterales] PhnP [Caulobacter sp. AP07] >gb|EJL33253....   
. . .Asticcacaulis excentricus CB 48................. 160  1e-44  2 hits  [Proteobacteria] [Alphaproteobacteria] [Caulobacterales] metal-dependent hydrolase [Asticcacaulis ...   
. . .Phenylobacterium zucineum HLK1.................. 155  2e-42  2 hits  [Proteobacteria] [Alphaproteobacteria] [Caulobacterales] hypothetical protein PHZ_c1602 [Phenyloba...   
. . .Brevundimonas diminuta.......................... 140  4e-37  1 hit   [Proteobacteria] [Alphaproteobacteria] [Caulobacterales] PhnP [Brevundimonas diminuta] >gb|EGF9447...   
. . .Brevundimonas subvibrioides ATCC 15264.......... 139  1e-36  2 hits  [Proteobacteria] [Alphaproteobacteria] [Caulobacterales] hypothetical protein Bresu_1991 [Brevundi...   
. . .Brevundimonas sp. BAL3.......................... 139  1e-36  2 hits  [Proteobacteria] [Alphaproteobacteria] [Caulobacterales] PhnP [Brevundimonas sp. BAL3] >gb|EDX7904...   
. . .Asticcacaulis biprosthecium..................... 138  2e-36  1 hit   [Proteobacteria] [Alphaproteobacteria] [Caulobacterales] PhnP [Asticcacaulis biprosthecium] >gb|EG...   
. . .alpha proteobacterium IMCC14465................. 151  2e-41  2 hits  [Proteobacteria] [Alphaproteobacteria]   PhnP [alpha proteobacterium IMCC14465] >g...   
. . .Oceaniovalibus guishaninsula.................... 149  2e-40  1 hit   [Proteobacteria] [Alphaproteobacteria]   PhnP [Oceaniovalibus guishaninsula] >gb|E...   
. . .Parvularcula bermudensis HTCC2503............... 146  1e-39  2 hits  [Proteobacteria] [Alphaproteobacteria] [Parvularculales] hydrolase [Parvularcula bermudensis HTCC2...   
. . .Citromicrobium sp. JLT1363...................... 137  4e-36  1 hit   [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase [Citromicrobium sp. JLT1363]    
. . .Citromicrobium bathyomarinum.................... 136  1e-35  1 hit   [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase [Citromicrobium bathyomari...   
. . .Novosphingobium nitrogenifigens................. 131  1e-33  1 hit   [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase [Novosphingobium nitrogeni...   
. . .Sphingopyxis alaskensis RB2256.................. 130  2e-33  2 hits  [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase-like protein [Sphingopyxis al...   
. . .Sphingobium sp. SYK-6........................... 127  2e-32  3 hits  [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] putative hydrolase [Sphingobium sp. SYK-6...   
. . .Sphingomonas sp. PAMC 26621..................... 126  9e-32  1 hit   [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase [Sphingomonas sp. PAMC 26621]   
. . .Sphingobium yanoikuyae.......................... 124  4e-31  1 hit   [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase [Sphingobium yanoikuyae]        
. . .Sphingobium sp. AP49............................ 124  5e-31  2 hits  [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase [Sphingobium sp. AP49] >gb...   
. . .Sphingomonas echinoides......................... 124  7e-31  1 hit   [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase [Sphingomonas echinoides]       
. . .Sphingomonas sp. LH128.......................... 123  1e-30  2 hits  [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase [Sphingomonas sp. LH128] >...   
. . .Sphingomonas sp. SKA58.......................... 123  2e-30  2 hits  [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase [Sphingomonas sp. SKA58] >...   
. . .Sphingomonas sp. PAMC 26605..................... 122  2e-30  1 hit   [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase [Sphingomonas sp. PAMC 26605]   
. . .Sphingobium chlorophenolicum L-1................ 121  6e-30  2 hits  [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] PhnP protein [Sphingobium chlorophenolicu...   
. . .Sphingobium indicum............................. 119  2e-29  1 hit   [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase [Sphingobium indicum] >gb|...   
. . .Sphingobium japonicum UT26S..................... 119  2e-29  2 hits  [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] PhnP protein [Sphingobium japonicum UT26S...   
. . .Sphingomonas wittichii RW1...................... 119  3e-29  2 hits  [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase domain-containing protein ...   
. . .Sphingomonas sp. S17............................ 119  5e-29  2 hits  [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase [Sphingomonas sp. S17] >gb...   
. . .Novosphingobium aromaticivorans DSM 12444....... 118  7e-29  2 hits  [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase-like protein [Novosphingobium...   
. . .Novosphingobium sp. AP12........................ 118  1e-28  2 hits  [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase [Novosphingobium sp. AP12]...   
. . .Novosphingobium sp. Rr 2-17..................... 117  2e-28  2 hits  [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase [Novosphingobium sp. Rr 2-...   
. . .Sphingomonas elodea............................. 117  3e-28  1 hit   [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase [Sphingomonas elodea]           
. . .Novosphingobium sp. PP1Y........................ 116  6e-28  3 hits  [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase-like protein [Novosphingob...   
. . .Novosphingobium pentaromativorans............... 115  8e-28  1 hit   [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase [Novosphingobium pentaroma...   
. . .Sphingomonas sp. KC8............................ 111  2e-26  1 hit   [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase [Sphingomonas sp. KC8]          
. . .Zymomonas mobilis subsp. pomaceae ATCC 29192.... 107  7e-25  2 hits  [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase domain-containing protein ...   
. . .Zymomonas mobilis subsp. mobilis ATCC 29191..... 105  6e-24  2 hits  [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase [Zymomonas mobilis subsp. ...   
. . .Zymomonas mobilis subsp. mobilis ATCC 10988..... 103  3e-23  2 hits  [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase [Zymomonas mobilis subsp. ...   
. . .Erythrobacter sp. NAP1.......................... 127  5e-32  2 hits  [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase [Erythrobacter sp. NAP1] >...   
. . .Erythrobacter sp. SD-21......................... 122  3e-30  2 hits  [Proteobacteria] [Alphaproteobacteria] [Sphingomonadales] beta-lactamase [Erythrobacter sp. SD-21] ...   
. . .Tistrella mobilis KA081020-065.................. 136  1e-35  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] metallo-beta-lactamase superfamily [Tistr...   
. . .Rhodospirillum centenum SW...................... 129  9e-33  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] metallo-beta-lactamase superfamily [Rhodo...   
. . .Phaeospirillum molischianum..................... 124  3e-31  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] PhnP [Phaeospirillum molischianum] >emb|C...   
. . .Magnetospirillum magnetotacticum................ 120  3e-30  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] COG1235: Metal-dependent hydrolases of th...   
. . .Rhodospirillum photometricum DSM 122............ 118  7e-29  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] Beta-lactamase-like [Rhodospirillum photo...   
. . .Azospirillum brasilense Sp245................... 117  1e-28  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] putative Metal-dependent hydrolase [Azosp...   
. . .Oceanibaculum indicum........................... 111  3e-26  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] PhnP [Oceanibaculum indicum] >gb|EKE70924...   
. . .Azospirillum lipoferum 4B....................... 111  3e-26  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] putative Metal-dependent hydrolase [Azosp...   
. . .Azospirillum sp. B510........................... 111  4e-26  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] PhnP protein [Azospirillum sp. B510] >ref...   
. . .Magnetospirillum gryphiswaldense MSR-1.......... 110  1e-25  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] PhnP-like protein [Magnetospirillum gryphiswa...   
. . .Thalassospira xiamenensis....................... 102  8e-23  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] PhnP [Thalassospira xiamenensis] >gb|EKF1...   
. . .Thalassospira profundimaris..................... 97.1 5e-21  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] PhnP [Thalassospira profundimaris] >gb|EK... 
. . .Commensalibacter intestini...................... 130  3e-33  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] hydrolase [Commensalibacter intestini] >g...   
. . .Acetobacter tropicalis.......................... 128  3e-32  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] hydrolase [Acetobacter tropicalis] >dbj|G...   
. . .Gluconacetobacter xylinus NBRC 3288............. 125  2e-31  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] metal-dependent hydrolase [Gluconacetobac...   
. . .Gluconacetobacter europaeus..................... 122  2e-30  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] hydrolase [Gluconacetobacter europaeus]        
. . .Gluconacetobacter sp. SXCC-1.................... 119  3e-29  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] hydrolase [Gluconacetobacter sp. SXCC-1] ...   
. . .Gluconacetobacter hansenii...................... 119  4e-29  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] hydrolase [Gluconacetobacter hansenii] >g...   
. . .Acetobacter aceti............................... 118  9e-29  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] hydrolase [Acetobacter aceti]                  
. . .Gluconacetobacter oboediens..................... 117  1e-28  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] hydrolase [Gluconacetobacter oboediens]        
. . .Gluconobacter oxydans H24....................... 116  5e-28  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] PhnP protein [Gluconobacter oxydans H24] ...   
. . .Acetobacter pasteurianus IFO 3283-01............ 115  8e-28  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] metal-dependent hydrolase PhnP [Acetobact...   
. . .Acetobacter pasteurianus........................ 115  1e-27  3 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] metal-dependent hydrolase PhnP [Acetobact...   
. . .Granulibacter bethesdensis CGDNIH1.............. 114  2e-27  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] metal-dependent hydrolase [Granulibacter bet...   
. . .Acidiphilium cryptum JF-5....................... 113  5e-27  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] beta-lactamase domain-containing protein ...   
. . .Acetobacter pasteurianus subsp. pasteurianus LM. 113  7e-27  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] hydrolase [Acetobacter pasteurianus] >dbj...   
. . .Gluconobacter morbifer.......................... 112  8e-27  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] hydrolase [Gluconobacter morbifer] >gb|EH...   
. . .Acetobacter pomorum............................. 112  1e-26  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] hydrolase [Acetobacter pomorum] >gb|EGE48...   
. . .Gluconobacter frateurii......................... 110  5e-26  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] PhnP protein [Gluconobacter frateurii]         
. . .Gluconacetobacter diazotrophicus PAl 5.......... 110  5e-26  4 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] beta-lactamase-like [Gluconacetobacter di...   
. . .Gluconacetobacter diazotrophicus................ 110  7e-26  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] beta-lactamase domain-containing protein ...   
. . .Roseomonas cervicalis........................... 105  3e-24  1 hit   [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] hydrolase [Roseomonas cervicalis] >gb|EFH...   
. . .Acetobacteraceae bacterium AT-5844.............. 103  3e-23  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] hydrolase [Acetobacteraceae bacterium AT-...   
. . .Acidocella sp. MX-AZ02.......................... 103  4e-23  2 hits  [Proteobacteria] [Alphaproteobacteria] [Rhodospirillales] hydrolase [Acidocella sp. MX-AZ02] >gb|EK...   
. . .alpha proteobacterium BAL199.................... 125  2e-31  2 hits  [Proteobacteria] [Alphaproteobacteria]   Beta-lactamase-like protein [alpha proteo...   
. . .Candidatus Puniceispirillum marinum IMCC1322.... 122  3e-30  2 hits  [Proteobacteria] [Alphaproteobacteria]   beta-lactamase-like protein [Candidatus P...   
. . .SAR 116 cluster alpha proteobacterium HIMB100... 118  9e-29  2 hits  [Proteobacteria] [Alphaproteobacteria]   beta-lactamase [SAR116 cluster alpha prot...   
. . .Micavibrio aeruginosavorus ARL-13............... 96.3 1e-20  2 hits  [Proteobacteria] [Alphaproteobacteria]   metallo-beta-lactamase superfamily protei... 
. . Acidithiobacillus caldus SM-1.................... 143  2e-38  2 hits  [Proteobacteria] [Gammaproteobacteria] [Acidithiobacillales] metal-dependent hydrolase of the beta-lac...   
. . Acidithiobacillus ferrooxidans ATCC 53993........ 141  2e-37  2 hits  [Proteobacteria] [Gammaproteobacteria] [Acidithiobacillales] beta-lactamase domain-containing protein ...   
. . Acidithiobacillus ferrivorans SS3................ 140  3e-37  2 hits  [Proteobacteria] [Gammaproteobacteria] [Acidithiobacillales] metallo-beta-lactamase family protein [Ac...   
. . Acidithiobacillus thiooxidans.................... 69.7 3e-12  1 hit   [Proteobacteria] [Gammaproteobacteria] [Acidithiobacillales] metallo-beta-lactamase family protein [Ac... 
. . Geobacter uraniireducens Rf4..................... 133  2e-34  2 hits  [Proteobacteria] [Deltaproteobacteria] [Desulfuromonadales] beta-lactamase domain-containing protein ...   
. . Geobacter lovleyi SZ............................. 131  1e-33  4 hits  [Proteobacteria] [Deltaproteobacteria] [Desulfuromonadales] beta-lactamase [Geobacter lovleyi SZ] >re...   
. . Geobacter daltonii FRC-32........................ 129  4e-33  2 hits  [Proteobacteria] [Deltaproteobacteria] [Desulfuromonadales] beta-lactamase [Geobacter daltonii FRC-32...   
. . Geobacter sp. M18................................ 127  3e-32  3 hits  [Proteobacteria] [Deltaproteobacteria] [Desulfuromonadales] beta-lactamase domain-containing protein ...   
. . Geobacter sulfurreducens KN400................... 125  2e-31  2 hits  [Proteobacteria] [Deltaproteobacteria] [Desulfuromonadales] metal-dependent hydrolase [Geobacter sulf...   
. . Geobacter bemidjiensis Bem....................... 123  8e-31  2 hits  [Proteobacteria] [Deltaproteobacteria] [Desulfuromonadales] beta-lactamase superfamily metal-dependen...   
. . Geobacter metallireducens GS-15.................. 122  1e-30  2 hits  [Proteobacteria] [Deltaproteobacteria] [Desulfuromonadales] metal-dependent hydrolase [Geobacter meta...   
. . Geobacter sp. M21................................ 117  1e-28  3 hits  [Proteobacteria] [Deltaproteobacteria] [Desulfuromonadales] beta-lactamase [Geobacter sp. M21] >ref|W...   
. . Geobacter lovleyi................................ 58.5 2e-07  2 hits  [Proteobacteria] [Deltaproteobacteria] [Desulfuromonadales] beta-lactamase [Geobacter lovleyi SZ] >re... 
. . Pelobacter carbinolicus DSM 2380................. 133  2e-34  2 hits  [Proteobacteria] [Deltaproteobacteria] [Desulfuromonadales] metal-dependent hydrolase [Pelobacter car...   
. . Pelobacter propionicus DSM 2379.................. 130  3e-33  2 hits  [Proteobacteria] [Deltaproteobacteria] [Desulfuromonadales] beta-lactamase domain-containing protein [Pe...   
. . Desulfuromonas acetoxidans....................... 122  4e-30  2 hits  [Proteobacteria] [Deltaproteobacteria] [Desulfuromonadales] beta-lactamase [Desulfuromonas acetoxidan...   
. . Desulfuromonas acetoxidans DSM 684............... 67.4 1e-10  2 hits  [Proteobacteria] [Deltaproteobacteria] [Desulfuromonadales] beta-lactamase [Desulfuromonas acetoxidan... 
. . Bacteriovorax marinus SJ......................... 101  2e-22  2 hits  [Proteobacteria] [Deltaproteobacteria] [Bdellovibrionales] putative hydrolase [Bacteriovorax marinus...   
. . beta proteobacterium KB13........................ 128  1e-32  2 hits  [Proteobacteria] [Betaproteobacteria]    beta-lactamase [beta proteobacterium KB13...   
. . Methylotenera mobilis JLW8....................... 118  8e-29  2 hits  [Proteobacteria] [Betaproteobacteria] [Methylophilales] beta-lactamase domain-containing protein ...   
. . Lutiella nitroferrum............................. 117  2e-28  1 hit   [Proteobacteria] [Betaproteobacteria] [Neisseriales] beta-lactamase [Pseudogulbenkiania ferroo...   
. . Pseudogulbenkiania sp. NH8B...................... 116  5e-28  3 hits  [Proteobacteria] [Betaproteobacteria] [Neisseriales] beta-lactamase domain containing protein ...   
. . Methylovorus glucosetrophus SIP3-4............... 115  1e-27  2 hits  [Proteobacteria] [Betaproteobacteria] [Methylophilales] beta-lactamase domain-containing protein ...   
. . Methylophilales bacterium HTCC2181............... 113  4e-27  2 hits  [Proteobacteria] [Betaproteobacteria] [Methylophilales] beta-lactamase [Methylophilales bacterium...   
. . Methylotenera versatilis 301..................... 112  1e-26  2 hits  [Proteobacteria] [Betaproteobacteria] [Methylophilales] beta-lactamase domain-containing protein ...   
. . Laribacter hongkongensis HLHK9................... 99.4 9e-22  2 hits  [Proteobacteria] [Betaproteobacteria] [Neisseriales] hydrolase protein [Laribacter hongkongens... 
. .Halothermothrix orenii H 168...................... 138  2e-36  2 hits  [Firmicutes] [Clostridia] [Halanaerobiales] beta-lactamase domain-containing protein ...   
. .Halanaerobium praevalens DSM 2228................. 134  1e-34  2 hits  [Firmicutes] [Clostridia] [Halanaerobiales] beta-lactamase [Halanaerobium praevalens ...   
. .Halanaerobium hydrogeniformans.................... 125  1e-31  3 hits  [Firmicutes] [Clostridia] [Halanaerobiales] beta-lactamase [Halanaerobium hydrogenifo...   
. .Natranaerobius thermophilus JW/NM-WN-LF........... 119  2e-29  2 hits  [Firmicutes] [Clostridia] [Natranaerobiales] beta-lactamase [Natranaerobius thermophil...   
. .Thermacetogenium phaeum DSM 12270................. 73.6 7e-13  2 hits  [Firmicutes] [Clostridia] [Thermoanaerobacterales] beta-lactamase-like protein [Thermacetoge... 
. .Desulfitobacterium metallireducens................ 60.5 4e-08  1 hit   [Firmicutes] [Clostridia] [Clostridiales] beta-lactamase [Desulfitobacterium metall... 
. .Desulfitobacterium hafniense DCB-2................ 58.2 3e-07  2 hits  [Firmicutes] [Clostridia] [Clostridiales] beta-lactamase [Desulfitobacterium hafnie... 
. .Gemmata obscuriglobus............................. 137  8e-36  1 hit   [Planctomycetes] [Planctomycetacia] [Planctomycetales] hydrolase [Gemmata obscuriglobus]              
. .Planctomyces brasiliensis DSM 5305................ 122  3e-30  2 hits  [Planctomycetes] [Planctomycetacia] [Planctomycetales] beta-lactamase [Planctomyces brasiliensis...   
. .Rhodopirellula baltica............................ 117  2e-28  1 hit   [Planctomycetes] [Planctomycetacia] [Planctomycetales] hydrolase [Rhodopirellula baltica] >gb|EG...   
. .planctomycete KSU-1............................... 115  3e-28  2 hits  [Planctomycetes] [Planctomycetacia] [Planctomycetales] conserved hypothetical protein [planctomy...   
. .Planctomyces maris................................ 112  1e-26  1 hit   [Planctomycetes] [Planctomycetacia] [Planctomycetales] hydrolase [Planctomyces maris] >gb|EDL579...   
. .Schlesneria paludicola............................ 112  1e-26  1 hit   [Planctomycetes] [Planctomycetacia] [Planctomycetales] hydrolase [Schlesneria paludicola]             
. .Planctomyces limnophilus DSM 3776................. 109  1e-25  2 hits  [Planctomycetes] [Planctomycetacia] [Planctomycetales] beta-lactamase [Planctomyces limnophilus ...   
. .Blastopirellula marina............................ 108  5e-25  1 hit   [Planctomycetes] [Planctomycetacia] [Planctomycetales] hydrolase [Blastopirellula marina] >gb|EA...   
. .Pirellula staleyi DSM 6068........................ 106  2e-24  2 hits  [Planctomycetes] [Planctomycetacia] [Planctomycetales] beta-lactamase domain-containing protein ...   
. .Isosphaera pallida ATCC 43644..................... 105  4e-24  2 hits  [Planctomycetes] [Planctomycetacia] [Planctomycetales] Metal-dependent hydrolase of the beta-lac...   
. .Candidatus Kuenenia stuttgartiensis............... 118  9e-29  1 hit   [Planctomycetes] [Planctomycetacia] [Planctomycetales] conserved hypothetical protein [Candidatus Ku...   
. .Phycisphaera mikurensis NBRC 102666............... 111  3e-26  2 hits  [Planctomycetes] [Phycisphaerae] [Phycisphaerales] putative hydrolase [Phycisphaera mikurens...   
. .Akkermansia muciniphila ATCC BAA-835.............. 130  2e-33  2 hits  [Verrucomicrobia] [Verrucomicrobiae] [Verrucomicrobiales] beta-lactamase [Akkermansia muciniphila A...   
. .Verrucomicrobium spinosum......................... 121  6e-30  1 hit   [Verrucomicrobia] [Verrucomicrobiae] [Verrucomicrobiales] metallo-beta-lactamase [Verrucomicrobium ...   
. .Pedosphaera parvula............................... 107  2e-24  1 hit   [Verrucomicrobia] [Verrucomicrobiae] [Verrucomicrobiales] metallo-beta-lactamase [Pedosphaera parvu...   
. .Verrucomicrobiae bacterium DG1235................. 78.6 1e-14  2 hits  [Verrucomicrobia] [Verrucomicrobiae] [Verrucomicrobiales] beta-lactamase [Verrucomicrobiae bacteriu... 
. .Chthoniobacter flavus............................. 118  7e-29  1 hit   [Verrucomicrobia] [Spartobacteria]       metallo-beta-lactamase [Chthoniobacter fl...   
. .Methylacidiphilum infernorum V4................... 115  8e-28  3 hits  [Verrucomicrobia] [Methylacidiphilales]  putative coenzyme PQQ synthesis protein G [Met...   
. .Methylacidiphilum infernorum...................... 115  1e-27  1 hit   [Verrucomicrobia] [Methylacidiphilales]  Metal-dependent hydrolase of the beta-lac...   
. .Methylacidiphilum fumariolicum.................... 103  2e-23  1 hit   [Verrucomicrobia] [Methylacidiphilales]  metallo-beta-lactamase [Methylacidiphilum...   
. .Coraliomargarita akajimensis DSM 45221............ 83.2 4e-16  2 hits  [Verrucomicrobia] [Opitutae] [Puniceicoccales] beta-lactamase domain-containing protein ... 
. .Opitutus terrae PB90-1............................ 82.4 6e-16  2 hits  [Verrucomicrobia] [Opitutae]             beta-lactamase domain-containing protein ... 
. .Opitutaceae bacterium TAV1........................ 72.0 3e-12  2 hits  [Verrucomicrobia] [Opitutae]             beta-lactamase [Opitutaceae bacterium TAV... 
. .Opitutaceae bacterium TAV5........................ 72.0 3e-12  2 hits  [Verrucomicrobia] [Opitutae]             beta-lactamase [Opitutaceae bacterium TAV... 
. .Rhodothermus marinus SG0.5JP17-172................ 129  7e-33  2 hits  [Bacteroidetes] [Bacteroidetes Order II. Incertae sedis] beta-lactamase domain-containing protein ...   
. .Rhodothermus marinus DSM 4252..................... 129  8e-33  2 hits  [Bacteroidetes] [Bacteroidetes Order II. Incertae sedis] beta-lactamase domain-containing protein ...   
. .Salinibacter ruber M8............................. 109  2e-25  2 hits  [Bacteroidetes] [Bacteroidetes Order II. Incertae sedis] metallo-beta-lactamase superfamily protei...   
. .Capnocytophaga canimorsus Cc5..................... 124  4e-31  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] lipoate-protein ligase B [Capnocytophaga ...   
. .Capnocytophaga sputigena.......................... 123  8e-31  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Capnocytophaga sputigena]...   
. .Flavobacterium branchiophilum FL-15............... 122  2e-30  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] PhnP protein [Flavobacterium branchiophil...   
. .Anaerophaga thermohalophila....................... 120  2e-29  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Anaerophaga thermohalophila]        
. .uncultured Flavobacteriia bacterium............... 116  3e-28  1 hit   [Bacteroidetes] [Flavobacteriia]         metallo-beta-lactamase domain-containing prot...   
. .Elizabethkingia anophelis......................... 114  2e-27  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Elizabethkingia anophelis...   
. .Flavobacteria bacterium BAL38..................... 114  2e-27  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Flavobacteria bacterium B...   
. .Microscilla marina................................ 114  3e-27  1 hit   [Bacteroidetes] [Cytophagia] [Cytophagales] hydrolase [Microscilla marina] >gb|EAY314...   
. .Capnocytophaga ochracea........................... 114  4e-27  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Capnocytophaga ochracea] ...   
. .Flavobacteria bacterium MS024-2A.................. 113  5e-27  2 hits  [Bacteroidetes] [Flavobacteriia]         beta-lactamase [Flavobacteria bacterium M...   
. .Flavobacterium frigoris........................... 113  5e-27  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Flavobacterium frigoris] ...   
. .Polaribacter sp. MED152........................... 113  7e-27  3 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] metallo-beta-lactamase superfamily protei...   
. .Capnocytophaga ochracea DSM 7271.................. 112  1e-26  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] metallo-beta-lactamase domain-containing ...   
. .Imtechella halotolerans........................... 112  1e-26  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Imtechella halotolerans] ...   
. .Flavobacteriaceae bacterium S85................... 112  1e-26  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Flavobacteriaceae bacteri...   
. .Dokdonia donghaensis.............................. 112  1e-26  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] putative hydrolase [Dokdonia donghaensis]...   
. .Flavobacterium columnare ATCC 49512............... 112  2e-26  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] PhnP protein [Flavobacterium columnare AT...   
. .Capnocytophaga sp. oral taxon 335................. 112  2e-26  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Capnocytophaga sp. oral t...   
. .Leeuwenhoekiella blandensis....................... 111  2e-26  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Leeuwenhoekiella blandens...   
. .Capnocytophaga sp. oral taxon 412................. 111  2e-26  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Capnocytophaga sp. oral t...   
. .Gramella forsetii KT0803.......................... 111  3e-26  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] metallo-beta-lactamase domain-containing pro...   
. .Capnocytophaga gingivalis......................... 111  3e-26  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Capnocytophaga gingivalis...   
. .Blattabacterium sp. (Blattella germanica) str. ... 111  3e-26  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] metallo-beta-lactamase domain protein [Bl...   
. .Capnocytophaga sp. CM59........................... 110  7e-26  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Capnocytophaga sp. CM59] ...   
. .Flavobacterium sp. CF136.......................... 110  8e-26  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Flavobacterium sp. CF136]...   
. .Fluviicola taffensis DSM 16823.................... 110  9e-26  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] metal-dependent hydrolase [Fluviicola taf...   
. .Blattabacterium sp. (Periplaneta americana) str... 109  1e-25  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] metal-dependent hydrolase [Blattabacteriu...   
. .Flavobacteriaceae bacterium 3519-10............... 109  1e-25  3 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] Metal-dependent hydrolases of the beta-la...   
. .Myroides odoratimimus............................. 109  1e-25  4 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Myroides odoratimimus] >g...   
. .Flavobacteriaceae bacterium HQM9.................. 109  1e-25  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Flavobacteriaceae bacteri...   
. .Sphingobacterium spiritivorum..................... 109  1e-25  2 hits  [Bacteroidetes] [Sphingobacteriia] [Sphingobacteriales] hydrolase [Sphingobacterium spiritivorum]...   
. .Paludibacter propionicigenes WB4.................. 109  2e-25  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Paludibacter propionicigenes W...   
. .Gillisia sp. ck-I2-15............................. 108  2e-25  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Galbibacter sp. ck-I2-15]...   
. .Myroides odoratimimus CCUG 10230.................. 108  3e-25  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Myroides odoratimimus] >g...   
. .Myroides odoratimimus CIP 101113.................. 108  3e-25  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Myroides odoratimimus] >g...   
. .Odoribacter splanchnicus DSM 20712................ 108  3e-25  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] beta-lactamase domain-containing protein ...   
. .Capnocytophaga sp. oral taxon 329................. 108  4e-25  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Capnocytophaga sp. oral t...   
. .Flavobacterium indicum GPTSA100-9................. 108  4e-25  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] PhnP protein [Flavobacterium indicum GPTS...   
. .Gillisia limnaea.................................. 108  5e-25  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Gillisia limnaea] >gb|EHQ...   
. .Flavobacterium johnsoniae UW101................... 107  6e-25  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase domain-containing protein ...   
. .Weeksella virosa DSM 16922........................ 107  9e-25  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Weeksella virosa DSM 1692...   
. .Blattabacterium sp. (Mastotermes darwiniensis) ... 107  1e-24  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] metal-dependent hydrolase [Blattabacteriu...   
. .Zobellia galactanivorans.......................... 107  1e-24  3 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] metallo-beta-lactamase superfamily protei...   
. .Capnocytophaga sp. oral taxon 338................. 107  1e-24  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Capnocytophaga sp. oral t...   
. .Krokinobacter sp. 4H-3-7-5........................ 107  1e-24  3 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase domain-containing protein ...   
. .Sphingobacterium sp. 21........................... 107  1e-24  3 hits  [Bacteroidetes] [Sphingobacteriia] [Sphingobacteriales] beta-lactamase [Sphingobacterium sp. 21] ...   
. .Flavobacteria bacterium BBFL7..................... 106  1e-24  2 hits  [Bacteroidetes] [Flavobacteriia]         beta-lactamase [Flavobacteria bacterium B...   
. .Sphingobacterium spiritivorum ATCC 33300.......... 106  2e-24  1 hit   [Bacteroidetes] [Sphingobacteriia] [Sphingobacteriales] hydrolase [Sphingobacterium spiritivorum]...   
. .Flavobacterium sp. F52............................ 106  2e-24  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Flavobacterium sp. F52] >...   
. .Polaribacter...................................... 106  2e-24  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Polaribacter] >gb|EAR1278...   
. .Marinilabilia salmonicolor........................ 105  3e-24  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Marinilabilia salmonicolor]         
. .Cellulophaga lytica DSM 7489...................... 105  4e-24  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase domain-containing protein ...   
. .Croceibacter atlanticus HTCC2559.................. 105  4e-24  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] hydrolase, metal-dependent [Croceibacter ...   
. .Anaerophaga sp. HS1............................... 105  5e-24  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Anaerophaga sp. HS1]                
. .Cellulophaga algicola DSM 14237................... 105  7e-24  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Cellulophaga algicola DSM...   
. .Myroides odoratimimus CCUG 3837................... 105  7e-24  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Myroides odoratimimus] >g...   
. .unidentified eubacterium SCB49.................... 104  9e-24  1 hit   [Bacteroidetes]                          metal-dependent hydrolase [unidentified eubact...   
. .Aquimarina agarilytica............................ 104  1e-23  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Aquimarina agarilytica]        
. .Kordia algicida................................... 103  1e-23  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Kordia algicida] >gb|EDP9...   
. .Riemerella anatipestifer DSM 15868................ 103  2e-23  4 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] metal-dependent hydrolase [Riemerella ana...   
. .Riemerella anatipestifer.......................... 103  2e-23  3 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Riemerella anatipestifer]...   
. .Bizionia argentinensis............................ 102  4e-23  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Bizionia argentinensis] >...   
. .Myroides.......................................... 102  5e-23  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Myroides] >gb|EHQ43829.1|...   
. .Zunongwangia profunda SM-A87...................... 102  5e-23  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] metallo-beta-lactamase domain-containing ...   
. .Flavobacterium psychrophilum JIP02/86............. 102  8e-23  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] PhnP protein [Flavobacterium psychrophilu...   
. .Niastella koreensis GR20-10....................... 102  9e-23  2 hits  [Bacteroidetes] [Sphingobacteriia] [Sphingobacteriales] beta-lactamase [Niastella koreensis GR20-...   
. .Odoribacter laneus................................ 101  1e-22  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Odoribacter laneus] >gb|EHP493...   
. .Riemerella anatipestifer RA-CH-1.................. 101  1e-22  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] hypothetical protein B739_0134 [Riemerell...   
. .Belliella sp. LW7................................. 101  1e-22  1 hit   [Bacteroidetes] [Cytophagia] [Cytophagales] hydrolase [Nitritalea halalkaliphila] >gb...   
. .Flavobacteriales bacterium ALC-1.................. 101  2e-22  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Flavobacteriales bacteriu...   
. .Gillisia sp. CBA3202.............................. 101  2e-22  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Gillisia sp. CBA3202]          
. .Fibrisoma limi.................................... 100  2e-22  1 hit   [Bacteroidetes] [Cytophagia] [Cytophagales] hydrolase [Fibrisoma limi] >emb|CCH54171....   
. .Flexibacter litoralis DSM 6794.................... 100  2e-22  2 hits  [Bacteroidetes] [Cytophagia] [Cytophagales] beta-lactamase superfamily metal-dependen...   
. .Mesoflavibacter zeaxanthinifaciens................ 100  4e-22  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Mesoflavibacter zeaxanthi...   
. .Runella slithyformis DSM 19594.................... 100  4e-22  2 hits  [Bacteroidetes] [Cytophagia] [Cytophagales] beta-lactamase [Runella slithyformis DSM ...   
. .Maribacter sp. HTCC2170........................... 99.8 6e-22  3 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] putative hydrolase [Maribacter sp. HTCC21... 
. .Dysgonomonas mossii............................... 99.4 9e-22  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Dysgonomonas mossii] >gb|EGK04... 
. .Alistipes sp. JC136............................... 99.4 1e-21  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] beta-lactamase [Alistipes sp. JC136]         
. .Robiginitalea biformata HTCC2501.................. 99.0 1e-21  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] hydrolase [Robiginitalea biformata HTCC25... 
. .Pedobacter agri................................... 99.0 1e-21  1 hit   [Bacteroidetes] [Sphingobacteriia] [Sphingobacteriales] hydrolase [Pedobacter agri]                  
. .Myroides injenensis............................... 98.6 2e-21  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Myroides injenensis]         
. .Belliella baltica DSM 15883....................... 98.6 2e-21  2 hits  [Bacteroidetes] [Cytophagia] [Cytophagales] beta-lactamase superfamily metal-dependen... 
. .Joostella marina.................................. 98.6 2e-21  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Joostella marina] >gb|EIJ... 
. .Prevotella nigrescens............................. 98.2 2e-21  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella nigre... 
. .Prevotella sp. C561............................... 98.2 3e-21  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella sp. C... 
. .Saprospira grandis................................ 97.8 3e-21  2 hits  [Bacteroidetes] [Sphingobacteriia] [Sphingobacteriales] hydrolase [Saprospira grandis] >gb|EJF535... 
. .Pedobacter sp. BAL39.............................. 97.8 3e-21  2 hits  [Bacteroidetes] [Sphingobacteriia] [Sphingobacteriales] hydrolase [Pedobacter sp. BAL39] >gb|EDM3... 
. .Prevotella pallens................................ 97.8 3e-21  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella palle... 
. .Blattabacterium sp. (Cryptocercus punctulatus) ... 97.8 3e-21  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] metallo-beta-lactamase domain-containing ... 
. .Bacteroides salyersiae............................ 97.4 4e-21  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides salyersiae] >gb|EI... 
. .Muricauda ruestringensis DSM 13258................ 97.4 4e-21  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase domain-containing protein ... 
. .Alistipes shahii WAL 8301......................... 97.4 4e-21  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] Metal-dependent hydrolases of the beta-la... 
. .Bacteroides eggerthii............................. 97.1 5e-21  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides eggerthii] >gb|EEC... 
. .Bacteroides....................................... 97.1 5e-21  11 hits [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides] >gb|EGF52277.1| m... 
. .Lacinutrix sp. 5H-3-7-4........................... 97.1 5e-21  3 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase domain-containing protein ... 
. .Fibrella aestuarina BUZ 2......................... 97.1 6e-21  2 hits  [Bacteroidetes] [Cytophagia] [Cytophagales] beta-lactamase domain protein [Fibrella a... 
. .Cyclobacterium marinum DSM 745.................... 96.7 8e-21  2 hits  [Bacteroidetes] [Cytophagia] [Cytophagales] metal-dependent hydrolase [Cyclobacterium... 
. .Aequorivita sublithincola DSM 14238............... 96.3 1e-20  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase superfamily metal-dependen... 
. .Spirosoma linguale DSM 74......................... 95.9 1e-20  2 hits  [Bacteroidetes] [Cytophagia] [Cytophagales] beta-lactamase [Spirosoma linguale DSM 74... 
. .Pedobacter heparinus DSM 2366..................... 95.9 1e-20  2 hits  [Bacteroidetes] [Sphingobacteriia] [Sphingobacteriales] beta-lactamase domain-containing protein ... 
. .Marivirga tractuosa DSM 4126...................... 95.5 2e-20  2 hits  [Bacteroidetes] [Cytophagia] [Cytophagales] metal-dependent hydrolase [Marivirga trac... 
. .Parabacteroides johnsonii......................... 95.5 2e-20  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Parabacteroides johnsonii] >gb... 
. .Pontibacter sp. BAB1700........................... 95.5 2e-20  2 hits  [Bacteroidetes] [Cytophagia] [Cytophagales] hydrolase [Pontibacter sp. BAB1700] >gb|E... 
. .Prevotella multisaccharivorax..................... 95.1 3e-20  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella multi... 
. .Bacteroides sp. 4_1_36............................ 95.1 3e-20  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides] >gb|EFV25327.1| m... 
. .Chitinophaga pinensis DSM 2588.................... 94.7 3e-20  2 hits  [Bacteroidetes] [Sphingobacteriia] [Sphingobacteriales] beta-lactamase domain-containing protein ... 
. .Bacteroides stercoris ATCC 43183.................. 94.7 4e-20  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides] >gb|EDS16581.1| m... 
. .Porphyromonas sp. oral taxon 279.................. 94.7 3e-19  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Porphyromonas sp. oral taxon 2... 
. .Barnesiella intestinihominis...................... 94.0 7e-20  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Barnesiella intestinihominis] ... 
. .Parabacteroides merdae............................ 94.0 8e-20  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Parabacteroides merdae] >gb|EK... 
. .Dysgonomonas gadei................................ 93.6 9e-20  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Dysgonomonas gadei] >gb|EGK016... 
. .Prevotella timonensis............................. 93.6 1e-19  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella timon... 
. .Parabacteroides merdae ATCC 43184................. 93.6 1e-19  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Parabacteroides merdae] >gb|ED... 
. .Bacteroides eggerthii 1_2_48FAA................... 93.6 1e-19  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides eggerthii] >gb|EFV... 
. .Bacteroides nordii................................ 93.2 1e-19  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides nordii] >gb|EIY460... 
. .Emticicia oligotrophica DSM 17448................. 93.2 1e-19  2 hits  [Bacteroidetes] [Cytophagia] [Cytophagales] beta-lactamase [Emticicia oligotrophica D... 
. .Bacteroides sp. D20............................... 93.2 1e-19  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides sp. D20] >gb|EFA19... 
. .Prevotella melaninogenica ATCC 25845.............. 93.2 1e-19  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] metallo-beta-lactamase domain protein [Pr... 
. .Bacteroides caccae ATCC 43185..................... 92.8 2e-19  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides] >gb|EDM20350.1| m... 
. .Bacteroides caccae................................ 92.8 2e-19  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides caccae] >gb|EIY199... 
. .Prevotella melaninogenica......................... 92.4 3e-19  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella melan... 
. .Saprospira grandis str. Lewin..................... 91.7 4e-19  2 hits  [Bacteroidetes] [Sphingobacteriia] [Sphingobacteriales] metal-dependent hydrolase [Saprospira gra... 
. .Bacteroides helcogenes P 36-108................... 91.7 5e-19  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides helcogenes P 36-10... 
. .Alistipes finegoldii DSM 17242.................... 91.7 5e-19  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] beta-lactamase superfamily metal-dependen... 
. .Chryseobacterium gleum............................ 91.7 6e-19  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Chryseobacterium gleum] >... 
. .Prevotella sp. oral taxon 306..................... 91.3 6e-19  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella sp. o... 
. .Prevotella sp. oral taxon 472..................... 91.3 6e-19  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella sp. o... 
. .Bacteroides finegoldii DSM 17565.................. 91.3 7e-19  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides] >gb|EEX47217.1| m... 
. .Chryseobacterium sp. CF314........................ 91.3 7e-19  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Chryseobacterium sp. CF31... 
. .Prevotella intermedia 17.......................... 90.9 8e-19  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] beta-lactamase family protein [Prevotella... 
. .Mucilaginibacter paludis.......................... 90.9 9e-19  1 hit   [Bacteroidetes] [Sphingobacteriia] [Sphingobacteriales] hydrolase [Mucilaginibacter paludis] >gb|... 
. .Bacteroides coprosuis............................. 90.9 9e-19  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides coprosuis] >gb|EGJ... 
. .Alistipes indistinctus............................ 90.9 1e-18  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Alistipes indistinctus] >gb|EH... 
. .Alistipes sp. HGB5................................ 90.9 1e-18  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] beta-lactamase [Alistipes sp. HGB5] >gb|E... 
. .Bergeyella zoohelcum.............................. 90.5 1e-18  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Bergeyella zoohelcum] >gb... 
. .Cytophaga hutchinsonii ATCC 33406................. 90.5 1e-18  2 hits  [Bacteroidetes] [Cytophagia] [Cytophagales] metal-dependent hydrolase [Cytophaga hutchin... 
. .Bergeyella zoohelcum ATCC 43767................... 89.7 2e-18  1 hit   [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase [Bergeyella zoohelcum] >gb... 
. .Bacteroides ovatus................................ 89.4 3e-18  3 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides ovatus] >gb|EGM953... 
. .Bacteroides sp. 1_1_14............................ 89.0 4e-18  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides sp. 1_1_14] >gb|EF... 
. .Bacteroides sp. 2_1_56FAA......................... 89.0 4e-18  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides sp. 2_1_56FAA] >gb... 
. .Prevotella marshii................................ 89.0 4e-18  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella marsh... 
. .Psychroflexus torquis ATCC 700755................. 89.0 5e-18  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] metal-dependent hydrolase, beta-lactamase... 
. .Dyadobacter fermentans DSM 18053.................. 88.2 6e-18  2 hits  [Bacteroidetes] [Cytophagia] [Cytophagales] beta-lactamase domain-containing protein ... 
. .Bacteroides finegoldii............................ 88.2 7e-18  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides finegoldii] >gb|EK... 
. .Aquiflexum sp. LW9................................ 88.2 8e-18  1 hit   [Bacteroidetes] [Cytophagia] [Cytophagales] hydrolase [Cecembia lonarensis] >gb|EKB51... 
. .Owenweeksia hongkongensis DSM 17368............... 88.2 8e-18  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase superfamily metal-dependen... 
. .Bacteroides sp. 2_2_4............................. 88.2 8e-18  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides] >gb|EEO58079.1| m... 
. .Bacteroides ovatus CL02T12C04..................... 88.2 8e-18  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides ovatus] >gb|EIY614... 
. .Parabacteroides goldsteinii....................... 87.8 9e-18  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Parabacteroides goldsteinii] >... 
. .Niabella soli..................................... 87.8 9e-18  1 hit   [Bacteroidetes] [Sphingobacteriia] [Sphingobacteriales] hydrolase [Niabella soli] >gb|EHP52793.1|... 
. .Bacteroides sp. 1_1_6............................. 87.8 1e-17  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides sp. 1_1_6] >gb|EES... 
. .Blattabacterium sp. (Blaberus giganteus).......... 87.4 1e-17  3 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] metallo-beta-lactamase domain-containing ... 
. .Bacteroides fragilis.............................. 86.7 2e-17  4 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides fragilis] >gb|EIK3... 
. .Prevotella ruminicola 23.......................... 86.7 3e-17  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] phnP protein [Prevotella ruminicola 23] >... 
. .Bacteroides sp. D22............................... 86.7 3e-17  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides] >gb|EFI13541.1| l... 
. .Prevotella sp. oral taxon 317..................... 86.7 3e-17  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella sp. o... 
. .Parabacteroides distasonis ATCC 8503.............. 86.7 3e-17  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Parabacteroides distasonis ATC... 
. .Ornithobacterium rhinotracheale DSM 15997......... 86.7 3e-17  2 hits  [Bacteroidetes] [Flavobacteriia] [Flavobacteriales] beta-lactamase superfamily metal-dependen... 
. .Bacteroides sp. D1................................ 86.3 3e-17  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides] >gb|EEO50797.1| m... 
. .Prevotella oralis................................. 86.3 3e-17  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella orali... 
. .Prevotella bryantii............................... 86.3 3e-17  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella bryan... 
. .Prevotella sp. MSX73.............................. 86.3 3e-17  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella sp. M... 
. .Bacteroides salanitronis DSM 18170................ 86.3 4e-17  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] beta-lactamase domain-containing protein ... 
. .Solitalea canadensis DSM 3403..................... 85.9 4e-17  2 hits  [Bacteroidetes] [Sphingobacteriia] [Sphingobacteriales] beta-lactamase superfamily metal-dependen... 
. .Bacteroidales..................................... 85.9 5e-17  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroidales] >gb|EEY84809.1|... 
. .Bacteroides xylanisolvens......................... 85.9 5e-17  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides xylanisolvens] >gb... 
. .Prevotella denticola F0289........................ 85.1 7e-17  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] metallo-beta-lactamase domain-containing ... 
. .Haliscomenobacter hydrossis DSM 1100.............. 85.1 9e-17  2 hits  [Bacteroidetes] [Sphingobacteriia] [Sphingobacteriales] metallo-beta-lactamase domain-containing ... 
. .Bacteroidetes..................................... 84.7 1e-16  1 hit   [Bacteroidetes]                          lipoate--protein ligase [Bacteroidetes] >... 
. .Prevotella buccae................................. 84.7 1e-16  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella bucca... 
. .Pedobacter saltans DSM 12145...................... 84.7 1e-16  2 hits  [Bacteroidetes] [Sphingobacteriia] [Sphingobacteriales] beta-lactamase [Pedobacter saltans DSM 12... 
. .Paraprevotella xylaniphila........................ 84.3 2e-16  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Paraprevotella x... 
. .Porphyromonas asaccharolytica DSM 20707........... 84.3 1e-15  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] Octanoyltransferase [Porphyromonas asacch... 
. .Bacteroides fragilis HMW 616...................... 84.0 2e-16  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides fragilis] >gb|EKA8... 
. .Prevotella denticola.............................. 84.0 2e-16  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella denti... 
. .Prevotella disiens................................ 84.0 2e-16  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella disie... 
. .Bacteroides sp. D2................................ 83.6 3e-16  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides sp. D2] >gb|EFS327... 
. .Prevotella buccae ATCC 33574...................... 83.2 3e-16  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella bucca... 
. .Bacteroides faecis................................ 83.2 3e-16  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides faecis]               
. .Porphyromonas asaccharolytica..................... 83.2 2e-15  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Porphyromonas asaccharolytica]... 
. .Porphyromonas uenonis............................. 83.2 3e-15  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Porphyromonas uenonis] >gb|EEK... 
. .Prevotella histicola.............................. 82.4 8e-16  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella histi... 
. .Porphyromonas gingivalis ATCC 33277............... 82.4 4e-15  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Porphyromonas gingivalis ATCC ... 
. .Bacteroides plebeius.............................. 81.6 1e-15  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides plebeius] >gb|EDY9... 
. .Bacteroides fragilis 3_1_12....................... 80.9 2e-15  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides fragilis] >gb|EFR5... 
. .Algoriphagus sp. PR1.............................. 80.1 3e-15  2 hits  [Bacteroidetes] [Cytophagia] [Cytophagales] hydrolase [Algoriphagus sp. PR1] >gb|EAZ7... 
. .Bacteroides coprophilus........................... 80.1 4e-15  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides coprophilus] >gb|E... 
. .Leadbetterella byssophila DSM 17132............... 79.7 5e-15  2 hits  [Bacteroidetes] [Cytophagia] [Cytophagales] beta-lactamase [Leadbetterella byssophila... 
. .Bacteroides fragilis HMW 610...................... 79.3 7e-15  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides fragilis] >gb|EKA9... 
. .Bacteroides dorei................................. 79.3 8e-15  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides dorei] >gb|EEB2410... 
. .Bacteroides sp. 9_1_42FAA......................... 79.3 8e-15  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides] >gb|EEO61517.1| m... 
. .Bacteroides sp. 3_1_33FAA......................... 79.3 9e-15  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides] >gb|EEZ23488.1| m... 
. .Bacteroides vulgatus ATCC 8482.................... 79.3 9e-15  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides vulgatus ATCC 8482... 
. .Prevotella sp. oral taxon 302..................... 79.3 1e-14  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Alloprevotella r... 
. .Bacteroides vulgatus.............................. 79.0 1e-14  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Bacteroides vulgatus] >gb|EFG1... 
. .Prevotella amnii.................................. 78.2 2e-14  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella amnii... 
. .Porphyromonas endodontalis........................ 77.8 2e-13  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] hydrolase [Porphyromonas endodontalis] >g... 
. .Prevotella maculosa............................... 76.3 8e-14  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella macul... 
. .Candidatus Azobacteroides pseudotrichonymphae g... 76.3 9e-14  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] hypothetical protein CFPG_219 [Candidatus... 
. .Prevotella oris................................... 75.9 1e-13  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella oris]... 
. .Prevotella micans................................. 75.1 2e-13  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella mican... 
. .Prevotella oris C735.............................. 74.7 3e-13  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella oris]... 
. .Prevotella salivae................................ 74.3 4e-13  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella saliv... 
. .Prevotella oulorum................................ 66.6 2e-10  1 hit   [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate--protein ligase [Prevotella oulor... 
. .Porphyromonas gingivalis TDC60.................... 63.2 9e-09  2 hits  [Bacteroidetes] [Bacteroidia] [Bacteroidales] lipoate-protein ligase B [Porphyromonas g... 
. .Caldithrix abyssi................................. 128  2e-32  1 hit   []                                       beta-lactamase domain-containing protein ...   
. .Acidobacterium capsulatum ATCC 51196.............. 127  3e-32  2 hits  [Acidobacteria] [Acidobacteriales]       metallo-beta-lactamase family protein [Ac...   
. .Acidobacterium sp. MP5ACTX8....................... 116  4e-28  2 hits  [Acidobacteria] [Acidobacteriales]       beta-lactamase [Granulicella mallensis MP...   
. .Granulicella tundricola MP5ACTX9.................. 121  5e-30  2 hits  [Acidobacteria] [Acidobacteriales]       metallo-beta-lactamase family protein [Gr...   
. .Terriglobus roseus DSM 18391...................... 121  7e-30  2 hits  [Acidobacteria] [Acidobacteriales]       beta-lactamase superfamily metal-dependen...   
. .Terriglobus saanensis SP1PR4...................... 119  6e-29  2 hits  [Acidobacteria] [Acidobacteriales]       metallo-beta-lactamase family protein [Te...   
. .Candidatus Chloracidobacterium thermophilum B..... 109  1e-25  2 hits  [Acidobacteria]                          beta-lactamase superfamily metal-dependen...   
. .Candidatus Koribacter versatilis Ellin345......... 103  4e-23  2 hits  [Acidobacteria]                          beta-lactamase-like protein [Candidatus Kori...   
. .Candidatus Solibacter usitatus Ellin6076.......... 102  8e-23  2 hits  [Acidobacteria] [Solibacteres] [Solibacterales] beta-lactamase domain-containing protein [Ca...   
. .uncultured bacterium.............................. 127  3e-32  5 hits  []                                       hypothetical protein ACD_16C00084G0003 [uncult...   
. .Leptospirillum sp. Group II '5-way CG'............ 126  1e-31  1 hit   [Nitrospirae] [Nitrospira] [Nitrospirales] Putative metallo-beta-lactamase family protein...   
. .Leptospirillum ferriphilum ML-04.................. 124  3e-31  2 hits  [Nitrospirae] [Nitrospira] [Nitrospirales] metal-dependent hydrolase [Leptospirillum...   
. .Leptospirillum ferrooxidans C2-3.................. 120  1e-29  2 hits  [Nitrospirae] [Nitrospira] [Nitrospirales] hypothetical protein LFE_1640 [Leptospiri...   
. .Leptospirillum ferrodiazotrophum.................. 119  2e-29  1 hit   [Nitrospirae] [Nitrospira] [Nitrospirales] putative metallo-beta-lactamase family protein...   
. .Leptospirillum ferrooxidans....................... 106  1e-24  2 hits  [Nitrospirae] [Nitrospira] [Nitrospirales] Lfe137p1 [Leptospirillum ferrooxidans]              
. .Thermobaculum terrenum ATCC BAA-798............... 119  2e-29  2 hits  []                                       beta-lactamase [Thermobaculum terrenum AT...   
. .Brachyspira murdochii DSM 12563................... 118  5e-29  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] beta-lactamase [Brachyspira murdochii DSM...   
. .Brachyspira intermedia PWS/A...................... 116  3e-28  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] metal-dependent hydrolase [Brachyspira in...   
. .Brachyspira hyodysenteriae WA1.................... 116  5e-28  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] metal-dependent hydrolase [Brachyspira hy...   
. .Brachyspira pilosicoli WesB....................... 112  9e-27  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] metal-dependent hydrolase [Brachyspira pi...   
. .Brachyspira pilosicoli B2904...................... 112  9e-27  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] metal-dependent hydrolase [Brachyspira pi...   
. .Brachyspira pilosicoli 95/1000.................... 112  2e-26  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] metal-dependent hydrolase [Brachyspira pi...   
. .Spirochaeta smaragdinae DSM 11293................. 118  8e-29  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] beta-lactamase [Spirochaeta smaragdinae D...   
. .Sphaerochaeta coccoides DSM 17374................. 107  2e-24  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] beta-lactamase domain-containing protein ...   
. .Spirochaeta caldaria DSM 7334..................... 103  4e-23  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] beta-lactamase domain-containing protein ...   
. .Borrelia hermsii DAH.............................. 99.0 1e-21  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] metal-dependent hydrolase [Borrelia herms... 
. .Borrelia burgdorferi.............................. 98.6 2e-21  3 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] PhnP protein [Borrelia burgdorferi] >gb|E... 
. .Sphaerochaeta globosa str. Buddy.................. 98.6 2e-21  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] beta-lactamase [Sphaerochaeta globosa str... 
. .Sphaerochaeta pleomorpha str. Grapes.............. 97.8 3e-21  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] metal-dependent hydrolase, beta-lactamase... 
. .Treponema phagedenis.............................. 97.8 3e-21  1 hit   [Spirochaetes] [Spirochaetia] [Spirochaetales] metallo-beta-lactamase domain protein [Tr... 
. .Borrelia burgdorferi JD1.......................... 97.4 3e-21  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] PhnP protein [Borrelia burgdorferi JD1] >... 
. .Borrelia burgdorferi N40.......................... 97.1 5e-21  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] PhnP protein [Borrelia burgdorferi N40] >... 
. .Treponema azotonutricium ZAS-9.................... 97.1 8e-21  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] metallo-beta-lactamase family protein [Tr... 
. .Borrelia garinii.................................. 95.9 1e-20  4 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] PhnP protein [Borrelia garinii] >gb|EED30... 
. .Borrelia garinii BgVir............................ 95.5 2e-20  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] PhnP [Borrelia garinii BgVir] >ref|WP_014... 
. .Borrelia sp. SV1.................................. 95.1 2e-20  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] PhnP protein [Borrelia sp. SV1] >gb|EEH00... 
. .Borrelia garinii PBr.............................. 95.1 3e-20  1 hit   [Spirochaetes] [Spirochaetia] [Spirochaetales] PhnP protein [Borrelia garinii] >gb|EED29... 
. .Borrelia garinii NMJW1............................ 94.4 4e-20  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] phnP protein [Borrelia garinii NMJW1] >re... 
. .Borrelia duttonii Ly.............................. 92.8 2e-19  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] phnP protein [Borrelia duttonii Ly] >ref|... 
. .Borrelia valaisiana............................... 92.8 2e-19  1 hit   [Spirochaetes] [Spirochaetia] [Spirochaetales] PhnP protein [Borrelia valaisiana] >gb|EE... 
. .Borrelia bissettii DN127.......................... 92.8 2e-19  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] metallo-beta-lactamase superfamily protei... 
. .Treponema primitia ZAS-2.......................... 92.8 2e-19  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] lipoate-protein ligase B [Treponema primi... 
. .Borrelia afzelii PKo.............................. 91.3 6e-19  4 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] phnP protein [Borrelia afzelii PKo] >ref|YP_... 
. .Borrelia afzelii HLJ01............................ 91.3 7e-19  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] phnP protein [Borrelia afzelii HLJ01] >re... 
. .Borrelia recurrentis A1........................... 90.9 8e-19  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] phnP protein [Borrelia recurrentis A1] >r... 
. .Borrelia spielmanii............................... 90.1 1e-18  1 hit   [Spirochaetes] [Spirochaetia] [Spirochaetales] PhnP protein [Borrelia spielmanii] >gb|EE... 
. .Treponema primitia................................ 85.9 5e-17  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] beta-lactamase [Treponema primitia]          
. .Turneriella parva DSM 21527....................... 85.5 7e-17  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] beta-lactamase domain-containing protein ... 
. .Treponema sp. JC4................................. 82.4 9e-16  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] Metal-dependent hydrolase of the beta-lac... 
. .Treponema brennaborense DSM 12168................. 79.7 7e-15  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] beta-lactamase domain-containing protein ... 
. .Treponema succinifaciens DSM 2489................. 77.8 4e-14  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] beta-lactamase domain-containing protein ... 
. .Treponema saccharophilum.......................... 68.9 7e-11  1 hit   [Spirochaetes] [Spirochaetia] [Spirochaetales] beta-lactamase domain protein [Treponema ... 
. .Borrelia crocidurae str. Achema................... 63.5 5e-10  2 hits  [Spirochaetes] [Spirochaetia] [Spirochaetales] hypothetical protein Q7M_537, partial [Bo... 
. .Thermomicrobium roseum DSM 5159................... 118  8e-29  2 hits  [Chloroflexi] [Thermomicrobia] [Thermomicrobiales] hypothetical protein trd_1369 [Thermomicr...   
. .Oscillochloris trichoides......................... 113  5e-27  1 hit   [Chloroflexi] [Chloroflexi] [Chloroflexales] beta-lactamase [Oscillochloris trichoides...   
. .Chloroflexus aurantiacus J-10-fl.................. 112  1e-26  2 hits  [Chloroflexi] [Chloroflexi] [Chloroflexales] beta-lactamase domain-containing protein ...   
. .Nitrolancetus hollandicus......................... 111  3e-26  1 hit   [Chloroflexi] [Thermomicrobia] [Sphaerobacterales] beta-lactamase [Nitrolancetus hollandicus...   
. .Herpetosiphon aurantiacus DSM 785................. 104  1e-23  2 hits  [Chloroflexi] [Chloroflexi] [Herpetosiphonales] beta-lactamase domain-containing protein ...   
. .Sphaerobacter thermophilus DSM 20745.............. 102  1e-22  2 hits  [Chloroflexi] [Thermomicrobia] [Sphaerobacterales] beta-lactamase domain-containing protein ...   
. .Chloroflexus aggregans DSM 9485................... 94.4 5e-20  2 hits  [Chloroflexi] [Chloroflexi] [Chloroflexales] beta-lactamase domain-containing protein ... 
. .Gemmatimonas aurantiaca T-27...................... 118  9e-29  2 hits  [Gemmatimonadetes] [Gemmatimonadetes] [Gemmatimonadales] hypothetical protein GAU_1105 [Gemmatimon...   
. .Chloroherpeton thalassium ATCC 35110.............. 113  6e-27  2 hits  [Chlorobi] [Chlorobia] [Chlorobiales]    beta-lactamase domain-containing protein ...   
. .Parachlamydia acanthamoebae....................... 92.8 2e-19  2 hits  [Chlamydiae] [Chlamydiales]              beta-lactamase [Parachlamydia acanthamoeb... 
. .Parachlamydia acanthamoebae UV7................... 91.7 5e-19  2 hits  [Chlamydiae] [Chlamydiales]              metal dependent hydrolase of the beta-lac... 
. .Waddlia chondrophila WSU 86-1044.................. 85.9 5e-17  2 hits  [Chlamydiae] [Chlamydiales]              metal-dependent hydrolase, beta- lactamas... 
. .Waddlia chondrophila 2032/99...................... 85.9 5e-17  1 hit   [Chlamydiae] [Chlamydiales]              metal dependent hydrolase of the beta-lactama... 
. .Simkania negevensis Z............................. 75.9 1e-13  2 hits  [Chlamydiae] [Chlamydiales]              metal dependent hydrolase of the beta-lac... 
. .Chlamydophila pneumoniae LPCoLN................... 70.5 1e-11  2 hits  [Chlamydiae] [Chlamydiales]              metallo-beta-lactamase family protein [Ch... 
. .Chlamydia psittaci M56............................ 70.5 1e-11  2 hits  [Chlamydiae] [Chlamydiales]              metallo-beta-lactamase superfamily protei... 
. .Chlamydophila pecorum E58......................... 70.1 1e-11  2 hits  [Chlamydiae] [Chlamydiales]              metal dependent hydrolase [Chlamydophila ... 
. .Chlamydia trachomatis E/11023..................... 68.6 6e-11  2 hits  [Chlamydiae] [Chlamydiales]              metal-dependent hydrolase [Chlamydia trac... 
. .Chlamydia trachomatis K/SotonK1................... 68.2 7e-11  2 hits  [Chlamydiae] [Chlamydiales]              putative hydrolase [Chlamydia trachomatis... 
. .Chlamydia trachomatis B/Jali20/OT................. 68.2 7e-11  2 hits  [Chlamydiae] [Chlamydiales]              metal-dependent hydrolase [Chlamydia trac... 
. .Chlamydia trachomatis 434/Bu...................... 67.8 1e-10  2 hits  [Chlamydiae] [Chlamydiales]              metal-dependent hydrolase [Chlamydia trac... 
. .Chlamydia psittaci CP3............................ 62.4 1e-08  2 hits  [Chlamydiae] [Chlamydiales]              metallo-beta-lactamase superfamily protei... 
. .Chlamydia psittaci 01DC12......................... 62.4 1e-08  2 hits  [Chlamydiae] [Chlamydiales]              putative metal-dependent hydrolase [Chlam... 
. .Chlamydia psittaci GR9............................ 62.4 1e-08  2 hits  [Chlamydiae] [Chlamydiales]              metallo-beta-lactamase superfamily protei... 
. .Chlamydophila psittaci 6BC........................ 61.6 1e-08  4 hits  [Chlamydiae] [Chlamydiales]              putative metal-dependent hydrolase [Chlam... 
. .Chlamydia psittaci WC............................. 61.6 1e-08  2 hits  [Chlamydiae] [Chlamydiales]              metallo-beta-lactamase superfamily protei... 
. .Chlamydia psittaci NJ1............................ 60.5 4e-08  2 hits  [Chlamydiae] [Chlamydiales]              metallo-beta-lactamase superfamily protei... 
. .Truepera radiovictrix DSM 17093................... 60.1 5e-08  2 hits  [Deinococcus-Thermus] [Deinococci] [Deinococcales] beta-lactamase-like protein [Truepera rad... 
. Edhazardia aedis USNM 41457........................ 70.9 1e-11  1 hit   [Microsporidia]                          hypothetical protein EDEG_02527 [Edhazardia ae... 
. Wallemia sebi CBS 633.66........................... 61.6 2e-08  1 hit   [Basidiomycota] [Wallemiomycetes] [Wallemiales] hypothetical protein WALSEDRAFT_39891 [Wallemi... 
. Laccaria bicolor S238N-H82......................... 60.1 1e-07  2 hits  [Basidiomycota] [Agaricomycetes] [Agaricales] predicted protein [Laccaria bicolor S238N... 
. Ustilago maydis 521................................ 59.7 1e-07  2 hits  [Basidiomycota] [Ustilaginomycetes] [Ustilaginales] hypothetical protein UM04303.1 [Ustilago may... 
. Melampsora larici-populina 98AG31.................. 59.3 2e-07  2 hits  [Basidiomycota] [Pucciniales]            Hypothetical protein MELLADRAFT_124040 [Melamp... 
. Ustilago hordei.................................... 58.9 3e-07  1 hit   [Basidiomycota] [Ustilaginomycetes] [Ustilaginales] uncharacterized protein UHOR_06453 [Ustilago ... 
. Populus trichocarpa................................ 65.9 8e-10  1 hit   [Streptophyta] [Malpighiales]            predicted protein [Populus trichocarpa]      
. Arabidopsis thaliana............................... 64.7 1e-09  8 hits  [Streptophyta] [Brassicales]             metallo-beta-lactamase domain-containing ... 
. Medicago truncatula................................ 62.4 1e-08  2 hits  [Streptophyta] [Fabales]                 Hydrolase-like protein [Medicago truncatu... 
. Vitis vinifera..................................... 62.4 2e-08  2 hits  [Streptophyta] [Vitales]                 PREDICTED: putative hydrolase C777.06c [V... 
. Selaginella moellendorffii......................... 61.2 3e-08  4 hits  [Streptophyta] [Isoetopsida] [Selaginellales] hypothetical protein SELMODRAFT_76733 [Se... 
. Albugo laibachii Nc14.............................. 60.1 8e-08  1 hit   [] [Albuginales]                         conserved hypothetical protein [Albugo laibac... 
. Trichomonas vaginalis G3........................... 59.7 9e-08  2 hits  [] [Trichomonadida]                      metallo-beta-lactamase superfamily protei... 
. Glycine max........................................ 58.9 2e-07  3 hits  [Streptophyta] [Fabales]                 uncharacterized protein LOC100786919 [Gly... 
. Oryza sativa Indica Group.......................... 58.9 2e-07  1 hit   [Streptophyta] [Liliopsida] [Poales]     hypothetical protein OsI_31065 [Oryza sativa I... 
. Arabidopsis lyrata subsp. lyrata................... 58.9 3e-07  2 hits  [Streptophyta] [Brassicales]             metallo-beta-lactamase family protein [Ar... 
. Ricinus communis................................... 58.5 3e-07  2 hits  [Streptophyta] [Malpighiales]            catalytic, putative [Ricinus communis] >g... 
. Physcomitrella patens subsp. patens................ 58.5 4e-07  2 hits  [Streptophyta] [Bryopsida] [Funariales]  predicted protein [Physcomitrella patens ... 
________________________________________________________________________________________________________________________=

BLAST

+PROTOCOLE:

NCBI

a) Blastp, base de donnée : Swissprot , paramètre par défaut du NCBI sauf "max target : 5000"

b) Blastp, base de donnée : nr , paramètre par défaut du NCBI sauf "max target : 5000"


ANALYSE DES RÉSULTATS:


a) On obtient 49 hits avec la base de données swissprot ( e-value allant de 8e-17 à 9,2). La plupart des hits sont alignés sur les 40 premiers acides aminés de notre séquence requête. Elles correspondent pour la plupart à des ribonucléases (ou aux domaine protéiques identifiés avec interproscan). Ce qui pourrait signifier que ce domaine de 40 acides aminés serait impliqué dans l'activité hydrolase de la protéine.

Comme on a peu de résultats avec des e-values peu fiables et des hits qui ne s’étendent pas sur toute notre séquence cible, on fait un blast contre nr.


b) On obtient 5000 hits avec la base de données nr (e-value allant de 3e-80 à 10). Les 100 premiers hits sont alignés sur toute la séquence requête. Elles correspondent pour la plupart à des métallo-béta-lactamases ou à des Phnp (protéine avec un domaine metallo-dépendent hydrolases d'une béta-lactamase). Cette concordance est aussi trouvé par interprosan car on trouve aussi un domaine de beta-lactamase avec une faible e-value.


En comparant les résultats trouvés avec les différentes bases de données, on peut dire que nos résultats obtenus avec swissprot ne sont pas du tout significatifs car nos hit de swissprot ont une evalue beaucoup plus forte que nos hits avec nr.



RÉSULTATS BRUTS:
______________________________________________________________________________________________________________________=
a)Blastp, Swissprot

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q7MUY1.1|LIPB_PORGI  RecName: Full=Octanoyltransferase; Alt...  82.0    8e-17
sp|O74545.1|YCV6_SCHPO  RecName: Full=Putative hydrolase C777.06c  52.0    8e-07
sp|O31760.3|RNJ2_BACSU  RecName: Full=Ribonuclease J 2; Short=...  42.4    0.002
sp|P54548.1|RNZ_BACSU  RecName: Full=Ribonuclease Z; Short=RNa...  37.0    0.074
sp|B1J6H3.1|RNZ_PSEPW  RecName: Full=Ribonuclease Z; Short=RNa...  36.6    0.094
sp|P28607.1|ARS_ALTCA  RecName: Full=Arylsulfatase; Short=AS; ...  35.0    0.31 
sp|Q8EQ58.1|RNZ_OCEIH  RecName: Full=Ribonuclease Z; Short=RNa...  34.7    0.37 
sp|Q89NF8.1|RNZ_BRAJA  RecName: Full=Ribonuclease Z; Short=RNa...  34.7    0.39 
sp|Q45493.1|RNJ1_BACSU  RecName: Full=Ribonuclease J 1; Short=...  34.7    0.55 
sp|Q65HN6.1|RNZ_BACLD  RecName: Full=Ribonuclease Z; Short=RNa...  34.3    0.59 
sp|P16692.1|PHNP_ECOLI  RecName: Full=Phosphoribosyl 1,2-cycli...  33.9    0.61 
sp|B1WQW1.1|RNZ_CYAA5  RecName: Full=Ribonuclease Z; Short=RNa...  34.3    0.62 
sp|Q6GHG0.1|RNJ2_STAAR  RecName: Full=Ribonuclease J 2; Short=...  33.9    0.81 
sp|Q9Z8N7.1|SKPL_CHLPN  RecName: Full=Skp-like protein; Flags:...  33.1    0.81 
sp|Q58897.2|RNZ_METJA  RecName: Full=Ribonuclease Z; Short=RNa...  33.5    0.90 
sp|Q7V0B9.1|RNZ_PROMP  RecName: Full=Ribonuclease Z; Short=RNa...  33.5    0.94 
sp|B9DNT1.1|RNZ_STACT  RecName: Full=Ribonuclease Z; Short=RNa...  33.5    1.0  
sp|Q5HPR6.2|RNJ2_STAEQ  RecName: Full=Ribonuclease J 2; Short=...  33.5    1.2  
sp|Q49X63.1|RNJ2_STAS1  RecName: Full=Ribonuclease J 2; Short=...  33.5    1.2  
sp|Q12MM2.1|GLO2_SHEDO  RecName: Full=Hydroxyacylglutathione h...  33.1    1.2  
sp|Q6G9T8.1|RNJ2_STAAS  RecName: Full=Ribonuclease J 2; Short=...  33.5    1.3  
sp|Q95Q18.1|LACB2_CAEEL  RecName: Full=Beta-lactamase-like pro...  32.7    1.5  
sp|A8G6G0.1|RNZ_PROM2  RecName: Full=Ribonuclease Z; Short=RNa...  32.7    1.6  
sp|A4YHP1.1|RNZ_METS5  RecName: Full=Ribonuclease Z; Short=RNa...  32.7    1.6  
sp|A3PEI3.1|RNZ_PROM0  RecName: Full=Ribonuclease Z; Short=RNa...  32.7    1.7  
sp|Q1IA50.1|RNZ_PSEE4  RecName: Full=Ribonuclease Z; Short=RNa...  32.7    1.9  
sp|C4L3C2.1|RNZ_EXISA  RecName: Full=Ribonuclease Z; Short=RNa...  32.7    2.0  
sp|A2BSS2.1|RNZ_PROMS  RecName: Full=Ribonuclease Z; Short=RNa...  32.3    2.1  
sp|Q4L5X8.1|RNJ2_STAHJ  RecName: Full=Ribonuclease J 2; Short=...  32.7    2.2  
sp|Q5F486.1|BAG5_CHICK  RecName: Full=BAG family molecular cha...  32.3    2.3  
sp|A2BY56.1|RNZ_PROM5  RecName: Full=Ribonuclease Z; Short=RNa...  32.3    2.4  
sp|A5MZX7.1|RNZ_CLOK5  RecName: Full=Ribonuclease Z; Short=RNa...  32.3    2.5  
sp|Q60355.2|Y047_METJA  RecName: Full=Uncharacterized protein ...  32.3    2.9  
sp|C0SP91.1|YYCJ_BACSU  RecName: Full=Putative metallo-hydrola...  32.0    3.3  
sp|B7K1N1.1|RNZ_CYAP8  RecName: Full=Ribonuclease Z; Short=RNa...  31.6    4.4  
sp|Q9H777.2|RNZ1_HUMAN  RecName: Full=Zinc phosphodiesterase E...  31.6    4.9  
sp|B0CE23.1|RNZ_ACAM1  RecName: Full=Ribonuclease Z; Short=RNa...  31.2    5.1  
sp|Q834G2.1|RNZ_ENTFA  RecName: Full=Ribonuclease Z; Short=RNa...  31.2    5.6  
sp|Q29RY4.1|RNZ1_BOVIN  RecName: Full=Zinc phosphodiesterase E...  31.2    6.2  
sp|Q9J531.1|V204_FOWPN  RecName: Full=Uncharacterized serpin-l...  30.8    6.7  
sp|A7Z6F0.1|RNZ_BACA2  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    6.8  
sp|Q118J2.1|RNZ_TRIEI  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    7.2  
sp|A1S6T3.1|GLO2_SHEAM  RecName: Full=Hydroxyacylglutathione h...  30.4    8.1  
sp|A6M1F0.1|MURG_CLOB8  RecName: Full=UDP-N-acetylglucosamine-...  30.8    8.2  
sp|Q5QZL0.1|GLO2_IDILO  RecName: Full=Hydroxyacylglutathione h...  30.4    8.3  
sp|Q8VEB6.1|RNZ1_MOUSE  RecName: Full=Zinc phosphodiesterase E...  30.8    8.3  
sp|P71374.1|GLO2_HAEIN  RecName: Full=Hydroxyacylglutathione h...  30.4    8.5  
sp|Q4L6K4.1|RNZ_STAHJ  RecName: Full=Ribonuclease Z; Short=RNa...  30.4    9.1  
sp|Q7NDW3.1|RNZ_GLOVI  RecName: Full=Ribonuclease Z; Short=RNa...  30.4    9.2  

RecName: Full=Octanoyltransferase; AltName: Full=Lipoate-protein ligase B; AltName: Full=Lipoyl/octanoyl transferase; AltName: Full=Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase
Sequence ID: sp|Q7MUY1.1|LIPB_PORGILength: 492Number of Matches: 1
Related Information
Gene-associated gene details
Range 1: 46 to 254GenPeptGraphics Next Match Previous Match
Alignment statistics for match #1 Score	Expect	Method	Identities	Positives	Gaps
82.0 bits(201) 	8e-17 	Compositional matrix adjust. 	60/216(28%) 	109/216(50%) 	12/216(5%)

Query  2    RNILIDTSPDIKFQLLKNKVKNINNVFYTHAHADQTHGINEMRAFYIINKKKLPVYGDKI  61
            + ILID SPD + Q L   + +++ V  TH H D   G++++R   I   ++L VY ++ 
Sbjct  46   KRILIDCSPDFRQQALFAGIDSLDAVLLTHEHFDHVGGLDDLRT--ICWHRELAVYAEQN  103

Query  62   TKKLLFSTFKYCFKGTSSYPAT--LKFINLSRIHKFDNGKDKIVIKNITVEHGLIDSKCY  119
                +     Y F+  + YP T  LK   +     F      + ++ + + HG +    Y
Sbjct  104  VLDSIRDRLHYVFR-KNPYPGTPLLKLCEVKPDMPFQVA--DLTVEPLRIMHGRLPILGY  160

Query  120  IINNKCAYVSDVSKIYNKDIIKLKNLKYFVVDCLRF-KQHPSHFNLSDVFKIIKKIGPKK  178
             I  + A+++D+  I  ++I  LK+ +   ++ LR+ K+HPSH  +      I +IG  +
Sbjct  161  KI-GEMAFLTDMKDIAAEEIECLKSCRLLFINGLRYRKEHPSHQTIEQAIDTIGQIGNPE  219

Query  179  TILTNL--HSDIDYNYLKHKLPKNIIPAYDGLNFLI  212
            ++L +L  H+ +   +L+  LP +I   YDGL  +I
Sbjct  220  SVLIHLSHHAPLHQEHLE-ILPPHIHSGYDGLEAII  254


Download GenPeptGraphics Next Previous Descriptions
RecName: Full=Putative hydrolase C777.06c
Sequence ID: sp|O74545.1|YCV6_SCHPOLength: 301Number of Matches: 1
Related Information
Gene-associated gene details
Range 1: 66 to 294GenPeptGraphics Next Match Previous Match
Alignment statistics for match #1 Score	Expect	Method	Identities	Positives	Gaps
52.0 bits(123) 	8e-07 	Compositional matrix adjust. 	56/232(24%) 	99/232(42%) 	29/232(12%)

Query  2    RNILIDTSPDIKFQLLKN----KVKNINNVFYTHAHADQTHGINEMRAFYI-INKKKLPV  56
            +NILID         LK+    K++ ++ V  TH HAD  +G++++R + +   +  + +
Sbjct  66   KNILIDCGKHFYVSALKHFVEHKIRYLDAVILTHDHADAINGMDDLREWTLGFLQPSVKI  125

Query  57   YGDKITKKLLFSTFKYCF-----KGTSSYPATLKFINLSRIHKFDNGKDKIVIKNITVEH  111
            Y  + T K++  +F Y        G  S P T  F   S    F      I +  + V H
Sbjct  126  YLTERTYKVIERSFPYMVNAKNATGGGSVP-TFDFHVFSPDKPFKLDDIDISVTPLPVHH  184

Query  112  GLI-----DSKCYIIN----NKCAYVSDVSKIYNKDIIKLKNLKYFVVDCLRFKQHPSHF  162
            G+      +S+ Y          +Y+SD + +       ++     VVD L+ + +PSHF
Sbjct  185  GVYFIEGKESQTYFCMGFRVGDMSYISDCNYVPPTTKKLMEGSNVVVVDALKHEPYPSHF  244

Query  163  NLSDVFKIIKKIG--PKKTILTNLHSDIDYNYLKHKL-----PKNIIPAYDG  207
            +     + I  +   P + + T     +++N    +L     P    PAYDG
Sbjct  245  SFKQAEEFIASLEHVPSRVLYTGFSHKVEHNETVKELSVLKVPTE--PAYDG  294


Download GenPeptGraphics Next Previous Descriptions
RecName: Full=Ribonuclease J 2; Short=RNase J2
Sequence ID: sp|O31760.3|RNJ2_BACSULength: 555Number of Matches: 1
Related Information
Gene-associated gene details
Range 1: 55 to 109GenPeptGraphics Next Match Previous Match
Alignment statistics for match #1 Score	Expect	Method	Identities	Positives	Gaps
42.4 bits(98) 	0.002 	Compositional matrix adjust. 	22/62(35%) 	32/62(51%) 	7/62(11%)

Query  10   PDIKFQLLKNKVKNINNVFYTHAHADQTHGINEMRAFYIINKKKLPVYGDKITKKLLFST  69
            PDI +  L  +   +  +F TH H +   G+     FY++NK  +PVYG K+T  LL   
Sbjct  55   PDISY--LIERADRVKAIFLTHGHDENIGGV-----FYLLNKLSVPVYGTKLTLALLREK  107

Query  70   FK  71
             K
Sbjct  108  LK  109


Download GenPeptGraphics Next Previous Descriptions
RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=tRNA 3 endonuclease; AltName: Full=tRNase Z
Sequence ID: sp|P54548.1|RNZ_BACSULength: 307Number of Matches: 1
Related Information
Gene-associated gene details
Range 1: 35 to 168GenPeptGraphics Next Match Previous Match
Alignment statistics for match #1 Score	Expect	Method	Identities	Positives	Gaps
37.0 bits(84) 	0.074 	Compositional matrix adjust. 	36/146(25%) 	67/146(45%) 	17/146(11%)

Query  5    LIDTSPDIKFQLLKNKVK--NINNVFYTHAHADQTHGINEM---RAFYIINKKKLPVYGD  59
            L D     + Q+L   +K   I  +F TH H D  +G+  +   R+F    + +L VYG 
Sbjct  35   LFDCGEATQHQILHTTIKPRKIEKIFITHMHGDHVYGLPGLLGSRSFQ-GGEDELTVYGP  93

Query  60   KITKKLLFSTFKYCFKGTSSYPATLKFINLSRIHKFDNGKDKIVIKNITVEHGLIDSKCY  119
            K  K  + ++     K   +YP  ++ I    +  F++  D+ ++  ++V HG +++  Y
Sbjct  94   KGIKAFIETSLAVT-KTHLTYPLAIQEIEEGIV--FED--DQFIVTAVSVIHG-VEAFGY  147

Query  120  IINNKCAYVSDVSKIYNKDIIKLKNL  145
             +  K     DV      D++K  N+
Sbjct  148  RVQEK-----DVPGSLKADVLKEMNI  168


Download GenPeptGraphics Next Previous Descriptions
RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=tRNA 3 endonuclease; AltName: Full=tRNase Z
Sequence ID: sp|B1J6H3.1|RNZ_PSEPWLength: 321Number of Matches: 1
Related Information
Gene-associated gene details
Range 1: 34 to 139GenPeptGraphics Next Match Previous Match
Alignment statistics for match #1 Score	Expect	Method	Identities	Positives	Gaps
36.6 bits(83) 	0.094 	Compositional matrix adjust. 	21/110(19%) 	49/110(44%) 	7/110(6%)

Query  5    LIDTSPDIKFQLLKN--KVKNINNVFYTHAHADQTHGINEMRAFYIINKKKLPVYGDKIT  62
            L+D     + QLL     V+++  +F TH H D   G+  + A   ++ +  P+  D + 
Sbjct  34   LVDCGEGTQHQLLHTPLSVRDLRAIFITHVHGDHCFGLPGLLASAGMSGRTAPL--DLVL  91

Query  63   KKLLFSTFKYCFKGTSSY-PATLKFINLSRIHKFDNGKDKIVIKNITVEH  111
               L    +     + S+ P  L+ + + ++ ++ +  D + +  + + H
Sbjct  92   PAALHDWVRLSLAASDSFLPFELRLLAVEQLGEWRS--DTLAVSTVQLSH  139

______________________________________________________________________________________________________________________
b) Blastp, base de donnée : nr



Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
           34,075,208 sequences; 11,905,140,037 total letters
Query= 
Length=212


                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|WP_018414124.1|  metallo-beta-lactamase [Candidatus Pelagi...    251   3e-80
ref|WP_006996917.1|  metallo-beta-lactamase [Candidatus Pelagi...    251   4e-80
ref|YP_266414.1|  metallo-beta-lactamase family protein [Candi...    251   4e-80
ref|WP_020169420.1|  metallo-beta-lactamase [Candidatus Pelagi...    249   2e-79
ref|YP_006756598.1|  metallo-beta-lactamase family protein [al...    213   3e-65
ref|WP_008545261.1|  metallo-beta-lactamase [Candidatus Pelagi...    209   8e-64
ref|WP_017969931.1|  hypothetical protein [alpha proteobacteri...    191   6e-57
ref|WP_022734860.1|  metallo-beta-lactamase [Candidatus Pelagi...    189   3e-56
ref|YP_001754194.1|  beta-lactamase domain-containing protein ...    187   3e-55
ref|WP_020095550.1|  PhnP [Methylobacterium sp. 285MFTsu5.1]         186   7e-55
ref|WP_007562987.1|  PhnP [Methylobacterium sp. GXF4] >gb|EIZ8...    186   1e-54
ref|WP_018036772.1|  hypothetical protein [unclassified Alphap...    185   1e-54
ref|YP_577265.1|  hypothetical protein Nham_2006 [Nitrobacter ...    179   3e-52
ref|WP_009466112.1|  PhnP [Roseibium sp. TrichSKD4] >gb|EFO337...    176   6e-51
ref|WP_009491201.1|  PhnP [Microvirga sp. WSM3557] >gb|EIM2973...    176   7e-51
ref|WP_022998605.1|  PhnP [Labrenzia sp. C1B10] >gb|ERP98019.1...    174   4e-50
ref|WP_018997025.1|  PhnP [Hirschia maritima]                        174   7e-50
ref|WP_018271681.1|  PhnP [Bradyrhizobium elkanii]                   173   9e-50
ref|WP_009797520.1|  PhnP [Nitrobacter sp. Nb-311A] >gb|EAQ356...    173   9e-50
ref|WP_018043558.1|  PhnP [Methylobacterium sp. 88A]                 172   3e-49
ref|WP_017971485.1|  hypothetical protein [alpha proteobacteri...    170   1e-48
ref|YP_002501967.1|  beta-lactamase domain-containing protein ...    170   1e-48
ref|WP_021079365.1|  PhnP protein [Bradyrhizobium sp. DFCI-1] ...    170   2e-48
ref|WP_019903857.1|  PhnP [Methylobacterium sp. 77]                  170   2e-48
ref|YP_760514.1|  metallo-beta-lactamase family protein [Hypho...    169   4e-48
ref|WP_017943978.1|  hypothetical protein [alpha proteobacteri...    168   6e-48
ref|WP_006934473.1|  PhnP [Labrenzia aggregata] >gb|EAV43997.1...    169   8e-48
ref|YP_318073.1|  hypothetical protein Nwi_1460 [Nitrobacter w...    168   9e-48
ref|YP_002289103.1|  hydrolase [Oligotropha carboxidovorans OM...    168   9e-48
ref|YP_001419267.1|  beta-lactamase domain-containing protein ...    168   1e-47
ref|WP_018080159.1|  hypothetical protein [Asticcacaulis benev...    168   1e-47
ref|WP_006020564.1|  hypothetical protein [Afipia broomeae] >g...    167   1e-47
ref|WP_002711819.1|  hypothetical protein [Afipia clevelandens...    167   1e-47
ref|YP_004304011.1|  Lipoyltransferase [Polymorphum gilvum SL0...    167   2e-47
ref|WP_009736338.1|  PhnP [Bradyrhizobiaceae bacterium SG-6C] ...    166   3e-47
ref|YP_532575.1|  putative hydrolase [Rhodopseudomonas palustr...    167   3e-47
ref|WP_008969824.1|  PhnP [Bradyrhizobium sp. STM 3843] >emb|C...    166   5e-47
ref|YP_003060013.1|  beta-lactamase [Hirschia baltica ATCC 498...    166   6e-47
ref|WP_017971786.1|  hypothetical protein [alpha proteobacteri...    166   7e-47
ref|YP_003593203.1|  metal-dependent hydrolase [Caulobacter se...    166   7e-47
ref|YP_001927332.1|  beta-lactamase domain-containing protein ...    166   9e-47
ref|WP_009339474.1|  PhnP [Afipia sp. 1NLS2] >gb|EFI51923.1| h...    165   1e-46
ref|WP_019197128.1|  PhnP [Afipia birgiae]                           165   1e-46
ref|YP_004109041.1|  hypothetical protein [Rhodopseudomonas pa...    164   2e-46
ref|YP_781786.1|  putative hydrolase [Rhodopseudomonas palustr...    164   3e-46
ref|YP_005450927.1|  hypothetical protein S23_36160 [Bradyrhiz...    164   3e-46
ref|WP_019966357.1|  PhnP [Pannonibacter phragmitetus]               164   4e-46
ref|NP_948122.1|  hydrolase [Rhodopseudomonas palustris CGA009...    164   4e-46
ref|WP_002715855.1|  hypothetical protein [Afipia felis] >gb|E...    163   8e-46
ref|YP_001992099.1|  hypothetical protein Rpal_3118 [Rhodopseu...    163   1e-45
ref|WP_017483938.1|  PhnP [Methylobacterium sp. MB200]               163   1e-45
ref|WP_022734400.1|  PhnP [Thalassospira lucentensis]                162   1e-45
ref|WP_018181681.1|  hypothetical protein [Kaistia granuli]          162   2e-45
ref|WP_022695440.1|  PhnP [Ponticaulis koreensis]                    162   2e-45
ref|WP_008132150.1|  PhnP [Bradyrhizobium sp. YR681] >gb|EJN14...    162   2e-45
ref|YP_007513452.1|  conserved hypothetical protein [Bradyrhiz...    162   2e-45
ref|WP_006613931.1|  PhnP [Bradyrhizobium sp. ORS 285] >emb|CC...    162   2e-45
ref|YP_006562037.1|  metallo beta-lactamase-like protein [Phae...    162   2e-45
ref|YP_001240070.1|  hypothetical protein BBta_4098 [Bradyrhiz...    162   3e-45
ref|YP_353752.1|  PhnP-like protein [Rhodobacter sphaeroides 2...    161   3e-45
ref|WP_008189479.1|  PhnP [Labrenzia alexandrii] >gb|EEE43360....    160   3e-45
ref|WP_009157396.1|  PhnP [Thalassiobium sp. R2A62] >gb|EET463...    161   4e-45
ref|YP_569849.1|  putative hydrolase [Rhodopseudomonas palustr...    160   8e-45
ref|WP_002720857.1|  PhnP [Rhodobacter sphaeroides] >gb|EGJ221...    160   8e-45
ref|YP_005610065.1|  hypothetical protein BJ6T_52170 [Bradyrhi...    160   1e-44
ref|YP_006572245.1|  metallo beta-lactamase domain-containing ...    160   1e-44
ref|WP_009030384.1|  PhnP [Bradyrhizobium sp. ORS 375] >emb|CC...    160   1e-44
ref|WP_007591086.1|  PhnP [Bradyrhizobium sp. WSM1253] >gb|EIG...    160   1e-44
ref|YP_001205821.1|  hypothetical protein BRADO3831 [Bradyrhiz...    160   1e-44
ref|WP_018457853.1|  PhnP [Mesorhizobium sp. WSM4349]                160   1e-44
ref|WP_007610349.1|  PhnP [Bradyrhizobium sp. WSM471] >gb|EHR0...    160   1e-44
ref|WP_008960400.1|  PhnP [Bradyrhizobium sp. STM 3809] >emb|C...    160   1e-44
ref|YP_004088662.1|  metal-dependent hydrolase [Asticcacaulis ...    160   1e-44
ref|WP_019298429.1|  PhnP [Phaeobacter gallaeciensis]                159   2e-44
ref|YP_001525180.1|  metal-dependent hydrolase [Azorhizobium c...    159   2e-44
ref|WP_020057499.1|  PhnP [alpha proteobacterium SCGC AAA076-C03]    159   2e-44
ref|WP_009561842.1|  Metal-dependent hydrolases of the beta-la...    159   2e-44
ref|YP_001773159.1|  beta-lactamase-like protein [Methylobacte...    159   2e-44
ref|YP_002526394.1|  PhnP-like protein [Rhodobacter sphaeroide...    159   2e-44
ref|YP_002423260.1|  beta-lactamase-like protein [Methylobacte...    159   3e-44
ref|YP_486296.1|  putative hydrolase [Rhodopseudomonas palustr...    159   3e-44
ref|YP_002965482.1|  metal-dependent hydrolase [Methylobacteri...    159   4e-44
ref|YP_611823.1|  beta-lactamase-like protein [Ruegeria sp. TM...    158   5e-44
ref|WP_009360657.1|  metal-dependent hydrolase, beta-lactamase...    157   9e-44
ref|WP_005852683.1|  PhnP [Sulfitobacter sp. EE-36] >gb|EAP839...    157   1e-43
ref|YP_001641625.1|  beta-lactamase-like protein [Methylobacte...    157   1e-43
ref|WP_022697817.1|  PhnP [Maricaulis sp. JL2009]                    157   1e-43
ref|YP_509216.1|  beta-lactamase-like protein [Jannaschia sp. ...    157   1e-43
ref|NP_771154.1|  hypothetical protein bll4514 [Bradyrhizobium...    157   1e-43
ref|WP_018302920.1|  PhnP [Wenxinia marina]                          157   1e-43
ref|WP_004615353.1|  metal-dependent hydrolase, beta-lactamase...    157   1e-43
ref|WP_019404775.1|  hypothetical protein [Chelatococcus sp. GW1]    156   1e-43
ref|WP_008033345.1|  PhnP [Rhodobacterales bacterium HTCC2255]...    157   2e-43
ref|YP_167950.1|  hypothetical protein SPO2743 [Ruegeria pomer...    157   2e-43
ref|YP_001166765.1|  beta-lactamase domain-containing protein ...    157   2e-43
ref|YP_003070611.1|  metal-dependent hydrolase [Methylobacteri...    157   2e-43
ref|WP_008207676.1|  PhnP [Roseobacter sp. SK209-2-6] >gb|EBA1...    156   2e-43
ref|WP_009826686.1|  PhnP [Sulfitobacter sp. NAS-14.1] >gb|EAP...    156   2e-43
ref|WP_008229422.1|  PhnP [Roseobacter sp. GAI101] >gb|EEB8651...    156   3e-43
ref|WP_008546662.1|  PhnP [Pseudovibrio sp. JE062] >gb|EEA9649...    156   4e-43
ref|WP_018641959.1|  PhnP [Bradyrhizobium japonicum]                 155   5e-43
ref|WP_008560990.1|  PhnP [Ruegeria sp. R11] >gb|EEB71139.1| b...    155   5e-43
ref|WP_018320473.1|  PhnP [Bradyrhizobium japonicum]                 155   5e-43
ref|WP_009811203.1|  PhnP [Roseobacter sp. MED193] >gb|EAQ4722...    155   6e-43
ref|WP_021100011.1|  Metal-dependent hydrolase of the beta-lac...    155   6e-43
ref|WP_008553965.1|  PhnP [Rhodobacterales bacterium Y4I] >gb|...    155   7e-43
ref|WP_018408280.1|  PhnP [Methylocystis rosea]                      155   9e-43
ref|WP_020176078.1|  PhnP [Methyloferula stellata]                   154   1e-42
ref|WP_007254969.1|  PhnP [Oceanicola granulosus] >gb|EAR50317...    154   1e-42
ref|YP_005081676.1|  metal dependent hydrolase [Pseudovibrio s...    154   1e-42
ref|WP_007205264.1|  PhnP [Loktanella vestfoldensis] >gb|EAQ05...    154   2e-42
ref|YP_001684321.1|  hypothetical protein Caul_2696 [Caulobact...    154   2e-42
ref|YP_002130442.1|  hypothetical protein PHZ_c1602 [Phenyloba...    155   2e-42
ref|WP_007814089.1|  PhnP [Roseobacter sp. AzwK-3b] >gb|EDM715...    154   2e-42
ref|WP_008559421.1|  hypothetical protein [Bradyrhizobium sp. ...    153   4e-42
ref|WP_008837831.1|  PhnP [Mesorhizobium alhagi] >gb|EHK55240....    153   6e-42
ref|YP_002549551.1|  metal dependent hydrolase [Agrobacterium ...    153   6e-42
ref|WP_008757634.1|  PhnP [Rhodobacteraceae bacterium KLH11] >...    153   6e-42
ref|WP_005614840.1|  beta-lactamase-like protein [Ruegeria mob...    152   8e-42
ref|NP_420628.1|  hypothetical protein CC_1821 [Caulobacter cr...    152   9e-42
ref|YP_007705670.1|  metallo-beta-lactamase-like protein [Octa...    152   1e-41
ref|YP_007914277.1|  metal-dependent hydrolase [Hyphomicrobium...    152   1e-41
ref|WP_008335167.1|  PhnP [Maritimibacter alkaliphilus] >gb|EA...    152   1e-41
ref|WP_009175683.1|  PhnP [Silicibacter sp. TrichCH4B] >gb|EEW...    152   2e-41
ref|YP_003693697.1|  metal-dependent hydrolase [Starkeya novel...    152   2e-41
ref|WP_008280127.1|  PhnP [Roseovarius sp. TM1035] >gb|EDM3289...    151   2e-41
ref|YP_007700145.1|  metallo-beta-lactamase-like protein [Octa...    151   2e-41
ref|WP_019955065.1|  PhnP [Loktanella vestfoldensis]                 151   2e-41
ref|WP_008517513.1|  PhnP [alpha proteobacterium IMCC14465] >g...    151   2e-41
ref|YP_683640.1|  hypothetical protein RD1_3469 [Roseobacter d...    151   3e-41
ref|WP_009505808.1|  PhnP [Citreicella sp. 357] >gb|EIE49927.1...    151   3e-41
ref|WP_007197335.1|  PhnP [Hoeflea phototrophica] >gb|EDQ32831...    151   4e-41
ref|WP_022712074.1|  beta-lactamase [Pseudochrobactrum sp. AO18b]    151   4e-41
ref|WP_018631987.1|  hypothetical protein [Meganema perideroedes]    151   4e-41
ref|WP_018265378.1|  PhnP [Methylosinus sp. LW4]                     150   5e-41
ref|YP_001532265.1|  beta-lactamase domain-containing protein ...    150   5e-41
ref|WP_006466898.1|  beta-lactamase [Ochrobactrum intermedium]...    150   5e-41
ref|YP_006590332.1|  beta-lactamase domain-containing protein ...    150   5e-41
ref|YP_001370626.1|  beta-lactamase domain-containing protein ...    150   5e-41
ref|WP_008236687.1|  PhnP [Roseobacter sp. CCS2] >gb|EBA10685....    150   5e-41
ref|WP_018687871.1|  hypothetical protein [Ahrensia kielensis]       150   7e-41
ref|WP_007120114.1|  PhnP [Oceanibulbus indolifex] >gb|EDQ0435...    150   8e-41
ref|WP_007667939.1|  PhnP [Caulobacter sp. AP07] >gb|EJL33253....    149   1e-40
ref|WP_008385138.1|  PhnP [Rhodovulum sp. PH10] >gb|EJW12120.1...    150   1e-40
ref|YP_001832654.1|  metal-dependent hydrolase [Beijerinckia i...    149   2e-40
ref|WP_010660028.1|  beta-lactamase [Ochrobactrum anthropi]          149   2e-40
ref|WP_003502721.1|  PhnP [Agrobacterium tumefaciens] >gb|EHH0...    149   2e-40
ref|WP_009828774.1|  PhnP [Rhodobacteraceae bacterium HTCC2083...    149   2e-40
ref|WP_020012508.1|  PhnP [Agrobacterium sp. 224MFTsu3.1]            149   2e-40
ref|WP_022673771.1|  beta-lactamase [Sphingopyxis baekryungensis]    149   2e-40
ref|YP_004691591.1|  metallo-beta-lactamase-like protein [Rose...    149   2e-40
ref|WP_007425648.1|  PhnP [Oceaniovalibus guishaninsula] >gb|E...    149   2e-40
ref|WP_021585197.1|  beta-lactamase [Ochrobactrum sp. EGD-AQ16...    149   3e-40
ref|YP_002360873.1|  beta-lactamase domain-containing protein ...    149   3e-40
ref|WP_020086617.1|  hypothetical protein [Hyphomicrobium zava...    148   3e-40
ref|WP_018899858.1|  PhnP [Rhizobium sp. 2MFCol3.1]                  149   3e-40
ref|WP_003610737.1|  PhnP [Methylosinus trichosporium] >gb|EFH...    148   3e-40
ref|WP_019566273.1|  PhnP [Agrobacterium sp. 10MFCol1.1]             147   3e-40
ref|WP_006470520.1|  beta-lactamase domain-containing protein ...    148   4e-40
ref|WP_005856825.1|  PhnP [Sagittula stellata] >gb|EBA09282.1|...    148   5e-40
ref|YP_004899198.1|  metal-dependent hydrolase [Pelagibacteriu...    148   6e-40
ref|WP_005983978.1|  PhnP [Ruegeria lacuscaerulensis] >gb|EEX1...    147   8e-40
ref|YP_005603783.1|  hypothetical protein [Brucella melitensis...    147   1e-39
ref|WP_006226375.1|  hypothetical protein [Brucella abortus] >...    147   1e-39
ref|YP_004278711.1|  metal dependent hydrolase [Agrobacterium ...    147   1e-39
ref|YP_006758521.1|  metallo-beta-lactamase family protein [al...    147   1e-39
ref|WP_018063240.1|  hypothetical protein [Martelella mediterr...    145   1e-39
ref|YP_003855410.1|  hydrolase [Parvularcula bermudensis HTCC2...    146   1e-39
ref|NP_354500.2|  metal dependent hydrolase [Agrobacterium fab...    147   1e-39
ref|WP_006111321.1|  hypothetical protein [Brucella abortus] >...    147   2e-39
ref|YP_003106927.1|  metallo-beta-lactamase family protein [Br...    146   2e-39
ref|NP_539902.1|  PHNP protein [Brucella melitensis bv. 1 str....    146   2e-39
ref|NP_698005.1|  hypothetical protein BR0997 [Brucella suis 1...    146   2e-39
ref|WP_006316212.1|  PhnP [Agrobacterium sp. ATCC 31749] >gb|E...    146   2e-39
ref|WP_006199812.1|  PhnP [Mesorhizobium amorphae] >gb|EHH1379...    146   2e-39
pdb|3PY6|A  Chain A, Crystal Structure Of A Beta-Lactamase-Lik...    146   2e-39
ref|WP_020043656.1|  PhnP [Salipiger mucosus] >gb|EPX82232.1| ...    146   2e-39
ref|WP_020399009.1|  hypothetical protein [Kordiimonas gwangya...    145   2e-39
ref|WP_018391134.1|  PhnP [Xanthobacteraceae]                        146   2e-39
ref|WP_008186126.1|  PhnP [Rhodobacteraceae bacterium HTCC2150...    146   2e-39
ref|WP_008935758.1|  beta-lactamase [Brucella] >gb|EEZ32918.1|...    146   2e-39
pdb|3MD7|A  Chain A, Crystal Structure Of A Beta-Lactamase-Lik...    147   2e-39
ref|WP_006174172.1|  beta-lactamase [Brucella] >gb|EEX90318.1|...    146   3e-39
ref|WP_003496036.1|  PhnP [Agrobacterium tumefaciens] >gb|EGP5...    146   3e-39
ref|YP_756681.1|  beta-lactamase-like protein [Maricaulis mari...    146   4e-39
ref|WP_009812197.1|  PhnP [Roseovarius nubinhibens] >gb|EAP767...    145   4e-39
ref|WP_004688330.1|  beta-lactamase [Brucella neotomae] >gb|EE...    145   4e-39
ref|WP_003515244.1|  PhnP [Agrobacterium tumefaciens] >gb|EHJ9...    144   5e-39
ref|WP_009817915.1|  PhnP [Roseovarius sp. 217] >gb|EAQ23944.1...    145   5e-39
ref|YP_004012657.1|  metal-dependent hydrolase [Rhodomicrobium...    145   5e-39
ref|YP_003755855.1|  metal-dependent hydrolase [Hyphomicrobium...    145   5e-39
ref|WP_007799145.1|  PhnP [Pelagibaca bermudensis] >gb|EAU4734...    145   6e-39
ref|WP_008029695.1|  PhnP [Rhodobacter sp. SW2] >gb|EEW25499.1...    145   7e-39
ref|WP_008039708.1|  PhnP [Bartonella tamiae] >gb|EJF88834.1| ...    145   7e-39
ref|WP_018324818.1|  hypothetical protein [Rhizobium giardinii]      145   7e-39
ref|WP_010442739.1|  PhnP [Ruegeria sp. TW15]                        144   8e-39
ref|WP_022702832.1|  PhnP [Pseudorhodobacter ferrugineus]            144   1e-38
ref|WP_007755085.1|  PhnP [Rhizobium sp. CF080] >gb|EJL72506.1...    144   1e-38
ref|YP_008632407.1|  conserved hypothetical protein [Rhizobium...    144   1e-38
ref|WP_021098568.1|  Metal-dependent hydrolase of the beta-lac...    144   1e-38
ref|WP_010137952.1|  PhnP [Oceanicola sp. S124]                      144   2e-38
ref|YP_005188812.1|  Metal dependent hydrolase [Sinorhizobium ...    144   2e-38
ref|WP_009571419.1|  PhnP [Celeribacter baekdonensis] >gb|EKE7...    144   2e-38
ref|WP_008129275.1|  PhnP [Phyllobacterium sp. YR531] >gb|EJM9...    144   2e-38
ref|WP_003166936.1|  metallo-beta-lactamase family protein [Br...    144   2e-38
ref|YP_004749304.1|  metal-dependent hydrolase of the beta-lac...    143   2e-38
ref|WP_003523686.1|  metal dependent hydrolase [Agrobacterium ...    143   3e-38
ref|WP_021776441.1|  histidine ammonia-lyase protein [alpha pr...    143   3e-38
ref|YP_004675825.1|  metal-dependent hydrolase [Hyphomicrobium...    143   4e-38
ref|WP_009209652.1|  PhnP [Aurantimonas manganoxydans] >gb|EAS...    143   4e-38
ref|YP_674145.1|  beta-lactamase-like protein [Chelativorans s...    143   4e-38
ref|WP_009800875.1|  hypothetical protein [Oceanicaulis sp. HT...    142   4e-38
ref|WP_022727018.1|  PhnP [Fodinicurvata sediminis]                  142   4e-38
ref|WP_008875771.1|  putative hydrolase [Mesorhizobium metalli...    142   7e-38
ref|WP_018481909.1|  PhnP [Rhizobium leguminosarum]                  142   8e-38
ref|YP_002826121.1|  metal dependent hydrolase [Sinorhizobium ...    142   9e-38
ref|YP_007333754.1|  metal dependent hydrolase [Rhizobium trop...    142   9e-38
ref|WP_016921099.1|  PhnP [Methylocystis parvus]                     142   1e-37
ref|WP_018697950.1|  hypothetical protein [Amorphus coralli]         142   1e-37
ref|WP_008885839.1|  PhnP [Citreicella sp. SE45] >gb|EEX15881....    142   1e-37
ref|NP_102217.1|  hydrolase [Mesorhizobium loti MAFF303099] >r...    142   1e-37
ref|WP_009805927.1|  PhnP [Oceanicola batsensis] >gb|EAQ04172....    142   1e-37
ref|WP_007874891.1|  hypothetical protein [Ochrobactrum sp. CD...    142   1e-37
ref|YP_002544540.1|  metal-dependent hydrolase [Agrobacterium ...    141   1e-37
ref|WP_018072116.1|  PhnP [Rhizobium leguminosarum]                  142   1e-37
ref|WP_009463341.1|  PhnP [Ahrensia sp. R2A130] >gb|EFL90266.1...    141   2e-37
ref|YP_002219556.1|  beta-lactamase domain-containing protein ...    141   2e-37
ref|WP_017504814.1|  PhnP [alpha proteobacterium L41A]               141   2e-37
ref|YP_006399337.1|  octanoyltransferase LipB [Sinorhizobium f...    141   2e-37
ref|WP_017964346.1|  PhnP [Rhizobium leguminosarum]                  141   2e-37
ref|WP_007696065.1|  PhnP [Rhizobium sp. AP16] >gb|EJK81816.1|...    141   2e-37
ref|WP_007066502.1|  PhnP [Fulvimarina pelagi] >gb|EAU42528.1|...    141   2e-37
ref|WP_007629066.1|  PhnP [Rhizobium sp. CCGE 510] >gb|EJT0528...    141   2e-37
ref|WP_018147299.1|  hypothetical protein [Henriciella marina]       141   3e-37
ref|WP_007816505.1|  PhnP [Rhizobium sp. CF142] >gb|EJJ29513.1...    140   3e-37
ref|WP_022699494.1|  PhnP [Oceanicaulis alexandrii]                  141   3e-37
ref|YP_003064627.1|  metal-dependent hydrolase protein [Candid...    140   3e-37
ref|YP_004784226.1|  metallo-beta-lactamase family protein [Ac...    140   3e-37
ref|WP_007557388.1|  metal-dependent hydrolase protein [Candid...    140   3e-37
ref|WP_007532550.1|  PhnP [Rhizobium mesoamericanum] >emb|CCM7...    140   4e-37
ref|WP_003164885.1|  PhnP [Brevundimonas diminuta] >gb|EGF9447...    140   4e-37
ref|WP_018494598.1|  PhnP [Rhizobium leguminosarum]                  140   5e-37
ref|WP_018855057.1|  PhnP [Rhizobium sp. 42MFCr.1]                   140   5e-37
ref|WP_018239842.1|  PhnP [Rhizobium sp. BR816]                      139   6e-37
ref|WP_003586409.1|  PhnP [Rhizobium leguminosarum] >gb|EJB026...    140   6e-37
ref|WP_003573086.1|  PhnP [Rhizobium leguminosarum] >gb|EJC726...    139   9e-37
ref|WP_018242062.1|  PhnP [Rhizobium]                                139   1e-36
ref|YP_469665.1|  metal-dependent hydrolase [Rhizobium etli CF...    139   1e-36
ref|WP_008526349.1|  PhnP [Rhizobium sp. Pop5] >gb|EJZ21597.1|...    139   1e-36
ref|YP_003818925.1|  hypothetical protein Bresu_1991 [Brevundi...    139   1e-36
ref|YP_768056.1|  hypothetical protein RL2471 [Rhizobium legum...    139   1e-36
ref|WP_017988376.1|  PhnP [Rhizobium leguminosarum]                  139   1e-36
ref|WP_003539765.1|  PhnP [Rhizobium leguminosarum] >gb|EJC664...    139   1e-36
ref|WP_008258962.1|  PhnP [Brevundimonas sp. BAL3] >gb|EDX7904...    139   1e-36
ref|YP_003964836.1|  beta-lactamase [Ketogulonicigenium vulgar...    139   2e-36
ref|WP_020049990.1|  PhnP [Rhizobium leguminosarum]                  139   2e-36
ref|WP_017960505.1|  PhnP [Rhizobium leguminosarum]                  139   2e-36
ref|YP_002508849.1|  beta-lactamase domain-containing protein ...    138   2e-36
ref|YP_001978374.1|  metal-dependent hydrolase [Rhizobium etli...    139   2e-36
ref|WP_010029160.1|  probable metal-dependent hydrolase protei...    137   2e-36
ref|WP_017994102.1|  PhnP [Rhizobium leguminosarum]                  139   2e-36
ref|WP_010392723.1|  PhnP [Paracoccus sp. TRP]                       138   2e-36
ref|YP_002975807.1|  beta-lactamase [Rhizobium leguminosarum b...    139   2e-36
ref|WP_009449477.1|  PhnP [Nitratireductor indicus] >gb|EKF436...    138   2e-36
ref|WP_006274377.1|  PhnP [Asticcacaulis biprosthecium] >gb|EG...    138   2e-36
ref|WP_010297470.1|  hypothetical protein [Candidatus Odyssell...    138   2e-36
ref|YP_032258.1|  hypothetical protein BQ06070 [Bartonella qui...    138   2e-36
ref|YP_003577412.1|  metallo-beta-lactamase [Rhodobacter capsu...    138   2e-36
ref|YP_006665024.1|  hypothetical protein RM11_0579 [Bartonell...    138   3e-36
ref|YP_002281311.1|  beta-lactamase [Rhizobium leguminosarum b...    138   3e-36
ref|WP_020185327.1|  hypothetical protein [Hyphomicrobium sp. 99]    138   3e-36
ref|WP_007793506.1|  PhnP [Rhizobium sp. CF122] >gb|EJL54395.1...    138   3e-36
ref|WP_016553942.1|  hypothetical protein [Rhizobium grahamii]...    138   3e-36
ref|WP_019171102.1|  PhnP [Pseudaminobacter salicylatoxidans]        138   3e-36
ref|WP_007009864.1|  PhnP [Nitratireductor aquibiodomus] >gb|E...    138   3e-36
ref|WP_004854395.1|  PhnP [Bartonella doshiae] >gb|EJF82205.1|...    138   3e-36
ref|WP_018047880.1|  hypothetical protein [Nitrospina sp. AB-6...    136   4e-36
ref|WP_010413470.1|  beta-lactamase [Citromicrobium sp. JLT1363]     137   4e-36
ref|WP_007606615.1|  PhnP [Rhizobium sp. PDO1-076] >gb|EHS4975...    137   5e-36
ref|YP_004062832.1|  metal-dependent hydrolase protein [Candid...    137   5e-36
ref|YP_004142957.1|  hydrolase [Mesorhizobium ciceri biovar bi...    137   6e-36
ref|WP_003579324.1|  PhnP [Rhizobium leguminosarum] >gb|EJC793...    137   6e-36
ref|WP_019995229.1|  hypothetical protein [Aureimonas ureilytica]    137   6e-36
ref|WP_010043384.1|  hydrolase [Gemmata obscuriglobus]               137   8e-36
ref|WP_009996015.1|  probable metal-dependent hydrolase protei...    137   9e-36
ref|YP_007305868.1|  metal-dependent hydrolase, beta-lactamase...    137   9e-36
ref|YP_004613035.1|  hydrolase [Mesorhizobium opportunistum WS...    137   1e-35
ref|WP_017927194.1|  hypothetical protein [Loktanella hongkong...    137   1e-35
ref|WP_019858054.1|  PhnP [Mesorhizobium loti]                       137   1e-35
emb|CCF19514.1|  Metal dependent hydrolase [Rhizobium sp.]           137   1e-35
ref|WP_006727695.1|  PhnP [Agrobacterium albertimagni] >gb|EKF...    137   1e-35
ref|WP_010238132.1|  beta-lactamase [Citromicrobium bathyomari...    136   1e-35
ref|YP_006371104.1|  metallo-beta-lactamase superfamily [Tistr...    136   1e-35
ref|WP_006333560.1|  putative hydrolase [Mesorhizobium sp. STM...    136   1e-35
ref|WP_006589651.1|  PhnP [Bartonella birtlesii] >gb|EJF76973....    136   2e-35
ref|WP_018047052.1|  hypothetical protein [Nitrospina sp. AB-6...    135   2e-35
ref|WP_022706828.1|  PhnP [Paracoccus zeaxanthinifaciens]            136   2e-35
ref|WP_017196428.1|  PhnP [Bartonella birtlesii]                     136   2e-35
ref|WP_017952797.1|  hypothetical protein [Nitrospina sp. SCGC...    134   2e-35
ref|YP_915935.1|  beta-lactamase domain-containing protein [Pa...    135   3e-35
ref|YP_002972029.1|  putative PhnP protein [Bartonella grahami...    135   3e-35
ref|WP_010703752.1|  PhnP protein [Bartonella schoenbuchensis]...    135   3e-35
ref|WP_017671184.1|  hypothetical protein [Blastomonas sp. AAP53]    135   4e-35
ref|WP_003051683.1|  beta-lactamase-like protein [Sphingopyxis...    134   4e-35
ref|WP_008599922.1|  Metal-dependent hydrolases of the beta-la...    134   4e-35
ref|WP_021691794.1|  putative hydrolase [Novosphingobium tarda...    134   5e-35
ref|WP_018094907.1|  PhnP [Sinorhizobium meliloti]                   135   6e-35
ref|YP_001326973.1|  beta-lactamase domain-containing protein ...    135   6e-35
ref|WP_019833278.1|  hypothetical protein [Sphingomonas sp. PR...    134   9e-35
ref|WP_005865237.1|  PhnP [Bartonella alsatica] >gb|EJF75877.1...    134   9e-35
ref|WP_018985109.1|  hypothetical protein [Methylophilus methy...    134   9e-35
ref|WP_004859968.1|  PhnP [Bartonella taylorii] >gb|EJF94139.1...    134   9e-35
ref|WP_010702429.1|  PhnP protein [Bartonella bovis] >gb|ENN93...    134   1e-34
ref|YP_005836120.1|  beta-lactamase [Halanaerobium praevalens ...    134   1e-34
ref|WP_020178543.1|  hypothetical protein [Methylopila sp. M107]     134   1e-34
ref|YP_033655.1|  hypothetical protein BH08500 [Bartonella hen...    134   1e-34
emb|CBI77805.1|  conserved hypothetical protein [Bartonella ro...    134   1e-34
ref|WP_019516767.1|  hypothetical protein [Sphingomonas sp. Mn...    133   1e-34
ref|WP_022715609.1|  PhnP [Rhizobium mongolense]                     134   1e-34
ref|NP_385705.1|  hypothetical protein SMc01194 [Sinorhizobium...    134   2e-34
ref|WP_003528323.1|  PhnP [Sinorhizobium meliloti] >gb|EHK7813...    134   2e-34
ref|YP_007190176.1|  Metal-dependent hydrolases of the beta-la...    134   2e-34
ref|YP_001229340.1|  beta-lactamase domain-containing protein ...    133   2e-34
ref|WP_004863875.1|  PhnP [Bartonella vinsonii] >gb|EJF87909.1...    133   2e-34
ref|YP_006715853.1|  metal-dependent hydrolase [Pelobacter car...    133   2e-34
emb|CBI82220.1|  conserved hypothetical protein [Bartonella sc...    133   2e-34
ref|WP_019961794.1|  hypothetical protein [Woodsholea maritima]      133   3e-34
ref|WP_008597476.1|  PhnP [Nitratireductor pacificus] >gb|EKF1...    132   3e-34
ref|WP_019223326.1|  PhnP [Bartonella rattaustraliani]               133   3e-34
ref|WP_004865683.1|  PhnP [Bartonella vinsonii] >gb|EJF98533.1...    133   3e-34
ref|WP_006924458.1|  PhnP [Bartonella washoensis] >gb|EJF77965...    133   3e-34
ref|YP_001609535.1|  hypothetical protein Btr_1169 [Bartonella...    132   3e-34
ref|WP_006925298.1|  PhnP [Bartonella washoensis] >gb|EJF85979...    132   4e-34
ref|YP_004159023.1|  hypothetical protein BARCL_0764 [Bartonel...    132   4e-34
ref|WP_017269882.1|  PhnP [Sinorhizobium meliloti]                   132   4e-34
ref|YP_989107.1|  metallo-beta-lactamase family protein [Barto...    132   4e-34
emb|CBI79275.1|  conserved hypothetical protein [Bartonella sp...    132   4e-34
emb|CBI80861.1|  conserved hypothetical protein [Bartonella sp...    132   5e-34
ref|WP_018037104.1|  hypothetical protein [alpha proteobacteri...    131   7e-34
ref|WP_005773548.1|  PhnP [Bartonella elizabethae] >gb|EJF8483...    132   7e-34
ref|WP_022197227.1|  beta-lactamase domain protein [Akkermansi...    131   8e-34
ref|WP_010701199.1|  PhnP protein [Bartonella bovis] >gb|ENN92...    131   9e-34
ref|WP_005488788.1|  Metal-dependent hydrolases of the beta-la...    131   9e-34
ref|WP_008066499.1|  beta-lactamase [Novosphingobium nitrogeni...    131   1e-33
ref|YP_001414379.1|  beta-lactamase-like protein [Parvibaculum...    131   1e-33
ref|WP_007346695.1|  PhnP [Bartonella rattimassiliensis] >gb|E...    131   1e-33
ref|YP_001953556.1|  beta-lactamase [Geobacter lovleyi SZ] >re...    131   1e-33
ref|YP_007462654.1|  PhnP protein [Bartonella vinsonii subsp. ...    131   1e-33
ref|WP_018427887.1|  hypothetical protein [Hoeflea sp. 108]          130   1e-33
ref|YP_001877492.1|  beta-lactamase [Akkermansia muciniphila A...    130   2e-33
ref|WP_010705274.1|  PhnP protein [Bartonella vinsonii] >gb|EN...    131   2e-33
ref|WP_020054818.1|  hypothetical protein [alpha proteobacteri...    130   2e-33
ref|WP_009363486.1|  beta-lactamase [Brucella sp. BO2] >gb|EFM...    128   2e-33
ref|WP_020707329.1|  hypothetical protein [Acidobacteriaceae b...    130   2e-33
ref|YP_616308.1|  beta-lactamase-like protein [Sphingopyxis al...    130   2e-33
ref|YP_903063.1|  beta-lactamase domain-containing protein [Pe...    130   3e-33
ref|WP_008853699.1|  hydrolase [Commensalibacter intestini] >g...    130   3e-33
ref|WP_021692070.1|  metal-dependent hydrolases of the beta-la...    130   4e-33
ref|YP_002536844.1|  beta-lactamase [Geobacter daltonii FRC-32...    129   4e-33
ref|WP_020716479.1|  hypothetical protein [Acidobacteriaceae b...    129   4e-33
ref|WP_009539990.1|  Metal-dependent hydrolase [Caenispirillum...    129   5e-33
ref|WP_022690584.1|  beta-lactamase [Sphingomonas-like bacteri...    129   5e-33
ref|WP_018747074.1|  hypothetical protein [Chitiniphilus shina...    129   6e-33
ref|YP_004823973.1|  beta-lactamase domain-containing protein ...    129   7e-33
ref|YP_003289499.1|  beta-lactamase domain-containing protein ...    129   8e-33
ref|WP_017999866.1|  PhnP [Paracoccus sp. N5]                        129   8e-33
ref|YP_002297398.1|  metallo-beta-lactamase superfamily [Rhodo...    129   9e-33
ref|WP_007477289.1|  PhnP [Bartonella melophagi] >gb|EJF90204....    129   1e-32
ref|WP_022571983.1|  metal-dependent hydrolase, beta-lactamase...    128   1e-32
ref|WP_009853036.1|  beta-lactamase [beta proteobacterium KB13...    128   1e-32
ref|WP_020181887.1|  hypothetical protein [Methylotenera sp. 1...    128   1e-32
ref|WP_017930565.1|  hypothetical protein [Robiginitomaculum a...    128   1e-32
ref|WP_007553323.1|  PhnP [Bartonella sp. DB5-6] >gb|EJF77364....    128   2e-32
ref|WP_021236624.1|  beta-lactamase [Sphingobium quisquiliarum...    128   2e-32
ref|WP_006928067.1|  beta-lactamase domain-containing protein ...    128   2e-32
ref|YP_004835151.1|  putative hydrolase [Sphingobium sp. SYK-6...    127   2e-32
ref|YP_002756350.1|  metallo-beta-lactamase family protein [Ac...    127   3e-32
ref|WP_006557607.1|  hydrolase [Acetobacter tropicalis] >dbj|G...    128   3e-32
ref|YP_004197174.1|  beta-lactamase domain-containing protein ...    127   3e-32
ref|WP_020717603.1|  hypothetical protein [Acidobacteriaceae b...    127   3e-32
gb|EKE10025.1|  hypothetical protein ACD_16C00084G0003 [uncult...    127   3e-32
ref|WP_021131271.1|  beta-lactamase superfamily hydrolase [Pha...    127   3e-32
ref|WP_005011595.1|  Beta-lactamase domain protein [Nitrospina...    126   5e-32
ref|WP_007164237.1|  beta-lactamase [Erythrobacter sp. NAP1] >...    127   5e-32
ref|YP_008403616.1|  beta-lactamase domain protein [Paracoccus...    126   8e-32
ref|WP_008682398.1|  metallo-beta-lactamase family protein [Rh...    126   8e-32
ref|WP_010216999.1|  beta-lactamase [Sphingomonas sp. PAMC 26621]    126   9e-32
ref|WP_022000582.1|  uncharacterized protein [Acetobacter sp. ...    126   9e-32
ref|YP_003995300.1|  beta-lactamase [Halanaerobium hydrogenifo...    125   1e-31
gb|EDZ38709.1|  Putative metallo-beta-lactamase family protein...    126   1e-31
ref|WP_017978825.1|  hypothetical protein [Sphingomonas melonis]     124   2e-31
ref|WP_007675161.1|  Beta-lactamase-like protein [alpha proteo...    125   2e-31
ref|YP_004867485.1|  metal-dependent hydrolase [Gluconacetobac...    125   2e-31
ref|YP_006891383.1|  metal-dependent hydrolase [Geobacter sulf...    125   2e-31
ref|WP_019882475.1|  hypothetical protein [Methylophilus sp. 42]     124   2e-31
ref|WP_020593557.1|  hypothetical protein [Kiloniella laminariae]    125   3e-31
ref|WP_002731176.1|  PhnP [Phaeospirillum molischianum] >emb|C...    124   3e-31
ref|WP_021317818.1|  beta-lactamase [Sphingobium ummariense] >...    124   3e-31
ref|YP_006766225.1|  metal-dependent hydrolase [Leptospirillum...    124   3e-31
ref|YP_004741057.1|  lipoate-protein ligase B [Capnocytophaga ...    124   4e-31
ref|YP_007461316.1|  PhnP protein [Bartonella australis Aust/N...    124   4e-31
ref|WP_010338746.1|  beta-lactamase [Sphingobium yanoikuyae]         124   4e-31
ref|WP_018979590.1|  hypothetical protein [Saccharibacter flor...    124   5e-31
ref|WP_007705439.1|  beta-lactamase [Sphingobium sp. AP49] >gb...    124   5e-31
ref|WP_020468277.1|  hypothetical protein [Zavarzinella formosa]     124   6e-31
ref|WP_019915246.1|  hypothetical protein [Methylophilus sp. 1]      124   7e-31
ref|WP_010402769.1|  beta-lactamase [Sphingomonas echinoides]        124   7e-31
ref|WP_020021131.1|  hypothetical protein [alpha proteobacteri...    124   7e-31
ref|YP_002137159.1|  beta-lactamase superfamily metal-dependen...    123   8e-31
ref|WP_002680784.1|  beta-lactamase [Capnocytophaga sputigena]...    123   8e-31
ref|WP_004207126.1|  hypothetical protein [Sphingobium yanoiku...    123   1e-30
ref|WP_022686377.1|  beta-lactamase [Sphingomonas phyllosphaerae]    123   1e-30
ref|WP_008828542.1|  beta-lactamase [Sphingomonas sp. LH128] >...    123   1e-30
ref|WP_019957140.1|  hypothetical protein [Vitreoscilla sterco...    123   1e-30
ref|WP_009413370.1|  metallo-beta-lactamase domain protein [Ca...    123   1e-30
ref|WP_020614046.1|  beta-lactamase [Spirochaeta bajacaliforni...    123   1e-30
ref|YP_006719730.1|  metal-dependent hydrolase [Geobacter meta...    122   1e-30
ref|WP_010163829.1|  beta-lactamase [Sphingomonas sp. PAMC 26617]    122   2e-30
ref|WP_009821643.1|  beta-lactamase [Sphingomonas sp. SKA58] >...    123   2e-30
ref|WP_010508014.1|  hydrolase [Gluconacetobacter europaeus]         122   2e-30
ref|WP_017669171.1|  hypothetical protein [Sandarakinorhabdus ...    122   2e-30
ref|WP_019086179.1|  hydrolase [Gluconacetobacter europaeus]         122   2e-30
ref|WP_022724811.1|  beta-lactamase [alpha proteobacterium SCG...    122   2e-30
ref|WP_018943821.1|  beta-lactamase [Polaribacter franzmannii]       122   2e-30
ref|WP_010186435.1|  beta-lactamase [Sphingomonas sp. PAMC 26605]    122   2e-30
ref|YP_004843472.1|  PhnP protein [Flavobacterium branchiophil...    122   2e-30
ref|YP_458136.1|  metal-dependent hydrolase [Erythrobacter lit...    122   3e-30
ref|YP_004269145.1|  beta-lactamase [Planctomyces brasiliensis...    122   3e-30
ref|WP_009864659.1|  COG1235: Metal-dependent hydrolases of th...    120   3e-30
ref|WP_006832130.1|  beta-lactamase [Erythrobacter sp. SD-21] ...    122   3e-30
ref|YP_007205026.1|  beta-lactamase superfamily metal-dependen...    122   3e-30
ref|YP_003550687.1|  beta-lactamase-like protein [Candidatus P...    122   3e-30
ref|WP_006002829.1|  beta-lactamase [Desulfuromonas acetoxidan...    122   4e-30
ref|WP_016744407.1|  beta-lactamase [Sphingomonas wittichii]         121   4e-30
ref|WP_022678864.1|  beta-lactamase [Sandarakinorhabdus limnop...    122   4e-30
ref|YP_004218630.1|  metallo-beta-lactamase family protein [Gr...    121   5e-30
ref|WP_020466775.1|  hypothetical protein [Singulisphaera acid...    122   5e-30
ref|YP_007378189.1|  metal-dependent hydrolase, beta-lactamase...    121   6e-30
ref|YP_004552914.1|  PhnP protein [Sphingobium chlorophenolicu...    121   6e-30
ref|WP_009965877.1|  metallo-beta-lactamase [Verrucomicrobium ...    121   6e-30
ref|NP_953511.1|  metal-dependent hydrolase [Geobacter sulfurr...    121   7e-30
ref|YP_006423326.1|  beta-lactamase superfamily metal-dependen...    121   7e-30
ref|WP_009415515.1|  metallo-beta-lactamase domain protein [Ca...    120   7e-30
ref|WP_019014292.1|  hypothetical protein [Elioraea tepidiphila]     121   8e-30
ref|WP_020058985.1|  hypothetical protein [alpha proteobacteri...    120   1e-29
ref|WP_008725633.1|  metal-dependent hydrolase [Brachyspira ha...    120   1e-29
ref|WP_022678465.1|  beta-lactamase [Novosphingobium sp. B-7]        120   1e-29
ref|WP_020383107.1|  hypothetical protein [Candidatus Poribact...    120   1e-29
ref|WP_019643803.1|  hypothetical protein [Novispirillum iters...    120   1e-29
ref|YP_005469451.1|  hypothetical protein LFE_1640 [Leptospiri...    120   1e-29
ref|WP_010418787.1|  hydrolase [Anaerophaga thermohalophila]         120   2e-29
ref|WP_019369373.1|  hypothetical protein [Sphingomonas sp. AT...    119   2e-29
ref|WP_018278954.1|  hypothetical protein [Capnocytophaga cyno...    120   2e-29
ref|YP_003321879.1|  beta-lactamase [Thermobaculum terrenum AT...    119   2e-29
ref|YP_001916337.1|  beta-lactamase [Natranaerobius thermophil...    119   2e-29
ref|WP_007689144.1|  beta-lactamase [Sphingobium indicum] >gb|...    119   2e-29
ref|WP_020820867.1|  beta-lactamase [Sphingobium] >gb|EPR09833...    119   2e-29
gb|EES53189.1|  putative metallo-beta-lactamase family protein...    119   2e-29
ref|WP_020168413.1|  beta-lactamase [Methylotenera]                  119   2e-29
ref|YP_003545110.1|  PhnP protein [Sphingobium japonicum UT26S...    119   2e-29
ref|WP_016776246.1|  hydrolase [Anaerophaga thermohalophila]         119   3e-29
ref|WP_007400379.1|  hydrolase [Gluconacetobacter sp. SXCC-1] ...    119   3e-29
ref|WP_020005579.1|  beta-lactamase [Brachyspira innocens]           119   3e-29
ref|YP_001260994.1|  beta-lactamase domain-containing protein ...    119   3e-29
ref|WP_003620384.1|  hydrolase [Gluconacetobacter hansenii] >g...    119   4e-29
ref|WP_008731461.1|  metal-dependent hydrolase [Brachyspira ha...    119   5e-29
ref|WP_021826749.1|  hypothetical protein [Holospora obtusa] >...    119   5e-29
ref|WP_008615601.1|  beta-lactamase superfamily hydrolase [Mag...    119   5e-29
ref|WP_007403221.1|  beta-lactamase [Sphingomonas sp. S17] >gb...    119   5e-29
ref|YP_003634765.1|  beta-lactamase [Brachyspira murdochii DSM...    118   5e-29
ref|YP_004181534.1|  metallo-beta-lactamase family protein [Te...    119   6e-29
ref|WP_006979814.1|  metallo-beta-lactamase [Chthoniobacter fl...    118   7e-29
ref|YP_497211.1|  beta-lactamase-like protein [Novosphingobium...    118   7e-29
ref|YP_008090052.1|  Metal-dependent hydrolases of the beta-la...    118   7e-29
ref|YP_005417887.1|  Beta-lactamase-like [Rhodospirillum photo...    118   7e-29
ref|YP_003805362.1|  beta-lactamase [Spirochaeta smaragdinae D...    118   8e-29
ref|YP_002522574.1|  hypothetical protein trd_1369 [Thermomicr...    118   8e-29
ref|YP_003048567.1|  beta-lactamase domain-containing protein ...    118   8e-29
ref|WP_010666989.1|  hydrolase [Acetobacter aceti]                   118   9e-29
ref|WP_009603795.1|  beta-lactamase [SAR116 cluster alpha prot...    118   9e-29
ref|YP_002760617.1|  hypothetical protein GAU_1105 [Gemmatimon...    118   9e-29
emb|CAJ73901.1|  conserved hypothetical protein [Candidatus Ku...    118   9e-29
ref|WP_007683786.1|  beta-lactamase [Novosphingobium sp. AP12]...    118   1e-28
ref|WP_019052143.1|  beta-lactamase [Sphingobium xenophagum]         118   1e-28
ref|YP_004679838.1|  metal-dependent hydrolases of the beta-la...    117   1e-28
ref|WP_007335682.1|  phnP protein [Rhodopirellula baltica] >gb...    118   1e-28
ref|NP_870191.1|  phnP protein homolog- hydrolase [Rhodopirell...    118   1e-28
ref|WP_010514035.1|  hydrolase [Gluconacetobacter oboediens]         117   1e-28
ref|YP_003020153.1|  beta-lactamase [Geobacter sp. M21] >ref|W...    117   1e-28
ref|YP_005031627.1|  putative Metal-dependent hydrolase [Azosp...    117   1e-28
ref|WP_021958134.1|  metal-dependent hydrolase [Brachyspira sp...    117   1e-28
ref|WP_017182368.1|  beta-lactamase [Sphingobium xenophagum]         117   2e-28
ref|WP_009101477.1|  metallo-beta-lactamase family protein [Rh...    118   2e-28
ref|WP_008669902.1|  metallo-beta-lactamase family protein [Rh...    117   2e-28
ref|WP_008953333.1|  beta-lactamase [Pseudogulbenkiania ferroo...    117   2e-28
ref|WP_008994090.1|  beta-lactamase [Novosphingobium sp. Rr 2-...    117   2e-28
ref|WP_007326895.1|  hydrolase [Rhodopirellula baltica] >gb|EG...    117   2e-28
ref|WP_008660720.1|  phnP protein [Rhodopirellula europaea] >g...    117   3e-28
ref|WP_006949182.1|  Metal-dependent hydrolases of the beta-la...    117   3e-28
ref|WP_010543547.1|  beta-lactamase [Sphingomonas elodea]            117   3e-28
ref|YP_005594494.1|  metal-dependent hydrolase [Brachyspira in...    116   3e-28
ref|WP_007221394.1|  conserved hypothetical protein [planctomy...    115   3e-28
ref|WP_020677193.1|  hypothetical protein [Geopsychrobacter el...    117   3e-28
ref|WP_009867205.1|  COG1235: Metal-dependent hydrolases of th...    115   3e-28
emb|CCF99261.1|  metallo-beta-lactamase domain-containing prot...    116   3e-28
ref|WP_022653529.1|  beta-lactamase [Aquaspirillum serpens]          116   4e-28
ref|YP_005057472.1|  beta-lactamase [Granulicella mallensis MP...    116   4e-28
ref|YP_006984998.1|  PhnP protein [Gluconobacter oxydans H24] ...    116   5e-28
ref|YP_002720473.1|  metal-dependent hydrolase [Brachyspira hy...    116   5e-28
ref|YP_004845991.1|  beta-lactamase domain containing protein ...    116   5e-28
ref|YP_004535205.1|  beta-lactamase-like protein [Novosphingob...    116   6e-28
ref|WP_007282035.1|  metal-dependent hydrolase PhnP [Gluconoba...    116   6e-28
ref|YP_007614452.1|  beta-lactamase domain-containing protein ...    115   6e-28
ref|WP_021232679.1|  beta-lactamase [Novosphingobium lindanicl...    115   6e-28
ref|WP_019459841.1|  hypothetical protein [Roseomonas sp. B5]        115   7e-28
ref|WP_022843817.1|  beta-lactamase [Acidobacteriaceae bacteri...    115   8e-28
ref|WP_021348024.1|  beta-lactamase [Elizabethkingia meningose...    115   8e-28
ref|WP_007015232.1|  beta-lactamase [Novosphingobium pentaroma...    115   8e-28
ref|YP_003187676.1|  metal-dependent hydrolase PhnP [Acetobact...    115   8e-28
gb|ABX56580.1|  putative coenzyme PQQ synthesis protein G [Met...    115   8e-28
ref|WP_022827403.1|  beta-lactamase [Flavobacterium antarcticum]     115   9e-28
ref|WP_020494180.1|  hypothetical protein [Verrucomicrobium sp...    115   1e-27
ref|WP_003623518.1|  metal-dependent hydrolase PhnP [Acetobact...    115   1e-27
ref|WP_018969119.1|  hypothetical protein [Rubritalea marina]        114   1e-27
ref|YP_001940909.1|  Metal-dependent hydrolase of the beta-lac...    115   1e-27
ref|YP_003051149.1|  beta-lactamase domain-containing protein ...    115   1e-27
ref|WP_022545971.1|  hypothetical protein [Bacteroides sp. CF5...    115   1e-27
ref|WP_020150461.1|  hypothetical protein [Verrucomicrobia bac...    115   1e-27
emb|CCT60702.1|  metal-dependent hydrolase [Acetobacter pasteu...    115   1e-27
ref|YP_008393421.2|  metal-dependent hydrolase [Acetobacter pa...    115   1e-27
gb|EKD31793.1|  Phosphonate metabolism protein PhnP [unculture...    115   2e-27
ref|WP_020020421.1|  hypothetical protein [alpha proteobacteri...    114   2e-27
ref|YP_744900.1|  metal-dependent hydrolase [Granulibacter bet...    114   2e-27
ref|WP_009091878.1|  beta-lactamase [Elizabethkingia anophelis...    114   2e-27
ref|WP_008257564.1|  beta-lactamase [Flavobacteria bacterium B...    114   2e-27
ref|WP_002694033.1|  hydrolase [Microscilla marina] >gb|EAY314...    114   3e-27
ref|WP_022683173.1|  beta-lactamase [Sphingobium sp. YL23]           114   4e-27
ref|WP_002673312.1|  beta-lactamase [Capnocytophaga ochracea] ...    114   4e-27
ref|WP_017732975.1|  hypothetical protein [Nafulsella turpanen...    113   4e-27
ref|WP_008107316.1|  beta-lactamase [Methylophilales bacterium...    113   4e-27
ref|WP_009410917.1|  metallo-beta-lactamase family protein [Ca...    113   4e-27
ref|WP_006563263.1|  beta-lactamase [Oscillochloris trichoides...    113   5e-27
ref|WP_008866563.1|  beta-lactamase [Flavobacteria bacterium M...    113   5e-27
ref|YP_001234045.1|  beta-lactamase domain-containing protein ...    113   5e-27
ref|WP_007138770.1|  beta-lactamase [Flavobacterium frigoris] ...    113   5e-27
ref|WP_019090233.1|  hydrolase [Acetobacter pasteurianus]            113   5e-27
ref|WP_019898444.1|  beta-lactamase [Methylotenera mobilis]          113   6e-27
ref|YP_007233806.1|  metal-dependent hydrolase [Brachyspira pi...    113   6e-27
ref|YP_001995684.1|  beta-lactamase domain-containing protein ...    113   6e-27
ref|WP_008697809.1|  phnP protein [Rhodopirellula maiorica] >g...    114   7e-27
ref|WP_003628782.1|  hydrolase [Acetobacter pasteurianus] >dbj...    113   7e-27
ref|YP_007670742.1|  metallo-beta-lactamase superfamily protei...    113   7e-27
ref|WP_008851415.1|  hydrolase [Gluconobacter morbifer] >gb|EH...    112   8e-27
ref|WP_021225068.1|  beta-lactamase [Sphingobium lactosutens] ...    113   8e-27
ref|YP_006704256.1|  metal-dependent hydrolase [Brachyspira pi...    112   9e-27
ref|YP_006707075.1|  metal-dependent hydrolase [Brachyspira pi...    112   9e-27
ref|WP_006115223.1|  hydrolase [Acetobacter pomorum] >gb|EGE48...    112   1e-26
ref|YP_003140404.1|  metallo-beta-lactamase domain-containing ...    112   1e-26
ref|WP_016479085.1|  PhnP protein [Capnocytophaga sp. oral tax...    112   1e-26
ref|WP_008239822.1|  beta-lactamase [Imtechella halotolerans] ...    112   1e-26
ref|WP_010134922.1|  beta-lactamase [Flavobacteriaceae bacteri...    112   1e-26
ref|YP_001635003.1|  beta-lactamase domain-containing protein ...    112   1e-26
ref|YP_426786.1|  beta-lactamase-like [Rhodospirillum rubrum A...    112   1e-26
ref|WP_002647920.1|  hydrolase [Planctomyces maris] >gb|EDL579...    112   1e-26
ref|WP_021779034.1|  putative hydrolase [Dokdonia donghaensis]...    112   1e-26
ref|WP_010582074.1|  hydrolase [Schlesneria paludicola]              112   1e-26
ref|YP_003674311.1|  beta-lactamase domain-containing protein ...    112   1e-26
ref|WP_009418861.1|  metallo-beta-lactamase family protein [Ca...    112   2e-26
ref|YP_004941826.1|  PhnP protein [Flavobacterium columnare AT...    112   2e-26
ref|WP_009418142.1|  beta-lactamase [Capnocytophaga sp. oral t...    112   2e-26
ref|WP_021246619.1|  hypothetical protein [Sphingobium baderi]...    111   2e-26
ref|YP_003784914.1|  metal-dependent hydrolase [Brachyspira pi...    112   2e-26
ref|WP_010123317.1|  beta-lactamase [Sphingomonas sp. KC8]           111   2e-26
ref|WP_009780620.1|  beta-lactamase [Leeuwenhoekiella blandens...    111   2e-26
ref|WP_009421693.1|  beta-lactamase [Capnocytophaga sp. oral t...    111   2e-26
ref|WP_008945666.1|  PhnP [Oceanibaculum indicum] >gb|EKE70924...    111   3e-26
ref|WP_022835695.1|  beta-lactamase [Salisaeta longa]                111   3e-26
ref|YP_861490.1|  metallo-beta-lactamase domain-containing pro...    111   3e-26
dbj|GAD09435.1|  metal-dependent hydrolase of the beta-lactama...    111   3e-26
ref|WP_002665553.1|  beta-lactamase [Capnocytophaga gingivalis...    111   3e-26
ref|WP_008475981.1|  beta-lactamase [Nitrolancetus hollandicus...    111   3e-26
ref|YP_003284211.1|  metallo-beta-lactamase domain protein [Bl...    111   3e-26
ref|YP_005039228.1|  putative Metal-dependent hydrolase [Azosp...    111   3e-26
ref|YP_005445245.1|  putative hydrolase [Phycisphaera mikurens...    111   3e-26
ref|YP_003449002.1|  PhnP protein [Azospirillum sp. B510] >ref...    111   4e-26
ref|WP_006296315.1|  hypothetical protein [Holospora undulata]...    110   4e-26
ref|WP_020148923.1|  hypothetical protein [Verrucomicrobia bac...    111   4e-26
ref|WP_010065726.1|  beta-lactamase domain protein, partial [R...    110   5e-26
ref|WP_010501552.1|  PhnP protein [Gluconobacter frateurii]          110   5e-26
ref|YP_001602047.1|  beta-lactamase-like [Gluconacetobacter di...    110   5e-26
ref|WP_021928219.1|  putative uncharacterized protein [Alistip...    110   7e-26
ref|YP_002274448.1|  beta-lactamase domain-containing protein ...    110   7e-26
ref|WP_009641584.1|  beta-lactamase [Capnocytophaga sp. CM59] ...    110   7e-26
ref|WP_016419394.1|  hypothetical protein [Capnocytophaga gran...    110   7e-26
ref|WP_007811772.1|  beta-lactamase [Flavobacterium sp. CF136]...    110   8e-26
ref|YP_004342876.1|  metal-dependent hydrolase [Fluviicola taf...    110   9e-26
emb|CAM76685.1|  PhnP-like protein [Magnetospirillum gryphiswa...    110   1e-25
ref|YP_003256819.1|  metal-dependent hydrolase [Blattabacteriu...    109   1e-25
ref|YP_003095993.1|  Metal-dependent hydrolases of the beta-la...    109   1e-25
ref|YP_004861733.1|  beta-lactamase superfamily metal-dependen...    109   1e-25
ref|YP_003630315.1|  beta-lactamase [Planctomyces limnophilus ...    109   1e-25
ref|WP_019388734.1|  beta-lactamase [Flavobacteriaceae bacteri...    109   1e-25
ref|WP_006261054.1|  beta-lactamase [Myroides odoratimimus] >g...    109   1e-25
ref|WP_010520976.1|  beta-lactamase [Flavobacteriaceae bacteri...    109   1e-25
ref|WP_003001868.1|  hydrolase [Sphingobacterium spiritivorum]...    109   1e-25
ref|YP_444636.1|  metallo-beta-lactamase superfamily protein [...    110   1e-25
ref|YP_004041271.1|  hydrolase [Paludibacter propionicigenes W...    109   2e-25
ref|WP_017665267.1|  beta-lactamase [Porphyrobacter sp. AAP82]       109   2e-25
ref|YP_003570445.1|  metallo-beta-lactamase superfamily protei...    109   2e-25
ref|WP_008990724.1|  beta-lactamase [Galbibacter sp. ck-I2-15]...    108   2e-25
ref|WP_006259067.1|  beta-lactamase [Myroides odoratimimus] >g...    108   3e-25
ref|WP_016988676.1|  beta-lactamase [Flavobacterium sp. ACAM 123]    108   3e-25
ref|WP_006263453.1|  beta-lactamase [Myroides odoratimimus] >g...    108   3e-25
ref|YP_004251966.1|  beta-lactamase domain-containing protein ...    108   3e-25
ref|WP_009389394.1|  beta-lactamase [Capnocytophaga sp. oral t...    108   4e-25
ref|YP_153591.1|  hypothetical protein AM220 [Anaplasma margin...    108   4e-25
ref|WP_010267146.1|  PhnP protein [Anaplasma marginale]              109   4e-25
ref|WP_010262994.1|  hypothetical protein, partial [Anaplasma ...    108   4e-25
ref|YP_005357986.1|  PhnP protein [Flavobacterium indicum GPTS...    108   4e-25
ref|WP_022569205.1|  beta-lactamase, partial [Ochrobactrum int...    106   5e-25
ref|WP_010269508.1|  PhnP protein [Anaplasma marginale]              108   5e-25
ref|YP_002563300.1|  PhnP protein [Anaplasma marginale str. Fl...    108   5e-25
ref|WP_006990450.1|  beta-lactamase [Gillisia limnaea] >gb|EHQ...    108   5e-25
ref|YP_421809.1|  beta-lactamase superfamily hydrolase [Magnet...    108   5e-25
ref|WP_002651249.1|  hydrolase [Blastopirellula marina] >gb|EA...    108   5e-25
ref|WP_017508112.1|  hypothetical protein [beta proteobacteriu...    107   6e-25
ref|YP_001194788.1|  beta-lactamase domain-containing protein ...    107   6e-25
ref|YP_004661388.1|  beta-lactamase domain-containing protein ...    107   7e-25
ref|YP_004238619.1|  beta-lactamase [Weeksella virosa DSM 1692...    107   9e-25
ref|YP_004928187.1|  metal-dependent hydrolase [Blattabacteriu...    107   1e-24
ref|YP_004738490.1|  metallo-beta-lactamase superfamily protei...    107   1e-24
ref|WP_009745601.1|  beta-lactamase [Capnocytophaga sp. oral t...    107   1e-24
ref|YP_004431927.1|  beta-lactamase domain-containing protein ...    107   1e-24
gb|AAO38319.1|  Lfe137p1 [Leptospirillum ferrooxidans]               106   1e-24
ref|YP_004319077.1|  beta-lactamase [Sphingobacterium sp. 21] ...    107   1e-24
ref|WP_006794982.1|  beta-lactamase [Flavobacteria bacterium B...    106   1e-24
ref|WP_003007682.1|  hydrolase [Sphingobacterium spiritivorum]...    106   2e-24
ref|YP_004411933.1|  beta-lactamase domain-containing protein ...    107   2e-24
ref|WP_008462538.1|  beta-lactamase [Flavobacterium sp. F52] >...    106   2e-24
ref|WP_007417603.1|  metallo-beta-lactamase [Pedosphaera parvu...    107   2e-24
ref|YP_003372673.1|  beta-lactamase domain-containing protein ...    106   2e-24
ref|YP_001492809.1|  hypothetical protein A1E_05565 [Rickettsi...    106   2e-24
ref|WP_018150066.1|  hypothetical protein [Leeia oryzae]             105   2e-24
ref|WP_004570453.1|  beta-lactamase [Polaribacter] >gb|EAR1278...    106   2e-24
ref|WP_021627994.1|  metallo-beta-lactamase family protein [Ca...    107   2e-24
ref|WP_016197927.1|  Metal-dependent hydrolases of the beta-la...    106   2e-24
ref|WP_018028191.1|  hypothetical protein [Porphyromonas somerae]    106   3e-24
ref|YP_180014.1|  PhnP protein [Ehrlichia ruminantium str. Wel...    106   3e-24
ref|WP_010662800.1|  hydrolase [Marinilabilia salmonicolor]          105   3e-24
ref|WP_007002243.1|  hydrolase [Roseomonas cervicalis] >gb|EFH...    105   3e-24
ref|WP_020080359.1|  hypothetical protein [Flavobacterium sp. ...    105   4e-24
ref|YP_004177527.1|  Metal-dependent hydrolase of the beta-lac...    105   4e-24
ref|YP_007392221.1|  metallo-beta-lactamase domain protein [Bl...    105   4e-24
ref|YP_196065.1|  PhnP protein [Ehrlichia ruminantium str. Gar...    105   4e-24
ref|YP_004263424.1|  beta-lactamase domain-containing protein ...    105   4e-24
ref|YP_003716661.1|  hydrolase, metal-dependent [Croceibacter ...    105   4e-24
ref|WP_010528227.1|  hydrolase [Anaerophaga sp. HS1]                 105   5e-24
ref|WP_018128043.1|  hypothetical protein [Balneola vulgaris]        105   6e-24
ref|YP_006517653.1|  beta-lactamase [Zymomonas mobilis subsp. ...    105   6e-24
ref|YP_004166224.1|  beta-lactamase [Cellulophaga algicola DSM...    105   7e-24
ref|WP_006265176.1|  beta-lactamase [Myroides odoratimimus] >g...    105   7e-24
ref|YP_505618.1|  metallo-beta-lactamase family protein [Anapl...    105   7e-24
ref|WP_020538306.1|  hypothetical protein [Lewinella cohaerens]      105   8e-24
ref|WP_018249242.1|  hypothetical protein [Orenia marismortui]       104   9e-24
ref|YP_067795.1|  phosphonate metabolism protein PhnP [Rickett...    104   9e-24
ref|YP_008333094.1|  PhnP protein [Anaplasma phagocytophilum s...    104   9e-24
gb|EDM44070.1|  metal-dependent hydrolase [unidentified eubact...    104   9e-24
ref|WP_010182678.1|  beta-lactamase [Aquimarina agarilytica]         104   1e-23
ref|WP_019669572.1|  beta-lactamase [Eudoraea adriatica]             104   1e-23
ref|WP_018473104.1|  hypothetical protein [Echinicola pacifica]      104   1e-23
ref|WP_020211556.1|  hypothetical protein [Flavobacterium rivuli]    104   1e-23
ref|WP_018357592.1|  hypothetical protein [Porphyromonas levii]      104   1e-23
ref|YP_001543096.1|  beta-lactamase domain-containing protein ...    104   1e-23
ref|WP_017498820.1|  beta-lactamase [Flavobacterium sp. WG21]        103   1e-23
ref|WP_007094130.1|  beta-lactamase [Kordia algicida] >gb|EDP9...    103   1e-23
ref|WP_020607262.1|  hydrolase [Spirosoma spitsbergense]             103   1e-23
ref|WP_022187660.1|  uncharacterized protein [Azospirillum sp....    104   2e-23
ref|WP_020527253.1|  hypothetical protein [Flexithrix dorotheae]     103   2e-23
ref|WP_009061679.1|  metallo-beta-lactamase [Methylacidiphilum...    103   2e-23
ref|YP_004046381.1|  metal-dependent hydrolase [Riemerella ana...    103   2e-23
ref|WP_004919415.1|  beta-lactamase [Riemerella anatipestifer]...    103   2e-23
ref|WP_022063620.1|  putative uncharacterized protein [Alistip...    103   2e-23
ref|WP_008626701.1|  Metal-dependent hydrolase [Mariniradius s...    103   3e-23
ref|WP_018108443.1|  hypothetical protein [Bacteroides propion...    103   3e-23
ref|WP_007435027.1|  hydrolase [Acetobacteraceae bacterium AT-...    103   3e-23
ref|YP_005620529.1|  beta-lactamase [Zymomonas mobilis subsp. ...    103   3e-23
ref|WP_008493007.1|  hydrolase [Acidocella sp. MX-AZ02] >gb|EK...    103   4e-23
ref|YP_591705.1|  beta-lactamase-like protein [Candidatus Kori...    103   4e-23
ref|WP_022478791.1|  beta-lactamase domain-containing protein ...    103   4e-23
ref|YP_004698577.1|  beta-lactamase domain-containing protein ...    103   4e-23
ref|WP_008634785.1|  beta-lactamase [Bizionia argentinensis] >...    102   4e-23
ref|WP_002991459.1|  beta-lactamase [Myroides] >gb|EHQ43829.1|...    102   5e-23
ref|NP_221217.1|  hypothetical protein RP869 [Rickettsia prowa...    102   5e-23
ref|YP_162829.1|  beta-lactamase domain-containing protein [Zy...    102   5e-23
ref|YP_003585053.1|  metallo-beta-lactamase domain-containing ...    102   5e-23
ref|WP_021988719.1|  putative uncharacterized protein [Odoriba...    102   7e-23
ref|WP_007089566.1|  PhnP [Thalassospira xiamenensis] >gb|EKF1...    102   8e-23
ref|YP_823115.1|  beta-lactamase domain-containing protein [Ca...    102   8e-23
ref|YP_001295997.1|  PhnP protein [Flavobacterium psychrophilu...    102   8e-23
ref|WP_022636052.1|  beta-lactamase domain-containing protein ...    102   8e-23
ref|YP_005012589.1|  beta-lactamase [Niastella koreensis GR20-...    102   9e-23
ref|WP_018676682.1|  hypothetical protein [Riemerella columbina]     102   1e-22
ref|WP_022047860.1|  putative uncharacterized protein [Odoriba...    101   1e-22
ref|WP_019988016.1|  hydrolase [Rudanella lutea]                     101   1e-22
ref|YP_003318458.1|  beta-lactamase domain-containing protein ...    102   1e-22
ref|WP_008580679.1|  beta-lactamase [Rickettsia endosymbiont o...    101   1e-22
ref|WP_009136065.1|  hydrolase [Odoribacter laneus] >gb|EHP493...    101   1e-22
ref|WP_018620168.1|  hydrolase [Spirosoma luteum]                    101   1e-22
ref|YP_006722642.1|  hypothetical protein B739_0134 [Riemerell...    101   1e-22
ref|WP_021268228.1|  beta-lactamase family protein [Bacteriovo...    101   1e-22
ref|WP_009579050.1|  Metal-dependent hydrolase of the beta-lac...    101   1e-22
ref|WP_009055245.1|  hydrolase [Nitritalea halalkaliphila] >gb...    101   1e-22
ref|WP_022082090.1|  putative uncharacterized protein [Bactero...    101   1e-22
ref|WP_008271412.1|  beta-lactamase [Flavobacteriales bacteriu...    101   2e-22
ref|WP_010232026.1|  beta-lactamase [Gillisia sp. CBA3202]           101   2e-22
ref|YP_005414465.1|  beta-lactamase [Rickettsia australis str....    101   2e-22
ref|WP_020897838.1|  Metal-dependent hydrolases of the beta-la...    101   2e-22
ref|WP_009282751.1|  hydrolase [Fibrisoma limi] >emb|CCH54171....    100   2e-22
ref|YP_005035134.1|  putative hydrolase [Bacteriovorax marinus...    101   2e-22
ref|YP_005364752.1|  PhnP protein [Candidatus Rickettsia ambly...    100   2e-22
ref|WP_019130955.1|  hypothetical protein [Bacteroidales bacte...    100   2e-22
ref|YP_006435970.1|  beta-lactamase superfamily metal-dependen...    100   2e-22
ref|NP_360979.1|  PhnP protein [Rickettsia conorii str. Malish...    100   3e-22
ref|WP_007651138.1|  Metal-dependent hydrolase of the beta-lac...    100   3e-22
ref|WP_016917270.1|  beta-lactamase [Rickettsia honei]               100   4e-22
ref|YP_001499842.1|  beta-lactamase superfamily hydrolase [Ric...    100   4e-22
ref|YP_005389836.1|  beta-lactamase superfamily hydrolase [Ric...    100   4e-22
ref|YP_247387.1|  beta-lactamase superfamily hydrolase [Ricket...    100   4e-22
ref|WP_010517161.1|  beta-lactamase [Mesoflavibacter zeaxanthi...    100   4e-22
ref|YP_004658952.1|  beta-lactamase [Runella slithyformis DSM ...    100   4e-22
ref|WP_021070254.1|  hypothetical protein [Sphingobacterium pa...    100   5e-22
gb|AGC72069.1|  metal-dependent hydrolases of the beta-lactama...  98.6    5e-22
ref|YP_001495420.1|  PhnP protein [Rickettsia rickettsii str. ...  99.8    5e-22
ref|YP_004764984.1|  beta-lactamase superfamily hydrolase [Ric...  99.8    6e-22
ref|YP_190469.1|  PhnP protein [Gluconobacter oxydans 621H] >r...  99.8    6e-22
ref|YP_003863383.1|  putative hydrolase [Maribacter sp. HTCC21...  99.8    6e-22
ref|WP_016926654.1|  beta-lactamase [Rickettsia conorii]           99.4    7e-22
ref|YP_538489.1|  beta-lactamase superfamily hydrolase [Ricket...  99.4    7e-22
ref|WP_022061899.1|  metal-dependent hydrolases of the beta-la...  99.4    7e-22
ref|WP_004363489.1|  hypothetical protein [Prevotella nigresce...  99.4    8e-22
ref|YP_007224577.1|  beta-lactamase superfamily metal-dependen...  99.4    8e-22
ref|YP_002796684.1|  hydrolase protein [Laribacter hongkongens...  99.4    9e-22
ref|WP_006842311.1|  hydrolase [Dysgonomonas mossii] >gb|EGK04...  99.4    9e-22
ref|WP_018668582.1|  hydrolase [Bacteroides gallinarum]            99.4    9e-22
ref|WP_017442768.1|  beta-lactamase [Rickettsia japonica]          99.4    9e-22
ref|WP_022315874.1|  putative phnP protein [Prevotella sp. CAG...  99.0    9e-22
ref|WP_018479040.1|  hydrolase [Pontibacter roseus]                98.6    9e-22
ref|YP_005301396.1|  beta-lactamase superfamily hydrolase [Ric...  99.0    1e-21
ref|YP_002916972.1|  beta-lactamase superfamily hydrolase [Ric...  99.0    1e-21
ref|WP_016195118.1|  Metal-dependent hydrolase of the beta-lac...  98.2    1e-21
ref|WP_010260998.1|  beta-lactamase [Alistipes sp. JC136]          99.4    1e-21
ref|YP_003196080.1|  hydrolase [Robiginitalea biformata HTCC25...  99.0    1e-21
ref|YP_001883957.1|  metal-dependent hydrolase [Borrelia herms...  99.0    1e-21
ref|WP_010600818.1|  hydrolase [Pedobacter agri]                   99.0    1e-21
ref|WP_002557120.1|  PhnP protein [Borrelia burgdorferi] >gb|E...  98.6    2e-21
ref|WP_010251232.1|  beta-lactamase [Myroides injenensis]          98.6    2e-21
ref|WP_002656112.1|  PhnP protein [Borrelia burgdorferi] >gb|E...  98.6    2e-21
ref|YP_006408638.1|  beta-lactamase superfamily metal-dependen...  98.6    2e-21
ref|WP_008614618.1|  beta-lactamase [Joostella marina] >gb|EIJ...  98.6    2e-21
ref|WP_010420865.1|  beta-lactamase [Rickettsia helvetica]         98.2    2e-21
ref|WP_021188134.1|  hypothetical protein [Sphingobacterium sp...  98.2    2e-21
ref|YP_004246835.1|  beta-lactamase [Sphaerochaeta globosa str...  98.6    2e-21
ref|WP_021930225.1|  putative uncharacterized protein [Tannere...  98.2    2e-21
ref|WP_004367762.1|  lipoate--protein ligase [Prevotella nigre...  98.2    2e-21
ref|YP_001494076.1|  beta-lactamase superfamily hydrolase [Ric...  98.2    2e-21
ref|YP_005302596.1|  beta-lactamase superfamily hydrolase [Ric...  98.2    2e-21
ref|WP_022582164.1|  hydrolase [Rhodonellum psychrophilum] >gb...  98.2    2e-21
ref|WP_009034485.1|  hydrolase [Indibacter alkaliphilus] >gb|E...  97.8    2e-21
ref|YP_506461.1|  metallo-beta-lactamase family protein [Neori...  98.2    3e-21
ref|YP_005062021.1|  metal-dependent hydrolase, beta-lactamase...  97.8    3e-21
ref|WP_002659184.1|  hydrolase [Saprospira grandis] >gb|EJF535...  97.8    3e-21
ref|WP_009195083.1|  hypothetical protein [Cesiribacter andama...  97.8    3e-21
ref|WP_019150749.1|  beta-lactamase [Alistipes senegalensis]       98.2    3e-21
ref|WP_008237001.1|  hydrolase [Pedobacter sp. BAL39] >gb|EDM3...  97.8    3e-21
ref|WP_009010493.1|  lipoate--protein ligase [Prevotella sp. C...  98.2    3e-21
ref|WP_006046291.1|  lipoate--protein ligase [Prevotella palle...  97.8    3e-21
ref|WP_004997108.1|  beta-lactamase [Rickettsia sibirica] >gb|...  97.8    3e-21
ref|WP_002700109.1|  metallo-beta-lactamase domain protein [Tr...  97.8    3e-21
ref|YP_007642638.1|  Metal-dependent hydrolase of the beta-lac...  97.8    3e-21
ref|YP_005037669.1|  metallo-beta-lactamase domain-containing ...  97.8    3e-21
ref|NP_212667.1|  phnP protein [Borrelia burgdorferi B31] >ref...  97.4    3e-21
ref|YP_005805624.1|  PhnP protein [Borrelia burgdorferi JD1] >...  97.4    3e-21
ref|WP_007481983.1|  hydrolase [Bacteroides salyersiae] >gb|EI...  97.4    4e-21
ref|YP_004789477.1|  beta-lactamase domain-containing protein ...  97.4    4e-21
ref|WP_017259018.1|  hypothetical protein [Pedobacter arcticus]    97.4    4e-21
ref|YP_004885321.1|  metal-dependent hydrolase [Rickettsia jap...  97.4    4e-21
ref|YP_007815592.1|  Metal-dependent hydrolases of the beta-la...  97.4    4e-21
ref|WP_004289973.1|  hydrolase [Bacteroides eggerthii] >gb|EEC...  97.1    5e-21
ref|NP_903388.1|  hydrolase [Chromobacterium violaceum ATCC 12...  97.1    5e-21
ref|WP_009121647.1|  hydrolase [Bacteroides] >gb|EGF52277.1| m...  97.1    5e-21
ref|YP_004580901.1|  beta-lactamase domain-containing protein ...  97.1    5e-21
gb|EKE21039.1|  hypothetical protein ACD_7C00376G0001 [uncultu...  97.1    5e-21
ref|YP_005806717.1|  PhnP protein [Borrelia burgdorferi N40] >...  97.1    5e-21
ref|WP_008891045.1|  PhnP [Thalassospira profundimaris] >gb|EK...  97.1    5e-21
ref|WP_022830362.1|  hydrolase [Cytophagales str. B6]              97.1    6e-21
ref|YP_002845739.1|  beta-lactamase [Rickettsia africae ESF-5]...  97.1    6e-21
ref|YP_007320814.1|  beta-lactamase domain protein [Fibrella a...  97.1    6e-21
ref|YP_302792.1|  Beta-lactamase-like [Ehrlichia canis str. Ja...  97.1    6e-21
ref|WP_021862313.1|  metallo-beta-lactamase domain protein [Pa...  96.7    7e-21
ref|WP_018336365.1|  hypothetical protein [Butyricimonas syner...  97.1    7e-21
ref|YP_945525.1|  metal-dependent hydrolase [Borrelia turicata...  96.7    8e-21
ref|YP_004526474.1|  metallo-beta-lactamase family protein [Tr...  97.1    8e-21
ref|YP_004772537.1|  metal-dependent hydrolase [Cyclobacterium...  96.7    8e-21
ref|WP_018361864.1|  lipoate--protein ligase [Prevotella nance...  96.3    1e-20
ref|YP_006419264.1|  beta-lactamase superfamily metal-dependen...  96.3    1e-20
ref|WP_021891068.1|  putative uncharacterized protein [Bactero...  96.3    1e-20
ref|YP_008470549.1|  hypothetical protein HMPREF0669_01655 [Pr...  95.9    1e-20
ref|YP_004865593.1|  metallo-beta-lactamase superfamily protei...  96.3    1e-20
ref|WP_004792550.1|  PhnP protein [Borrelia garinii] >gb|EED30...  95.9    1e-20
ref|YP_003388087.1|  beta-lactamase [Spirosoma linguale DSM 74...  95.9    1e-20
ref|YP_003093322.1|  beta-lactamase domain-containing protein ...  95.9    1e-20
ref|YP_008658298.1|  Octanoyltransferase [Blattabacterium sp. ...  95.9    2e-20
ref|YP_005391707.1|  beta-lactamase [Rickettsia montanensis st...  95.9    2e-20
ref|WP_016947989.1|  beta-lactamase [Rickettsia endosymbiont o...  95.5    2e-20
ref|YP_004052943.1|  metal-dependent hydrolase [Marivirga trac...  95.5    2e-20
ref|WP_008158479.1|  hydrolase [Parabacteroides johnsonii] >gb...  95.5    2e-20
ref|YP_006203218.1|  PhnP [Borrelia garinii BgVir] >ref|WP_014...  95.5    2e-20
ref|WP_022393908.1|  uncharacterized protein [Bacteroides inte...  95.5    2e-20
ref|WP_007653776.1|  hydrolase [Pontibacter sp. BAB1700] >gb|E...  95.5    2e-20
ref|WP_005930930.1|  hypothetical protein [Bacteroides] >gb|EO...  95.1    2e-20
ref|WP_008882618.1|  PhnP protein [Borrelia sp. SV1] >gb|EEH00...  95.1    2e-20
ref|WP_004791424.1|  PhnP protein [Borrelia garinii] >gb|EED29...  95.1    3e-20
ref|WP_007574786.1|  lipoate--protein ligase [Prevotella multi...  95.1    3e-20
ref|WP_005832365.1|  hydrolase [Bacteroides] >gb|EFV25327.1| m...  95.1    3e-20
ref|YP_003120983.1|  beta-lactamase domain-containing protein ...  94.7    3e-20
ref|WP_005653464.1|  hydrolase [Bacteroides] >gb|EDS16581.1| m...  94.7    4e-20
ref|YP_006871215.1|  phnP protein [Borrelia garinii NMJW1] >re...  94.4    4e-20
ref|YP_507772.1|  metallo-beta-lactamase family protein [Ehrli...  94.7    4e-20
ref|WP_007664988.1|  hydrolase [Bacteroides intestinalis] >gb|...  94.0    4e-20
ref|WP_017141403.1|  hydrolase [Bacteroides eggerthii]             93.6    5e-20
ref|YP_002463334.1|  beta-lactamase domain-containing protein ...  94.4    5e-20
ref|YP_001938436.1|  PhnP protein [Orientia tsutsugamushi str....  94.4    5e-20
ref|WP_020599714.1|  hydrolase [Spirosoma panaciterrae]            94.4    6e-20
ref|WP_007209738.1|  hydrolase [Bacteroides cellulosilyticus] ...  93.6    6e-20
emb|CDF79451.1|  metal-dependent hydrolases of the beta-lactam...  94.0    6e-20
ref|WP_022163059.1|  metallo-beta-lactamase domain protein [Ba...  94.0    6e-20
ref|YP_072972.1|  phnP protein [Borrelia garinii PBi] >ref|WP_...  94.0    7e-20
ref|WP_009124188.1|  hydrolase [Bacteroides fluxus] >gb|EGF588...  93.2    7e-20
ref|WP_008862002.1|  hydrolase [Barnesiella intestinihominis] ...  94.0    7e-20
ref|YP_008766.1|  phnP protein [Candidatus Protochlamydia amoe...  93.6    8e-20
ref|WP_005644173.1|  hydrolase [Parabacteroides merdae] >gb|EK...  94.0    8e-20
ref|WP_021940677.1|  metallo-beta-lactamase superfamily protei...  93.6    8e-20
ref|WP_005843688.1|  lipoate--protein ligase [Prevotella denta...  93.2    9e-20
ref|WP_021967225.1|  uncharacterized protein [Bacteroides inte...  93.6    9e-20
ref|WP_010855328.1|  Metal-dependent hydrolases of the beta-la...  93.6    9e-20
ref|WP_006799692.1|  hydrolase [Dysgonomonas gadei] >gb|EGK016...  93.6    9e-20
ref|YP_001249127.1|  hypothetical protein OTBS_1916 [Orientia ...  93.6    9e-20
ref|YP_003081771.1|  metallo-beta-lactamase [Neorickettsia ris...  93.6    1e-19
ref|WP_008126043.1|  lipoate--protein ligase [Prevotella timon...  93.6    1e-19
ref|WP_022044029.1|  metal-dependent hydrolase beta-lactamase ...  93.6    1e-19
ref|WP_005635145.1|  hydrolase [Parabacteroides merdae] >gb|ED...  93.6    1e-19
ref|WP_004294712.1|  hydrolase [Bacteroides eggerthii] >gb|EFV...  93.6    1e-19
ref|WP_009132233.1|  hypothetical protein [Bacteroides oleicip...  93.2    1e-19
ref|WP_007486799.1|  hydrolase [Bacteroides nordii] >gb|EIY460...  93.2    1e-19
ref|WP_018344792.1|  hydrolase [Cytophaga aurantiaca]              93.2    1e-19
ref|WP_022322215.1|  metallo-beta-lactamase domain protein [Pa...  93.2    1e-19
ref|WP_022157183.1|  metallo-beta-lactamase family protein [Pr...  93.2    1e-19
ref|YP_006874640.1|  beta-lactamase [Emticicia oligotrophica D...  93.2    1e-19
ref|WP_009038214.1|  hydrolase [Bacteroides sp. D20] >gb|EFA19...  93.2    1e-19
ref|WP_022730836.1|  PhnP [Thalassospira lucentensis]              93.2    1e-19
ref|WP_022210916.1|  uncharacterized protein [Bacteroides cell...  93.2    1e-19
ref|YP_003814572.1|  metallo-beta-lactamase domain protein [Pr...  93.2    1e-19
ref|WP_005678121.1|  hydrolase [Bacteroides] >gb|EDM20350.1| m...  92.8    2e-19
ref|WP_005467990.1|  lipoyl(octanoyl) transferase [Porphyromon...  95.1    2e-19
ref|WP_005681372.1|  hydrolase [Bacteroides caccae] >gb|EIY199...  92.8    2e-19
ref|YP_002222177.1|  phnP protein [Borrelia duttonii Ly] >ref|...  92.8    2e-19
ref|WP_006068905.1|  PhnP protein [Borrelia valaisiana] >gb|EE...  92.8    2e-19
ref|YP_004777765.1|  metallo-beta-lactamase superfamily protei...  92.8    2e-19
ref|YP_004531621.1|  lipoate-protein ligase B [Treponema primi...  92.8    2e-19
ref|WP_021478800.1|  beta-lactamase [Pseudogulbenkiania ferroo...  92.8    2e-19
ref|YP_007277878.1|  metal-dependent hydrolase, beta-lactamase...  92.8    2e-19
ref|WP_002561514.1|  PhnP protein [Bacteroides sp. HPS0048] >g...  92.4    2e-19
ref|WP_019245334.1|  hypothetical protein [Alistipes sp. AP11]     92.4    2e-19
ref|WP_006340313.1|  beta-lactamase [Parachlamydia acanthamoeb...  92.8    2e-19
ref|WP_006846880.1|  lipoate--protein ligase [Prevotella copri...  92.0    2e-19
ref|WP_020888942.1|  Metal-dependent hydrolases of the beta-la...  91.3    3e-19
ref|WP_016662126.1|  PhnP protein [Bacteroides stercoris] >gb|...  92.4    3e-19
ref|WP_009432746.1|  hydrolase [Porphyromonas sp. oral taxon 2...  94.7    3e-19
ref|WP_004360338.1|  lipoate--protein ligase [Prevotella melan...  92.4    3e-19
ref|WP_008147491.1|  hypothetical protein, partial [Parabacter...  91.3    3e-19
ref|WP_018967279.1|  lipoate--protein ligase [Prevotella loesc...  92.0    3e-19
ref|WP_022333773.1|  metallo-beta-lactamase domain protein [Al...  92.0    4e-19
ref|YP_005322040.1|  metal-dependent hydrolase [Saprospira gra...  91.7    4e-19
ref|YP_004161449.1|  hydrolase [Bacteroides helcogenes P 36-10...  91.7    5e-19
ref|YP_008415673.1|  PhnP protein [Borrelia miyamotoi LB-2001]...  91.7    5e-19
ref|YP_006411757.1|  beta-lactamase superfamily metal-dependen...  91.7    5e-19
ref|WP_018696949.1|  beta-lactamase [Alistipes onderdonkii]        91.7    5e-19
ref|YP_004652296.1|  metal dependent hydrolase of the beta-lac...  91.7    5e-19
ref|WP_007216318.1|  hydrolase [Bacteroides cellulosilyticus] ...  91.3    6e-19
ref|YP_709977.1|  phnP protein [Borrelia afzelii PKo] >ref|YP_...  91.3    6e-19
ref|WP_002980923.1|  beta-lactamase [Chryseobacterium gleum] >...  91.7    6e-19
ref|WP_009434947.1|  lipoate--protein ligase [Prevotella sp. o...  91.3    6e-19
ref|WP_020403493.1|  hypothetical protein [Gracilimonas tropica]   91.3    6e-19
ref|WP_009235895.1|  lipoate--protein ligase [Prevotella sp. o...  91.3    6e-19
ref|WP_007748038.1|  hydrolase [Bacteroides] >gb|EEX47217.1| m...  91.3    7e-19
ref|WP_007846369.1|  beta-lactamase [Chryseobacterium sp. CF31...  91.3    7e-19
ref|WP_018909647.1|  lipoate--protein ligase [Prevotella veror...  91.3    7e-19
ref|YP_006931708.1|  phnP protein [Borrelia afzelii HLJ01] >re...  91.3    7e-19
ref|WP_022430906.1|  metallo-beta-lactamase family protein [Pr...  90.9    8e-19
ref|YP_002222986.1|  phnP protein [Borrelia recurrentis A1] >r...  90.9    8e-19
ref|YP_006297854.1|  beta-lactamase family protein [Prevotella...  90.9    8e-19
ref|WP_021852311.1|  metallo-beta-lactamase domain protein [Pr...  90.9    9e-19
ref|WP_008504823.1|  hydrolase [Mucilaginibacter paludis] >gb|...  90.9    9e-19
ref|WP_006744378.1|  hydrolase [Bacteroides coprosuis] >gb|EGJ...  90.9    9e-19
ref|WP_004328996.1|  beta-lactamase [Alistipes putredinis] >gb...  90.1    1e-18
ref|WP_009135048.1|  hydrolase [Alistipes indistinctus] >gb|EH...  90.9    1e-18
ref|WP_009317001.1|  hydrolase [Tannerella sp. 6_1_58FAA_CT1] ...  90.5    1e-18
ref|WP_009596232.1|  beta-lactamase [Alistipes sp. HGB5] >gb|E...  90.9    1e-18
ref|WP_022602727.1|  hydrolase [Coprobacter fastidiosus] >gb|E...  90.5    1e-18
ref|WP_002688628.1|  beta-lactamase [Bergeyella zoohelcum] >gb...  90.5    1e-18
ref|WP_007897584.1|  lipoate--protein ligase [Prevotella sterc...  89.7    1e-18
ref|WP_019540859.1|  hypothetical protein [Proteiniphilum acet...  90.5    1e-18
ref|WP_019038450.1|  beta-lactamase [Psychroflexus tropicus]       90.5    1e-18
ref|YP_679378.1|  metal-dependent hydrolase [Cytophaga hutchin...  90.5    1e-18
ref|WP_021667361.1|  lipoyl(octanoyl) transferase [Porphyromon...  92.8    1e-18
ref|WP_021672154.1|  metallo-beta-lactamase domain protein [Pr...  90.5    1e-18
ref|WP_016267209.1|  PhnP protein [Bacteroides thetaiotaomicro...  90.1    1e-18
ref|WP_020570391.1|  hypothetical protein [Lewinella persica]      90.5    1e-18
ref|WP_022460990.1|  metallo-beta-lactamase domain protein [Al...  90.1    1e-18
ref|WP_006433936.1|  PhnP protein [Borrelia spielmanii] >gb|EE...  90.1    1e-18
ref|YP_007539161.1|  metallo-beta-lactamase domain protein [Bl...  90.1    2e-18
ref|WP_021963241.1|  putative phnP protein [Prevotella sp. CAG...  90.1    2e-18
ref|WP_022308700.1|  metallo-beta-lactamase domain protein [Al...  90.1    2e-18
ref|WP_022389631.1|  putative uncharacterized protein [Tannere...  89.7    2e-18
ref|WP_021646256.1|  metallo-beta-lactamase domain protein [Ba...  89.0    2e-18
ref|WP_021994283.1|  metallo-beta-lactamase domain protein [Pr...  89.7    2e-18
ref|WP_022121619.1|  lipoate-protein ligase B [Prevotella copr...  89.7    2e-18
ref|WP_002663604.1|  beta-lactamase [Bergeyella zoohelcum] >gb...  89.7    2e-18
ref|WP_007173958.1|  lipoate--protein ligase [Prevotella berge...  89.0    2e-18
ref|WP_022252641.1|  lipoate-protein ligase B [Prevotella sp. ...  89.7    2e-18
ref|WP_004304018.1|  hydrolase [Bacteroides ovatus] >gb|EGM953...  89.4    3e-18
ref|YP_212474.1|  hydrolase [Bacteroides fragilis NCTC 9343] >...  89.0    3e-18
ref|WP_018107930.1|  hypothetical protein, partial [Porphyromo...  88.2    4e-18
ref|WP_008762409.1|  hydrolase [Bacteroides sp. 1_1_14] >gb|EF...  89.0    4e-18
ref|YP_100266.1|  metal-dependent hydrolase [Bacteroides fragi...  89.0    4e-18
ref|WP_009293187.1|  hydrolase [Bacteroides sp. 2_1_56FAA] >gb...  89.0    4e-18
ref|NP_810280.1|  hydrolase [Bacteroides thetaiotaomicron VPI-...  89.0    4e-18
ref|WP_006948663.1|  lipoate--protein ligase [Prevotella marsh...  89.0    4e-18
ref|WP_004297033.1|  hydrolase [Bacteroides ovatus] >gb|EDO140...  88.2    4e-18
ref|WP_022406509.1|  uDP-N-acetylenolpyruvoylglucosamine reduc...  91.7    4e-18
ref|YP_006865898.1|  metal-dependent hydrolase, beta-lactamase...  89.0    5e-18
ref|WP_022138580.1|  uncharacterized protein [Bacteroides sp. ...  88.6    5e-18
ref|WP_019944286.1|  hydrolase [Dyadobacter beijingensis]          88.2    5e-18
ref|WP_022931752.1|  beta-lactamase [Treponema bryantii]           89.0    6e-18
ref|YP_003084450.1|  beta-lactamase domain-containing protein ...  88.2    6e-18
ref|WP_007766355.1|  hydrolase [Bacteroides finegoldii] >gb|EK...  88.2    7e-18
ref|WP_019949296.1|  hypothetical protein [Hymenobacter aeroph...  88.2    7e-18
ref|WP_022470948.1|  hydrolase metal-dependent [Bacteroides th...  88.2    7e-18
ref|WP_009183118.1|  hydrolase [Cecembia lonarensis] >gb|EKB51...  88.2    8e-18
ref|YP_004988853.1|  beta-lactamase superfamily metal-dependen...  88.2    8e-18
ref|WP_004311496.1|  hydrolase [Bacteroides] >gb|EEO58079.1| m...  88.2    8e-18
gb|EKD61609.1|  hypothetical protein ACD_54C00170G0001, partia...  85.9    8e-18
ref|WP_004321259.1|  hydrolase [Bacteroides ovatus] >gb|EIY614...  88.2    8e-18
ref|WP_007652953.1|  hydrolase [Parabacteroides goldsteinii] >...  87.8    9e-18
ref|WP_008588050.1|  hydrolase [Niabella soli] >gb|EHP52793.1|...  87.8    9e-18
ref|WP_022384167.1|  uncharacterized protein [Bacteroides sp. ...  87.8    9e-18
ref|WP_019975694.1|  hypothetical protein [Empedobacter brevis]    87.8    1e-17
ref|WP_008764916.1|  hydrolase [Bacteroides sp. 1_1_6] >gb|EES...  87.8    1e-17
ref|WP_022811894.1|  beta-lactamase [Poribacteria bacterium WG...  87.8    1e-17
ref|WP_019208973.1|  hypothetical protein [Phocaeicola abscess...  87.8    1e-17
ref|YP_006337161.1|  metallo-beta-lactamase domain-containing ...  87.4    1e-17
ref|WP_016520615.1|  hypothetical protein [Treponema socranski...  87.8    1e-17
ref|YP_007233045.1|  beta-lactamase [Liberibacter crescens BT-...  85.9    1e-17
ref|WP_022130829.1|  putative uncharacterized protein [Bactero...  87.4    2e-17
ref|WP_006255752.1|  hydrolase [Alloprevotella tannerae] >gb|E...  86.3    2e-17
ref|WP_021897148.1|  putative uncharacterized protein [Prevote...  86.7    2e-17
ref|WP_003435540.1|  metal-dependent hydrolase, beta-lactamase...  86.7    2e-17
ref|WP_010799854.1|  PhnP protein [Parabacteroides] >gb|EMZ366...  86.7    2e-17
ref|WP_022007106.1|  uncharacterized protein [Proteobacteria b...  87.0    2e-17
ref|WP_005798607.1|  hydrolase [Bacteroides fragilis] >gb|EIK3...  86.7    2e-17
ref|YP_003573954.1|  phnP protein [Prevotella ruminicola 23] >...  86.7    3e-17
ref|WP_008643420.1|  hydrolase [Bacteroides] >gb|EFI13541.1| l...  86.7    3e-17
ref|WP_009230071.1|  lipoate--protein ligase [Prevotella sp. o...  86.7    3e-17
ref|YP_001302532.1|  hydrolase [Parabacteroides distasonis ATC...  86.7    3e-17
ref|WP_022102091.1|  phnP protein [Prevotella sp. CAG:5226] >e...  86.7    3e-17
ref|YP_006426877.1|  beta-lactamase superfamily metal-dependen...  86.7    3e-17
ref|WP_004313651.1|  hydrolase [Bacteroides] >gb|EEO50797.1| m...  86.3    3e-17
ref|WP_022511555.1|  metallo-beta-lactamase domain protein [Pr...  86.3    3e-17
ref|WP_004368239.1|  lipoate--protein ligase [Prevotella orali...  86.3    3e-17
ref|WP_006283407.1|  lipoate--protein ligase [Prevotella bryan...  86.3    3e-17
ref|WP_022196357.1|  metallo-beta-lactamase superfamily [Azosp...  86.3    3e-17
ref|WP_022480322.1|  phnP protein [Prevotella sp. CAG:891] >em...  86.3    3e-17
ref|WP_007412371.1|  lipoate--protein ligase [Prevotella sp. M...  86.3    3e-17
ref|YP_004258050.1|  beta-lactamase domain-containing protein ...  86.3    4e-17
ref|WP_022231307.1|  putative uncharacterized protein [Bactero...  86.3    4e-17
ref|WP_018464701.1|  hypothetical protein [Prevotella paludivi...  86.3    4e-17
ref|YP_006255097.1|  beta-lactamase superfamily metal-dependen...  85.9    4e-17
ref|YP_003709598.1|  metal-dependent hydrolase, beta- lactamas...  85.9    5e-17
ref|WP_023056740.1|  beta-lactamase family protein [Prevotella...  85.9    5e-17
ref|WP_010260234.1|  beta-lactamase [Treponema primitia]           85.9    5e-17
ref|WP_005862219.1|  hydrolase [Bacteroidales] >gb|EEY84809.1|...  85.9    5e-17
ref|WP_022326574.1|  lipoate-protein ligase B [Prevotella sp. ...  85.9    5e-17
ref|WP_008025465.1|  hydrolase [Bacteroides xylanisolvens] >gb...  85.9    5e-17
ref|WP_022569786.1|  beta-lactamase [Ochrobactrum intermedium]...  85.1    5e-17
emb|CCB91705.1|  metal dependent hydrolase of the beta-lactama...  85.9    5e-17
ref|WP_022149518.1|  lipoate-protein ligase B [Prevotella sp. ...  85.5    6e-17
ref|WP_021843520.1|  phosphonate metabolism protein PhnP [Bact...  85.9    6e-17
ref|WP_022111569.1|  lipoate-protein ligase B [Prevotella sp. ...  85.5    7e-17
ref|YP_006439513.1|  beta-lactamase domain-containing protein ...  85.5    7e-17
ref|YP_004327929.1|  metallo-beta-lactamase domain-containing ...  85.1    7e-17
ref|WP_022396823.1|  beta-lactamase domain protein [Akkermansi...  82.4    8e-17
ref|YP_004448576.1|  metallo-beta-lactamase domain-containing ...  85.1    9e-17
ref|WP_009162787.1|  metallo-beta-lactamase domain protein [Pr...  85.1    9e-17
ref|WP_021847570.1|  metallo-beta-lactamase domain protein [Ba...  85.1    1e-16
ref|WP_008622271.1|  lipoate--protein ligase [Bacteroidetes] >...  84.7    1e-16
ref|WP_021980601.1|  metallo-beta-lactamase domain protein [Pa...  84.7    1e-16
ref|WP_004341905.1|  lipoate--protein ligase [Prevotella bucca...  84.7    1e-16
ref|WP_022354331.1|  putative uncharacterized protein [Bactero...  84.7    1e-16
ref|YP_004273254.1|  beta-lactamase [Pedobacter saltans DSM 12...  84.7    1e-16
ref|WP_021853352.1|  putative phnP protein [Prevotella sp. CAG...  84.3    2e-16
ref|WP_008627434.1|  lipoate--protein ligase [Paraprevotella x...  84.3    2e-16
ref|WP_020249062.1|  hypothetical protein [candidate division ...  84.3    2e-16
ref|WP_016525917.1|  hypothetical protein [Treponema maltophil...  84.3    2e-16
ref|WP_004348496.1|  lipoate--protein ligase [Prevotella bucca...  84.0    2e-16
ref|WP_005820849.1|  hydrolase [Bacteroides fragilis] >gb|EKA8...  84.0    2e-16
ref|WP_021949100.1|  metallo-beta-lactamase domain protein [Pr...  84.0    2e-16
ref|WP_021330451.1|  beta-lactamase family protein [Treponema ...  84.7    2e-16
ref|WP_016562928.1|  metallo-beta-lactamase domain protein [Ba...  84.0    2e-16
ref|WP_004353128.1|  lipoate--protein ligase [Prevotella denti...  84.0    2e-16
ref|WP_005831395.1|  hydrolase [Bacteroides uniformis] >gb|EDO...  83.2    2e-16
ref|WP_004358137.1|  lipoate--protein ligase [Prevotella disie...  84.0    2e-16
ref|WP_021669738.1|  metallo-beta-lactamase domain protein [Pr...  83.6    3e-16
ref|WP_009000036.1|  hydrolase [Bacteroides sp. D2] >gb|EFS327...  83.6    3e-16
ref|WP_005936422.1|  hypothetical protein [Bacteroides massili...  83.6    3e-16
ref|WP_022507228.1|  uncharacterized protein [Bacteroides sp. ...  83.6    3e-16
ref|WP_004346087.1|  lipoate--protein ligase [Prevotella bucca...  83.2    3e-16
ref|WP_010538605.1|  hydrolase [Bacteroides faecis]                83.2    3e-16
ref|YP_003548632.1|  beta-lactamase domain-containing protein ...  83.2    4e-16
ref|WP_021970781.1|  putative uncharacterized protein [Bactero...  83.2    4e-16
ref|WP_019599527.1|  hypothetical protein [Rhodonellum psychro...  82.4    4e-16
ref|WP_007366407.1|  lipoate--protein ligase [Prevotella multi...  82.8    5e-16
ref|WP_022302364.1|  uncharacterized protein [Bacteroides faec...  83.2    5e-16
ref|WP_007566882.1|  hydrolase [Bacteroides coprocola] >gb|EDU...  82.4    5e-16
ref|WP_004337767.1|  lipoate--protein ligase [Prevotella bivia...  82.8    6e-16
ref|WP_022824572.1|  hydrolase [Hymenobacter norwichensis]         82.8    6e-16
gb|EKD61211.1|  Beta-lactamase protein, partial [uncultured ba...  80.5    6e-16
ref|YP_001818940.1|  beta-lactamase domain-containing protein ...  82.4    6e-16
ref|WP_008822239.1|  lipoate--protein ligase [Prevotella histi...  82.4    8e-16
ref|WP_009103892.1|  Metal-dependent hydrolase of the beta-lac...  82.4    9e-16
ref|WP_004382688.1|  lipoate--protein ligase [Prevotella veror...  82.0    1e-15
ref|WP_010055292.1|  hypothetical protein, partial [Rhizobium ...  79.3    1e-15
ref|WP_022019946.1|  metallo-beta-lactamase superfamily protei...  82.0    1e-15
ref|WP_022052844.1|  putative uncharacterized protein [Bactero...  81.6    1e-15
ref|WP_007560792.1|  hydrolase [Bacteroides plebeius] >gb|EDY9...  81.6    1e-15
ref|YP_004442314.1|  Octanoyltransferase [Porphyromonas asacch...  84.3    1e-15
ref|WP_018611944.1|  hypothetical protein [Segetibacter koreen...  81.6    1e-15
ref|WP_004331055.1|  hydrolase [Porphyromonas asaccharolytica]...  83.2    2e-15
ref|WP_005780008.1|  hydrolase [Bacteroides fragilis] >gb|EFR5...  80.9    2e-15
ref|WP_022011891.1|  hydrolase [Bacteroides fragilis CAG:558] ...  80.9    3e-15
ref|WP_008201733.1|  hydrolase [Algoriphagus sp. PR1] >gb|EAZ7...  80.1    3e-15
ref|WP_007365937.1|  hydrolase [Porphyromonas uenonis] >gb|EEK...  83.2    3e-15
ref|WP_021276808.1|  beta-lactamase family protein [Bacteriovo...  80.9    3e-15
ref|WP_008144072.1|  hydrolase [Bacteroides coprophilus] >gb|E...  80.1    4e-15
ref|WP_022124892.1|  metallo-beta-lactamase domain protein [Ba...  80.1    4e-15
ref|WP_019967412.1|  lipoate--protein ligase [Prevotella macul...  80.1    4e-15
ref|YP_001929247.1|  hydrolase [Porphyromonas gingivalis ATCC ...  82.4    4e-15
ref|WP_021583131.1|  beta-lactamase family protein [Prevotella...  80.1    4e-15
ref|WP_021272145.1|  beta-lactamase family protein [Bacteriovo...  80.1    4e-15
ref|WP_004585515.1|  beta-lactamase family protein, partial [P...  81.6    4e-15
ref|WP_022311608.1|  lipoate-protein ligase B [Prevotella sp. ...  80.1    4e-15
ref|WP_022277758.1|  putative uncharacterized protein [Bactero...  80.1    4e-15
ref|YP_003999013.1|  beta-lactamase [Leadbetterella byssophila...  79.7    5e-15
ref|NP_905510.1|  lipoate-protein ligase B [Porphyromonas ging...  82.0    6e-15
ref|WP_018709570.1|  hydrolase [Bacteroides] >emb|CDD31697.1| ...  79.7    6e-15
ref|WP_018965395.1|  hydrolase [Porphyromonas gulae]               82.0    6e-15
ref|WP_005806965.1|  hydrolase [Bacteroides fragilis] >gb|EKA9...  79.3    7e-15
ref|YP_004439680.1|  beta-lactamase domain-containing protein ...  79.7    7e-15
ref|WP_007837009.1|  hydrolase [Bacteroides dorei] >gb|EEB2410...  79.3    8e-15
ref|WP_008673737.1|  hydrolase [Bacteroides] >gb|EEO61517.1| m...  79.3    8e-15
ref|WP_007845526.1|  hydrolase [Bacteroides] >gb|EEZ23488.1| m...  79.3    9e-15
ref|YP_001299522.1|  hydrolase [Bacteroides vulgatus ATCC 8482...  79.3    9e-15
ref|WP_009346766.1|  lipoate--protein ligase [Alloprevotella r...  79.3    1e-14
ref|WP_005846045.1|  hydrolase [Bacteroides vulgatus] >gb|EFG1...  79.0    1e-14
ref|WP_008097811.1|  beta-lactamase [Verrucomicrobiae bacteriu...  78.6    1e-14
ref|WP_019036616.1|  lipoate--protein ligase [Prevotella amnii]    78.6    1e-14
ref|WP_022453238.1|  lipoate-protein ligase B [Prevotella sp. ...  79.3    2e-14
ref|WP_016276934.1|  PhnP protein [Bacteroides massiliensis] >...  78.2    2e-14
ref|WP_008449464.1|  lipoate--protein ligase [Prevotella amnii...  78.2    2e-14
ref|WP_022437126.1|  metallo-beta-lactamase domain protein [Pr...  77.8    3e-14
ref|WP_008668422.1|  hydrolase [Bacteroides] >gb|EET16118.1| m...  77.4    4e-14
ref|YP_004366206.1|  beta-lactamase domain-containing protein ...  77.8    4e-14
ref|WP_017970849.1|  hypothetical protein [alpha proteobacteri...  74.3    5e-14
ref|NP_829137.1|  metal-dependent hydrolase [Chlamydophila cav...  77.0    6e-14
ref|WP_021826484.1|  beta-lactamase family protein [Prevotella...  76.6    6e-14
ref|WP_018629848.1|  hydrolase [Niabella aurantiaca]               76.6    8e-14
ref|WP_008565091.1|  lipoate--protein ligase [Prevotella macul...  76.3    8e-14
ref|WP_021274017.1|  beta-lactamase family protein [Bacteriovo...  76.6    8e-14
ref|YP_002308893.1|  hypothetical protein CFPG_219 [Candidatus...  76.3    9e-14
ref|YP_004671076.1|  metal dependent hydrolase of the beta-lac...  75.9    1e-13
ref|YP_007233044.1|  beta-lactamase [Liberibacter crescens BT-...  73.6    1e-13
ref|WP_004370872.1|  lipoate--protein ligase [Prevotella oris]...  75.9    1e-13
ref|WP_004334424.1|  hydrolase [Porphyromonas endodontalis] >g...  77.8    2e-13
ref|WP_006953364.1|  lipoate--protein ligase [Prevotella mican...  75.1    2e-13
ref|WP_018920186.1|  lipoate--protein ligase [Prevotella oris]     74.7    3e-13
ref|WP_004376180.1|  lipoate--protein ligase [Prevotella oris]...  74.7    3e-13
ref|WP_021590236.1|  beta-lactamase family protein [Prevotella...  74.7    3e-13
ref|XP_005709295.1|  metallo-beta-lactamase family protein [Ga...  75.1    4e-13
ref|WP_007133727.1|  lipoate--protein ligase [Prevotella saliv...  74.3    4e-13
ref|WP_022039900.1|  beta-lactamase domain protein [Bacteroide...  73.9    7e-13
ref|WP_022285920.1|  phosphonate metabolism protein PhnP [Bact...  74.3    7e-13
ref|YP_006918879.1|  beta-lactamase-like protein [Thermacetoge...  73.6    7e-13
ref|WP_022324541.1|  phosphonate metabolism protein PhnP [Alis...  73.6    1e-12
ref|WP_020355966.1|  metallo-beta-lactamase superfamily protei...  72.8    2e-12
ref|WP_018360870.1|  hypothetical protein [Porphyromonas macacae]  74.3    2e-12
ref|WP_007362541.1|  beta-lactamase [Opitutaceae bacterium TAV...  72.0    3e-12
ref|WP_009513910.1|  beta-lactamase [Opitutaceae bacterium TAV...  72.0    3e-12
ref|WP_010636748.1|  metallo-beta-lactamase family protein [Ac...  69.7    3e-12
ref|WP_021828138.1|  metallo-beta-lactamase superfamily protei...  70.9    7e-12
ref|NP_224675.1|  metal dependent hydrolase [Chlamydophila pne...  70.9    8e-12
ref|YP_005661862.1|  metallo-beta-lactamase family protein [Ch...  70.5    1e-11
gb|EMR09233.1|  hypothetical protein PNEG_02568 [Pneumocystis ...  70.9    1e-11
gb|EJW03092.1|  hypothetical protein EDEG_02527 [Edhazardia ae...  70.9    1e-11
ref|YP_006737173.1|  metallo-beta-lactamase superfamily protei...  70.5    1e-11
ref|YP_004377267.1|  metal dependent hydrolase [Chlamydophila ...  70.1    1e-11
ref|YP_008581580.1|  metal dependent hydrolase [Chlamydia peco...  70.1    1e-11
ref|WP_022148796.1|  beta-lactamase domain protein [Bacteroide...  70.1    2e-11
ref|YP_545605.1|  hydrolase protein [Methylobacillus flagellat...  66.6    3e-11
emb|CCG84741.1|  protein of unknown function [Taphrina deforma...  69.7    4e-11
ref|YP_005809591.1|  metal-dependent hydrolase [Chlamydia trac...  68.6    6e-11
dbj|GAD05672.1|  octanoate-(acyl-carrier-protein)-protein-N-oc...  69.7    6e-11
ref|YP_007731218.1|  putative hydrolase [Chlamydia trachomatis...  68.2    7e-11
ref|YP_002887998.1|  metal-dependent hydrolase [Chlamydia trac...  68.2    7e-11
ref|WP_002705784.1|  beta-lactamase domain protein [Treponema ...  68.9    7e-11
ref|NP_219889.1|  metal-dependent hydrolase [Chlamydia trachom...  67.8    8e-11
ref|YP_001654708.1|  metal-dependent hydrolase [Chlamydia trac...  67.8    1e-10
dbj|GAD06558.1|  octanoate-(acyl-carrier-protein)-protein-N-oc...  69.3    1e-10
ref|YP_515661.1|  beta-lactamase superfamily metal dependent h...  67.8    1e-10
ref|YP_007722138.1|  putative hydrolase [Chlamydia trachomatis...  67.4    1e-10
ref|WP_005998385.1|  beta-lactamase [Desulfuromonas acetoxidan...  67.4    1e-10
ref|WP_004379561.1|  lipoate--protein ligase [Prevotella oulor...  66.6    2e-10
ref|NP_297033.1|  hydrolase, metal-dependent, putative [Chlamy...  66.6    2e-10
ref|WP_009437316.1|  hypothetical protein [Prevotella sp. oral...  65.1    5e-10
ref|WP_021903665.1|  metallo-beta-lactamase domain protein [Po...  63.5    5e-10
ref|YP_006272468.1|  hypothetical protein Q7M_537, partial [Bo...  63.5    5e-10
ref|XP_002327550.1|  predicted protein [Populus trichocarpa]       65.9    8e-10
ref|YP_219684.1|  hydrolase [Chlamydophila abortus S26/3] >ref...  65.1    1e-09
ref|NP_001190670.1|  metallo-beta-lactamase domain-containing ...  64.7    1e-09
gb|ERP63230.1|  hypothetical protein POPTR_0003s04460g [Populu...  63.9    2e-09
ref|XP_004297566.1|  PREDICTED: putative hydrolase C777.06c-li...  64.3    3e-09
gb|EPY51350.1|  hydrolase [Schizosaccharomyces cryophilus OY26]    63.9    5e-09
ref|XP_004146818.1|  PREDICTED: putative hydrolase C777.06c-li...  63.9    5e-09
gb|EOY27118.1|  Catalytic, putative isoform 2 [Theobroma cacao]    62.8    6e-09
gb|EMT05882.1|  Putative hydrolase [Aegilops tauschii]             63.2    7e-09
ref|YP_004510833.1|  lipoate-protein ligase B [Porphyromonas g...  63.2    9e-09
gb|EMS18281.1|  metallo-beta-lactamase domain containing prote...  63.2    9e-09
ref|WP_020340304.1|  metallo-beta-lactamase superfamily protei...  58.9    9e-09
ref|XP_004510385.1|  PREDICTED: putative hydrolase C777.06c-li...  62.8    1e-08
ref|YP_006739271.1|  metallo-beta-lactamase superfamily protei...  62.4    1e-08
ref|YP_006974183.1|  putative metal-dependent hydrolase [Chlam...  62.4    1e-08
ref|YP_006733983.1|  metallo-beta-lactamase superfamily protei...  62.4    1e-08
gb|EPS68673.1|  hypothetical protein M569_06095, partial [Genl...  62.0    1e-08
gb|EOY27117.1|  Catalytic, putative isoform 1 [Theobroma cacao]    62.4    1e-08
ref|XP_003627115.1|  Hydrolase-like protein [Medicago truncatu...  62.4    1e-08
ref|YP_004422116.1|  putative metal-dependent hydrolase [Chlam...  61.6    1e-08
ref|YP_006738216.1|  metallo-beta-lactamase superfamily protei...  61.6    1e-08
ref|XP_002280465.1|  PREDICTED: putative hydrolase C777.06c [V...  62.4    2e-08
gb|EIM20476.1|  hypothetical protein WALSEDRAFT_39891 [Wallemi...  61.6    2e-08
ref|XP_002962125.1|  hypothetical protein SELMODRAFT_76733 [Se...  61.2    3e-08
ref|XP_002970963.1|  hypothetical protein SELMODRAFT_95258 [Se...  61.2    3e-08
gb|EOA21045.1|  hypothetical protein CARUB_v10001384mg, partia...  61.2    3e-08
ref|WP_006718708.1|  beta-lactamase [Desulfitobacterium metall...  60.5    4e-08
ref|WP_021169602.1|  beta-lactamase-like protein [Sporomusa ov...  60.5    4e-08
ref|YP_006732870.1|  metallo-beta-lactamase superfamily protei...  60.1    4e-08
ref|YP_007438000.1|  beta-lactamase superfamily metal dependen...  60.1    4e-08
ref|YP_004357407.1|  metal-dependent hydrolases of the beta-la...  57.8    4e-08
ref|YP_006740379.1|  metallo-beta-lactamase superfamily protei...  60.5    4e-08
ref|YP_003706262.1|  beta-lactamase-like protein [Truepera rad...  60.1    5e-08
ref|WP_022078589.1|  uncharacterized protein [Acetobacter sp. ...  59.3    5e-08
emb|CCA24935.1|  conserved hypothetical protein [Albugo laibac...  60.1    8e-08
ref|XP_001314411.1|  metallo-beta-lactamase superfamily protei...  59.7    9e-08
gb|EMJ18939.1|  hypothetical protein PRUPE_ppa007983mg [Prunus...  60.1    1e-07
ref|WP_021686689.1|  metallo-beta-lactamase domain protein [Tr...  60.1    1e-07
ref|XP_005534952.1|  hypothetical protein, conserved [Cyanidio...  60.1    1e-07
ref|XP_001873935.1|  predicted protein [Laccaria bicolor S238N...  60.1    1e-07
gb|EMS18292.1|  metallo-beta-lactamase domain containing prote...  60.1    1e-07
ref|NP_192270.4|  metallo-beta-lactamase domain-containing pro...  59.7    1e-07
emb|CCJ30481.1|  unnamed protein product [Pneumocystis jirovecii]  59.3    1e-07
ref|XP_760450.1|  hypothetical protein UM04303.1 [Ustilago may...  59.7    1e-07
gb|AAD15317.1|  putative hydrolase [Arabidopsis thaliana] >emb...  58.9    2e-07
ref|NP_001242806.1|  uncharacterized protein LOC100786919 [Gly...  58.9    2e-07
gb|EGG06849.1|  Hypothetical protein MELLADRAFT_124040 [Melamp...  59.3    2e-07
ref|NP_001078146.1|  metallo-beta-lactamase family protein [Ar...  58.5    2e-07
gb|EPQ29119.1|  hypothetical protein PFL1_03407 [Pseudozyma fl...  59.3    2e-07
gb|EEC84446.1|  hypothetical protein OsI_31065 [Oryza sativa I...  58.9    2e-07
ref|WP_022456440.1|  putative uncharacterized protein [Parabac...  57.4    2e-07
ref|XP_005832594.1|  hypothetical protein GUITHDRAFT_152648 [G...  58.9    2e-07
ref|YP_001951164.1|  beta-lactamase [Geobacter lovleyi SZ] >re...  58.5    2e-07
ref|XP_002882849.1|  metallo-beta-lactamase family protein [Ar...  58.9    3e-07
ref|YP_002458353.1|  beta-lactamase [Desulfitobacterium hafnie...  58.2    3e-07
emb|CCF50863.1|  uncharacterized protein UHOR_06453 [Ustilago ...  58.9    3e-07
ref|WP_018213366.1|  beta-lactamase [Desulfitobacterium hafnie...  58.2    3e-07
gb|EQC42170.1|  hypothetical protein SDRG_01010 [Saprolegnia d...  58.5    3e-07
ref|XP_003531613.1|  PREDICTED: putative hydrolase C777.06c-li...  58.5    3e-07
ref|XP_002527395.1|  catalytic, putative [Ricinus communis] >g...  58.5    3e-07
ref|YP_545596.1|  hydrolase protein [Methylobacillus flagellat...  56.2    3e-07
dbj|BAB02903.1|  hydrolase-like protein [Arabidopsis thaliana]     58.2    3e-07
ref|XP_001777744.1|  predicted protein [Physcomitrella patens ...  58.5    4e-07
gb|ELQ74849.1|  putative Metallo-hydrolase/oxidoreductase, Bet...  57.8    4e-07
ref|NP_187996.2|  metallo-beta-lactamase family protein [Arabi...  58.2    4e-07
ref|YP_519762.1|  hypothetical protein DSY3529 [Desulfitobacte...  57.4    5e-07
ref|XP_004235592.1|  PREDICTED: putative hydrolase C777.06c-li...  57.8    6e-07
gb|EGG06920.1|  Hypothetical protein MELLADRAFT_124039 [Melamp...  57.4    8e-07
gb|EJK56047.1|  hypothetical protein THAOC_24141 [Thalassiosir...  57.4    9e-07
ref|WP_005809150.1|  beta-lactamase [Desulfitobacterium hafnie...  56.6    1e-06
gb|EPB91330.1|  hypothetical protein HMPREF1544_01847 [Mucor c...  57.0    1e-06
dbj|BAD23415.1|  hydrolase-like protein [Oryza sativa Japonica...  57.0    1e-06
ref|YP_003893794.1|  beta-lactamase domain-containing protein ...  56.2    1e-06
ref|WP_021990841.1|  lipoate-protein ligase B [Prevotella sp. ...  54.3    1e-06
ref|XP_002460117.1|  hypothetical protein SORBIDRAFT_02g023000...  57.0    1e-06
gb|EOA30898.1|  hypothetical protein CARUB_v10014045mg [Capsel...  56.6    1e-06
emb|CCM00313.1|  predicted protein [Fibroporia radiculosa]         57.0    1e-06
gb|ACR37870.1|  unknown [Zea mays] >tpg|DAA61179.1| TPA: hypot...  56.6    2e-06
emb|CBQ68840.1|  conserved hypothetical protein [Sporisorium r...  56.2    2e-06
ref|WP_022015881.1|  beta-lactamase domain-containing protein ...  56.2    2e-06
gb|EPX73704.1|  hydrolase [Schizosaccharomyces octosporus yFS286]  56.2    2e-06
dbj|BAJ92435.1|  predicted protein [Hordeum vulgare subsp. vul...  56.2    2e-06
ref|XP_003576460.1|  PREDICTED: LOW QUALITY PROTEIN: putative ...  55.8    2e-06
emb|CBJ27204.1|  conserved unknown protein [Ectocarpus silicul...  56.2    2e-06
gb|EOR00011.1|  Splicing factor U2AF 50 kDa subunit [Wallemia ...  56.2    3e-06
ref|WP_020370988.1|  metallo-beta-lactamase superfamily protei...  55.1    3e-06
ref|WP_019850022.1|  beta-lactamase [Desulfitobacterium sp. PCE1]  55.1    4e-06
ref|YP_004342670.1|  beta-lactamase domain-containing protein ...  54.7    4e-06
gb|EGF79174.1|  hypothetical protein BATDEDRAFT_89854 [Batrach...  55.1    4e-06
ref|XP_002285983.1|  predicted protein [Thalassiosira pseudona...  54.7    5e-06
ref|WP_020616296.1|  hypothetical protein [Paenibacillus daeje...  54.7    5e-06
ref|WP_008926900.1|  phosphonate metabolism protein PhnP [Pant...  54.7    5e-06
gb|ERN15314.1|  hypothetical protein AMTR_s00036p00080390 [Amb...  54.7    5e-06
ref|WP_003852451.1|  Metal-dependent hydrolase of the beta-lac...  54.3    5e-06
ref|YP_007907805.1|  Metal-dependent hydrolases of the beta-la...  54.7    5e-06
dbj|GAC99789.1|  metallo-beta-lactamase [Pseudozyma hubeiensis...  54.7    6e-06
gb|EJF66422.1|  hypothetical protein DICSQDRAFT_130703 [Dichom...  54.7    7e-06
ref|WP_004076749.1|  beta-lactamase [Methanoplanus limicola] >...  53.9    7e-06
ref|NP_001143802.1|  uncharacterized protein LOC100276574 [Zea...  54.3    7e-06
emb|CCC49664.1|  conserved hypothetical protein [Trypanosoma v...  54.3    8e-06
ref|XP_004956669.1|  PREDICTED: putative hydrolase C777.06c-li...  54.3    9e-06
ref|YP_686690.1|  putative metallo-beta-lactamase [Methanocell...  53.5    1e-05
ref|XP_004991899.1|  hypothetical protein PTSG_06517 [Salpingo...  53.5    1e-05
ref|XP_001771656.1|  predicted protein [Physcomitrella patens ...  53.5    2e-05
ref|WP_006119632.1|  phosphonate metabolism protein PhnP [Pant...  53.1    2e-05
ref|XP_003633034.1|  PREDICTED: putative hydrolase C777.06c-li...  53.5    2e-05
ref|XP_002874854.1|  hypothetical protein ARALYDRAFT_911824 [A...  53.1    2e-05
ref|XP_002279654.1|  PREDICTED: putative hydrolase C777.06c-li...  53.1    2e-05
ref|YP_001403646.1|  beta-lactamase domain-containing protein ...  52.8    2e-05
emb|CBI30946.3|  unnamed protein product [Vitis vinifera]          53.1    2e-05
ref|YP_003727475.1|  beta-lactamase-like protein [Methanohalob...  52.4    3e-05
ref|YP_004357406.1|  metal-dependent hydrolases of the beta-la...  48.9    3e-05
ref|WP_008386360.1|  beta-lactamase [Rhodovulum sp. PH10] >gb|...  52.0    3e-05
dbj|GAA94712.1|  hypothetical protein E5Q_01365 [Mixia osmunda...  52.4    4e-05
ref|YP_003597575.1|  hypothetical protein BMD_2377 [Bacillus m...  52.0    4e-05
ref|XP_002531433.1|  catalytic, putative [Ricinus communis] >g...  52.4    4e-05
ref|XP_002909119.1|  conserved hypothetical protein [Phytophth...  52.4    4e-05
emb|CCC48970.1|  conserved hypothetical protein [Trypanosoma v...  52.4    4e-05
ref|NP_588252.1|  hydrolase (predicted) [Schizosaccharomyces p...  52.0    5e-05
ref|WP_019638455.1|  hypothetical protein [Paenibacillus fonti...  51.6    6e-05
ref|WP_021664222.1|  lipoyl(octanoyl) transferase [Porphyromon...  51.6    6e-05
ref|YP_003541369.1|  beta-lactamase [Methanohalophilus mahii D...  51.6    6e-05
ref|YP_003562869.1|  hypothetical protein BMQ_2412 [Bacillus m...  51.6    6e-05
ref|XP_004342650.1|  metallo-beta-lactamase [Capsaspora owczar...  51.6    7e-05
gb|EGZ15753.1|  hypothetical protein PHYSODRAFT_315934 [Phytop...  51.6    7e-05
ref|YP_005495017.1|  beta-lactamase [Bacillus megaterium WSH-0...  51.2    8e-05
ref|XP_002317290.1|  predicted protein [Populus trichocarpa] >...  51.2    8e-05
ref|YP_001030452.1|  hypothetical protein Mlab_1016 [Methanoco...  50.4    1e-04
gb|ELA47486.1|  hypothetical protein VCUG_01018 [Vavraia culic...  50.8    1e-04
ref|WP_021662551.1|  lipoyl(octanoyl) transferase [Porphyromon...  50.8    1e-04
ref|WP_021677766.1|  lipoyl(octanoyl) transferase [Porphyromon...  50.8    1e-04
gb|EMJ12851.1|  hypothetical protein PRUPE_ppa008911mg [Prunus...  50.8    1e-04
ref|WP_021678328.1|  lipoyl(octanoyl) transferase [Porphyromon...  50.8    1e-04
gb|EQC25815.1|  hypothetical protein SDRG_16330 [Saprolegnia d...  50.4    2e-04
ref|YP_005920006.1|  Metallo-beta-lactamase domain protein [Me...  50.1    2e-04
gb|EGO02715.1|  hypothetical protein SERLA73DRAFT_48080 [Serpu...  50.4    2e-04
ref|NP_579657.1|  ATP-binding protein phnp [Pyrococcus furiosu...  50.1    2e-04
ref|XP_001330638.1|  lipoate-protein ligase [Trichomonas vagin...  50.1    2e-04
ref|YP_004171061.1|  beta-lactamase domain-containing protein ...  49.7    2e-04
dbj|BAJ92126.1|  predicted protein [Hordeum vulgare subsp. vul...  50.1    2e-04
ref|NP_618933.1|  ATP-binding protein PhnP [Methanosarcina ace...  49.3    3e-04
ref|YP_007489550.1|  Metallo-beta-lactamase domain protein [Me...  49.3    3e-04
ref|NP_632877.1|  hypothetical protein MM_0853 [Methanosarcina...  49.3    3e-04
ref|YP_503760.1|  beta-lactamase-like protein [Methanospirillu...  49.3    3e-04
ref|WP_010054796.1|  hypothetical protein, partial [Gemmata ob...  47.4    4e-04
ref|YP_003869657.1|  beta-lactamase superfamily metal-dependen...  48.9    4e-04
ref|XP_003328537.1|  hypothetical protein PGTG_10496 [Puccinia...  49.3    4e-04
ref|YP_842628.1|  beta-lactamase domain-containing protein [Me...  48.9    5e-04
gb|EIM83308.1|  hypothetical protein STEHIDRAFT_113465 [Stereu...  48.9    6e-04
ref|YP_002467575.1|  beta-lactamase [Methanosphaerula palustri...  48.5    6e-04
ref|YP_005195133.1|  carbon-phosphorus lyase complex accessory...  48.5    7e-04
ref|WP_007314450.1|  beta-lactamase [Methanolinea tarda] >gb|E...  48.1    8e-04
ref|YP_004615266.1|  beta-lactamase [Methanosalsum zhilinae DS...  48.1    9e-04
ref|XP_002531432.1|  conserved hypothetical protein [Ricinus c...  48.1    9e-04
ref|WP_017347110.1|  phosphonate metabolism protein PhnP [Pant...  48.1    9e-04
ref|WP_004037287.1|  beta-lactamase [Methanofollis liminatans]...  47.8    0.001
ref|YP_006455786.1|  carbon-phosphorus lyase complex accessory...  47.8    0.001
emb|CCC92113.1|  conserved hypothetical protein [Trypanosoma c...  48.1    0.001
ref|XP_815007.1|  hypothetical protein [Trypanosoma cruzi stra...  48.1    0.001
ref|XP_002912154.1|  hypothetical protein CC1G_13686 [Coprinop...  47.8    0.001
ref|YP_006923526.1|  beta-lactamase domain protein [Methanolob...  47.4    0.001
ref|WP_003303844.1|  carbon-phosphorus lyase complex accessory...  47.4    0.001
ref|YP_003399985.1|  beta-lactamase [Archaeoglobus profundus D...  47.4    0.002
gb|EQC42169.1|  hypothetical protein SDRG_01009 [Saprolegnia d...  47.4    0.002
gb|EOY27593.1|  Metallo-hydrolase/oxidoreductase superfamily p...  47.8    0.002
ref|XP_002968726.1|  hypothetical protein SELMODRAFT_145906 [S...  47.4    0.002
ref|XP_002172884.1|  metallo-beta-lactamase family protein [Sc...  47.4    0.002
ref|YP_006645168.1|  carbon-phosphorus lyase complex accessory...  47.4    0.002
ref|XP_004150774.1|  PREDICTED: putative hydrolase C777.06c-li...  47.4    0.002
ref|YP_002581893.1|  Metal-dependent hydrolase [Thermococcus s...  47.4    0.002
ref|XP_004164683.1|  PREDICTED: putative hydrolase C777.06c-li...  47.4    0.002
ref|YP_048616.1|  carbon-phosphorus lyase complex accessory pr...  47.0    0.002
ref|WP_003210610.1|  carbon-phosphorus lyase [Pseudomonas] >gb...  47.0    0.002
ref|XP_003192686.1|  hypothetical protein CGB_C2630C [Cryptoco...  47.4    0.002
ref|WP_016401288.1|  metal-dependent hydrolases of the beta-la...  47.0    0.002
ref|YP_004423695.1|  hypothetical protein PNA2_0775 [Pyrococcu...  47.0    0.002
ref|YP_003004993.1|  phosphonate metabolism protein PhnP [Dick...  46.6    0.002
ref|XP_003593864.1|  Hydrolase-like protein [Medicago truncatu...  47.0    0.003
ref|XP_004244865.1|  PREDICTED: putative hydrolase C777.06c-li...  47.0    0.003
ref|YP_007342976.1|  5-phospho-alpha-D-ribosyl 1,2-cyclic phos...  46.6    0.003
ref|YP_002958583.1|  Metallo-beta-lactamase superfamily protei...  46.6    0.003
ref|YP_003435263.1|  ATP-binding protein PhnP (PhnP) [Ferroglo...  46.6    0.003
gb|EPS70458.1|  hypothetical protein M569_04297, partial [Genl...  46.6    0.003
gb|EKM60808.1|  hypothetical protein PHACADRAFT_246965 [Phaner...  46.6    0.004
ref|YP_004384605.1|  metallo-beta-lactamase domain-containing ...  46.2    0.004
ref|WP_018975490.1|  hypothetical protein [Saccharibacillus ku...  46.2    0.004
gb|EKG08653.1|  hypothetical protein TCSYLVIO_000189 [Trypanos...  46.2    0.004
gb|EKM83605.1|  hypothetical protein AGABI1DRAFT_33237 [Agaric...  46.6    0.004
ref|WP_018026470.1|  hypothetical protein [Oligella urethralis]    46.2    0.004
gb|EPQ61087.1|  Metallo-hydrolase/oxidoreductase [Gloeophyllum...  46.2    0.004
ref|WP_021258449.1|  beta-lactamase [Paenibacillus alvei] >gb|...  46.2    0.005
ref|YP_006272467.1|  hypothetical protein Q7M_536, partial [Bo...  44.7    0.005
ref|XP_776491.1|  hypothetical protein CNBC5450 [Cryptococcus ...  46.2    0.005
gb|EPS99072.1|  hypothetical protein FOMPIDRAFT_1024325 [Fomit...  46.2    0.005
ref|XP_001730428.1|  hypothetical protein MGL_2224 [Malassezia...  46.2    0.005
ref|YP_566585.1|  beta-lactamase-like protein [Methanococcoide...  45.4    0.006
ref|XP_569533.1|  hypothetical protein [Cryptococcus neoforman...  45.8    0.007
ref|YP_304089.1|  ATP-binding protein PhnP [Methanosarcina bar...  45.4    0.007
ref|WP_006424426.1|  metallo-beta-lactamase domain protein [de...  45.4    0.007
gb|EIW64514.1|  hypothetical protein TRAVEDRAFT_25667 [Tramete...  45.8    0.007
gb|AFR97873.1|  metallo-beta-lactamase [Cryptococcus neoforman...  45.8    0.008
ref|WP_007813343.1|  beta-lactamase [Roseobacter sp. AzwK-3b] ...  45.4    0.008
ref|XP_003524871.1|  PREDICTED: putative hydrolase C777.06c-li...  45.4    0.008
ref|YP_007311927.1|  metal-dependent hydrolase, beta-lactamase...  45.4    0.008
ref|XP_002990613.1|  hypothetical protein SELMODRAFT_429046 [S...  45.4    0.008
gb|EGO28417.1|  hypothetical protein SERLADRAFT_458787 [Serpul...  45.4    0.009
gb|ACU19588.1|  unknown [Glycine max]                              45.1    0.009
emb|CAN79104.1|  hypothetical protein VITISV_006256 [Vitis vin...  45.4    0.009
ref|WP_021015317.1|  phosphonate metabolism protein PhnP [Serr...  45.1    0.011
ref|YP_003882370.1|  metal-dependent hydrolases of the beta-la...  45.1    0.011
gb|EKF26845.1|  hypothetical protein MOQ_009443 [Trypanosoma c...  45.1    0.011
ref|YP_003806895.1|  Metal-dependent hydrolase of the beta-lac...  45.1    0.011
ref|YP_003520685.1|  PhnP [Pantoea ananatis LMG 20103] >ref|WP...  45.1    0.011
gb|EEC69678.1|  hypothetical protein OsI_39116 [Oryza sativa I...  44.7    0.014
ref|XP_003542957.1|  PREDICTED: putative hydrolase C777.06c-li...  44.7    0.015
ref|WP_006882716.1|  beta-lactamase [Halosimplex carlsbadense]...  44.3    0.017
ref|XP_004963215.1|  PREDICTED: putative hydrolase C777.06c-li...  44.7    0.017
ref|YP_605050.1|  beta-lactamase-like protein [Deinococcus geo...  44.3    0.017
ref|YP_003016079.1|  phosphonate metabolism protein PhnP [Pect...  44.3    0.018
ref|WP_003288404.1|  carbon-phosphorus lyase [Pseudomonas stut...  44.3    0.019
ref|NP_001242826.1|  uncharacterized protein LOC100794862 [Gly...  44.3    0.020
ref|XP_004485977.1|  PREDICTED: putative hydrolase C777.06c-li...  44.3    0.020
ref|YP_006447858.1|  metal-dependent hydrolase, beta-lactamase...  44.3    0.021
ref|XP_002443564.1|  hypothetical protein SORBIDRAFT_08g021620...  44.3    0.022
ref|WP_003461841.1|  carbon-phosphorus lyase [Pseudomonas pseu...  43.5    0.032
ref|WP_006638113.1|  ribonuclease J2 [Bacillus sonorensis] >gb...  43.9    0.033
ref|YP_003334142.1|  phosphonate metabolism protein PhnP [Dick...  43.5    0.034
ref|YP_957233.1|  carbon-phosphorus lyase complex accessory pr...  43.5    0.036
ref|XP_847159.1|  hypothetical protein [Trypanosoma brucei bru...  43.5    0.036
ref|YP_004625784.1|  metallo-beta-lactamase family protein [Th...  43.1    0.037
ref|YP_004379562.1|  carbon-phosphorus lyase complex accessory...  43.1    0.044
ref|WP_021256362.1|  beta-lactamase [Paenibacillus alvei] >gb|...  43.1    0.044
ref|YP_003584429.1|  ribonuclease Z [Zunongwangia profunda SM-...  43.1    0.045
ref|NP_069314.1|  ATP-binding protein PhnP [Archaeoglobus fulg...  43.1    0.046
gb|EOA36915.1|  hypothetical protein CARUB_v10009742mg [Capsel...  43.1    0.046
ref|WP_021509804.1|  hypothetical protein [Pantoea dispersa] >...  42.7    0.050
ref|YP_007250199.1|  metal-dependent hydrolase, beta-lactamase...  42.7    0.051
ref|WP_016943900.1|  phosphonate metabolism protein PhnP [Dick...  42.7    0.052
ref|XP_002532980.1|  catalytic, putative [Ricinus communis] >g...  43.1    0.053
ref|YP_004969210.1|  metallo-beta-lactamase superfamily hydrol...  43.1    0.057
ref|WP_019846299.1|  phosphonate metabolism protein PhnP [Dick...  42.7    0.062
ref|WP_017362496.1|  carbon-phosphorus lyase [Pseudomonas mend...  42.7    0.063
ref|YP_002986940.1|  phosphonate metabolism protein PhnP [Dick...  42.4    0.072
ref|WP_019381790.1|  ribonuclease J [Bacillus oceanisediminis]     42.7    0.072
gb|EMT30699.1|  hypothetical protein F775_13826 [Aegilops taus...  42.4    0.072
ref|WP_017036619.1|  hypothetical protein [Vibrio genomosp. F10]   42.4    0.074
ref|YP_079076.1|  RNase,metallo beta-lactamase superfamily pro...  42.7    0.075
ref|YP_008078042.1|  ribonuclease J2 [Bacillus licheniformis 9...  42.7    0.076
ref|WP_018107829.1|  hypothetical protein [Porphyromonas benno...  39.7    0.077
ref|WP_009330687.1|  ribonuclease J [Bacillus sp. 2_A_57_CT2] ...  42.7    0.077
ref|WP_017040020.1|  hypothetical protein [Vibrio genomosp. F10]   42.4    0.078
ref|WP_017037426.1|  hypothetical protein [Vibrio genomosp. F10]   42.4    0.083
ref|YP_004763255.1|  metal-dependent hydrolase [Thermococcus s...  42.0    0.084
ref|XP_003577357.1|  PREDICTED: putative hydrolase C777.06c-li...  42.4    0.088
ref|YP_005420969.1|  ribonuclease J [Bacillus amyloliquefacien...  42.7    0.088
ref|WP_007611486.1|  ribonuclease J [Bacillus sp. 5B6] >gb|EIF...  42.7    0.091
ref|WP_021493672.1|  ribonuclease J [Bacillus amyloliquefacien...  42.4    0.092
ref|YP_008412634.1|  ribonuclease J2 [Bacillus amyloliquefacie...  42.4    0.092
ref|YP_007497308.1|  ribonuclease J2 [Bacillus amyloliquefacie...  42.4    0.092
ref|YP_005130362.1|  ribonuclease J [Bacillus amyloliquefacien...  42.4    0.092
ref|YP_003920346.1|  ribonuclease J2 [Bacillus amyloliquefacie...  42.4    0.092
ref|WP_017417792.1|  ribonuclease J [Bacillus amyloliquefaciens]   42.4    0.093
ref|YP_001421256.1|  hypothetical protein RBAM_016620 [Bacillu...  42.4    0.093
ref|YP_007445580.1|  ribonuclease J [Bacillus amyloliquefacien...  42.4    0.095
ref|YP_005541412.1|  ribonuclease J2 [Bacillus amyloliquefacie...  42.4    0.095
ref|YP_007186416.1|  ribonuclease J [Bacillus amyloliquefacien...  42.4    0.096
ref|WP_020583383.1|  hypothetical protein [Endozoicomonas elys...  42.0    0.097
gb|AAN86996.1|  PhnP-like protein [Pectobacterium carotovorum ...  41.6    0.098
ref|WP_017435791.1|  metallo-hydrolase [Geobacillus caldoxylos...  42.0    0.10 
ref|WP_016936077.1|  ribonuclease J [Bacillus siamensis]           42.4    0.10 
ref|WP_008814898.1|  phosphonate metabolism protein PhnP [Ente...  42.0    0.10 
ref|WP_010327992.1|  ribonuclease J [Bacillus vallismortis]        42.4    0.11 
ref|YP_007404281.1|  carbon-phosphorus lyase complex accessory...  42.0    0.11 
ref|YP_003866083.1|  ribonuclease J2 [Bacillus subtilis subsp....  42.4    0.11 
ref|WP_019714449.1|  ribonuclease J [Bacillus subtilis]            42.4    0.11 
ref|YP_004877300.1|  hypothetical protein GYO_2034 [Bacillus s...  42.4    0.11 
ref|WP_003238465.1|  hypothetical protein [Bacillus subtilis] ...  42.4    0.11 
ref|WP_021479279.1|  ribonuclease J [Bacillus sp. EGD-AK10] >g...  42.4    0.12 
ref|YP_006231619.1|  metallo-beta-lactamase [Bacillus sp. JS] ...  42.4    0.12 
ref|YP_007209619.1|  hypothetical protein A7A1_3406 [Bacillus ...  42.4    0.12 
ref|WP_019258427.1|  ribonuclease J [Bacillus subtilis]            42.4    0.12 
ref|YP_432156.1|  beta-lactamase superfamily hydrolase [Hahell...  42.0    0.12 
ref|YP_005556805.1|  hypothetical protein I33_1865 [Bacillus s...  42.4    0.12 
ref|NP_389560.2|  ribonuclease J2 [Bacillus subtilis subsp. su...  42.4    0.12 
ref|WP_002426056.1|  phosphonate metabolism protein PhnP [Yers...  41.6    0.12 
ref|WP_017694892.1|  ribonuclease J [Bacillus subtilis]            42.4    0.12 
ref|WP_010788641.1|  Zn-dependent hydrolase [Bacillus atrophae...  42.4    0.12 
emb|CBH13356.1|  hypothetical protein, conserved [Trypanosoma ...  42.0    0.12 
ref|YP_003973124.1|  ribonuclease J2 [Bacillus atrophaeus 1942...  42.4    0.12 
ref|WP_006816728.1|  phosphonate metabolism protein PhnP [Yoke...  41.6    0.13 
ref|YP_001722422.1|  carbon-phosphorus lyase complex accessory...  41.6    0.14 
ref|YP_001047995.1|  beta-lactamase domain-containing protein ...  41.6    0.14 
ref|WP_022632984.1|  Phosphonate metabolism protein PhnP [Dick...  41.6    0.14 
ref|WP_000059797.1|  phosphonate metabolism protein PhnP [Esch...  41.6    0.14 
ref|WP_022998439.1|  beta-lactamase [Labrenzia sp. C1B10] >gb|...  42.0    0.15 
gb|EJT46034.1|  hypothetical protein A1Q1_05516 [Trichosporon ...  41.6    0.16 
ref|WP_006934702.1|  beta-lactamase [Labrenzia aggregata] >gb|...  42.0    0.16 
ref|YP_006261206.1|  Beta-lactamase-like protein [Deinococcus ...  41.2    0.17 
ref|XP_003531166.1|  PREDICTED: putative hydrolase C777.06c-li...  41.6    0.17 
tpg|DAA50325.1|  TPA: hypothetical protein ZEAMMB73_166857 [Ze...  41.6    0.17 
ref|WP_021348739.1|  ribonuclease Z [Elizabethkingia meningose...  41.6    0.17 
ref|WP_009088601.1|  ribonuclease Z [Elizabethkingia anophelis...  41.6    0.17 
ref|WP_002467998.1|  metallo-hydrolase [Staphylococcus epiderm...  41.2    0.18 
ref|NP_668056.1|  carbon-phosphorus lyase complex accessory pr...  41.2    0.18 
ref|WP_021488650.1|  carbon-phosphorus lyase [Pseudomonas mend...  41.2    0.18 
ref|YP_004396217.1|  beta-lactamase domain-containing protein ...  41.6    0.19 
ref|YP_008109207.1|  phosphonate metabolism protein PhnP [Ente...  41.2    0.20 
ref|WP_009430514.1|  ribonuclease J [Peptoniphilus sp. oral ta...  41.6    0.20 
ref|WP_018676599.1|  ribonuclease Z [Riemerella columbina]         41.2    0.20 
ref|WP_002472777.1|  metallo-hydrolase [Staphylococcus pettenk...  41.2    0.21 
ref|WP_010334297.1|  ribonuclease J [Bacillus mojavensis]          41.6    0.21 
ref|WP_017176734.1|  metallo-hydrolase [Staphylococcus massili...  41.2    0.21 
ref|YP_004774659.1|  ribonuclease Z [Cyclobacterium marinum DS...  41.2    0.21 
ref|WP_002501606.1|  metallo-hydrolase [Staphylococcus epiderm...  41.2    0.22 
ref|WP_002496900.1|  metallo-hydrolase [Staphylococcus epiderm...  40.8    0.22 
ref|YP_001402522.1|  carbon-phosphorus lyase complex accessory...  40.8    0.22 
ref|NP_142252.2|  hypothetical protein PH0260 [Pyrococcus hori...  40.8    0.23 
ref|WP_023302938.1|  protein phnP [Enterobacter cloacae] >gb|E...  40.8    0.23 
ref|YP_002951308.1|  beta-lactamase [Geobacillus sp. WCH70] >r...  40.8    0.23 
ref|WP_009383241.1|  metallo-beta-lactamase YycJ [Staphylococc...  40.8    0.24 
ref|WP_008474562.1|  ribonuclease J [Nitrolancetus hollandicus...  41.2    0.25 
gb|AEW11400.1|  RNAse Z [Riemerella anatipestifer] >gb|AEW1140...  39.3    0.25 
ref|YP_006545242.1|  Octanoyltransferase [Methanoculleus bourg...  40.8    0.25 
ref|WP_022853998.1|  metallo-beta-lactamase [Thermodesulfatato...  40.8    0.25 
ref|WP_010479546.1|  ATP-binding protein [Thermococcus zilligii]   40.8    0.26 
gb|AEW11406.1|  RNAse Z [Riemerella anatipestifer] >gb|AEW1141...  39.3    0.26 
ref|NP_001144639.1|  uncharacterized protein LOC100277658 [Zea...  40.8    0.26 
dbj|BAA29332.1|  257aa long hypothetical protein [Pyrococcus h...  40.8    0.26 
ref|WP_002434091.1|  metallo-hydrolase [Staphylococcus capitis...  40.8    0.26 
ref|WP_005186531.1|  phosphonate metabolism protein PhnP [Yers...  40.8    0.26 
ref|WP_002495142.1|  metallo-hydrolase [Staphylococcus epiderm...  40.8    0.27 
gb|EJU05287.1|  hypothetical protein DACRYDRAFT_19840 [Dacryop...  41.2    0.27 
gb|EEC75821.1|  hypothetical protein OsI_12786 [Oryza sativa I...  40.8    0.27 
ref|WP_023320186.1|  protein phnP [Klebsiella oxytoca] >gb|ESM...  40.8    0.27 
ref|YP_005517855.1|  beta-lactamase [Alicyclobacillus acidocal...  41.2    0.27 
ref|WP_022819992.1|  ribonuclease J [Fusobacterium russii]         41.2    0.27 
ref|NP_763577.1|  hypothetical protein SE0022 [Staphylococcus ...  40.8    0.28 
ref|YP_004843866.1|  ribonuclease Z [Flavobacterium branchioph...  40.8    0.28 
ref|YP_006353894.1|  ATP-binding protein phnp [Pyrococcus sp. ...  40.8    0.28 
ref|WP_002502255.1|  metallo-hydrolase [Staphylococcus epiderm...  40.8    0.28 
ref|WP_002468937.1|  metallo-hydrolase [Staphylococcus epiderm...  40.8    0.28 
ref|WP_006810444.1|  phosphonate metabolism protein PhnP [Ente...  40.4    0.29 
ref|WP_002437330.1|  metallo-hydrolase [Staphylococcus epiderm...  40.4    0.29 
ref|WP_002445012.1|  metallo-hydrolase [Staphylococcus caprae]...  40.4    0.29 
gb|EGG04469.1|  Hypothetical protein MELLADRAFT_78359 [Melamps...  40.8    0.30 
ref|WP_023349987.1|  putative hydrolase [Staphylococcus capiti...  40.4    0.31 
ref|XP_004975578.1|  PREDICTED: putative hydrolase C777.06c-li...  40.8    0.31 
ref|WP_018663437.1|  metallo-hydrolase [Bacillus acidiproducens]   40.4    0.31 
ref|WP_002500514.1|  metallo-hydrolase [Staphylococcus epiderm...  40.4    0.32 
ref|XP_001350768.1|  conserved Plasmodium protein [Plasmodium ...  40.8    0.33 
ref|WP_010345515.1|  beta-lactamase [Paenibacillus peoriae]        40.4    0.34 
ref|YP_006467583.1|  putative hydrolase of the metallo-beta-la...  40.8    0.34 
ref|WP_019453321.1|  phosphonate metabolism protein PhnP [Serr...  40.4    0.35 
ref|WP_002449280.1|  metallo-hydrolase [Staphylococcus hominis...  40.4    0.36 
ref|YP_944960.1|  carbon-phosphorus lyase complex accessory pr...  40.4    0.36 
ref|WP_016517488.1|  phosphonate metabolism protein PhnP [Cede...  40.0    0.36 
ref|WP_007840394.1|  ribonuclease Z [Chryseobacterium sp. CF31...  40.4    0.36 
ref|WP_004933437.1|  carbon-phosphorus lyase complex accessory...  40.4    0.37 
ref|WP_006837476.1|  ribonuclease J [Bacillus sp. SG-1] >gb|ED...  40.8    0.39 
ref|WP_003376966.1|  ribonuclease J [Clostridium botulinum] >g...  40.8    0.39 
ref|YP_007844631.1|  phosphonate metabolism protein PhnP [Ente...  40.0    0.40 
gb|EAY91171.1|  hypothetical protein OsI_12780 [Oryza sativa I...  40.4    0.40 
ref|WP_017497614.1|  ribonuclease Z [Flavobacterium sp. WG21]      40.4    0.41 
ref|YP_004656863.1|  coenzyme PQQ synthesis protein B [Runella...  40.4    0.41 
ref|WP_002454350.1|  metallo-hydrolase [Staphylococcus caprae]...  40.0    0.42 
ref|WP_020059084.1|  ribonuclease J [Bacillus sp. 123MFChir2]      40.4    0.42 
ref|WP_002503261.1|  metallo-hydrolase [Staphylococcus epiderm...  40.0    0.42 
ref|WP_006177359.1|  phosphonate metabolism protein PhnP [Ente...  40.0    0.42 
ref|YP_878348.1|  metallo-beta-lactamase superfamily hydrolase...  40.4    0.44 
ref|WP_004093763.1|  phosphonate metabolism protein PhnP [Hafn...  40.0    0.45 
ref|WP_021815480.1|  metallo-hydrolase [Lactobacillus fermentu...  40.0    0.46 
ref|WP_016898457.1|  metallo-hydrolase [Staphylococcus capitis]    40.0    0.46 
gb|AEO93647.1|  gp388 [Bacillus phage G]                           40.0    0.46 
ref|YP_001196861.1|  ribonuclease Z [Flavobacterium johnsoniae...  40.0    0.47 
gb|ESK98195.1|  metallo-beta-lactamase family protein [Monilio...  40.0    0.48 
ref|WP_002454568.1|  metallo-hydrolase [Staphylococcus hominis...  40.0    0.48 
ref|WP_019834686.1|  metallo-hydrolase [Staphylococcus sp. MDS7B]  40.0    0.49 
ref|WP_017175610.1|  metallo-hydrolase [Staphylococcus hominis]    40.0    0.50 
ref|YP_251937.1|  hypothetical protein SH0022 [Staphylococcus ...  40.0    0.50 
ref|WP_002488456.1|  metallo-hydrolase [Staphylococcus hominis...  40.0    0.51 
ref|WP_016808417.1|  phosphonate metabolism protein PhnP [Kleb...  39.7    0.52 
ref|WP_019241182.1|  hypothetical protein [Bacillus sp. AP8]       40.0    0.53 
ref|WP_023324021.1|  protein phnP [Enterobacter sp. MGH 38] >g...  39.7    0.54 
ref|WP_003860235.1|  phosphonate metabolism protein PhnP [Ente...  39.7    0.54 
ref|WP_023295776.1|  protein phnP [Enterobacter cloacae] >gb|E...  39.7    0.56 
ref|WP_023299109.1|  protein phnP [Enterobacter cloacae] >gb|E...  39.7    0.59 
ref|WP_017382648.1|  phosphonate metabolism protein PhnP [Ente...  39.7    0.59 
ref|XP_003559646.1|  PREDICTED: putative hydrolase C777.06c-li...  39.7    0.59 
ref|WP_023305273.1|  protein phnP [Enterobacter cloacae] >gb|E...  39.7    0.60 
ref|WP_008468867.1|  ribonuclease Z [Flavobacterium sp. F52] >...  39.7    0.63 
ref|WP_003349133.1|  ribonuclease J [Bacillus methanolicus] >g...  40.0    0.63 
ref|WP_019051095.1|  ribonuclease Z [Elizabethkingia meningose...  39.7    0.64 
ref|WP_002687920.1|  ribonuclease Z [Bergeyella zoohelcum] >gb...  39.7    0.64 
ref|WP_003366135.1|  ribonuclease J [Clostridium botulinum] >g...  40.0    0.66 
ref|WP_002980702.1|  ribonuclease Z [Chryseobacterium gleum] >...  39.7    0.66 
ref|WP_007202594.1|  ribonuclease J [Bacillus macauensis] >gb|...  40.0    0.67 
ref|XP_816733.1|  hypothetical protein [Trypanosoma cruzi stra...  39.7    0.69 
ref|YP_001842835.1|  hypothetical protein LAF_0019 [Lactobacil...  39.3    0.72 
ref|WP_022646776.1|  protein phnP [Enterobacter sp. MGH 8] >gb...  39.3    0.74 
ref|YP_007994224.1|  Beta-lactamase superfamily I metal-depend...  39.3    0.74 
ref|WP_003685643.1|  metallo-hydrolase [Lactobacillus fermentu...  39.3    0.76 
ref|WP_007431057.1|  beta-lactamase [Paenibacillus sp. Aloe-11...  39.3    0.76 
ref|WP_010323928.1|  phosphonate metabolism protein PhnP [Mari...  39.3    0.78 
ref|WP_021296410.1|  ribonuclease J [Alicyclobacillus acidoter...  39.7    0.78 
gb|ACF87606.1|  unknown [Zea mays] >tpg|DAA37894.1| TPA: hypot...  39.7    0.78 
ref|WP_009616298.1|  ribonuclease J [Desulfosporosinus sp. OT]...  39.7    0.79 
ref|YP_001296579.1|  Ribonuclease Z [Flavobacterium psychrophi...  39.3    0.81 
ref|WP_017677519.1|  carbon-phosphorus lyase [Pseudomonas alca...  39.3    0.82 
ref|WP_004109403.1|  phosphonate metabolism protein PhnP [Kleb...  39.3    0.82 
ref|WP_023329129.1|  protein phnP [Klebsiella oxytoca] >gb|ESN...  39.3    0.83 
ref|YP_002993618.1|  metallo-beta-lactamase superfamily protei...  39.3    0.85 
ref|WP_008358059.1|  ribonuclease J [Bacillus sp. HYC-10] >gb|...  39.7    0.86 
ref|WP_002232047.1|  putative phosphonate metabolism protein P...  38.1    0.88 
ref|YP_004013913.1|  RNA-metabolising metallo-beta-lactamase [...  39.7    0.89 
ref|WP_004856574.1|  phosphonate metabolism protein PhnP [Kleb...  39.3    0.90 
gb|EIW69075.1|  hypothetical protein TREMEDRAFT_62803 [Tremell...  39.3    0.93 
ref|WP_001831758.1|  metallo-hydrolase [Staphylococcus epiderm...  39.3    0.94 
ref|WP_021962045.1|  ribonuclease J 2 [Mycoplasma sp. CAG:877]...  39.3    0.94 
ref|WP_004389259.1|  phosphonate metabolism protein PhnP [Yers...  38.9    0.98 
ref|YP_002463756.1|  beta-lactamase domain-containing protein ...  39.3    0.99 
ref|WP_002664119.1|  ribonuclease Z [Bergeyella zoohelcum] >gb...  39.3    0.99 
ref|WP_019556054.1|  phosphonate metabolism protein PhnP [Thio...  38.9    1.00 
ref|YP_006875097.1|  Ribonuclease Z [Emticicia oligotrophica D...  39.3    1.0  
ref|YP_006527858.1|  beta-lactamase domain protein [Melioribac...  38.9    1.0  
ref|WP_017694704.1|  phosphonate metabolism protein PhnP [Ente...  38.9    1.0  
ref|WP_017428937.1|  hypothetical protein [Halomonas jeotgali]     38.9    1.0  
ref|YP_300115.1|  metal-dependent hydrolase [Staphylococcus sa...  38.9    1.0  
ref|WP_005587893.1|  Ribonuclease J 1 [Clostridium ultunense] ...  39.3    1.1  
gb|ERM99205.1|  hypothetical protein AMTR_s00092p00106290 [Amb...  38.9    1.1  
ref|WP_017010720.1|  hypothetical protein [Enterovibrio calvie...  38.9    1.1  
ref|WP_002481989.1|  metallo-hydrolase [Staphylococcus saproph...  38.9    1.1  
ref|YP_002559428.1|  metallo-beta-lactamase family protein Yyc...  38.9    1.1  
ref|WP_023334202.1|  protein phnP [Enterobacter sp. MGH 24] >g...  38.9    1.1  
ref|YP_004623705.1|  metallo-beta-lactamase superfamily protei...  38.9    1.2  
ref|YP_006431048.1|  hypothetical protein Desde_2955 [Desulfit...  39.3    1.2  
ref|YP_002635540.1|  hypothetical protein Sca_2452 [Staphyloco...  38.9    1.2  
ref|WP_020373046.1|  ribonuclease J [Sulfobacillus thermosulfi...  39.3    1.2  
ref|WP_002991168.1|  ribonuclease Z [Myroides] >gb|EHQ43683.1|...  38.9    1.2  
ref|WP_008455733.1|  phosphonate metabolism protein PhnP [Ente...  38.9    1.2  
ref|WP_009222377.1|  ribonuclease J [Peptoniphilus sp. oral ta...  39.3    1.2  
gb|EMD41644.1|  hypothetical protein CERSUDRAFT_110218 [Ceripo...  38.9    1.2  
ref|YP_004238864.1|  ribonuclease Z [Weeksella virosa DSM 1692...  38.9    1.2  
gb|EIW69074.1|  hypothetical protein TREMEDRAFT_31568 [Tremell...  38.9    1.2  
ref|WP_002494608.1|  metallo-hydrolase [Staphylococcus epiderm...  38.9    1.2  
ref|WP_002462715.1|  metallo-hydrolase [Staphylococcus simiae]...  38.9    1.2  
ref|WP_003708910.1|  hypothetical protein [Neisseria lactamica...  38.5    1.2  
ref|WP_008189042.1|  beta-lactamase [Labrenzia alexandrii] >gb...  39.3    1.2  
ref|YP_006724536.1|  hypothetical protein B739_2054 [Riemerell...  38.9    1.3  
ref|YP_004044753.1|  rnase z [Riemerella anatipestifer ATCC 11...  38.9    1.3  
gb|ABP68574.1|  YycJ [Staphylococcus sciuri]                       38.5    1.3  
ref|WP_017796969.1|  ribonuclease Z [Oceanobacillus kimchii]       38.9    1.3  
ref|WP_021443052.1|  carbon-phosphorus lyase [Pseudomonas sp. ...  38.5    1.3  
ref|WP_008339978.1|  ribonuclease J [Alicyclobacillus acidocal...  38.9    1.3  
ref|YP_007547750.1|  Glyoxalase II [Bibersteinia trehalosi USD...  38.5    1.3  
ref|XP_002181877.1|  predicted protein [Phaeodactylum tricornu...  38.9    1.3  
ref|YP_003184874.1|  beta-lactamase domain-containing protein ...  38.9    1.3  
ref|XP_004253722.1|  zinc phosphodiesterase, putative [Entamoe...  38.5    1.3  
ref|WP_002302340.1|  hypothetical protein [Streptococcus mutan...  38.5    1.3  
ref|WP_010292899.1|  ribonuclease J [Clostridium sp. JC122]        38.9    1.3  
ref|WP_023310081.1|  protein phnP [Enterobacter cloacae] >gb|E...  38.5    1.4  
ref|WP_017017305.1|  hypothetical protein [Enterovibrio calvie...  38.1    1.4  
ref|WP_002494242.1|  metallo-hydrolase [Staphylococcus epiderm...  38.5    1.4  
ref|WP_005213583.1|  ribonuclease J 1 [Clostridium celatum] >g...  38.9    1.4  
ref|YP_415540.1|  hypothetical protein SAB0022 [Staphylococcus...  38.5    1.5  
ref|WP_021676419.1|  ribonuclease J 1 [Peptostreptococcaceae b...  38.9    1.5  
ref|YP_006232192.1|  ribonuclease Z [Bacillus sp. JS] >ref|WP_...  38.5    1.5  
ref|WP_008044424.1|  putative hydrolase [Reinekea blandensis] ...  38.5    1.6  
ref|WP_008257745.1|  ribonuclease Z [Flavobacteria bacterium B...  38.5    1.6  
ref|YP_003843343.1|  RNA-metabolising metallo-beta-lactamase [...  38.9    1.6  
ref|WP_017636744.1|  metallo-hydrolase [Staphylococcus sp. E463]   38.5    1.6  
ref|WP_019166070.1|  metallo-hydrolase [Staphylococcus delphini]   38.1    1.7  
ref|WP_007499509.1|  zn-dependent hydrolase [Bacillus stratosp...  38.5    1.7  
ref|WP_007779954.1|  ribonuclease J [Desulfosporosinus youngia...  38.5    1.8  
ref|NP_376776.1|  hypothetical protein ST0874 [Sulfolobus toko...  38.1    1.8  
ref|WP_008344715.1|  ribonuclease J [Bacillus] >gb|EIL84701.1|...  38.5    1.8  
ref|WP_003212233.1|  ribonuclease J [Bacillus pumilus] >gb|EDW...  38.5    1.8  
ref|YP_001486824.1|  metallo beta lactamase [Bacillus pumilus ...  38.5    1.9  
ref|YP_507753.1|  metallo-beta-lactamase family protein [Ehrli...  38.5    1.9  
ref|WP_022108531.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-...  38.5    1.9  
ref|WP_023293498.1|  protein phnP [Enterobacter cloacae] >gb|E...  38.1    1.9  
ref|WP_004822778.1|  ribonuclease J [Peptoniphilus indolicus] ...  38.5    1.9  
ref|WP_020882819.1|  phosphonate metabolism protein PhnP [Ente...  38.1    1.9  
ref|YP_004950176.1|  phnP [Enterobacter cloacae EcWSU1] >ref|W...  38.1    2.0  
ref|WP_021242925.1|  phosphonate metabolism protein PhnP [Ente...  38.1    2.0  
ref|WP_021179076.1|  Metal-dependent hydrolases of the beta-la...  38.1    2.1  
emb|CDH98017.1|  Zn-dependent hydrolase (beta-lactamase superf...  38.1    2.1  
ref|WP_019468535.1|  metallo-hydrolase [Staphylococcus sp. AL1]    38.1    2.1  
ref|YP_300725.1|  metal-dependent hydrolase [Staphylococcus sa...  38.1    2.1  
ref|YP_002436139.1|  hypothetical protein DvMF_1726 [Desulfovi...  36.6    2.2  
ref|WP_018132499.1|  ribonuclease J [Alicyclobacillus pohliae]     38.5    2.2  
ref|NP_781704.1|  Zn-dependent hydrolase [Clostridium tetani E...  38.5    2.2  
ref|WP_003350133.1|  ribonuclease J [Bacillus methanolicus] >g...  38.5    2.2  
ref|WP_020214323.1|  hypothetical protein [Flavobacterium rivuli]  38.1    2.3  
ref|YP_006194229.1|  hypothetical protein ST398NM01_0024 [Stap...  37.7    2.3  
ref|WP_017753813.1|  hypothetical protein [Bacillus sp. ZYK]       38.1    2.3  
ref|WP_018150424.1|  hypothetical protein [Leeia oryzae]           37.7    2.3  
gb|EJT96710.1|  hypothetical protein DACRYDRAFT_72917 [Dacryop...  38.1    2.4  
ref|WP_023326517.1|  protein phnP [Enterobacter sp. MGH 34] >g...  37.7    2.4  
ref|WP_022268417.1|  putative uncharacterized protein [Firmicu...  37.7    2.5  
gb|EGT40884.1|  hypothetical protein CAEBREN_18266 [Caenorhabd...  38.1    2.5  
ref|YP_005732834.1|  YycJ protein [Staphylococcus aureus subsp...  37.7    2.6  
ref|XP_724702.1|  hypothetical protein [Plasmodium yoelii yoel...  38.1    2.6  
ref|WP_021722088.1|  mRNA degradation ribonuclease,metallo-bet...  37.7    2.6  
ref|WP_019414844.1|  ribonuclease J [Paenisporosarcina sp. TG20]   38.1    2.6  
dbj|BAK03165.1|  predicted protein [Hordeum vulgare subsp. vul...  37.7    2.6  
ref|WP_005896361.1|  ribonuclease J [Fusobacterium nucleatum] ...  38.1    2.7  
ref|WP_002450183.1|  metallo-hydrolase [Staphylococcus] >gb|EE...  37.7    2.7  
ref|WP_002240109.1|  hypothetical protein [Neisseria meningiti...  37.4    2.7  
ref|YP_003241988.1|  beta-lactamase domain-containing protein ...  37.7    2.7  
ref|YP_003610864.1|  carbon-phosphorus lyase complex accessory...  37.7    2.7  
ref|WP_010328334.1|  ribonuclease Z [Bacillus vallismortis]        37.7    2.8  
ref|WP_023037388.1|  hypothetical protein [Fusobacterium nucle...  38.1    2.8  
ref|WP_010358591.1|  ribonuclease [Streptomyces acidiscabies]      38.1    2.8  
ref|YP_007383798.1|  hypothetical protein A284_00115 [Staphylo...  37.7    2.8  
ref|WP_017380881.1|  ribonuclease J [Paenisporosarcina sp. TG-14]  38.1    2.9  
ref|WP_020081712.1|  hypothetical protein [Flavobacterium sp. ...  37.7    3.0  
ref|YP_004640936.1|  protein RnjA [Paenibacillus mucilaginosus...  38.1    3.0  
ref|YP_002240947.1|  carbon-phosphorus lyase complex accessory...  37.4    3.0  
ref|WP_010286295.1|  ribonuclease J [Kurthia sp. JC30]             37.7    3.0  
ref|WP_002461001.1|  metallo-hydrolase [Staphylococcus lugdune...  37.4    3.0  
gb|ABU63624.1|  YycJ [Staphylococcus lugdunensis] >gb|ABU63631...  37.4    3.0  
gb|AGZ25678.1|  metallo-beta-lactamase domain-containing prote...  37.4    3.1  
ref|YP_003472765.1|  Zn-dependent hydrolase (beta-lactamase su...  37.4    3.1  
ref|WP_023345280.1|  protein phnP [Enterobacter sp. MGH 16] >g...  37.4    3.1  
ref|YP_005759155.1|  metallo-beta-lactamase superfamily protei...  37.4    3.1  
ref|WP_019258830.1|  ribonuclease Z [Bacillus subtilis]            37.7    3.2  
ref|WP_007690669.1|  beta-lactamase [Halococcus hamelinensis] ...  37.4    3.2  
ref|YP_003564582.1|  metallo-beta-lactamase family protein [Ba...  37.7    3.2  
ref|WP_016765368.1|  ribonuclease J [Bacillus megaterium]          37.7    3.2  
ref|YP_003599303.1|  metallo-beta-lactamase family protein [Ba...  37.7    3.2  
ref|YP_008484099.1|  YycJ [Staphylococcus aureus subsp. aureus...  37.4    3.2  
gb|EJD04263.1|  hypothetical protein FOMMEDRAFT_121904 [Fomiti...  37.7    3.2  
gb|ERZ95650.1|  hypothetical protein GLOINDRAFT_309667 [Rhizop...  37.4    3.3  
ref|WP_008678274.1|  ribonuclease J [Clostridium sp. 7_2_43FAA...  37.7    3.3  
ref|WP_002260484.1|  metallo-beta-lactamase superfamily protei...  37.4    3.3  
gb|ABP68569.1|  YycJ [Staphylococcus sciuri]                       37.4    3.3  
ref|WP_017722896.1|  metal-dependent hydrolase [Staphylococcus...  37.4    3.4  
ref|YP_004877873.1|  ribonuclease Z [Bacillus subtilis subsp. ...  37.4    3.4  
ref|WP_002236237.1|  hypothetical protein [Neisseria meningiti...  37.4    3.4  
ref|WP_003236802.1|  ribonuclease Z [Bacillus subtilis] >gb|EL...  37.4    3.4  
ref|WP_006322286.1|  mRNA degradation ribonucleases J1/J2 [Ano...  37.7    3.4  
ref|WP_004890992.1|  mRNA degradation ribonuclease J1/J2 [Anox...  37.7    3.4  
ref|WP_002271902.1|  hypothetical protein [Streptococcus mutan...  37.4    3.5  
ref|WP_022828600.1|  ribonuclease Z [Flavobacterium antarcticum]   37.4    3.5  
ref|WP_018358226.1|  hypothetical protein [Porphyromonas levii]    37.4    3.5  
ref|YP_002316026.1|  mRNA degradation ribonucleases J1/J2 [Ano...  37.7    3.5  
ref|WP_010858507.1|  hypothetical protein [Lysinibacillus spha...  37.7    3.6  
ref|WP_008909869.1|  ribonuclease J [Caloramator australicus] ...  37.7    3.6  
ref|WP_019167440.1|  metallo-hydrolase [Staphylococcus interme...  37.4    3.6  
ref|WP_023323481.1|  protein phnP [Klebsiella pneumoniae] >gb|...  37.4    3.6  
ref|YP_004826872.1|  phosphonate metabolism protein PhnP [Ente...  37.4    3.6  
ref|WP_002230044.1|  hypothetical protein [Neisseria meningiti...  37.4    3.6  
ref|WP_008500051.1|  phosphonate metabolism protein PhnP [Ente...  37.4    3.7  
ref|XP_002631710.1|  Hypothetical protein CBG20910 [Caenorhabd...  37.4    3.7  
ref|WP_007805224.1|  ribonuclease Z [Flavobacterium sp. CF136]...  37.4    3.8  
ref|YP_007875636.1|  carbon-phosphorus lyase complex accessory...  37.4    3.8  
ref|WP_019804853.1|  metallo-hydrolase [Streptococcus mutans]      37.4    3.8  
ref|WP_002286339.1|  hypothetical protein [Streptococcus mutan...  37.4    3.8  
ref|WP_001803639.1|  metallo-hydrolase [Staphylococcus aureus]...  37.4    3.8  
ref|WP_008423490.1|  hypothetical protein [Clostridium sp. Mad...  37.7    3.8  
ref|WP_017305570.1|  hypothetical protein [Spirulina subsalsa]     37.7    3.9  
ref|WP_003332600.1|  beta-lactamase domain-containing protein ...  37.7    3.9  
ref|WP_002800884.1|  hypothetical protein [Microcystis aerugin...  37.7    3.9  
ref|WP_016206456.1|  RNA-metabolising metallo-beta-lactamase f...  37.7    3.9  
ref|WP_004161181.1|  hypothetical protein [Microcystis aerugin...  37.7    3.9  
ref|WP_002771686.1|  hypothetical protein [Microcystis aerugin...  37.7    4.0  
pdb|4GCW|A  Chain A, Crystal Structure Of Rnase Z In Complex W...  37.4    4.0  
ref|WP_000056644.1|  phosphonate metabolism protein PhnP [Shig...  37.0    4.1  
ref|WP_002735309.1|  metallo-beta-lactamase superfamily protei...  37.4    4.1  
ref|WP_000671041.1|  phosphonate metabolism protein PhnP [Shig...  37.0    4.1  
ref|YP_184291.1|  metallo-beta-lactamase superfamily protein [...  37.0    4.1  
ref|YP_184934.1|  metallo-beta-lactamase YycJ [Staphylococcus ...  37.0    4.2  
ref|WP_021165541.1|  ribonuclease J [Lactococcus lactis] >gb|E...  37.4    4.2  
ref|WP_002777762.1|  hypothetical protein [Microcystis aerugin...  37.4    4.2  
ref|WP_023291662.1|  protein phnP [Klebsiella pneumoniae] >gb|...  37.0    4.2  
ref|WP_000059947.1|  phosphonate metabolism protein PhnP [Shig...  37.0    4.2  
ref|WP_021212476.1|  ribonuclease J, partial [Lactococcus lact...  37.4    4.2  
ref|WP_002234384.1|  hypothetical protein [Neisseria meningiti...  37.0    4.3  
ref|NP_721860.1|  hypothetical protein SMU_1515 [Streptococcus...  37.0    4.3  
ref|WP_002748042.1|  metallo-beta-lactamase superfamily protei...  37.4    4.4  
ref|WP_009362534.1|  mRNA degradation ribonucleases J1/J2 [Ano...  37.4    4.4  
ref|WP_016517081.1|  Ribonuclease [Microcystis aeruginosa] >gb...  37.4    4.4  
ref|YP_003484507.1|  hypothetical protein SmuNN2025_0589 [Stre...  37.0    4.5  
ref|WP_005837902.1|  beta-lactamase [Eubacterium saphenum] >gb...  37.4    4.5  
ref|NP_370546.1|  hypothetical protein SAV0022 [Staphylococcus...  37.0    4.5  
ref|WP_002480275.1|  hypothetical protein [Staphylococcus simu...  37.0    4.5  
ref|YP_005324547.1|  metallo-beta-lactamase superfamily protei...  37.0    4.5  
ref|WP_008497932.1|  Zn-dependent hydrolase, RNA-metabolising ...  37.4    4.5  
ref|YP_008608688.1|  ribonuclease J [Bacillus infantis NRRL B-...  37.4    4.5  
ref|WP_002257001.1|  metallo-beta-lactamase superfamily protei...  37.0    4.6  
ref|YP_003793499.1|  hypothetical protein BACI_c37490, partial...  37.0    4.6  
ref|WP_016990843.1|  ribonuclease Z [Flavobacterium sp. ACAM 123]  37.0    4.6  
ref|WP_008430894.1|  ribonuclease J [Planococcus donghaensis] ...  37.4    4.6  
ref|YP_005738197.1|  metallo-beta-lactamase hydrolase [Staphyl...  37.0    4.6  
ref|WP_002762297.1|  hypothetical protein [Microcystis aerugin...  37.4    4.6  
ref|WP_019804161.1|  metallo-hydrolase [Streptococcus mutans]      37.0    4.6  
ref|WP_010255588.1|  ribonuclease Z [Myroides injenensis]          37.0    4.6  
ref|WP_000620658.1|  metallo-hydrolase [Staphylococcus aureus]...  37.0    4.7  
ref|XP_001748574.1|  hypothetical protein [Monosiga brevicolli...  37.4    4.7  
ref|WP_009610621.1|  beta-lactamase [Caldanaerobacter subterra...  37.0    4.7  
ref|WP_023331816.1|  protein phnP [Enterobacter sp. MGH 25] >g...  37.0    4.7  
ref|YP_002459972.1|  beta-lactamase [Desulfitobacterium hafnie...  37.4    4.8  
ref|WP_002264820.1|  hypothetical protein [Streptococcus mutan...  37.0    4.8  
ref|WP_000620656.1|  metallo-hydrolase [Staphylococcus aureus]...  37.0    4.8  
ref|WP_022587358.1|  beta-lactamase [Caldanaerobacter subterra...  37.0    4.8  
ref|WP_001806596.1|  metallo-hydrolase [Staphylococcus aureus]...  37.0    4.8  
gb|EKD56513.1|  hypothetical protein ACD_58C00166G0001 [uncult...  37.0    4.9  
ref|YP_410375.1|  carbon-phosphorus lyase complex accessory pr...  37.0    4.9  
ref|WP_021214417.1|  ribonuclease J [Lactococcus lactis] >gb|E...  37.4    4.9  
ref|YP_008428779.1|  ATP-binding protein [Thermococcus litoral...  37.0    4.9  
ref|YP_007867101.1|  Zn-dependent hydrolase YycJ/WalJ, require...  37.0    4.9  
ref|YP_005875480.1|  Ribonuclease J2 [Lactococcus lactis subsp...  37.4    4.9  
ref|WP_009171986.1|  ribonuclease J [Clostridium sp. DL-VIII] ...  37.4    4.9  
ref|WP_005707859.1|  hypothetical protein [Haemophilus paraphr...  36.6    4.9  
ref|YP_809645.1|  metallo-beta-lactamase superfamily hydrolase...  37.4    5.0  
ref|WP_002285192.1|  hypothetical protein [Streptococcus mutan...  37.0    5.0  
ref|WP_019714884.1|  ribonuclease Z [Bacillus subtilis]            37.0    5.0  
emb|CAB65404.1|  YycJ protein [Staphylococcus aureus]              37.0    5.0  
ref|WP_001813851.1|  metallo-hydrolase [Staphylococcus aureus]...  37.0    5.1  
ref|WP_001789371.1|  metallo-hydrolase [Staphylococcus aureus]...  37.0    5.1  
ref|YP_006576872.1|  carbon-phosphorus lyase complex accessory...  37.0    5.1  
ref|YP_001032203.1|  metallo-beta-lactamase superfamily protei...  37.4    5.1  
ref|YP_002531300.1|  metallo-beta-lactamase [Bacillus cereus Q...  37.4    5.1  
ref|NP_390265.1|  ribonuclease Z [Bacillus subtilis subsp. sub...  37.0    5.2  
ref|WP_017656593.1|  ribonuclease J [Bacillus sp. WBUNB009]        37.4    5.2  
ref|NP_833518.1|  Zn-dependent hydrolase [Bacillus cereus ATCC...  37.4    5.2  
ref|WP_021215755.1|  ribonuclease J [Lactococcus lactis] >gb|E...  37.4    5.2  
ref|WP_003230369.1|  ribonuclease Z [Bacillus subtilis] >gb|EH...  37.0    5.2  
ref|YP_005296497.1|  Zn-dependent hydrolase (beta-lactamasesup...  37.0    5.2  
ref|NP_267774.1|  hypothetical protein L61727 [Lactococcus lac...  37.4    5.2  
ref|YP_006999875.1|  mRNA degradation ribonuclease, metallo-be...  37.4    5.2  
ref|YP_006601600.1|  metallo-beta-lactamase [Bacillus thuringi...  37.4    5.3  
ref|WP_001978137.1|  ribonuclease J [Bacillus cereus] >gb|EAL1...  37.0    5.3  
emb|CAP37843.2|  Protein CBG20910 [Caenorhabditis briggsae]        37.0    5.3  
ref|WP_016079101.1|  ribonuclease J [Bacillus cereus] >gb|EOO7...  37.4    5.3  
ref|WP_002137917.1|  ribonuclease J [Bacillus cereus] >gb|EJV8...  37.4    5.3  
ref|WP_002190494.1|  ribonuclease J [Bacillus cereus] >gb|EJS0...  37.4    5.3  
ref|WP_000823098.1|  ribonuclease J [Bacillus cereus] >gb|EJQ2...  37.4    5.3  
ref|WP_002066808.1|  ribonuclease J [Bacillus cereus] >gb|EEL6...  37.4    5.3  
ref|WP_000823099.1|  ribonuclease J [Bacillus cereus] >gb|EEK6...  37.4    5.3  
ref|YP_003665994.1|  Zn-dependent hydrolase [Bacillus thuringi...  37.4    5.3  
ref|YP_002368599.1|  metallo-beta-lactamase [Bacillus cereus B...  37.4    5.3  
ref|YP_196079.1|  hypothetical protein ERGA_CDS_01530 [Ehrlich...  37.0    5.3  
ref|WP_016105958.1|  ribonuclease J [Bacillus cereus] >gb|EOP6...  37.0    5.3  
ref|WP_002111351.1|  ribonuclease J [Bacillus cereus] >gb|EJQ9...  37.0    5.3  
ref|WP_002199548.1|  ribonuclease J [Bacillus cereus] >gb|EJQ4...  37.0    5.3  
ref|WP_000823083.1|  ribonuclease J [Bacillus cereus group] >g...  37.0    5.3  
ref|WP_002014581.1|  ribonuclease J [Bacillus cereus] >gb|EEK7...  37.0    5.3  
ref|WP_004137470.1|  carbon-phosphorus lyase complex accessory...  36.6    5.4  
ref|YP_001211839.1|  hydrolase [Pelotomaculum thermopropionicu...  37.0    5.4  
ref|WP_002173072.1|  ribonuclease J [Bacillus cereus] >gb|EJR5...  37.0    5.4  
ref|WP_000823082.1|  ribonuclease J [Bacillus thuringiensis] >...  37.0    5.4  
ref|WP_000823091.1|  ribonuclease J [Bacillus cereus] >gb|EEL5...  37.0    5.4  
ref|WP_000823094.1|  ribonuclease J [Bacillus cereus] >gb|EEK9...  37.0    5.4  
ref|WP_000823095.1|  ribonuclease J [Bacillus cereus] >gb|EEK8...  37.0    5.4  
ref|YP_002447307.1|  metallo-beta-lactamase [Bacillus cereus G...  37.0    5.4  
ref|WP_000823092.1|  ribonuclease J [Bacillus cereus] >gb|EJR6...  37.0    5.4  
ref|WP_006095695.1|  ribonuclease J [Bacillus pseudomycoides] ...  37.0    5.4  
ref|WP_002088065.1|  ribonuclease J [Bacillus cereus group] >g...  37.0    5.4  
ref|YP_003354174.1|  mRNA degradation ribonuclease, metallo-be...  37.0    5.5  
ref|YP_037858.1|  metallo-beta-lactamase family protein [Bacil...  37.0    5.5  
ref|WP_002121721.1|  ribonuclease J [Bacillus cereus] >gb|EJQ4...  37.0    5.5  
ref|WP_000823077.1|  ribonuclease J [Bacillus cereus] >gb|EJQ1...  37.0    5.5  
ref|WP_003203719.1|  ribonuclease J [Bacillus mycoides] >gb|EE...  37.0    5.5  
ref|YP_006829788.1|  3-oxoacyl-ACP reductase [Bacillus thuring...  37.0    5.5  
ref|WP_000823073.1|  ribonuclease J [Bacillus cereus] >gb|EEK7...  37.0    5.5  
ref|WP_016911379.1|  metallo-hydrolase [Staphylococcus vitulinus]  36.6    5.5  
ref|YP_001375680.1|  beta-lactamase domain-containing protein ...  37.0    5.5  
ref|WP_002796637.1|  hypothetical protein [Microcystis aerugin...  37.0    5.5  
ref|WP_002781964.1|  conserved hypothetical protein [Microcyst...  37.0    5.5  
ref|WP_019272967.1|  hypothetical protein [Neisseria lactamica]    36.6    5.5  
ref|WP_018211211.1|  ribonuclease J [Desulfitobacterium hafnie...  37.0    5.5  
ref|WP_010295532.1|  ribonuclease J [Clostridium sp. JC122]        37.0    5.5  
ref|WP_000823074.1|  ribonuclease J [Bacillus cereus] >gb|EJS7...  37.0    5.5  
ref|WP_000823076.1|  ribonuclease J [Bacillus cereus] >gb|EJS5...  37.0    5.5  
ref|WP_000823081.1|  ribonuclease J [Bacillus cereus] >gb|EJQ5...  37.0    5.5  
ref|WP_000823072.1|  ribonuclease J [Bacillus cereus] >gb|EEK9...  37.0    5.5  
ref|WP_000823084.1|  ribonuclease J [Bacillus cereus group] >g...  37.0    5.5  
ref|YP_001646368.1|  beta-lactamase domain-containing protein ...  37.0    5.5  
ref|WP_008786951.1|  phosphonate metabolism protein PhnP [Citr...  36.6    5.6  
ref|WP_016092178.1|  ribonuclease J [Bacillus cereus] >gb|EOO1...  37.0    5.6  
ref|WP_002146114.1|  ribonuclease J [Bacillus cereus] >gb|EJQ8...  37.0    5.6  
ref|WP_000823080.1|  ribonuclease J [Bacillus cereus] >gb|EEK6...  37.0    5.6  
ref|WP_021124550.1|  metallo-beta-lactamase superfamily protei...  37.0    5.6  
ref|WP_017151281.1|  ribonuclease J [Bacillus sp. FJAT-13831]      37.0    5.6  
ref|WP_000823086.1|  ribonuclease J [Bacillus cereus] >gb|EEL8...  37.0    5.6  
ref|WP_002057374.1|  ribonuclease J [Bacillus cereus] >gb|EEL4...  37.0    5.6  
ref|WP_000823090.1|  ribonuclease J [Bacillus cereus group] >g...  37.0    5.6  
ref|YP_003207497.1|  ribonuclease J 1 (RNase J1) [Candidatus M...  37.0    5.7  
ref|YP_005573696.1|  Zn-dependent hydrolase [Bacillus thuringi...  37.0    5.7  
ref|WP_000823078.1|  ribonuclease J [Bacillus cereus] >gb|EEL8...  37.0    5.7  
ref|WP_001983549.1|  ribonuclease J [Bacillus cereus] >gb|EDX5...  37.0    5.7  
ref|NP_846177.1|  metallo-beta-lactamase [Bacillus anthracis s...  37.0    5.7  
ref|WP_018782289.1|  ribonuclease J [Bacillus sp. 95MFCvi2.1]      37.0    5.7  
ref|YP_005756491.1|  metallo-beta-lactamase superfamily protei...  36.6    5.7  
ref|WP_008046593.1|  Metal-dependent Hydrolase of the beta-lac...  36.6    5.7  
ref|WP_000823079.1|  ribonuclease J [Bacillus cereus] >gb|EJS7...  37.0    5.7  
ref|YP_003866703.1|  ribonuclease Z [Bacillus subtilis subsp. ...  37.0    5.7  
ref|YP_001661052.1|  beta-lactamase-like protein [Microcystis ...  37.0    5.8  
ref|YP_005557386.1|  ribonuclease Z [Bacillus subtilis subsp. ...  37.0    5.8  
ref|WP_016115935.1|  ribonuclease J [Bacillus cereus] >gb|EOP5...  37.0    5.8  
ref|WP_021557444.1|  protein phnP [Escherichia coli] >gb|EQW81...  36.6    5.8  
ref|WP_009708751.1|  ribonuclease J [Desmospora sp. 8437] >gb|...  37.0    5.8  
ref|WP_018764694.1|  ribonuclease J [Bacillus sp. 105MF]           37.0    5.9  
ref|WP_002751939.1|  hypothetical protein [Microcystis aerugin...  37.0    5.9  
ref|WP_019378302.1|  hypothetical protein [Virgibacillus halod...  36.6    5.9  
ref|XP_005837762.1|  hypothetical protein GUITHDRAFT_103372 [G...  37.0    5.9  
ref|WP_019835369.1|  metallo-hydrolase [Staphylococcus sp. MDS7B]  36.6    5.9  
ref|WP_019468094.1|  hypothetical protein [Staphylococcus sp. ...  36.6    5.9  
ref|WP_004127918.1|  phosphonate metabolism protein PhnP [Kleb...  36.6    5.9  
ref|YP_006791395.1|  ribonuclease J [Exiguobacterium antarctic...  37.0    5.9  
ref|WP_008202917.1|  hypothetical protein [Microcystis sp. T1-...  37.0    6.0  
ref|WP_021128089.1|  hypothetical protein [[Clostridium] sorde...  37.0    6.0  
ref|WP_003394780.1|  mRNA degradation ribonucleases J1/J2 [Ano...  37.0    6.1  
ref|YP_001814296.1|  beta-lactamase domain-containing protein ...  37.0    6.1  
ref|YP_209053.1|  hydrolase [Neisseria gonorrhoeae FA 1090] >r...  36.6    6.1  
ref|WP_002828992.1|  Zn-dependent hydrolase [Weissella parames...  37.0    6.1  
ref|WP_020079855.1|  phosphonate metabolism protein PhnP [Ente...  36.6    6.2  
ref|YP_007221262.1|  LOW QUALITY PROTEIN: hypothetical protein...  37.0    6.2  
ref|WP_003031808.1|  phosphonate metabolism protein PhnP [Citr...  36.6    6.2  
ref|XP_675528.1|  hypothetical protein [Plasmodium berghei str...  37.0    6.2  
ref|YP_004093478.1|  hypothetical protein Bcell_0465 [Bacillus...  37.0    6.3  
ref|WP_005810908.1|  ribonuclease J [Desulfitobacterium hafnie...  37.0    6.3  
ref|YP_002002828.1|  putative hydrolase [Neisseria gonorrhoeae...  36.2    6.3  
ref|WP_018306754.1|  ribonuclease J [Desulfitobacterium hafnie...  37.0    6.3  
ref|YP_518609.1|  hypothetical protein DSY2376 [Desulfitobacte...  37.0    6.3  
ref|WP_021657181.1|  ribonuclease J 1 [Clostridiales bacterium...  37.0    6.4  
ref|WP_022267388.1|  putative uncharacterized protein [Firmicu...  36.6    6.5  
ref|YP_001697342.1|  hypothetical protein Bsph_1614 [Lysinibac...  37.0    6.5  
ref|WP_008178953.1|  ribonuclease J [Bacillus sp. B14905] >gb|...  37.0    6.5  
ref|WP_016992825.1|  ribonuclease J [Lysinibacillus boronitole...  37.0    6.6  
ref|WP_019505673.1|  ribonuclease Z [Pleurocapsa sp. PCC 7319]     36.6    6.6  
ref|WP_021885432.1|  metallo-beta-lactamase domain protein [Cl...  36.6    6.6  
ref|WP_004224952.1|  ribonuclease J [Lysinibacillus fusiformis...  37.0    6.6  
ref|WP_017723698.1|  metallo-hydrolase [Staphylococcus xylosus]    36.6    6.7  
ref|WP_020618400.1|  hypothetical protein [Paenibacillus daeje...  36.6    6.7  
ref|WP_003702089.1|  hypothetical protein [Neisseria gonorrhoe...  36.2    6.7  
ref|WP_010686003.1|  beta-lactamase domain-containing protein ...  37.0    6.8  
ref|WP_023284482.1|  protein phnP [Klebsiella pneumoniae] >gb|...  36.6    6.8  
ref|WP_006258287.1|  ribonuclease Z [Myroides odoratimimus] >g...  36.6    6.9  
ref|WP_016999155.1|  metallo-hydrolase [Staphylococcus lentus]     36.6    6.9  
ref|YP_007389790.1|  Metal-dependent hydrolases of the beta-la...  36.6    6.9  
ref|YP_180028.1|  hypothetical protein Erum1610 [Ehrlichia rum...  37.0    7.0  
ref|WP_017727373.1|  ribonuclease J, partial [Bacillus sp. L1(...  36.6    7.1  
ref|WP_007086837.1|  RNA-metabolising metallo-beta-lactamase [...  36.6    7.2  
ref|WP_002506240.1|  metallo-hydrolase [Staphylococcus] >emb|C...  36.2    7.2  
ref|WP_023313827.1|  protein phnP [Klebsiella pneumoniae] >gb|...  36.2    7.2  
ref|YP_001455291.1|  hypothetical protein CKO_03779 [Citrobact...  35.4    7.3  
ref|WP_002279972.1|  hypothetical protein [Streptococcus mutan...  36.2    7.3  
ref|WP_006261567.1|  ribonuclease Z [Myroides odoratimimus] >g...  36.6    7.3  
ref|WP_010172693.1|  ribonuclease J 2 [Bacillus coahuilensis]      36.6    7.3  
ref|WP_007784159.1|  hypothetical protein [Brevibacillus sp. C...  36.2    7.3  
ref|WP_019850039.1|  hypothetical protein [Desulfitobacterium ...  36.2    7.3  
ref|WP_009484483.1|  PhnP domain protein [Klebsiella sp. MS 92...  35.4    7.4  
ref|WP_004955859.1|  phosphonate metabolism protein PhnP [Serr...  36.2    7.4  
ref|YP_006475795.1|  carbon-phosphorus lyase complex accessory...  36.2    7.4  
ref|WP_000059944.1|  phosphonate metabolism protein PhnP [Esch...  36.2    7.4  
ref|WP_021095416.1|  mRNA degradation ribonucleases J1/J2 [Ano...  36.6    7.4  
ref|WP_007976623.1|  ATP-binding protein [Haladaptatus pauciha...  36.2    7.6  
ref|XP_001612788.1|  metallo-beta-lactamase domain containing ...  37.0    7.6  
emb|CCI74706.1|  phnP [Klebsiella pneumoniae]                      36.2    7.6  
ref|YP_004063199.1|  beta-lactamase domain-containing protein ...  36.6    7.7  
ref|YP_007672577.1|  ribonuclease Z [Polaribacter sp. MED152] ...  36.6    7.7  
ref|WP_023285715.1|  protein phnP [Klebsiella pneumoniae] >gb|...  36.2    7.7  
gb|ELU44598.1|  RINT-1 family protein [Rhizoctonia solani AG-1...  37.0    7.7  
ref|WP_004872875.1|  phosphonate metabolism protein PhnP [Kleb...  35.0    7.8  
ref|YP_006014217.1|  metallo-beta-lactamase superfamily protei...  36.2    7.8  
ref|YP_003943594.1|  phosphonate metabolism protein PhnP [Ente...  36.2    7.9  
ref|YP_007225931.1|  ribonuclease Z [Echinicola vietnamensis D...  36.2    7.9  
ref|YP_004456451.1|  Zn-dependent hydrolase [Melissococcus plu...  36.6    8.0  
ref|YP_005319502.1|  Zn-dependent hydrolase [Melissococcus plu...  36.6    8.0  
ref|WP_002308039.1|  hypothetical protein [Streptococcus mutan...  36.2    8.0  
ref|WP_002240839.1|  hypothetical protein [Neisseria meningiti...  36.2    8.1  
ref|YP_001930938.1|  beta-lactamase domain-containing protein ...  36.2    8.1  
ref|WP_002284492.1|  hypothetical protein [Streptococcus mutan...  36.2    8.2  
ref|WP_005918470.1|  ribonuclease J [Fusobacterium nucleatum] ...  36.6    8.2  
ref|WP_017459509.1|  phosphonate metabolism protein PhnP [Ente...  36.2    8.2  
ref|WP_003743148.1|  hypothetical protein [Neisseria mucosa] >...  36.2    8.2  
ref|WP_019034866.1|  ribonuclease J [Peptoniphilus lacrimalis]     36.6    8.3  
ref|WP_007138723.1|  ribonuclease Z [Flavobacterium frigoris] ...  36.2    8.3  
ref|NP_243264.1|  hypothetical protein BH2398 [Bacillus halodu...  36.6    8.4  
ref|WP_009589688.1|  beta-lactamase [Paenibacillus sp. HGF5] >...  36.2    8.4  
ref|WP_007560730.1|  beta-lactamase [Methylobacterium sp. GXF4...  36.6    8.5  
ref|WP_002243666.1|  hypothetical protein [Neisseria meningiti...  35.8    8.5  
ref|WP_020062632.1|  hypothetical protein [Bacillus sp. 123MFC...  36.2    8.5  
ref|XP_005376626.1|  PREDICTED: ganglioside GM2 activator [Chi...  36.2    8.5  
ref|YP_001311199.1|  beta-lactamase domain-containing protein ...  36.6    8.7  
ref|YP_005493284.1|  hydrolase of the metallo-beta-lactamase s...  36.6    8.8  
ref|WP_018705060.1|  hypothetical protein [Bacillus fordii]        36.6    8.8  
ref|YP_003012114.1|  beta-lactamase [Paenibacillus sp. JDR-2] ...  36.6    8.8  
ref|YP_001320280.1|  beta-lactamase domain-containing protein ...  36.6    8.8  
ref|WP_019322849.1|  metallo-hydrolase [Streptococcus mutans]      36.2    9.0  
ref|YP_005081950.1|  metallo-beta-lactamase family protein [Ps...  36.6    9.1  
ref|WP_008546958.1|  beta-lactamase [Pseudovibrio sp. JE062] >...  36.6    9.1  
pdb|1Y44|A  Chain A, Crystal Structure Of Rnase Z >pdb|1Y44|B ...  36.2    9.2  
ref|WP_002230950.1|  hypothetical protein [Neisseria meningiti...  35.8    9.2  
ref|YP_003441659.1|  phosphonate metabolism protein PhnP [Kleb...  36.2    9.2  
ref|XP_003328538.1|  hypothetical protein PGTG_10497 [Puccinia...  36.2    9.3  
ref|WP_001363770.1|  carbon-phosphorus lyase complex accessory...  35.4    9.5  
ref|YP_002341891.1|  hydrolase [Neisseria meningitidis Z2491] ...  35.8    9.6  
ref|YP_005894979.1|  metallo-beta-lactamase domain-containing ...  35.8    9.6  
ref|YP_002549247.1|  metal dependent hydrolase [Agrobacterium ...  36.2    9.7  
ref|WP_023317426.1|  protein phnP [Klebsiella pneumoniae] >gb|...  35.8    9.7  
ref|WP_010736115.1|  metallo-beta-lactamase [Enterococcus mund...  36.2    9.7  
ref|YP_001598309.1|  hydrolase [Neisseria meningitidis 053442]...  35.8    9.7  
ref|WP_002245262.1|  metallo-beta-lactamase superfamily protei...  35.8    9.8  
ref|WP_002233228.1|  hypothetical protein [Neisseria meningiti...  35.8    10.0 
ref|WP_002214997.1|  hypothetical protein [Neisseria meningiti...  35.8    10.0 
ref|WP_003753560.1|  hypothetical protein [Neisseria polysacch...  35.8    10.0 
ref|WP_021569724.1|  protein phnP [Escherichia coli] >gb|ERB29...  35.8    10.0 

ALIGNMENTS
>ref|WP_018414124.1| metallo-beta-lactamase [Candidatus Pelagibacter ubique]
Length=259

 Score =   251 bits (641),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 162/207 (78%), Gaps = 0/207 (0%)

Query  2    RNILIDTSPDIKFQLLKNKVKNINNVFYTHAHADQTHGINEMRAFYIINKKKLPVYGDKI  61
            +NILIDTSPD++ QLLKNK+K+IN VFYTH HADQTHGIN++R F++INKK++PVY D  
Sbjct  47   QNILIDTSPDLRSQLLKNKIKSINKVFYTHLHADQTHGINDLRPFFLINKKQIPVYADIN  106

Query  62   TKKLLFSTFKYCFKGTSSYPATLKFINLSRIHKFDNGKDKIVIKNITVEHGLIDSKCYII  121
            TK+ L STFKYCFK +  YP+TL   +L + H+F     KI I++I V+HG I S CY+I
Sbjct  107  TKRYLLSTFKYCFKSSFGYPSTLNINSLKKKHEFIIKDKKIKIESIPVQHGKIKSICYLI  166

Query  122  NNKCAYVSDVSKIYNKDIIKLKNLKYFVVDCLRFKQHPSHFNLSDVFKIIKKIGPKKTIL  181
            NNK AY SD+S+ + KD  KLKNL+Y ++DCL ++ H +HFNL+ V +I+K + PKKTIL
Sbjct  167  NNKLAYASDISQFFKKDYKKLKNLEYLIIDCLWYRNHSAHFNLNQVLEIVKILTPKKTIL  226

Query  182  TNLHSDIDYNYLKHKLPKNIIPAYDGL  208
            TN+HSD+DY  +K KLPKNIIP +DGL
Sbjct  227  TNMHSDLDYIKVKKKLPKNIIPGFDGL  253


>ref|WP_006996917.1| metallo-beta-lactamase [Candidatus Pelagibacter ubique]
 gb|EAS84330.1| metallo-beta-lactamase family protein [Candidatus Pelagibacter 
ubique HTCC1002]
Length=259

 Score =   251 bits (640),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 159/207 (77%), Gaps = 0/207 (0%)

Query  2    RNILIDTSPDIKFQLLKNKVKNINNVFYTHAHADQTHGINEMRAFYIINKKKLPVYGDKI  61
            +NILIDTSPD++ QLLKNK+K+I+ VFYTH HADQTHGIN++R F++INKK++PVY D  
Sbjct  47   QNILIDTSPDLRSQLLKNKIKSISKVFYTHLHADQTHGINDLRPFFLINKKQIPVYADSN  106

Query  62   TKKLLFSTFKYCFKGTSSYPATLKFINLSRIHKFDNGKDKIVIKNITVEHGLIDSKCYII  121
            TKK L STFKYCFK +  YP+TL   +L + H+F     KI I++I V+HG I S CY+I
Sbjct  107  TKKYLLSTFKYCFKSSFGYPSTLNIYSLKKKHEFIIKDKKIKIESIPVQHGKIKSICYLI  166

Query  122  NNKCAYVSDVSKIYNKDIIKLKNLKYFVVDCLRFKQHPSHFNLSDVFKIIKKIGPKKTIL  181
            NNK AY SD+S  + KD  KLKNL+Y ++DCL  + H +HFNL  V +I+K + PKKTIL
Sbjct  167  NNKLAYASDISLFFKKDYKKLKNLEYLIIDCLWCRNHSAHFNLDQVLEIVKILTPKKTIL  226

Query  182  TNLHSDIDYNYLKHKLPKNIIPAYDGL  208
            TN+HSD+DY  LK KLPKNIIP +DGL
Sbjct  227  TNMHSDLDYAKLKKKLPKNIIPGFDGL  253


>ref|YP_266414.1| metallo-beta-lactamase family protein [Candidatus Pelagibacter 
ubique HTCC1062]
 ref|WP_011282101.1| metallo-beta-lactamase [Candidatus Pelagibacter ubique]
 gb|AAZ21810.1| metallo-beta-lactamase family protein [Candidatus Pelagibacter 
ubique HTCC1062]
Length=259

 Score =   251 bits (640),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 160/207 (77%), Gaps = 0/207 (0%)

Query  2    RNILIDTSPDIKFQLLKNKVKNINNVFYTHAHADQTHGINEMRAFYIINKKKLPVYGDKI  61
            +NILIDTSPD++ QLLKNK+K+I+ VFYTH HADQTHGIN++R F++INKK++PVY D  
Sbjct  47   QNILIDTSPDLRSQLLKNKIKSISKVFYTHLHADQTHGINDLRPFFLINKKQIPVYADIN  106

Query  62   TKKLLFSTFKYCFKGTSSYPATLKFINLSRIHKFDNGKDKIVIKNITVEHGLIDSKCYII  121
            TKK L STFKYCFK +  YP+TL   +L + H+F     KI I++I V+HG I S CY+I
Sbjct  107  TKKYLLSTFKYCFKSSFGYPSTLNINSLKKKHEFIIKDKKIKIESIPVQHGKIKSICYLI  166

Query  122  NNKCAYVSDVSKIYNKDIIKLKNLKYFVVDCLRFKQHPSHFNLSDVFKIIKKIGPKKTIL  181
            NNK AY SD+S  + KD  KLKNL+Y ++DCL ++ H +HFNL  V +I+K + PKKTIL
Sbjct  167  NNKLAYASDISLFFKKDYKKLKNLEYLIIDCLWYRNHSAHFNLDQVLEIVKILTPKKTIL  226

Query  182  TNLHSDIDYNYLKHKLPKNIIPAYDGL  208
            TN+HSD+DY  LK KLPKNIIP +DGL
Sbjct  227  TNMHSDLDYAKLKKKLPKNIIPGFDGL  253


>ref|WP_020169420.1| metallo-beta-lactamase [Candidatus Pelagibacter ubique]
Length=259

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 161/207 (78%), Gaps = 0/207 (0%)

Query  2    RNILIDTSPDIKFQLLKNKVKNINNVFYTHAHADQTHGINEMRAFYIINKKKLPVYGDKI  61
            +NILIDTSPD++ QLLKN++K+I+ VFYTH HADQTHGIN++R F++INKK++PVY D  
Sbjct  47   QNILIDTSPDLRSQLLKNEIKSISKVFYTHLHADQTHGINDLRPFFLINKKQIPVYADIN  106

Query  62   TKKLLFSTFKYCFKGTSSYPATLKFINLSRIHKFDNGKDKIVIKNITVEHGLIDSKCYII  121
            TKK L STFKYCFK +  YP+TL   +L + H+F     KI I++I V+HG I S CY+I
Sbjct  107  TKKYLLSTFKYCFKSSFGYPSTLNINSLKKKHEFIIKDKKIKIESIPVQHGKIKSICYLI  166

Query  122  NNKCAYVSDVSKIYNKDIIKLKNLKYFVVDCLRFKQHPSHFNLSDVFKIIKKIGPKKTIL  181
            NNK AY SD+S  + KD  KLKNL+Y ++DCL ++ H +HFNL+ V +I+K + PKKTIL
Sbjct  167  NNKLAYASDISLFFKKDYKKLKNLEYLIIDCLWYRNHSAHFNLNQVLEIVKILTPKKTIL  226

Query  182  TNLHSDIDYNYLKHKLPKNIIPAYDGL  208
            TN+HSD+DY  LK KLPKNIIP +DGL
Sbjct  227  TNMHSDLDYVKLKKKLPKNIIPGFDGL  253


>ref|YP_006756598.1| metallo-beta-lactamase family protein [alpha proteobacterium 
HIMB5]
 ref|WP_014953253.1| metallo-beta-lactamase [alpha proteobacterium HIMB5]
 gb|AFS47421.1| metallo-beta-lactamase family protein [alpha proteobacterium 
HIMB5]
Length=256

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 138/210 (66%), Gaps = 1/210 (0%)

Query  2    RNILIDTSPDIKFQLLKNKVKNINNVFYTHAHADQTHGINEMRAFYIINKKKLPVYGDKI  61
            +NILIDTSPD++ QL+ NK+ NI+ V ++H HADQTHGIN++R FYI NKK +P Y D  
Sbjct  45   KNILIDTSPDLRQQLINNKINNIDYVLFSHMHADQTHGINDLRVFYIKNKKTIPAYADAA  104

Query  62   TKKLLFSTFKYCFKG-TSSYPATLKFINLSRIHKFDNGKDKIVIKNITVEHGLIDSKCYI  120
            T K L  +F YCFK     YPA ++      I K  + +  I I +  V HG + S CYI
Sbjct  105  TTKYLKKSFSYCFKSFNKEYPAIIQLNKTKNIMKIKDKQKTIKINSFPVPHGKVKSICYI  164

Query  121  INNKCAYVSDVSKIYNKDIIKLKNLKYFVVDCLRFKQHPSHFNLSDVFKIIKKIGPKKTI  180
             + K AY+SDVS I  K     KNLKY V+DCL ++ HPSH NL  V ++ K + PKKTI
Sbjct  165  FDQKLAYISDVSNIEKKYFKYFKNLKYLVIDCLWYRYHPSHLNLEKVLELTKILKPKKTI  224

Query  181  LTNLHSDIDYNYLKHKLPKNIIPAYDGLNF  210
            LTNLHSD+DY  L  +LPK IIPAYDGL  
Sbjct  225  LTNLHSDLDYKELLKRLPKKIIPAYDGLTL  254


>ref|WP_008545261.1| metallo-beta-lactamase [Candidatus Pelagibacter sp. HTCC7211]
 gb|EDZ60536.1| metallo-beta-lactamase family protein [Candidatus Pelagibacter 
sp. HTCC7211]
Length=258

 Score =   209 bits (532),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 145/213 (68%), Gaps = 3/213 (1%)

Query  1    QRNILIDTSPDIKFQLLKNKVKNINNVFYTHAHADQTHGINEMRAFYIINKKKLPVYGDK  60
            + N+LIDTSPD++ QLL++K+K IN VFY+H HADQTHGIN++R+FY+ NKK + V+ DK
Sbjct  44   KENVLIDTSPDLRQQLLRHKIKKINKVFYSHMHADQTHGINDLRSFYLSNKKPIEVFADK  103

Query  61   ITKKLLFSTFKYCFKGTS-SYPATLKF--INLSRIHKFDNGKDKIVIKNITVEHGLIDSK  117
             T + L   F +CFK  S  YPATLK   IN       ++   KI +K I+V HG ++S 
Sbjct  104  STSQYLKDNFSFCFKSYSKEYPATLKLNKINTKNNLFVNSSIKKIEVKPISVIHGNVNSI  163

Query  118  CYIINNKCAYVSDVSKIYNKDIIKLKNLKYFVVDCLRFKQHPSHFNLSDVFKIIKKIGPK  177
            CYIIN + AY+SDVS+I  KD+   KNLKY +VDCL +  HPSH NL     +I  + PK
Sbjct  164  CYIINRELAYISDVSEILKKDLKYFKNLKYLIVDCLWYNFHPSHLNLEKSLNLINYLKPK  223

Query  178  KTILTNLHSDIDYNYLKHKLPKNIIPAYDGLNF  210
            K ILTNL   +DY  LK  +PKN+IPA+DGL  
Sbjct  224  KAILTNLSPVLDYKVLKKLVPKNVIPAHDGLTL  256


>ref|WP_017969931.1| hypothetical protein [alpha proteobacterium SCGC AAA280-P20]
Length=261

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 141/214 (66%), Gaps = 5/214 (2%)

Query  3    NILIDTSPDIKFQLLKNKVKNINNVFYTHAHADQTHGINEMRAFYIINKKKLPVYGDKIT  62
            NI+IDTSPD+K QLL NK+K I+ V YTH HADQTHGINE+R F+ INKKK+P+Y DK T
Sbjct  49   NIIIDTSPDMKNQLLNNKIKKIDFVVYTHDHADQTHGINELRPFFWINKKKIPIYADKRT  108

Query  63   KKLLFSTFKYCFKGTSSYPATLKFINLSRIHKFDNGK-DKIVIKNITVEHGLIDSKCYII  121
               L ++F+Y F   S Y   +  +N+ + + F   K + I ++ I V+HG ID   Y+ 
Sbjct  109  SNYLLNSFEYLFVKKSRYYKPILEMNIIKNNFFLKKKNNSIKLETIKVKHGDIDCNGYLF  168

Query  122  NNKCAYVSDVSKIYNKDIIKLKNLKYFVVDCLRFKQHPSHFNLSDVFKIIKKIGPKKTIL  181
             NK AY+SD S I N+ + +L NLK  ++DCL+FK+H +H N       IK + PKKTIL
Sbjct  169  -NKIAYISDCSSISNECLKRLMNLKLLIIDCLKFKRHATHLNFKTCLSYIKMLNPKKTIL  227

Query  182  TNLHSDIDYNYLKHKL---PKNIIPAYDGLNFLI  212
            TNLHSDIDY   K KL    KNIIP YDGL   I
Sbjct  228  TNLHSDIDYLSFKKKLSKISKNIIPGYDGLRVSI  261


>ref|WP_022734860.1| metallo-beta-lactamase [Candidatus Pelagibacter ubique]
Length=254

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 131/207 (63%), Gaps = 1/207 (0%)

Query  3    NILIDTSPDIKFQLLKNKVKNINNVFYTHAHADQTHGINEMRAFYIINKKKLPVYGDKIT  62
            +ILIDTSPDIK Q L NK+++++ + YTH HADQT GI EMR F+  NKKK+PVY    T
Sbjct  46   SILIDTSPDIKSQFLNNKIRSLDAIIYTHEHADQTSGIFEMRPFFWKNKKKIPVYASSRT  105

Query  63   KKLLFSTFKYCFKGTSSYPATLKFINLSRIHKFDNGKDKIVIKNITVEHGLIDSKCYIIN  122
             K L   + +CF     Y   +K   + +         ++ +    VEHG+I S  Y  +
Sbjct  106  IKELKDKYTFCFSQRHGYKPIMKANTIKKKFLIKKDNTQLFVDAFEVEHGMIKSTGYRFD  165

Query  123  NKCAYVSDVSKIYNKDIIKLKNLKYFVVDCLRFKQHPSHFNLSDVFKIIKKIGPKKTILT  182
            +  AY+SD +KI N    KL NLKY ++DCLR ++HPSHFN  D    IK + P+K ILT
Sbjct  166  D-IAYISDCNKISNSVSKKLLNLKYLIIDCLRKEKHPSHFNFDDALSFIKLVKPQKAILT  224

Query  183  NLHSDIDYNYLKHKLPKNIIPAYDGLN  209
            NLH D+DY  LK KLPKNI+PA+DGLN
Sbjct  225  NLHVDMDYFDLKRKLPKNIMPAFDGLN  251


>ref|YP_001754194.1| beta-lactamase domain-containing protein [Methylobacterium radiotolerans 
JCM 2831]
 ref|WP_012318499.1| PhnP [Methylobacterium radiotolerans]
 gb|ACB23511.1| beta-lactamase domain protein [Methylobacterium radiotolerans 
JCM 2831]
Length=267

 Score =   187 bits (475),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 129/212 (61%), Gaps = 5/212 (2%)

Query  3    NILIDTSPDIKFQLLKNKVKNINNVFYTHAHADQTHGINEMRAFYIINKKKLPVYGDKIT  62
             +L+DTSPD++ QL+   V  ++ V YTHAHAD THGI+++R   I  + ++PVY D +T
Sbjct  53   TLLVDTSPDLREQLIDAGVTRLDGVLYTHAHADHTHGIDDLRPLVIAMRARIPVYADALT  112

Query  63   KKLLFSTFKYCFKGT--SSYPATLKFINLS--RIHKFDNGKDKIVIKNITVEHGLIDSKC  118
            + LL + F YCF+    S+YP  L   +L+  R    +     I ++ + VEHG  ++  
Sbjct  113  RSLLTARFGYCFETPPGSAYPPILDLRDLAAGRDLALEGEGGAITVEALPVEHG-NEAAL  171

Query  119  YIINNKCAYVSDVSKIYNKDIIKLKNLKYFVVDCLRFKQHPSHFNLSDVFKIIKKIGPKK  178
                   AY+ DVS I    + +L+ L   ++D LR   HP+HF++SD   +I+ + P++
Sbjct  172  GFRFGAAAYMPDVSLIPEASLARLRGLDLLIIDALRDTPHPTHFSVSDALALIRAVRPRR  231

Query  179  TILTNLHSDIDYNYLKHKLPKNIIPAYDGLNF  210
             +LTNLH+D+DY  L  +LP+ I+PAYDG++ 
Sbjct  232  AVLTNLHTDLDYAALAARLPEGIVPAYDGMSL  263


>ref|WP_020095550.1| PhnP [Methylobacterium sp. 285MFTsu5.1]
Length=267

 Score =   186 bits (473),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 80/212 (38%), Positives = 129/212 (61%), Gaps = 5/212 (2%)

Query  3    NILIDTSPDIKFQLLKNKVKNINNVFYTHAHADQTHGINEMRAFYIINKKKLPVYGDKIT  62
             +L+DTSPD++ QL+   V  ++ V YTHAHAD THGI+++R   I  + ++PVY D +T
Sbjct  53   TLLVDTSPDLREQLIDAGVTRLDGVLYTHAHADHTHGIDDLRPLVIAMRARIPVYADALT  112

Query  63   KKLLFSTFKYCFKGT--SSYPATLKFINLS--RIHKFDNGKDKIVIKNITVEHGLIDSKC  118
            + LL + F YCF+    S+YP  L   +L+  R    +     I ++++ VEHG  ++  
Sbjct  113  RSLLTARFGYCFETPPGSAYPPILDLRDLAAGRDLTLEGEGGAITVESLPVEHG-NEAAL  171

Query  119  YIINNKCAYVSDVSKIYNKDIIKLKNLKYFVVDCLRFKQHPSHFNLSDVFKIIKKIGPKK  178
                   AY+ DVS I    + +L+ L   ++D LR   HP+HF++SD   +I+ + P++
Sbjct  172  GFRFGAAAYMPDVSLIPEASLARLRGLDLLIIDALRDTPHPTHFSVSDALALIESVQPRR  231

Query  179  TILTNLHSDIDYNYLKHKLPKNIIPAYDGLNF  210
             +LTNLH+D+D+  L  +LP+ I+PAYDG+  
Sbjct  232  AVLTNLHTDLDFGALAARLPEGIVPAYDGMTL  263