GOS 2188010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091138054632
Annotathon code: GOS_2188010
Sample :
  • GPS :20°31'21n; 85°24'49w
  • Caribbean Sea: Yucatan Channel - Mexico
  • Open Ocean (-2m, 27°C, 0.1-0.8 microns)
Authors
Team : Algarve 2011
Username : Geneticistas
Annotated on : 2011-05-20 16:19:45
  • Lagoa João Carvalho
  • Rodrigues João Paulo Vieira
  • Trindade Patrícia Isabel Tiago

Synopsis

  • Taxonomy: Alphaproteobacteria (NCBI info)
    Rank: class - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 28211
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order:
    Bacteria; Proteobacteria; Alphaproteobacteria;

Genomic Sequence

>JCVI_READ_1091138054632 GOS_2188010 Genomic DNA
CATTTTTACTTCTAAAATCACTTGCGCCTGCGCCTACAGGGTCCAAAACCCAAGGTATGCCAAGTAATTTTGCTTCATTTACAACTTTAATTGCACATTT
TTGCCAATGTTGATCAAAAGTTCCAATATTTATAGTTAAAGCACCGTTAATTGCTTTAGATAGATTTGCAAAAGATTTGGCTTCTTCAATTGCGTGAGCC
ATCGCAGGGGATGCCCCAATTGATAATAACATGTTTGCAGCTATATCCATAGAAACAAAGTTACTTATATTCCAAACCAATGGCGATTTTGTTTTTATTT
CCTTAAGTAAGTTTCCTGCATTAGTATCTTTTAAATAATTCATACTCTCCCTCCGCCAGTATTATCTAGATCAGGTTATAAGGGTATTTCTCAGCTTATT
ATCTAAGCACCCCTGTTATTTATGTTTATAATTATATATGACAGAAGTTTTTTAATCTACATTATTTTAAATTTAGTTATGATTAATTCTTGTTTTTTTA
TGTTATTTATTCTCTTATATAAATGAGGACATTTTATGATAATTAATCATGGAGTAAGAGGATCTATACCTACTTCAGGGACTTTTACAGTCAAATATGG
AGGTTCAACACCTTGTGTGGAAATTCTTACAAAAAATGTTCAGATTATATTTGACTGTGGTAGTGGGTTTTCTAAAGTTAAAATCAATGATACGAAACCA
ACAATAATTTTATTATCTCATTTCCATCACGATCATCTTCAAGGTCTACCATTTAATCCAACTTTATATTCCTCAAGAGAACCAATTTTAGTTGCCTGCG
CTCACAAATCAAAGCTTGAAACAAAAGAAATTATTAAGCAAAGTTTCTCGCCTCCATTTTTTCCTTTTGATTTATTAAATTTGACCAACAACGTAAAAGT
TG

Translation

[536 - 901/902]   direct strand
>GOS_2188010 Translation [536-901   direct strand]
MIINHGVRGSIPTSGTFTVKYGGSTPCVEILTKNVQIIFDCGSGFSKVKINDTKPTIILLSHFHHDHLQGLPFNPTLYSSREPILVACAHKSKLETKEII
KQSFSPPFFPFDLLNLTNNVKV

[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

The ORFs with more than 60 a.a. are likely to encode proteins. When we ran the BLAST we found significant homologies, that indicates that it is a coding ORF.


The protein domain results indicates that of five overlapping domains proteins the most likely is the beta-lactamase. Despite having an E-value slightly higher (1.6e-06) than the other possible domain with 1.6e-08, the beta-lactamase is the most informative about the protein.The Blast results show several possible domains, including a hypothetical protein which dose not have any information on the databases, and a putative hydrolase protein with much higher e-values (6e-15) and lower hits values(84.0).

To sum up these results indicate that the most likely domain is the beta-lactamase though as it is possible to observe in the raw results there are several domains with very similar results which introduces some uncertainty.


The taxonomy report indicates that the protein may belong to an alpha-proteobacteria due to the higher homology to this class. Observed results have a fairly high degree of uncertainty, as can be seen on the results of the multiple alignement where there are only 15% of conserved positions. This low level of homolgy is due to the lack of about 115 aa at the 3' end, making the sequence in study the most divergent of all significant sequences present.

As the study sequence is missing a large number of a.a., when building the trees the sequence appears separated from the other taxa. This makes it impossible to root the tree since no monophiletic group with the study sequence can be formed.


Tts possible that the protein belongs to an alpha class, but the uncertainty of this classification very high, due to the lack of homology between the study sequence and others found in the database.

ORF finding

PROTOCOL

a) SMS ORFinder / Direct strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

b) SMS ORFinder / Reverse strand / frames 1, 2 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code



RESULTS ANALYSIS


The ORF is in the direct stand, in the reading frame +2. It is complete on its 5' end, but presents no STOP codon leading to the conclusion that is not complete at the 3' end.

This sequence shows three more ORFs, one in the same stand and in the same reading frame and two others in the reverse stand in the reading frame +2.

There is no melucular weight because the protein is not complet so it is impossible to find his weight.

RAW RESULTS

a) Direct strand

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 527 to base 901.
GGACATTTTATGATAATTAATCATGGAGTAAGAGGATCTATACCTACTTCAGGGACTTTT
ACAGTCAAATATGGAGGTTCAACACCTTGTGTGGAAATTCTTACAAAAAATGTTCAGATT
ATATTTGACTGTGGTAGTGGGTTTTCTAAAGTTAAAATCAATGATACGAAACCAACAATA
ATTTTATTATCTCATTTCCATCACGATCATCTTCAAGGTCTACCATTTAATCCAACTTTA
TATTCCTCAAGAGAACCAATTTTAGTTGCCTGCGCTCACAAATCAAAGCTTGAAACAAAA
GAAATTATTAAGCAAAGTTTCTCGCCTCCATTTTTTCCTTTTGATTTATTAAATTTGACC
AACAACGTAAAAGTT

>Translation of ORF number 1 in reading frame 2 on the direct strand.
GHFMIINHGVRGSIPTSGTFTVKYGGSTPCVEILTKNVQIIFDCGSGFSKVKINDTKPTI
ILLSHFHHDHLQGLPFNPTLYSSREPILVACAHKSKLETKEIIKQSFSPPFFPFDLLNLT
NNVKV

No ORFs were found in reading frame 3.

_______________________________________________________________________________________

b) Reverse strand

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 542 to base 901.
TACTGGCGGAGGGAGAGTATGAATTATTTAAAAGATACTAATGCAGGAAACTTACTTAAG
GAAATAAAAACAAAATCGCCATTGGTTTGGAATATAAGTAACTTTGTTTCTATGGATATA
GCTGCAAACATGTTATTATCAATTGGGGCATCCCCTGCGATGGCTCACGCAATTGAAGAA
GCCAAATCTTTTGCAAATCTATCTAAAGCAATTAACGGTGCTTTAACTATAAATATTGGA
ACTTTTGATCAACATTGGCAAAAATGTGCAATTAAAGTTGTAAATGAAGCAAAATTACTT
GGCATACCTTGGGTTTTGGACCCTGTAGGCGCAGGCGCAAGTGATTTTAGAAGTAAAAAT


>Translation of ORF number 1 in reading frame 2 on the reverse strand.
YWRRESMNYLKDTNAGNLLKEIKTKSPLVWNISNFVSMDIAANMLLSIGASPAMAHAIEE
AKSFANLSKAINGALTINIGTFDQHWQKCAIKVVNEAKLLGIPWVLDPVGAGASDFRSKN


No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOL


a) Phylogeny.fr / MUSCLE


RESULTS ANALYSIS


The MSA results confirm that the protein is not complet in the 3' end, there are abut 115 amino acids missing from the sequence. The 15% of conserved position, probably due to the missing amino acids in the analyzed sequence, give us a signal that the results are not very reliable.


RAW RESULTS

H.ochraceu      --MTAFEIQFHGVRGSLASPGIHTAAVGGHTSCIEIGVAG-RRIVLDAGTGLAALGDRIL
Roseibium       -MSEEFSLRFWGVRGSTPTPGTGTLRYGGETSCLEIRAGN-ARMLVDCGSGARNLGMELC
S.fredii        MQDDTFRVKFWGVRGSLPVSGEQFLRYGGNTPCIEVRCGA-EVLIFDAGSGLREAGLSL-
R.etli          MTTELFQIKFWGVRGSIPVSGPEFDRYGGNTSCIEIRCGN-HRMLFDAGSGLREAGLSL-
A.vitis         MNSSVFQVKFWGVRGSIPVCGAEFDVYGGNTPCIEVRCGE-HRLIFDAGSGIRQAGLDM-
Sequencia       ---GHFMIINHGVRGSIPTSGTFTVKYGGSTPCVEILTKN-VQIIFDCGSGFSKVKIN--
M.tundripa      -----MKIKFWGVRGSIPTPGPSTVKYGGNTTCIEIRTDDNDLIILDAGTGIHALAQNL-
Magnetococ      -----MKIRFWGVRGSIASPGPNTLRYGGNTTCIEIRTDDDALIIIDGGTGIFPLAQTL-
R.ferrired      -----MKIRFWGVRGSIASPGPSTVRYGGNTTCIEIRTDNNELIILDAGTGIFPLSQTL-
P.tunicata      -----MKVTFYGTRGSIPTPGPNTVIYGGNTACVLLEANN-KKLILDSGTGIRLLGER--
P.atlantic      -----MRLTFYGVRGSIPTPGAEYIKYGGNTACVHIELNDGNDIIIDAGTGIRTLGQK--
                     : :   *.*** .  *      ** *.*: :       ::.* *:*         

H.ochraceu      TLGDLARPTTILLSHVHWDHIQGIPFFKPIYIAGSEIEIISGPNG-F-MPLAEVLRRQ--
Roseibium       -QKKQSADMDILFTHTHLDHICGLPFFWPAFDPDSQINAWAGHFEEPELKLADVVNRI--
S.fredii        -MSEGVSEFDVFFTHTHYDHIIGLPYFKPIYRCSSAVRFWSGHLHGK-MSTAEMINEF--
R.etli          -LADGVSDVDLFFSHCHYDHIIGLPFFKAIYYPSINVNIWSGHLDGK-MSTREMVEQF--
A.vitis         -MGDKTSNVDLFFSHCHYDHIIGLPFFKPIYNPEITVNIWSGHLAGS-MTTDQMIHQF--
Sequencia       ----DTKPTIILLSHFHHDHLQGLPFNPTLYSSREPILVACAHKS-K-LETKEIIKQS--
M.tundripa      -LKEMPVQAHIFITHTHWDHIQGLPFFIPIFIPNNHIKIY-GGID-P-VTNETINRALSV
Magnetococ      -LGQMPLTAHIFITHTHWDHIQGLPFFIPQYIPANRLVLH-GAHD-P-VEQRDLREILTY
R.ferrired      -LAELPVTANVFISHSHWDHIQGLPFFIPNFIPGNTLRLH-GAFD-P-VSGKGVEQVMAV
P.tunicata      -LAKETDSIHILLSHNHWDHIQGFPFFVPAYQANRTIHIYSAPTE-P-MQPKAILEQ---
P.atlantic      -LAAKEGDIHLLLTHNHWDHIQGFPFFTPIYQPQRNIFITPGQTT-L-AEHDNILRQ---
                          ::::* * **: *:*:  . :     :    .           :      

H.ochraceu      -MSPPFFPVAFDELSAEVRARDVGIGAR-FMVGEVQVTVARLNHPDPVYGYRLDYDGHAL
Roseibium       -MSPPVFPLAAKSLKA-LSFCDYQVGSELPVCGDATVRTMRLNHPGGACGYRIEFQGKVI
S.fredii        -MRPPWFPVGPGICQASLDTVDFRPGETLSPRKDVTVRTMSLVHPGGCVGYRVDWGGRAV
R.etli          -ISPPWFPVKTDICQATMNFRDFHAGQVLSPHEGIEIKTFTLNHPGGAIGYRIEWQGRSI
A.vitis         -VSPPYFPVKMDICKASLQFHDFRAGDILTPRPGISIGTFALDHPGGCIGYRVEWAGKVL
Sequencia       -FSPPFFPF---------------------------------------------------
M.tundripa      QLQYSFFPIREAQLNARIEYATVKPGVP-VHVGRAVITPIVLSHPVLNFGYRIDCDGQSV
Magnetococ      QYQYCYFPVREVELKANLEYVTLKEYQV-IQVGDATVSCIYMNHPVLNLGYRVNCNGKSV
R.ferrired      QLQYSYFPVREAEMKARMEYVTLKPEQS-LQIGSATVTPFLMNHPVIDFGYRIEANGKSV
P.tunicata      -MERSFFPVPPSKLSAKIHVHSLTEEVANLNIVGFEIITKAINHPNGGFAYKISCDNKTI
P.atlantic      -MSGSYFPVQFNTLPSAIALEAKPDNLRQWHIGEAKIQRQKINHPGGGSAYCITADGSKV
                      **.                                                   

H.ochraceu      VYATDTEHYSCV-DP-----------------TLRALAQGADVLIYDAQYTPEEYRGDQG
Roseibium       CIITDHEHGNVEIDA-----------------KLPGFVEGADIMIYDAMYTDEEY-----
S.fredii        ALIYDHEHEPGILDP-----------------ELLDFIAGADLMVYDCTYLESEM-----
R.etli          ALIYDIEHNPGSYDP-----------------VSLEMMQGADLVVYDCTYNEDEM-----
A.vitis         ALVFDIEHQPGELDP-----------------TALALMANADIAVYDAAFTEAEM-----
Sequencia       --------------------------------DLLNLTNNVKV-----------------
M.tundripa      FFTGDYEPQLNIYDPEDDEYAEFQSFVDAKWDEVVLAMKDVDALIVDSSYTNEEY-----
Magnetococ      FFTGDHEPITNIYADDHHYHDEYSRFIEAKDKAILDFIDQVDVLIADTSYTAAEY-----
R.ferrired      FFTGDHEPPLNIYEPGDESYDEYQGFIDEKAHSILRAMHGVDVLIADSSYTEAEY-----
P.tunicata      AYVTDNELYSKDNLKTS-------------LSQWHAFLADVDLLIHDAQYTDSEM-----
P.atlantic      VYITDNELYPPYKKSTD-------------FLDWVEFARDADLVIHDAQYMLTDM-----
                                                        ..                  

H.ochraceu      PAKVGWGHSTFEAAAELARQADVERLVLFHHDPARSDAQVEAIERRARLCFPNT------
Roseibium       ETYIGWGHSTWQKAVELAREAEVKTPVLFHHDPRRVDDELDEIGTAAADVYPGT------
S.fredii        AAYRGYGHSTGIHGSRLAMAAGIPRLAMFHHDPSRNDAALAAMEQEVQAFFAGA------
R.etli          QRFKGFGHSTWQHGTELAKMAGAKRFALFHHAPSRTDEQLAQMEAQAEAAFPGA------
A.vitis         QRYRGFGHSSWEQGVKLAEQANVGQLLLFHHAPWRTDSEMALLERLAQEAFPAT------
Sequencia       ------------------------------------------------------------
M.tundripa      ASKQGWGHGTYDSGIKLATAAKAKKLFFTHHEPTRSDTSLEIIYQNLLQNNPGT--GCEL
Magnetococ      AMKKGWGHGTYDTSVALAKACRAKKLFFTHHEPTRSDDALEKIYQETLERYPRQPGDPEY
R.ferrired      PAKKGWGHGTFNSSMAYAKAAGAKMLFCTHHEPTRSDDALEAAFRQVLLDNPPLPGGPEV
P.tunicata      PSKLGWGHSSIAQAITLGQTAKVKQLILYSHAPERTDNELNAVLAQYDKNQPMQ-----F
P.atlantic      PGKAGWGHSVAEEAVKLSMACRAKRLALYSHDHTRTDDNIAAVEAHCQELVEIAQADLEL
                                                                            

H.ochraceu      VAAREHMMITIGAMAQRSDALLCAGARSRAGAGGQSVGVEAA
Roseibium       LVAKEGLILKP-------------------------------
S.fredii        FAARDHQVIDL-------------------------------
R.etli          FAARDNQTVVI-------------------------------
A.vitis         LMARDGMLLDI-------------------------------
Sequencia       ------------------------------------------
M.tundripa      LLAQEGIDISL-------------------------------
Magnetococ      LLAQEGRYFEV-------------------------------
R.ferrired      RLAREGETYEF-------------------------------
P.tunicata      DIAKEGQVIHL-------------------------------
P.atlantic      FAAAEGMSIAL

Protein Domains

PROTOCOL

InterPro, default parameters at EBI


RESULTS ANALYSIS


The protein domain raw results suggest that the sequence encode a beta-lactamase-like protein because it has a low E-value (1.6e-06) and it is the one with more information available ,since that the other domains obtain are not even identified, except the metallo-hydrolase/oxidoreductase with a low E-Value (1.6e-08) but have very few information about it.

The Beta-lactamase protein is an ezyme that give bacteria the ability to be resistant to some antibiotics such as penicillins and cephamycins, so it has hydrolase activity.

RAW RESULTS 
  
Sequence_1	848B6A33D80A5CF9	125	Gene3D	        G3DSA:3.60.15.10 	no description	                        5	119	8.3e-09	T	14-Mar-2011	NULL	        NULL	
Sequence_1	848B6A33D80A5CF9	125	HMMPanther	PTHR13754:SF10	        SUBFAMILY NOT NAMED                 	16	76	0.00025	T	14-Mar-2011	NULL       	NULL	
Sequence_1	848B6A33D80A5CF9	125	HMMPanther	PTHR13754	        FAMILY NOT NAMED  	                16	76	0.00025	T	14-Mar-2011	NULL     	NULL	
Sequence_1	848B6A33D80A5CF9	125	superfamily	SSF56281  	        Metallo-hydrolase/oxidoreductase 	4	75	1.6e-08	T	14-Mar-2011	NULL     	NULL	
Sequence_1	848B6A33D80A5CF9	125	HMMPfam	        PF00753  	        Lactamase_B	                        30	75	1.6e-06	T	14-Mar-2011	IPR001279	Beta-lactamase-like	Molecular Function: hydrolase activity (GO:0016787)

Phylogeny

PROTOCOL:


a) Phylogeny.fr / BioNJ method /

b) Phylogeny.fr / PhyML method / no bootstrap / default substitution model /



RESULTS ANALYSIS


When comparing the two methods of trees (BioNJ, PhyML), both are very similar. The tree is unrooted because it is impossible to form in and out-groups because we can not find homologous sequence that form a monophyletic group with the organism that the sequence under study belongs to, so we can not say any taxonomic reference from these trees. This kind of results is due to the incomplet sequence that shows a large numbers of diferencs compared to the homolugus sequences.

RAW RESULTS

a) BioNJ method

                                                                                                 --------0.1-------
  
 +----------------------------------------------------------------------------------Sequencia_ORF                         [a-proteobacteria]
 |
 |                             +-----------------------------------------------------------------Roseibium_sp.            [a-proteobacteria]
 |                             |
 |                        +----+
 |                        |    |                                    +-------------------------------------------S.fredii  [a-proteobacteria]
 |                        |    +------------------------------------+   
 |                        |                                         |            +------------R.etli                      [a-proteobacteria]
 |                        |                                         +------------+
 |                    +---+                                                      +-----------------------A.vitis          [a-proteobacteria]
 |                    |   |
 |                    |   |          +----------M.tundripaludum                                                           [g-proteobacteria]
 |                    |   |          |
 |                    |   +----------+
 |            +-------+              |               +-----------------Magnetococcus_sp.                                  [proteobacteria]
 |            |       |              +---------------+
 |            |       |                              +-------------R.ferrireducens                                        [b-proteobacteria]
 |            |       |
 +------------+       +-----------------------------------------------------------------------H.ochraceum                 [d-proteobacteria]
              |
              |  
              |                             +----------------------------------P.tunicata                                 [g-proteobacteria]
              +-----------------------------+
                                            +-----------------------------P.atlantica                                     [g-proteobacteria]




b) PhyML method 

                                                                                                   -------0.2------
 
 +----------------------------------------------------------------------Sequencia_ORF                                    [a-proteobacteria]
 |
 |                               +----------------------------------------------------Roseibium_sp.                      [a-proteobacteria]
 |                               |
 |                   +-----------+
 |                   |           |-M.tundripaludum                                                                       [g-proteobacteria]
 |                   |           |       
 |                   |           |                +-------------Magnetococcus_sp.                                        [proteobacteria]
 |                   |           +----------------+
 |                   |                            +---R.ferrireducens                                                    [b-proteobacteria]
 +-------------------+
                     |---------------------------------------------------------H.ochraceum                               [d-proteobacteria]
                     |
                     |
                     |                        +--------------------P.tunicata                                            [g-proteobacteria]
                     |------------------------+
                     |                        +-----------P.atlantica                                                    [g-proteobacteria]
                     |
                     |                                                 +----------------------------------------S.fredii [a-proteobacteria]
                     |                                                 |
                     +-------------------------------------------------+
                                                                       |---------------A.vitis                           [a-proteobacteria]
                                                                       |
                                                                       +---R.etli                                        [a-proteobacteria]

Taxonomy report

PROTOCOL


A)BLASTp versus NR, NCBI default parameters apart from "Number of descriptions_1000"

B)BLASTp versus swissprot, NCBI parameters apart from "Number of descriptions_1000"


RESULTS ANALYSIS



The taxonomic classication indicates us that this sequence may belongs to an alpha-protobacteria, though there are some doubts due the low number of hits (between 2 and 4) that make this results Inaccurate.

RAW RESULTS

A)
Lineage Report

root
. cellular organisms
. . Bacteria                         [bacteria]
. . . Proteobacteria                   [proteobacteria]
. . . . Alphaproteobacteria              [a-proteobacteria]
. . . . . unclassified Alphaproteobacteria [a-proteobacteria]
. . . . . . Candidatus Puniceispirillum marinum IMCC1322 -------------  117  2 hits [a-proteobacteria]       hypothetical protein SAR116_2089 [Candidatus Puniceispirill
. . . . . . alpha proteobacterium BAL199 .............................   75  2 hits [a-proteobacteria]       hypothetical protein BAL199_10957 [alpha proteobacterium BA
. . . . . Rhizobium etli CIAT 652 ------------------------------------   85  2 hits [a-proteobacteria]       hydrolase protein, beta-lactamase superfamily [Rhizobium et
. . . . . Rhizobium leguminosarum bv. viciae 3841 ....................   84  2 hits [a-proteobacteria]       hypothetical protein pRL110071 [Rhizobium leguminosarum bv.
. . . . . Rhizobium leguminosarum bv. trifolii WSM2304 ...............   84  2 hits [a-proteobacteria]       beta-lactamase domain protein [Rhizobium leguminosarum bv. 
. . . . . Rhizobium leguminosarum bv. trifolii WSM1325 ...............   83  2 hits [a-proteobacteria]       putative hydrolase protein, beta-lactamase superfamily [Rhi
. . . . . Rhizobium etli Kim 5 .......................................   83  1 hit  [a-proteobacteria]       putative hydrolase protein, beta-lactamase superfamily [Rhi
. . . . . Rhizobium etli IE4771 ......................................   83  1 hit  [a-proteobacteria]       putative hydrolase protein, beta-lactamase superfamily [Rhi
. . . . . Rhizobium etli CFN 42 ......................................   83  2 hits [a-proteobacteria]       hypothetical protein RHE_PE00054 [Rhizobium etli CFN 42] >g
. . . . . Sinorhizobium fredii NGR234 ................................   80  2 hits [a-proteobacteria]       metal dependant beta lactamase [Sinorhizobium fredii NGR234
. . . . . Agrobacterium radiobacter K84 ..............................   80  2 hits [a-proteobacteria]       hypothetical protein Arad_9513 [Agrobacterium radiobacter K
. . . . . Agrobacterium vitis S4 .....................................   79  2 hits [a-proteobacteria]       metal dependant beta lactamase protein [Agrobacterium vitis
. . . . . Sinorhizobium medicae WSM419 ...............................   78  2 hits [a-proteobacteria]       beta-lactamase domain-containing protein [Sinorhizobium med
. . . . . Roseibium sp. TrichSKD4 ....................................   78  2 hits [a-proteobacteria]       metallo-beta-lactamase superfamily [Roseibium sp. TrichSKD4
. . . . . Sinorhizobium meliloti 1021 ................................   77  2 hits [a-proteobacteria]       hypothetical protein SM_b21254 [Sinorhizobium meliloti 1021
. . . . . Sinorhizobium meliloti BL225C ..............................   77  2 hits [a-proteobacteria]       hypothetical protein SM_b21254 [Sinorhizobium meliloti 1021
. . . . . Sinorhizobium meliloti AK83 ................................   77  2 hits [a-proteobacteria]       beta-lactamase domain-containing protein [Sinorhizobium mel
. . . . . Agrobacterium tumefaciens str. C58 .........................   75  2 hits [a-proteobacteria]       metal dependant beta lactamase protein [Agrobacterium tumef
. . . . . Agrobacterium sp. H13-3 ....................................   75  2 hits [a-proteobacteria]       metal dependent beta lactamase protein [Agrobacterium sp. H
. . . . . Mesorhizobium loti MAFF303099 ..............................   73  2 hits [a-proteobacteria]       hypothetical protein mlr3257 [Mesorhizobium loti MAFF303099
. . . . . Methylobacterium chloromethanicum CM4 ......................   72  2 hits [a-proteobacteria]       beta-lactamase domain protein [Methylobacterium chlorometha
. . . . . Methylobacterium extorquens DM4 ............................   72  2 hits [a-proteobacteria]       beta-lactamase domain protein [Methylobacterium chlorometha
. . . . . Methylobacterium populi BJ001 ..............................   72  2 hits [a-proteobacteria]       beta-lactamase domain protein [Methylobacterium populi BJ00
. . . . . Magnetospirillum magnetotacticum MS-1 ......................   72  2 hits [a-proteobacteria]       COG1235: Metal-dependent hydrolases of the beta-lactamase s
. . . . . Methylobacterium extorquens PA1 ............................   72  2 hits [a-proteobacteria]       beta-lactamase domain-containing protein [Methylobacterium 
. . . . . Labrenzia aggregata IAM 12614 ..............................   72  2 hits [a-proteobacteria]       hypothetical protein SIAM614_09458 [Stappia aggregata IAM 1
. . . . . Afipia sp. 1NLS2 ...........................................   70  2 hits [a-proteobacteria]       metal-dependent hydrolase of the beta-lactamase superfamily
. . . . . Pseudovibrio sp. JE062 .....................................   70  2 hits [a-proteobacteria]       metal dependant beta lactamase protein [Pseudovibrio sp. JE
. . . . . Methylobacterium radiotolerans JCM 2831 ....................   70  2 hits [a-proteobacteria]       beta-lactamase domain-containing protein [Methylobacterium 
. . . . . Azospirillum sp. B510 ......................................   70  4 hits [a-proteobacteria]       beta-lactamase superfamily hydrolase [Azospirillum sp. B510
. . . . . Aurantimonas manganoxydans SI85-9A1 ........................   69  4 hits [a-proteobacteria]       putative metal-dependent beta-lactamase [Aurantimonas manga
. . . . . Rhodospirillum centenum SW .................................   68  4 hits [a-proteobacteria]       metallo-beta-lactamase superfamily [Rhodospirillum centenum
. . . . . Methylobacterium nodulans ORS 2060 .........................   68  4 hits [a-proteobacteria]       beta-lactamase domain-containing protein [Methylobacterium 
. . . . . Oligotropha carboxidovorans OM5 ............................   67  2 hits [a-proteobacteria]       metal-dependent hydrolase of the beta-lactamase superfamily
. . . . . Methylobacterium sp. 4-46 ..................................   65  4 hits [a-proteobacteria]       beta-lactamase domain-containing protein [Methylobacterium 
. . . . . Rhizobium etli 8C-3 ........................................   62  1 hit  [a-proteobacteria]       putative hydrolase protein, beta-lactamase superfamily [Rhi
. . . . . Ahrensia sp. R2A130 ........................................   57  2 hits [a-proteobacteria]       beta-lactamase domain protein [Ahrensia sp. R2A130] >gi|303
. . . . . Rhodospirillum rubrum ATCC 11170 ...........................   54  2 hits [a-proteobacteria]       beta-lactamase-like [Rhodospirillum rubrum ATCC 11170] >gi|
. . . . . Magnetospirillum gryphiswaldense MSR-1 .....................   52  1 hit  [a-proteobacteria]       beta-lactamase [Magnetospirillum gryphiswaldense MSR-1]
. . . . . Hoeflea phototrophica DFL-43 ...............................   51  2 hits [a-proteobacteria]       metal dependant beta lactamase protein [Hoeflea phototrophi
. . . . . Erythrobacter sp. NAP1 .....................................   47  2 hits [a-proteobacteria]       metallo-beta-lactamase family protein [Erythrobacter sp. NA
. . . . . Magnetospirillum magneticum AMB-1 ..........................   46  2 hits [a-proteobacteria]       beta-lactamase superfamily hydrolase [Magnetospirillum magn
. . . . . Methylobacterium extorquens AM1 ............................   42  2 hits [a-proteobacteria]       putative hydrolase of beta-lactamase superfamily [Methyloba
. . . . . Bradyrhizobium japonicum USDA 110 ..........................   42  2 hits [a-proteobacteria]       hypothetical protein bll1142 [Bradyrhizobium japonicum USDA
. . . . . Rhodopseudomonas palustris BisA53 ..........................   41  2 hits [a-proteobacteria]       beta-lactamase domain-containing protein [Rhodopseudomonas 
. . . . . Labrenzia alexandrii DFL-11 ................................   40  2 hits [a-proteobacteria]       hypothetical protein SADFL11_3779 [Labrenzia alexandrii DFL
. . . . . Sphingomonas wittichii RW1 .................................   40  2 hits [a-proteobacteria]       beta-lactamase superfamily hydrolase [Sphingomonas wittichi
. . . . . Bradyrhizobium sp. BTAi1 ...................................   39  4 hits [a-proteobacteria]       hypothetical protein BBta_0796 [Bradyrhizobium sp. BTAi1] >
. . . . . Rhodopseudomonas palustris CGA009 ..........................   38  2 hits [a-proteobacteria]       Beta-lactamase-like [Rhodopseudomonas palustris CGA009] >gi
. . . . . Rhodopseudomonas palustris TIE-1 ...........................   38  2 hits [a-proteobacteria]       Beta-lactamase-like [Rhodopseudomonas palustris CGA009] >gi
. . . . . Rhodopseudomonas palustris DX-1 ............................   38  2 hits [a-proteobacteria]       hypothetical protein Rpdx1_0958 [Rhodopseudomonas palustris
. . . . . Rhodopseudomonas palustris HaA2 ............................   38  2 hits [a-proteobacteria]       Beta-lactamase-like [Rhodopseudomonas palustris HaA2] >gi|8
. . . . . Rhodopseudomonas palustris BisB5 ...........................   38  2 hits [a-proteobacteria]       beta-lactamase-like [Rhodopseudomonas palustris BisB5] >gi|
. . . . . Roseobacter sp. AzwK-3b ....................................   38  2 hits [a-proteobacteria]       beta-lactamase-like protein [Roseobacter sp. AzwK-3b] >gi|1
. . . . . Rhodopseudomonas palustris BisB18 ..........................   36  2 hits [a-proteobacteria]       beta-lactamase-like [Rhodopseudomonas palustris BisB18] >gi
. . . . . Caulobacter sp. K31 ........................................   35  2 hits [a-proteobacteria]       ribonuclease Z [Caulobacter sp. K31] >gi|167349062|gb|ABZ71
. . . . . Hyphomonas neptunium ATCC 15444 ............................   35  2 hits [a-proteobacteria]       ribonuclease Z [Hyphomonas neptunium ATCC 15444] >gi|114739
. . . . . Asticcacaulis excentricus CB 48 ............................   34  2 hits [a-proteobacteria]       signal transduction histidine kinase [Asticcacaulis excentr
. . . . . Phenylobacterium zucineum HLK1 .............................   34  2 hits [a-proteobacteria]       metallo-beta-lactamase family protein [Phenylobacterium zuc
. . . . . Oceanicola granulosus HTCC2516 .............................   34  2 hits [a-proteobacteria]       putative metallo-beta-lactamase superfamily protein [Oceani
. . . . Haliangium ochraceum DSM 14365 -------------------------------   90 12 hits [d-proteobacteria]       beta-lactamase domain protein [Haliangium ochraceum DSM 143
. . . . Myxococcus xanthus DK 1622 ...................................   84  4 hits [d-proteobacteria]       metallo-beta-lactamase family protein [Myxococcus xanthus D
. . . . Myxococcus xanthus ...........................................   84  2 hits [d-proteobacteria]       unknown [Myxococcus xanthus]
. . . . Stigmatella aurantiaca DW4/3-1 ...............................   77  8 hits [d-proteobacteria]       TaR3 [Stigmatella aurantiaca DW4/3-1] >gi|115368527|gb|EAU6
. . . . Alteromonas macleodii ATCC 27126 .............................   74  1 hit  [g-proteobacteria]       beta-lactamase-like protein [Alteromonas macleodii ATCC 271
. . . . Alteromonas macleodii 'Deep ecotype' .........................   74  2 hits [g-proteobacteria]       beta-lactamase-like protein [Alteromonas macleodii 'Deep ec
. . . . Pseudoalteromonas tunicata D2 ................................   73  2 hits [g-proteobacteria]       hypothetical protein PTD2_09024 [Pseudoalteromonas tunicata
. . . . Alteromonadales bacterium TW-7 ...............................   73  2 hits [g-proteobacteria]       metal-dependent hydrolase [Alteromonadales bacterium TW-7] 
. . . . Plesiocystis pacifica SIR-1 ..................................   73  2 hits [d-proteobacteria]       beta-lactamase-like protein [Plesiocystis pacifica SIR-1] >
. . . . Sorangium cellulosum 'So ce 56' ..............................   73  4 hits [d-proteobacteria]       hypothetical protein sce9034 [Sorangium cellulosum 'So ce 5
. . . . delta proteobacterium NaphS2 .................................   72  4 hits [d-proteobacteria]       metallo-beta-lactamase domain protein [delta proteobacteriu
. . . . Pseudoalteromonas atlantica T6c ..............................   71  2 hits [g-proteobacteria]       beta-lactamase-like [Pseudoalteromonas atlantica T6c] >gi|1
. . . . uncultured Desulfobacterium sp. ..............................   70  1 hit  [d-proteobacteria]       hypothetical protein N47_E44950 [uncultured Desulfobacteriu
. . . . Desulfococcus oleovorans Hxd3 ................................   68  2 hits [d-proteobacteria]       metal-dependent hydrolase [Desulfococcus oleovorans Hxd3] >
. . . . Desulfatibacillum alkenivorans AK-01 .........................   68  4 hits [d-proteobacteria]       beta-lactamase domain protein [Desulfatibacillum alkenivora
. . . . Methylobacter tundripaludum SV96 .............................   67  2 hits [g-proteobacteria]       beta-lactamase-like protein [Methylobacter tundripaludum SV
. . . . Magnetococcus sp. MC-1 .......................................   65  2 hits [proteobacteria]         beta-lactamase domain-containing protein [Magnetococcus sp.
. . . . Curvibacter putative symbiont of Hydra magnipapillata ........   63  1 hit  [b-proteobacteria]       hypothetical protein Csp_A09910 [Curvibacter putative symbi
. . . . Rhodoferax ferrireducens T118 ................................   63  2 hits [b-proteobacteria]       beta-lactamase-like [Rhodoferax ferrireducens T118] >gi|893
. . . . Desulfonatronospira thiodismutans ASO3-1 .....................   63  2 hits [d-proteobacteria]       metal-dependent hydrolase [Desulfonatronospira thiodismutan
. . . . Desulfohalobium retbaense DSM 5692 ...........................   62  2 hits [d-proteobacteria]       beta-lactamase domain protein [Desulfohalobium retbaense DS
. . . . Desulfobacterium autotrophicum HRM2 ..........................   61  2 hits [d-proteobacteria]       hypothetical protein HRM2_37440 [Desulfobacterium autotroph
. . . . Desulfovibrio aespoeensis Aspo-2 .............................   61  2 hits [d-proteobacteria]       beta-lactamase domain-containing protein [Desulfovibrio aes
. . . . Gallionella capsiferriformans ES-2 ...........................   60  2 hits [b-proteobacteria]       beta-lactamase domain-containing protein [Gallionella capsi
. . . . Syntrophus aciditrophicus SB .................................   59  4 hits [d-proteobacteria]       metal-dependent hydrolase [Syntrophus aciditrophicus SB] >g
. . . . Beggiatoa sp. PS .............................................   59  2 hits [g-proteobacteria]       beta-lactamase [Beggiatoa sp. PS] >gi|152066723|gb|EDN66058
. . . . Desulfobulbus propionicus DSM 2032 ...........................   58  2 hits [d-proteobacteria]       hypothetical protein Despr_0304 [Desulfobulbus propionicus 
. . . . Desulfarculus baarsii DSM 2075 ...............................   58  2 hits [d-proteobacteria]       metal-dependent hydrolase [Desulfarculus baarsii DSM 2075] 
. . . . Desulfovibrio sp. ND132 ......................................   57  2 hits [d-proteobacteria]       beta-lactamase-like protein [Desulfovibrio sp. ND132] >gi|3
. . . . Desulfotalea psychrophila LSv54 ..............................   56  2 hits [d-proteobacteria]       hypothetical protein DP0003 [Desulfotalea psychrophila LSv5
. . . . delta proteobacterium MLMS-1 .................................   56  4 hits [d-proteobacteria]       conserved hypothetical protein [delta proteobacterium MLMS-
. . . . Desulfurivibrio alkaliphilus AHT2 ............................   53  2 hits [d-proteobacteria]       hypothetical protein DaAHT2_2295 [Desulfurivibrio alkaliphi
. . . . Bdellovibrio bacteriovorus HD100 .............................   48  2 hits [d-proteobacteria]       metallo-beta-lactamase superfamily protein [Bdellovibrio ba
. . . . Desulfovibrio salexigens DSM 2638 ............................   48  2 hits [d-proteobacteria]       metallo-beta-lactamase family protein [Desulfovibrio salexi
. . . . Desulfovibrio sp. 3_1_syn3 ...................................   46  2 hits [d-proteobacteria]       GAF domain/HD domain protein [Desulfovibrio sp. 3_1_syn3] >
. . . . Dechloromonas aromatica RCB ..................................   40  2 hits [b-proteobacteria]       metallo-beta-lactamase family protein [Dechloromonas aromat
. . . . Desulfovibrio fructosovorans JJ ..............................   38  2 hits [d-proteobacteria]       conserved hypothetical protein [Desulfovibrio fructosovoran
. . . . Desulfomicrobium baculatum DSM 4028 ..........................   36  2 hits [d-proteobacteria]       beta-lactamase domain protein [Desulfomicrobium baculatum D
. . . . Achromobacter xylosoxidans A8 ................................   36  2 hits [b-proteobacteria]       metallo-beta-lactamase superfamily protein 8 [Achromobacter
. . . . Idiomarina baltica OS145 .....................................   36  2 hits [g-proteobacteria]       Possible cAMP phosphodiesterase, metallo-beta-lactamase sup
. . . . Citrobacter koseri ATCC BAA-895 ..............................   35  3 hits [enterobacteria]         ribonuclease Z [Citrobacter koseri ATCC BAA-895] >gi|166991
. . . . Pectobacterium carotovorum subsp. carotovorum WPP14 ..........   35  1 hit  [enterobacteria]         carbon-phosphorus lyase complex accessory protein [Pectobac
. . . . beta proteobacterium KB13 ....................................   35  2 hits [b-proteobacteria]       cAMP phosphodiesterase class-II [beta proteobacterium KB13]
. . . . Citrobacter sp. 30_2 .........................................   35  2 hits [enterobacteria]         ribonuclease Z [Citrobacter sp. 30_2] >gi|226907844|gb|EEH9
. . . . Pelobacter carbinolicus DSM 2380 .............................   35  2 hits [d-proteobacteria]       beta-lactamase superfamily hydrolase [Pelobacter carbinolic
. . . . Escherichia fergusonii B253 ..................................   34  1 hit  [enterobacteria]         ribonuclease BN [Escherichia fergusonii B253]
. . . . Citrobacter youngae ATCC 29220 ...............................   34  2 hits [enterobacteria]         ribonuclease Z [Citrobacter youngae ATCC 29220] >gi|2910719
. . . . Reinekea blandensis MED297 ...................................   34  2 hits [g-proteobacteria]       putative hydrolase [Reinekea sp. MED297] >gi|88779858|gb|EA
. . . . Escherichia fergusonii ECD227 ................................   34  1 hit  [enterobacteria]         ribonuclease Z [Escherichia fergusonii ECD227]
. . . . Escherichia fergusonii ATCC 35469 ............................   34  2 hits [enterobacteria]         ribonuclease Z [Escherichia fergusonii ATCC 35469] >gi|2183
. . . Deferribacter desulfuricans SSM1 -------------------------------   86  2 hits [bacteria]               hypothetical protein DEFDS_0695 [Deferribacter desulfurican
. . . Candidatus Koribacter versatilis Ellin345 ......................   80  2 hits [bacteria]               hypothetical protein Acid345_4119 [Candidatus Koribacter ve
. . . Herpetosiphon aurantiacus ATCC 23779 ...........................   78  6 hits [GNS bacteria]           beta-lactamase domain-containing protein [Herpetosiphon aur
. . . Anaerolinea thermophila UNI-1 ..................................   77  4 hits [GNS bacteria]           hypothetical protein ANT_30090 [Anaerolinea thermophila UNI
. . . Brachyspira pilosicoli 95/1000 .................................   76  2 hits [spirochetes]            putative phytochrome sensor protein [Brachyspira pilosicoli
. . . Denitrovibrio acetiphilus DSM 12809 ............................   76  2 hits [bacteria]               hypothetical protein Dacet_0875 [Denitrovibrio acetiphilus 
. . . Brachyspira murdochii DSM 12563 ................................   74  2 hits [spirochetes]            ElaC, metal-dependent hydrolase of the beta- lactamase supe
. . . Brachyspira hyodysenteriae WA1 .................................   74  2 hits [spirochetes]            ElaC, Metal-dependent hydrolases of the beta-lactamase supe
. . . Calditerrivibrio nitroreducens DSM 19672 .......................   72  2 hits [bacteria]               hypothetical protein Calni_1833 [Calditerrivibrio nitroredu
. . . Ktedonobacter racemifer DSM 44963 ..............................   72  2 hits [GNS bacteria]           beta-lactamase domain-containing protein [Ktedonobacter rac
. . . Chthoniobacter flavus Ellin428 .................................   71  4 hits [verrucomicrobia]        response regulator receiver protein [Chthoniobacter flavus 
. . . Heliobacterium modesticaldum Ice1 ..............................   70  2 hits [firmicutes]             conserved beta-lactamase domain protein [Heliobacterium mod
. . . Oscillochloris trichoides DG-6 .................................   69  6 hits [GNS bacteria]           hypothetical protein OSCT_3168 [Oscillochloris trichoides D
. . . Trichodesmium erythraeum IMS101 ................................   68  6 hits [cyanobacteria]          beta-lactamase-like [Trichodesmium erythraeum IMS101] >gi|1
. . . Microcoleus chthonoplastes PCC 7420 ............................   68  6 hits [cyanobacteria]          metallo-beta-lactamase superfamily protein [Microcoleus cht
. . . Synechococcus sp. PCC 7002 .....................................   68  2 hits [cyanobacteria]          beta-lactamase superfamily hydrolase [Synechococcus sp. PCC
. . . Thermosynechococcus elongatus BP-1 .............................   68  2 hits [cyanobacteria]          hypothetical protein tlr1981 [Thermosynechococcus elongatus
. . . Calothrix viguieri .............................................   67  1 hit  [cyanobacteria]          hypothetical protein [Calothrix viguieri]
. . . 'Nostoc azollae' 0708 ..........................................   66  4 hits [cyanobacteria]          beta-lactamase domain-containing protein ['Nostoc azollae' 
. . . Spirochaeta smaragdinae DSM 11293 ..............................   65  6 hits [spirochetes]            metallo-beta-lactamase family protein [Spirochaeta smaragdi
. . . Clostridium asparagiforme DSM 15981 ............................   65  4 hits [firmicutes]             hypothetical protein CLOSTASPAR_06613 [Clostridium asparagi
. . . Oscillatoria sp. PCC 6506 ......................................   65  6 hits [cyanobacteria]          beta-lactamase-like [Oscillatoria sp. PCC 6506] >gi|3003371
. . . Lyngbya sp. PCC 8106 ...........................................   65  6 hits [cyanobacteria]          Beta-lactamase-like protein [Lyngbya sp. PCC 8106] >gi|1194
. . . Anabaena variabilis ATCC 29413 .................................   65  4 hits [cyanobacteria]          beta-lactamase-like protein [Anabaena variabilis ATCC 29413
. . . Nostoc sp. PCC 7120 ............................................   65  4 hits [cyanobacteria]          hypothetical protein alr4847 [Nostoc sp. PCC 7120] >gi|1713
. . . Synechocystis sp. PCC 6803 .....................................   65  2 hits [cyanobacteria]          hypothetical protein sll1036 [Synechocystis sp. PCC 6803] >
. . . Cyanothece sp. PCC 8801 ........................................   64  2 hits [cyanobacteria]          beta-lactamase domain-containing protein [Cyanothece sp. PC
. . . Cyanothece sp. PCC 8802 ........................................   64  2 hits [cyanobacteria]          beta-lactamase domain-containing protein [Cyanothece sp. PC
. . . Nostoc punctiforme PCC 73102 ...................................   64  4 hits [cyanobacteria]          beta-lactamase domain-containing protein [Nostoc punctiform
. . . Microcystis aeruginosa NIES-843 ................................   64  2 hits [cyanobacteria]          beta-lactamase-like protein [Microcystis aeruginosa NIES-84
. . . Treponema vincentii ATCC 35580 .................................   64  2 hits [spirochetes]            metallo-beta-lactamase family protein [Treponema vincentii 
. . . Microcystis aeruginosa PCC 7806 ................................   64  1 hit  [cyanobacteria]          unnamed protein product [Microcystis aeruginosa PCC 7806]
. . . Crocosphaera watsonii WH 8501 ..................................   63  2 hits [cyanobacteria]          Beta-lactamase-like [Crocosphaera watsonii WH 8501] >gi|678
. . . Acaryochloris marina MBIC11017 .................................   63  2 hits [cyanobacteria]          metallo-beta-lactamase superfamily protein [Acaryochloris m
. . . Arthrospira maxima CS-328 ......................................   63  4 hits [cyanobacteria]          beta-lactamase domain protein [Arthrospira maxima CS-328] >
. . . Arthrospira platensis NIES-39 ..................................   63  3 hits [cyanobacteria]          hypothetical protein [Arthrospira platensis NIES-39]
. . . Arthrospira platensis str. Paraca ..............................   63  2 hits [cyanobacteria]          beta-lactamase-like protein [Arthrospira platensis str. Par
. . . Algoriphagus sp. PR1 ...........................................   62  2 hits [CFB group bacteria]     metallo-beta-lactamase family protein [Algoriphagus sp. PR1
. . . Cyanothece sp. PCC 7822 ........................................   62  2 hits [cyanobacteria]          beta-lactamase domain-containing protein [Cyanothece sp. PC
. . . Cyanothece sp. CCY0110 .........................................   62  2 hits [cyanobacteria]          Beta-lactamase-like protein [Cyanothece sp. CCY0110] >gi|12
. . . Cyanothece sp. ATCC 51142 ......................................   62  2 hits [cyanobacteria]          hypothetical protein cce_2009 [Cyanothece sp. ATCC 51142] >
. . . Treponema phagedenis F0421 .....................................   62  2 hits [spirochetes]            metallo-beta-lactamase domain protein [Treponema phagedenis
. . . Butyrivibrio proteoclasticus B316 ..............................   61  2 hits [firmicutes]             metallo-beta-lactamase family protein [Butyrivibrio proteoc
. . . Cyanothece sp. PCC 7425 ........................................   60  2 hits [cyanobacteria]          beta-lactamase domain-containing protein [Cyanothece sp. PC
. . . Chloroflexus aggregans DSM 9485 ................................   60  4 hits [GNS bacteria]           beta-lactamase domain-containing protein [Chloroflexus aggr
. . . Treponema denticola ATCC 35405 .................................   60  2 hits [spirochetes]            metallo-beta-lactamase family protein [Treponema denticola 
. . . Treponema denticola F0402 ......................................   60  1 hit  [spirochetes]            metallo-beta-lactamase family protein [Treponema denticola 
. . . Gemmatimonas aurantiaca T-27 ...................................   59  2 hits [bacteria]               hypothetical protein GAU_1182 [Gemmatimonas aurantiaca T-27
. . . Spirochaeta thermophila DSM 6192 ...............................   59  2 hits [spirochetes]            hypothetical protein STHERM_c10770 [Spirochaeta thermophila
. . . Spirochaeta thermophila DSM 6578 ...............................   59  2 hits [spirochetes]            hypothetical protein STHERM_c10770 [Spirochaeta thermophila
. . . Syntrophomonas wolfei subsp. wolfei str. Goettingen ............   59  2 hits [firmicutes]             beta-lactamase-like protein [Syntrophomonas wolfei subsp. w
. . . Cyanothece sp. PCC 7424 ........................................   58  2 hits [cyanobacteria]          beta-lactamase domain protein [Cyanothece sp. PCC 7424] >gi
. . . Verrucomicrobium spinosum DSM 4136 .............................   57  1 hit  [verrucomicrobia]        putative phytochrome sensor protein [Verrucomicrobium spino
. . . Clostridium bolteae ATCC BAA-613 ...............................   57  2 hits [firmicutes]             hypothetical protein CLOBOL_07324 [Clostridium bolteae ATCC
. . . Treponema pallidum subsp. pallidum str. Chicago ................   57  1 hit  [spirochetes]            metallo-beta-lactamase family protein [Treponema pallidum s
. . . Treponema pallidum subsp. pallidum str. Nichols ................   56  2 hits [spirochetes]            hypothetical protein TP0489 [Treponema pallidum subsp. pall
. . . Treponema pallidum subsp. pallidum SS14 ........................   56  2 hits [spirochetes]            hypothetical protein TP0489 [Treponema pallidum subsp. pall
. . . Chloroflexus aurantiacus J-10-fl ...............................   52  4 hits [GNS bacteria]           beta-lactamase-like protein [Chloroflexus aurantiacus J-10-
. . . Chloroflexus sp. Y-400-fl ......................................   52  4 hits [GNS bacteria]           beta-lactamase-like protein [Chloroflexus aurantiacus J-10-
. . . Coraliomargarita akajimensis DSM 45221 .........................   50  2 hits [verrucomicrobia]        metallo-beta-lactamase family protein [Coraliomargarita aka
. . . Clostridium acetobutylicum ATCC 824 ............................   49  2 hits [firmicutes]             sulphohydrolase/glycosulfatase, Zn-dependent hydrolase [Clo
. . . Clostridium acetobutylicum EA 2018 .............................   49  1 hit  [firmicutes]             sulphohydrolase/glycosulfatase, Zn-dependent hydrolase [Clo
. . . Leptospira borgpetersenii serovar Hardjo-bovis L550 ............   45  6 hits [spirochetes]            metal-dependent hydrolase [Leptospira borgpetersenii serova
. . . Leptospira borgpetersenii serovar Hardjo-bovis JB197 ...........   45  6 hits [spirochetes]            metal-dependent hydrolase [Leptospira borgpetersenii serova
. . . Ammonifex degensii KC4 .........................................   42  2 hits [firmicutes]             beta-lactamase domain protein [Ammonifex degensii KC4] >gi|
. . . Leptospira interrogans serovar Lai str. 56601 ..................   42  6 hits [spirochetes]            metal-dependent hydrolase [Leptospira interrogans serovar L
. . . Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130 .   42  6 hits [spirochetes]            metal-dependent hydrolase [Leptospira interrogans serovar L
. . . Brevibacillus brevis NBRC 100599 ...............................   41  2 hits [firmicutes]             hypothetical protein BBR47_33870 [Brevibacillus brevis NBRC
. . . Pedobacter sp. BAL39 ...........................................   41  2 hits [CFB group bacteria]     hypothetical protein PBAL39_16199 [Pedobacter sp. BAL39] >g
. . . Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)' ......   40  6 hits [spirochetes]            beta-lactamase family hydrolase [Leptospira biflexa serovar
. . . Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)' .......   40  6 hits [spirochetes]            beta-lactamase family hydrolase [Leptospira biflexa serovar
. . . Lentisphaera araneosa HTCC2155 .................................   40  2 hits [bacteria]               Beta-lactamase-like protein [Lentisphaera araneosa HTCC2155
. . . Bacillus mycoides DSM 2048 .....................................   39  2 hits [firmicutes]             Zn-dependent hydrolase (Beta-lactamase superfamily) [Bacill
. . . Bacillus cereus AH603 ..........................................   39  2 hits [firmicutes]             Zn-dependent hydrolase (Beta-lactamase superfamily) [Bacill
. . . Bacillus cereus BDRD-ST196 .....................................   39  2 hits [firmicutes]             Zn-dependent hydrolase (Beta-lactamase superfamily) [Bacill
. . . Bacillus cereus AH621 ..........................................   39  2 hits [firmicutes]             Zn-dependent hydrolase (Beta-lactamase superfamily) [Bacill
. . . Bacillus weihenstephanensis KBAB4 ..............................   39  2 hits [firmicutes]             beta-lactamase domain-containing protein [Bacillus weihenst
. . . Persephonella marina EX-H1 .....................................   39  2 hits [aquificales]            metal dependent phosphohydrolase [Persephonella marina EX-H
. . . Bacillus thuringiensis BMB171 ..................................   39  2 hits [firmicutes]             zinc-dependent hydrolase [Bacillus thuringiensis BMB171] >g
. . . Chitinophaga pinensis DSM 2588 .................................   39  2 hits [CFB group bacteria]     beta-lactamase domain protein [Chitinophaga pinensis DSM 25
. . . Bacillus cereus F65185 .........................................   39  2 hits [firmicutes]             Zn-dependent hydrolase (Beta-lactamase superfamily) [Bacill
. . . Bacillus cereus Rock4-2 ........................................   39  2 hits [firmicutes]             Zn-dependent hydrolase (Beta-lactamase superfamily) [Bacill
. . . Flavobacteriaceae bacterium 3519-10 ............................   39  2 hits [CFB group bacteria]     Metal-dependent hydrolases of the beta-lactamase superfamil
. . . Caldicellulosiruptor kristjanssonii 177R1B .....................   38  2 hits [firmicutes]             beta-lactamase domain protein [Caldicellulosiruptor kristja
. . . Caldicellulosiruptor lactoaceticus 6A ..........................   38  2 hits [firmicutes]             beta-lactamase domain protein [Caldicellulosiruptor kristja
. . . Desulfotomaculum reducens MI-1 .................................   38  2 hits [firmicutes]             beta-lactamase domain-containing protein [Desulfotomaculum 
. . . Coprobacillus sp. 29_1 .........................................   38  2 hits [firmicutes]             hypothetical protein HMPREF9488_03774 [Coprobacillus sp. 29
. . . Listeria welshimeri serovar 6b str. SLCC5334 ...................   38  4 hits [firmicutes]             metallo-beta-lactamase family protein [Listeria welshimeri 
. . . Riemerella anatipestifer DSM 15868 .............................   38  2 hits [CFB group bacteria]     metal-dependent hydrolase of the beta-lactamase superfamily
. . . Riemerella anatipestifer RA-GD .................................   38  1 hit  [CFB group bacteria]     metal-dependent hydrolase of the beta-lactamase superfamily
. . . Bacillus cereus ATCC 4342 ......................................   38  2 hits [firmicutes]             Zn-dependent hydrolase (Beta-lactamase superfamily) [Bacill
. . . Bacillus cereus G9241 ..........................................   38  2 hits [firmicutes]             mRNA 3'-end processing factor, putative [Bacillus cereus G9
. . . Riemerella anatipestifer RA-YM .................................   38  1 hit  [CFB group bacteria]     Metal-dependent hydrolases of the beta-lactamase superfamil
. . . Bacillus thuringiensis serovar sotto str. T04001 ...............   38  2 hits [firmicutes]             Zn-dependent hydrolase (Beta-lactamase superfamily) [Bacill
. . . Bacillus cereus BDRD-Cer4 ......................................   38  2 hits [firmicutes]             Zn-dependent hydrolase (Beta-lactamase superfamily) [Bacill
. . . Bacillus cereus G9842 ..........................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus cereus G984
. . . Bacillus cereus B4264 ..........................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus cereus B426
. . . Bacillus cereus Q1 .............................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus cereus Q1] 
. . . Bacillus cereus H3081.97 .......................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus cereus H308
. . . Bacillus cereus AH187 ..........................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus cereus H308
. . . Bacteroides sp. 3_1_33FAA ......................................   38  2 hits [CFB group bacteria]     metal-dependent hydrolase [Bacteroides sp. 3_1_33FAA] >gi|2
. . . Bacillus thuringiensis serovar finitimus YBT-020 ...............   38  1 hit  [firmicutes]             metallo-beta-lactamase family protein [Bacillus thuringiens
. . . Bacillus cereus biovar anthracis str. CI .......................   38  2 hits [firmicutes]             Zn-dependent hydrolase [Bacillus anthracis CI] >gi|30037549
. . . Bacillus cereus 03BB102 ........................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus cereus 03BB
. . . Bacillus cereus SJ1 ............................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus cereus 03BB
. . . Bacillus anthracis str. A0389 ..................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus anthracis s
. . . Bacillus anthracis str. Australia 94 ...........................   38  1 hit  [firmicutes]             metallo-beta-lactamase family protein [Bacillus anthracis s
. . . Bacillus cereus 03BB108 ........................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus cereus 03BB
. . . Bacillus cereus NVH0597-99 .....................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus cereus NVH0
. . . Bacillus cereus W ..............................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus cereus W] >
. . . Bacillus cereus AH820 ..........................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus cereus AH82
. . . Bacillus anthracis str. A0488 ..................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus anthracis s
. . . Bacillus anthracis str. A0442 ..................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus anthracis s
. . . Bacillus anthracis str. A0193 ..................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus anthracis s
. . . Bacillus anthracis str. A0465 ..................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus anthracis s
. . . Bacillus anthracis str. A0174 ..................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus anthracis s
. . . Bacillus anthracis Tsiankovskii-I ..............................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus anthracis s
. . . Bacillus anthracis str. CDC 684 ................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus anthracis s
. . . Bacillus anthracis str. CNEVA-9066 .............................   38  1 hit  [firmicutes]             metallo-beta-lactamase family protein [Bacillus anthracis s
. . . Bacillus anthracis str. A1055 ..................................   38  1 hit  [firmicutes]             metallo-beta-lactamase family protein [Bacillus anthracis s
. . . Bacillus anthracis str. Western North America USA6153 ..........   38  1 hit  [firmicutes]             metallo-beta-lactamase family protein [Bacillus anthracis s
. . . Bacillus anthracis str. Kruger B ...............................   38  1 hit  [firmicutes]             metallo-beta-lactamase family protein [Bacillus anthracis s
. . . Bacillus anthracis str. Vollum .................................   38  1 hit  [firmicutes]             metallo-beta-lactamase family protein [Bacillus anthracis s
. . . Bacillus thuringiensis str. Al Hakam ...........................   38  2 hits [firmicutes]             Zn-dependent hydrolase [Bacillus thuringiensis str. Al Haka
. . . Bacillus thuringiensis serovar konkukian str. 97-27 ............   38  2 hits [firmicutes]             Zn-dependent hydrolase [Bacillus thuringiensis serovar konk
. . . Bacillus anthracis str. Sterne .................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus anthracis s
. . . Bacillus cereus E33L ...........................................   38  2 hits [firmicutes]             zinc-dependent hydrolase [Bacillus cereus E33L] >gi|5197713
. . . Bacillus cereus ATCC 10987 .....................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus cereus ATCC
. . . Bacillus anthracis str. Ames ...................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus anthracis s
. . . Bacillus anthracis str. 'Ames Ancestor' ........................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus anthracis s
. . . Bacillus anthracis str. A0248 ..................................   38  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus anthracis s
. . . Bacillus anthracis str. A2012 ..................................   38  1 hit  [firmicutes]             COG1782: Predicted metal-dependent RNase, consists of a met
. . . Bacteroides sp. 9_1_42FAA ......................................   38  2 hits [CFB group bacteria]     metal-dependent hydrolase [Bacteroides sp. 9_1_42FAA] >gi|2
. . . Bacteroides dorei DSM 17855 ....................................   38  2 hits [CFB group bacteria]     hypothetical protein BACDOR_03525 [Bacteroides dorei DSM 17
. . . Bacteroides dorei 5_1_36/D4 ....................................   38  2 hits [CFB group bacteria]     hypothetical protein BACDOR_03525 [Bacteroides dorei DSM 17
. . . Bacteroides vulgatus ATCC 8482 .................................   37  2 hits [CFB group bacteria]     putative hydrolase [Bacteroides vulgatus ATCC 8482] >gi|149
. . . Conexibacter woesei DSM 14684 ..................................   37  2 hits [high GC Gram+]          ribonuclease Z [Conexibacter woesei DSM 14684] >gi|28394887
. . . Butyrivibrio crossotus DSM 2876 ................................   37  2 hits [firmicutes]             ribonuclease Z [Butyrivibrio crossotus DSM 2876] >gi|292809
. . . Bacillus cereus AH676 ..........................................   37  2 hits [firmicutes]             Zn-dependent hydrolase (Beta-lactamase superfamily) [Bacill
. . . Bacillus cereus Rock1-15 .......................................   37  2 hits [firmicutes]             Zn-dependent hydrolase (Beta-lactamase superfamily) [Bacill
. . . Bacillus sp. NRRL B-14911 ......................................   37  2 hits [firmicutes]             metal-dependent hydrolase [Bacillus sp. NRRL B-14911] >gi|8
. . . Bacillus cereus ATCC 14579 .....................................   37  2 hits [firmicutes]             zinc-dependent hydrolase [Bacillus cereus ATCC 14579] >gi|2
. . . Bacteroides vulgatus PC510 .....................................   37  2 hits [CFB group bacteria]     metallo-beta-lactamase domain protein [Bacteroides vulgatus
. . . butyrate-producing bacterium SS3/4 .............................   37  1 hit  [firmicutes]             Zn-dependent hydrolases, including glyoxylases [butyrate-pr
. . . Catonella morbi ATCC 51271 .....................................   37  2 hits [firmicutes]             hypothetical protein GCWU000282_00315 [Catonella morbi ATCC
. . . Clostridium kluyveri DSM 555 ...................................   36  2 hits [firmicutes]             hydrolase [Clostridium kluyveri DSM 555] >gi|219853364|ref|
. . . Clostridium kluyveri NBRC 12016 ................................   36  2 hits [firmicutes]             hydrolase [Clostridium kluyveri DSM 555] >gi|219853364|ref|
. . . cyanobacterium UCYN-A ..........................................   36  2 hits [cyanobacteria]          RNAse Z [cyanobacterium UCYN-A] >gi|284810037|gb|ADB95734.1
. . . Bacillus cereus 172560W ........................................   36  2 hits [firmicutes]             Zn-dependent hydrolase (Beta-lactamase superfamily) [Bacill
. . . Borrelia sp. SV1 ...............................................   36  2 hits [spirochetes]            ribonuclease Z [Borrelia sp. SV1] >gi|225371623|gb|EEH01050
. . . Bacillus pumilus ATCC 7061 .....................................   36  4 hits [firmicutes]             YhfI [Bacillus pumilus ATCC 7061] >gi|194013631|gb|EDW23196
. . . Bacillus pumilus SAFR-032 ......................................   36  2 hits [firmicutes]             metal-dependent hydrolase [Bacillus pumilus SAFR-032] >gi|1
. . . Borrelia burgdorferi 80a .......................................   36  1 hit  [spirochetes]            ribonuclease Z [Borrelia burgdorferi 80a] >gi|216264266|ref
. . . Borrelia burgdorferi 156a ......................................   36  2 hits [spirochetes]            ribonuclease Z [Borrelia burgdorferi 80a] >gi|216264266|ref
. . . Borrelia burgdorferi 72a .......................................   36  2 hits [spirochetes]            ribonuclease Z [Borrelia burgdorferi 80a] >gi|216264266|ref
. . . Borrelia burgdorferi 64b .......................................   36  2 hits [spirochetes]            ribonuclease Z [Borrelia burgdorferi 80a] >gi|216264266|ref
. . . Borrelia burgdorferi WI91-23 ...................................   36  2 hits [spirochetes]            ribonuclease Z [Borrelia burgdorferi 80a] >gi|216264266|ref
. . . Borrelia burgdorferi CA-11.2A ..................................   36  2 hits [spirochetes]            ribonuclease Z [Borrelia burgdorferi 80a] >gi|216264266|ref
. . . Borrelia burgdorferi 94a .......................................   36  2 hits [spirochetes]            ribonuclease Z [Borrelia burgdorferi 80a] >gi|216264266|ref
. . . Borrelia burgdorferi 118a ......................................   36  2 hits [spirochetes]            ribonuclease Z [Borrelia burgdorferi 80a] >gi|216264266|ref
. . . Borrelia burgdorferi 29805 .....................................   36  2 hits [spirochetes]            ribonuclease Z [Borrelia burgdorferi 80a] >gi|216264266|ref
. . . Borrelia burgdorferi JD1 .......................................   36  1 hit  [spirochetes]            ribonuclease Z [Borrelia burgdorferi 80a] >gi|216264266|ref
. . . Borrelia burgdorferi N40 .......................................   36  1 hit  [spirochetes]            ribonuclease Z [Borrelia burgdorferi 80a] >gi|216264266|ref
. . . Borrelia garinii PBr ...........................................   36  2 hits [spirochetes]            ribonuclease Z [Borrelia garinii PBr] >gi|219685602|ref|ZP_
. . . Borrelia garinii Far04 .........................................   36  2 hits [spirochetes]            ribonuclease Z [Borrelia garinii PBr] >gi|219685602|ref|ZP_
. . . Borrelia garinii PBi ...........................................   36  2 hits [spirochetes]            ribonuclease Z [Borrelia garinii PBi] >gi|56749371|sp|Q660C
. . . Borrelia garinii ...............................................   36  1 hit  [spirochetes]            ribonuclease Z [Borrelia garinii PBi] >gi|56749371|sp|Q660C
. . . Borrelia burgdorferi B31 .......................................   36  2 hits [spirochetes]            ribonuclease Z [Borrelia burgdorferi B31] >gi|218249811|ref
. . . Borrelia burgdorferi ZS7 .......................................   36  3 hits [spirochetes]            ribonuclease Z [Borrelia burgdorferi B31] >gi|218249811|ref
. . . Borrelia burgdorferi Bol26 .....................................   36  2 hits [spirochetes]            ribonuclease Z [Borrelia burgdorferi B31] >gi|218249811|ref
. . . Borrelia burgdorferi ...........................................   36  1 hit  [spirochetes]            ribonuclease Z [Borrelia burgdorferi B31] >gi|218249811|ref
. . . Lactobacillus salivarius ATCC 11741 ............................   36  2 hits [firmicutes]             metal-dependent hydrolase [Lactobacillus salivarius ATCC 11
. . . Chryseobacterium gleum ATCC 35910 ..............................   36  2 hits [CFB group bacteria]     lipoate-protein ligase B [Chryseobacterium gleum ATCC 35910
. . . Listeria monocytogenes FSL J2-071 ..............................   36  2 hits [firmicutes]             metallo-beta-lactamase [Listeria monocytogenes FSL J2-071] 
. . . Bacillus cellulosilyticus DSM 2522 .............................   36  2 hits [firmicutes]             hypothetical protein Bcell_3369 [Bacillus cellulosilyticus 
. . . Listeria monocytogenes HCC23 ...................................   36  2 hits [firmicutes]             metallo-beta-lactamase superfamily protein [Listeria monocy
. . . Listeria monocytogenes L99 .....................................   36  1 hit  [firmicutes]             metallo-beta-lactamase superfamily protein [Listeria monocy
. . . Candidatus Cloacamonas acidaminovorans .........................   36  2 hits [bacteria]               metallo-beta-lactamase family protein [Candidatus Cloacamon
. . . Borrelia spielmanii A14S .......................................   36  2 hits [spirochetes]            ribonuclease Z [Borrelia spielmanii A14S] >gi|224514131|gb|
. . . Bacillus cereus ATCC 10876 .....................................   36  2 hits [firmicutes]             Zn-dependent hydrolase (Beta-lactamase superfamily) [Bacill
. . . Bacillus cereus AH1134 .........................................   36  2 hits [firmicutes]             metallo-beta-lactamase family protein [Bacillus cereus AH11
. . . Bacteroides coprocola DSM 17136 ................................   36  2 hits [CFB group bacteria]     hypothetical protein BACCOP_03290 [Bacteroides coprocola DS
. . . Listeria monocytogenes FSL F2-208 ..............................   36  1 hit  [firmicutes]             metallo-beta-lactamase family protein [Listeria monocytogen
. . . Subdoligranulum variabile DSM 15176 ............................   36  2 hits [firmicutes]             ribonuclease Z [Subdoligranulum variabile DSM 15176] >gi|28
. . . Lactobacillus salivarius CECT 5713 .............................   36  1 hit  [firmicutes]             UPF0173 metal-dependent hydrolase [Lactobacillus salivarius
. . . Listeria monocytogenes FSL J1-208 ..............................   36  1 hit  [firmicutes]             metallo-beta-lactamase superfamily protein [Listeria monocy
. . . Candidatus Solibacter usitatus Ellin6076 .......................   35  2 hits [bacteria]               RNAse Z [Candidatus Solibacter usitatus Ellin6076] >gi|1162
. . . Bacillus subtilis subsp. spizizenii ATCC 6633 ..................   35  2 hits [firmicutes]             metal-dependent hydrolase [Bacillus subtilis subsp. spizize
. . . Bacillus subtilis subsp. spizizenii str. W23 ...................   35  2 hits [firmicutes]             metal-dependent hydrolase [Bacillus subtilis subsp. spizize
. . . Bacillus thuringiensis serovar israelensis ATCC 35646 ..........   35  2 hits [firmicutes]             putative Zn-dependent hydrolases (beta-lactamase superfamil
. . . Bacteroides sp. 4_3_47FAA ......................................   35  2 hits [CFB group bacteria]     metal-dependent hydrolase [Bacteroides sp. 4_3_47FAA] >gi|3
. . . Bacteroides sp. 3_1_40A ........................................   35  2 hits [CFB group bacteria]     metal-dependent hydrolase [Bacteroides sp. 4_3_47FAA] >gi|3
. . . Symbiobacterium thermophilum IAM 14863 .........................   35  2 hits [firmicutes]             metal-dependent hydrolase [Symbiobacterium thermophilum IAM
. . . Frankia sp. CcI3 ...............................................   35  2 hits [high GC Gram+]          beta-lactamase-like protein [Frankia sp. CcI3] >gi|86567810
. . . Listeria monocytogenes serotype 1/2a str. F6854 ................   35  2 hits [firmicutes]             metallo-beta-lactamase family protein [Listeria monocytogen
. . . Listeria monocytogenes J0161 ...................................   35  1 hit  [firmicutes]             metallo-beta-lactamase family protein [Listeria monocytogen
. . . Listeria monocytogenes J2818 ...................................   35  2 hits [firmicutes]             metallo-beta-lactamase family protein [Listeria monocytogen
. . . Listeria monocytogenes F6900 ...................................   35  2 hits [firmicutes]             metallo-beta-lactamase family protein [Listeria monocytogen
. . . Synechococcus sp. JA-3-3Ab .....................................   35  2 hits [cyanobacteria]          ribonuclease Z [Synechococcus sp. JA-3-3Ab] >gi|86554852|gb
. . . Listeria monocytogenes EGD-e ...................................   35  2 hits [firmicutes]             hypothetical protein lmo2167 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes Finland 1988 ............................   35  1 hit  [firmicutes]             hypothetical protein lmo2167 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes FSL R2-561 ..............................   35  1 hit  [firmicutes]             hypothetical protein lmo2167 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes FSL N3-165 ..............................   35  2 hits [firmicutes]             hypothetical protein lmo2167 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes 10403S ..................................   35  1 hit  [firmicutes]             hypothetical protein lmo2167 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes FSL J2-003 ..............................   35  1 hit  [firmicutes]             hypothetical protein lmo2167 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes LO28 ....................................   35  1 hit  [firmicutes]             hypothetical protein lmo2167 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes 08-5578 .................................   35  2 hits [firmicutes]             hypothetical protein lmo2167 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes 08-5923 .................................   35  2 hits [firmicutes]             hypothetical protein lmo2167 [Listeria monocytogenes EGD-e]
. . . Faecalibacterium prausnitzii A2-165 ............................   35  2 hits [firmicutes]             ribonuclease Z [Faecalibacterium prausnitzii A2-165] >gi|25
. . . Eubacterium rectale DSM 17629 ..................................   35  1 hit  [firmicutes]             RNAse Z [Eubacterium rectale DSM 17629] >gi|291528533|emb|C
. . . Eubacterium rectale M104/1 .....................................   35  1 hit  [firmicutes]             RNAse Z [Eubacterium rectale DSM 17629] >gi|291528533|emb|C
. . . Eubacterium rectale ATCC 33656 .................................   35  3 hits [firmicutes]             ribonuclease Z [Eubacterium rectale ATCC 33656] >gi|2594941
. . . Listeria monocytogenes FSL F2-515 ..............................   35  1 hit  [firmicutes]             hypothetical protein LmonF_01406 [Listeria monocytogenes FS
. . . Synechococcus sp. JA-2-3B'a(2-13) ..............................   35  2 hits [cyanobacteria]          ribonuclease Z [Synechococcus sp. JA-2-3B'a(2-13)] >gi|8655
. . . Lactobacillus salivarius ACS-116-V-Col5a .......................   35  2 hits [firmicutes]             conserved hypothetical protein [Lactobacillus salivarius AC
. . . Cytophaga hutchinsonii ATCC 33406 ..............................   35  3 hits [CFB group bacteria]     ribonuclease Z [Cytophaga hutchinsonii ATCC 33406] >gi|1230
. . . Faecalibacterium prausnitzii L2-6 ..............................   35  1 hit  [firmicutes]             Metal-dependent hydrolases of the beta-lactamase superfamil
. . . Bacillus subtilis ..............................................   35  2 hits [firmicutes]             YtkL [Bacillus subtilis]
. . . Rhodopirellula baltica SH 1 ....................................   35  2 hits [planctomycetes]         hypothetical protein RB7292 [Rhodopirellula baltica SH 1] >
. . . Listeria seeligeri FSL N1-067 ..................................   35  1 hit  [firmicutes]             metallo-beta-lactamase family protein [Listeria seeligeri F
. . . Ruminococcus gnavus ATCC 29149 .................................   35  2 hits [firmicutes]             hypothetical protein RUMGNA_00518 [Ruminococcus gnavus ATCC
. . . Bacteroides coprophilus DSM 18228 ..............................   35  2 hits [CFB group bacteria]     hypothetical protein BACCOPRO_02768 [Bacteroides coprophilu
. . . Porphyromonas endodontalis ATCC 35406 ..........................   35  2 hits [CFB group bacteria]     metallo-beta-lactamase family protein [Porphyromonas endodo
. . . Bacillus subtilis subsp. subtilis str. 168 .....................   35  3 hits [firmicutes]             metal-dependent hydrolase [Bacillus subtilis subsp. subtili
. . . Bacillus subtilis subsp. subtilis str. NCIB 3610 ...............   35  1 hit  [firmicutes]             metal-dependent hydrolase [Bacillus subtilis subsp. subtili
. . . Bacillus subtilis subsp. subtilis str. JH642 ...................   35  1 hit  [firmicutes]             metal-dependent hydrolase [Bacillus subtilis subsp. subtili
. . . Bacillus subtilis subsp. subtilis str. SMY .....................   35  1 hit  [firmicutes]             metal-dependent hydrolase [Bacillus subtilis subsp. subtili
. . . Bacillus subtilis BSn5 .........................................   35  2 hits [firmicutes]             metal-dependent hydrolase [Bacillus subtilis subsp. subtili
. . . Bacillus subtilis subsp. natto BEST195 .........................   35  1 hit  [firmicutes]             metal-dependent hydrolase [Bacillus subtilis subsp. subtili
. . . Prevotella bivia JCVIHMP010 ....................................   35  2 hits [CFB group bacteria]     ribonuclease Z [Prevotella bivia JCVIHMP010] >gi|282587689|
. . . Clostridium sp. L2-50 ..........................................   35  2 hits [firmicutes]             hypothetical protein CLOL250_01096 [Clostridium sp. L2-50] 
. . . Bacillus sp. m3-13 .............................................   35  1 hit  [firmicutes]             Metallo-beta-lactamase family protein [Bacillus sp. m3-13]
. . . Clostridiales bacterium 1_7_47FAA ..............................   35  2 hits [firmicutes]             conserved hypothetical protein [Clostridiales bacterium 1_7
. . . Faecalibacterium cf. prausnitzii KLE1255 .......................   35  2 hits [firmicutes]             putative ribonuclease Z [Faecalibacterium cf. prausnitzii K
. . . Veillonella parvula DSM 2008 ...................................   35  2 hits [firmicutes]             beta-lactamase domain protein [Veillonella parvula DSM 2008
. . . Bacteroides pectinophilus ATCC 43243 ...........................   35  2 hits [CFB group bacteria]     hypothetical protein BACPEC_00178 [Bacteroides pectinophilu
. . . Halothermothrix orenii H 168 ...................................   35  2 hits [firmicutes]             hypothetical protein Hore_18630 [Halothermothrix orenii H 1
. . . Bacteroides salanitronis DSM 18170 .............................   35  4 hits [CFB group bacteria]     beta-lactamase domain-containing protein [Bacteroides salan
. . . Borrelia afzelii PKo ...........................................   35  3 hits [spirochetes]            ribonuclease Z [Borrelia afzelii PKo] >gi|216263464|ref|ZP_
. . . Borrelia afzelii ACA-1 .........................................   35  2 hits [spirochetes]            ribonuclease Z [Borrelia afzelii PKo] >gi|216263464|ref|ZP_
. . . Pirellula staleyi DSM 6068 .....................................   35  2 hits [planctomycetes]         sulphohydrolase/glycosulfatase, Zn-dependent hydrolase [Pir
. . . Carboxydothermus hydrogenoformans Z-2901 .......................   35  2 hits [firmicutes]             metallo-beta-lactamase family protein [Carboxydothermus hyd
. . . Borrelia valaisiana VS116 ......................................   35  2 hits [spirochetes]            ribonuclease Z [Borrelia valaisiana VS116] >gi|224510993|gb
. . . Prochlorococcus marinus str. MIT 9515 ..........................   34  3 hits [cyanobacteria]          metallo-beta-lactamase superfamily protein [Prochlorococcus
. . . Cellulophaga algicola DSM 14237 ................................   34  2 hits [CFB group bacteria]     rnase z [Cellulophaga algicola DSM 14237] >gi|319423059|gb|
. . . Chlorobaculum parvum NCIB 8327 .................................   34  2 hits [green sulfur bacteria]  seceted metal-dependent hydrolase of the beta-lactamase sup
. . . Prevotella bryantii B14 ........................................   34  2 hits [CFB group bacteria]     ribonuclease Z [Prevotella bryantii B14] >gi|299775615|gb|E
. . . Clostridium sp. M62/1 ..........................................   34  2 hits [firmicutes]             VicX protein [Clostridium sp. M62/1] >gi|291074452|gb|EFE11
. . . Clostridium cf. saccharolyticum K10 ............................   34  1 hit  [firmicutes]             VicX protein [Clostridium sp. M62/1] >gi|291074452|gb|EFE11
. . . Clostridium perfringens C str. JGS1495 .........................   34  2 hits [firmicutes]             ribonuclease Z [Clostridium perfringens C str. JGS1495] >gi
. . . Clostridium perfringens B str. ATCC 3626 .......................   34  2 hits [firmicutes]             ribonuclease Z [Clostridium perfringens B str. ATCC 3626] >
. . . Clostridium perfringens NCTC 8239 ..............................   34  2 hits [firmicutes]             ribonuclease Z [Clostridium perfringens NCTC 8239] >gi|1823
. . . Bacillus halodurans C-125 ......................................   34  2 hits [firmicutes]             metal-dependent hydrolase [Bacillus halodurans C-125] >gi|1
. . . Bacillus halodurans ............................................   34  1 hit  [firmicutes]             metal-dependent hydrolase [Bacillus halodurans C-125] >gi|1
. . . Clostridium perfringens SM101 ..................................   34  3 hits [firmicutes]             ribonuclease Z [Clostridium perfringens SM101] >gi|12334179
. . . Raphidiopsis brookii D9 ........................................   34  2 hits [cyanobacteria]          Beta-lactamase-like protein [Raphidiopsis brookii D9] >gi|2
. . . Faecalibacterium prausnitzii SL3/3 .............................   34  1 hit  [firmicutes]             Metal-dependent hydrolases of the beta-lactamase superfamil
. . . Prevotella buccae D17 ..........................................   34  2 hits [CFB group bacteria]     ribonuclease Z [Prevotella buccae D17] >gi|288338220|gb|EFC
. . . Faecalibacterium prausnitzii M21/2 .............................   34  2 hits [firmicutes]             hypothetical protein FAEPRAM212_02277 [Faecalibacterium pra
. . . Ruminococcus torques L2-14 .....................................   34  1 hit  [firmicutes]             Metal-dependent hydrolases of the beta-lactamase superfamil
. . . Capnocytophaga sp. oral taxon 338 str. F0234 ...................   34  1 hit  [CFB group bacteria]     phage gp28 protein [Capnocytophaga sp. oral taxon 338 str. 
. . . Exiguobacterium sp. AT1b .......................................   34  3 hits [firmicutes]             ribonuclease Z [Exiguobacterium sp. AT1b] >gi|259494134|sp|
. . . Lactobacillus salivarius UCC118 ................................   34  3 hits [firmicutes]             metallo-beta-lactamase family protein [Lactobacillus saliva
. . . Planococcus donghaensis MPA1U2 .................................   34  2 hits [firmicutes]             metal-dependent hydrolase [Planococcus donghaensis MPA1U2] 
. . . Prevotella melaninogenica ATCC 25845 ...........................   34  2 hits [CFB group bacteria]     ribonuclease Z [Prevotella melaninogenica ATCC 25845] >gi|3
. . . Clostridium perfringens ATCC 13124 .............................   34  3 hits [firmicutes]             ribonuclease Z [Clostridium perfringens ATCC 13124] >gi|123
. . . Enterococcus faecalis ARO1/DG ..................................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis AR01/DG] >gi|25715804
. . . Enterococcus faecalis TX1346 ...................................   34  1 hit  [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1346]
. . . Enterococcus faecalis TX1322 ...................................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis ATCC 4200 ................................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis T3 .......................................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis T8 .......................................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis DS5 ......................................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis JH1 ......................................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis E1Sol ....................................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis Fly1 .....................................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis D6 .......................................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis X98 ......................................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis PC1.1 ....................................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis TUSoD Ef11 ...............................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis TX4248 ...................................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis TX2134 ...................................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis TX0109 ...................................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis TX0411 ...................................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis TX0470 ...................................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis TX2137 ...................................   34  1 hit  [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis TX4000 ...................................   34  1 hit  [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis TX0017 ...................................   34  1 hit  [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis TX0027 ...................................   34  1 hit  [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis TX2141 ...................................   34  1 hit  [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis TX0043 ...................................   34  1 hit  [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis TX0645 ...................................   34  1 hit  [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Enterococcus faecalis TX1302 ...................................   34  1 hit  [firmicutes]             ribonuclease Z [Enterococcus faecalis TX1322] >gi|256619186
. . . Brevibacterium linens BL2 ......................................   34  1 hit  [high GC Gram+]          hypothetical protein BlinB_00820 [Brevibacterium linens BL2]
. . . Enterococcus faecalis HIP11704 .................................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis HIP11704] >gi|3072730
. . . Enterococcus faecalis TX0855 ...................................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis HIP11704] >gi|3072730
. . . Paenibacillus larvae subsp. larvae BRL-230010 ..................   34  1 hit  [firmicutes]             Metallo-beta-lactamase superfamily protein [Paenibacillus l
. . . Thermoanaerobacterium xylanolyticum LX-11 ......................   34  2 hits [firmicutes]             hypothetical protein ThexyDRAFT_1772 [Thermoanaerobacterium
. . . Prevotella melaninogenica D18 ..................................   34  2 hits [CFB group bacteria]     ribonuclease Z [Prevotella melaninogenica D18] >gi|28833505
. . . Enterococcus faecalis ATCC 29200 ...............................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis ATCC 29200] >gi|25597
. . . Enterococcus faecalis T1 .......................................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis ATCC 29200] >gi|25597
. . . Enterococcus faecalis TX0102 ...................................   34  2 hits [firmicutes]             ribonuclease Z [Enterococcus faecalis ATCC 29200] >gi|25597
. . . Enterococcus faecalis TX0031 ...................................   34  1 hit  [firmicutes]             ribonuclease Z [Enterococcus faecalis ATCC 29200] >gi|25597
. . . Enterococcus faecalis TX0312 ...................................   34  1 hit  [firmicutes]             ribonuclease Z [Enterococcus faecalis ATCC 29200] >gi|25597
. . . Enterococcus faecalis TX1341 ...................................   34  1 hit  [firmicutes]             ribonuclease Z [Enterococcus faecalis ATCC 29200] >gi|25597
. . . Enterococcus faecalis 62 .......................................   34  1 hit  [firmicutes]             ribonuclease Z [Enterococcus faecalis ATCC 29200] >gi|25597
. . . Prevotella bergensis DSM 17361 .................................   34  2 hits [CFB group bacteria]     ribonuclease Z [Prevotella bergensis DSM 17361] >gi|2703327
. . . Caldicellulosiruptor saccharolyticus DSM 8903 ..................   34  2 hits [firmicutes]             beta-lactamase domain-containing protein [Caldicellulosirup
. . . Enterococcus faecalis V583 .....................................   34  2 hits [firmicutes]             AtsA/ElaC family beta-lactamase [Enterococcus faecalis V583
. . . Enterococcus faecalis TX0104 ...................................   34  2 hits [firmicutes]             AtsA/ElaC family beta-lactamase [Enterococcus faecalis V583
. . . Enterococcus faecalis HH22 .....................................   34  2 hits [firmicutes]             AtsA/ElaC family beta-lactamase [Enterococcus faecalis V583
. . . Enterococcus faecalis T2 .......................................   34  2 hits [firmicutes]             AtsA/ElaC family beta-lactamase [Enterococcus faecalis V583
. . . Enterococcus faecalis Merz96 ...................................   34  2 hits [firmicutes]             AtsA/ElaC family beta-lactamase [Enterococcus faecalis V583
. . . Enterococcus faecalis CH188 ....................................   34  2 hits [firmicutes]             AtsA/ElaC family beta-lactamase [Enterococcus faecalis V583
. . . Enterococcus faecalis T11 ......................................   34  2 hits [firmicutes]             AtsA/ElaC family beta-lactamase [Enterococcus faecalis V583
. . . Enterococcus faecalis R712 .....................................   34  2 hits [firmicutes]             AtsA/ElaC family beta-lactamase [Enterococcus faecalis V583
. . . Enterococcus faecalis S613 .....................................   34  2 hits [firmicutes]             AtsA/ElaC family beta-lactamase [Enterococcus faecalis V583
. . . Enterococcus faecalis TX0860 ...................................   34  2 hits [firmicutes]             AtsA/ElaC family beta-lactamase [Enterococcus faecalis V583
. . . Enterococcus faecalis TX0635 ...................................   34  2 hits [firmicutes]             AtsA/ElaC family beta-lactamase [Enterococcus faecalis V583
. . . Enterococcus faecalis DAPTO 512 ................................   34  2 hits [firmicutes]             AtsA/ElaC family beta-lactamase [Enterococcus faecalis V583
. . . Enterococcus faecalis DAPTO 516 ................................   34  2 hits [firmicutes]             AtsA/ElaC family beta-lactamase [Enterococcus faecalis V583
. . . Enterococcus faecalis ..........................................   34  1 hit  [firmicutes]             AtsA/ElaC family beta-lactamase [Enterococcus faecalis V583
. . . Enterococcus sp. 7L76 ..........................................   34  1 hit  [firmicutes]             AtsA/ElaC family beta-lactamase [Enterococcus faecalis V583
. . . Enterococcus faecalis TX4244 ...................................   34  1 hit  [firmicutes]             AtsA/ElaC family beta-lactamase [Enterococcus faecalis V583
. . . Enterococcus faecalis TX0012 ...................................   34  1 hit  [firmicutes]             AtsA/ElaC family beta-lactamase [Enterococcus faecalis V583
. . . Enterococcus faecalis TX1342 ...................................   34  1 hit  [firmicutes]             AtsA/ElaC family beta-lactamase [Enterococcus faecalis V583
. . . Enterococcus faecalis TX0309B ..................................   34  1 hit  [firmicutes]             AtsA/ElaC family beta-lactamase [Enterococcus faecalis V583
. . . Enterococcus faecalis TX0630 ...................................   34  1 hit  [firmicutes]             AtsA/ElaC family beta-lactamase [Enterococcus faecalis V583
. . . Enterococcus faecalis TX0309A ..................................   34  1 hit  [firmicutes]             AtsA/ElaC family beta-lactamase [Enterococcus faecalis V583
. . . Prochlorococcus marinus subsp. pastoris str. CCMP1986 ..........   34  3 hits [cyanobacteria]          hypothetical protein PMM1349 [Prochlorococcus marinus subsp
. . . Caldicellulosiruptor hydrothermalis 108 ........................   34  2 hits [firmicutes]             beta-lactamase domain protein [Caldicellulosiruptor hydroth
. . . Bacillus licheniformis ATCC 14580 ..............................   34  5 hits [firmicutes]             metal-dependent hydrolase [Bacillus licheniformis ATCC 1458
. . . Bacillus sp. BT1B_CT2 ..........................................   34  2 hits [firmicutes]             metal-dependent hydrolase [Bacillus licheniformis ATCC 1458
. . Thalassiosira pseudonana CCMP1335 --------------------------------   67  2 hits [diatoms]                hypothetical protein THAPSDRAFT_261063 [Thalassiosira pseud
. . Methanospirillum hungatei JF-1 ...................................   47  4 hits [euryarchaeotes]         sulphohydrolase/glycosulfatase, Zn-dependent hydrolase [Met
. . Trichomonas vaginalis G3 .........................................   46  4 hits [trichomonads]           RNA-metabolising metallo-beta-lactamase family protein [Tri
. . Haloquadratum walsbyi DSM 16790 ..................................   44  2 hits [euryarchaeotes]         ribonuclease Z (RNase Z) (tRNA 3 endonuclease) [Haloquadrat
. . Ferroplasma acidarmanus fer1 .....................................   43  1 hit  [euryarchaeotes]         ribonuclease Z [Ferroplasma acidarmanus fer1]
. . Acidilobus saccharovorans 345-15 .................................   42  2 hits [crenarchaeotes]         Ribonuclease Z [Acidilobus saccharovorans 345-15] >gi|30232
. . Picrophilus torridus DSM 9790 ....................................   41  5 hits [euryarchaeotes]         ribonuclease Z [Picrophilus torridus DSM 9790] >gi|56749432
. . Methanoregula boonei 6A8 .........................................   41  2 hits [euryarchaeotes]         beta-lactamase domain-containing protein [Candidatus Methan
. . uncultured methanogenic archaeon RC-I ............................   40  4 hits [euryarchaeotes]         putative metallo-beta-lactamase [uncultured methanogenic ar
. . Methanocella paludicola SANAE ....................................   40  2 hits [euryarchaeotes]         hypothetical protein MCP_0179 [Methanocella paludicola SANA
. . Methanococcus maripaludis C5 .....................................   40  4 hits [euryarchaeotes]         beta-lactamase domain-containing protein [Methanococcus mar
. . Methanococcus vannielii SB .......................................   40  2 hits [euryarchaeotes]         beta-lactamase domain-containing protein [Methanococcus van
. . Sulfolobus tokodaii str. 7 .......................................   40  3 hits [crenarchaeotes]         hypothetical protein ST0948 [Sulfolobus tokodaii str. 7] >g
. . Neospora caninum Liverpool .......................................   39  1 hit  [apicomplexans]          hypothetical protein NCLIV_014990 [Neospora caninum Liverpo
. . Methanococcus maripaludis S2 .....................................   39  4 hits [euryarchaeotes]         beta-lactamase-like protein [Methanococcus maripaludis S2] 
. . uncultured archaeon GZfos26D6 ....................................   39  1 hit  [archaea]                metallo-beta-lactamase [uncultured archaeon GZfos26D6]
. . uncultured archaeon ..............................................   39  2 hits [archaea]                ribonuclease Z [uncultured archaeon]
. . Ignisphaera aggregans DSM 17230 ..................................   39  4 hits [crenarchaeotes]         beta-lactamase domain protein [Ignisphaera aggregans DSM 17
. . Halorhabdus utahensis DSM 12940 ..................................   39  2 hits [euryarchaeotes]         ribonuclease Z [Halorhabdus utahensis DSM 12940] >gi|256692
. . Hydra magnipapillata .............................................   39  1 hit  [hydrozoans]             PREDICTED: similar to predicted protein [Hydra magnipapilla
. . Natronomonas pharaonis DSM 2160 ..................................   38  3 hits [euryarchaeotes]         hypothetical protein NP2254A [Natronomonas pharaonis DSM 21
. . Methanococcus maripaludis C6 .....................................   38  4 hits [euryarchaeotes]         beta-lactamase domain-containing protein [Methanococcus mar
. . Methanococcus maripaludis C7 .....................................   38  4 hits [euryarchaeotes]         beta-lactamase domain-containing protein [Methanococcus mar
. . Metallosphaera sedula DSM 5348 ...................................   38  3 hits [crenarchaeotes]         ribonuclease Z [Metallosphaera sedula DSM 5348] >gi|1720469
. . Methanococcus aeolicus Nankai-3 ..................................   38  2 hits [euryarchaeotes]         beta-lactamase domain-containing protein [Methanococcus aeo
. . Hyperthermus butylicus DSM 5456 ..................................   37  2 hits [crenarchaeotes]         metal-dependent hydrolase of beta lactamase, ElaC [Hyperthe
. . Schizophyllum commune H4-8 .......................................   37  2 hits [basidiomycetes]         hypothetical protein SCHCODRAFT_50876 [Schizophyllum commun
. . Ignicoccus hospitalis KIN4/I .....................................   37  3 hits [crenarchaeotes]         ribonuclease Z [Ignicoccus hospitalis KIN4/I] >gi|166991104
. . Methanothermococcus okinawensis IH1 ..............................   37  2 hits [euryarchaeotes]         RNA-metabolising metallo-beta-lactamase [Methanothermococcu
. . Sulfolobus acidocaldarius DSM 639 ................................   36  2 hits [crenarchaeotes]         metallo-beta-lactamase superfamily protein [Sulfolobus acid
. . Sulfolobus acidocaldarius ........................................   36  1 hit  [crenarchaeotes]         metallo-beta-lactamase superfamily protein [Sulfolobus acid
. . Zea mays (maize) .................................................   36  5 hits [monocots]               hypothetical protein LOC100279987 [Zea mays] >gi|219887045|
. . Methanosaeta thermophila PT ......................................   36  2 hits [euryarchaeotes]         ribonuclease Z [Methanosaeta thermophila PT] >gi|116665688|
. . Sorghum bicolor (milo) ...........................................   36  2 hits [monocots]               hypothetical protein SORBIDRAFT_01g000850 [Sorghum bicolor]
. . Nematostella vectensis ...........................................   36  2 hits [sea anemones]           predicted protein [Nematostella vectensis] >gi|156219264|gb
. . Methanobacterium sp. AL-21 .......................................   36  2 hits [euryarchaeotes]         Ribonuclease Z [Methanobacterium sp. AL-21] >gi|325329834|g
. . Toxoplasma gondii VEG ............................................   36  1 hit  [apicomplexans]          cleavage and polyadenylation specificity factor, putative [
. . Toxoplasma gondii GT1 ............................................   36  1 hit  [apicomplexans]          cleavage and polyadenylation specificity factor, putative [
. . Toxoplasma gondii ME49 ...........................................   36  2 hits [apicomplexans]          cleavage and polyadenylation specificity factor, putative [
. . Methanosarcina barkeri str. Fusaro ...............................   36  2 hits [euryarchaeotes]         ribonuclease Z [Methanosarcina barkeri str. Fusaro] >gi|723
. . Pyrococcus abyssi GE5 ............................................   36  2 hits [euryarchaeotes]         ribonuclease Z [Pyrococcus abyssi GE5] >gi|41017586|sp|Q9UZ
. . Pyrococcus abyssi ................................................   36  1 hit  [euryarchaeotes]         ribonuclease Z [Pyrococcus abyssi GE5] >gi|41017586|sp|Q9UZ
. . Penicillium marneffei ATCC 18224 .................................   36  2 hits [ascomycetes]            conserved hypothetical protein [Penicillium marneffei ATCC 
. . Methanococcus voltae A3 ..........................................   36  2 hits [euryarchaeotes]         beta-lactamase domain protein [Methanococcus voltae A3] >gi
. . Debaryomyces hansenii CBS767 .....................................   36  1 hit  [ascomycetes]            DEHA2F02134p [Debaryomyces hansenii CBS767] >gi|218511903|s
. . Debaryomyces hansenii ............................................   36  2 hits [ascomycetes]            DEHA2F02134p [Debaryomyces hansenii CBS767] >gi|218511903|s
. . Aciduliprofundum boonei T469 .....................................   36  6 hits [euryarchaeotes]         ribonuclease Z [Aciduliprofundum boonei T469] >gi|289597097
. . Candidatus Micrarchaeum acidiphilum ARMAN-2 ......................   36  1 hit  [euryarchaeotes]         ribonuclease Z [Candidatus Micrarchaeum acidiphilum ARMAN-2]
. . Methanococcoides burtonii DSM 6242 ...............................   35  2 hits [euryarchaeotes]         ribonuclease Z [Methanococcoides burtonii DSM 6242] >gi|917
. . Trichinella spiralis .............................................   35  1 hit  [nematodes]              cleavage and polyadenylation specificity factor subunit 3 [
. . Methanocaldococcus vulcanius M7 ..................................   35  2 hits [euryarchaeotes]         beta-lactamase domain protein [Methanocaldococcus vulcanius
. . Vitis vinifera (wine grape) ......................................   35  3 hits [eudicots]               unnamed protein product [Vitis vinifera]
. . Physcomitrella patens subsp. patens ..............................   35  4 hits [mosses]                 predicted protein [Physcomitrella patens subsp. patens] >gi
. . Methanocaldococcus jannaschii DSM 2661 ...........................   35  2 hits [euryarchaeotes]         putative mRNA 3'-end processing factor 3 [Methanocaldococcu
. . Methanocaldococcus jannaschii ....................................   35  1 hit  [euryarchaeotes]         putative mRNA 3'-end processing factor 3 [Methanocaldococcu
. . Arabidopsis thaliana (thale-cress) ...............................   35 13 hits [eudicots]               putative cleavage and polyadenylation specifity factor [Ara
. . Oryza sativa Japonica Group (Japanese rice) ......................   35  6 hits [monocots]               Os03g0852900 [Oryza sativa Japonica Group] >gi|27573349|gb|
. . Oryza sativa Indica Group (Indian rice) ..........................   35  1 hit  [monocots]               hypothetical protein OsI_14368 [Oryza sativa Indica Group]
. . Arabidopsis lyrata subsp. lyrata .................................   35  4 hits [eudicots]               hypothetical protein ARALYDRAFT_322516 [Arabidopsis lyrata 
. . Blastocystis hominis .............................................   35  1 hit  [eukaryotes]             unnamed protein product [Blastocystis hominis]
. . Methanocaldococcus fervens AG86 ..................................   35  2 hits [euryarchaeotes]         beta-lactamase domain protein [Methanocaldococcus fervens A
. . Natrialba magadii ATCC 43099 .....................................   35  2 hits [euryarchaeotes]         ribonuclease Z [Natrialba magadii ATCC 43099] >gi|289531092
. . Methanobrevibacter smithii DSM 2375 ..............................   35  2 hits [euryarchaeotes]         hypothetical protein METSMIALI_01601 [Methanobrevibacter sm
. . Methanosarcina mazei Go1 .........................................   35  2 hits [euryarchaeotes]         ribonuclease Z [Methanosarcina mazei Go1] >gi|41017564|sp|Q
. . Methanosarcina mazei .............................................   35  1 hit  [euryarchaeotes]         ribonuclease Z [Methanosarcina mazei Go1] >gi|41017564|sp|Q
. . Methanobrevibacter smithii DSM 2374 ..............................   35  2 hits [euryarchaeotes]         ribonuclease Z [Methanobrevibacter smithii DSM 2374] >gi|28
. . Methanobrevibacter smithii ATCC 35061 ............................   35  2 hits [euryarchaeotes]         ribonuclease Z [Methanobrevibacter smithii ATCC 35061] >gi|
. . Selaginella moellendorffii .......................................   35  6 hits [club-mosses]            hypothetical protein SELMODRAFT_234972 [Selaginella moellen
. . Thermococcus kodakarensis KOD1 ...................................   35  2 hits [euryarchaeotes]         ribonuclease Z [Thermococcus kodakarensis KOD1] >gi|7391786
. . Thermococcus kodakarensis ........................................   35  1 hit  [euryarchaeotes]         ribonuclease Z [Thermococcus kodakarensis KOD1] >gi|7391786
. . Encephalitozoon cuniculi GB-M1 ...................................   35  2 hits [microsporidians]        similarity to HYPOTHETICAL PROTEIN YO47_METJA [Encephalitoz
. . Ricinus communis .................................................   35  2 hits [eudicots]               Cleavage and polyadenylation specificity factor 73 kDa subu
. . Candida tropicalis MYA-3404 ......................................   34  2 hits [ascomycetes]            hypothetical protein CTRG_01665 [Candida tropicalis MYA-340
. . Populus trichocarpa (black cottonwood) ...........................   34  8 hits [eudicots]               predicted protein [Populus trichocarpa] >gi|222839280|gb|EE
. . Trypanosoma brucei TREU927 .......................................   34  1 hit  [kinetoplastids]         cleavage and polyadenylation specificity factor subunit [Tr
. . Trypanosoma brucei ...............................................   34  2 hits [kinetoplastids]         cleavage and polyadenylation specificity factor subunit [Tr
. . Trypanosoma brucei gambiense DAL972 ..............................   34  1 hit  [kinetoplastids]         cleavage and polyadenylation specificity factor subunit, pu
. . Entamoeba histolytica HM-1:IMSS ..................................   34  2 hits [eukaryotes]             metallo-beta-lactamase family protein [Entamoeba histolytic
. . Methanocaldococcus sp. FS406-22 ..................................   34  2 hits [euryarchaeotes]         RNA-metabolising metallo-beta-lactamase [Methanocaldococcus
. . Entamoeba dispar SAW760 ..........................................   34  2 hits [eukaryotes]             cleavage and polyadenylation specificity factor [Entamoeba 
. . Methanosarcina acetivorans C2A ...................................   34  2 hits [euryarchaeotes]         ribonuclease Z [Methanosarcina acetivorans C2A] >gi|4101756
. . Methanosarcina acetivorans .......................................   34  1 hit  [euryarchaeotes]         ribonuclease Z [Methanosarcina acetivorans C2A] >gi|4101756
. . Plasmodium yoelii yoelii str. 17XNL ..............................   34  1 hit  [apicomplexans]          cleavage and polyadenylation specificity factor, 73 kDa sub
. . Plasmodium yoelii yoelii .........................................   34  1 hit  [apicomplexans]          cleavage and polyadenylation specificity factor, 73 kDa sub
. . Halogeometricum borinquense DSM 11551 ............................   34  2 hits [euryarchaeotes]         rnase z [Halogeometricum borinquense DSM 11551] >gi|3122940
. . Micromonas sp. RCC299 ............................................   34  2 hits [green algae]            predicted protein [Micromonas sp. RCC299] >gi|226524082|gb|
. . Plasmodium knowlesi strain H .....................................   34  2 hits [apicomplexans]          cleavage and polyadenylation specifity protein [Plasmodium 
. . Thermococcus onnurineus NA1 ......................................   34  3 hits [euryarchaeotes]         ribonuclease Z [Thermococcus onnurineus NA1] >gi|254808680|
. . Plasmodium vivax SaI-1 ...........................................   34  2 hits [apicomplexans]          cleavage and polyadenylation specifity factor protein [Plas
. . Plasmodium vivax .................................................   34  2 hits [apicomplexans]          cleavage and polyadenylation specifity factor protein [Plas
. . Schistosoma mansoni ..............................................   34  2 hits [flatworms]              cleavage and polyadenylation specificity factor-related [Sc
. . Methanocaldococcus infernus ME ...................................   34  2 hits [euryarchaeotes]         RNA-metabolising metallo-beta-lactamase [Methanocaldococcus
. . Methanothermus fervidus DSM 2088 .................................   34  2 hits [euryarchaeotes]         rnase z [Methanothermus fervidus DSM 2088] >gi|311224687|gb
. . Desulfurococcus mucosus DSM 2162 .................................   34  2 hits [crenarchaeotes]         RNAse Z [Desulfurococcus mucosus DSM 2162] >gi|319753138|gb
. . Tetrahymena thermophila ..........................................   34  2 hits [ciliates]               metallo beta lactamase domain containing protein [Tetrahyme
. . Tetrahymena thermophila SB210 ....................................   34  2 hits [ciliates]               metallo beta lactamase domain containing protein [Tetrahyme
. . Paramecium tetraurelia strain d4-2 ...............................   34  1 hit  [ciliates]               hypothetical protein [Paramecium tetraurelia strain d4-2] >
. . Paramecium tetraurelia ...........................................   34  1 hit  [ciliates]               hypothetical protein [Paramecium tetraurelia strain d4-2] >
. . Volvox carteri f. nagariensis ....................................   34  2 hits [green algae]            hypothetical protein VOLCADRAFT_65253 [Volvox carteri f. na
. . Thermoproteus neutrophilus V24Sta ................................   34  2 hits [crenarchaeotes]         beta-lactamase domain-containing protein [Thermoproteus neu
. . Danio rerio (zebra fish) .........................................   34  3 hits [bony fishes]            elaC homolog 1 (E. coli) [Danio rerio]
. . Caenorhabditis elegans (nematode) ................................   34  2 hits [nematodes]              hypothetical protein Y40B10A.4 [Caenorhabditis elegans] >gi
. . Halalkalicoccus jeotgali B3 ......................................   34  2 hits [euryarchaeotes]         hypothetical protein HacjB3_03180 [Halalkalicoccus jeotgali
. . Thermoplasma acidophilum DSM 1728 ................................   34  2 hits [euryarchaeotes]         ribonuclease Z [Thermoplasma acidophilum DSM 1728] >gi|1064
. . Thermoplasma acidophilum .........................................   34  1 hit  [euryarchaeotes]         ribonuclease Z [Thermoplasma acidophilum DSM 1728] >gi|1064
. . Leishmania major strain Friedlin .................................   34  2 hits [kinetoplastids]         cleavage and polyadenylation specificity factor [Leishmania
. . Leishmania mexicana MHOM/GT/2001/U1103 ...........................   33  1 hit  [kinetoplastids]         cleavage and polyadenylation specificity factor,putative [L
. uncultured organism ------------------------------------------------   35  1 hit  [unclassified]           putative protein [uncultured organism]


B)
Lineage Report

cellular organisms
. Archaea            [archaea]
. . Euryarchaeota      [euryarchaeotes]
. . . Thermoplasmatales  [euryarchaeotes]
. . . . Picrophilus torridus DSM 9790 ------------------------------------   41 2 hits [euryarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . . . Thermoplasma acidophilum DSM 1728 ................................   34 1 hit  [euryarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . . . Thermoplasma volcanium GSS1 ......................................   33 2 hits [euryarchaeotes]        RecName: Full=UPF0173 metal-dependent hydrolase TV0864
. . . Natronomonas pharaonis DSM 2160 ------------------------------------   38 1 hit  [euryarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . . Pyrococcus abyssi ..................................................   36 1 hit  [euryarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . . Methanocaldococcus jannaschii ......................................   35 4 hits [euryarchaeotes]        RecName: Full=Uncharacterized protein MJ0162
. . . Methanosarcina mazei ...............................................   35 1 hit  [euryarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . . Thermococcus kodakarensis ..........................................   35 2 hits [euryarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . . Methanosarcina acetivorans .........................................   34 1 hit  [euryarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . . Thermococcus onnurineus NA1 ........................................   34 1 hit  [euryarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . . Pyrococcus horikoshii ..............................................   33 1 hit  [euryarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . . Methanothermobacter thermautotrophicus str. Delta H ................   33 1 hit  [euryarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . . Thermococcus gammatolerans EJ3 .....................................   32 1 hit  [euryarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . . Pyrococcus furiosus DSM 3638 .......................................   31 1 hit  [euryarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . . Haloarcula marismortui .............................................   31 1 hit  [euryarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . . Thermococcus sibiricus MM 739 ......................................   30 1 hit  [euryarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . . Methanococcus aeolicus Nankai-3 ....................................   30 1 hit  [euryarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . . Methanococcus maripaludis C6 .......................................   29 1 hit  [euryarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . . Halorubrum lacusprofundi ATCC 49239 ................................   29 1 hit  [euryarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . . uncultured methanogenic archaeon RC-I ..............................   29 1 hit  [euryarchaeotes]        RecName: Full=UPF0173 metal-dependent hydrolase UNCMA_04270
. . . Methanopyrus kandleri ..............................................   29 1 hit  [euryarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . . Methanococcus vannielii SB .........................................   29 1 hit  [euryarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . . Archaeoglobus fulgidus .............................................   28 1 hit  [euryarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . Sulfolobus tokodaii str. 7 -------------------------------------------   40 1 hit  [crenarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . Metallosphaera sedula DSM 5348 .......................................   38 1 hit  [crenarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . Ignicoccus hospitalis KIN4/I .........................................   37 1 hit  [crenarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . Sulfolobus acidocaldarius ............................................   36 1 hit  [crenarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . Pyrobaculum arsenaticum DSM 13514 ....................................   31 2 hits [crenarchaeotes]        RecName: Full=UPF0282 protein Pars_1056
. . Sulfolobus solfataricus ..............................................   31 1 hit  [crenarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . Pyrobaculum aerophilum str. IM2 ......................................   31 1 hit  [crenarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . Cenarchaeum symbiosum ................................................   30 1 hit  [archaea]               RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . Sulfolobus islandicus L.S.2.15 .......................................   30 1 hit  [crenarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . Sulfolobus islandicus Y.N.15.51 ......................................   30 1 hit  [crenarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . Sulfolobus islandicus Y.G.57.14 ......................................   30 1 hit  [crenarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . Sulfolobus islandicus M.16.27 ........................................   29 1 hit  [crenarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . Sulfolobus islandicus M.16.4 .........................................   29 1 hit  [crenarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . Sulfolobus islandicus M.14.25 ........................................   29 1 hit  [crenarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . Aeropyrum pernix .....................................................   28 1 hit  [crenarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . Pyrobaculum calidifontis JCM 11548 ...................................   28 1 hit  [crenarchaeotes]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. . Nanoarchaeum equitans Kin4-M .........................................   28 1 hit  [archaea]               RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Borrelia garinii -------------------------------------------------------   36 1 hit  [spirochetes]           RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Borrelia burgdorferi ...................................................   36 1 hit  [spirochetes]           RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Borrelia burgdorferi ZS7 ...............................................   36 1 hit  [spirochetes]           RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Debaryomyces hansenii ..................................................   36 1 hit  [ascomycetes]           RecName: Full=Endoribonuclease YSH1; AltName: Full=mRNA 3'-
. Citrobacter koseri ATCC BAA-895 ........................................   35 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Eubacterium rectale ATCC 33656 .........................................   35 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Cytophaga hutchinsonii ATCC 33406 ......................................   35 1 hit  [CFB group bacteria]    RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Bacillus subtilis ......................................................   35 1 hit  [firmicutes]            RecName: Full=UPF0173 metal-dependent hydrolase ytkL
. Arabidopsis thaliana (thale-cress) .....................................   35 2 hits [eudicots]              RecName: Full=Cleavage and polyadenylation specificity fact
. Borrelia afzelii PKo ...................................................   35 1 hit  [spirochetes]           RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Prochlorococcus marinus str. MIT 9515 ..................................   34 1 hit  [cyanobacteria]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Bacillus halodurans ....................................................   34 2 hits [firmicutes]            RecName: Full=UPF0173 metal-dependent hydrolase BH3178
. Clostridium perfringens SM101 ..........................................   34 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Exiguobacterium sp. AT1b ...............................................   34 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Lactobacillus salivarius UCC118 ........................................   34 1 hit  [firmicutes]            RecName: Full=UPF0173 metal-dependent hydrolase LSL_0324
. Clostridium perfringens ATCC 13124 .....................................   34 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Enterococcus faecalis ..................................................   34 2 hits [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Prochlorococcus marinus subsp. pastoris str. CCMP1986 ..................   34 1 hit  [cyanobacteria]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Bacillus licheniformis ATCC 14580 ......................................   34 2 hits [firmicutes]            RecName: Full=UPF0173 metal-dependent hydrolase BLi03080/BL
. Natranaerobius thermophilus JW/NM-WN-LF ................................   33 1 hit  [firmicutes]            RecName: Full=UPF0173 metal-dependent hydrolase Nther_2337
. Yarrowia lipolytica ....................................................   33 1 hit  [ascomycetes]           RecName: Full=Endoribonuclease YSH1; AltName: Full=mRNA 3'-
. Prochlorococcus marinus str. MIT 9215 ..................................   33 1 hit  [cyanobacteria]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Clostridium kluyveri DSM 555 ...........................................   33 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Clostridium kluyveri NBRC 12016 ........................................   33 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Clostridium perfringens ................................................   33 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Clostridium tetani .....................................................   33 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Clostridium acetobutylicum .............................................   33 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Borrelia duttonii Ly ...................................................   33 1 hit  [spirochetes]           RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Borrelia recurrentis A1 ................................................   33 1 hit  [spirochetes]           RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Prochlorococcus marinus ................................................   33 1 hit  [cyanobacteria]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Prochlorococcus marinus str. MIT 9301 ..................................   33 1 hit  [cyanobacteria]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Bacillus amyloliquefaciens FZB42 .......................................   33 1 hit  [firmicutes]            RecName: Full=UPF0173 metal-dependent hydrolase RBAM_026340
. Prochlorococcus marinus str. AS9601 ....................................   33 1 hit  [cyanobacteria]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Prochlorococcus marinus str. MIT 9312 ..................................   33 1 hit  [cyanobacteria]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Treponema denticola ....................................................   33 1 hit  [spirochetes]           RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Erwinia tasmaniensis ...................................................   33 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 ...   32 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Salmonella enterica subsp. enterica serovar Typhi ......................   32 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Salmonella enterica subsp. enterica serovar Typhimurium ................   32 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Salmonella enterica ....................................................   32 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Salmonella enterica subsp. enterica serovar Paratyphi A ................   32 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ......   32 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Salmonella enterica subsp. enterica serovar Agona str. SL483 ...........   32 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ....   32 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ......   32 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 .   32 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .....   32 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Escherichia coli O127:H6 str. E2348/69 .................................   32 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Escherichia coli O6 ....................................................   32 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Escherichia coli UTI89 .................................................   32 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Escherichia coli APEC O1 ...............................................   32 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Escherichia coli S88 ...................................................   32 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 .   32 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Escherichia coli ED1a ..................................................   32 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Oligotropha carboxidovorans OM5 ........................................   32 1 hit  [a-proteobacteria]      RecName: Full=Glycerol-3-phosphate dehydrogenase [NAD(P)+];
. Lactobacillus fermentum IFO 3956 .......................................   32 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Geobacillus sp. WCH70 ..................................................   32 1 hit  [firmicutes]            RecName: Full=UPF0173 metal-dependent hydrolase GWCH70_2696
. Dictyostelium discoideum ...............................................   32 3 hits [cellular slime molds]  RecName: Full=Cleavage and polyadenylation specificity fact
. Borrelia hermsii DAH ...................................................   32 1 hit  [spirochetes]           RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Mus musculus (mouse) ...................................................   32 2 hits [rodents]               RecName: Full=Zinc phosphodiesterase ELAC protein 1; AltNam
. Listeria monocytogenes HCC23 ...........................................   31 2 hits [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Salinibacter ruber DSM 13855 ...........................................   31 1 hit  [CFB group bacteria]    RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Escherichia coli 536 ...................................................   31 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Homo sapiens (man) .....................................................   31 2 hits [primates]              RecName: Full=Zinc phosphodiesterase ELAC protein 1; AltNam
. Bos taurus (cow) .......................................................   31 2 hits [even-toed ungulates]   RecName: Full=Zinc phosphodiesterase ELAC protein 1; AltNam
. Listeria monocytogenes serotype 4b str. F2365 ..........................   31 2 hits [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Listeria monocytogenes serotype 4b str. CLIP 80459 .....................   31 2 hits [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Escherichia coli IAI39 .................................................   31 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Listeria innocua .......................................................   31 2 hits [firmicutes]            RecName: Full=UPF0173 metal-dependent hydrolase lin1612
. Listeria welshimeri serovar 6b str. SLCC5334 ...........................   31 2 hits [firmicutes]            RecName: Full=UPF0173 metal-dependent hydrolase lwe1590
. Lysinibacillus sphaericus C3-41 ........................................   31 1 hit  [firmicutes]            RecName: Full=UPF0173 metal-dependent hydrolase Bsph_4138
. Synechococcus sp. CC9902 ...............................................   31 1 hit  [cyanobacteria]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Escherichia coli E24377A ...............................................   31 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Escherichia coli 55989 .................................................   31 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Escherichia coli IAI1 ..................................................   31 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Escherichia coli O157:H7 ...............................................   31 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Shigella boydii CDC 3083-94 ............................................   31 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Listeria monocytogenes .................................................   31 2 hits [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Escherichia coli K-12 ..................................................   31 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Shigella flexneri ......................................................   31 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Escherichia coli HS ....................................................   31 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Escherichia coli ATCC 8739 .............................................   31 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Escherichia coli SE11 ..................................................   31 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Escherichia coli BW2952 ................................................   31 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Borrelia turicatae 91E135 ..............................................   31 1 hit  [spirochetes]           RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Pseudoalteromonas carrageenovora .......................................   31 1 hit  [g-proteobacteria]      RecName: Full=Arylsulfatase; Short=AS; AltName: Full=Aryl-s
. Prochlorococcus marinus str. NATL1A ....................................   31 1 hit  [cyanobacteria]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Synechococcus sp. CC9605 ...............................................   31 1 hit  [cyanobacteria]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Lactococcus lactis subsp. lactis .......................................   31 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Prochlorococcus marinus str. NATL2A ....................................   31 1 hit  [cyanobacteria]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Synechocystis sp. PCC 6803 .............................................   31 1 hit  [cyanobacteria]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Prochlorococcus marinus str. MIT 9303 ..................................   31 1 hit  [cyanobacteria]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Synechococcus sp. CC9311 ...............................................   31 1 hit  [cyanobacteria]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Escherichia coli UMN026 ................................................   31 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Prochlorococcus marinus str. MIT 9313 ..................................   31 1 hit  [cyanobacteria]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ......................   31 2 hits [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Klebsiella pneumoniae 342 ..............................................   31 2 hits [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Synechococcus sp. WH 8102 ..............................................   31 1 hit  [cyanobacteria]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Gramella forsetii KT0803 ...............................................   31 1 hit  [CFB group bacteria]    RecName: Full=UPF0173 metal-dependent hydrolase GFO_2312
. Nocardia farcinica .....................................................   31 1 hit  [high GC Gram+]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Clostridium phytofermentans ISDg .......................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Treponema pallidum .....................................................   30 1 hit  [spirochetes]           RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Treponema pallidum subsp. pallidum SS14 ................................   30 1 hit  [spirochetes]           RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Eubacterium eligens ATCC 27750 .........................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Bradyrhizobium japonicum ...............................................   30 1 hit  [a-proteobacteria]      RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus pneumoniae R6 ............................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus pneumoniae ...............................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus pneumoniae D39 ...........................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus pneumoniae ATCC 700669 ...................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus pneumoniae JJA ...........................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Enterobacter sp. 638 ...................................................   30 2 hits [enterobacteria]        RecName: Full=Hydroxyacylglutathione hydrolase; AltName: Fu
. Streptococcus pneumoniae G54 ...........................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Synechococcus sp. WH 7803 ..............................................   30 2 hits [cyanobacteria]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus pneumoniae 70585 .........................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus pneumoniae Hungary19A-6 ..................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus pneumoniae P1031 .........................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus pneumoniae Taiwan19F-14 ..................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus pneumoniae CGSP14 ........................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus suis 98HAH33 .............................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus suis 05ZYH33 .............................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Aspergillus fumigatus ..................................................   30 1 hit  [ascomycetes]           RecName: Full=Endoribonuclease ysh1; AltName: Full=mRNA 3'-
. Emericella nidulans ....................................................   30 1 hit  [ascomycetes]           RecName: Full=Endoribonuclease ysh1; AltName: Full=mRNA 3'-
. Streptococcus thermophilus CNRZ1066 ....................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus thermophilus LMG 18311 ...................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus thermophilus LMD-9 .......................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus equi subsp. zooepidemicus MGCS10565 ......................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Steptococcus equi subsp. zooepidemicus H70 .............................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus pyogenes serotype M18 ....................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus pyogenes serotype M6 .....................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus pyogenes serotype M28 ....................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus pyogenes MGAS10270 .......................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus pyogenes MGAS10750 .......................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus pyogenes str. Manfredo ...................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus pyogenes NZ131 ...........................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus agalactiae serogroup III .................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus agalactiae serogroup Ia ..................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus equi subsp. equi 4047 ....................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus pyogenes serotype M3 .....................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus pyogenes serotype M1 .....................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus pyogenes MGAS2096 ........................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus pyogenes MGAS9429 ........................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus agalactiae serogroup V ...................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Buchnera aphidicola str. Bp (Baizongia pistaciae) ......................   30 1 hit  [enterobacteria]        RecName: Full=Hydroxyacylglutathione hydrolase; AltName: Fu
. Clostridium beijerinckii NCIMB 8052 ....................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus uberis 0140J .............................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus sanguinis SK36 ...........................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus gordonii str. Challis ....................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Haemophilus parasuis SH0165 ............................................   30 1 hit  [g-proteobacteria]      RecName: Full=Hydroxyacylglutathione hydrolase; AltName: Fu
. Parabacteroides distasonis ATCC 8503 ...................................   30 1 hit  [CFB group bacteria]    RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Salinispora arenicola CNS-205 ..........................................   30 1 hit  [high GC Gram+]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Cyanothece sp. PCC 8801 ................................................   30 1 hit  [cyanobacteria]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Lactococcus lactis subsp. cremoris SK11 ................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Cronobacter sakazakii ATCC BAA-894 .....................................   30 1 hit  [enterobacteria]        RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Cyanothece sp. ATCC 51142 ..............................................   30 1 hit  [cyanobacteria]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Marinobacter aquaeolei VT8 .............................................   30 1 hit  [g-proteobacteria]      RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Lactococcus lactis subsp. cremoris MG1363 ..............................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365 ...............   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842 .................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Brevibacillus brevis NBRC 100599 .......................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Streptococcus mutans ...................................................   30 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Bradyrhizobium sp. ORS278 ..............................................   29 1 hit  [a-proteobacteria]      RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Xenopus laevis (common platanna) .......................................   29 1 hit  [frogs & toads]         RecName: Full=Aprataxin; AltName: Full=Forkhead-associated 
. Drosophila melanogaster ................................................   29 1 hit  [flies]                 RecName: Full=Probable cleavage and polyadenylation specifi
. Bacillus clausii KSM-K16 ...............................................   29 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Pediococcus pentosaceus ATCC 25745 .....................................   29 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Xenopus (Silurana) tropicalis ..........................................   29 1 hit  [frogs & toads]         RecName: Full=Aprataxin; AltName: Full=Forkhead-associated 
. Exiguobacterium sibiricum 255-15 .......................................   29 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Schizosaccharomyces pombe ..............................................   29 1 hit  [ascomycetes]           RecName: Full=Endoribonuclease ysh1; AltName: Full=mRNA 3'-
. Oceanobacillus iheyensis ...............................................   29 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Alkaliphilus oremlandii OhILAs .........................................   29 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Caenorhabditis elegans (nematode) ......................................   29 1 hit  [nematodes]             RecName: Full=Putative UDP-glucuronosyltransferase ugt-48; 
. Saccharomyces cerevisiae (yeast) .......................................   28 1 hit  [ascomycetes]           RecName: Full=Endoribonuclease YSH1; AltName: Full=Yeast 73
. Trichodesmium erythraeum IMS101 ........................................   28 1 hit  [cyanobacteria]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Clostridium novyi NT ...................................................   28 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Thermomicrobium roseum DSM 5159 ........................................   28 1 hit  [GNS bacteria]          RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Gloeobacter violaceus ..................................................   28 1 hit  [cyanobacteria]         RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Actinobacillus pleuropneumoniae serovar 5b str. L20 ....................   28 1 hit  [g-proteobacteria]      RecName: Full=Hydroxyacylglutathione hydrolase; AltName: Fu
. Bacteroides vulgatus ATCC 8482 .........................................   28 1 hit  [CFB group bacteria]    RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Actinobacillus pleuropneumoniae serovar 7 str. AP76 ....................   28 1 hit  [g-proteobacteria]      RecName: Full=Hydroxyacylglutathione hydrolase; AltName: Fu
. Actinobacillus pleuropneumoniae serovar 3 str. JL03 ....................   28 1 hit  [g-proteobacteria]      RecName: Full=Hydroxyacylglutathione hydrolase; AltName: Fu
. Lactobacillus reuteri DSM 20016 ........................................   28 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Lactobacillus reuteri JCM 1112 .........................................   28 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293 ...............   28 1 hit  [firmicutes]            RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=
. Xylella fastidiosa Temecula1 ...........................................   28 1 hit  [g-proteobacteria]      RecName: Full=Hydroxyacylglutathione hydrolase; AltName: Fu
. Xylella fastidiosa M23 .................................................   28 1 hit  [g-proteobacteria]      RecName: Full=Hydroxyacylglutathione hydrolase; AltName: Fu
. Xylella fastidiosa M12 .................................................   28 1 hit  [g-proteobacteria]      RecName: Full=Hydroxyacylglutathione hydrolase; AltName: Fu
. Xylella fastidiosa .....................................................   28 1 hit  [g-proteobacteria]      RecName: Full=Hydroxyacylglutathione hydrolase; AltName: Fu
. Pelotomaculum thermopropionicum SI .....................................   28 1 hit  [firmicutes]            RecName: Full=UPF0173 metal-dependent hydrolase PTH_1415

BLAST

PROTOCOL:


A)BLASTp versus NR, NCBI default parameters apart from "Number of descriptions_1000"

B)BLASTp versus swissprot, NCBI parameters apart from "Number of descriptions_1000"


RESULTS ANALYSIS


The BLAST raw results have a very low E-value (7e-25), which indicates that the likelihood of the homology be dived to a random alignment and very low, since the hits on the results are quite low (117), which means there was very few sequences that showed homology, which introduces a very high degree of uncertainty. It is likely that the sequence encodes a protein beta-lactamase-like protein due to that is the lowest E-Value (7e-25). ther are also probability that the sequence can encode other kinds of proteins but all of them has lowers hits and higher E-values, like the putative hydrolase that have hit value and E-value 84.0 6e-15, respectively.

RAW RESULTS

A) Sequences producing significant alignments:                       (Bits)  Value

ref|YP_003552416.1|  hypothetical protein SAR116_2089 [Candida...   117    7e-25
ref|YP_003268033.1|  beta-lactamase domain protein [Haliangium...  90.5    7e-17
ref|YP_003495931.1|  hypothetical protein DEFDS_0695 [Deferrib...  86.3    1e-15
ref|YP_001985667.1|  hydrolase protein, beta-lactamase superfa...  85.9    1e-15
ref|YP_632389.1|  metallo-beta-lactamase family protein [Myxoc...  84.7    4e-15
ref|YP_771104.1|  hypothetical protein pRL110071 [Rhizobium le...  84.7    4e-15
gb|AAD34636.1|AF153678_5  unknown [Myxococcus xanthus]             84.7    4e-15
ref|YP_002278225.1|  beta-lactamase domain protein [Rhizobium ...  84.3    5e-15
ref|YP_002985070.1|  putative hydrolase protein, beta-lactamas...  84.0    6e-15
ref|ZP_03501525.1|  putative hydrolase protein, beta-lactamase...  83.6    7e-15
ref|ZP_03519521.1|  putative hydrolase protein, beta-lactamase...  83.6    7e-15
ref|YP_472220.1|  hypothetical protein RHE_PE00054 [Rhizobium ...  83.6    7e-15
ref|YP_593193.1|  hypothetical protein Acid345_4119 [Candidatu...  80.5    7e-14
ref|YP_002823432.1|  metal dependant beta lactamase [Sinorhizo...  80.1    8e-14
ref|YP_002542135.1|  hypothetical protein Arad_9513 [Agrobacte...  80.1    1e-13
ref|YP_002547414.1|  metal dependant beta lactamase protein [A...  79.7    1e-13
ref|YP_001313320.1|  beta-lactamase domain-containing protein ...  79.0    2e-13
ref|ZP_07660769.1|  metallo-beta-lactamase superfamily [Roseib...  78.6    3e-13
ref|YP_001543367.1|  beta-lactamase domain-containing protein ...  78.6    3e-13
ref|ZP_01461717.1|  TaR3 [Stigmatella aurantiaca DW4/3-1] >gb|...  77.4    5e-13
ref|YP_004175635.1|  hypothetical protein ANT_30090 [Anaerolin...  77.4    5e-13
ref|NP_437298.1|  hypothetical protein SM_b21254 [Sinorhizobiu...  77.4    6e-13
ref|ZP_07598771.1|  beta-lactamase domain-containing protein [...  77.0    8e-13
ref|YP_003785256.1|  putative phytochrome sensor protein [Brac...  76.6    9e-13
ref|YP_003503610.1|  hypothetical protein Dacet_0875 [Denitrov...  76.3    1e-12
ref|ZP_02190437.1|  hypothetical protein BAL199_10957 [alpha p...  75.9    1e-12
ref|NP_355517.2|  metal dependant beta lactamase protein [Agro...  75.1    3e-12
ref|YP_004279813.1|  metal dependent beta lactamase protein [A...  75.1    3e-12
ref|ZP_04715336.1|  beta-lactamase-like protein [Alteromonas m...  74.7    4e-12
ref|YP_003633549.1|  ElaC, metal-dependent hydrolase of the be...  74.7    4e-12
ref|YP_002721765.1|  ElaC, Metal-dependent hydrolases of the b...  74.3    5e-12
ref|YP_002127256.1|  beta-lactamase-like protein [Alteromonas ...  74.3    5e-12
ref|ZP_01133776.1|  hypothetical protein PTD2_09024 [Pseudoalt...  73.9    7e-12
ref|ZP_01612036.1|  metal-dependent hydrolase [Alteromonadales...  73.6    7e-12
ref|NP_104404.1|  hypothetical protein mlr3257 [Mesorhizobium ...  73.6    8e-12
ref|YP_003268619.1|  beta-lactamase domain protein [Haliangium...  73.2    1e-11
ref|ZP_01908046.1|  beta-lactamase-like protein [Plesiocystis ...  73.2    1e-11
ref|YP_001619686.1|  hypothetical protein sce9034 [Sorangium c...  73.2    1e-11
ref|YP_002423613.1|  beta-lactamase domain protein [Methylobac...  72.8    1e-11
ref|YP_001927601.1|  beta-lactamase domain protein [Methylobac...  72.8    1e-11
ref|ZP_00049437.2|  COG1235: Metal-dependent hydrolases of the...  72.8    1e-11
ref|YP_004051901.1|  hypothetical protein Calni_1833 [Calditer...  72.8    1e-11
ref|YP_001641895.1|  beta-lactamase domain-containing protein ...  72.8    1e-11
ref|ZP_01545201.1|  hypothetical protein SIAM614_09458 [Stappi...  72.8    2e-11
ref|ZP_06967797.1|  beta-lactamase domain-containing protein [...  72.0    2e-11
ref|ZP_07205314.1|  metallo-beta-lactamase domain protein [del...  72.0    2e-11
ref|YP_001543403.1|  hypothetical protein Haur_0627 [Herpetosi...  71.6    3e-11
ref|YP_660855.1|  beta-lactamase-like [Pseudoalteromonas atlan...  71.2    4e-11
ref|ZP_03127535.1|  response regulator receiver protein [Chtho...  71.2    4e-11
ref|ZP_07027098.1|  metal-dependent hydrolase of the beta-lact...  70.9    6e-11
ref|YP_001680446.1|  conserved beta-lactamase domain protein [...  70.5    7e-11
ref|ZP_05085463.1|  metal dependant beta lactamase protein [Ps...  70.1    8e-11
emb|CBX30983.1|  hypothetical protein N47_E44950 [uncultured D...  70.1    9e-11
ref|YP_001753739.1|  beta-lactamase domain-containing protein ...  70.1    9e-11
ref|YP_003449818.1|  beta-lactamase superfamily hydrolase [Azo...  70.1    9e-11
ref|ZP_07687217.1|  hypothetical protein OSCT_3168 [Oscillochl...  69.7    1e-10
ref|YP_001542828.1|  beta-lactamase domain-containing protein ...  69.7    1e-10
ref|ZP_01229114.1|  putative metal-dependent beta-lactamase [A...  69.3    2e-10
ref|YP_001529367.1|  metal-dependent hydrolase [Desulfococcus ...  68.9    2e-10
ref|YP_002299106.1|  metallo-beta-lactamase superfamily [Rhodo...  68.9    2e-10
ref|YP_002432358.1|  beta-lactamase domain protein [Desulfatib...  68.9    2e-10
ref|YP_002495623.1|  beta-lactamase domain-containing protein ...  68.9    2e-10
ref|YP_722511.1|  beta-lactamase-like [Trichodesmium erythraeu...  68.6    3e-10
ref|ZP_05024797.1|  metallo-beta-lactamase superfamily protein...  68.6    3e-10
ref|YP_001735630.1|  beta-lactamase superfamily hydrolase [Syn...  68.2    3e-10
ref|YP_724082.1|  beta-lactamase-like [Trichodesmium erythraeu...  68.2    4e-10
ref|YP_003954022.1|  metallo-beta-lactamase family protein [St...  68.2    4e-10
ref|NP_682771.1|  hypothetical protein tlr1981 [Thermosynechoc...  68.2    4e-10
ref|YP_002289169.1|  metal-dependent hydrolase of the beta-lac...  67.8    5e-10
ref|XP_002286333.1|  hypothetical protein THAPSDRAFT_261063 [T...  67.4    6e-10
emb|CAA71027.1|  hypothetical protein [Calothrix viguieri]         67.4    7e-10
ref|ZP_07653295.1|  beta-lactamase-like protein [Methylobacter...  67.0    7e-10
ref|ZP_01466293.1|  TaR3 [Stigmatella aurantiaca DW4/3-1] >gb|...  66.6    9e-10
ref|YP_632131.1|  metallo-beta-lactamase family protein [Myxoc...  66.6    1e-09
ref|YP_003722076.1|  beta-lactamase domain-containing protein ...  66.2    1e-09
ref|YP_003803799.1|  metallo-beta-lactamase family protein [Sp...  65.9    2e-09
ref|YP_001769227.1|  beta-lactamase domain-containing protein ...  65.9    2e-09
ref|ZP_03762573.1|  hypothetical protein CLOSTASPAR_06613 [Clo...  65.9    2e-09
ref|YP_002430271.1|  metal-dependent hydrolase [Desulfatibacil...  65.5    2e-09
ref|YP_003270704.1|  beta-lactamase domain protein [Haliangium...  65.5    2e-09
ref|ZP_07109629.1|  beta-lactamase-like [Oscillatoria sp. PCC ...  65.5    2e-09
ref|ZP_01620405.1|  Beta-lactamase-like protein [Lyngbya sp. P...  65.1    3e-09
ref|YP_322634.1|  beta-lactamase-like protein [Anabaena variab...  65.1    3e-09
ref|NP_488887.1|  hypothetical protein alr4847 [Nostoc sp. PCC...  65.1    3e-09
ref|NP_440086.1|  hypothetical protein sll1036 [Synechocystis ...  65.1    3e-09
ref|YP_867111.1|  beta-lactamase domain-containing protein [Ma...  65.1    3e-09
ref|YP_003268618.1|  beta-lactamase domain protein [Haliangium...  64.7    3e-09
ref|YP_002372436.1|  beta-lactamase domain-containing protein ...  64.7    4e-09
ref|YP_721594.1|  beta-lactamase-like [Trichodesmium erythraeu...  64.7    4e-09
ref|YP_001864617.1|  beta-lactamase domain-containing protein ...  64.3    4e-09
ref|YP_001658796.1|  beta-lactamase-like protein [Microcystis ...  64.3    5e-09
ref|ZP_05622949.1|  metallo-beta-lactamase family protein [Tre...  64.3    6e-09
emb|CAO86438.1|  unnamed protein product [Microcystis aerugino...  64.3    6e-09
ref|ZP_00517741.1|  Beta-lactamase-like [Crocosphaera watsonii...  63.9    7e-09
ref|YP_001516974.1|  metallo-beta-lactamase superfamily protei...  63.9    7e-09
ref|ZP_03273189.1|  beta-lactamase domain protein [Arthrospira...  63.5    8e-09
emb|CBA28994.1|  hypothetical protein Csp_A09910 [Curvibacter ...  63.5    8e-09
ref|ZP_01619227.1|  Beta-lactamase-like protein [Lyngbya sp. P...  63.5    8e-09
dbj|BAI90802.1|  hypothetical protein [Arthrospira platensis N...  63.5    9e-09
ref|YP_523241.1|  beta-lactamase-like [Rhodoferax ferrireducen...  63.5    9e-09
dbj|BAI93672.1|  hypothetical protein [Arthrospira platensis N...  63.5    9e-09
ref|ZP_07017909.1|  metal-dependent hydrolase [Desulfonatronos...  63.5    9e-09
ref|ZP_06383377.1|  beta-lactamase-like protein [Arthrospira p...  63.5    1e-08
ref|YP_003196940.1|  beta-lactamase domain protein [Desulfohal...  62.8    1e-08
ref|ZP_07719586.1|  metallo-beta-lactamase family protein [Alg...  62.8    1e-08
ref|ZP_03275788.1|  beta-lactamase domain protein [Arthrospira...  62.8    2e-08
ref|YP_003890548.1|  beta-lactamase domain-containing protein ...  62.8    2e-08
gb|AAR26319.1|  TaR3 [Myxococcus xanthus]                          62.8    2e-08
ref|ZP_01728466.1|  Beta-lactamase-like protein [Cyanothece sp...  62.4    2e-08
ref|ZP_06381727.1|  beta-lactamase-like protein [Arthrospira p...  62.4    2e-08
ref|YP_001803425.1|  hypothetical protein cce_2009 [Cyanothece...  62.4    2e-08
ref|ZP_07110345.1|  beta-lactamase-like [Oscillatoria sp. PCC ...  62.4    2e-08
ref|ZP_03512621.1|  putative hydrolase protein, beta-lactamase...  62.4    2e-08
ref|ZP_07108924.1|  beta-lactamase-like [Oscillatoria sp. PCC ...  62.0    2e-08
ref|ZP_08037323.1|  metallo-beta-lactamase domain protein [Tre...  62.0    2e-08
ref|YP_003449467.1|  hypothetical protein AZL_022850 [Azospiri...  62.0    3e-08
ref|YP_003265081.1|  beta-lactamase domain protein [Haliangium...  61.6    3e-08
ref|YP_002604966.1|  hypothetical protein HRM2_37440 [Desulfob...  61.6    4e-08
ref|ZP_03127131.1|  response regulator receiver protein [Chtho...  61.6    4e-08
ref|YP_004120957.1|  beta-lactamase domain-containing protein ...  61.2    4e-08
ref|YP_001611496.1|  hypothetical protein sce0859 [Sorangium c...  61.2    4e-08
ref|YP_003831430.1|  metallo-beta-lactamase family protein [Bu...  61.2    4e-08
ref|YP_002483102.1|  beta-lactamase domain-containing protein ...  60.8    5e-08
ref|YP_002463611.1|  beta-lactamase domain-containing protein ...  60.8    5e-08
ref|ZP_05031097.1|  metallo-beta-lactamase superfamily, putati...  60.5    7e-08
ref|YP_003847488.1|  beta-lactamase domain-containing protein ...  60.1    9e-08
ref|NP_972147.1|  metallo-beta-lactamase family protein [Trepo...  60.1    9e-08
ref|YP_002760694.1|  hypothetical protein GAU_1182 [Gemmatimon...  59.7    1e-07
ref|YP_460113.1|  metal-dependent hydrolase [Syntrophus acidit...  59.7    1e-07
ref|YP_003874295.1|  hypothetical protein STHERM_c10770 [Spiro...  59.3    2e-07
ref|YP_753050.1|  beta-lactamase-like protein [Syntrophomonas ...  59.3    2e-07
ref|ZP_02003942.1|  beta-lactamase [Beggiatoa sp. PS] >gb|EDN6...  59.3    2e-07
ref|ZP_07199555.1|  metallo-beta-lactamase family protein [del...  58.9    2e-07
ref|YP_004193779.1|  hypothetical protein Despr_0304 [Desulfob...  58.2    3e-07
ref|ZP_01622626.1|  Beta-lactamase-like protein [Lyngbya sp. P...  58.2    3e-07
ref|YP_002379269.1|  beta-lactamase domain protein [Cyanothece...  58.2    3e-07
ref|YP_003805755.1|  hypothetical protein Spirs_4079 [Spirocha...  58.2    4e-07
ref|YP_003809249.1|  metal-dependent hydrolase [Desulfarculus ...  58.2    4e-07
ref|ZP_07375763.1|  beta-lactamase domain protein [Ahrensia sp...  57.8    5e-07
ref|YP_002296835.1|  hypothetical protein RC1_0586 [Rhodospiri...  57.8    5e-07
ref|ZP_08110273.1|  beta-lactamase-like protein [Desulfovibrio...  57.8    5e-07
ref|ZP_02926028.1|  putative phytochrome sensor protein [Verru...  57.4    6e-07
ref|ZP_02089747.1|  hypothetical protein CLOBOL_07324 [Clostri...  57.4    6e-07
ref|YP_002496669.1|  putative phytochrome sensor protein [Meth...  57.4    7e-07
gb|ADD72603.1|  metallo-beta-lactamase family protein [Trepone...  57.4    7e-07
ref|NP_218930.1|  hypothetical protein TP0489 [Treponema palli...  57.0    8e-07
ref|YP_063739.1|  hypothetical protein DP0003 [Desulfotalea ps...  56.6    1e-06
ref|YP_001767861.1|  putative phytochrome sensor protein [Meth...  56.6    1e-06
ref|ZP_01291566.1|  conserved hypothetical protein [delta prot...  56.2    2e-06
ref|YP_003270705.1|  beta-lactamase domain protein [Haliangium...  55.5    2e-06
ref|ZP_05026745.1|  hypothetical protein MC7420_2133 [Microcol...  55.5    2e-06
ref|YP_003721697.1|  hypothetical protein Aazo_2700 ['Nostoc a...  54.3    6e-06
ref|YP_426898.1|  beta-lactamase-like [Rhodospirillum rubrum A...  54.3    6e-06
ref|ZP_07687059.1|  beta-lactamase domain protein [Oscillochlo...  53.9    7e-06
ref|YP_003691579.1|  hypothetical protein DaAHT2_2295 [Desulfu...  53.5    8e-06
emb|CAM76801.1|  beta-lactamase [Magnetospirillum gryphiswalde...  52.8    2e-05
ref|YP_001635011.1|  beta-lactamase-like protein [Chloroflexus...  52.4    2e-05
ref|NP_487608.1|  hypothetical protein all3568 [Nostoc sp. PCC...  52.0    2e-05
ref|ZP_02167489.1|  metal dependant beta lactamase protein [Ho...  51.6    4e-05
ref|YP_001866052.1|  hypothetical protein Npun_F2555 [Nostoc p...  51.2    4e-05
ref|YP_324048.1|  hypothetical protein Ava_3546 [Anabaena vari...  51.2    5e-05
ref|YP_003550202.1|  metallo-beta-lactamase family protein [Co...  50.4    9e-05
ref|NP_149211.1|  sulphohydrolase/glycosulfatase, Zn-dependent...  49.7    1e-04
ref|ZP_07687060.1|  metal-dependent hydrolase [Oscillochloris ...  48.9    2e-04
ref|NP_970098.1|  metallo-beta-lactamase superfamily protein [...  48.5    3e-04
ref|YP_002992057.1|  metallo-beta-lactamase family protein [De...  48.1    4e-04
ref|ZP_01041536.1|  metallo-beta-lactamase family protein [Ery...  47.8    5e-04
ref|YP_001635010.1|  metal-dependent hydrolase [Chloroflexus a...  47.8    5e-04
ref|YP_503008.1|  sulphohydrolase/glycosulfatase, Zn-dependent...  47.4    7e-04
ref|ZP_07358372.1|  GAF domain/HD domain protein [Desulfovibri...  47.0    0.001
ref|XP_001584070.1|  RNA-metabolising metallo-beta-lactamase f...  46.6    0.001
ref|YP_421699.1|  beta-lactamase superfamily hydrolase [Magnet...  46.2    0.002
ref|YP_798470.1|  metal-dependent hydrolase [Leptospira borgpe...  45.4    0.002
ref|YP_004173145.1|  hypothetical protein ANT_05110 [Anaerolin...  45.4    0.003
ref|YP_002463612.1|  metal-dependent hydrolase [Chloroflexus a...  45.1    0.003
ref|YP_657794.1|  ribonuclease Z (RNase Z) (tRNA 3 endonucleas...  44.7    0.004
ref|YP_461178.1|  seceted metal-dependent hydrolase [Syntrophu...  43.9    0.006
ref|YP_797815.1|  metal-dependent hydrolase [Leptospira borgpe...  43.5    0.009
ref|YP_003954272.1|  hypothetical protein STAUR_4665 [Stigmate...  43.5    0.010
ref|ZP_05571256.1|  ribonuclease Z [Ferroplasma acidarmanus fer1]  43.5    0.010
ref|YP_003815630.1|  Ribonuclease Z [Acidilobus saccharovorans...  42.7    0.016
ref|YP_002965786.1|  putative hydrolase of beta-lactamase supe...  42.7    0.017
ref|YP_003238697.1|  beta-lactamase domain protein [Ammonifex ...  42.7    0.017
ref|NP_767782.1|  hypothetical protein bll1142 [Bradyrhizobium...  42.7    0.017
ref|NP_712299.1|  metal-dependent hydrolase [Leptospira interr...  42.4    0.018
ref|NP_711401.1|  metal-dependent hydrolase [Leptospira interr...  42.0    0.029
ref|YP_002772868.1|  hypothetical protein BBR47_33870 [Breviba...  42.0    0.030
ref|YP_779659.1|  beta-lactamase domain-containing protein [Rh...  41.6    0.032
ref|YP_024051.1|  ribonuclease Z [Picrophilus torridus DSM 979...  41.6    0.033
ref|YP_001403813.1|  beta-lactamase domain-containing protein ...  41.6    0.036
ref|ZP_01883081.1|  hypothetical protein PBAL39_16199 [Pedobac...  41.2    0.041
ref|ZP_00054458.2|  COG1235: Metal-dependent hydrolases of the...  41.2    0.050
ref|ZP_05115891.1|  hypothetical protein SADFL11_3779 [Labrenz...  40.8    0.059
ref|YP_503158.1|  ribonuclease Z [Methanospirillum hungatei JF...  40.8    0.060
ref|YP_685953.1|  putative metallo-beta-lactamase [uncultured ...  40.8    0.065
ref|YP_003355234.1|  hypothetical protein MCP_0179 [Methanocel...  40.4    0.073
ref|YP_285210.1|  metallo-beta-lactamase family protein [Dechl...  40.4    0.078
ref|YP_001838708.1|  beta-lactamase family hydrolase [Leptospi...  40.4    0.082
ref|YP_001264290.1|  beta-lactamase superfamily hydrolase [Sph...  40.4    0.087
ref|YP_001096728.1|  beta-lactamase domain-containing protein ...  40.4    0.088
ref|YP_001323209.1|  beta-lactamase domain-containing protein ...  40.0    0.099
ref|ZP_01875214.1|  Beta-lactamase-like protein [Lentisphaera ...  40.0    0.11 
ref|NP_376853.1|  hypothetical protein ST0948 [Sulfolobus toko...  40.0    0.11 
ref|ZP_04168276.1|  Zn-dependent hydrolase (Beta-lactamase sup...  39.7    0.12 
ref|ZP_04196823.1|  Zn-dependent hydrolase (Beta-lactamase sup...  39.7    0.12 
ref|ZP_04261468.1|  Zn-dependent hydrolase (Beta-lactamase sup...  39.7    0.12 
ref|ZP_04294402.1|  Zn-dependent hydrolase (Beta-lactamase sup...  39.7    0.12 
ref|YP_001644484.1|  beta-lactamase domain-containing protein ...  39.7    0.12 
emb|CBZ51704.1|  hypothetical protein NCLIV_014990 [Neospora c...  39.7    0.13 
ref|YP_002730775.1|  metal dependent phosphohydrolase [Perseph...  39.7    0.13 
ref|NP_988501.1|  beta-lactamase-like protein [Methanococcus m...  39.7    0.15 
ref|YP_003664088.1|  zinc-dependent hydrolase [Bacillus thurin...  39.3    0.15 
gb|AAU83041.1|  metallo-beta-lactamase [uncultured archaeon GZ...  39.3    0.15 
ref|YP_001236964.1|  hypothetical protein BBta_0796 [Bradyrhiz...  39.3    0.16 
emb|CBH36919.1|  ribonuclease Z [uncultured archaeon]              39.3    0.16 
ref|YP_003860227.1|  beta-lactamase domain protein [Ignisphaer...  39.3    0.16 
ref|YP_003126237.1|  beta-lactamase domain protein [Chitinopha...  39.3    0.16 
ref|YP_003131087.1|  ribonuclease Z [Halorhabdus utahensis DSM...  39.3    0.18 
ref|ZP_04202629.1|  Zn-dependent hydrolase (Beta-lactamase sup...  39.3    0.19 
ref|ZP_04211523.1|  Zn-dependent hydrolase (Beta-lactamase sup...  39.3    0.19 
ref|XP_002157795.1|  PREDICTED: similar to predicted protein [...  39.3    0.19 
ref|YP_003095993.1|  Metal-dependent hydrolases of the beta-la...  39.3    0.19 
ref|YP_326778.1|  hypothetical protein NP2254A [Natronomonas p...  38.9    0.20 
ref|NP_946151.1|  Beta-lactamase-like [Rhodopseudomonas palust...  38.9    0.20 
ref|YP_004027565.1|  beta-lactamase domain protein [Caldicellu...  38.9    0.21 
ref|YP_004107319.1|  hypothetical protein Rpdx1_0958 [Rhodopse...  38.9    0.21 
ref|YP_001113166.1|  beta-lactamase domain-containing protein ...  38.9    0.26 
ref|YP_001549337.1|  beta-lactamase domain-containing protein ...  38.5    0.28 
ref|YP_488215.1|  Beta-lactamase-like [Rhodopseudomonas palust...  38.5    0.28 
ref|ZP_07335214.1|  conserved hypothetical protein [Desulfovib...  38.5    0.28 
ref|YP_567928.1|  beta-lactamase-like [Rhodopseudomonas palust...  38.5    0.30 
ref|ZP_08012938.1|  hypothetical protein HMPREF9488_03774 [Cop...  38.5    0.32 
ref|YP_850380.1|  metallo-beta-lactamase family protein [Liste...  38.5    0.32 
ref|YP_001329844.1|  beta-lactamase domain-containing protein ...  38.5    0.33 
ref|YP_004046381.1|  metal-dependent hydrolase of the beta-lac...  38.5    0.33 
ref|ZP_04283478.1|  Zn-dependent hydrolase (Beta-lactamase sup...  38.1    0.34 
ref|ZP_00236509.1|  mRNA 3'-end processing factor, putative [B...  38.1    0.34 
gb|EFT35421.1|  Metal-dependent hydrolases of the beta-lactama...  38.1    0.36 
ref|YP_001191867.1|  ribonuclease Z [Metallosphaera sedula DSM...  38.1    0.36 
ref|YP_001325237.1|  beta-lactamase domain-containing protein ...  38.1    0.37 
ref|ZP_04125885.1|  Zn-dependent hydrolase (Beta-lactamase sup...  38.1    0.38 
ref|ZP_04256112.1|  Zn-dependent hydrolase (Beta-lactamase sup...  38.1    0.38 
ref|YP_002445135.1|  metallo-beta-lactamase family protein [Ba...  38.1    0.38 
ref|YP_002366474.1|  metallo-beta-lactamase family protein [Ba...  38.1    0.38 
ref|ZP_01902265.1|  beta-lactamase-like protein [Roseobacter s...  38.1    0.39 
ref|YP_002529477.1|  metallo-beta-lactamase family protein [Ba...  38.1    0.41 
ref|ZP_03235877.1|  metallo-beta-lactamase family protein [Bac...  38.1    0.41 
ref|ZP_06087205.1|  metal-dependent hydrolase [Bacteroides sp....  38.1    0.42 
gb|ADY21069.1|  metallo-beta-lactamase family protein [Bacillu...  38.1    0.42 
ref|YP_003791539.1|  Zn-dependent hydrolase [Bacillus anthraci...  38.1    0.42 
ref|YP_002749027.1|  metallo-beta-lactamase family protein [Ba...  38.1    0.42 
ref|ZP_02897052.1|  metallo-beta-lactamase family protein [Bac...  38.1    0.42 
ref|ZP_03112398.1|  metallo-beta-lactamase family protein [Bac...  38.1    0.42 
ref|ZP_03106219.1|  metallo-beta-lactamase family protein [Bac...  38.1    0.42 
ref|ZP_03100875.1|  metallo-beta-lactamase family protein [Bac...  38.1    0.42 
ref|YP_002450739.1|  metallo-beta-lactamase family protein [Ba...  38.1    0.42 
ref|ZP_02214221.1|  metallo-beta-lactamase family protein [Bac...  38.1    0.42 
ref|YP_894372.1|  Zn-dependent hydrolase [Bacillus thuringiens...  38.1    0.42 
ref|YP_035906.1|  Zn-dependent hydrolase [Bacillus thuringiens...  38.1    0.42 
ref|YP_027879.1|  metallo-beta-lactamase family protein [Bacil...  38.1    0.42 
ref|YP_083159.1|  zinc-dependent hydrolase [Bacillus cereus E3...  38.1    0.42 
ref|NP_978132.1|  metallo-beta-lactamase family protein [Bacil...  38.1    0.42 
ref|NP_844172.1|  metallo-beta-lactamase family protein [Bacil...  38.1    0.42 
ref|ZP_00392031.1|  COG1782: Predicted metal-dependent RNase, ...  38.1    0.42 
ref|ZP_04540815.1|  metal-dependent hydrolase [Bacteroides sp....  38.1    0.43 
ref|ZP_03302128.1|  hypothetical protein BACDOR_03525 [Bactero...  38.1    0.44 
ref|YP_001299522.1|  putative hydrolase [Bacteroides vulgatus ...  37.7    0.48 
ref|YP_003394991.1|  ribonuclease Z [Conexibacter woesei DSM 1...  37.7    0.50 
ref|YP_001012862.1|  metal-dependent hydrolase of beta lactama...  37.7    0.50 
ref|ZP_05791931.1|  ribonuclease Z [Butyrivibrio crossotus DSM...  37.7    0.51 
ref|ZP_04191254.1|  Zn-dependent hydrolase (Beta-lactamase sup...  37.7    0.51 
ref|ZP_04238844.1|  Zn-dependent hydrolase (Beta-lactamase sup...  37.7    0.51 
ref|ZP_01174106.1|  metal-dependent hydrolase [Bacillus sp. NR...  37.7    0.52 
ref|NP_831461.1|  zinc-dependent hydrolase [Bacillus cereus AT...  37.7    0.54 
ref|XP_003036274.1|  hypothetical protein SCHCODRAFT_50876 [Sc...  37.7    0.55 
ref|YP_685431.1|  ribonuclease Z [uncultured methanogenic arch...  37.4    0.64 
emb|CAH04845.1|  metal dependent hydrolase of beta-lactamase s...  37.4    0.64 
ref|YP_001435623.1|  ribonuclease Z [Ignicoccus hospitalis KIN...  37.4    0.65 
ref|ZP_06743778.1|  metallo-beta-lactamase domain protein [Bac...  37.4    0.66 
ref|ZP_07329957.1|  RNA-metabolising metallo-beta-lactamase [M...  37.4    0.67 
emb|CBL41305.1|  Zn-dependent hydrolases, including glyoxylase...  37.4    0.69 
ref|ZP_04449092.1|  hypothetical protein GCWU000282_00315 [Cat...  37.4    0.70 
ref|YP_001393458.1|  hydrolase [Clostridium kluyveri DSM 555] ...  37.0    0.75 
ref|YP_003422115.1|  RNAse Z [cyanobacterium UCYN-A] >gb|ADB95...  37.0    0.78 
ref|YP_003157617.1|  beta-lactamase domain protein [Desulfomic...  37.0    0.79 
ref|YP_255919.1|  metallo-beta-lactamase superfamily protein [...  37.0    0.87 
ref|NP_001146407.1|  hypothetical protein LOC100279987 [Zea ma...  37.0    0.90 
ref|YP_843355.1|  ribonuclease Z [Methanosaeta thermophila PT]...  37.0    0.90 
ref|XP_002463500.1|  hypothetical protein SORBIDRAFT_01g000850...  37.0    0.93 
ref|ZP_04305567.1|  Zn-dependent hydrolase (Beta-lactamase sup...  36.6    1.0  
ref|ZP_03772771.1|  ribonuclease Z [Borrelia sp. SV1] >gb|EEH0...  36.6    1.0  
ref|ZP_03053222.1|  YhfI [Bacillus pumilus ATCC 7061] >gb|EDW2...  36.6    1.0  
ref|YP_001486211.1|  metal-dependent hydrolase [Bacillus pumil...  36.6    1.1  
ref|XP_001632211.1|  predicted protein [Nematostella vectensis...  36.6    1.1  
ref|ZP_03086956.1|  ribonuclease Z [Borrelia burgdorferi 80a] ...  36.6    1.1  
ref|YP_004289868.1|  Ribonuclease Z [Methanobacterium sp. AL-2...  36.6    1.1  
ref|YP_003980213.1|  metallo-beta-lactamase superfamily protei...  36.6    1.1  
gb|EEE30417.1|  cleavage and polyadenylation specificity facto...  36.6    1.1  
gb|EEE22852.1|  cleavage and polyadenylation specificity facto...  36.6    1.1  
ref|XP_002369178.1|  cleavage and polyadenylation specificity ...  36.6    1.1  
ref|ZP_03539192.1|  ribonuclease Z [Borrelia garinii PBr] >ref...  36.6    1.1  
ref|XP_001329114.1|  Sulphohydrolase/Glycosulfatase, Zn-depend...  36.6    1.1  
ref|YP_305310.1|  ribonuclease Z [Methanosarcina barkeri str. ...  36.6    1.1  
ref|YP_073193.1|  ribonuclease Z [Borrelia garinii PBi] >sp|Q6...  36.6    1.2  
ref|YP_001840240.1|  putative metallo-beta-lactamase superfami...  36.6    1.2  
ref|NP_212889.1|  ribonuclease Z [Borrelia burgdorferi B31] >r...  36.6    1.2  
ref|ZP_04009626.1|  metal-dependent hydrolase [Lactobacillus s...  36.6    1.2  
ref|NP_126781.1|  ribonuclease Z [Pyrococcus abyssi GE5] >sp|Q...  36.6    1.2  
ref|ZP_07088915.1|  lipoate-protein ligase B [Chryseobacterium...  36.6    1.3  
ref|ZP_06556102.1|  metallo-beta-lactamase [Listeria monocytog...  36.6    1.3  
ref|YP_004096342.1|  hypothetical protein Bcell_3369 [Bacillus...  36.2    1.3  
ref|YP_002349351.1|  metallo-beta-lactamase superfamily protei...  36.2    1.3  
ref|YP_001740387.1|  metallo-beta-lactamase family protein [Ca...  36.2    1.3  
ref|ZP_03675030.1|  ribonuclease Z [Borrelia spielmanii A14S] ...  36.2    1.3  
ref|YP_530644.1|  beta-lactamase-like [Rhodopseudomonas palust...  36.2    1.4  
ref|ZP_04316896.1|  Zn-dependent hydrolase (Beta-lactamase sup...  36.2    1.4  
ref|XP_002151845.1|  conserved hypothetical protein [Penicilli...  36.2    1.4  
ref|YP_003707598.1|  beta-lactamase domain protein [Methanococ...  36.2    1.4  
ref|ZP_03231620.1|  metallo-beta-lactamase family protein [Bac...  36.2    1.4  
ref|ZP_03011385.1|  hypothetical protein BACCOP_03290 [Bactero...  36.2    1.4  
gb|EFR83828.1|  metallo-beta-lactamase family protein [Listeri...  36.2    1.5  
ref|XP_460457.2|  DEHA2F02134p [Debaryomyces hansenii CBS767] ...  36.2    1.5  
ref|ZP_01042209.1|  Possible cAMP phosphodiesterase, metallo-b...  36.2    1.5  
ref|ZP_04874584.1|  ribonuclease Z [Aciduliprofundum boonei T4...  36.2    1.5  
ref|ZP_05981292.1|  ribonuclease Z [Subdoligranulum variabile ...  36.2    1.5  
ref|YP_799217.1|  beta-lactamase superfamily hydrolase [Leptos...  36.2    1.6  
ref|NP_001151522.1|  cleavage and polyadenylation specificity ...  36.2    1.6  
gb|ADJ78599.1|  UPF0173 metal-dependent hydrolase [Lactobacill...  36.2    1.6  
gb|EET89975.1|  ribonuclease Z [Candidatus Micrarchaeum acidip...  36.2    1.6  
ref|ZP_05295296.1|  metallo-beta-lactamase superfamily protein...  36.2    1.6  
ref|NP_710322.1|  metal-dependent hydrolase of the beta-lactam...  36.2    1.7  
ref|YP_826925.1|  RNAse Z [Candidatus Solibacter usitatus Elli...  35.8    1.7  
ref|ZP_06874546.1|  metal-dependent hydrolase [Bacillus subtil...  35.8    1.7  
ref|YP_566726.1|  ribonuclease Z [Methanococcoides burtonii DS...  35.8    1.7  
ref|ZP_00739107.1|  putative Zn-dependent hydrolases (beta-lac...  35.8    1.7  
ref|YP_001684295.1|  ribonuclease Z [Caulobacter sp. K31] >gb|...  35.8    1.8  
gb|EFV60027.1|  cleavage and polyadenylation specificity facto...  35.8    1.8  
ref|YP_003247989.1|  beta-lactamase domain protein [Methanocal...  35.8    1.8  
ref|ZP_05255726.1|  metal-dependent hydrolase [Bacteroides sp....  35.8    1.8  
ref|YP_076154.1|  metal-dependent hydrolase [Symbiobacterium t...  35.8    1.8  
emb|CBI29794.3|  unnamed protein product [Vitis vinifera]          35.8    1.9  
ref|YP_481348.1|  beta-lactamase-like protein [Frankia sp. CcI...  35.8    1.9  
ref|ZP_03054978.1|  Zn-dependent hydrolase [Bacillus pumilus A...  35.8    1.9  
ref|XP_001765559.1|  predicted protein [Physcomitrella patens ...  35.8    1.9  
ref|NP_247130.1|  putative mRNA 3'-end processing factor 3 [Me...  35.8    1.9  
ref|ZP_00233347.1|  metallo-beta-lactamase family protein [Lis...  35.8    1.9  
gb|AAD12712.1|  putative cleavage and polyadenylation specifit...  35.8    1.9  
ref|XP_001756677.1|  predicted protein [Physcomitrella patens ...  35.8    2.0  
ref|YP_475073.1|  ribonuclease Z [Synechococcus sp. JA-3-3Ab] ...  35.8    2.0  
ref|ZP_04873839.1|  ribonuclease Z [Aciduliprofundum boonei T4...  35.8    2.0  
ref|YP_001452114.1|  ribonuclease Z [Citrobacter koseri ATCC B...  35.8    2.0  
emb|CAN71414.1|  hypothetical protein VITISV_029216 [Vitis vin...  35.8    2.0  
ref|NP_465691.1|  hypothetical protein lmo2167 [Listeria monoc...  35.8    2.0  
emb|CBI29772.3|  unnamed protein product [Vitis vinifera]          35.8    2.0  
ref|YP_760010.1|  ribonuclease Z [Hyphomonas neptunium ATCC 15...  35.8    2.0  
ref|ZP_05613611.1|  ribonuclease Z [Faecalibacterium prausnitz...  35.8    2.0  
ref|ZP_03832300.1|  carbon-phosphorus lyase complex accessory ...  35.8    2.0  
emb|CBK89592.1|  RNAse Z [Eubacterium rectale DSM 17629] >emb|...  35.8    2.1  
ref|NP_001051928.1|  Os03g0852900 [Oryza sativa Japonica Group...  35.8    2.1  
ref|YP_002936757.1|  ribonuclease Z [Eubacterium rectale ATCC ...  35.8    2.1  
gb|EAY92623.1|  hypothetical protein OsI_14368 [Oryza sativa I...  35.8    2.1  
ref|ZP_05288964.1|  hypothetical protein LmonF_01406 [Listeria...  35.8    2.1  
ref|YP_477860.1|  ribonuclease Z [Synechococcus sp. JA-2-3B'a(...  35.8    2.1  
ref|ZP_05081864.1|  cAMP phosphodiesterase class-II [beta prot...  35.8    2.2  
gb|ADD61657.1|  putative protein [uncultured organism]             35.8    2.2  
ref|ZP_07206079.1|  conserved hypothetical protein [Lactobacil...  35.4    2.2  
ref|YP_678522.1|  ribonuclease Z [Cytophaga hutchinsonii ATCC ...  35.4    2.2  
emb|CBK99761.1|  Metal-dependent hydrolases of the beta-lactam...  35.4    2.2  
ref|XP_002875087.1|  hypothetical protein ARALYDRAFT_322516 [A...  35.4    2.3  
ref|YP_848466.1|  metallo-beta-lactamase family protein [Liste...  35.4    2.3  
gb|AAC00323.1|  YtkL [Bacillus subtilis]                           35.4    2.3  
ref|NP_867745.1|  hypothetical protein RB7292 [Rhodopirellula ...  35.4    2.4  
emb|CBK24374.2|  unnamed protein product [Blastocystis hominis]    35.4    2.4  
gb|EFS01366.1|  metallo-beta-lactamase family protein [Listeri...  35.4    2.5  
ref|ZP_02039765.1|  hypothetical protein RUMGNA_00518 [Ruminoc...  35.4    2.5  
ref|ZP_03644381.1|  hypothetical protein BACCOPRO_02768 [Bacte...  35.4    2.5  
ref|ZP_04389601.1|  metallo-beta-lactamase family protein [Por...  35.4    2.5  
ref|NP_390819.2|  metal-dependent hydrolase [Bacillus subtilis...  35.4    2.6  
ref|YP_003858739.1|  beta-lactamase domain protein [Ignisphaer...  35.4    2.6  
ref|ZP_06268566.1|  ribonuclease Z [Prevotella bivia JCVIHMP01...  35.4    2.6  
ref|YP_003127533.1|  beta-lactamase domain protein [Methanocal...  35.4    2.6  
ref|ZP_02074326.1|  hypothetical protein CLOL250_01096 [Clostr...  35.4    2.6  
ref|YP_001097718.1|  beta-lactamase domain-containing protein ...  35.4    2.6  
ref|ZP_07707559.1|  Metallo-beta-lactamase family protein [Bac...  35.4    2.7  
ref|YP_003480005.1|  ribonuclease Z [Natrialba magadii ATCC 43...  35.4    2.7  
ref|ZP_04669409.1|  conserved hypothetical protein [Clostridia...  35.4    2.7  
sp|Q8GUU3.1|CPS3B_ARATH  RecName: Full=Cleavage and polyadenyl...  35.4    2.8  
ref|ZP_04562786.1|  ribonuclease Z [Citrobacter sp. 30_2] >gb|...  35.0    3.0  
ref|ZP_07799455.1|  putative ribonuclease Z [Faecalibacterium ...  35.0    3.2  
ref|YP_003311298.1|  beta-lactamase domain protein [Veillonell...  35.0    3.2  
ref|ZP_03608468.1|  hypothetical protein METSMIALI_01601 [Meth...  35.0    3.2  
ref|ZP_03461124.1|  hypothetical protein BACPEC_00178 [Bactero...  35.0    3.2  
ref|NP_632330.1|  ribonuclease Z [Methanosarcina mazei Go1] >s...  35.0    3.2  
ref|YP_002509607.1|  hypothetical protein Hore_18630 [Halother...  35.0    3.2  
ref|XP_002886569.1|  hypothetical protein ARALYDRAFT_475225 [A...  35.0    3.2  
gb|AAL66977.1|  putative cleavage and polyadenylation specific...  35.0    3.2  
ref|NP_176297.1|  CPSF73-I (CLEAVAGE AND POLYADENYLATION SPECI...  35.0    3.2  
ref|YP_004258050.1|  beta-lactamase domain-containing protein ...  35.0    3.2  
ref|ZP_05974925.1|  ribonuclease Z [Methanobrevibacter smithii...  35.0    3.2  
ref|YP_001330642.1|  beta-lactamase domain-containing protein ...  35.0    3.2  
ref|YP_710202.1|  ribonuclease Z [Borrelia afzelii PKo] >ref|Z...  35.0    3.2  
ref|YP_357003.1|  beta-lactamase superfamily hydrolase [Peloba...  35.0    3.2  
ref|YP_001236413.1|  putative hydrolase [Bradyrhizobium sp. BT...  35.0    3.2  
ref|YP_001273065.1|  ribonuclease Z [Methanobrevibacter smithi...  35.0    3.3  
ref|YP_003370161.1|  sulphohydrolase/glycosulfatase, Zn-depend...  35.0    3.6  
ref|YP_359182.1|  metallo-beta-lactamase family protein [Carbo...  35.0    3.6  
ref|XP_002986181.1|  hypothetical protein SELMODRAFT_234972 [S...  35.0    3.6  
ref|YP_183527.1|  ribonuclease Z [Thermococcus kodakarensis KO...  35.0    3.6  
ref|NP_586250.1|  similarity to HYPOTHETICAL PROTEIN YO47_METJ...  35.0    3.6  
ref|XP_002512186.1|  Cleavage and polyadenylation specificity ...  35.0    3.7  
ref|ZP_03672160.1|  ribonuclease Z [Borrelia valaisiana VS116]...  35.0    3.7  
ref|XP_002984991.1|  hypothetical protein SELMODRAFT_234671 [S...  34.7    3.7  
ref|XP_002547358.1|  hypothetical protein CTRG_01665 [Candida ...  34.7    3.7  
ref|XP_002333964.1|  predicted protein [Populus trichocarpa] >...  34.7    3.7  
ref|XP_844284.1|  cleavage and polyadenylation specificity fac...  34.7    3.7  
emb|CBH10412.1|  cleavage and polyadenylation specificity fact...  34.7    3.9  
ref|XP_002323824.1|  predicted protein [Populus trichocarpa] >...  34.7    3.9  
ref|YP_001548530.1|  beta-lactamase domain-containing protein ...  34.7    3.9  
ref|YP_001011824.1|  metallo-beta-lactamase superfamily protei...  34.7    3.9  
ref|XP_653580.1|  metallo-beta-lactamase family protein [Entam...  34.7    3.9  
ref|YP_004165666.1|  rnase z [Cellulophaga algicola DSM 14237]...  34.7    4.1  
ref|XP_002323825.1|  predicted protein [Populus trichocarpa] >...  34.7    4.1  
ref|YP_003803650.1|  ribonuclease Z [Spirochaeta smaragdinae D...  34.7    4.1  
ref|YP_003457547.1|  RNA-metabolising metallo-beta-lactamase [...  34.7    4.1  
ref|YP_004086834.1|  signal transduction histidine kinase [Ast...  34.7    4.2  
ref|XP_001736991.1|  cleavage and polyadenylation specificity ...  34.7    4.2  
ref|YP_004258326.1|  beta-lactamase domain-containing protein ...  34.7    4.2  
ref|NP_617924.1|  ribonuclease Z [Methanosarcina acetivorans C...  34.7    4.4  
ref|YP_001838409.1|  hypothetical protein LEPBI_I1009 [Leptosp...  34.7    4.4  
ref|XP_726151.1|  cleavage and polyadenylation specificity fac...  34.7    4.4  
ref|YP_004037950.1|  rnase z [Halogeometricum borinquense DSM ...  34.7    4.4  
ref|YP_001999048.1|  seceted metal-dependent hydrolase of the ...  34.7    4.5  
gb|EGC06778.1|  ribonuclease BN [Escherichia fergusonii B253]      34.7    4.6  
ref|ZP_07060490.1|  ribonuclease Z [Prevotella bryantii B14] >...  34.7    4.6  
ref|ZP_06346927.1|  VicX protein [Clostridium sp. M62/1] >gb|E...  34.7    4.6  
ref|ZP_02863569.1|  ribonuclease Z [Clostridium perfringens C ...  34.7    4.6  
ref|ZP_02637230.1|  ribonuclease Z [Clostridium perfringens B ...  34.7    4.6  
ref|XP_002508805.1|  predicted protein [Micromonas sp. RCC299]...  34.7    4.7  
ref|XP_002260489.1|  cleavage and polyadenylation specifity pr...  34.7    4.7  
ref|ZP_06352037.1|  ribonuclease Z [Citrobacter youngae ATCC 2...  34.7    4.8  
ref|ZP_01112579.1|  putative hydrolase [Reinekea sp. MED297] >...  34.7    4.8  
ref|YP_002306634.1|  ribonuclease Z [Thermococcus onnurineus N...  34.3    4.9  
ref|ZP_02643417.1|  ribonuclease Z [Clostridium perfringens NC...  34.3    4.9  
ref|NP_244044.1|  metal-dependent hydrolase [Bacillus halodura...  34.3    4.9  
ref|XP_001616006.1|  cleavage and polyadenylation specifity fa...  34.3    4.9  
ref|YP_698680.1|  ribonuclease Z [Clostridium perfringens SM10...  34.3    5.0  
ref|XP_002579538.1|  cleavage and polyadenylation specificity ...  34.3    5.0  
ref|YP_023053.1|  metal dependent hydrolase [Picrophilus torri...  34.3    5.0  
ref|ZP_06304441.1|  Beta-lactamase-like protein [Raphidiopsis ...  34.3    5.0  
ref|YP_003616664.1|  RNA-metabolising metallo-beta-lactamase [...  34.3    5.0  
emb|CBL01846.1|  Metal-dependent hydrolases of the beta-lactam...  34.3    5.1  
ref|ZP_06418966.1|  ribonuclease Z [Prevotella buccae D17] >gb...  34.3    5.2  
ref|ZP_02091989.1|  hypothetical protein FAEPRAM212_02277 [Fae...  34.3    5.2  
ref|YP_004004305.1|  rnase z [Methanothermus fervidus DSM 2088...  34.3    5.3  
emb|CBL26328.1|  Metal-dependent hydrolases of the beta-lactam...  34.3    5.3  
ref|YP_004176378.1|  RNAse Z [Desulfurococcus mucosus DSM 2162...  34.3    5.3  
gb|EGD33306.1|  phage gp28 protein [Capnocytophaga sp. oral ta...  34.3    5.3  
ref|YP_002884865.1|  ribonuclease Z [Exiguobacterium sp. AT1b]...  34.3    5.4  
ref|XP_001612477.1|  cleavage and polyadenylation specifity fa...  34.3    5.4  
ref|XP_001017643.2|  metallo beta lactamase domain containing ...  34.3    5.4  
ref|XP_001462430.1|  hypothetical protein [Paramecium tetraure...  34.3    5.4  
ref|XP_002954899.1|  hypothetical protein VOLCADRAFT_65253 [Vo...  34.3    5.5  
ref|ZP_03762766.1|  hypothetical protein CLOSTASPAR_06808 [Clo...  34.3    5.5  
ref|YP_535220.1|  metallo-beta-lactamase family protein [Lacto...  34.3    5.5  
gb|EGC94554.1|  ribonuclease Z [Escherichia fergusonii ECD227]     34.3    5.5  
ref|NP_987551.1|  rhodopsin-like GPCR superfamily protein [Met...  34.3    5.5  
ref|ZP_08093702.1|  metal-dependent hydrolase [Planococcus don...  34.3    5.6  
ref|YP_003814717.1|  ribonuclease Z [Prevotella melaninogenica...  34.3    5.6  
ref|YP_696056.1|  ribonuclease Z [Clostridium perfringens ATCC...  34.3    5.6  
ref|ZP_05593207.1|  ribonuclease Z [Enterococcus faecalis AR01...  34.3    5.6  
ref|YP_001794615.1|  beta-lactamase domain-containing protein ...  34.3    5.6  
gb|EFU19823.1|  hypothetical protein SpithDRAFT_1525 [Spirocha...  34.3    5.7  
gb|EFU16413.1|  ribonuclease Z [Enterococcus faecalis TX1346]      34.3    5.7  
ref|YP_002131088.1|  metallo-beta-lactamase family protein [Ph...  34.3    5.7  
ref|ZP_04434421.1|  ribonuclease Z [Enterococcus faecalis TX13...  34.3    5.8  
ref|XP_002314781.1|  predicted protein [Populus trichocarpa] >...  34.3    5.8  
ref|ZP_05912167.1|  hypothetical protein BlinB_00820 [Brevibac...  34.3    5.8  
emb|CAN87929.1|  elaC homolog 1 (E. coli) [Danio rerio]            34.3    5.8  
ref|ZP_05569173.1|  ribonuclease Z [Enterococcus faecalis HIP1...  34.3    5.9  
ref|ZP_02327780.1|  Metallo-beta-lactamase superfamily protein...  34.3    5.9  
ref|NP_001003503.1|  zinc phosphodiesterase ELAC protein 1 [Da...  34.3    5.9  
ref|ZP_01156556.1|  putative metallo-beta-lactamase superfamil...  34.3    5.9  
ref|ZP_08117480.1|  hypothetical protein ThexyDRAFT_1772 [Ther...  34.3    5.9  
ref|ZP_06407970.1|  ribonuclease Z [Prevotella melaninogenica ...  34.3    5.9  
ref|ZP_04438612.1|  ribonuclease Z [Enterococcus faecalis ATCC...  34.3    5.9  
ref|YP_002382072.1|  ribonuclease Z [Escherichia fergusonii AT...  34.3    5.9  
ref|NP_503556.1|  hypothetical protein Y40B10A.4 [Caenorhabdit...  34.3    5.9  
ref|YP_003735821.1|  hypothetical protein HacjB3_03180 [Halalk...  34.3    6.0  
ref|ZP_06006947.1|  ribonuclease Z [Prevotella bergensis DSM 1...  34.3    6.0  
ref|YP_001180359.1|  beta-lactamase domain-containing protein ...  34.3    6.0  
ref|NP_815399.1|  AtsA/ElaC family beta-lactamase [Enterococcu...  34.3    6.0  
ref|NP_893466.1|  hypothetical protein PMM1349 [Prochlorococcu...  34.3    6.0  
ref|YP_003992692.1|  beta-lactamase domain protein [Caldicellu...  34.3    6.1  
ref|XP_001012725.2|  metallo beta lactamase domain containing ...  34.3    6.1  
ref|YP_080223.1|  metal-dependent hydrolase [Bacillus lichenif...  34.3    6.1  
ref|NP_394611.1|  ribonuclease Z [Thermoplasma acidophilum DSM...  34.3    6.1  
ref|ZP_01227936.1|  putative metallo-beta-lactamase [Aurantimo...  34.3    6.1  
sp|Q9HJ19.2|RNZ_THEAC  RecName: Full=Ribonuclease Z; Short=RNa...  34.3    6.2  
ref|XP_001686447.1|  cleavage and polyadenylation specificity ...  34.3    6.3  
emb|CBZ30452.1|  cleavage and polyadenylation specificity fact...  33.9    6.4  
ref|ZP_08009340.1|  beta-lactamase [Coprobacillus sp. 29_1] >g...  33.9    6.4  
ref|YP_003993409.1|  beta-lactamase domain protein [Caldicellu...  33.9    6.5  
emb|CBZ37798.1|  unnamed protein product [Leishmania donovani ...  33.9    6.5  
ref|YP_003840683.1|  beta-lactamase domain protein [Caldicellu...  33.9    6.5  
gb|AAD43049.1|AF125393_1  Rab27 isoform [Homo sapiens]             33.9    6.6  
ref|NP_143054.1|  ribonuclease Z [Pyrococcus horikoshii OT3] >...  33.9    6.6  
ref|YP_002574158.1|  hypothetical protein Athe_2315 [Caldicell...  33.9    6.6  
ref|XP_001468678.1|  cleavage and polyadenylation specificity ...  33.9    6.6  
ref|ZP_05139061.1|  ribonuclease Z [Prochlorococcus marinus st...  33.9    6.7  
ref|ZP_02427894.1|  hypothetical protein CLORAM_01282 [Clostri...  33.9    6.8  
ref|YP_002501242.1|  beta-lactamase domain-containing protein ...  33.9    6.8  
ref|ZP_07709419.1|  metal-dependent hydrolase [Bacillus sp. m3...  33.9    6.8  
ref|XP_001364239.1|  PREDICTED: similar to D29 [Monodelphis do...  33.9    6.8  
ref|YP_001918490.1|  beta-lactamase domain protein [Natranaero...  33.9    6.9  
ref|XP_001416263.1|  predicted protein [Ostreococcus lucimarin...  33.9    7.0  
ref|YP_001196861.1|  ribonuclease Z [Flavobacterium johnsoniae...  33.9    7.0  
ref|NP_348211.1|  ribonuclease Z [Clostridium acetobutylicum A...  33.9    7.1  
ref|YP_004010621.1|  beta-lactamase-like protein [Rhodomicrobi...  33.9    7.2  
ref|XP_504965.2|  YALI0F03817p [Yarrowia lipolytica] >sp|Q6C2Z...  33.9    7.2  
ref|XP_001486604.1|  hypothetical protein PGUG_02275 [Meyerozy...  33.9    7.3  
ref|YP_003544798.1|  ribonuclease Z [Sphingobium japonicum UT2...  33.9    7.3  
emb|CBI29775.3|  unnamed protein product [Vitis vinifera]          33.9    7.3  
ref|YP_001484777.1|  metallo-beta-lactamase superfamily protei...  33.9    7.5  
ref|ZP_02186563.1|  ribonuclease Z [alpha proteobacterium BAL1...  33.9    7.5  
gb|EDK38177.2|  hypothetical protein PGUG_02275 [Pichia guilli...  33.9    7.6  
ref|ZP_02025544.1|  hypothetical protein EUBVEN_00797 [Eubacte...  33.9    7.6  
ref|ZP_07248741.1|  metallo-beta-lactamase superfamily protein...  33.9    7.7  
ref|XP_002578028.1|  zinc phosphodiesterase [Schistosoma manso...  33.9    7.7  
ref|YP_001395794.1|  ribonuclease Z [Clostridium kluyveri DSM ...  33.9    7.7  
ref|ZP_07578908.1|  RNA-metabolising metallo-beta-lactamase [T...  33.9    7.7  
gb|AAS80153.1|  ACT11D09.9 [Cucumis melo]                          33.9    7.8  
gb|EGC30185.1|  hypothetical protein DICPUDRAFT_158104 [Dictyo...  33.9    7.9  
ref|ZP_03625956.1|  beta-lactamase domain protein [Streptococc...  33.9    7.9  
ref|YP_004002307.1|  beta-lactamase domain protein [Caldicellu...  33.9    8.0  
ref|ZP_05392846.1|  beta-lactamase domain protein [Clostridium...  33.9    8.0  
ref|NP_562279.1|  ribonuclease Z [Clostridium perfringens str....  33.9    8.0  
ref|NP_393565.1|  hypothetical protein Ta0086 [Thermoplasma ac...  33.9    8.0  
ref|YP_001551288.1|  metallo-beta-lactamase superfamily protei...  33.9    8.0  
ref|ZP_08085906.1|  ribonuclease Z [Prevotella oralis ATCC 332...  33.9    8.0  
ref|YP_003641306.1|  metal-dependent hydrolase [Thermincola sp...  33.9    8.0  
ref|YP_003716808.1|  ribonuclease Z [Croceibacter atlanticus H...  33.9    8.0  
ref|YP_003010345.1|  beta-lactamase domain protein [Paenibacil...  33.9    8.1  
ref|ZP_07904220.1|  ribonuclease Z [Eubacterium saburreum DSM ...  33.9    8.2  
sp|Q892B5.2|RNZ_CLOTE  RecName: Full=Ribonuclease Z; Short=RNa...  33.9    8.2  
ref|NP_069368.1|  mRNA 3'-end processing factor, putative [Arc...  33.9    8.2  
ref|ZP_08106901.1|  hypothetical protein HMPREF9475_01764 [Clo...  33.5    8.4  
ref|ZP_08089085.1|  hypothetical protein HMPREF9474_00834 [Clo...  33.5    8.4  
ref|ZP_01994678.1|  hypothetical protein DORLON_00663 [Dorea l...  33.5    8.4  
ref|YP_753748.1|  hypothetical protein Swol_1067 [Syntrophomon...  33.5    8.4  
ref|XP_001864146.1|  artemis protein [Culex quinquefasciatus] ...  33.5    8.5  
ref|YP_001261739.1|  beta-lactamase superfamily hydrolase [Sph...  33.5    8.6  
ref|YP_001665394.1|  beta-lactamase domain-containing protein ...  33.5    8.6  
ref|XP_742453.1|  cleavage and polyadenylation specifity facto...  33.5    8.7  
ref|YP_003725917.1|  ribonuclease Z [Methanohalobium evestigat...  33.5    8.7  
ref|YP_002760704.1|  hypothetical protein GAU_1192 [Gemmatimon...  33.5    8.7  
gb|EEH05732.1|  conserved hypothetical protein [Ajellomyces ca...  33.5    8.7  
ref|ZP_03782083.1|  hypothetical protein RUMHYD_01519 [Blautia...  33.5    8.7  
sp|Q97IQ6.2|RNZ_CLOAB  RecName: Full=Ribonuclease Z; Short=RNa...  33.5    8.7  
ref|YP_003863896.1|  ribonuclease Z [Maribacter sp. HTCC2170] ...  33.5    8.7  
ref|YP_001663701.1|  beta-lactamase domain-containing protein ...  33.5    8.9  
ref|NP_782743.1|  ribonuclease Z [Clostridium tetani E88] >gb|...  33.5    8.9  
gb|EFR99371.1|  metallo-beta-lactamase family protein [Listeri...  33.5    9.0  
ref|YP_003541470.1|  RNAse Z [Methanohalophilus mahii DSM 5219...  33.5    9.0  
ref|XP_001509223.1|  PREDICTED: similar to D29 [Ornithorhynchu...  33.5    9.0  
ref|YP_912565.1|  beta-lactamase superfamily hydrolase [Chloro...  33.5    9.0  
ref|XP_002713584.1|  PREDICTED: elaC homolog 1-like [Oryctolag...  33.5    9.1  
ref|YP_003465385.1|  metallo-beta-lactamase family protein [Li...  33.5    9.2  
ref|XP_003059912.1|  predicted protein [Micromonas pusilla CCM...  33.5    9.2  
ref|YP_002222389.1|  ribonuclease Z [Borrelia duttonii Ly] >sp...  33.5    9.2  
gb|EFA75892.1|  integrator complex subunit 11 [Polysphondylium...  33.5    9.3  
ref|YP_002223197.1|  ribonuclease Z [Borrelia recurrentis A1] ...  33.5    9.3  
ref|ZP_00229630.1|  metallo-beta-lactamase family protein [Lis...  33.5    9.3  
gb|EER41590.1|  conserved hypothetical protein [Ajellomyces ca...  33.5    9.3  
ref|ZP_01859625.1|  metal-dependent hydrolase [Bacillus sp. SG...  33.5    9.3  
ref|NP_178282.2|  ATCPSF73-II (cleavage and polyadenylation sp...  33.5    9.3  
ref|ZP_02954224.1|  ribonuclease Z [Clostridium perfringens D ...  33.5    9.4  
ref|ZP_08146170.1|  ribonuclease Z [Enterococcus casseliflavus...  33.5    9.5  
gb|EGC49455.1|  conserved hypothetical protein [Ajellomyces ca...  33.5    9.5  
gb|EFS02466.1|  metallo-beta-lactamase family protein [Listeri...  33.5    9.6  
ref|YP_002495346.1|  beta-lactamase domain protein [Methylobac...  33.5    9.6  
ref|XP_001564581.1|  cleavage and polyadenylation specificity ...  33.5    9.7  
ref|ZP_06474135.1|  beta-lactamase domain protein [Frankia sym...  33.5    9.7  
ref|ZP_05649083.1|  ribonuclease Z [Enterococcus gallinarum EG...  33.5    9.7  
ref|ZP_01439487.1|  metallo-beta-lactamase family protein [Ful...  33.5    9.7  
gb|ABE11293.1|  conserved hypothetical protein [uncultured Pro...  33.5    9.7  
ref|XP_002842540.1|  hypothetical protein [Tuber melanosporum ...  33.5    9.8  
ref|YP_004023370.1|  hypothetical protein Calkro_0657 [Caldice...  33.5    9.9  
ref|XP_002526000.1|  cleavage and polyadenylation specificity ...  33.5    9.9  
ref|XP_001610645.1|  succinate dehydrogenase alpha subunit [Ba...  33.5    9.9  
ref|NP_875821.1|  metallo-beta-lactamase superfamily protein [...  33.5    9.9  
ref|YP_014789.1|  metallo-beta-lactamase family protein [Liste...  33.5    10.0 

ALIGNMENTS
>ref|YP_003552416.1| hypothetical protein SAR116_2089 [Candidatus Puniceispirillum 
marinum IMCC1322]
 gb|ADE40332.1| hypothetical protein SAR116_2089 [Candidatus Puniceispirillum 
marinum IMCC1322]
Length=262

 Score =  117 bits (292),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 75/116 (65%), Gaps = 0/116 (0%)

Query  9    GVRGSIPTSGTFTVKYGGSTPCVEILTKNVQIIFDCGSGFSKVKINDTKPTIILLSHFHH  68
            GVRGS P SG   +++GGST   EI+T   QIIFD GSGF  +KI D  P  IL SHFHH
Sbjct  7    GVRGSTPVSGKDYIEFGGSTTSFEIITPQCQIIFDTGSGFRNIKIRDDLPVFILYSHFHH  66

Query  69   DHLQGLPFNPTLYSSREPILVACAHKSKLETKEIIKQSFSPPFFPFDLLNLTNNVK  124
            DH+QGL FNP+L++ R+ + V  A   K+  +E ++  FS  +FP D  +  ++++
Sbjct  67   DHIQGLAFNPSLFACRQNVYVCSALTDKVGLREKLQSYFSGSYFPVDAFSALSHLE  122


>ref|YP_003268033.1| beta-lactamase domain protein [Haliangium ochraceum DSM 14365]
 gb|ACY16140.1| beta-lactamase domain protein [Haliangium ochraceum DSM 14365]
Length=309

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 68/129 (53%), Gaps = 6/129 (4%)

Query  3    FMIINHGVRGSIPTSGTFTVKYGGSTPCVEILTKNVQIIFDCGSGFSKV-----KIND-T  56
            F I  HGVRGS+ + G  T   GG T C+EI     +I+ D G+G + +      + D  
Sbjct  4    FEIQFHGVRGSLASPGIHTAAVGGHTSCIEIGVAGRRIVLDAGTGLAALGDRILTLGDLA  63

Query  57   KPTIILLSHFHHDHLQGLPFNPTLYSSREPILVACAHKSKLETKEIIKQSFSPPFFPFDL  116
            +PT ILLSH H DH+QG+PF   +Y +   I +       +   E++++  SPPFFP   
Sbjct  64   RPTTILLSHVHWDHIQGIPFFKPIYIAGSEIEIISGPNGFMPLAEVLRRQMSPPFFPVAF  123

Query  117  LNLTNNVKV  125
              L+  V+ 
Sbjct  124  DELSAEVRA  132


>ref|YP_003495931.1| hypothetical protein DEFDS_0695 [Deferribacter desulfuricans 
SSM1]
 dbj|BAI80175.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
Length=269

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/118 (39%), Positives = 64/118 (55%), Gaps = 1/118 (0%)

Query  9    GVRGSIPTSGTFTVKYGGSTPCVEILTKNVQIIFDCGSGFSKVK-INDTKPTIILLSHFH  67
            G RG+IP SG   VKYGGSTP + + + +  IIFD G+G  K+  + + K   I L+H H
Sbjct  6    GSRGTIPVSGYSYVKYGGSTPSLFLSSNDTAIIFDAGTGLYKLNSVKNLKNIFIFLTHLH  65

Query  68   HDHLQGLPFNPTLYSSREPILVACAHKSKLETKEIIKQSFSPPFFPFDLLNLTNNVKV  125
             DH+ GLP     Y+    I +    K  +++ E IK  F  PFFP     L  N+++
Sbjct  66   WDHIMGLPLFSYFYNPSANIKIFIDKKDDIDSTEFIKHLFKEPFFPVSHEKLNCNLQI  123


>ref|YP_001985667.1| hydrolase protein, beta-lactamase superfamily [Rhizobium etli 
CIAT 652]
 gb|ACE93404.1| putative hydrolase protein, beta-lactamase superfamily [Rhizobium 
etli CIAT 652]
Length=276

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/129 (37%), Positives = 70/129 (55%), Gaps = 7/129 (5%)

Query  3    FMIINHGVRGSIPTSGTFTVKYGGSTPCVEILTKNVQIIFDCGSGFSKVKI----NDTKP  58
            F I   GVRGSIP SG    +YGG+T C+EI   N +++FD GSG  +  +    +    
Sbjct  6    FQIKFWGVRGSIPVSGPEFDRYGGNTSCIEIRCGNHRMLFDAGSGLREAGLSLLADGVSD  65

Query  59   TIILLSHFHHDHLQGLPFNPTLYSSREPILVACAH-KSKLETKEIIKQSFSPPFFPF--D  115
              +  SH H+DH+ GLPF   +Y     + +   H   K+ T+E+++Q  SPP+FP   D
Sbjct  66   VDLFFSHCHYDHIIGLPFFKAIYYPSINVNIWSGHLDGKMSTREMVEQFISPPWFPVKTD  125

Query  116  LLNLTNNVK  124
            +   T N +
Sbjct  126  ICQATMNFR  134


>ref|YP_632389.1| metallo-beta-lactamase family protein [Myxococcus xanthus DK 
1622]
 gb|ABF86256.1| metallo-beta-lactamase family protein [Myxococcus xanthus DK 
1622]
Length=277

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 64/116 (56%), Gaps = 5/116 (4%)

Query  3    FMIINHGVRGSIPTSGTFTVKYGGSTPCVEILTKNVQIIFDCGSGFSKVK---INDTKPT  59
            F +   GVRGSIP+ G  T +YGG+TPCVE+   +  +IFD G+G   +    +   KP 
Sbjct  3    FEVRFWGVRGSIPSPGAHTKRYGGNTPCVEVRCGDELLIFDLGTGARALGHALVAKKKPV  62

Query  60   --IILLSHFHHDHLQGLPFNPTLYSSREPILVACAHKSKLETKEIIKQSFSPPFFP  113
               I +SH+H+DHLQGLPF   +Y     + V    +     K+++     PP+FP
Sbjct  63   KGSIFISHYHYDHLQGLPFFGPMYLPTSDLTVYGPARHGQSVKQLLSGQMVPPYFP  118


>ref|YP_771104.1| hypothetical protein pRL110071 [Rhizobium leguminosarum bv. viciae 
3841]
 emb|CAK03013.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae 
3841]
Length=276

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/129 (37%), Positives = 69/129 (54%), Gaps = 7/129 (5%)

Query  3    FMIINHGVRGSIPTSGTFTVKYGGSTPCVEILTKNVQIIFDCGSGFSKVKI----NDTKP  58
            F I   GVRGSIP SG    +YGG+T C+EI     ++IFD GSG  +  +    +    
Sbjct  6    FQIKFWGVRGSIPVSGPEFDRYGGNTSCIEIRCGKHRMIFDAGSGLREAGLSMLADGVSD  65

Query  59   TIILLSHFHHDHLQGLPFNPTLYSSREPILVACAH-KSKLETKEIIKQSFSPPFFPF--D  115
              +  SH H+DH+ GLPF   +Y     + +   H   K+ T+E+++Q  SPP+FP   D
Sbjct  66   VDLFFSHCHYDHIIGLPFFKAIYYPSINVNIWSGHLDGKMSTREMVEQFISPPWFPVKTD  125

Query  116  LLNLTNNVK  124
            +   T N +
Sbjct  126  ICQATMNFR  134


>gb|AAD34636.1|AF153678_5 unknown [Myxococcus xanthus]
Length=309

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 64/116 (56%), Gaps = 5/116 (4%)

Query  3    FMIINHGVRGSIPTSGTFTVKYGGSTPCVEILTKNVQIIFDCGSGFSKVK---INDTKPT  59
            F +   GVRGSIP+ G  T +YGG+TPCVE+   +  +IFD G+G   +    +   KP 
Sbjct  35   FEVRFWGVRGSIPSPGAHTKRYGGNTPCVEVRCGDELLIFDLGTGARALGHALVAKKKPV  94

Query  60   --IILLSHFHHDHLQGLPFNPTLYSSREPILVACAHKSKLETKEIIKQSFSPPFFP  113
               I +SH+H+DHLQGLPF   +Y     + V    +     K+++     PP+FP
Sbjct  95   KGSIFISHYHYDHLQGLPFFGPMYLPTSDLTVYGPARHGQSVKQLLSGQMVPPYFP  150


>ref|YP_002278225.1| beta-lactamase domain protein [Rhizobium leguminosarum bv. trifolii 
WSM2304]
 gb|ACI59125.1| beta-lactamase domain protein [Rhizobium leguminosarum bv. trifolii 
WSM2304]
Length=276

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 69/129 (54%), Gaps = 7/129 (5%)

Query  3    FMIINHGVRGSIPTSGTFTVKYGGSTPCVEILTKNVQIIFDCGSGFSKVKI----NDTKP  58
            F +   GVRGSIP SG    +YGG+T C+EI     ++IFD GSG  +  +    +    
Sbjct  6    FQVKFWGVRGSIPVSGPEFDRYGGNTSCIEIRCGEHRMIFDAGSGLREAGLSLLADGVSD  65

Query  59   TIILLSHFHHDHLQGLPFNPTLYSSREPILVACAH-KSKLETKEIIKQSFSPPFFPF--D  115
              +  SH H+DH+ GLPF   +Y     + +   H   K+ T+E+++Q  SPP+FP   D
Sbjct  66   VDLFFSHCHYDHIIGLPFFKAIYYPSINVNIWSGHLDGKMSTREMVEQFISPPWFPVKTD  125

Query  116  LLNLTNNVK  124
            +   T N +
Sbjct  126  ICQATMNFR  134


>ref|YP_002985070.1| putative hydrolase protein, beta-lactamase superfamily [Rhizobium 
leguminosarum bv. trifolii WSM1325]
 gb|ACS60108.1| putative hydrolase protein, beta-lactamase superfamily [Rhizobium 
leguminosarum bv. trifolii WSM1325]
Length=276

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/127 (37%), Positives = 70/127 (56%), Gaps = 7/127 (5%)

Query  3    FMIINHGVRGSIPTSGTFTVKYGGSTPCVEILTKNVQIIFDCGSGFSKVKINDTKPTI--  60
            F +   GVRGSIP SG    +YGG+T C+EI     ++IFD GSG  +  ++    ++  
Sbjct  6    FQVKFWGVRGSIPVSGPEFDRYGGNTSCIEIRCGEHRMIFDAGSGLREAGLSLLADSVSD  65

Query  61   --ILLSHFHHDHLQGLPFNPTLYSSREPILVACAH-KSKLETKEIIKQSFSPPFFPF--D  115
              +  SH H+DH+ GLPF   +Y     + +   H   K+ T+E+++Q  SPP+FP   D
Sbjct  66   VDLFFSHCHYDHIIGLPFFKAIYYPSINVNIWSGHLDGKMSTREMVEQFISPPWFPVKTD  125

Query  116  LLNLTNN  122
            +   T N
Sbjct  126  ICQATMN  132


>ref|ZP_03501525.1| putative hydrolase protein, beta-lactamase superfamily [Rhizobium 
etli Kim 5]
Length=276

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 69/129 (54%), Gaps = 7/129 (5%)

Query  3    FMIINHGVRGSIPTSGTFTVKYGGSTPCVEILTKNVQIIFDCGSGFSKVKI----NDTKP  58
            F I   GVRGSIP SG    +YGG+T C+EI     +++FD GSG  +  +    +    
Sbjct  6    FQIKFWGVRGSIPVSGPEFDRYGGNTSCIEIRCGKHRMLFDAGSGLREAGLSLLADGVSD  65

Query  59   TIILLSHFHHDHLQGLPFNPTLYSSREPILVACAH-KSKLETKEIIKQSFSPPFFPF--D  115
              +  SH H+DH+ GLPF   +Y     + +   H   K+ T+E+++Q  SPP+FP   D
Sbjct  66   VDLFFSHCHYDHIIGLPFFKAIYYPSINVNIWSGHLDGKMSTREMVEQFISPPWFPVKTD  125

Query  116  LLNLTNNVK  124
            +   T N +
Sbjct  126  ICQATMNFR  134


>ref|ZP_03519521.1| putative hydrolase protein, beta-lactamase superfamily [Rhizobium 
etli IE4771]
Length=276

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 69/129 (54%), Gaps = 7/129 (5%)

Query  3    FMIINHGVRGSIPTSGTFTVKYGGSTPCVEILTKNVQIIFDCGSGFSKVKI----NDTKP  58
            F I   GVRGSIP SG    +YGG+T C+EI     +++FD GSG  +  +    +    
Sbjct  6    FQIKFWGVRGSIPVSGPEFDRYGGNTSCIEIRCGKHRMLFDAGSGLREAGLSLLADGVSD  65

Query  59   TIILLSHFHHDHLQGLPFNPTLYSSREPILVACAH-KSKLETKEIIKQSFSPPFFPF--D  115
              +  SH H+DH+ GLPF   +Y     + +   H   K+ T+E+++Q  SPP+FP   D
Sbjct  66   VDLFFSHCHYDHIIGLPFFKAIYYPSINVNIWSGHLDGKMSTREMVEQFISPPWFPVKTD  125

Query  116  LLNLTNNVK  124
            +   T N +
Sbjct  126  ICQATMNFR  134


>ref|YP_472220.1| hypothetical protein RHE_PE00054 [Rhizobium etli CFN 42]
 gb|ABC93493.1| hypothetical conserved protein [Rhizobium etli CFN 42]
Length=276

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 69/129 (54%), Gaps = 7/129 (5%)

Query  3    FMIINHGVRGSIPTSGTFTVKYGGSTPCVEILTKNVQIIFDCGSGFSKVKI----NDTKP  58
            F I   GVRGSIP SG    +YGG+T C+EI     +++FD GSG  +  +    +    
Sbjct  6    FQIKFWGVRGSIPVSGPEFDRYGGNTSCIEIRCGKHRLLFDAGSGLREAGLSLLADGVSD  65

Query  59   TIILLSHFHHDHLQGLPFNPTLYSSREPILVACAH-KSKLETKEIIKQSFSPPFFPF--D  115
              +  SH H+DH+ GLPF   +Y     + +   H   K+ T+E+++Q  SPP+FP   D
Sbjct  66   VDLFFSHCHYDHIIGLPFFKAIYYPSINVNIWSGHLDGKMSTREMVEQFISPPWFPVKTD  125

Query  116  LLNLTNNVK  124
            +   T N +
Sbjct  126  ICQATMNFR  134


B)

Sequences producing significant alignments:                       (Bits)  Value

sp|Q6KZJ4.1|RNZ_PICTO  RecName: Full=Ribonuclease Z; Short=RNa...  41.6    0.001
sp|Q973F1.1|RNZ_SULTO  RecName: Full=Ribonuclease Z; Short=RNa...  40.0    0.004
sp|Q3IRM5.1|RNZ_NATPD  RecName: Full=Ribonuclease Z; Short=RNa...  38.9    0.007
sp|A4YHP1.1|RNZ_METS5  RecName: Full=Ribonuclease Z; Short=RNa...  38.1    0.013
sp|A8ABB4.1|RNZ_IGNH4  RecName: Full=Ribonuclease Z; Short=RNa...  37.4    0.023
sp|Q4J9A4.1|RNZ_SULAC  RecName: Full=Ribonuclease Z; Short=RNa...  37.0    0.031
sp|Q660C0.1|RNZ_BORGA  RecName: Full=Ribonuclease Z; Short=RNa...  36.6    0.041
sp|O51696.1|RNZ_BORBU  RecName: Full=Ribonuclease Z; Short=RNa...  36.6    0.042
sp|Q9UZP4.1|RNZ_PYRAB  RecName: Full=Ribonuclease Z; Short=RNa...  36.6    0.044
sp|Q6BMW3.2|YSH1_DEBHA  RecName: Full=Endoribonuclease YSH1; A...  36.2    0.052
sp|Q57626.1|Y162_METJA  RecName: Full=Uncharacterized protein ...  35.8    0.069
sp|A8ADW5.1|RNZ_CITK8  RecName: Full=Ribonuclease Z; Short=RNa...  35.8    0.071
sp|C4ZFN9.1|RNZ_EUBR3  RecName: Full=Ribonuclease Z; Short=RNa...  35.8    0.074
sp|Q11TT4.1|RNZ_CYTH3  RecName: Full=Ribonuclease Z; Short=RNa...  35.4    0.079
sp|Q795U4.1|YTKL_BACSU  RecName: Full=UPF0173 metal-dependent ...  35.4    0.091
sp|Q8GUU3.1|CPS3B_ARATH  RecName: Full=Cleavage and polyadenyl...  35.4    0.099
sp|Q8Q032.1|RNZ_METMA  RecName: Full=Ribonuclease Z; Short=RNa...  35.0    0.11 
sp|Q9C952.1|CPSF3_ARATH  RecName: Full=Cleavage and polyadenyl...  35.0    0.11 
sp|Q0SMA2.1|RNZ_BORAP  RecName: Full=Ribonuclease Z; Short=RNa...  35.0    0.12 
sp|Q5JE70.1|RNZ_PYRKO  RecName: Full=Ribonuclease Z; Short=RNa...  35.0    0.13 
sp|A2BY56.1|RNZ_PROM5  RecName: Full=Ribonuclease Z; Short=RNa...  34.7    0.14 
sp|Q8TLK5.1|RNZ_METAC  RecName: Full=Ribonuclease Z; Short=RNa...  34.7    0.16 
sp|B6YT50.1|RNZ_THEON  RecName: Full=Ribonuclease Z; Short=RNa...  34.3    0.17 
sp|Q9K829.1|Y3178_BACHD  RecName: Full=UPF0173 metal-dependent...  34.3    0.17 
sp|Q0ST77.1|RNZ_CLOPS  RecName: Full=Ribonuclease Z; Short=RNa...  34.3    0.18 
sp|C4L3C2.1|RNZ_EXISA  RecName: Full=Ribonuclease Z; Short=RNa...  34.3    0.19 
sp|Q1WV48.1|Y324_LACS1  RecName: Full=UPF0173 metal-dependent ...  34.3    0.20 
sp|Q0TQN4.1|RNZ_CLOP1  RecName: Full=Ribonuclease Z; Short=RNa...  34.3    0.20 
sp|Q834G2.1|RNZ_ENTFA  RecName: Full=Ribonuclease Z; Short=RNa...  34.3    0.21 
sp|Q7V0B9.1|RNZ_PROMP  RecName: Full=Ribonuclease Z; Short=RNa...  34.3    0.21 
sp|Q65G70.1|Y413_BACLD  RecName: Full=UPF0173 metal-dependent ...  34.3    0.22 
sp|Q9HJ19.2|RNZ_THEAC  RecName: Full=Ribonuclease Z; Short=RNa...  34.3    0.22 
sp|O58883.1|RNZ_PYRHO  RecName: Full=Ribonuclease Z; Short=RNa...  33.9    0.23 
sp|B2A8L8.1|Y2337_NATTJ  RecName: Full=UPF0173 metal-dependent...  33.9    0.24 
sp|Q6C2Z7.2|YSH1_YARLI  RecName: Full=Endoribonuclease YSH1; A...  33.9    0.26 
sp|A8G6G0.1|RNZ_PROM2  RecName: Full=Ribonuclease Z; Short=RNa...  33.9    0.27 
sp|A5MZX7.1|RNZ_CLOK5  RecName: Full=Ribonuclease Z; Short=RNa...  33.9    0.27 
sp|Q8XKN1.1|RNZ_CLOPE  RecName: Full=Ribonuclease Z; Short=RNa...  33.9    0.28 
sp|Q892B5.2|RNZ_CLOTE  RecName: Full=Ribonuclease Z; Short=RNa...  33.9    0.29 
sp|Q97IQ6.2|RNZ_CLOAB  RecName: Full=Ribonuclease Z; Short=RNa...  33.5    0.31 
sp|B5RMU7.1|RNZ_BORDL  RecName: Full=Ribonuclease Z; Short=RNa...  33.5    0.33 
sp|B5RQ92.1|RNZ_BORRA  RecName: Full=Ribonuclease Z; Short=RNa...  33.5    0.33 
sp|Q7VAN0.1|RNZ_PROMA  RecName: Full=Ribonuclease Z; Short=RNa...  33.5    0.35 
sp|A3PEI3.1|RNZ_PROM0  RecName: Full=Ribonuclease Z; Short=RNa...  33.5    0.36 
sp|A7Z7L6.1|Y2634_BACA2  RecName: Full=UPF0173 metal-dependent...  33.5    0.37 
sp|A2BSS2.1|RNZ_PROMS  RecName: Full=Ribonuclease Z; Short=RNa...  33.1    0.41 
sp|Q97AE6.1|Y864_THEVO  RecName: Full=UPF0173 metal-dependent ...  33.1    0.41 
sp|O27859.1|RNZ_METTH  RecName: Full=Ribonuclease Z; Short=RNa...  33.1    0.41 
sp|Q319D8.1|RNZ_PROM9  RecName: Full=Ribonuclease Z; Short=RNa...  33.1    0.42 
sp|Q73LB4.1|RNZ_TREDE  RecName: Full=Ribonuclease Z; Short=RNa...  33.1    0.44 
sp|B2VHF1.1|RNZ_ERWT9  RecName: Full=Ribonuclease Z; Short=RNa...  33.1    0.47 
sp|C5A5S2.1|RNZ_THEGJ  RecName: Full=Ribonuclease Z; Short=RNa...  32.7    0.54 
sp|B5R2Z4.1|RNZ_SALEP  RecName: Full=Ribonuclease Z; Short=RNa...  32.7    0.55 
sp|P60194.1|RNZ_SALTI  RecName: Full=Ribonuclease Z; Short=RNa...  32.7    0.55 
sp|B5RCD8.1|RNZ_SALG2  RecName: Full=Ribonuclease Z; Short=RNa...  32.7    0.56 
sp|B7UFT1.1|RNZ_ECO27  RecName: Full=Ribonuclease Z; Short=RNa...  32.7    0.57 
sp|Q8FFK8.1|RNZ_ECOL6  RecName: Full=Ribonuclease Z; Short=RNa...  32.7    0.57 
sp|C0Q055.1|RNZ_SALPC  RecName: Full=Ribonuclease Z; Short=RNa...  32.7    0.58 
sp|B7MXV1.1|RNZ_ECO81  RecName: Full=Ribonuclease Z; Short=RNa...  32.7    0.59 
sp|B6JAF0.1|GPDA_OLICO  RecName: Full=Glycerol-3-phosphate deh...  32.7    0.61 
sp|Q979A8.2|RNZ_THEVO  RecName: Full=Ribonuclease Z; Short=RNa...  32.7    0.61 
sp|B2GBD1.1|RNZ_LACF3  RecName: Full=Ribonuclease Z; Short=RNa...  32.3    0.69 
sp|C5D672.1|Y2696_GEOSW  RecName: Full=UPF0173 metal-dependent...  32.3    0.70 
sp|Q86A79.1|CPSF3_DICDI  RecName: Full=Cleavage and polyadenyl...  32.3    0.71 
sp|B2S197.1|RNZ_BORHD  RecName: Full=Ribonuclease Z; Short=RNa...  32.3    0.82 
sp|Q8VEB6.1|RNZ1_MOUSE  RecName: Full=Zinc phosphodiesterase E...  32.3    0.86 
sp|B8DBV5.1|RNZ_LISMH  RecName: Full=Ribonuclease Z; Short=RNa...  32.0    0.89 
sp|Q2S0L2.1|RNZ_SALRD  RecName: Full=Ribonuclease Z; Short=RNa...  32.0    0.90 
sp|A4WJR7.1|Y1056_PYRAR  RecName: Full=UPF0282 protein Pars_1056   32.0    0.96 
sp|Q0TFH3.1|RNZ_ECOL5  RecName: Full=Ribonuclease Z; Short=RNa...  32.0    0.96 
sp|Q9H777.2|RNZ1_HUMAN  RecName: Full=Zinc phosphodiesterase E...  32.0    0.97 
sp|Q29RY4.1|RNZ1_BOVIN  RecName: Full=Zinc phosphodiesterase E...  32.0    1.0  
sp|Q71Y44.1|RNZ_LISMF  RecName: Full=Ribonuclease Z; Short=RNa...  32.0    1.0  
sp|B7NNU8.1|RNZ_ECO7I  RecName: Full=Ribonuclease Z; Short=RNa...  32.0    1.0  
sp|Q92BD8.1|Y1612_LISIN  RecName: Full=UPF0173 metal-dependent...  32.0    1.0  
sp|A0AJ26.1|Y1590_LISW6  RecName: Full=UPF0173 metal-dependent...  32.0    1.0  
sp|B1HX23.2|Y4138_LYSSC  RecName: Full=UPF0173 metal-dependent...  32.0    1.1  
sp|Q3AZH7.1|RNZ_SYNS9  RecName: Full=Ribonuclease Z; Short=RNa...  32.0    1.1  
sp|A7ZP87.1|RNZ_ECO24  RecName: Full=Ribonuclease Z; Short=RNa...  32.0    1.1  
sp|Q8XCZ0.2|RNZ_ECO57  RecName: Full=Ribonuclease Z; Short=RNa...  32.0    1.1  
sp|B2TW54.1|RNZ_SHIB3  RecName: Full=Ribonuclease Z; Short=RNa...  32.0    1.1  
sp|Q8Y5S8.1|RNZ_LISMO  RecName: Full=Ribonuclease Z; Short=RNa...  32.0    1.1  
sp|Q97Z88.1|RNZ_SULSO  RecName: Full=Ribonuclease Z; Short=RNa...  32.0    1.1  
sp|Q8ZTJ7.1|RNZ_PYRAE  RecName: Full=Ribonuclease Z; Short=RNa...  32.0    1.1  
sp|P0A8V0.1|RNZ_ECOLI  RecName: Full=Ribonuclease Z; Short=RNa...  32.0    1.1  
sp|A1R0H8.1|RNZ_BORT9  RecName: Full=Ribonuclease Z; Short=RNa...  32.0    1.1  
sp|P28607.1|ARS_ALTCA  RecName: Full=Arylsulfatase; Short=AS; ...  32.0    1.1  
sp|A2C4C2.1|RNZ_PROM1  RecName: Full=Ribonuclease Z; Short=RNa...  32.0    1.1  
sp|Q3AHP8.1|RNZ_SYNSC  RecName: Full=Ribonuclease Z; Short=RNa...  31.6    1.1  
sp|Q9CHT8.1|RNZ_LACLA  RecName: Full=Ribonuclease Z; Short=RNa...  31.6    1.1  
sp|Q46JB7.1|RNZ_PROMT  RecName: Full=Ribonuclease Z; Short=RNa...  31.6    1.2  
sp|Q55132.1|RNZ_SYNY3  RecName: Full=Ribonuclease Z; Short=RNa...  31.6    1.2  
sp|Q54YL3.1|INT11_DICDI  RecName: Full=Integrator complex subu...  31.6    1.2  
sp|Q8U182.1|RNZ_PYRFU  RecName: Full=Ribonuclease Z; Short=RNa...  31.6    1.3  
sp|A2C725.1|RNZ_PROM3  RecName: Full=Ribonuclease Z; Short=RNa...  31.6    1.3  
sp|Q0I7X5.1|RNZ_SYNS3  RecName: Full=Ribonuclease Z; Short=RNa...  31.6    1.3  
sp|B7N5N4.1|RNZ_ECOLU  RecName: Full=Ribonuclease Z; Short=RNa...  31.6    1.3  
sp|Q7V5W1.2|RNZ_PROMM  RecName: Full=Ribonuclease Z; Short=RNa...  31.6    1.3  
sp|A6TBW1.1|RNZ_KLEP7  RecName: Full=Ribonuclease Z; Short=RNa...  31.2    1.5  
sp|B5XNW7.1|RNZ_KLEP3  RecName: Full=Ribonuclease Z; Short=RNa...  31.2    1.5  
sp|Q5UZJ9.1|RNZ_HALMA  RecName: Full=Ribonuclease Z; Short=RNa...  31.2    1.6  
sp|Q7U8S4.1|RNZ_SYNPX  RecName: Full=Ribonuclease Z; Short=RNa...  31.2    1.6  
sp|A0M3T2.1|Y2312_GRAFK  RecName: Full=UPF0173 metal-dependent...  31.2    1.7  
sp|Q5YQ00.1|RNZ_NOCFA  RecName: Full=Ribonuclease Z; Short=RNa...  31.2    1.8  
sp|A9KSU3.1|RNZ_CLOPH  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    2.0  
sp|O07896.1|RNZ_TREPA  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    2.0  
sp|C4Z309.1|RNZ_EUBE2  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    2.0  
sp|Q89NF8.1|RNZ_BRAJA  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    2.0  
sp|C6A2P3.1|RNZ_THESM  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    2.0  
sp|A6UUY8.1|RNZ_META3  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    2.1  
sp|Q8DQN1.1|RNZ_STRR6  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    2.1  
sp|A4W6V2.1|GLO2_ENT38  RecName: Full=Hydroxyacylglutathione h...  30.8    2.1  
sp|B5E2R6.1|RNZ_STRP4  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    2.2  
sp|A5GN87.1|RNZ_SYNPW  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    2.2  
sp|C1C636.1|RNZ_STRP7  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    2.2  
sp|A4W299.1|RNZ_STRS2  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    2.2  
sp|Q4WRC2.1|YSH1_ASPFU  RecName: Full=Endoribonuclease ysh1; A...  30.8    2.2  
sp|Q5BEP0.1|YSH1_EMENI  RecName: Full=Endoribonuclease ysh1; A...  30.8    2.2  
sp|Q5LZD1.1|RNZ_STRT1  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    2.3  
sp|Q57744.1|Y296_METJA  RecName: Full=Uncharacterized protein ...  30.8    2.3  
sp|B4U3M1.1|RNZ_STREM  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    2.3  
sp|Q71Z90.1|Y1599_LISMF  RecName: Full=UPF0173 metal-dependent...  30.8    2.3  
sp|C0MDJ9.1|RNZ_STRS7  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    2.3  
sp|Q8P1A6.1|RNZ_STRP8  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    2.3  
sp|Q9QXK7.1|CPSF3_MOUSE  RecName: Full=Cleavage and polyadenyl...  30.8    2.3  
sp|Q8E4W1.1|RNZ_STRA3  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    2.3  
sp|C0MAM9.1|RNZ_STRE4  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    2.4  
sp|P60198.1|RNZ_STRP3  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    2.4  
sp|Q8DZ99.1|RNZ_STRA5  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    2.4  
sp|Q835K6.1|Y1371_ENTFA  RecName: Full=UPF0173 metal-dependent...  30.8    2.4  
sp|P79101.1|CPSF3_BOVIN  RecName: Full=Cleavage and polyadenyl...  30.8    2.4  
sp|Q60355.2|Y047_METJA  RecName: Full=Uncharacterized protein ...  30.8    2.4  
sp|Q89AN4.1|GLO2_BUCBP  RecName: Full=Hydroxyacylglutathione h...  30.8    2.4  
sp|Q9UKF6.1|CPSF3_HUMAN  RecName: Full=Cleavage and polyadenyl...  30.8    2.4  
sp|A0AK82.1|RNZ_LISW6  RecName: Full=Ribonuclease Z; Short=RNa...  30.8    2.4  
sp|A6LU82.1|RNZ_CLOB8  RecName: Full=Ribonuclease Z; Short=RNa...  30.4    2.5  
sp|Q92A38.1|RNZ_LISIN  RecName: Full=Ribonuclease Z; Short=RNa...  30.4    2.5  
sp|B9DUP5.1|RNZ_STRU0  RecName: Full=Ribonuclease Z; Short=RNa...  30.4    2.6  
sp|A3CNR9.1|RNZ_STRSV  RecName: Full=Ribonuclease Z; Short=RNa...  30.4    2.7  
sp|A8AWX4.1|RNZ_STRGC  RecName: Full=Ribonuclease Z; Short=RNa...  30.4    2.8  
sp|Q8Y6V4.1|Y1577_LISMO  RecName: Full=UPF0173 metal-dependent...  30.4    2.8  
sp|B8F6A3.1|GLO2_HAEPS  RecName: Full=Hydroxyacylglutathione h...  30.4    2.8  
sp|B8DHH0.1|Y991_LISMH  RecName: Full=UPF0173 metal-dependent ...  30.4    2.9  
sp|C1KVM4.1|Y1588_LISMC  RecName: Full=UPF0173 metal-dependent...  30.4    3.0  
sp|A4WKM8.1|RNZ_PYRAR  RecName: Full=Ribonuclease Z; Short=RNa...  30.4    3.0  
sp|A6LFA6.1|RNZ_PARD8  RecName: Full=Ribonuclease Z; Short=RNa...  30.4    3.0  
sp|A8M3K2.1|RNZ_SALAI  RecName: Full=Ribonuclease Z; Short=RNa...  30.4    3.1  
sp|B7K1N1.1|RNZ_CYAP8  RecName: Full=Ribonuclease Z; Short=RNa...  30.0    3.3  
sp|Q031A3.1|RNZ_LACLS  RecName: Full=Ribonuclease Z; Short=RNa...  30.0    3.4  
sp|A7MHT9.1|RNZ_ENTS8  RecName: Full=Ribonuclease Z; Short=RNa...  30.0    3.4  
sp|B1WQW1.1|RNZ_CYAA5  RecName: Full=Ribonuclease Z; Short=RNa...  30.0    3.5  
sp|A1U2M9.1|RNZ_MARAV  RecName: Full=Ribonuclease Z; Short=RNa...  30.0    3.7  
sp|A0RYQ9.1|RNZ_CENSY  RecName: Full=Ribonuclease Z; Short=RNa...  30.0    3.7  
sp|A2RIV7.1|RNZ_LACLM  RecName: Full=Ribonuclease Z; Short=RNa...  30.0    3.8  
sp|Q04B09.1|RNZ_LACDB  RecName: Full=Ribonuclease Z; Short=RNa...  30.0    3.9  
sp|C3MPH2.1|RNZ_SULIL  RecName: Full=Ribonuclease Z; Short=RNa...  30.0    4.0  
sp|C0ZBP8.1|RNZ_BREBN  RecName: Full=Ribonuclease Z; Short=RNa...  30.0    4.0  
sp|Q8DT90.1|RNZ_STRMU  RecName: Full=Ribonuclease Z; Short=RNa...  30.0    4.0  
sp|C3NHZ9.1|RNZ_SULIN  RecName: Full=Ribonuclease Z; Short=RNa...  30.0    4.2  
sp|Q9KC61.1|RNZ_BACHD  RecName: Full=Ribonuclease Z; Short=RNa...  30.0    4.2  
sp|A4YN80.1|RNZ_BRASO  RecName: Full=Ribonuclease Z; Short=RNa...  29.6    4.4  
sp|C3N554.1|RNZ_SULIA  RecName: Full=Ribonuclease Z; Short=RNa...  29.6    4.4  
sp|A9AB37.1|RNZ_METM6  RecName: Full=Ribonuclease Z; Short=RNa...  29.6    4.6  
sp|Q7T287.1|APTX_XENLA  RecName: Full=Aprataxin; AltName: Full...  29.6    4.8  
sp|Q9V3D6.1|CPSF2_DROME  RecName: Full=Probable cleavage and p...  29.6    5.0  
sp|B9LQT0.1|RNZ_HALLT  RecName: Full=Ribonuclease Z; Short=RNa...  29.6    5.1  
sp|Q0W1B0.1|Y427_UNCMA  RecName: Full=UPF0173 metal-dependent ...  29.6    5.2  
sp|Q8TWK0.1|RNZ_METKA  RecName: Full=Ribonuclease Z; Short=RNa...  29.6    5.2  
sp|Q6KZZ9.1|Y1118_PICTO  RecName: Full=UPF0173 metal-dependent...  29.6    5.4  
sp|Q5WGC3.1|RNZ_BACSK  RecName: Full=Ribonuclease Z; Short=RNa...  29.3    6.0  
sp|Q5JIX0.1|Y1681_PYRKO  RecName: Full=UPF0282 protein TK1681      29.3    6.2  
sp|Q03F36.1|RNZ_PEDPA  RecName: Full=Ribonuclease Z; Short=RNa...  29.3    6.3  
sp|P61801.1|APTX_XENTR  RecName: Full=Aprataxin; AltName: Full...  29.3    6.9  
sp|B1YLU8.1|RNZ_EXIS2  RecName: Full=Ribonuclease Z; Short=RNa...  29.3    7.0  
sp|O13794.1|YSH1_SCHPO  RecName: Full=Endoribonuclease ysh1; A...  29.3    7.0  
sp|Q8EQ58.1|RNZ_OCEIH  RecName: Full=Ribonuclease Z; Short=RNa...  29.3    7.0  
sp|A6UN58.1|RNZ_METVS  RecName: Full=Ribonuclease Z; Short=RNa...  29.3    7.1  
sp|A6T510.1|GLO2_KLEP7  RecName: Full=Hydroxyacylglutathione h...  29.3    7.2  
sp|A8MGK0.1|RNZ_ALKOO  RecName: Full=Ribonuclease Z; Short=RNa...  29.3    7.2  
sp|Q18081.3|UGT48_CAEEL  RecName: Full=Putative UDP-glucuronos...  29.3    7.2  
sp|B5Y1G4.1|GLO2_KLEP3  RecName: Full=Hydroxyacylglutathione h...  29.3    7.2  
sp|Q06224.1|YSH1_YEAST  RecName: Full=Endoribonuclease YSH1; A...  28.9    7.3  
sp|A5GJK5.1|GLO2_SYNPW  RecName: Full=Hydroxyacylglutathione h...  28.9    7.7  
sp|O29323.1|RNZ_ARCFU  RecName: Full=Ribonuclease Z; Short=RNa...  28.9    7.7  
sp|Q118J2.1|RNZ_TRIEI  RecName: Full=Ribonuclease Z; Short=RNa...  28.9    7.7  
sp|A0Q1D1.1|RNZ_CLONN  RecName: Full=Ribonuclease Z; Short=RNa...  28.9    8.1  
sp|Q9YAV8.2|RNZ_AERPE  RecName: Full=Ribonuclease Z; Short=RNa...  28.9    8.2  
sp|Q58897.2|RNZ_METJA  RecName: Full=Ribonuclease Z; Short=RNa...  28.9    8.4  
sp|B9KYQ3.1|RNZ_THERP  RecName: Full=Ribonuclease Z; Short=RNa...  28.9    8.5  
sp|A3MV61.1|RNZ_PYRCJ  RecName: Full=Ribonuclease Z; Short=RNa...  28.9    8.5  
sp|Q7NDW3.1|RNZ_GLOVI  RecName: Full=Ribonuclease Z; Short=RNa...  28.9    8.6  
sp|Q74MH2.1|RNZ_NANEQ  RecName: Full=Ribonuclease Z; Short=RNa...  28.9    8.7  
sp|A3MZD3.1|GLO2_ACTP2  RecName: Full=Hydroxyacylglutathione h...  28.9    8.7  
sp|A6L3H3.1|RNZ_BACV8  RecName: Full=Ribonuclease Z; Short=RNa...  28.9    8.8  
sp|B3H0S9.1|GLO2_ACTP7  RecName: Full=Hydroxyacylglutathione h...  28.9    8.9  
sp|A5VJA0.1|RNZ_LACRD  RecName: Full=Ribonuclease Z; Short=RNa...  28.9    8.9  
sp|Q03W55.1|RNZ_LEUMM  RecName: Full=Ribonuclease Z; Short=RNa...  28.9    9.0  
sp|Q54EJ5.1|GLOB2_DICDI  RecName: Full=Glyoxylase B2               28.9    9.1  
sp|A4WCQ3.1|RNZ_ENT38  RecName: Full=Ribonuclease Z; Short=RNa...  28.9    9.2  
sp|Q87C74.1|GLO2_XYLFT  RecName: Full=Hydroxyacylglutathione h...  28.9    9.2  
sp|B0U365.1|GLO2_XYLFM  RecName: Full=Hydroxyacylglutathione h...  28.9    9.2  
sp|Q9PBI4.1|GLO2_XYLFA  RecName: Full=Hydroxyacylglutathione h...  28.9    9.4  
sp|Q65HN6.1|RNZ_BACLD  RecName: Full=Ribonuclease Z; Short=RNa...  28.9    9.4  
sp|A5D2B7.1|Y1415_PELTS  RecName: Full=UPF0173 metal-dependent...  28.5    9.8  

ALIGNMENTS
>sp|Q6KZJ4.1|RNZ_PICTO RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=tRNA 
3 endonuclease; AltName: Full=tRNase Z
Length=309

 Score = 41.6 bits (96),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/77 (36%), Positives = 35/77 (46%), Gaps = 11/77 (14%)

Query  3   FMIINHGVRGSIPTSGTFTVKYGGSTPCVEILTKNVQIIFDCGSG----FSKVKINDTKP  58
           F I   G  GS+P       K G   P + +   N+  +FDCG G    F K  ++    
Sbjct  5   FKITFLGTGGSVP-------KPGRGLPAIAVQVDNIVNLFDCGEGTQKQFMKSGVSFMNV  57

Query  59  TIILLSHFHHDHLQGLP  75
             I +SHFH DH  GLP
Sbjct  58  KNIFISHFHGDHFFGLP  74


>sp|Q973F1.1|RNZ_SULTO RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=tRNA 
3 endonuclease; AltName: Full=tRNase Z
Length=293

 Score = 40.0 bits (92),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 26/106 (25%), Positives = 52/106 (50%), Gaps = 9/106 (8%)

Query  29   PCVEILTKNVQIIFDCGSG----FSKVKINDTKPTIILLSHFHHDHLQGLP---FNPTLY  81
            P + +  +    +FDCG G      +  ++  K  +I ++H H DH+ GLP       +Y
Sbjct  20   PAIMVRREGFDALFDCGEGTQWRMMEHNLSFMKIKLIGITHMHGDHVLGLPGMIETMGMY  79

Query  82   SSREPILVACAHKSKLETKEIIKQSFSPPFFPFDLLNL--TNNVKV  125
            S +E +L+    + K   ++I K+++  P F   +++     N+K+
Sbjct  80   SRKESLLLMGPKELKEFLEDIFKKTYFYPNFEIQIIDKYEDENIKI  125


>sp|Q3IRM5.1|RNZ_NATPD RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=tRNA 
3 endonuclease; AltName: Full=tRNase Z
Length=308

 Score = 38.9 bits (89),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 27/111 (25%), Positives = 50/111 (46%), Gaps = 13/111 (11%)

Query  9    GVRGSIPTSGTFTVKYGGSTPCVEILTKNVQIIFDCGSGFSKVKIN---DTKPTIILLSH  65
            G  G++PT+         +T  V +  +  +++FDCG G  +  +        +   ++H
Sbjct  9    GTSGAVPTTRR-------NTSAVFLRREGDRMLFDCGEGTQRQMMRFGTGFAVSKAFITH  61

Query  66   FHHDHLQGLP--FNPTLYSSR-EPILVACAHKSKLETKEIIKQSFSPPFFP  113
             H DH+ GLP       ++ R EP+ V      + E +++I  +   P FP
Sbjct  62   LHGDHILGLPGLLQTMDFNDREEPLSVYVPSGKQAELRDLIDTAAGAPSFP  112


>sp|A4YHP1.1|RNZ_METS5 RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=tRNA 
3 endonuclease; AltName: Full=tRNase Z
Length=291

 Score = 38.1 bits (87),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 22/97 (23%), Positives = 43/97 (45%), Gaps = 7/97 (7%)

Query  29   PCVEILTKNVQIIFDCGSGFS----KVKINDTKPTIILLSHFHHDHLQGLPF---NPTLY  81
            P   +  + + I+ DCG G      +  +N     +I ++H H DH+ GLP       +Y
Sbjct  20   PAYLVRREGLSILMDCGEGTQITMIRNSLNIMNVNVIAITHLHADHVLGLPSLIQTMGMY  79

Query  82   SSREPILVACAHKSKLETKEIIKQSFSPPFFPFDLLN  118
              +E + +      K    E  ++++  P FP + ++
Sbjct  80   DRKERLYILGPEGLKDLLTETFERTYFSPNFPIEFVS  116


>sp|A8ABB4.1|RNZ_IGNH4 RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=tRNA 
3 endonuclease; AltName: Full=tRNase Z
Length=300

 Score = 37.4 bits (85),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 32/61 (53%), Gaps = 7/61 (11%)

Query  36  KNVQIIFDCGSG----FSKVKINDTKPTIILLSHFHHDHLQGLP---FNPTLYSSREPIL  88
           + V  + DCG G      K KI+ ++  ++ +SH H DH+ GLP       + S R+ +L
Sbjct  30  EGVGALLDCGEGTQFQLMKAKISFSRIKVVFVSHLHGDHVLGLPGLLQTMAMASRRDELL  89

Query  89  V  89
           V
Sbjct  90  V  90


>sp|Q4J9A4.1|RNZ_SULAC RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=tRNA 
3 endonuclease; AltName: Full=tRNase Z
Length=292

 Score = 37.0 bits (84),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 41/94 (44%), Gaps = 15/94 (15%)

Query  3   FMIINHGVRGSIPTSGTFTVKYGGSTPCVEILTKNVQIIFDCGSGFSKVKINDT----KP  58
           F II  GV G  P             P + I  +  +I+ DCG G     I  +    K 
Sbjct  2   FEIIFIGVGGGAPNKRGL--------PGILIRREGFEILLDCGEGTQNKMIEHSISFMKL  53

Query  59  TIILLSHFHHDHLQGLP---FNPTLYSSREPILV  89
            +I +SH H DH+ GLP       +YS ++ +L+
Sbjct  54  NLIGISHLHGDHVLGLPGIIQTMAMYSRQQKLLL  87


>sp|Q660C0.1|RNZ_BORGA RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=tRNA 
3 endonuclease; AltName: Full=tRNase Z
Length=319

 Score = 36.6 bits (83),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 31/59 (53%), Gaps = 9/59 (15%)

Query  41  IFDCGSG----FSKVKINDTKPTIILLSHFHHDHLQGLPFNPTLYSS-----REPILVA  90
           +FDCG G      K KI+  K  +I ++H H DH+ GL     L S      +EP+++A
Sbjct  34  LFDCGEGTQMSLRKQKISWQKIKMICITHLHADHITGLLGIVMLMSQSGETRKEPLIIA  92


>sp|O51696.1|RNZ_BORBU RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=tRNA 
3 endonuclease; AltName: Full=tRNase Z
 sp|B7J0K1.1|RNZ_BORBZ RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=tRNA 
3 endonuclease; AltName: Full=tRNase Z
Length=319

 Score = 36.6 bits (83),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 31/59 (53%), Gaps = 9/59 (15%)

Query  41  IFDCGSG----FSKVKINDTKPTIILLSHFHHDHLQGLPFNPTLYSS-----REPILVA  90
           +FDCG G      K KI+  K  +I ++H H DH+ GL     L S      +EP+++A
Sbjct  34  LFDCGEGTQMSLRKQKISWQKIKMICITHLHADHITGLLGIVMLMSQSGETRKEPLIIA  92


>sp|Q9UZP4.1|RNZ_PYRAB RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=tRNA 
3 endonuclease; AltName: Full=tRNase Z
Length=307

 Score = 36.6 bits (83),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 26/106 (25%), Positives = 45/106 (43%), Gaps = 7/106 (6%)

Query  27   STPCVEILTKNVQIIFDCGSG-FSKVKINDTKP---TIILLSHFHHDHLQGLPF---NPT  79
            + P + I  +   I+FD G G   +++I    P     I ++HFH DH  GLP       
Sbjct  19   NVPSIAIKVEGELILFDVGEGTLRQMEIAGLSPMKIRRIFITHFHGDHYLGLPALIQTMN  78

Query  80   LYSSREPILVACAHKSKLETKEIIKQSFSPPFFPFDLLNLTNNVKV  125
            L+  +EP+ +     S    K ++   +  P F   +  L    ++
Sbjct  79   LWKRKEPLHIYGPENSIEFIKNLLNSGYFAPSFDVTVHELPGKARL  124


>sp|Q6BMW3.2|YSH1_DEBHA RecName: Full=Endoribonuclease YSH1; AltName: Full=mRNA 3'-end-processing 
protein YSH1
Length=815

 Score = 36.2 bits (82),  Expect = 0.052, Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 35/80 (44%), Gaps = 16/80 (20%)

Query  13  SIPTSGTFTVKYGGSTPCVE-------ILTKNVQIIFDCG-----SGFSKVKIND----T  56
           S P  GT   K+ G   C E       I  KN  I+ D G      G S +   D    +
Sbjct  5   SQPADGTDDFKFFGLGGCNEVGRSCHIIEYKNKVIMLDAGVHPGLQGLSSLPFYDEYDLS  64

Query  57  KPTIILLSHFHHDHLQGLPF  76
           K  I+L+SHFH DH   LP+
Sbjct  65  KVDILLVSHFHLDHAASLPY  84


>sp|Q57626.1|Y162_METJA RecName: Full=Uncharacterized protein MJ0162
Length=421

 Score = 35.8 bits (81),  Expect = 0.069, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query  30  CVEILTKNVQIIFDCGSGFSKV---KINDTKPTIILLSHFHHDHLQGLPF  76
           CVE+ T+  +++ DCG         K++D     +++SH H DH   +PF
Sbjct  17  CVEVETQKGRVLLDCGMSPDTGEIPKVDDKAVDAVIVSHAHLDHCGAIPF  66


>sp|A8ADW5.1|RNZ_CITK8 RecName: Full=Ribonuclease Z; Short=RNase Z; AltName: Full=tRNA 
3 endonuclease; AltName: Full=tRNase Z
Length=305

 Score = 35.8 bits (81),  Expect = 0.071, Method: Compositional matrix adjust.
 Identities = 23/87 (27%), Positives = 42/87 (49%), Gaps = 7/87 (8%)

Query  41   IFDCGSGFSKVKINDT----KPTIILLSHFHHDHLQGLP---FNPTLYSSREPILVACAH  93
            +FDCG G     +N      K   I +SH H DHL GLP    + ++  + +P+ +    
Sbjct  36   LFDCGEGTQHQMLNTAFNPGKLDRIFISHLHGDHLFGLPGLLCSRSMAGNAQPLTIYGPK  95

Query  94   KSKLETKEIIKQSFSPPFFPFDLLNLT  120
              +  T+  ++ S S   +P +++ +T
Sbjct  96   GIREFTETALRLSGSWTDYPLEIVEIT  122