GOS 2163030

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1093017093825
Annotathon code: GOS_2163030
Sample :
  • GPS :3°20'36s; 101°22'26w
  • Tropical South Pacific: Tropical South Pacific - International
  • Open Ocean (-2m, 28.6°C, 0.1-0.8 microns)
Authors
Team : Algarve 2011
Username : ANVBQ
Annotated on : 2011-05-24 16:01:17
  • Calheiros André dos Santos
  • Martins Vânia Carina Correia
  • Rosinha Nádia Alexandra Saragoça

Synopsis

  • Taxonomy: Candidatus Pelagibacter (NCBI info)
    Rank: genus - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 198251
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order: Rickettsiales
    Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; SAR11 cluster; Candidatus Pelagibacter;

Genomic Sequence

>JCVI_READ_1093017093825 GOS_2163030 Genomic DNA
CTTTTGGTATATCAACTAGAACTGGTCCTGGTCTTCCTGTTGTGGCAACTTCAAAAGCTTTATGTATAATTTTTGACAAATCTTTTACATCCTTTACGAG
CCAATTATGTTTTGTGCATGGTCTTGTAATTCCAGTTGTATCGCATTCCTGAAATGCATCTGTACCAATTAAGTGAGTTGGAACTTGTCCAGATATACAA
ACTAATGGTATGGAGTCCATATATGCATCCGTCAAAGCGGTGACAGCATTTGTTGCTCCTGGTCCAGAAGTAACTAATACTACACCAGGCTTACCCGAAG
ATCTTGCGTATCCTTCTGCTGCGTGTCCCGCACCTTGTTCGTGTCTTACTAAAATATGTTTAATTCTCTCATGATTTTTTAATTCATCATAAATTGGAAG
AACTGCGCCACCAGGATAACCAAATATATATTCGACATCTTGATCCTCAAGACATTTGAAAACTATTTCTGCACCTGAATATAATTTAGACATCTGTCCA
ATCTAGCTGAAGTTGTGCTAATTGGTCAAGTTTTAGCAGAAATTATTTTAGAATTTTTTTGAATGGATTTTCTGATTTTGGATCAATTTTGTGCCAATTA
CTCATATGACCTCGAGACCATGTGCTCTGTCTTTTGGCGTATTGTCTGGTTTTTATTAGTATCTTGTCTTTAACGTCACTCAATTCAGCTTTTTTACTTA
AAAAAGAGTTAATCTCTTTAATACCAATCACATGATTAACACTATTCAATTTGTTAATTTTAATGAGATTAAATTTCTTAACTTCGCTTATGGCTCCTAA
ATCAAACATTCTATCAATTCTTTTTTTTATATTCTTTATTAATTTGTCTCTTGGATAATCCACATAAGTCATCACAAACTCATTCTTGTCGAAAAAGGTC
TTTGTCTCTTTAAACCATTTGTATAATGATTTTTTTGTAAGCTTTTTAACTTCGTATGCCCTTATTGATCTATTAACATCATTTGAATTAATAAATTTTT
AGAGACAGGATCTAATTTGACTAATTTTTTATAAAATTGC

Translation

[548 - 1039/1040]   indirect strand
>GOS_2163030 Translation [548-1039   indirect strand]
MSKLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAEGYARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCI
SGQVPTHLIGTDAFQECDTTGITRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK

[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

The analisised sequence has 167 aa and presents multiple sequences with homologes, with this information we consider it is coding. This sequence presents the start codon at position 548, but have no stop codon (because of this it is impossible calculate it's molecular weight).

By analisys of the BLAST results (E-Value of 5e-86 and score of 320 bits) it is possible to conclude that this sequence has a biological function and presents homology with the protein acetolactate synthase. But analisys the results in InterPro we verify that this protein appear as unintegrated (E-Value 2.5e-111)and as integrated protein the TPP_enzyme_N (E-value 1.5E-60), but as this enzyme is found in multiple proteins such as Acetolactate Synthase, we considere a Acetolactate Synthase homolog with sequence in study, this kind of enzymes make the synthesis of the aminoacid chain.(1)

The taxon for this organism is alpha-proteobacteria, because the score values and hits are high, and E-Value is low. Analyzing the phylogenetic tree we conclued that sequence in study belongs to the organism Candidatus Pelagibacter with branch support value 1.

This alpha-proteobacteria is envolved in biosynthetic process and the molecular function is catalytic activity.



(1)IPR004789






ORF finding

PROTOCOL

a) SMS ORFinder / foward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

b)SMS ORFinder / reverse strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code


RESULTS ANALYSIS


In the reading frame 1 and 2 the direct strand and on the reading frame 3 on the reverse strand no ORFs were found. In the reading frame 3 on the direct strand was found an ORF of 66 aa, this ORF is complete in both the 5 ' as the 3'. In the reading frame 1 on the reverse strand two ORFs were found: the first ORF has 152 aa and second has 62 aa. The longest ORF is found on the reverse strand, the reading frame -2, has 167 aa, with this info we find it the morost likely to have biological function. It is an incomplete ORF at the 3' as it presents no stop codon, but is complete in the 5 'end (this result can be confirmed in the multiple alignment). As this is the longest ORF it is the one to be annotated0. The sequence is coding, as despite having less than 200 aa it shows a high homology. The ORFs other found ORFs have no biological significance.


RAW RESULTS

a) foward strand


No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 177 to base 374.
GTTGGAACTTGTCCAGATATACAAACTAATGGTATGGAGTCCATATATGCATCCGTCAAA
GCGGTGACAGCATTTGTTGCTCCTGGTCCAGAAGTAACTAATACTACACCAGGCTTACCC
GAAGATCTTGCGTATCCTTCTGCTGCGTGTCCCGCACCTTGTTCGTGTCTTACTAAAATA
TGTTTAATTCTCTCATGA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
VGTCPDIQTNGMESIYASVKAVTAFVAPGPEVTNTTPGLPEDLAYPSAACPAPCSCLTKI
CLILS*

b)reverse strand

>ORF number 1 in reading frame 1 on the reverse strand extends from base 43 to base 498.
AAATTTATTAATTCAAATGATGTTAATAGATCAATAAGGGCATACGAAGTTAAAAAGCTT
ACAAAAAAATCATTATACAAATGGTTTAAAGAGACAAAGACCTTTTTCGACAAGAATGAG
TTTGTGATGACTTATGTGGATTATCCAAGAGACAAATTAATAAAGAATATAAAAAAAAGA
ATTGATAGAATGTTTGATTTAGGAGCCATAAGCGAAGTTAAGAAATTTAATCTCATTAAA
ATTAACAAATTGAATAGTGTTAATCATGTGATTGGTATTAAAGAGATTAACTCTTTTTTA
AGTAAAAAAGCTGAATTGAGTGACGTTAAAGACAAGATACTAATAAAAACCAGACAATAC
GCCAAAAGACAGAGCACATGGTCTCGAGGTCATATGAGTAATTGGCACAAAATTGATCCA
AAATCAGAAAATCCATTCAAAAAAATTCTAAAATAA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
KFINSNDVNRSIRAYEVKKLTKKSLYKWFKETKTFFDKNEFVMTYVDYPRDKLIKNIKKR
IDRMFDLGAISEVKKFNLIKINKLNSVNHVIGIKEINSFLSKKAELSDVKDKILIKTRQY
AKRQSTWSRGHMSNWHKIDPKSENPFKKILK*

>ORF number 2 in reading frame 1 on the reverse strand extends from base 751 to base 936.
GCCTGGTGTAGTATTAGTTACTTCTGGACCAGGAGCAACAAATGCTGTCACCGCTTTGAC
GGATGCATATATGGACTCCATACCATTAGTTTGTATATCTGGACAAGTTCCAACTCACTT
AATTGGTACAGATGCATTTCAGGAATGCGATACAACTGGAATTACAAGACCATGCACAAA
ACATAA

>Translation of ORF number 2 in reading frame 1 on the reverse strand.
AWCSISYFWTRSNKCCHRFDGCIYGLHTISLYIWTSSNSLNWYRCISGMRYNWNYKTMHK
T*

>ORF number 1 in reading frame 2 on the reverse strand extends from base 539 to base 1039.
ATTGGACAGATGTCTAAATTATATTCAGGTGCAGAAATAGTTTTCAAATGTCTTGAGGAT
CAAGATGTCGAATATATATTTGGTTATCCTGGTGGCGCAGTTCTTCCAATTTATGATGAA
TTAAAAAATCATGAGAGAATTAAACATATTTTAGTAAGACACGAACAAGGTGCGGGACAC
GCAGCAGAAGGATACGCAAGATCTTCGGGTAAGCCTGGTGTAGTATTAGTTACTTCTGGA
CCAGGAGCAACAAATGCTGTCACCGCTTTGACGGATGCATATATGGACTCCATACCATTA
GTTTGTATATCTGGACAAGTTCCAACTCACTTAATTGGTACAGATGCATTTCAGGAATGC
GATACAACTGGAATTACAAGACCATGCACAAAACATAATTGGCTCGTAAAGGATGTAAAA
GATTTGTCAAAAATTATACATAAAGCTTTTGAAGTTGCCACAACAGGAAGACCAGGACCA
GTTCTAGTTGATATACCAAAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
IGQMSKLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGH
AAEGYARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQEC
DTTGITRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOL

Phylogeny.fr/MUSCLE


RESULTS ANALYSIS


The sequence in study is complete in the 5'end in the same metionine as most other species, we consider it the starting codon for our sequence, but the sequence is incomplete in the 3'end as it does not present a STOP codon and is smaller than any other sequence on the analisys. All the sequencies present aproximatly de same size.And the results are in accordance with the results presented in protein domains.

The sequences present similar sizes showing that the domain is preserved.

RAW RESULTS

 
                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
out_gi_Caminiba  ------------------MKMTGARIVIESLIKENVEVVFGYPGGAIMNVYDEIYKQDKF
out_gi_Methylot  --------MADTPKNSSSKQITGAEILIRCLHEENVEFVFGYPGGAVLHIYDAIYHQDKF
out_gi_Burkhold  MNMPSAEFSTSDPLSPPDSDSIGATVLMKALADENVEFIWGYPGGSVLYIYDELYKQDKI
out_gi_Desulfov  ------------------MELTGAQIFLECLKKEGVDVVFGFPGGAVIDIYDELPNYP-F
gi_Azospirillum  ---------------MSEQKLTGAQIIIKALKDQGVDIIFGYPGGAVLPIYDALFQQNDL
out_gi_Nitrosoc  -----------------MGLLSGAEILVRCLQDEGVEYIFGYPGGAVLHIYDALYQQEAV
gi_Rhodobacter   ------------MNKAQTGTMTGAQMVVQALKDQGVEVVFGYPGGAVLPIYDAIFQQNDI
gi_Maritimibact  ----------------MTRQMTGAKMVVQALKDQGVDTVFGYPGGAVLPIYDEVFQQNDI
gi_Loktanella_v  ----------------MSKTMTGAKMVVQALIDQGVDVVFGYPGGAVLPIYDELFQQEKI
gi_Silicibacter  ----------------MTREMTGAKMVVQALKDQGVDTVFGYPGGAVLPIYDEIFLQNDI
gi_Sphingomonas  -----------------MAEKSGADILVECLVDLGVEVVFGYPGGAVLPIYDALYNHPTI
gi_Caulobacter   -MTAHQTIESQAPADTADRAMTGAEIVVRGLVDQGVEVLFGYPGGAVLPIYDALFHEPRL
gi_Xanthobacter  -MSPAGPKAPLMELQTMSIQMTGAEMVMRAFADQGVEHFFGYPGGAVLPIYDALFQQNAI
gi_Parvibaculum  ---------------MAAQELTGAEIVIKALVDQGVDTIFGYPGGAVLPIYDALFQQNKI
gi_Afipia_sp.    ---------MSETKKTESRQMTGAAMVVQALKDHSIQHIFGYPGGAVLPIYDEIFQQDAV
gi_Nitrobacter   ---------MSQNKHQDSNQMTGAAMIVRALVDHGVKHIFGYPGGAVLPIYDEIFQQRDI
gi_Roseibium_sp  ----------------MTREMTGAEMVIQALKDQGVDTIFGYPGGAVLPIYDEIIQQEGL
gi_Aurantimonas  --------------------MTGAAMVVQALKDHGVADIFGYPGGAVLPIYDEIFQQEAV
gi_Agrobacteriu  --------------------MTGAEIVLRALKDNGVEHIFGYPGGSVLPIYDEIFQQDEI
GOS_2163030      -------------IGQMSKLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERI
gi_Candidatus_P  ----------------MPKLYTGAEIVFKCLEDQKVEHIFGYPGGAVLPIYDELKNHSSI
                                      ####################################  #


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
out_gi_Caminiba  KHILTKHEQGAVHMADGYARATGKVGVAFVTSGPGITNAITGIATAYTDSIPMVVISGQV
out_gi_Methylot  KHILVRHEQAALHAADAYSRSTGKVGVALVTSGPGATNAVTGIATAYMDSIPMVIISGQV
out_gi_Burkhold  QHVLVRHEQAAVHAADAYARSTGKVGVCLVTSGPGVTNAVTGIATAYMDSIPMVVISGQV
out_gi_Desulfov  KHILVRHEQGAIHAADGYARATGDVGVCLVTSGPGATNTVTGIATAYMDSIPVVIFTGQV
gi_Azospirillum  KHVLVRHEQAAVHAAEGYARSTGKVGCVLVTSGPGATNAVTGLLDALCDSIPIVCLSGQV
out_gi_Nitrosoc  KHILVRHEQGAAHGADGYARATGKPGVVLVTSGPGATNAVTGIATAYMDSIPMVVITGQV
gi_Rhodobacter   KHILVRHEQGAVHMAEGYARSTGKPGVVVVTSGPGATNAVTGLTDALLDSIPLVVLSGQV
gi_Maritimibact  RHVLVRHEQGAVHAAEGYARSTGKPGVVLVTSGPGATNAVTGLTDALLDSIPIVVLTGQV
gi_Loktanella_v  KHVLVRHEQAAVHAAEGYARSTGKPGVALVTSGPGATNAVTGLTDALMDSIPIIVLTGQV
gi_Silicibacter  RHILVRHEQGAVHAAEGYARSTGKPGVALVTSGPGATNAVTGLTDALMDSIPIVVLTGQV
gi_Sphingomonas  RHVLVRHEQGATHMAEGYARSTGKPGVVLVTSGPGATNAVTGITDALLDSIPMVVITGQV
gi_Caulobacter   QHILVRHEQGAAHAAEGYARSSGKPGVVLVTSGPGATNAITGIMDALMDSIPMVVITGQV
gi_Xanthobacter  EHILVRHEQAAVHAAEGYARSSGKVGVVLVTSGPGATNAVTGLTDALMDSIPLVCITGQV
gi_Parvibaculum  RHILVRHEQGAVHAAEGYARSTGKPGVVLVTSGPGATNAVTGLTDALMDSIPLVCLTGQV
gi_Afipia_sp.    QHILVRHEQGAGHAAEGYARSTGKPGVALVTSGPGATNMVTALTDALMDSIPLVCITGQV
gi_Nitrobacter   EHVLVRHEQGAGHAAEGYARSTGKPGVALVTSGPGATNMVTPLADALMDSIPLVCITGQV
gi_Roseibium_sp  EHILVRHEQGAGHAAEGYARSTGKPGVVLVTSGPGATNMVTALTDALLDSIPLVCITGQV
gi_Aurantimonas  RHVLVRHEQGAGHAAEGYARSTGKPGVMLVTSGPGATNAVTALQDALMDSIPLVCITGQV
gi_Agrobacteriu  QHILVRHEQGAGHAAEGYARSTGKVGVMLVTSGPGVTNAITPLQDALMDSIPLVCLSGQV
GOS_2163030      KHILVRHEQGAGHAAEGYARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQV
gi_Candidatus_P  KHILVRHEQGAGHAAEGYARSSGKPGVVLVTSGPGATNVVTALTDAYMDSVPLVCISGQV
                 ############################################################


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
out_gi_Caminiba  PTTAIGTDAFQEVDAVGITRPITKHNFLVKDVKDLAYIIKEAFYLAKSGRPGPVHIDIPK
out_gi_Methylot  PTYAIGEDAFQECDTVGITRPCVKHNFLVKDVKDIAATMKKAFYVAASGRPGPVLVDIPK
out_gi_Burkhold  PTAAIGQDAFQECDTVGITRPCVKHNFLVKDVRDLAETVKKAFYIARTGRPGPVLIDIPK
out_gi_Desulfov  PTPLIGNDAFQEVDIVGITRPCTKHNYLVKDIKDLAYTVRQAFYLARTGRPGPVLVDLPK
gi_Azospirillum  PTHLIGNDAFQEADTTGITRPCTKHNYLVKDVDNLARTLHEAFYVARSGRPGPVLIDVPK
out_gi_Nitrosoc  PRAAIGSDAFQEVDSVGITRPCVKHNFLVKDLNDLALTVRKAFYIATTGRPGPVVVDIPK
gi_Rhodobacter   PTFMIGTDGFQEADTVGITRPCTKMNWLVKDTAKLSEVIHLGFHVATHGRPGPVLIDIPK
gi_Maritimibact  PTFMIGTDGFQEADTVGITRPCTKHNWLVKDTNKLADTIHQAFHVATTGRPGPTLIDIPK
gi_Loktanella_v  PTFMIGSDAFQEADTVGITRPCTKHNWLVKDTEKLSATLHEAFHVALSGRPGPVLIDIPK
gi_Silicibacter  PTFMIGSDAFQEADTVGITRPCTKHNWLVKDTNSLAATLHEAFHVATAGRPGPVLIDIPK
gi_Sphingomonas  PTQLIGTDAFQEADTVGITRHCSKHNYLVKDPAKLAGVVHEAFHIATTGRPGPVVVDIPK
gi_Caulobacter   PTHLIGTDAFQEADTVGMTRSCTKHNYLVKDVRDLPQIIHEAFKIATTGRPGPVLIDIPK
gi_Xanthobacter  ATHLIGNDAFQECDTVGITRPCTKHNYLVRDVNDLARVLHEAFYVAQNGRPGPVVVDIPK
gi_Parvibaculum  ATHLIGSDAFQECDTVGITRHCTKHNWLVKSAPELSRVMHEAFYVATNGRPGPVVIDIPK
gi_Afipia_sp.    PTHLIGNDAFQECDTVGITRPCTKHNWLVRDVNDLAKILHEAFYVATTGRPGPVVVDIPK
gi_Nitrobacter   PTHLIGNDAFQECDTVGITRPCTKHNWLVRDIKDLPKVLHEAFYVATSGRPGPVVVDVPK
gi_Roseibium_sp  PTQLIGSDAFQECDTVGITRPCTKHNWLVKDVEDLPRILHEAFYVATSGRPGPVVVDIPK
gi_Aurantimonas  PTTLIGSDAFQECDTVGITRPCTKHNWLVKDVNDLARVLHEAFHVATTGRPGPVVVDIPK
gi_Agrobacteriu  PTTLIGSDAFQECDTVGITRPCTKHNWLVKDVNDLARIIHEAFRIAKTGRPGPVVVDIPK
GOS_2163030      PTHLIGTDAFQECDTTGITRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK
gi_Candidatus_P  PTHLIGTDAFQECDTTGITRPCTKHNWLVKDINDLSNVMHEAFKVATTGRPGPVLIDIPK
                 ############################################################


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
out_gi_Caminiba  NVT--ADMTEFIYPE---KIDLKTYKPNYKGNKRAIKRTVEAIKNAKKPVFYIGGGSVLS
out_gi_Methylot  DIT--ADLCKFEYPE---SVSLRSYNPVTKGHLGQIKKALKLLAEAKRPMVYSGGGVVLG
out_gi_Burkhold  DIS--KTPCQYEPVK---SVSLRSYNPVTKGHSGQIRKAVSLLLSAKRPYIYTGGGIILA
out_gi_Desulfov  DIM--QQKFEFEWPE---DVSLRSYNPNLKPHARQIKKVAKLIEGAERPLIYAGGGVISS
gi_Azospirillum  DVQ--FADGTYVPPA---EVKHKTYRPQVKPEIARVEEAVELIANAKRPVFYTGGGVINA
out_gi_Nitrosoc  DVTDPNVKIPYHYPE--QLTLRSYHHPVTVETPEQIKKAVDLILSARRPMIYAGGGVVLG
gi_Rhodobacter   DVQ--FATAEYTPKP---KAKVSHYQPQLKGDLAQITRMVELIETAERPVFYTGGGVINS
gi_Maritimibact  DVQ--FAQGTYVEPQ---KARTEHYQPQVKGDIDAITRLAEMIEAAERPVFYTGGGVINS
gi_Loktanella_v  DVQ--FATGTYTEAR----QVETHYNPQVKGDLAMITELAKAMETAKRPVFYTGGGVINS
gi_Silicibacter  DVQ--FATGTYTGPK----PSTSHYQPAVKGDLDAITELVAAIETAKKPVFYTGGGVINS
gi_Sphingomonas  NVQ--IATAPYARPE---LKVHASYRPQTKADAAAIDAAVEMLAAAERPVLYTGGGVINS
gi_Caulobacter   DVQ--FAKGEYFGPG--EVASTHAYAPRTKGDAGRIAEAARMIAQARRPIFYTGGGVINA
gi_Xanthobacter  DVQ--FATGTYIGRE---NIQHKTYRPKLKAEDAQISAAVEMIAGAKKPIFYTGGGVINS
gi_Parvibaculum  DVQ--FQRAEYAGPQ---NVVHRTYRPKVKGDIDKIKEAVDLIANAKKPVFYTGGGIINS
gi_Afipia_sp.    DVQ--FATGTYHPPR--KNDVHVSYTPRVKGDAAQIRKAVALLASAKRPVIYSGGGVINS
gi_Nitrobacter   DLQ--FATGTYTPPR--KSDVHASYKPQIKGDAGQIRKAVALLLNAKRPVIYTGGGIINS
gi_Roseibium_sp  DVQ--FATGTYQGPTVNPSATHKSYRPQLKGDAGALRQVVEMMAAAKKPVFYTGGGVINS
gi_Aurantimonas  DVQ--FATGLYTPPA--PQTQHESYRPKLVGDRDRIEAAVAMLASAKRPIIYSGGGVINS
gi_Agrobacteriu  DVQ--FATGTYTPPE--NHTIQRSYQPKMQGDSRAIQAAVELMASARRPVIYSGGGVVNS
GOS_2163030      ------------------------------------------------------------
gi_Candidatus_P  DIQ--FAKAKYKKPK---IEKKLNGKIQNKFSQNDIEELIKLFSKAKKPVIYSGGGVINS
                                                                             


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
out_gi_Caminiba  G--ASNIIREIVKTTQIPAVETLMARGVLRYDCPYLLGMVGMHGSYAANMAMNDADLIIS
out_gi_Methylot  --DASAHLIKLIQSMGIPITSTLMGLGGFPASDEKFLGMLGMHGTYEANMAMQECDVLLA
out_gi_Burkhold  --DASRELNQFADLLGYPVTNTLMGLGGYRASDKKFLGMLGMHGTYEANMAMQHCDVLIA
out_gi_Desulfov  G--AEDELTWLAQSLNIPVTATLMGLGAFPGEDPLWLGMLGMHGTYAANMAINNADLVLA
gi_Azospirillum  GPFAAKLLTQFVKATGYPITSTLMGLGAFPASESQWLGMLGMHGTYEANLAMYECDVMIN
out_gi_Nitrosoc  --NAAQPLTEFVRLLGYPVTNTLMGLGGYPGTDPQFVGMLGMHGTYEANMGMHECDVLIA
gi_Rhodobacter   GPGASQLLRELVDATGFPITSTLMGLGAYPASGKAWLGMLGMHGLYEANLAMHGCDLMIN
gi_Maritimibact  GTAASQLLRELVDATNFPITSTLMGLGAYPASGKNWLGMLGMHGLYEANMAMHDCDLMIN
gi_Loktanella_v  GTAASQLLRELVAATGFPITSTLMGLGAYPASGDNWLGMLGMHGLYEANMAMHDCDLMIN
gi_Silicibacter  GPAASQLLRELVDATGFPITSTLMGLGAYPASGKNWIGMLGMHGLYEANMAMHDCDLMIN
gi_Sphingomonas  GPQASALLRELAALTGAPVTSTLMGLGAFPASSDQWLGMLGMHGTYEANWAMNQADLILC
gi_Caulobacter   GPKASAALREFAALTGAPVTSTLMGLGAFPAADPAWLGMLGMHGTFEANNAMHDCDVMIC
gi_Xanthobacter  GPEASRLLRELARLTGVPVTSTLMGLGAFPAANRQWLGMLGMHGTYEANMAMHDCDVMVC
gi_Parvibaculum  GNLASQLLREFVRLTGYPITSTLMGLGAYPASDKQWLGMLGMHGTFEANNAMHDCDVLIN
gi_Afipia_sp.    GLEATRLLRELVGTTNFPITSTLMGLGAYPASGKNWLGMLGMHGTYEANMAMHDCDVMLC
gi_Nitrobacter   GREASKTLRALVEATGFPITSTLMGLGAYPASGKNWLGMLGMHGTYEANMAMHDCDVMLC
gi_Roseibium_sp  GPEGAQLLRELVSLTGFPITSTLMGLGAYPGSGDNWLGMLGMHGTYEANMAMHDCDLMIN
gi_Aurantimonas  GPEAAQLLRELVALTGAPITSTLMGLGAYPASGESWLGMLGMHGTYEANLAMHGCDVMLC
gi_Agrobacteriu  GPEASKLLRELVSLTDFPITSTLMGLGSYPASGKNWLGMLGMHGSYEANMAMHDCDVMVC
GOS_2163030      ------------------------------------------------------------
gi_Candidatus_P  GPKASEALRELASLTGFPITSTLQGLGAFPGDDNQFLGMLGMHGTYEANNAMHDCDLLIN
                                                                             


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
out_gi_Caminiba  LGARFDDRVTGKIDEFAKNADI-IHIDIDPSQIGKVVETKYPIVGDVKLVLEEMMPML--
out_gi_Methylot  VGARFDDRVIGNTKHFLSTPRTIIHIDIDPSSISKRVKIDVPIVGDVKSVLADMNELI--
out_gi_Burkhold  IGARFDDRVIGDPAHFASRPRKIIHIDIDPSSISKRVKVDIPIVGDVKEVLKELIEQL--
out_gi_Desulfov  IGARFDDRVTGKVSTFAPKATL-VHIDIDPTSIQKNVAVHVPLVADCKSALSALKSEM--
gi_Azospirillum  IGARFDDRVTGKLSAFSPGSKK-IHVDIDPSSINKNVAVDIPIVGDCGAVLEDMLRIW--
out_gi_Nitrosoc  IGARFDDRVTGNLEQFCPYAKI-IHVDIDPSSISKNVQVDIPIVGDVGLVLKEMITVL--
gi_Rhodobacter   IGARFDDRITGRIKDFSPESTK-VHVDIDPSSINKVIRVDVPIIGDVGHVLEDALRLW--
gi_Maritimibact  VGARFDDRITGRIDAFSPGSKK-VHIDIDPSSINKVIHVDLPIVGDVGHVLEDLLRIW--
gi_Loktanella_v  IGARFDDRITGRIDAFSPRSKK-AHIDIDASSINKVVHADFPILGDVAHVLEDLLNVW--
gi_Silicibacter  VGARFDDRITGRIDAFSPKSKK-AHIDIDPSSINKVIRVDIPIVGDVAHVLEDVLKVW--
gi_Sphingomonas  IGARFDDRVTGRLDAFAPNSRK-IHIDIDRSSINKTVDVDLPVVADVGSALDDMIALW--
gi_Caulobacter   VGARFDDRVTGRLDAFSPGSKK-IHIDIDPSSINKNVRVDLPIVGDAGSVLEDLIAAW--
gi_Xanthobacter  IGARFDDRITGRLDAFAPGSKK-IHIDIDPSSINKNVKVDLPIIGDCTRVLADMVEAW--
gi_Parvibaculum  IGARFDDRVTGRLDAFSPNSKK-IHVDIDASSLNKNVRIDVGIIGDCAHVLEDMLRIW--
gi_Afipia_sp.    VGARFDDRVTGRPDAFSPNSKK-IHIDIDPSSINKNIRVDVPIIGDVANVLADLLEGL--
gi_Nitrobacter   IGARFDDRITGRTDAFSPGSKK-IHIDIDPSSINKNIRVDVPIIGDAGSVMADLLQAF--
gi_Roseibium_sp  IGARFDDRITGRIDAFAPNSRK-IHIDIDPSSINKIVKVDLPIIGDVAHVLEDLVRMW--
gi_Aurantimonas  VGARFDDRITGRLDAFSPHSRK-IHIDIDPSSINKNVRVDLPIIGDVTHVLRDMVGIW--
gi_Agrobacteriu  IGARFDDRITGRLNAFSPNSKK-IHIDIDPSSINKTVRVDIPITGDIAHVLEDMVRQW--
GOS_2163030      ------------------------------------------------------------
gi_Candidatus_P  IGARFDDRITGKIDEFSPKSKK-VHIDIDPSSINKIIKVDLAIVGDVSSVLNRINKTIVK
                                                                             


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
out_gi_Caminiba  -LDGIDPN---RYEEWREILKRYKELYPLTYSDSD-EVIKPQWVIQKTGE--LAPE-DAI
out_gi_Methylot  ATEKPAQN-TNALAAWFKQINAWRGKKCLDFAQSD-EFIKPQYVIQKLHE--VTKG-EAF
out_gi_Burkhold  QTAEHGPD-TEALAQWWKDIESWRAKDCLKYDRES-EIIKPQYVVEKAWE--LTDG-NAF
out_gi_Desulfov  EPNLDSVDWEVAHAVWVRQVQEWSETHPLRYKKGDTEFIKPQRVVEKVYE--ISKG-EAI
gi_Azospirillum  KARAKSPD-KAALKGWWSKIEGWRARNCLNYNRTE-SVIKPQYALERLRE--ALRGKDHY
out_gi_Nitrosoc  KSTDKRPD-GEALDKWWSQIEEWRGRRCLRYQQDG-KLIKPQYIIERLYE--ITKG-EAY
gi_Rhodobacter   KARGRKVN-KAGLAKWWAQIAEWRAVNCLDYKGST-KLIKPQYALQRLEA--LTKGMDRY
gi_Maritimibact  KSRGRKTN-VEALGNWWKQIDAWKEVNCLDYKNST-QTIKPQHALQRLEA--ITRGMDRY
gi_Loktanella_v  KARGRKTN-TEGLAKWWGQIKEWRAVDCLKFTQQG-KIIKPQYALERLEA--LTKKHDRY
gi_Silicibacter  KARGRKTN-TEAVAKWQAQISDWRKVNCLAYTNSE-KSIKPQYALQRLEA--LTKDRDRY
gi_Sphingomonas  KQRGHQQQ---DLSDWWSRIAQWRTKRSLSYPETG-PEIMPQRAIADLYQACMSTGRDVI
gi_Caulobacter   KAANLQPN-KAALTDWWAQIDQWRARQCLSYRRSD-SVIKPQYAIERLYE--LTKDKDVY
gi_Xanthobacter  NARSLKID-QPALAAWWTQIERWRSRNCLAYRPSD-EIIKPQFAIERLYE--ATKDKDVY
gi_Parvibaculum  KSKARRPD-KDALADWWKQIETWRGRKSLSFKTND-DVIKPQQAIQRLYE--LSKHRDTY
gi_Afipia_sp.    KAESKRPD----LKPWWAQIAKWRARNSLAFKKSD-DVILPQYAIQRLFE--ATKNRDTY
gi_Nitrobacter   KAEGKTPR----IDPWWFEIGRWRARNSLAYKKND-DVILPQFAIQRLFE--ATRGRDTY
gi_Roseibium_sp  RTSSAKAD-EAALKAWWAEIDSWRARNSLAYRPNN-DVIMPQYAIQRLYE--LTKDRETY
gi_Aurantimonas  KERGTAID-PASLAGWWDEIGTWRARDSLAYRPND-DVIMPQYAIQRLYA--HTRDRETY
gi_Agrobacteriu  RALAKKPD-AAQTAEWKASVAGWKARKSFSYTPSR-DVIMPQYAIERLSA--LSLGHDTY
GOS_2163030      ------------------------------------------------------------
gi_Candidatus_P  SKNGNGKSNKSNIAKWWEQIEKWRKKDSLNFINSD-ETIKPQYAVQRLYE--LTKNKDTY
                                                                             


                        430       440       450       460       470       480
                 =========+=========+=========+=========+=========+=========+
out_gi_Caminiba  ISTDVGQHQMWAAQFYPFTYPKQFLTSGGLGTMGFGFPAALGAKEGKKDKVVINFTGDGS
out_gi_Methylot  VTSDVGQHQMWAAQYYKFNDPRRWINSGGLGTMGVGLPYAMGVQFAHPNAQVACVTGEGS
out_gi_Burkhold  VCSDVGQHQMWAAQFYRFNKPRRWINSGGLGTMGFGLPAAMGVKMAHPDDDVLCITGEGS
out_gi_Desulfov  VATEVGQNQMWAAQFYKFKRSKSFLSSGGLGTMGFGFPAAIGAQMAFPDKLVVNIAGDGS
gi_Azospirillum  ITTEVGQHQMWAAQFLPFDQPNRWMTSGGLGTMGYGLPAAIGAQLAHPDAIVVDVSGEAS
out_gi_Nitrosoc  VTSDVGQHQMWTAQFYKFDKPRRWINSGGLGTMGFGLPAAMGVQLAYLDAPVVCVTGEAS
gi_Rhodobacter   ITTEVGQHQMWAAQFLGFEAPNRWMTSGGLGTMGYGLPASIGVQVAHPEALVINVAGDAS
gi_Maritimibact  VTTEVGQHQMWAAQFMGFDEPGRWMTSGGLGTMGYGLPASVGVQMAHPDSVVINVAGEAS
gi_Loktanella_v  ICTEVGQHQMWAAQYLGFEDPNRWMTSGGLGTMGYGFPASIGVQMAHPDALVINVAGEAS
gi_Silicibacter  VCTEVGQHQMWAAQFLGFEDPNRWMTSGGLGTMGYGFPASIGVQMAHPDALVINVAGEAS
gi_Sphingomonas  ITTEVGQHQMWAAQHFGFEAPNKWLTSGGLGTMGYGFPAAIGAQMGNPDSITICIAGDAS
gi_Caulobacter   ITTEVGQHQMWAAQFFRFEEPNRWMTSGGLGTMGYGLPAALGVQLAHPNSLVVDIAGEAS
gi_Xanthobacter  ISTEVGQHQMWAAQFFRFEEPNRWMTSGGLGTMGYGLPAAIGAQKAHPNALCIDIAGEAS
gi_Parvibaculum  ITTEVGQHQMWAAQHFPFEEPKHWMTSGGLGTMGYGLPAAVGVQIAHPDALVIDIAGEAS
gi_Afipia_sp.    ITTEVGQHQMWAAQFYGFEQPNRWMTSGGLGTMGYGFPSAIGVQVAHPKSLVIDIAGDAS
gi_Nitrobacter   ITTEVGQHQMWAAQFFGFDEPHRLMTSGGLGTMGYGLPAALGVQVAHRDSLVIDIAGDAS
gi_Roseibium_sp  ISTEVGQHQMWAAQFYGFDAPNRWLTSGGLGTMGYGLPAAIGAQVAHRDALCIDIAGDAS
gi_Aurantimonas  VSTEVGQHQMWAAQFYGFEAPNRWLTSGGLGTMGYGLPAAIGAQIAHPDALSVCIAGDAS
gi_Agrobacteriu  ITTEVGQHQMWAAQFFGFEQPNHWMTSGGLGTMGYGFPAAIGVQIAHPESLVIDIAGDAS
GOS_2163030      ------------------------------------------------------------
gi_Candidatus_P  VTTEVGQHQMWAAQHYKFNKPNRWMTSGGLGTMGYGLPAAVGVQIAHPEKLVVDIAGEAS
                                                                             


                        490       500       510       520       530       540
                 =========+=========+=========+=========+=========+=========+
out_gi_Caminiba  IVMNIQEVLTGYKYKLPVINIILNNNYLGMVRQWQTMFYEDRLSETDLSDVQPDFIKLAE
out_gi_Methylot  IQMNIQELSTCAQYHLPIKVIMLNNRYLGMVRQWQEFFYENRYSES-YMDSLPDFVKLAE
out_gi_Burkhold  IQMCIQELSTCLQYDTPVKIISLNNRYLGMVRQWQQIEYSKRYSHS-YMDALPDFVKLAE
out_gi_Desulfov  IQMNIQEMMTAVCNNLPVKIVILNNGYLGMVRQWQELFYNRNYCET-CMDAQPDFVKLAE
gi_Azospirillum  FLMNMQEIGTAVQYRAPVKIFILNNQYMGMVRQWQELLHGSRYSQS-YSEALPDFVKLAE
out_gi_Nitrosoc  IQMCIQELSTCMQYALPIKIVNLNNRYMGMVRQWQEFFYDRRYSHS-YMDALPDFVKLAE
gi_Rhodobacter   WLMNMQEMGTAVQFRAPVKQFILNNERLGMVRQWQQLLHGERYSQS-WSESLPDFVKLAD
gi_Maritimibact  WLMNMQEMGTAVQFRLPIKQFILNNERLGMVRQWQELLHGERYSHS-WSEALPDFVKLAE
gi_Loktanella_v  WLMNMQELGTAMQYRLPVKQFILNNERLGMVRQWQELLHGERYSSS-WSESLPDFVKLAE
gi_Silicibacter  WLMNMQEMGTAVQYRLPVKQFILNNERLGMVRQWQELLHGERYSHS-WSEALPDFVKLAE
gi_Sphingomonas  IQMNIQELGTATQYRLPVKIFILNNEYMGMVRQWQELTYESRYSNS-YSDSLPDFVKLGE
gi_Caulobacter   IQMCIQELSTAIQFDLPVKIFILNNEWMGMVRQWQQLLHGERYSHS-YSDSLPDFVKLAE
gi_Xanthobacter  ILMNMQEMSTAVQFDLPVKIFILNNRYMGMVRQWQELLHGGRYSHS-YSEALPDFVKLAD
gi_Parvibaculum  VQMCMQEISTAVQFMLPVKIFILNNEYMGMVRQWQELLHEGRYSHS-YSDSLPDFVKLAE
gi_Afipia_sp.    IQMMLQELSTAVQFDLPVKIFILNNQYMGMVRQWQQLLHGNRLSHS-YSEALPDFVKLAE
gi_Nitrobacter   VQMTMQEMSTAVQHDLPIKIFILNNQYMGMVRQWQQLLHGNRLSHS-YSEALPDFVKLAD
gi_Roseibium_sp  ILMNIQEMSTAVQFGLPVKVFILNNQYMGMVRQWQQLLHGNRLSHS-YTESLPDFIKLAE
gi_Aurantimonas  VLMNMQEMSTAVQHGANVKIFILNNQYMGMVRQWQQLLHGNRLSNS-YTEALPDFVKLAE
gi_Agrobacteriu  IQMCIQEMSCAVQYNAPVKIFILNNQYMGMVRQWQQLLHGNRLSNS-YTEAMPDFVKLAE
GOS_2163030      ------------------------------------------------------------
gi_Candidatus_P  VLMTMQEMSTAIQYNLPIKIFILNNQYMGMVRQWQELLHEKNYSES-YSEALPDFMKMAE
                                                                             


                        550       560       570       580       590       600
                 =========+=========+=========+=========+=========+=========+
out_gi_Caminiba  SMGGRGFTAKTKEEFEKVFNEALN--SNAVCFIDVQVDRREDVLPMVPPNSPLKNMLV--
out_gi_Methylot  AYGHVGMQITKPSDVEGALKEAFDM-KSRFVFLDFITDQKENVFPMIQNGKGLSEMILAS
out_gi_Burkhold  AYGHVGMRIEKTSDVEPALKEALRL-KDRTVFLDFQTDPTENVWPMVQAGKGITEMLL--
out_gi_Desulfov  AYGAAGYRVTEEKDLEPVLKEAFSN-GKPTII-DVRVDPEENVYPMVPAGASLTDMLL--
gi_Azospirillum  SWGCVGLRATTVAEVDEVIEKMLAVTDRPCII-DIAVDPKENCFPMIPGGKAHNEILF--
out_gi_Nitrosoc  AYGHVGMQIEEPGDVDAALKEAFAL-KDRLVFLDFITDQTENVYPMIAQGKGHHEMHL--
gi_Rhodobacter   AFGCKGIQCSDPADLDDAIMEMIRY-DGPFIF-DCLVEKHENCFPMIPSGKPHNEMLL--
gi_Maritimibact  AFGCKGRLVKDPAELDDAIQEMLDY-DGPFIL-DVMVEKHENCFPMIPSGEPHNKMLL--
gi_Loktanella_v  AFGAKGILCSDPDTLDDAIMEMLTH-KGPVLF-DCLVEKHENCFPMIPSGKPHNEMLL--
gi_Silicibacter  AFGAKGIICSDPADLDDAIMEMINY-DGPVIF-DCLVEKHENCFPMIPSGKAHNEMLL--
gi_Sphingomonas  AYGWTGIRIEGPEDLESGIRQMLDT-AGPVIV-DCRVAKLSNCFPMIPSGAAHTDMLL--
gi_Caulobacter   AYGAVGIRCDNPAELDAKILEMVNS-DKPVIF-DCRVEKHENCLPMIPSGKAHNEMIM--
gi_Xanthobacter  AYGGVGIRCEKPGDLDAAIQEMINV-KRPVIF-DCIVDQQENCFPMIPSGRAHNEMILGD
gi_Parvibaculum  AYGATGIRAEKPSELDAAIKKMIET-PGPVIF-DCLVDKFENCYPMIPSGAAHNEMIL--
gi_Afipia_sp.    AYGGVGMQVVKPGDLDGAIEEMIKV-RKPVIF-DCRVAALENCFPMIPSGKAHNEMLLPA
gi_Nitrobacter   AFGCVGLQATRPSDLDGAIAEMISV-KKPVLF-DCRVAALENCFPMIPSGKAHNEMLLPA
gi_Roseibium_sp  AYGGVGFRVDKPGDLDGAIEQMIAV-DKPVIF-DCRVANLTNCFPMIPSGKAHNEMLLPD
gi_Aurantimonas  AYGGHGIRCQKPGDLDAAIEEMLAV-DKPVLF-DCRVANLANCFPMIPSGKAHNEILLPD
gi_Agrobacteriu  AYGAVGIRCEKPDQLDDAILEMINV-KKPVIF-DCRVANLANCFPMIPSGKAHNEMLLPD
GOS_2163030      ------------------------------------------------------------
gi_Candidatus_P  AYGCKGIKAVNPLDLDEKIQEMIDY-DGPVIF-DCHVDPNENCFPMIPSGKPHNQMIL--
                                                                             


                        610
                 =========+=========
out_gi_Caminiba  -FKEDK-------------
out_gi_Methylot  DIGAEDL------------
out_gi_Burkhold  --GSEDL------------
out_gi_Desulfov  ------------------V
gi_Azospirillum  -GPEDSPSDATPEDGMVLV
out_gi_Nitrosoc  -APECKVPQSLEREWA---
gi_Rhodobacter   --GDAETEGAIGAKGAVLV
gi_Maritimibact  --GEASTADAIGTSGAVLV
gi_Loktanella_v  --GDASTKDAIQAGGAVLV
gi_Silicibacter  --GEAETQGVIDSKGSVLV
gi_Sphingomonas  --DPNQIAGIMSDEAKALV
gi_Caulobacter   -GEVEDIGNVIGEDGAGLV
gi_Xanthobacter  MAID--LDDAITDEGKMLV
gi_Parvibaculum  --GDDADGATVSEEGKMLV
gi_Afipia_sp.    EANDETTAAAF-AGGKALV
gi_Nitrobacter   EANDDVTAAAF-AGGKALV
gi_Roseibium_sp  EANDEAVANAIDASGKALV
gi_Aurantimonas  EASDEAVGSAIDAKGRALV
gi_Agrobacteriu  EATDDAVATAIDAKGRQLV
GOS_2163030      -------------------
gi_Candidatus_P  -GPNDQEENKIKGKGKALV
                                    




















Protein Domains

PROTOCOL

InterProScan/default parameters at EBI



RESULTS ANALYSIS


InterProScan has shown 5 domains, 4 of wich were unintegrated, as so these will be ignored in this analisys. All domains are ovelapped.

The integrated protein domain with an E-value of 1.5E-60 belongs to TPP_enzyme_N, this enzyme is found in multiple proteins such as Acetolactate Synthase, this domain has the function of conecting thiamine pyrophosphate.(1)

The results also show this sequence can contain the Acetolactate Synthase domain (not integrated) with an E-value of 2.5E-111, this protein belongs to a group of biosynthetic enzymes found in plants, fungi and bacteria. In it's subunits there is found one to conect natural modelators such as valine and leucine, this kind of enzymes make the sinthesys of the aminoacid chain. (2)

Despite the fact Acetolactate Synthase is not in a integrated domain this is the most probably function to the rotein as it's E-value is the closest to 0.


(1) IPR012001

(2) IPR004789


RAW RESULTS

Sequence_1	2F73F0BB2CB3A281	167	HMMPfam	         PF02776	             TPP_enzyme_N	                                     9	167	1.5e-60T	         12-Apr-2011	IPR012001	      Thiamine pyrophosphate enzyme, N-terminal TPP-binding domain	Molecular Function: thiamine pyrophosphate binding (GO:0030976)
Sequence_1	2F73F0BB2CB3A281	167	Gene3D	         G3DSA:3.40.50.970	    no description	                                     6	167	2.2e-72T	         12-Apr-2011	NULL	      NULL	
Sequence_1	2F73F0BB2CB3A281	167	superfamily	SSF52518	             Thiamin diphosphate-binding fold (THDP-binding)	 7	167	9.2e-56T	         12-Apr-2011	NULL	      NULL	
Sequence_1	2F73F0BB2CB3A281	167	HMMPanther	PTHR18968:SF13	    ACETOLACTATE SYNTHASE	                            3	167	2.5e-111T	         12-Apr-2011	NULL	      NULL	
Sequence_1	2F73F0BB2CB3A281	167	HMMPanther	PTHR18968	             FAMILY NOT NAMED	                            3	167	2.5e-111T   	         12-Apr-2011	NULL	      NULL	

Phylogeny

PROTOCOL

a) Phylogeny.fr / BioNJ method / in group: alpha-proteobacteria out group: other proteobacteria

b) Phylogeny.fr / PhyML method / no bootstrap / default substitution model /in group: alpha-proteobacteria out group: other proteobacteria


RESULTS ANALYSIS


Analysing the tree made with BioNJ we observe that outgroups are well separeted from ingroups presenting a branch support value of 95%. And analysing the tree made with PhyML observe that de ingroups and outgroups are not well separeted, so this is not a correct tree. The sequence analyzed in our study is inserted into the ingroups analyzed and it presents 91% Identity with Candidatus Pelagibacter and has a branch support value 1, this information can be checked in BioNJ.


RAW RESULTS
a) Phylogeny.fr / BioNJ method / in group: alpha-proteobacteria out group: other proteobacteria

                                                                                                          
                                                                                                     ------0.05----
 
               +------------------------------------------Sphingomonas_sp.                           (alpha-proteobacteria)
               |
   0.95        |--------------------------------Caulobacter_crescentus                               (alpha-proteobacteria)
 +-------------+
 |             |            1               +-----------GOS_2163030
 |             |----------------------------+
 |             |                            +------------Candidatus_Pelagibacter_sp.                 (alpha-proteobacteria)
 |             |
 |             |
 |             |---------------------------------------Xanthobacter_autotrophicus                            (alpha-proteobacteria)
 |             |
 |             |------------------------------------Parvibaculum_lavamentivorans                             (alpha-proteobacteria)
 |             |
 |             |--------------------------------------Roseibium_sp.                                          (alpha-proteobacteria)
 |             |
 |             |------------------------------------------Afipia_sp.                                         (alpha-proteobacteria)
 |             |
 |             |-----------------------------------------------Nitrobacter_winogradskyi                      (alpha-proteobacteria)
 |             |
 |             |--------------------------------------Aurantimonas_manganoxydans                             (alpha-proteobacteria)
 |             |
 |             |-----------------------------------------------Agrobacterium_vitis                           (alpha-proteobacteria)
 |             |
 |             |
 |             |-----------------------------------------------Azospirillum_sp.                              (alpha-proteobacteria)
 |             |
 |             |----------------------------------------------------------Rhodobacter_sp.                    (alpha-proteobacteria)
 |             |
 |             |-------------------------------------------------Maritimibacter_alkaliphilus                 (alpha-proteobacteria)
 |             |
 |             |-------------------------------------------------Loktanella_vestfoldensis                    (alpha-proteobacteria)
 |             |
 |             +-------------------------------------------Silicibacter_lacuscaerulensis                     (alpha-proteobacteria)
 |
 |       +------------------------------------------out_Methylotenera_sp.                                    (beta-proteobacteria)
 |0.95   |
 +-------+
         |----------------------------------------------out_Burkholderia_multivorans                         (beta-proteobacteria)          
         |
         |----------------------------------------------------------------out_Caminibacter_mediatlanticus    (epsilon-proteobacteria)
         |
         |--------------------------------------------------------out_Desulfovibrio_salexigens               (delta-proteobacteria)            
         |
         +-------------------------------out_Nitrosococcus_oceani                                            (gamma-proteobacteria)


b) Phylogeny.fr / PhyML method / no bootstrap / default substitution model /in group: alpha-proteobacteria out group: other proteobacteria



                                                                                                        -------0.1-----
 
               +-----------------------------------out_Methylotenera_sp.                                         (beta-proteobacteria)
      0.99     |
    +----------+--------------------------------------out_Burkholderia_multivorans                               (beta-proteobacteria)
    |          |
    |          |       0.61           +--------------------------------out_Caminibacter_mediatlanticus           (epsilon-proteobacteria)
    |          |----------------------+
    |          |                      +----------------------------out_Desulfovibrio_salexigens                  (delta-proteobacteria)
 +--+          |
 |  |          |
 |  |          +-----------out_Nitrosococcus_oceani                                                               (gamma-proteobacteria)
 |  |
 |  |-----------------------------------Sphingomonas_sp.                                                          (alpha-proteobacteria)
 |  |
 |  +--------------------------------Caulobacter_crescentus                                                       (alpha-proteobacteria)
 |
 |                   +---------------------------Azospirillum_sp.                                                 (alpha-proteobacteria)
 |                   |
 |  0.93             |     0.66               +-----------------Rhodobacter_sp.                                   (alpha-proteobacteria)
 +-------------------+------------------------+
                     |                        +---Maritimibacter_alkaliphilus                                      (alpha-proteobacteria)
                     |
                     |------------------------------Loktanella_vestfoldensis                                       (alpha-proteobacteria)
                     |
                     |
                     |------------------------Silicibacter_lacuscaerulensis                                         (alpha-proteobacteria)
                     |
                     |       +--------------------------GOS_2163030
                     | 0.89  |
                     |-------+--------------------------Candidatus_Pelagibacter_sp.                                  (alpha-proteobacteria)
                     |       |
                     |       |    0.88 +---Afipia_sp.                                                                (alpha-proteobacteria)
                     |       |  +------+
                     |       |  |      +--------------Nitrobacter_winogradskyi                                       (alpha-proteobacteria)
                     |      0.76|
                     |       +--+------------Roseibium_sp.                                                           (alpha-proteobacteria)
                     |          |
                     |          |
                     |          |-------------------Agrobacterium_vitis                                              (alpha-proteobacteria)
                     |          |
                     |          +----------Aurantimonas_manganoxydans                                                (alpha-proteobacteria)
                     |
                     |--------------------Xanthobacter_autotrophicus                                                 (alpha-proteobacteria)
                     |
                     +--------------------Parvibaculum_lavamentivorans                                                (alpha-proteobacteria)

Taxonomy report

PROTOCOL

a)BLASTp versus NR, NCBI default parameters apart from "Number of descriptions_1000"

b)BLASTp versus swissport, NCBI default parameters apart from "Number of descriptions_1000"



RESULTS ANALYSIS


This sequence belongs to a alpha-proteobacteria because it has score values and hits high, and the E-Value is low.

The sequences used in the taxonomy present alpha-proteobacteria as ingroup, since it is the group presenting a greatest number of hits and lowest E-values. As outgroup we use all other classes of proteobacteria (gama, beta, delta and epsilon) to increase biodiversity.




In group: alpha-proteobacteria


ref|ZP_05069586.1| Candidatus Pelagibacter sp. (HTCC7211) 5e-86 (alpha-proteobacteria)

ref|ZP_07025080.1| Afipia sp. (1NLS2) 1e-72 (alpha-proteobacteria)

ref|ZP_07661127.1| Roseibium sp. (TrichSKD4) 1e-72 (alpha-proteobacteria)

ref|YP_002517558.1| Caulobacter crescentus (NA1000) 3e-68 (alpha-proteobacteria)

ref|ZP_01303923.1| Sphingomonas sp. (SKA58) 2e-64 (alpha-proteobacteria)

ref|YP_003449356.1| Azospirillum sp. (B510) 5e-64 (alpha-proteobacteria)

ref|ZP_05843929.1| Rhodobacter sp. (SW2) 6e-64 (alpha-proteobacteria)

ref|ZP_05787379.1| Silicibacter lacuscaerulensis (ITI-1157) 1e-65 (alpha-proteobacteria)

ref|YP_318949.1| Nitrobacter winogradskyi (Nb-255) 1e-69 (alpha-proteobacteria)

ref|ZP_01227121.1| Aurantimonas manganoxydans (SI85-9A1) 3e-70 (alpha-proteobacteria)

ref|YP_002550030.1| Agrobacterium vitis (S4) 4e-70 (alpha-proteobacteria)

ref|YP_001413730.1| Parvibaculum lavamentivorans (DS-1) 4e-68 (alpha-proteobacteria)

ref|YP_001416393.1| Xanthobacter autotrophicus (Py2) 2e-67 (alpha-proteobacteria)

ref|ZP_01742236.1| Rhodobacterales bacterium (HTCC2150) 4e-68 (alpha-proteobacteria)

ref|ZP_01003737.1| Loktanella vestfoldensis (SKA53) 6e-67 (alpha-proteobacteria)


Out group: other proteobacteria


ref|YP_344503.1| Nitrosococcus oceani (ATCC 19707) 9e-64 (gamma-proteobacteria)

ref|YP_003673592.1| Methylotenera sp. (301) 5e-63 (beta-proteobacteria)

ref|YP_002991993.1| Desulfovibrio salexigens (DSM 2638) 5e-57 (delta-proteobacteria)

ref|YP_001579201.1| Burkholderia multivorans (ATCC 17616) 7e-56 (beta-proteobacteria)

ref|ZP_01870938.1| Caminibacter mediatlanticus (TB-2) 3e-55 (epsilon-proteobacteria)













































RAW RESULTS
a)BLASTp versus NR, NCBI default parameters apart from "Number of descriptions=1000"

Lineage Report

root
. cellular organisms
. . Bacteria                [bacteria]
. . . Proteobacteria          [proteobacteria]
. . . . Alphaproteobacteria     [a-proteobacteria]
. . . . . SAR11 cluster           [a-proteobacteria]
. . . . . . Candidatus Pelagibacter [a-proteobacteria]
. . . . . . . Candidatus Pelagibacter sp. HTCC7211 -----------------------  320 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ca
. . . . . . . Candidatus Pelagibacter ubique HTCC1062 ....................  320 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Candidatus Pelag
. . . . . . . Candidatus Pelagibacter ubique HTCC1002 ....................  319 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Candidatus Pelagib
. . . . . . . Candidatus Pelagibacter sp. IMCC9063 .......................  294 2 hits [a-proteobacteria]       acetolactate synthase large subunit [Candidatus Pelagibacte
. . . . . . alpha proteobacterium HIMB114 --------------------------------  290 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [al
. . . . . Polymorphum gilvum SL003B-26A1 ---------------------------------  279 2 hits [a-proteobacteria]       putative acetolactate synthase large subunit-like protein [
. . . . . Afipia sp. 1NLS2 ...............................................  275 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Af
. . . . . Roseibium sp. TrichSKD4 ........................................  275 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ro
. . . . . Labrenzia aggregata IAM 12614 ..................................  274 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Stappia aggregata 
. . . . . Hoeflea phototrophica DFL-43 ...................................  274 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Hoeflea phototroph
. . . . . Oligotropha carboxidovorans OM5 ................................  273 2 hits [a-proteobacteria]       large subunit of acetolactate synthase [Oligotropha carboxi
. . . . . Labrenzia alexandrii DFL-11 ....................................  273 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [La
. . . . . Brucella sp. BO1 ...............................................  270 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Br
. . . . . Brucella ceti M644/93/1 ........................................  270 3 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella ceti M6
. . . . . Brucella ceti M13/05/1 .........................................  270 3 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella ceti M6
. . . . . Brucella ovis ATCC 25840 .......................................  270 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella ovis AT
. . . . . Brucella neotomae 5K33 .........................................  270 3 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella neotoma
. . . . . Brucella abortus bv. 1 str. 9-941 ..............................  270 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella canis ATCC 23365 ......................................  270 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella suis ATCC 23445 .......................................  270 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella abortus S19 ...........................................  270 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella ceti str. Cudo ........................................  270 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella abortus str. 2308 A ...................................  270 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella abortus bv. 6 str. 870 ................................  270 3 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella abortus bv. 3 str. Tulya ..............................  270 3 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella abortus bv. 2 str. 86/8/59 ............................  270 3 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella suis bv. 5 str. 513 ...................................  270 3 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella suis bv. 3 str. 686 ...................................  270 3 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella pinnipedialis M163/99/10 ..............................  270 3 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella pinnipedialis B2/94 ...................................  270 3 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella abortus bv. 4 str. 292 ................................  270 3 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella pinnipedialis M292/94/1 ...............................  270 3 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella ceti M490/95/1 ........................................  270 3 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella ceti B1/94 ............................................  270 3 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella abortus bv. 9 str. C68 ................................  270 3 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella sp. F5/99 .............................................  270 3 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella abortus NCTC 8038 .....................................  270 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella suis bv. 4 str. 40 ....................................  270 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella abortus bv. 5 str. B3196 ..............................  270 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella abortus
. . . . . Brucella sp. NVSL 07-0026 ......................................  270 2 hits [a-proteobacteria]       acetolactate synthase [Brucella sp. NVSL 07-0026] >gi|29482
. . . . . Brucella sp. BO2 ...............................................  270 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Br
. . . . . Brucella suis 1330 .............................................  270 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella suis 13
. . . . . Brucella melitensis biovar Abortus 2308 ........................  270 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella suis 13
. . . . . Agrobacterium sp. H13-3 ........................................  270 2 hits [a-proteobacteria]       acetolactate synthase large subunit [Agrobacterium sp. H13-
. . . . . Brucella sp. 83/13 .............................................  270 3 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella sp. 83/
. . . . . Brucella sp. NF 2653 ...........................................  270 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella sp. 83/
. . . . . Ochrobactrum anthropi ATCC 49188 ...............................  270 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Ochrobactrum ant
. . . . . Ochrobactrum intermedium LMG 3301 ..............................  270 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Oc
. . . . . Agrobacterium tumefaciens str. C58 .............................  269 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Agrobacterium tu
. . . . . Chelativorans sp. BNC1 .........................................  269 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Mesorhizobium sp
. . . . . Rhizobium etli CNPAF512 ........................................  268 1 hit  [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Rhizobium etli C
. . . . . Aurantimonas manganoxydans SI85-9A1 ............................  267 2 hits [a-proteobacteria]       acetolactate synthase [Aurantimonas manganoxydans SI85-9A1]
. . . . . Nitrobacter sp. Nb-311A ........................................  267 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Nitrobacter sp. Nb
. . . . . Rhizobium leguminosarum bv. viciae 3841 ........................  267 4 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Rhizobium legumi
. . . . . Sinorhizobium fredii NGR234 ....................................  267 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Sinorhizobium fr
. . . . . Agrobacterium vitis S4 .........................................  267 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Agrobacterium vi
. . . . . Brucella melitensis bv. 1 str. 16M .............................  267 4 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella meliten
. . . . . Brucella melitensis ATCC 23457 .................................  267 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella meliten
. . . . . Brucella melitensis bv. 1 str. Rev.1 ...........................  267 3 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella meliten
. . . . . Brucella melitensis bv. 2 str. 63/9 ............................  267 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella meliten
. . . . . Brucella melitensis M28 ........................................  267 1 hit  [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella meliten
. . . . . Brucella melitensis M5-90 ......................................  267 1 hit  [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella meliten
. . . . . Brucella microti CCM 4915 ......................................  267 2 hits [a-proteobacteria]       acetolactate synthase 3 large subunit [Brucella microti CCM
. . . . . Brucella melitensis bv. 3 str. Ether ...........................  266 3 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Brucella meliten
. . . . . Rhizobium etli CIAT 894 ........................................  266 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Rhizobium etli C
. . . . . Rhizobium leguminosarum bv. trifolii WSM2304 ...................  266 4 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Rhizobium legumi
. . . . . Bradyrhizobium japonicum USDA 110 ..............................  266 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Bradyrhizobium j
. . . . . Sinorhizobium medicae WSM419 ...................................  266 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Sinorhizobium me
. . . . . Rhizobium etli CIAT 652 ........................................  266 2 hits [a-proteobacteria]       acetolactate synthase III protein, large subunit [Rhizobium
. . . . . Rhizobium etli CFN 42 ..........................................  266 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Rhizobium etli C
. . . . . Pseudovibrio sp. JE062 .........................................  266 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ps
. . . . . Sinorhizobium meliloti 1021 ....................................  266 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Sinorhizobium me
. . . . . Sinorhizobium meliloti BL225C ..................................  266 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Sinorhizobium me
. . . . . Sinorhizobium meliloti AK83 ....................................  266 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Sinorhizobium me
. . . . . Rhizobium etli Kim 5 ...........................................  266 1 hit  [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Rhizobium etli K
. . . . . Rhizobium leguminosarum bv. trifolii WSM1325 ...................  266 4 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Rhizobium legumi
. . . . . Nitrobacter winogradskyi Nb-255 ................................  265 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Nitrobacter wino
. . . . . Agrobacterium radiobacter K84 ..................................  265 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ag
. . . . . Mesorhizobium ciceri biovar biserrulae WSM1271 .................  263 4 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Me
. . . . . Mesorhizobium opportunistum WSM2075 ............................  262 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Me
. . . . . Methylocella silvestris BL2 ....................................  261 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Me
. . . . . Mesorhizobium loti MAFF303099 ..................................  261 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Mesorhizobium lo
. . . . . Azorhizobium caulinodans ORS 571 ...............................  261 2 hits [a-proteobacteria]       acetolactate synthase large subunit [Azorhizobium caulinoda
. . . . . Methylocystis sp. ATCC 49242 ...................................  261 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Me
. . . . . Starkeya novella DSM 506 .......................................  261 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [St
. . . . . Caulobacter crescentus NA1000 ..................................  261 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Caulobacter cres
. . . . . Caulobacter vibrioides .........................................  261 1 hit  [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Caulobacter cres
. . . . . Rhodobacterales bacterium HTCC2255 .............................  260 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [alpha proteobacter
. . . . . Parvibaculum lavamentivorans DS-1 ..............................  260 2 hits [a-proteobacteria]       acetolactate synthase large subunit [Parvibaculum lavamenti
. . . . . Caulobacter crescentus CB15 ....................................  260 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Caulobacter cres
. . . . . Rhodomicrobium vannielii ATCC 17100 ............................  260 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Rh
. . . . . Caulobacter segnis ATCC 21756 ..................................  259 2 hits [a-proteobacteria]       acetolactate synthase large subunit [Caulobacter segnis ATC
. . . . . Caulobacter sp. K31 ............................................  259 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Caulobacter sp. 
. . . . . Methylosinus trichosporium OB3b ................................  258 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Me
. . . . . Hyphomicrobium denitrificans ATCC 51888 ........................  258 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Hy
. . . . . Xanthobacter autotrophicus Py2 .................................  258 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Xa
. . . . . Nitrobacter hamburgensis X14 ...................................  257 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Nitrobacter hamb
. . . . . Loktanella vestfoldensis SKA53 .................................  256 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Loktanella vestfol
. . . . . Roseobacter sp. CCS2 ...........................................  256 2 hits [a-proteobacteria]       acetolactate synthase, large subunit [Roseobacter sp. CCS2]
. . . . . Rhodobacter sphaeroides KD131 ..................................  256 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Rhodobacter spha
. . . . . Rhodobacter sphaeroides 2.4.1 ..................................  256 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Rhodobacter spha
. . . . . Rhodobacter sphaeroides ATCC 17029 .............................  256 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Rhodobacter spha
. . . . . Roseobacter denitrificans OCh 114 ..............................  255 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Roseobacter deni
. . . . . Roseobacter litoralis Och 149 ..................................  255 2 hits [a-proteobacteria]       acetolactate synthase, large subunit [Roseobacter litoralis
. . . . . Sagittula stellata E-37 ........................................  255 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Sagittula stellata
. . . . . Rhodobacter sphaeroides ATCC 17025 .............................  255 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Rhodobacter spha
. . . . . Rhodobacteraceae bacterium KLH11 ...............................  255 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Rh
. . . . . Ketogulonicigenium vulgare Y25 .................................  254 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ke
. . . . . Roseovarius nubinhibens ISM ....................................  254 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Roseovarius nubinh
. . . . . Dinoroseobacter shibae DFL 12 ..................................  254 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Dinoroseobacter 
. . . . . Maritimibacter alkaliphilus HTCC2654 ...........................  254 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Maritimibacter alk
. . . . . Rhodobacter capsulatus SB 1003 .................................  254 2 hits [a-proteobacteria]       acetolactate synthase large subunit [Rhodobacter capsulatus
. . . . . Roseobacter sp. AzwK-3b ........................................  254 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Roseobacter sp. Az
. . . . . Silicibacter sp. TrichCH4B .....................................  253 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Si
. . . . . Roseovarius sp. TM1035 .........................................  253 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Roseovarius sp. TM
. . . . . Rhodopseudomonas palustris BisB18 ..............................  253 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Rhodopseudomonas
. . . . . Rhodobacterales bacterium Y4I ..................................  253 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Rh
. . . . . Fulvimarina pelagi HTCC2506 ....................................  253 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Fulvimarina pelagi
. . . . . Roseobacter sp. SK209-2-6 ......................................  253 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Roseobacter sp. SK
. . . . . Roseovarius sp. 217 ............................................  253 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Roseovarius sp. 21
. . . . . Rhodospirillum rubrum ATCC 11170 ...............................  253 2 hits [a-proteobacteria]       acetolactate synthase, large subunit [Rhodospirillum rubrum
. . . . . Beijerinckia indica subsp. indica ATCC 9039 ....................  253 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Be
. . . . . Rhodopseudomonas palustris HaA2 ................................  253 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Rhodopseudomonas
. . . . . Ruegeria pomeroyi DSS-3 ........................................  252 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Ruegeria pomeroy
. . . . . Ruegeria sp. R11 ...............................................  252 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ru
. . . . . Ruegeria sp. TM1040 ............................................  252 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Ruegeria sp. TM1
. . . . . Silicibacter lacuscaerulensis ITI-1157 .........................  252 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Si
. . . . . Phaeobacter gallaeciensis BS107 ................................  252 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Phaeobacter gallae
. . . . . Magnetospirillum magneticum AMB-1 ..............................  252 2 hits [a-proteobacteria]       thiamine pyrophosphate-requiring enzyme [Magnetospirillum m
. . . . . Phaeobacter gallaeciensis 2.10 .................................  252 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Phaeobacter gallae
. . . . . Roseobacter sp. GAI101 .........................................  252 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ro
. . . . . Oceanicola batsensis HTCC2597 ..................................  251 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Oceanicola batsens
. . . . . Roseobacter sp. MED193 .........................................  251 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Roseobacter sp. ME
. . . . . Bartonella tribocorum CIP 105476 ...............................  251 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Bartonella tribo
. . . . . Sphingobium japonicum UT26S ....................................  251 2 hits [a-proteobacteria]       acetolactate synthase large subunit [Sphingobium japonicum 
. . . . . Bartonella schoenbuchensis R1 ..................................  251 1 hit  [a-proteobacteria]       acetolactate synthase large subunit [Bartonella schoenbuche
. . . . . Methylobacterium sp. 4-46 ......................................  251 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Me
. . . . . Methylobacterium nodulans ORS 2060 .............................  251 2 hits [a-proteobacteria]       acetolactate synthase large subunit, biosynthetic type [Met
. . . . . Rhodopseudomonas palustris CGA009 ..............................  251 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Rhodopseudomonas
. . . . . Rhodopseudomonas palustris TIE-1 ...............................  251 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Rhodopseudomonas
. . . . . Rhodobacteraceae bacterium HTCC2083 ............................  250 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Rh
. . . . . Jannaschia sp. CCS1 ............................................  250 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Jannaschia sp. C
. . . . . Rhodopseudomonas palustris BisB5 ...............................  250 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Rhodopseudomonas
. . . . . Sphingobium chlorophenolicum L-1 ...............................  250 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Sp
. . . . . Erythrobacter sp. NAP1 .........................................  250 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Erythrobacter sp. 
. . . . . Bradyrhizobium sp. BTAi1 .......................................  250 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Bradyrhizobium s
. . . . . Rhodopseudomonas palustris DX-1 ................................  250 2 hits [a-proteobacteria]       acetolactate synthase large subunit, biosynthetic type [Rho
. . . . . Bradyrhizobium sp. ORS278 ......................................  250 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Bradyrhizobium s
. . . . . Methylobacterium radiotolerans JCM 2831 ........................  249 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Me
. . . . . Thalassiobium sp. R2A62 ........................................  249 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Th
. . . . . Rhodopseudomonas palustris BisA53 ..............................  249 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Rhodopseudomonas
. . . . . Citreicella sp. SE45 ...........................................  249 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ci
. . . . . alpha proteobacterium BAL199 ...................................  249 2 hits [a-proteobacteria]       Acetolactate synthase, large subunit, biosynthetic type [al
. . . . . Phenylobacterium zucineum HLK1 .................................  249 2 hits [a-proteobacteria]       acetolactate synthase, large subunit [Phenylobacterium zuci
. . . . . Rhodobacteraceae bacterium HTCC2150 ............................  248 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Rhodobacterales ba
. . . . . Sulfitobacter sp. NAS-14.1 .....................................  248 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Sulfitobacter sp. 
. . . . . Sphingomonas sp. SKA58 .........................................  248 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Sp
. . . . . Candidatus Puniceispirillum marinum IMCC1322 ...................  248 2 hits [a-proteobacteria]       acetolactate synthase large subunit biosynthetic type [Cand
. . . . . Octadecabacter antarcticus 307 .................................  248 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Oc
. . . . . Hirschia baltica ATCC 49814 ....................................  247 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Hi
. . . . . Paracoccus denitrificans PD1222 ................................  247 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Paracoccus denit
. . . . . Rhodospirillum centenum SW .....................................  247 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Rh
. . . . . Pelagibaca bermudensis HTCC2601 ................................  247 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Pelagibaca bermude
. . . . . Methylobacterium extorquens PA1 ................................  247 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Me
. . . . . Methylobacterium extorquens DM4 ................................  247 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Me
. . . . . Methylobacterium chloromethanicum CM4 ..........................  247 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Me
. . . . . Methylobacterium extorquens AM1 ................................  247 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Me
. . . . . Azospirillum sp. B510 ..........................................  247 2 hits [a-proteobacteria]       acetolactate synthase large subunit [Azospirillum sp. B510]
. . . . . Oceanibulbus indolifex HEL-45 ..................................  247 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Oceanibulbus indol
. . . . . Granulibacter bethesdensis CGDNIH1 .............................  246 2 hits [a-proteobacteria]       acetolactate synthase large subunit [Granulibacter bethesde
. . . . . Rhodobacter sp. SW2 ............................................  246 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Rh
. . . . . Bartonella grahamii as4aup .....................................  246 2 hits [a-proteobacteria]       acetolactate synthase isozyme III large subunit [Bartonella
. . . . . Hyphomonas neptunium ATCC 15444 ................................  246 2 hits [a-proteobacteria]       acetolactate synthase large subunit, biosynthetic type [Hyp
. . . . . Octadecabacter antarcticus 238 .................................  245 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Oc
. . . . . Magnetospirillum gryphiswaldense MSR-1 .........................  245 1 hit  [a-proteobacteria]       Acetolactate synthase, large subunit, biosynthetic type [Ma
. . . . . Sulfitobacter sp. EE-36 ........................................  244 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Sulfitobacter sp. 
. . . . . Acidiphilium multivorum AIU301 .................................  244 2 hits [a-proteobacteria]       acetolactate synthase large subunit [Acidiphilium multivoru
. . . . . Acidiphilium cryptum JF-5 ......................................  244 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ac
. . . . . Ahrensia sp. R2A130 ............................................  244 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ah
. . . . . Methylobacterium populi BJ001 ..................................  243 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Me
. . . . . Magnetospirillum magnetotacticum MS-1 ..........................  243 1 hit  [a-proteobacteria]       COG0028: Thiamine pyrophosphate-requiring enzymes [acetolac
. . . . . Roseomonas cervicalis ATCC 49957 ...............................  243 2 hits [a-proteobacteria]       acetolactate synthase large subunit [Roseomonas cervicalis 
. . . . . Oceanicola granulosus HTCC2516 .................................  242 2 hits [a-proteobacteria]       acetolactate synthase III large subunit [Oceanicola granulo
. . . . . Bartonella henselae str. Houston-1 .............................  240 2 hits [a-proteobacteria]       acetolactate synthase 3 catalytic subunit [Bartonella hense
. . . . . Sphingomonas wittichii RW1 .....................................  238 2 hits [a-proteobacteria]       acetolactate synthase large subunit [Sphingomonas wittichii
. . . . . Sphingopyxis alaskensis RB2256 .................................  238 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Sp
. . . . . Zymomonas mobilis subsp. mobilis ATCC 10988 ....................  232 2 hits [a-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Zy
. . . . . Zymomonas mobilis subsp. mobilis ZM4 ...........................  232 2 hits [a-proteobacteria]       acetolactate synthase large subunit [Zymomonas mobilis subs
. . . . . Zymomonas mobilis subsp. mobilis NCIMB 11163 ...................  232 2 hits [a-proteobacteria]       acetolactate synthase large subunit [Zymomonas mobilis subs
. . . . . Erythrobacter litoralis HTCC2594 ...............................  228 2 hits [a-proteobacteria]       acetolactate synthase large subunit [Erythrobacter litorali
. . . . . Erythrobacter sp. SD-21 ........................................  225 2 hits [a-proteobacteria]       acetolactate synthase large subunit [Erythrobacter sp. SD-2
. . . . . Gluconobacter oxydans 621H .....................................  224 2 hits [a-proteobacteria]       acetolactate synthase large subunit [Gluconobacter oxydans 
. . . . . Novosphingobium nitrogenifigens DSM 19370 ......................  223 2 hits [a-proteobacteria]       acetolactate synthase, large subunit [Novosphingobium nitro
. . . . . Acetobacter pasteurianus IFO 3283-01 ...........................  223 2 hits [a-proteobacteria]       acetolactate synthase large subunit [Acetobacter pasteurian
. . . . . Acetobacter pasteurianus IFO 3283-03 ...........................  223 1 hit  [a-proteobacteria]       acetolactate synthase large subunit [Acetobacter pasteurian
. . . . . Acetobacter pasteurianus IFO 3283-07 ...........................  223 1 hit  [a-proteobacteria]       acetolactate synthase large subunit [Acetobacter pasteurian
. . . . . Acetobacter pasteurianus IFO 3283-22 ...........................  223 1 hit  [a-proteobacteria]       acetolactate synthase large subunit [Acetobacter pasteurian
. . . . . Acetobacter pasteurianus IFO 3283-26 ...........................  223 1 hit  [a-proteobacteria]       acetolactate synthase large subunit [Acetobacter pasteurian
. . . . . Acetobacter pasteurianus IFO 3283-32 ...........................  223 1 hit  [a-proteobacteria]       acetolactate synthase large subunit [Acetobacter pasteurian
. . . . . Acetobacter pasteurianus IFO 3283-01-42C .......................  223 1 hit  [a-proteobacteria]       acetolactate synthase large subunit [Acetobacter pasteurian
. . . . . Acetobacter pasteurianus IFO 3283-12 ...........................  223 1 hit  [a-proteobacteria]       acetolactate synthase large subunit [Acetobacter pasteurian
. . . . . Acetobacter pomorum DM001 ......................................  221 2 hits [a-proteobacteria]       Acetolactate synthase large subunit [Acetobacter pomorum DM
. . . . . Gluconacetobacter diazotrophicus PAl 5 .........................  220 4 hits [a-proteobacteria]       putative acetolactate synthase isozyme III large subunit [G
. . . . . Novosphingobium aromaticivorans DSM 12444 ......................  218 2 hits [a-proteobacteria]       acetolactate synthase, large subunit [Novosphingobium aroma
. . . . Nitrosococcus oceani ATCC 19707 ----------------------------------  246 2 hits [g-proteobacteria]       acetolactate synthase large subunit biosynthetic type [Nitr
. . . . Nitrosococcus watsonii C-113 .....................................  246 2 hits [g-proteobacteria]       acetolactate synthase large subunit [Nitrosococcus watsoni 
. . . . Methylotenera sp. 301 ............................................  243 2 hits [b-proteobacteria]       acetolactate synthase large subunit [Methylotenera sp. 301]
. . . . Janthinobacterium sp. Marseille ..................................  243 2 hits [b-proteobacteria]       acetolactate synthase large subunit [Janthinobacterium sp. 
. . . . Methylococcus capsulatus str. Bath ...............................  243 2 hits [g-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Me
. . . . Oxalobacteraceae bacterium IMCC9480 ..............................  243 2 hits [b-proteobacteria]       Acetolactate synthase large subunit [Oxalobacteraceae bacte
. . . . Thioalkalivibrio sp. HL-EbGR7 ....................................  243 2 hits [g-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Th
. . . . Nitrosococcus halophilus Nc4 .....................................  242 2 hits [g-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ni
. . . . Nitrosospira multiformis ATCC 25196 ..............................  241 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ni
. . . . Methylophaga thiooxydans DMS010 ..................................  240 2 hits [g-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Me
. . . . Herminiimonas arsenicoxydans .....................................  240 2 hits [b-proteobacteria]       acetolactate synthase III large subunit [Herminiimonas arse
. . . . Acidithiobacillus ferrooxidans ATCC 53993 ........................  239 2 hits [g-proteobacteria]       acetolactate synthase large subunit [Acidithiobacillus ferr
. . . . Acidithiobacillus ferrooxidans ATCC 23270 ........................  239 2 hits [g-proteobacteria]       acetolactate synthase large subunit [Acidithiobacillus ferr
. . . . Methylobacter tundripaludum SV96 .................................  239 2 hits [g-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Me
. . . . Limnobacter sp. MED105 ...........................................  238 2 hits [b-proteobacteria]       acetolactate synthase large subunit [Limnobacter sp. MED105
. . . . Halothiobacillus neapolitanus c2 .................................  238 2 hits [g-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ha
. . . . Thioalkalivibrio sp. K90mix ......................................  238 2 hits [g-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Th
. . . . Nitrosomonas europaea ATCC 19718 .................................  238 2 hits [b-proteobacteria]       thiamine pyrophosphate dependent enzyme [Nitrosomonas europ
. . . . Nitrosomonas eutropha C91 ........................................  237 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ni
. . . . Nitrosomonas sp. AL212 ...........................................  236 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ni
. . . . Sideroxydans lithotrophicus ES-1 .................................  236 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Si
. . . . Dechloromonas aromatica RCB ......................................  236 2 hits [b-proteobacteria]       acetolactate synthase, large subunit [Dechloromonas aromati
. . . . Burkholderia thailandensis MSMB43 ................................  235 1 hit  [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia tha
. . . . Candidatus Accumulibacter phosphatis clade IIA str. UW-1 .........  234 2 hits [b-proteobacteria]       acetolactate synthase large subunit [Candidatus Accumulibac
. . . . Gallionella capsiferriformans ES-2 ...............................  234 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ga
. . . . Aromatoleum aromaticum EbN1 ......................................  234 2 hits [b-proteobacteria]       thiamine pyrophosphate dependent acetolactate synthase [Aro
. . . . Magnetococcus sp. MC-1 ...........................................  234 2 hits [proteobacteria]         acetolactate synthase, large subunit [Magnetococcus sp. MC-
. . . . Herbaspirillum seropedicae SmR1 ..................................  233 2 hits [b-proteobacteria]       acetolactate synthase isozyme III large subunit [Herbaspiri
. . . . Azoarcus sp. BH72 ................................................  233 2 hits [b-proteobacteria]       acetolactate synthase [Azoarcus sp. BH72] >gi|119671857|emb
. . . . Burkholderia mallei ATCC 23344 ...................................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia mal
. . . . Burkholderia mallei SAVP1 ........................................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia mal
. . . . Burkholderia mallei NCTC 10229 ...................................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia mal
. . . . Burkholderia mallei NCTC 10247 ...................................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia mal
. . . . Burkholderia mallei PRL-20 .......................................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia mal
. . . . Burkholderia mallei GB8 horse 4 ..................................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia mal
. . . . Burkholderia mallei ATCC 10399 ...................................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia mal
. . . . Burkholderia mallei FMH ..........................................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia mal
. . . . Desulfobacca acetoxidans DSM 11109 ...............................  233 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [De
. . . . Burkholderia mallei JHU ..........................................  233 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Bu
. . . . Burkholderia mallei 2002721280 ...................................  233 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Bu
. . . . Burkholderia pseudomallei 305 ....................................  233 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Bu
. . . . Burkholderia pseudomallei K96243 .................................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia pseudomallei 1710b ..................................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia pseudomallei 668 ....................................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia pseudomallei 1106a ..................................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia pseudomallei DM98 ...................................  233 1 hit  [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia pseudomallei 14 .....................................  233 1 hit  [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia pseudomallei 91 .....................................  233 1 hit  [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia pseudomallei 9 ......................................  233 1 hit  [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia pseudomallei B7210 ..................................  233 1 hit  [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia pseudomallei 7894 ...................................  233 1 hit  [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia pseudomallei NCTC 13177 .............................  233 1 hit  [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia pseudomallei 112 ....................................  233 1 hit  [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia pseudomallei BCC215 .................................  233 1 hit  [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia pseudomallei 576 ....................................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia pseudomallei Pakistan 9 .............................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia pseudomallei MSHR346 ................................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia pseudomallei 1106b ..................................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia pseudomallei 1655 ...................................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia pseudomallei Pasteur 52237 ..........................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia pseudomallei S13 ....................................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia pseudomallei 1710a ..................................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia pseudomallei 406e ...................................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia pse
. . . . Burkholderia phytofirmans PsJN ...................................  233 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia phy
. . . . Burkholderia oklahomensis EO147 ..................................  233 1 hit  [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia okl
. . . . Burkholderia oklahomensis C6786 ..................................  233 1 hit  [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia okl
. . . . Burkholderia thailandensis E264 ..................................  233 3 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia tha
. . . . Burkholderia thailandensis TXDOH .................................  233 1 hit  [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia tha
. . . . Burkholderia thailandensis Bt4 ...................................  233 1 hit  [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia tha
. . . . Achromobacter piechaudii ATCC 43553 ..............................  232 2 hits [b-proteobacteria]       acetolactate synthase large subunit [Achromobacter piechaud
. . . . Achromobacter xylosoxidans A8 ....................................  232 2 hits [b-proteobacteria]       acetolactate synthase large subunit, biosynthetic type 3 [A
. . . . Pusillimonas sp. T7-7 ............................................  232 1 hit  [b-proteobacteria]       acetolactate synthase isozyme III large subunit [Pusillimon
. . . . Achromobacter xylosoxidans C54 ...................................  231 1 hit  [b-proteobacteria]       acetolactate synthase large subunit [Achromobacter xylosoxi
. . . . Methylophilales bacterium HTCC2181 ...............................  231 2 hits [b-proteobacteria]       acetolactate synthase, large subunit [Methylophilales bacte
. . . . uncultured SUP05 cluster bacterium ...............................  231 1 hit  [g-proteobacteria]       acetolactate synthase, large subunit [uncultured SUP05 clus
. . . . Desulfovibrio fructosovorans JJ ..................................  231 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [De
. . . . Thauera sp. MZ1T .................................................  231 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Th
. . . . Methylobacillus flagellatus KT ...................................  231 2 hits [b-proteobacteria]       acetolactate synthase, large subunit [Methylobacillus flage
. . . . Desulfomicrobium baculatum DSM 4028 ..............................  230 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [De
. . . . Ralstonia eutropha JMP134 ........................................  230 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Ralstonia eutrop
. . . . beta proteobacterium KB13 ........................................  229 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [be
. . . . Burkholderia gladioli BSR3 .......................................  229 4 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Bu
. . . . Bordetella avium 197N ............................................  229 2 hits [b-proteobacteria]       acetolactate synthase isozyme III large subunit [Bordetella
. . . . Cupriavidus taiwanensis LMG 19424 ................................  229 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Cupriavidus taiw
. . . . Cupriavidus metallidurans CH34 ...................................  229 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Cupriavidus meta
. . . . Bordetella pertussis Tohama I ....................................  229 2 hits [b-proteobacteria]       acetolactate synthase large subunit [Bordetella pertussis T
. . . . Bordetella parapertussis 12822 ...................................  229 1 hit  [b-proteobacteria]       acetolactate synthase large subunit [Bordetella pertussis T
. . . . Bordetella bronchiseptica RB50 ...................................  229 2 hits [b-proteobacteria]       acetolactate synthase large subunit [Bordetella pertussis T
. . . . Bordetella parapertussis .........................................  229 1 hit  [b-proteobacteria]       acetolactate synthase large subunit [Bordetella pertussis T
. . . . Lutiella nitroferrum 2002 ........................................  228 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Lu
. . . . Laribacter hongkongensis HLHK9 ...................................  228 2 hits [b-proteobacteria]       IlvI [Laribacter hongkongensis HLHK9] >gi|226714014|gb|ACO7
. . . . Bordetella petrii DSM 12804 ......................................  228 1 hit  [b-proteobacteria]       acetolactate synthase large subunit [Bordetella petrii DSM 
. . . . Bordetella petrii ................................................  228 1 hit  [b-proteobacteria]       acetolactate synthase large subunit [Bordetella petrii DSM 
. . . . Ralstonia eutropha H16 ...........................................  228 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Ralstonia eutrop
. . . . Alicycliphilus denitrificans BC ..................................  228 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Al
. . . . Alicycliphilus denitrificans K601 ................................  228 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Al
. . . . Alcanivorax sp. DG881 ............................................  228 2 hits [g-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Al
. . . . Chromobacterium violaceum ATCC 12472 .............................  228 2 hits [b-proteobacteria]       acetolactate synthase isozyme III, large subunit [Chromobac
. . . . uncultured gamma proteobacterium EB000_65A11 .....................  228 1 hit  [g-proteobacteria]       hypothetical protein [uncultured gamma proteobacterium EB00
. . . . Desulfovibrio piger ATCC 29098 ...................................  226 2 hits [d-proteobacteria]       hypothetical protein DESPIG_01498 [Desulfovibrio piger ATCC
. . . . Alcanivorax borkumensis SK2 ......................................  226 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Alcanivorax bork
. . . . Desulfovibrio vulgaris str. 'Miyazaki F' .........................  226 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [De
. . . . Acidovorax sp. JS42 ..............................................  226 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Acidovorax sp. J
. . . . Desulfonatronospira thiodismutans ASO3-1 .........................  226 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [De
. . . . Acidovorax ebreus TPSY ...........................................  226 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Acidovorax ebreu
. . . . Syntrophus aciditrophicus SB .....................................  226 2 hits [d-proteobacteria]       acetolactate synthase large subunit [Syntrophus aciditrophi
. . . . marine gamma proteobacterium HTCC2143 ............................  225 2 hits [g-proteobacteria]       acetolactate synthase III large subunit [marine gamma prote
. . . . Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 .  225 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [De
. . . . Buchnera aphidicola str. Bp (Baizongia pistaciae) ................  225 3 hits [enterobacteria]         acetolactate synthase large subunit [Buchnera aphidicola st
. . . . Nitrosococcus oceani AFC27 .......................................  225 2 hits [g-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ni
. . . . uncultured Oceanospirillales bacterium HF4000_21D01 ..............  225 1 hit  [g-proteobacteria]       thiamine pyrophosphate-requiring enzymes [uncultured Oceano
. . . . Leptothrix cholodnii SP-6 ........................................  224 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Leptothrix cholo
. . . . Geobacter sp. M21 ................................................  224 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ge
. . . . Desulfovibrio vulgaris DP4 .......................................  224 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [De
. . . . Desulfovibrio vulgaris str. Hildenborough ........................  224 2 hits [d-proteobacteria]       acetolactate synthase large subunit, biosynthetic type [Des
. . . . Desulfovibrio vulgaris RCH1 ......................................  224 1 hit  [d-proteobacteria]       acetolactate synthase large subunit, biosynthetic type [Des
. . . . Geobacter sp. M18 ................................................  224 2 hits [d-proteobacteria]       acetolactate synthase large subunit [Geobacter sp. M18] >gi
. . . . Acidovorax citrulli AAC00-1 ......................................  224 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Acidovorax citru
. . . . Desulfovibrio salexigens DSM 2638 ................................  223 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [De
. . . . Acidovorax avenae subsp. avenae ATCC 19860 .......................  223 2 hits [b-proteobacteria]       acetolactate synthase large subunit, biosynthetic type [Aci
. . . . Geobacter bemidjiensis Bem .......................................  223 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ge
. . . . Bilophila wadsworthia 3_1_6 ......................................  223 4 hits [d-proteobacteria]       acetolactate synthase [Bilophila wadsworthia 3_1_6] >gi|316
. . . . Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica) ......  223 2 hits [g-proteobacteria]       acetolactate synthase, large subunit [Candidatus Ruthia mag
. . . . Geobacter metallireducens GS-15 ..................................  223 2 hits [d-proteobacteria]       acetolactate synthase, large subunit [Geobacter metalliredu
. . . . Acidovorax delafieldii 2AN .......................................  223 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ac
. . . . Geobacter uraniireducens Rf4 .....................................  223 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ge
. . . . uncultured gamma proteobacterium HF0070_10G19 ....................  223 1 hit  [g-proteobacteria]       thiamine pyrophosphate-requiring enzymes [uncultured gamma 
. . . . Sulfurimonas denitrificans DSM 1251 ..............................  223 2 hits [e-proteobacteria]       acetolactate synthase 3 catalytic subunit [Sulfurimonas den
. . . . uncultured Oceanospirillales bacterium HF0500_09M11 ..............  223 1 hit  [g-proteobacteria]       thiamine pyrophosphate-requiring enzymes [uncultured Oceano
. . . . uncultured Oceanospirillales bacterium HF4000_13G19 ..............  223 1 hit  [g-proteobacteria]       thiamine pyrophosphate-requiring enzymes [uncultured Oceano
. . . . Thiomicrospira crunogena XCL-2 ...................................  223 2 hits [g-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Th
. . . . Polaromonas sp. JS666 ............................................  223 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Polaromonas sp. 
. . . . Shewanella loihica PV-4 ..........................................  223 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Shewanella loihi
. . . . Ralstonia solanacearum MolK2 .....................................  223 2 hits [b-proteobacteria]       acetolactate synthase isozyme III (large subunit) protein [
. . . . Ralstonia solanacearum UW551 .....................................  223 2 hits [b-proteobacteria]       Acetolactate synthase large subunit [Ralstonia solanacearum
. . . . Ralstonia solanacearum IPO1609 ...................................  223 2 hits [b-proteobacteria]       Acetolactate synthase large subunit [Ralstonia solanacearum
. . . . uncultured gamma proteobacterium EB000_37F04 .....................  223 1 hit  [g-proteobacteria]       hypothetical protein [uncultured gamma proteobacterium EB00
. . . . Ralstonia solanacearum PSI07 .....................................  223 2 hits [b-proteobacteria]       acetolactate synthase, large subunit [Ralstonia solanacearu
. . . . Geobacter sp. FRC-32 .............................................  223 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ge
. . . . Buchnera aphidicola (Schlechtendalia chinensis) ..................  223 1 hit  [enterobacteria]         RecName: Full=Acetolactate synthase large subunit; Short=AH
. . . . Buchnera aphidicola ..............................................  223 4 hits [enterobacteria]         RecName: Full=Acetolactate synthase large subunit; Short=AH
. . . . Syntrophobacter fumaroxidans MPOB ................................  222 8 hits [d-proteobacteria]       acetolactate synthase large subunit, biosynthetic type [Syn
. . . . marine gamma proteobacterium HTCC2080 ............................  222 2 hits [g-proteobacteria]       diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains)
. . . . Ralstonia solanacearum CFBP2957 ..................................  222 2 hits [b-proteobacteria]       acetolactate synthase, large subunit [Ralstonia solanacearu
. . . . Actinobacillus pleuropneumoniae serovar 12 str. 1096 .............  222 2 hits [g-proteobacteria]       Acetolactate synthase large subunit [Actinobacillus pleurop
. . . . Actinobacillus pleuropneumoniae serovar 7 str. AP76 ..............  222 2 hits [g-proteobacteria]       acetolactate synthase large subunit [Actinobacillus pleurop
. . . . Actinobacillus pleuropneumoniae serovar 13 str. N273 .............  222 2 hits [g-proteobacteria]       acetolactate synthase large subunit [Actinobacillus pleurop
. . . . Desulfovibrio desulfuricans subsp. desulfuricans str. G20 ........  222 2 hits [d-proteobacteria]       acetolactate synthase large subunit [Desulfovibrio desulfur
. . . . Allochromatium vinosum DSM 180 ...................................  222 2 hits [g-proteobacteria]       acetolactate synthase large subunit, biosynthetic type [All
. . . . Actinobacillus pleuropneumoniae serovar 3 str. JL03 ..............  222 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Actinobacillus p
. . . . Actinobacillus pleuropneumoniae serovar 6 str. Femo ..............  222 4 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Actinobacillus p
. . . . Actinobacillus pleuropneumoniae serovar 2 str. 4226 ..............  222 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Actinobacillus p
. . . . Actinobacillus pleuropneumoniae serovar 1 str. 4074 ..............  222 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Actinobacillus p
. . . . Actinobacillus pleuropneumoniae serovar 2 str. S1536 .............  222 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Actinobacillus p
. . . . Actinobacillus pleuropneumoniae serovar 4 str. M62 ...............  222 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Actinobacillus p
. . . . Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261 ..........  222 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Actinobacillus p
. . . . Actinobacillus pleuropneumoniae serovar 10 str. D13039 ...........  222 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Actinobacillus p
. . . . Actinobacillus pleuropneumoniae serovar 11 str. 56153 ............  222 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Actinobacillus p
. . . . Desulfovibrio sp. FW1012B ........................................  222 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [De
. . . . Acidithiobacillus caldus ATCC 51756 ..............................  222 2 hits [g-proteobacteria]       Acetolactate synthase large subunit [Acidithiobacillus cald
. . . . Ralstonia pickettii 12D ..........................................  222 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Ralstonia picket
. . . . Ralstonia sp. 5_7_47FAA ..........................................  222 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Ralstonia picket
. . . . Ralstonia pickettii 12J ..........................................  221 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Ralstonia picket
. . . . Geobacter sulfurreducens PCA .....................................  221 2 hits [d-proteobacteria]       acetolactate synthase large subunit, biosynthetic type [Geo
. . . . Oxalobacter formigenes OXCC13 ....................................  221 2 hits [b-proteobacteria]       acetolactate synthase large subunit [Oxalobacter formigenes
. . . . Ralstonia solanacearum GMI1000 ...................................  221 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Ralstonia solana
. . . . Sulfuricurvum kujiense DSM 16994 .................................  221 2 hits [e-proteobacteria]       acetolactate synthase, large subunit [Sulfuricurvum kujiens
. . . . Shewanella woodyi ATCC 51908 .....................................  221 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Shewanella woody
. . . . Parasutterella excrementihominis YIT 11859 .......................  221 1 hit  [b-proteobacteria]       acetolactate synthase, large subunit [Parasutterella excrem
. . . . Candidatus Vesicomyosocius okutanii HA ...........................  221 2 hits [g-proteobacteria]       acetolactate synthase large subunit [Candidatus Vesicomyoso
. . . . Shewanella benthica KT99 .........................................  221 2 hits [g-proteobacteria]       acetolactate synthase III large subunit [Shewanella benthic
. . . . Verminephrobacter eiseniae EF01-2 ................................  221 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Verminephrobacte
. . . . Burkholderiales bacterium 1_1_47 .................................  221 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Bu
. . . . Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 ...........  220 1 hit  [enterobacteria]         acetolactate synthase 3 catalytic subunit [Photorhabdus asy
. . . . Photorhabdus asymbiotica .........................................  220 1 hit  [enterobacteria]         acetolactate synthase 3 catalytic subunit [Photorhabdus asy
. . . . Shewanella halifaxensis HAW-EB4 ..................................  220 2 hits [g-proteobacteria]       acetolactate synthase large subunit [Shewanella halifaxensi
. . . . uncultured gamma proteobacterium HF4000_36I10 ....................  220 1 hit  [g-proteobacteria]       thiamine pyrophosphate-requiring enzymes [uncultured gamma 
. . . . Ralstonia solanacearum CMR15 .....................................  220 1 hit  [b-proteobacteria]       acetolactate synthase, large subunit [Ralstonia solanacearu
. . . . Desulfococcus oleovorans Hxd3 ....................................  220 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [De
. . . . Photorhabdus luminescens subsp. laumondii TTO1 ...................  220 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Photorhabdus lum
. . . . Sulfurimonas autotrophica DSM 16294 ..............................  220 2 hits [e-proteobacteria]       acetolactate synthase large subunit [Sulfurimonas autotroph
. . . . Actinobacillus pleuropneumoniae serovar 5b str. L20 ..............  220 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Actinobacillus p
. . . . Vibrio vulnificus CMCP6 ..........................................  220 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Vibrio vulnificu
. . . . Vibrio vulnificus YJ016 ..........................................  220 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Vibrio vulnificu
. . . . Vibrio vulnificus MO6-24/O .......................................  220 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Vibrio vulnificu
. . . . Rhodoferax ferrireducens T118 ....................................  220 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Rhodoferax ferri
. . . . Geobacter sulfurreducens KN400 ...................................  219 1 hit  [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ge
. . . . Dickeya dadantii Ech586 ..........................................  219 2 hits [enterobacteria]         acetolactate synthase large subunit [Dickeya dadantii Ech58
. . . . Mariprofundus ferrooxydans PV-1 ..................................  219 2 hits [proteobacteria]         acetolactate synthase, large subunit, biosynthetic type [Ma
. . . . Dickeya zeae Ech1591 .............................................  219 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Dickeya zeae Ech
. . . . Desulfobacterium autotrophicum HRM2 ..............................  219 2 hits [d-proteobacteria]       IlvG [Desulfobacterium autotrophicum HRM2] >gi|223691914|gb
. . . . Desulfovibrio desulfuricans ND132 ................................  219 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [De
. . . . Desulfovibrio magneticus RS-1 ....................................  219 2 hits [d-proteobacteria]       acetolactate synthase large subunit [Desulfovibrio magnetic
. . . . Burkholderia multivorans ATCC 17616 ..............................  219 4 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia mul
. . . . Burkholderia sp. CCGE1001 ........................................  219 2 hits [b-proteobacteria]       acetolactate synthase large subunit [Burkholderia sp. CCGE1
. . . . Vibrio caribbenthicus ATCC BAA-2122 ..............................  219 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Vibrio caribbent
. . . . Arcobacter nitrofigilis DSM 7299 .................................  219 2 hits [e-proteobacteria]       acetolactate synthase large subunit [Arcobacter nitrofigili
. . . . Hippea maritima DSM 10411 ........................................  219 2 hits [d-proteobacteria]       acetolactate synthase large subunit [Hippea maritima DSM 10
. . . . Dickeya dadantii 3937 ............................................  219 2 hits [enterobacteria]         acetolactate synthase large subunit [Dickeya dadantii 3937]
. . . . Pectobacterium wasabiae WPP163 ...................................  219 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Pectobacterium w
. . . . Burkholderia xenovorans LB400 ....................................  219 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia xen
. . . . Desulfovibrio aespoeensis Aspo-2 .................................  219 2 hits [d-proteobacteria]       acetolactate synthase large subunit [Desulfovibrio aespoeen
. . . . Burkholderia sp. CCGE1003 ........................................  219 2 hits [b-proteobacteria]       acetolactate synthase large subunit, biosynthetic type [Bur
. . . . Burkholderia graminis C4D1M ......................................  219 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Bu
. . . . Burkholderia multivorans CGD2M ...................................  219 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Bu
. . . . Burkholderia multivorans CGD2 ....................................  219 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Bu
. . . . Burkholderia multivorans CGD1 ....................................  219 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Bu
. . . . Desulfatibacillum alkenivorans AK-01 .............................  219 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [De
. . . . Burkholderia sp. CCGE1002 ........................................  219 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Bu
. . . . Shewanella pealeana ATCC 700345 ..................................  219 2 hits [g-proteobacteria]       acetolactate synthase large subunit [Shewanella pealeana AT
. . . . Erwinia billingiae Eb661 .........................................  219 2 hits [enterobacteria]         Acetolactate synthase isozyme III large subunit [Erwinia bi
. . . . Xenorhabdus bovienii SS-2004 .....................................  219 2 hits [enterobacteria]         acetolactate synthase III, valine-sensitive, large subunit 
. . . . Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1 ....  218 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Po
. . . . uncultured gamma proteobacterium eBACHOT4E07 .....................  218 1 hit  [g-proteobacteria]       prediced acetolactate synthase III large subunit [unculture
. . . . Pelobacter propionicus DSM 2379 ..................................  218 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Pe
. . . . Haemophilus parasuis 29755 .......................................  218 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Haemophilus para
. . . . Buchnera aphidicola str. Sg (Schizaphis graminum) ................  218 2 hits [enterobacteria]         acetolactate synthase large subunit [Buchnera aphidicola st
. . . . Buchnera aphidicola (Schizaphis graminum) ........................  218 1 hit  [enterobacteria]         acetolactate synthase large subunit [Buchnera aphidicola st
. . . . Burkholderia ambifaria AMMD ......................................  218 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia amb
. . . . Pectobacterium carotovorum subsp. carotovorum PC1 ................  218 2 hits [enterobacteria]         acetolactate synthase, large subunit, biosynthetic type [Pe
. . . . Pectobacterium carotovorum subsp. brasiliensis PBR1692 ...........  218 1 hit  [enterobacteria]         acetolactate synthase 3 catalytic subunit [Pectobacterium c
. . . . Polynucleobacter necessarius subsp. necessarius STIR1 ............  218 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Po
. . . . Pectobacterium atrosepticum SCRI1043 .............................  218 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Pectobacterium a
. . . . Burkholderia dolosa AUO158 .......................................  218 2 hits [b-proteobacteria]       acetolactate synthase III large subunit [Burkholderia dolos
. . . . Shewanella sediminis HAW-EB3 .....................................  218 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Shewanella sedim
. . . . Moraxella catarrhalis 7169 .......................................  218 1 hit  [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Moraxella catarr
. . . . Moraxella catarrhalis 46P47B1 ....................................  218 1 hit  [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Moraxella catarr
. . . . Moraxella catarrhalis 12P80B1 ....................................  218 1 hit  [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Moraxella catarr
. . . . Moraxella catarrhalis 103P14B1 ...................................  218 1 hit  [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Moraxella catarr
. . . . Moraxella catarrhalis BC8 ........................................  218 1 hit  [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Moraxella catarr
. . . . Moraxella catarrhalis O35E .......................................  218 1 hit  [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Moraxella catarr
. . . . Moraxella catarrhalis 101P30B1 ...................................  218 1 hit  [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Moraxella catarr
. . . . Moraxella catarrhalis CO72 .......................................  218 1 hit  [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Moraxella catarr
. . . . Burkholderia sp. TJI49 ...........................................  218 1 hit  [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia sp.
. . . . Moraxella catarrhalis RH4 ........................................  218 2 hits [g-proteobacteria]       acetolactate synthase large subunit [Moraxella catarrhalis 
. . . . Moraxella catarrhalis BC1 ........................................  218 1 hit  [g-proteobacteria]       acetolactate synthase large subunit [Moraxella catarrhalis 
. . . . Moraxella catarrhalis BC7 ........................................  218 1 hit  [g-proteobacteria]       acetolactate synthase large subunit [Moraxella catarrhalis 
. . . . Vibrio sp. AND4 ..................................................  218 2 hits [g-proteobacteria]       acetolactate synthase III large subunit [Vibrio sp. AND4] >
. . . . Burkholderia ambifaria MC40-6 ....................................  218 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia amb
. . . . Vibrio sinaloensis DSM 21326 .....................................  218 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Vibrio sinaloens
. . . . Oxalobacter formigenes HOxBLS ....................................  218 2 hits [b-proteobacteria]       acetolactate synthase large subunit [Oxalobacter formigenes
. . . . Burkholderia ambifaria IOP40-10 ..................................  218 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Bu
. . . . Dickeya dadantii Ech703 ..........................................  218 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Dickeya dadantii
. . . . Pectobacterium carotovorum subsp. carotovorum WPP14 ..............  218 1 hit  [enterobacteria]         acetolactate synthase 3 catalytic subunit [Pectobacterium c
. . . . Burkholderia sp. Ch1-1 ...........................................  218 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Bu
. . . . gamma proteobacterium NOR5-3 .....................................  218 2 hits [g-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [ga
. . . . Gallibacterium anatis UMN179 .....................................  217 1 hit  [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Gallibacterium a
. . . . Caminibacter mediatlanticus TB-2 .................................  217 2 hits [e-proteobacteria]       acetolactate synthase III large subunit [Caminibacter media
. . . . Vibrio harveyi ATCC BAA-1116 .....................................  217 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Vibrio harveyi A
. . . . Shewanella frigidimarina NCIMB 400 ...............................  217 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Shewanella frigi
. . . . Serratia odorifera 4Rx13 .........................................  217 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Serratia odorife
. . . . Serratia proteamaculans 568 ......................................  217 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Serratia proteam
. . . . Vibrio harveyi HY01 ..............................................  217 2 hits [g-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Vi
. . . . Desulfovibrio sp. 3_1_syn3 .......................................  217 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [De
. . . . Hahella chejuensis KCTC 2396 .....................................  217 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Hahella chejuens
. . . . Desulfohalobium retbaense DSM 5692 ...............................  217 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [De
. . . . Vibrio harveyi 1DA3 ..............................................  217 2 hits [g-proteobacteria]       Acetolactate synthase 3 large subunit [Vibrio harveyi 1DA3]
. . . . Vibrio orientalis CIP 102891 .....................................  217 2 hits [g-proteobacteria]       acetolactate synthase large subunit [Vibrio orientalis CIP 
. . . . uncultured Desulfobacterium sp. ..................................  217 1 hit  [d-proteobacteria]       Acetolactate synthase large subunit [uncultured Desulfobact
. . . . Nitratiruptor sp. SB155-2 ........................................  217 2 hits [e-proteobacteria]       acetolactate synthase 3 catalytic subunit [Nitratiruptor sp
. . . . Yersinia ruckeri ATCC 29473 ......................................  217 2 hits [enterobacteria]         Acetolactate synthase large subunit [Yersinia ruckeri ATCC 
. . . . Anaeromyxobacter dehalogenans 2CP-C ..............................  217 2 hits [d-proteobacteria]       acetolactate synthase, large subunit [Anaeromyxobacter deha
. . . . Vibrio parahaemolyticus AQ3810 ...................................  217 2 hits [g-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Vi
. . . . Vibrio parahaemolyticus AQ4037 ...................................  217 2 hits [g-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Vi
. . . . Buchnera aphidicola str. LL01 (Acyrthosiphon pisum) ..............  217 1 hit  [enterobacteria]         acetolactate synthase large subunit [Buchnera aphidicola] >
. . . . Pseudomonas aeruginosa PAO1 ......................................  217 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Pseudomonas aeru
. . . . Pseudomonas aeruginosa UCBPP-PA14 ................................  217 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Pseudomonas aeru
. . . . Pseudomonas aeruginosa LESB58 ....................................  217 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Pseudomonas aeru
. . . . Pseudomonas aeruginosa C3719 .....................................  217 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Pseudomonas aeru
. . . . Pseudomonas aeruginosa 2192 ......................................  217 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Pseudomonas aeru
. . . . Pseudomonas aeruginosa 39016 .....................................  217 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Pseudomonas aeru
. . . . Pseudomonas aeruginosa PA7 .......................................  217 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Pseudomonas aeru
. . . . Buchnera aphidicola str. APS (Acyrthosiphon pisum) ...............  217 2 hits [enterobacteria]         acetolactate synthase large subunit [Buchnera aphidicola st
. . . . Buchnera aphidicola str. 5A (Acyrthosiphon pisum) ................  217 2 hits [enterobacteria]         acetolactate synthase large subunit [Buchnera aphidicola st
. . . . Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum) ..............  217 2 hits [enterobacteria]         acetolactate synthase large subunit [Buchnera aphidicola st
. . . . Buchnera aphidicola str. LSR1 (Acyrthosiphon pisum) ..............  217 1 hit  [enterobacteria]         acetolactate synthase large subunit [Buchnera aphidicola st
. . . . Buchnera aphidicola (Acyrthosiphon pisum) ........................  217 1 hit  [enterobacteria]         acetolactate synthase large subunit [Buchnera aphidicola st
. . . . Buchnera sp. .....................................................  217 1 hit  [enterobacteria]         acetolactate synthase large subunit [Buchnera aphidicola st
. . . . Buchnera aphidicola str. TLW03 (Acyrthosiphon pisum) .............  217 1 hit  [enterobacteria]         acetolactate synthase large subunit [Buchnera aphidicola st
. . . . Buchnera aphidicola str. JF99 (Acyrthosiphon pisum) ..............  217 1 hit  [enterobacteria]         acetolactate synthase large subunit [Buchnera aphidicola st
. . . . Aggregatibacter segnis ATCC 33393 ................................  217 2 hits [g-proteobacteria]       acetolactate synthase large subunit [Aggregatibacter segnis
. . . . Vibrio parahaemolyticus RIMD 2210633 .............................  217 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Vibrio parahaemo
. . . . Vibrio parahaemolyticus K5030 ....................................  217 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Vibrio parahaemo
. . . . Vibrio parahaemolyticus AN-5034 ..................................  217 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Vibrio parahaemo
. . . . Vibrio parahaemolyticus Peru-466 .................................  217 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Vibrio parahaemo
. . . . Vibrio parahaemolyticus 10329 ....................................  217 1 hit  [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Vibrio parahaemo
. . . . Vibrio alginolyticus 40B .........................................  217 2 hits [g-proteobacteria]       Acetolactate synthase 3 large subunit [Vibrio alginolyticus
. . . . Sulfurospirillum deleyianum DSM 6946 .............................  217 2 hits [e-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Su
. . . . Yersinia frederiksenii ATCC 33641 ................................  217 2 hits [enterobacteria]         Acetolactate synthase large subunit [Yersinia frederiksenii
. . . . Kingella oralis ATCC 51147 .......................................  217 2 hits [b-proteobacteria]       hypothetical protein GCWU000324_01619 [Kingella oralis ATCC
. . . . Burkholderia phymatum STM815 .....................................  217 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia phy
. . . . Vibrio sp. Ex25 ..................................................  217 4 hits [g-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Vi
. . . . Enterobacteriaceae bacterium 9_2_54FAA ...........................  217 2 hits [enterobacteria]         acetolactate synthase [Enterobacteriaceae bacterium 9_2_54F
. . . . Edwardsiella ictaluri 93-146 .....................................  217 2 hits [enterobacteria]         acetolactate synthase isozyme III, large subunit, putative 
. . . . Vibrio alginolyticus 12G01 .......................................  217 2 hits [g-proteobacteria]       acetolactate synthase III large subunit [Vibrio alginolytic
. . . . Burkholderia vietnamiensis G4 ....................................  216 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia vie
. . . . Shewanella baltica OS185 .........................................  216 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Shewanella balti
. . . . Actinobacillus minor 202 .........................................  216 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Actinobacillus m
. . . . Yersinia rohdei ATCC 43380 .......................................  216 2 hits [enterobacteria]         Acetolactate synthase large subunit [Yersinia rohdei ATCC 4
. . . . Helicobacter canadensis MIT 98-5491 ..............................  216 5 hits [e-proteobacteria]       acetolactate synthase 3 catalytic subunit [Helicobacter can
. . . . Saccharophagus degradans 2-40 ....................................  216 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Saccharophagus d
. . . . Actinobacillus minor NM305 .......................................  216 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Actinobacillus m
. . . . Shewanella baltica OS223 .........................................  216 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Shewanella balti
. . . . Shewanella baltica OS183 .........................................  216 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Shewanella balti
. . . . Shewanella baltica BA175 .........................................  216 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Shewanella balti
. . . . Yersinia pestis Angola ...........................................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pestis 
. . . . Yersinia pestis biovar Orientalis str. F1991016 ..................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pestis 
. . . . Yersinia pestis biovar Orientalis str. IP275 .....................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pestis 
. . . . Yersinia pestis biovar Antiqua str. E1979001 .....................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pestis 
. . . . Yersinia pestis biovar Antiqua str. B42003004 ....................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pestis 
. . . . Yersinia pestis biovar Antiqua str. UG05-0454 ....................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pestis 
. . . . Yersinia pestis biovar Orientalis str. MG05-1020 .................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pestis 
. . . . Yersinia pestis biovar Mediaevalis str. K1973002 .................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pestis 
. . . . Yersinia pestis KIM D27 ..........................................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pestis 
. . . . Yersinia pestis KIM 10 ...........................................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pestis 
. . . . Yersinia pestis biovar Microtus str. 91001 .......................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pestis 
. . . . Vibrio parahaemolyticus 16 .......................................  216 2 hits [g-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Vi
. . . . Yersinia pestis Pestoides F ......................................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pestis 
. . . . Vibrio coralliilyticus ATCC BAA-450 ..............................  216 2 hits [g-proteobacteria]       acetolactate synthase large subunit [Vibrio coralliilyticus
. . . . Yersinia kristensenii ATCC 33638 .................................  216 2 hits [enterobacteria]         Acetolactate synthase large subunit [Yersinia kristensenii 
. . . . Shewanella baltica OS155 .........................................  216 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Shewanella balti
. . . . Yersinia pseudotuberculosis IP 32953 .............................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pseudot
. . . . Yersinia pestis Antiqua ..........................................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pseudot
. . . . Yersinia pestis Nepal516 .........................................  216 4 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pseudot
. . . . Yersinia pestis CA88-4125 ........................................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pseudot
. . . . Yersinia pseudotuberculosis IP 31758 .............................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pseudot
. . . . Yersinia pseudotuberculosis YPIII ................................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pseudot
. . . . Yersinia pseudotuberculosis PB1/+ ................................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pseudot
. . . . Yersinia pestis CO92 .............................................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pseudot
. . . . Yersinia pestis Pestoides A ......................................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pseudot
. . . . Yersinia pestis biovar Orientalis str. PEXU2 .....................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pseudot
. . . . Yersinia pestis biovar Orientalis str. India 195 .................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pseudot
. . . . Yersinia pestis biovar Medievalis str. Harbin 35 .................  216 1 hit  [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pseudot
. . . . Yersinia intermedia ATCC 29909 ...................................  216 2 hits [enterobacteria]         Acetolactate synthase large subunit [Yersinia intermedia AT
. . . . Shewanella putrefaciens 200 ......................................  216 1 hit  [g-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Sh
. . . . Aliivibrio salmonicida LFI1238 ...................................  216 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Aliivibrio salmo
. . . . Shewanella putrefaciens CN-32 ....................................  216 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Shewanella putre
. . . . Shewanella sp. W3-18-1 ...........................................  216 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Shewanella sp. W
. . . . Yersinia enterocolitica subsp. enterocolitica 8081 ...............  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia enteroc
. . . . Yersinia enterocolitica subsp. palearctica 105.5R(r) .............  216 1 hit  [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia enteroc
. . . . Campylobacter showae RM3277 ......................................  216 2 hits [e-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ca
. . . . Yersinia aldovae ATCC 35236 ......................................  216 2 hits [enterobacteria]         Acetolactate synthase large subunit [Yersinia aldovae ATCC 
. . . . Burkholderia ambifaria MEX-5 .....................................  216 2 hits [b-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Bu
. . . . Shewanella baltica OS195 .........................................  216 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Shewanella balti
. . . . Shewanella baltica OS678 .........................................  216 1 hit  [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Shewanella balti
. . . . Congregibacter litoralis KT71 ....................................  216 2 hits [g-proteobacteria]       Acetolactate synthase isozyme III large subunit [Congregiba
. . . . Yersinia enterocolitica W22703 ...................................  216 1 hit  [enterobacteria]         acetolactate synthase isozyme 3 large subunit [Yersinia ent
. . . . Yersinia enterocolitica subsp. palearctica Y11 ...................  216 1 hit  [enterobacteria]         acetolactate synthase large subunit [Yersinia enterocolitic
. . . . Burkholderia sp. 383 .............................................  216 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia sp.
. . . . Burkholderia cenocepacia J2315 ...................................  216 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia cen
. . . . Edwardsiella tarda EIB202 ........................................  216 2 hits [enterobacteria]         acetolactate synthase 3 catalytic subunit [Edwardsiella tar
. . . . Edwardsiella tarda FL6-60 ........................................  216 1 hit  [enterobacteria]         acetolactate synthase 3 catalytic subunit [Edwardsiella tar
. . . . Burkholderia sp. H160 ............................................  216 2 hits [b-proteobacteria]       thiamine pyrophosphate protein TPP binding domain protein [
. . . . Anaeromyxobacter sp. Fw109-5 .....................................  216 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [An
. . . . Serratia odorifera DSM 4582 ......................................  216 2 hits [enterobacteria]         acetolactate synthase large subunit [Serratia odorifera DSM
. . . . Anaeromyxobacter sp. K ...........................................  216 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [An
. . . . Yersinia pestis FV-1 .............................................  216 1 hit  [enterobacteria]         acetolactate synthase 3 catalytic subunit [Yersinia pestis 
. . . . Cardiobacterium hominis ATCC 15826 ...............................  216 2 hits [g-proteobacteria]       biosynthetic family acetolactate synthase, large subunit [C
. . . . Shewanella violacea DSS12 ........................................  216 2 hits [g-proteobacteria]       acetolactate synthase III large subunit [Shewanella violace
. . . . Anaeromyxobacter dehalogenans 2CP-1 ..............................  216 2 hits [d-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [An
. . . . Actinobacillus ureae ATCC 25976 ..................................  215 2 hits [g-proteobacteria]       acetolactate synthase large subunit [Actinobacillus ureae A
. . . . Burkholderia cenocepacia AU 1054 .................................  215 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia cen
. . . . Burkholderia cenocepacia HI2424 ..................................  215 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia cen
. . . . Burkholderia cenocepacia MC0-3 ...................................  215 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia cen
. . . . Burkholderia cenocepacia PC184 ...................................  215 2 hits [b-proteobacteria]       acetolactate synthase 3 catalytic subunit [Burkholderia cen
. . . . Desulfobulbus propionicus DSM 2032 ...............................  215 2 hits [d-proteobacteria]       acetolactate synthase large subunit [Desulfobulbus propioni
. . . . Reinekea blandensis MED297 .......................................  215 2 hits [g-proteobacteria]       acetolactate synthase III large subunit [Reinekea sp. MED29
. . . . uncultured gamma proteobacterium EBAC_27G05 ......................  215 1 hit  [g-proteobacteria]       hypothetical protein [uncultured gamma proteobacterium EBAC
. . . . Pantoea ananatis AJ13355 .........................................  215 1 hit  [enterobacteria]         acetolactate synthase isozyme III large subunit IlvI [Panto
. . . . Pseudomonas aeruginosa ...........................................  215 2 hits [g-proteobacteria]       IlvI [Pseudomonas aeruginosa] >gi|118640848|gb|ABL09942.1| 
. . . . Teredinibacter turnerae T7901 ....................................  215 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Teredinibacter t
. . . . Campylobacterales bacterium GD 1 .................................  215 2 hits [e-proteobacteria]       acetolactate synthase, large subunit, biosynthetic type [Ca
. . . . Pantoea ananatis LMG 20103 .......................................  215 2 hits [enterobacteria]         IlvI [Pantoea ananatis LMG 20103] >gi|291151290|gb|ADD75874
. . . . Comamonas testosteroni CNB-2 .....................................  215 2 hits [b-proteobacteria]       acetolactate synthase, large subunit [Comamonas testosteron
. . . . Vibrio cholerae V51 ..............................................  215 2 hits [g-proteobacteria]       acetolactate synthase III, large subunit [Vibrio cholerae V
. . . . Haemophilus influenzae F3047 .....................................  215 2 hits [g-proteobacteria]       acetolactate synthase large subunit [Haemophilus influenzae
. . . . Haemophilus influenzae F3031 .....................................  215 2 hits [g-proteobacteria]       acetolactate synthase large subunit [Haemophilus influenzae
. . . . Haemophilus aegyptius ATCC 11116 .................................  215 2 hits [g-proteobacteria]       acetolactate synthase large subunit [Haemophilus influenzae
. . . . Shewanella sp. MR-4 ..............................................  215 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Shewanella sp. M
. . . . Shewanella sp. MR-7 ..............................................  215 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Shewanella sp. M
. . . . Shewanella oneidensis MR-1 .......................................  215 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Shewanella oneid
. . . . Actinobacillus succinogenes 130Z .................................  215 2 hits [g-proteobacteria]       acetolactate synthase 3 catalytic subunit [Actinobacillus s
. . . Chlorobium luteolum DSM 273 ----------------------------------------  238 2 hits [green sulfur bacteria]  acetolactate synthase large subunit biosynthetic type [Chlo
. . . Prosthecochloris aestuarii DSM 271 .................................  238 2 hits [green sulfur bacteria]  acetolactate synthase large subunit, biosynthetic type [Pro
. . . Chlorobium tepidum TLS .............................................  236 2 hits [green sulfur bacteria]  acetolactate synthase, large subunit [Chlorobium tepidum TL
. . . Chlorobium phaeobacteroides BS1 ....................................  236 2 hits [green sulfur bacteria]  acetolactate synthase, large subunit, biosynthetic type [Ch
. . . Chlorobium chlorochromatii CaD3 ....................................  235 2 hits [green sulfur bacteria]  acetolactate synthase large subunit biosynthetic type [Chlo
. . . Pelodictyon phaeoclathratiforme BU-1 ...............................  235 2 hits [green sulfur bacteria]  acetolactate synthase, large subunit, biosynthetic type [Pe
. . . Chlorobium phaeobacteroides DSM 266 ................................  234 2 hits [green sulfur bacteria]  acetolactate synthase, large subunit [Chlorobium phaeobacte
. . . Chlorobium limicola DSM 245 ........................................  234 2 hits [green sulfur bacteria]  acetolactate synthase, large subunit, biosynthetic type [Ch
. . . Chloroherpeton thalassium ATCC 35110 ...............................  233 2 hits [green sulfur bacteria]  acetolactate synthase, large subunit, biosynthetic type [Ch
. . . Chlorobium phaeovibrioides DSM 265 .................................  232 2 hits [green sulfur bacteria]  acetolactate synthase, large subunit [Prosthecochloris vibr
. . . Thermodesulfovibrio yellowstonii DSM 11347 .........................  232 2 hits [bacteria]               acetolactate synthase, large subunit, biosynthetic type [Th
. . . Chlorobaculum parvum NCIB 8327 .....................................  230 2 hits [green sulfur bacteria]  acetolactate synthase, large subunit, biosynthetic type [Ch
. . . Chlorobium ferrooxidans DSM 13031 ..................................  228 2 hits [green sulfur bacteria]  acetolactate synthase, large subunit, biosynthetic type [Ch
. . . Heliobacterium modesticaldum Ice1 ..................................  228 2 hits [firmicutes]             acetolactate synthase, large subunit, biosynthetic type [He
. . . Hydrogenobacter thermophilus TK-6 ..................................  228 3 hits [aquificales]            acetolactate synthase large subunit [Hydrogenobacter thermo
. . . Hydrogenivirga sp. 128-5-R1-1 ......................................  225 2 hits [aquificales]            acetolactate synthase large subunit [Hydrogenivirga sp. 128
. . . Desulfotomaculum reducens MI-1 .....................................  223 2 hits [firmicutes]             acetolactate synthase, large subunit, biosynthetic type [De
. . . Thermocrinis albus DSM 14484 .......................................  223 2 hits [aquificales]            acetolactate synthase, large subunit, biosynthetic type [Th
. . . uncultured bacterium HF0010_16H03 ..................................  222 1 hit  [bacteria]               unknown protein [uncultured bacterium HF0010_16H03]
. . . Candidatus Nitrospira defluvii .....................................  222 2 hits [bacteria]               acetolactate synthase large subunit [Candidatus Nitrospira 
. . . Aquifex aeolicus VF5 ...............................................  222 2 hits [aquificales]            acetolactate synthase large subunit [Aquifex aeolicus VF5] 
. . . Thermincola potens JR ..............................................  221 2 hits [firmicutes]             acetolactate synthase, large subunit, biosynthetic type [Th
. . . uncultured marine bacterium EB80_02D08 .............................  221 1 hit  [bacteria]               acetolactate synthase III large subunit [uncultured marine 
. . . Brevibacillus brevis NBRC 100599 ...................................  221 2 hits [firmicutes]             acetolactate synthase large subunit [Brevibacillus brevis N
. . . Desulfotomaculum acetoxidans DSM 771 ...............................  221 4 hits [firmicutes]             acetolactate synthase, large subunit, biosynthetic type [De
. . . Ammonifex degensii KC4 .............................................  221 2 hits [firmicutes]             acetolactate synthase, large subunit, biosynthetic type [Am
. . . Enterococcus italicus DSM 15952 ....................................  220 2 hits [firmicutes]             acetolactate synthase large subunit [Enterococcus italicus 
. . . Pelotomaculum thermopropionicum SI .................................  220 2 hits [firmicutes]             thiamine pyrophosphate-requiring enzymes [Pelotomaculum the
. . . Desulfotomaculum nigrificans DSM 574 ...............................  219 4 hits [firmicutes]             acetolactate synthase, large subunit, biosynthetic type [De
. . . Geobacillus thermodenitrificans NG80-2 .............................  218 2 hits [firmicutes]             acetolactate synthase catalytic subunit [Geobacillus thermo
. . . Geobacillus sp. G11MC16 ............................................  218 2 hits [firmicutes]             acetolactate synthase catalytic subunit [Geobacillus thermo
. . . Planococcus donghaensis MPA1U2 .....................................  218 2 hits [firmicutes]             acetolactate synthase large subunit [Planococcus donghaensi
. . . Hydrogenobaculum sp. Y04AAS1 .......................................  218 2 hits [aquificales]            acetolactate synthase, large subunit, biosynthetic type [Hy
. . . Leptospirillum sp. Group II '5-way CG' .............................  218 1 hit  [bacteria]               acetolactate synthase, large subunit [Leptospirillum sp. Gr
. . . Geobacillus sp. Y412MC61 ...........................................  217 2 hits [firmicutes]             acetolactate synthase catalytic subunit [Geobacillus sp. Y4
. . . Geobacillus sp. Y412MC52 ...........................................  217 2 hits [firmicutes]             acetolactate synthase catalytic subunit [Geobacillus sp. Y4
. . . Spirochaeta sp. Buddy ..............................................  217 2 hits [spirochetes]            acetolactate synthase, large subunit, biosynthetic type [Sp
. . . Geobacillus kaustophilus HTA426 ....................................  217 2 hits [firmicutes]             acetolactate synthase catalytic subunit [Geobacillus kausto
. . . Geobacillus sp. C56-T3 .............................................  217 2 hits [firmicutes]             acetolactate synthase, large subunit, biosynthetic type [Ge
. . . Acetohalobium arabaticum DSM 5501 ..................................  217 2 hits [firmicutes]             acetolactate synthase, large subunit [Acetohalobium arabati
. . . Leptospirillum ferrodiazotrophum ...................................  216 1 hit  [bacteria]               acetolactate synthase, large subunit, biosynthetic type [Le
. . . Oceanobacillus iheyensis HTE831 ....................................  216 2 hits [firmicutes]             acetolactate synthase large subunit [Oceanobacillus iheyens
. . . Syntrophomonas wolfei subsp. wolfei str. Goettingen ................  216 2 hits [firmicutes]             acetolactate synthase large subunit [Syntrophomonas wolfei 
. . . Candidatus Solibacter usitatus Ellin6076 ...........................  216 2 hits [bacteria]               acetolactate synthase large subunit [Candidatus Solibacter 
. . . Geobacillus stearothermophilus .....................................  216 1 hit  [firmicutes]             acetohydroxy acid synthase large subunit [Geobacillus stear
. . . Geobacillus sp. WCH70 ..............................................  216 2 hits [firmicutes]             acetolactate synthase catalytic subunit [Geobacillus sp. WC
. . . Abiotrophia defectiva ATCC 49176 ...................................  215 2 hits [firmicutes]             hypothetical protein GCWU000182_01630 [Abiotrophia defectiv
. . Xenopus (Silurana) tropicalis ----------------------------------------  224 1 hit  [frogs & toads]          PREDICTED: acetolactate synthase isozyme 3 large subunit-li
. . Methanospirillum hungatei JF-1 .......................................  218 2 hits [euryarchaeotes]         acetolactate synthase, large subunit, biosynthetic type [Me
. . Phytophthora infestans T30-4 .........................................  218 2 hits [oomycetes]              acetolactate synthase, mitochondrial precursor [Phytophthor
. . Candida albicans SC5314 ..............................................  216 4 hits [ascomycetes]            hypothetical protein CaO19.9180 [Candida albicans SC5314] >
. . Candida albicans WO-1 ................................................  216 1 hit  [ascomycetes]            hypothetical protein CaO19.9180 [Candida albicans SC5314] >
. . Candida tropicalis MYA-3404 ..........................................  216 2 hits [ascomycetes]            acetolactate synthase, mitochondrial precursor [Candida tro
. . Candida dubliniensis CD36 ............................................  216 2 hits [ascomycetes]            acetolactate synthase, putative [Candida dubliniensis CD36]
. . Saccharomyces cerevisiae Vin13 .......................................  215 1 hit  [ascomycetes]            Ilv2p [Saccharomyces cerevisiae Vin13]
. . Saccharomyces cerevisiae FostersB ....................................  215 1 hit  [ascomycetes]            Ilv2p [Saccharomyces cerevisiae FostersB]
. . Saccharomyces cerevisiae RM11-1a .....................................  215 1 hit  [ascomycetes]            acetolactate synthase [Saccharomyces cerevisiae RM11-1a]
. . Saccharomyces cerevisiae AWRI796 .....................................  215 1 hit  [ascomycetes]            Ilv2p [Saccharomyces cerevisiae AWRI796]
. uncultured marine microorganism HF4000_133G03 --------------------------  311 1 hit  [unclassified]           putative Thiamine pyrophosphate enzyme, N-terminal TPP-bind

b)BLASTp versus swissport, NCBI default parameters apart from "Number of descriptions=1000"

Lineage Report

cellular organisms
. Bacteria            [bacteria]
. . Proteobacteria      [proteobacteria]
. . . Gammaproteobacteria [g-proteobacteria]
. . . . Enterobacteriaceae  [enterobacteria]
. . . . . Buchnera aphidicola [enterobacteria]
. . . . . . Buchnera aphidicola str. Bp (Baizongia pistaciae) ----------------------  225 1 hit  [enterobacteria]         RecName: Full=Acetolactate synthase large subunit; Short=AH
. . . . . . Buchnera aphidicola (Schlechtendalia chinensis) ........................  223 1 hit  [enterobacteria]         RecName: Full=Acetolactate synthase large subunit; Short=AH
. . . . . . Buchnera aphidicola (Schizaphis graminum) ..............................  218 1 hit  [enterobacteria]         RecName: Full=Acetolactate synthase large subunit; Short=AH
. . . . . . Buchnera aphidicola (Acyrthosiphon pisum) ..............................  217 1 hit  [enterobacteria]         RecName: Full=Acetolactate synthase large subunit; Short=AH
. . . . . Escherichia coli K-12 ----------------------------------------------------  210 7 hits [enterobacteria]         RecName: Full=Acetolactate synthase isozyme 3 large subunit
. . . . . Salmonella enterica subsp. enterica serovar Typhimurium ..................  207 2 hits [enterobacteria]         RecName: Full=Acetolactate synthase isozyme 3 large subunit
. . . . . Escherichia coli O157:H7 .................................................  136 3 hits [enterobacteria]         RecName: Full=Glyoxylate carboligase; AltName: Full=Tartron
. . . . . Klebsiella pneumoniae ....................................................   96 1 hit  [enterobacteria]         RecName: Full=Acetolactate synthase, catabolic; Short=ALS
. . . . . Raoultella terrigena .....................................................   95 1 hit  [enterobacteria]         RecName: Full=Acetolactate synthase, catabolic; Short=ALS
. . . . . Edwardsiella ictaluri 93-146 .............................................   53 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .................   50 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Escherichia coli SMS-3-5 .................................................   50 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Klebsiella pneumoniae 342 ................................................   49 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ........................   49 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .......   49 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Cronobacter sakazakii ATCC BAA-894 .......................................   49 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Proteus mirabilis HI4320 .................................................   48 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Citrobacter koseri ATCC BAA-895 ..........................................   48 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...   48 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ......   48 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ........   48 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Salmonella enterica subsp. enterica serovar Agona str. SL483 .............   48 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Salmonella enterica ......................................................   48 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 .....   48 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Salmonella enterica subsp. enterica serovar Newport str. SL254 ...........   48 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Salmonella enterica subsp. enterica serovar Typhi ........................   48 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Salmonella enterica subsp. enterica serovar Paratyphi A ..................   48 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 ...   48 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Enterobacter sp. 638 .....................................................   48 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .   48 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Escherichia coli 55989 ...................................................   48 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Escherichia coli SE11 ....................................................   48 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Escherichia coli IAI1 ....................................................   48 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Escherichia fergusonii ATCC 35469 ........................................   48 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Pectobacterium atrosepticum ..............................................   48 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Escherichia coli UMN026 ..................................................   47 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Escherichia coli IAI39 ...................................................   47 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Escherichia coli UTI89 ...................................................   47 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Escherichia coli APEC O1 .................................................   47 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Escherichia coli O6 ......................................................   47 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Escherichia coli S88 .....................................................   47 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Escherichia coli ED1a ....................................................   47 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Shigella boydii Sb227 ....................................................   47 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Shigella sonnei Ss046 ....................................................   47 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Shigella flexneri ........................................................   47 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Shigella flexneri 5 str. 8401 ............................................   47 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Escherichia coli O157:H7 str. EC4115 .....................................   47 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Escherichia coli E24377A .................................................   47 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Escherichia coli HS ......................................................   47 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Escherichia coli str. K-12 substr. DH10B .................................   47 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Escherichia coli BW2952 ..................................................   47 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Escherichia coli O127:H6 str. E2348/69 ...................................   47 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Shigella boydii CDC 3083-94 ..............................................   47 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Pectobacterium carotovorum subsp. carotovorum PC1 ........................   47 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Serratia proteamaculans 568 ..............................................   46 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Enterobacter cloacae .....................................................   46 1 hit  [enterobacteria]         RecName: Full=Indole-3-pyruvate decarboxylase; Short=Indole
. . . . . Escherichia coli 536 .....................................................   46 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Escherichia coli ATCC 8739 ...............................................   46 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Shigella dysenteriae Sd197 ...............................................   46 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Yersinia enterocolitica subsp. enterocolitica 8081 .......................   46 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Photorhabdus luminescens subsp. laumondii ................................   46 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Yersinia pseudotuberculosis PB1/+ ........................................   43 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Yersinia pseudotuberculosis ..............................................   43 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Yersinia pseudotuberculosis YPIII ........................................   43 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Yersinia pseudotuberculosis IP 31758 .....................................   43 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Yersinia pestis Pestoides F ..............................................   43 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Yersinia pestis Angola ...................................................   43 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Yersinia pestis Nepal516 .................................................   43 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Yersinia pestis Antiqua ..................................................   43 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . . Yersinia pestis ..........................................................   43 1 hit  [enterobacteria]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Haemophilus influenzae Rd KW20 ---------------------------------------------  214 3 hits [g-proteobacteria]       RecName: Full=Acetolactate synthase large subunit; Short=AH
. . . . Pseudomonas putida .........................................................   73 1 hit  [g-proteobacteria]       RecName: Full=Benzoylformate decarboxylase; Short=BFD; Shor
. . . . Pseudomonas aeruginosa .....................................................   65 1 hit  [g-proteobacteria]       RecName: Full=Benzoylformate decarboxylase; Short=BFD; Shor
. . . . Shewanella sp. MR-7 ........................................................   58 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Shewanella loihica PV-4 ....................................................   56 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Shewanella oneidensis ......................................................   55 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Shewanella sp. MR-4 ........................................................   55 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Shewanella sp. ANA-3 .......................................................   55 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Shewanella baltica OS195 ...................................................   54 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Shewanella baltica OS185 ...................................................   54 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Shewanella baltica OS155 ...................................................   54 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Shewanella sediminis HAW-EB3 ...............................................   54 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Shewanella woodyi ATCC 51908 ...............................................   54 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Shewanella amazonensis SB2B ................................................   53 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Vibrio vulnificus ..........................................................   53 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Shewanella sp. W3-18-1 .....................................................   53 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Shewanella putrefaciens CN-32 ..............................................   53 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Aeromonas hydrophila subsp. hydrophila ATCC 7966 ...........................   52 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Aeromonas salmonicida subsp. salmonicida A449 ..............................   52 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Vibrio vulnificus YJ016 ....................................................   50 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Shewanella frigidimarina NCIMB 400 .........................................   50 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Shewanella halifaxensis HAW-EB4 ............................................   50 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Shewanella pealeana ATCC 700345 ............................................   49 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Haemophilus somnus 2336 ....................................................   47 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Psychromonas ingrahamii 37 .................................................   47 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Vibrio parahaemolyticus ....................................................   46 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Pasteurella multocida ......................................................   46 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Vibrio harveyi ATCC BAA-1116 ...............................................   46 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Vibrio fischeri ES114 ......................................................   46 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Haemophilus somnus 129PT ...................................................   45 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Vibrio splendidus LGP32 ....................................................   44 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Vibrio cholerae ............................................................   44 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Vibrio cholerae O395 .......................................................   44 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Vibrio cholerae M66-2 ......................................................   44 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Actinobacillus succinogenes 130Z ...........................................   41 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Mannheimia succiniciproducens MBEL55E ......................................   41 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Actinobacillus pleuropneumoniae serovar 5b str. L20 ........................   41 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Actinobacillus pleuropneumoniae serovar 3 str. JL03 ........................   41 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Haemophilus ducreyi ........................................................   40 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Actinobacillus pleuropneumoniae serovar 7 str. AP76 ........................   40 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Halorhodospira halophila SL1 ...............................................   39 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Haemophilus influenzae PittEE ..............................................   38 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Photobacterium profundum ...................................................   38 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Haemophilus influenzae PittGG ..............................................   37 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Haemophilus influenzae 86-028NP ............................................   37 1 hit  [g-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . . Pseudomonas fluorescens ....................................................   35 1 hit  [g-proteobacteria]       RecName: Full=Benzaldehyde lyase; AltName: Full=Benzoin ald
. . . Oxalobacter formigenes -------------------------------------------------------   86 1 hit  [b-proteobacteria]       RecName: Full=Oxalyl-CoA decarboxylase
. . . Sinorhizobium meliloti .......................................................   78 1 hit  [a-proteobacteria]       RecName: Full=Probable sulfoacetaldehyde acetyltransferase
. . . Castellaniella defragrans ....................................................   77 1 hit  [b-proteobacteria]       RecName: Full=Sulfoacetaldehyde acetyltransferase
. . . Achromobacter xylosoxidans ...................................................   75 1 hit  [b-proteobacteria]       RecName: Full=Sulfoacetaldehyde acetyltransferase
. . . Syntrophus aciditrophicus SB .................................................   69 1 hit  [d-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . Pseudomonas amyloderamosa ....................................................   60 1 hit  [proteobacteria]         RecName: Full=Uncharacterized 42.6 kDa protein in isoamylas
. . . Azospirillum brasilense ......................................................   56 1 hit  [a-proteobacteria]       RecName: Full=Indole-3-pyruvate decarboxylase; Short=Indole
. . . Sorangium cellulosum 'So ce 56' ..............................................   50 1 hit  [d-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . Desulfotalea psychrophila ....................................................   47 1 hit  [d-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . Dechloromonas aromatica RCB ..................................................   47 1 hit  [b-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . Bdellovibrio bacteriovorus ...................................................   45 1 hit  [d-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . Myxococcus xanthus DK 1622 ...................................................   42 1 hit  [d-proteobacteria]       RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . . Azoarcus sp. .................................................................   41 1 hit  [b-proteobacteria]       RecName: Full=Cyclohexane-1,2-dione hydrolase
. . . Rhodopseudomonas palustris BisB5 .............................................   36 1 hit  [a-proteobacteria]       RecName: Full=Orotate phosphoribosyltransferase; Short=OPRT
. . . Rhodopseudomonas palustris HaA2 ..............................................   36 1 hit  [a-proteobacteria]       RecName: Full=Orotate phosphoribosyltransferase; Short=OPRT
. . . Rhodopseudomonas palustris TIE-1 .............................................   34 1 hit  [a-proteobacteria]       RecName: Full=Orotate phosphoribosyltransferase; Short=OPRT
. . . Rhodopseudomonas palustris ...................................................   34 1 hit  [a-proteobacteria]       RecName: Full=Orotate phosphoribosyltransferase; Short=OPRT
. . . Rhodopseudomonas palustris BisB18 ............................................   32 1 hit  [a-proteobacteria]       RecName: Full=Orotate phosphoribosyltransferase; Short=OPRT
. . . Gluconobacter oxydans ........................................................   31 1 hit  [a-proteobacteria]       RecName: Full=UvrABC system protein C; Short=Protein uvrC; 
. . . Zymomonas mobilis ............................................................   31 1 hit  [a-proteobacteria]       RecName: Full=Pyruvate decarboxylase; Short=PDC
. . . Verminephrobacter eiseniae EF01-2 ............................................   31 1 hit  [b-proteobacteria]       RecName: Full=Carboxylate-amine ligase Veis_0584
. . . Bradyrhizobium sp. BTAi1 .....................................................   31 1 hit  [a-proteobacteria]       RecName: Full=Orotate phosphoribosyltransferase; Short=OPRT
. . . Bradyrhizobium sp. ORS278 ....................................................   30 1 hit  [a-proteobacteria]       RecName: Full=Orotate phosphoribosyltransferase; Short=OPRT
. . . Rickettsia peacockii str. Rustic .............................................   29 1 hit  [a-proteobacteria]       RecName: Full=UvrABC system protein C; Short=Protein uvrC; 
. . . Rickettsia africae ESF-5 .....................................................   29 1 hit  [a-proteobacteria]       RecName: Full=UvrABC system protein C; Short=Protein uvrC; 
. . . Rickettsia conorii ...........................................................   29 1 hit  [a-proteobacteria]       RecName: Full=UvrABC system protein C; Short=Protein uvrC; 
. . . Rickettsia rickettsii str. Iowa ..............................................   29 1 hit  [a-proteobacteria]       RecName: Full=UvrABC system protein C; Short=Protein uvrC; 
. . . Rickettsia rickettsii str. 'Sheila Smith' ....................................   29 1 hit  [a-proteobacteria]       RecName: Full=UvrABC system protein C; Short=Protein uvrC; 
. . Bacillus subtilis --------------------------------------------------------------  211 6 hits [firmicutes]             RecName: Full=Acetolactate synthase large subunit; Short=AH
. . Mycobacterium tuberculosis .....................................................  201 6 hits [high GC Gram+]          RecName: Full=Acetolactate synthase large subunit IlvB1; Sh
. . Mycobacterium bovis ............................................................  201 4 hits [high GC Gram+]          RecName: Full=Acetolactate synthase large subunit IlvB1; Sh
. . Mycobacterium leprae ...........................................................  201 3 hits [high GC Gram+]          RecName: Full=Acetolactate synthase; AltName: Full=ALS; Alt
. . Corynebacterium glutamicum .....................................................  197 1 hit  [high GC Gram+]          RecName: Full=Acetolactate synthase large subunit; Short=AH
. . Arthrospira platensis ..........................................................  196 1 hit  [cyanobacteria]          RecName: Full=Acetolactate synthase; AltName: Full=ALS; Alt
. . Synechococcus sp. WH 8102 ......................................................  192 2 hits [cyanobacteria]          RecName: Full=Acetolactate synthase large subunit; Short=AH
. . Mycobacterium avium ............................................................  190 1 hit  [high GC Gram+]          RecName: Full=Acetolactate synthase; AltName: Full=ALS; Alt
. . Lactococcus lactis subsp. lactis ...............................................  189 2 hits [firmicutes]             RecName: Full=Acetolactate synthase large subunit; Short=AH
. . Desulfonispora thiosulfatigenes ................................................   91 1 hit  [firmicutes]             RecName: Full=Sulfoacetaldehyde acetyltransferase
. . Streptococcus pneumoniae .......................................................   85 1 hit  [firmicutes]             RecName: Full=Pyruvate oxidase; AltName: Full=Pyruvic oxida
. . Lactobacillus plantarum ........................................................   77 1 hit  [firmicutes]             RecName: Full=Pyruvate oxidase; AltName: Full=Pyruvic oxida
. . Chlorobium limicola DSM 245 ....................................................   65 1 hit  [green sulfur bacteria]  RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Chlorobium phaeobacteroides DSM 266 ............................................   64 1 hit  [green sulfur bacteria]  RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Rubrobacter xylanophilus DSM 9941 ..............................................   59 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Bacteroides thetaiotaomicron ...................................................   56 1 hit  [CFB group bacteria]     RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Corynebacterium efficiens ......................................................   56 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Prosthecochloris aestuarii DSM 271 .............................................   55 1 hit  [green sulfur bacteria]  RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Corynebacterium glutamicum R ...................................................   55 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Pelodictyon phaeoclathratiforme BU-1 ...........................................   54 1 hit  [green sulfur bacteria]  RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Arthrobacter sp. FB24 ..........................................................   53 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Chlorobaculum parvum NCIB 8327 .................................................   53 1 hit  [green sulfur bacteria]  RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Chloroflexus aurantiacus J-10-fl ...............................................   53 1 hit  [GNS bacteria]           RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Parabacteroides distasonis ATCC 8503 ...........................................   53 1 hit  [CFB group bacteria]     RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Renibacterium salmoninarum ATCC 33209 ..........................................   52 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Mycobacterium ulcerans Agy99 ...................................................   52 2 hits [high GC Gram+]          RecName: Full=Alpha-keto-acid decarboxylase; Short=KDC
. . Chlorobium luteolum DSM 273 ....................................................   52 1 hit  [green sulfur bacteria]  RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Mycobacterium smegmatis str. MC2 155 ...........................................   52 2 hits [high GC Gram+]          RecName: Full=Alpha-keto-acid decarboxylase; Short=KDC
. . Mycobacterium avium 104 ........................................................   52 2 hits [high GC Gram+]          RecName: Full=Alpha-keto-acid decarboxylase; Short=KDC
. . Mycobacterium avium subsp. paratuberculosis ....................................   52 2 hits [high GC Gram+]          RecName: Full=Alpha-keto-acid decarboxylase; Short=KDC
. . Lactobacillus casei ............................................................   51 1 hit  [firmicutes]             RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . Trichodesmium erythraeum IMS101 ................................................   51 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Lactococcus lactis subsp. cremoris SK11 ........................................   51 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Chlorobaculum tepidum ..........................................................   51 1 hit  [green sulfur bacteria]  RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293 .......................   51 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Cytophaga hutchinsonii ATCC 33406 ..............................................   51 1 hit  [CFB group bacteria]     RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Mycobacterium bovis BCG str. Pasteur 1173P2 ....................................   51 2 hits [high GC Gram+]          RecName: Full=Alpha-keto-acid decarboxylase; Short=KDC >gi|
. . Mycobacterium tuberculosis H37Ra ...............................................   51 2 hits [high GC Gram+]          RecName: Full=Alpha-keto-acid decarboxylase; Short=KDC >gi|
. . Listeria innocua ...............................................................   51 2 hits [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Salinibacter ruber DSM 13855 ...................................................   50 1 hit  [CFB group bacteria]     RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Listeria welshimeri serovar 6b str. SLCC5334 ...................................   50 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Listeria monocytogenes .........................................................   50 2 hits [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Listeria monocytogenes serotype 4b str. F2365 ..................................   50 2 hits [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Synechocystis sp. PCC 6803 .....................................................   50 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Bacillus cytotoxicus NVH 391-98 ................................................   50 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 ...................   50 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Thermosynechococcus elongatus BP-1 .............................................   49 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Lactococcus lactis subsp. cremoris MG1363 ......................................   49 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Bacillus weihenstephanensis KBAB4 ..............................................   49 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Corynebacterium diphtheriae ....................................................   48 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Gramella forsetii KT0803 .......................................................   48 1 hit  [CFB group bacteria]     RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Chlorobium phaeovibrioides DSM 265 .............................................   48 1 hit  [green sulfur bacteria]  RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Oceanobacillus iheyensis .......................................................   48 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Cyanothece sp. PCC 7424 ........................................................   48 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Clostridium botulinum E3 str. Alaska E43 .......................................   48 1 hit  [firmicutes]             RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . Lysinibacillus sphaericus C3-41 ................................................   47 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Clostridium botulinum B str. Eklund 17B ........................................   47 1 hit  [firmicutes]             RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . Bacillus cereus E33L ...........................................................   47 3 hits [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Bacillus cereus ATCC 14579 .....................................................   47 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Bacillus thuringiensis serovar konkukian .......................................   47 2 hits [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Bacillus anthracis (anthrax) ...................................................   47 2 hits [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Bacillus thuringiensis str. Al Hakam ...........................................   47 2 hits [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Bacillus cereus ATCC 10987 .....................................................   47 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Staphylococcus aureus subsp. aureus COL ........................................   46 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Staphylococcus aureus subsp. aureus NCTC 8325 ..................................   46 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Staphylococcus aureus subsp. aureus USA300 .....................................   46 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Staphylococcus aureus subsp. aureus str. Newman ................................   46 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Staphylococcus aureus subsp. aureus USA300_TCH1516 .............................   46 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Mycobacterium tuberculosis F11 .................................................   46 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Mycobacterium bovis BCG str. Tokyo 172 .........................................   46 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Staphylococcus aureus subsp. aureus MRSA252 ....................................   46 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Chlorobium chlorochromatii CaD3 ................................................   46 1 hit  [green sulfur bacteria]  RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Bacteroides fragilis NCTC 9343 .................................................   46 1 hit  [CFB group bacteria]     RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Bacteroides fragilis ...........................................................   46 1 hit  [CFB group bacteria]     RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Corynebacterium jeikeium K411 ..................................................   46 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Staphylococcus aureus subsp. aureus MSSA476 ....................................   46 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Staphylococcus aureus subsp. aureus MW2 ........................................   46 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Staphylococcus aureus subsp. aureus N315 .......................................   46 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Staphylococcus aureus subsp. aureus Mu50 .......................................   46 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Staphylococcus aureus subsp. aureus Mu3 ........................................   46 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Staphylococcus aureus subsp. aureus JH1 ........................................   46 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Staphylococcus aureus subsp. aureus JH9 ........................................   46 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Enterococcus faecalis ..........................................................   46 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Mycobacterium leprae Br4923 ....................................................   46 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Flavobacterium psychrophilum JIP02/86 ..........................................   46 1 hit  [CFB group bacteria]     RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Geobacillus kaustophilus .......................................................   45 2 hits [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Acaryochloris marina MBIC11017 .................................................   45 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Mycobacterium marinum M ........................................................   45 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Clostridium perfringens ATCC 13124 .............................................   45 1 hit  [firmicutes]             RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . Clostridium perfringens ........................................................   45 1 hit  [firmicutes]             RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . Staphylococcus aureus RF122 ....................................................   45 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Thermobifida fusca YX ..........................................................   45 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Staphylococcus epidermidis ATCC 12228 ..........................................   45 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Porphyromonas gingivalis .......................................................   45 1 hit  [CFB group bacteria]     RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Staphylococcus haemolyticus JCSC1435 ...........................................   45 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Synechococcus elongatus PCC 6301 ...............................................   44 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Synechococcus elongatus PCC 7942 ...............................................   44 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Leuconostoc citreum KM20 .......................................................   44 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Staphylococcus epidermidis RP62A ...............................................   44 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Prochlorococcus marinus ........................................................   44 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Mycobacterium abscessus ATCC 19977 .............................................   44 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Nocardia farcinica .............................................................   44 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Microcystis aeruginosa NIES-843 ................................................   43 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Geobacillus thermodenitrificans NG80-2 .........................................   43 2 hits [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Bacteroides vulgatus ATCC 8482 .................................................   43 1 hit  [CFB group bacteria]     RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Arthrobacter aurescens TC1 .....................................................   43 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Bacillus pumilus SAFR-032 ......................................................   42 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Leifsonia xyli subsp. xyli .....................................................   42 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Synechococcus sp. JA-3-3Ab .....................................................   42 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Synechococcus sp. RCC307 .......................................................   42 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Bacillus clausii KSM-K16 .......................................................   42 1 hit  [firmicutes]             RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . Flavobacterium johnsoniae UW101 ................................................   42 1 hit  [CFB group bacteria]     RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Roseiflexus sp. RS-1 ...........................................................   42 1 hit  [GNS bacteria]           RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Saccharopolyspora erythraea NRRL 2338 ..........................................   41 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Propionibacterium acnes ........................................................   41 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Roseiflexus castenholzii DSM 13941 .............................................   41 1 hit  [GNS bacteria]           RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Anabaena variabilis ATCC 29413 .................................................   41 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Rhodococcus erythropolis PR4 ...................................................   41 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Chlorobium phaeobacteroides BS1 ................................................   40 1 hit  [green sulfur bacteria]  RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Prochlorococcus marinus str. NATL1A ............................................   40 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Prochlorococcus marinus str. NATL2A ............................................   40 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Clavibacter michiganensis subsp. sepedonicus ...................................   40 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Clavibacter michiganensis subsp. michiganensis NCPPB 382 .......................   40 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Nocardioides sp. JS614 .........................................................   40 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Nostoc sp. PCC 7120 ............................................................   40 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Rhodococcus jostii RHA1 ........................................................   40 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Rhodococcus opacus B4 ..........................................................   40 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Cyanothece sp. ATCC 51142 ......................................................   40 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Synechococcus sp. JA-2-3B'a(2-13) ..............................................   40 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Bacillus amyloliquefaciens FZB42 ...............................................   40 2 hits [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Bacillus cereus AH820 ..........................................................   40 1 hit  [firmicutes]             RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . Bacillus anthracis str. A0248 ..................................................   40 1 hit  [firmicutes]             RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . Bacillus anthracis str. CDC 684 ................................................   40 1 hit  [firmicutes]             RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . Bacillus cereus 03BB102 ........................................................   39 1 hit  [firmicutes]             RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . Bacillus licheniformis ATCC 14580 ..............................................   39 2 hits [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Mycobacterium vanbaalenii PYR-1 ................................................   39 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Mycobacterium sp. JLS ..........................................................   39 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Mycobacterium sp. MCS ..........................................................   39 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Mycobacterium sp. KMS ..........................................................   39 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Synechococcus sp. WH 7803 ......................................................   38 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Synechococcus sp. CC9311 .......................................................   38 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Cyanothece sp. PCC 8801 ........................................................   38 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Mycobacterium gilvum PYR-GCK ...................................................   38 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Kineococcus radiotolerans SRS30216 .............................................   38 1 hit  [high GC Gram+]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Candidatus Protochlamydia amoebophila UWE25 ....................................   37 1 hit  [chlamydias]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Synechococcus sp. CC9902 .......................................................   36 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Akkermansia muciniphila ATCC BAA-835 ...........................................   36 1 hit  [verrucomicrobia]        RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Desulfitobacterium hafniense Y51 ...............................................   35 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Desulfitobacterium hafniense DCB-2 .............................................   35 1 hit  [firmicutes]             RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Bacillus halodurans ............................................................   33 1 hit  [firmicutes]             RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . Synechococcus sp. CC9605 .......................................................   33 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Prochlorococcus marinus str. MIT 9515 ..........................................   33 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Prochlorococcus marinus str. MIT 9313 ..........................................   32 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Prochlorococcus marinus str. MIT 9215 ..........................................   32 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Prochlorococcus marinus str. MIT 9303 ..........................................   32 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Prochlorococcus marinus str. MIT 9301 ..........................................   31 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Prochlorococcus marinus str. MIT 9312 ..........................................   31 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. . Herpetosiphon aurantiacus ATCC 23779 ...........................................   31 1 hit  [GNS bacteria]           RecName: Full=Tryptophan 2,3-dioxygenase; Short=TDO; AltNam
. . Prochlorococcus marinus str. AS9601 ............................................   30 1 hit  [cyanobacteria]          RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. Saccharomyces cerevisiae (yeast) -------------------------------------------------  215 7 hits [ascomycetes]            RecName: Full=Acetolactate synthase catalytic subunit, mito
. Cryptococcus neoformans var. grubii ..............................................  207 1 hit  [basidiomycetes]         RecName: Full=Acetolactate synthase, mitochondrial; AltName
. Cryptococcus neoformans ..........................................................  206 2 hits [basidiomycetes]         RecName: Full=Acetolactate synthase, mitochondrial; AltName
. Arabidopsis thaliana (thale-cress) ...............................................  199 3 hits [eudicots]               RecName: Full=Acetolactate synthase, chloroplastic; AltName
. Brassica napus (rapeseeds) .......................................................  199 3 hits [eudicots]               RecName: Full=Acetolactate synthase 1, chloroplastic; AltNa
. Schizosaccharomyces pombe ........................................................  197 5 hits [ascomycetes]            RecName: Full=Acetolactate synthase, mitochondrial; AltName
. Guillardia theta .................................................................  192 1 hit  [cryptomonads]           RecName: Full=Acetolactate synthase large subunit; Short=AH
. Oryza sativa Japonica Group (Japanese rice) ......................................  187 5 hits [monocots]               RecName: Full=Probable acetolactate synthase 2, chloroplast
. Porphyra yezoensis ...............................................................  187 1 hit  [red algae]              RecName: Full=Acetolactate synthase large subunit; Short=AH
. Porphyra purpurea ................................................................  183 1 hit  [red algae]              RecName: Full=Acetolactate synthase large subunit; Short=AH
. Porphyra umbilicalis .............................................................  183 1 hit  [red algae]              RecName: Full=Acetolactate synthase large subunit; Short=AH
. Nicotiana tabacum (tobacco) ......................................................  182 4 hits [eudicots]               RecName: Full=Acetolactate synthase 2, chloroplastic; AltNa
. Zea mays (maize) .................................................................  181 3 hits [monocots]               RecName: Full=Acetolactate synthase 1, chloroplastic; AltNa
. Methanocaldococcus jannaschii ....................................................  178 2 hits [euryarchaeotes]         RecName: Full=Probable acetolactate synthase large subunit;
. Methanococcus aeolicus ...........................................................  175 1 hit  [euryarchaeotes]         RecName: Full=Probable acetolactate synthase large subunit;
. Cyanidium caldarium ..............................................................  164 1 hit  [red algae]              RecName: Full=Acetolactate synthase large subunit; Short=AH
. Xenopus laevis (common platanna) .................................................  100 1 hit  [frogs & toads]          RecName: Full=Acetolactate synthase-like protein; AltName: 
. Caenorhabditis elegans (nematode) ................................................  100 1 hit  [nematodes]              RecName: Full=Acetolactate synthase-like protein; AltName: 
. Danio rerio (zebra fish) .........................................................   98 1 hit  [bony fishes]            RecName: Full=Acetolactate synthase-like protein; AltName: 
. Mus musculus (mouse) .............................................................   93 3 hits [rodents]                RecName: Full=2-hydroxyacyl-CoA lyase 1; AltName: Full=2-hy
. Rattus norvegicus (brown rat) ....................................................   93 1 hit  [rodents]                RecName: Full=2-hydroxyacyl-CoA lyase 1; AltName: Full=2-hy
. Homo sapiens (man) ...............................................................   91 2 hits [primates]               RecName: Full=Acetolactate synthase-like protein; AltName: 
. Bos taurus (cow) .................................................................   88 1 hit  [even-toed ungulates]    RecName: Full=Acetolactate synthase-like protein; AltName: 
. Dictyostelium discoideum .........................................................   85 1 hit  [cellular slime molds]   RecName: Full=Probable 2-hydroxyacyl-CoA lyase 1; AltName: 
. Natronomonas pharaonis DSM 2160 ..................................................   55 1 hit  [euryarchaeotes]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. Oryza sativa Indica Group (Indian rice) ..........................................   52 3 hits [monocots]               RecName: Full=Pyruvate decarboxylase isozyme 3; Short=PDC
. Neurospora crassa ................................................................   51 1 hit  [ascomycetes]            RecName: Full=Pyruvate decarboxylase; AltName: Full=8-10 nm
. Hanseniaspora uvarum .............................................................   48 1 hit  [ascomycetes]            RecName: Full=Pyruvate decarboxylase
. Pisum sativum (peas) .............................................................   48 1 hit  [eudicots]               RecName: Full=Pyruvate decarboxylase isozyme 1; Short=PDC
. Aspergillus oryzae RIB40 .........................................................   48 1 hit  [ascomycetes]            RecName: Full=Pyruvate decarboxylase
. Aspergillus parasiticus ..........................................................   47 1 hit  [ascomycetes]            RecName: Full=Pyruvate decarboxylase
. Halobacterium salinarum ..........................................................   46 1 hit  [euryarchaeotes]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. Halobacterium salinarum R1 .......................................................   46 1 hit  [euryarchaeotes]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. Emericella nidulans ..............................................................   46 1 hit  [ascomycetes]            RecName: Full=Pyruvate decarboxylase
. Haloarcula marismortui ...........................................................   46 1 hit  [euryarchaeotes]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. Aspergillus fumigatus Af293 ......................................................   46 1 hit  [ascomycetes]            RecName: Full=Pyruvate decarboxylase
. Aspergillus terreus NIH2624 ......................................................   46 1 hit  [ascomycetes]            RecName: Full=Pyruvate decarboxylase
. Haloquadratum walsbyi DSM 16790 ..................................................   45 1 hit  [euryarchaeotes]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. Candida glabrata .................................................................   44 1 hit  [ascomycetes]            RecName: Full=Pyruvate decarboxylase
. Kluyveromyces marxianus ..........................................................   41 1 hit  [ascomycetes]            RecName: Full=Pyruvate decarboxylase
. Halorubrum lacusprofundi ATCC 49239 ..............................................   41 1 hit  [euryarchaeotes]         RecName: Full=2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
. Kluyveromyces lactis .............................................................   40 1 hit  [ascomycetes]            RecName: Full=Pyruvate decarboxylase
. Laccaria bicolor S238N-H82 .......................................................   31 1 hit  [basidiomycetes]         RecName: Full=Protein CLP1
. Drosophila melanogaster ..........................................................   31 1 hit  [flies]                  RecName: Full=MOXD1 homolog 2
. Thalictrum flavum subsp. glaucum .................................................   29 1 hit  [eudicots]               RecName: Full=S-norcoclaurine synthase; Flags: Precursor
. Methanococcoides burtonii DSM 6242 ...............................................   29 1 hit  [euryarchaeotes]         RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit D

BLAST

PROTOCOL

a)BLASTp versus NR, NCBI default parameters apart from "Number of descriptions_1000"

b)BLASTp versus swissport, NCBI default parameters apart from "Number of descriptions_1000"



RESULTS ANALYSIS


The E-values shown in the BLASTp verus NR are situated between 5e-86 and 1e-52 and the scores are between 320 and 209, in the BLASTp versus swissprot the E-Values are between 5e-86 and 9.8 and the scores between 225 and 29.3 bits.

THe protein acetolactate synthase presents a high similarity with the studyed sequence as it is the one with loest E-Value (5e-86) and highet score (320bits).

Despite diferent values and higher homology in the BLASTp versus NR the results of BLASTp versus Swissprot confirm our results.

This protein has probably the function of synthesing the aminoacids chain.








RAW RESULTS
a)BLASTp versus NR, NCBI default parameters apart from "Number of descriptions=1000"
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_05069586.1|  acetolactate synthase, large subunit, bios...   320    5e-86
ref|YP_265431.1|  acetolactate synthase 3 catalytic subunit [C...   320    5e-86
ref|ZP_01264833.1|  acetolactate synthase III large subunit [C...   319    6e-86
gb|ABZ06607.1|  putative Thiamine pyrophosphate enzyme, N-term...   311    2e-83
ref|ZP_06055313.1|  acetolactate synthase, large subunit, bios...   290    4e-77
ref|ZP_07025080.1|  acetolactate synthase, large subunit, bios...   275    1e-72
ref|ZP_07661127.1|  acetolactate synthase, large subunit, bios...   275    1e-72
ref|ZP_01546242.1|  acetolactate synthase III large subunit [S...   274    2e-72
ref|ZP_02166090.1|  acetolactate synthase III large subunit [H...   274    2e-72
ref|YP_002288287.1|  large subunit of acetolactate synthase [O...   273    4e-72
ref|ZP_05115112.1|  acetolactate synthase, large subunit, bios...   273    8e-72
ref|ZP_07476880.1|  acetolactate synthase, large subunit, bios...   270    4e-71
ref|ZP_05176238.1|  acetolactate synthase 3 catalytic subunit ...   270    4e-71
ref|YP_001259285.1|  acetolactate synthase 3 catalytic subunit...   270    4e-71
ref|ZP_05451593.1|  acetolactate synthase 3 catalytic subunit ...   270    5e-71
ref|YP_222077.1|  acetolactate synthase 3 catalytic subunit [B...   270    5e-71
ref|ZP_06793389.1|  acetolactate synthase [Brucella sp. NVSL 0...   270    5e-71
ref|ZP_07475882.1|  acetolactate synthase, large subunit, bios...   270    5e-71
ref|NP_698387.1|  acetolactate synthase 3 catalytic subunit [B...   270    5e-71
ref|YP_004279269.1|  acetolactate synthase large subunit [Agro...   270    5e-71
ref|ZP_05181235.1|  acetolactate synthase 3 catalytic subunit ...   270    5e-71
ref|YP_001370349.1|  acetolactate synthase 3 catalytic subunit...   270    6e-71
ref|ZP_04680594.1|  acetolactate synthase, large subunit, bios...   270    6e-71
ref|NP_355005.2|  acetolactate synthase 3 catalytic subunit [A...   269    1e-70
ref|YP_674049.1|  acetolactate synthase 3 catalytic subunit [M...   269    1e-70
ref|ZP_01227121.1|  acetolactate synthase [Aurantimonas mangan...   267    3e-70
ref|ZP_01045696.1|  acetolactate synthase III large subunit [N...   267    3e-70
ref|YP_768825.1|  acetolactate synthase 3 catalytic subunit [R...   267    3e-70
ref|YP_002826533.1|  acetolactate synthase 3 catalytic subunit...   267    3e-70
ref|YP_002550030.1|  acetolactate synthase 3 catalytic subunit...   267    3e-70
ref|NP_539534.1|  acetolactate synthase 3 catalytic subunit [B...   267    4e-70
ref|YP_003107316.1|  acetolactate synthase 3 large subunit [Br...   267    4e-70
ref|ZP_05454727.1|  acetolactate synthase 3 catalytic subunit ...   266    4e-70
ref|ZP_03529911.1|  acetolactate synthase 3 catalytic subunit ...   266    5e-70
ref|YP_002282032.1|  acetolactate synthase 3 catalytic subunit...   266    5e-70
ref|NP_773143.1|  acetolactate synthase 3 catalytic subunit [B...   266    5e-70
ref|YP_001327676.1|  acetolactate synthase 3 catalytic subunit...   266    5e-70
ref|YP_001979058.1|  acetolactate synthase III protein, large ...   266    6e-70
ref|YP_470286.1|  acetolactate synthase 3 catalytic subunit [R...   266    6e-70
ref|ZP_05083617.1|  acetolactate synthase, large subunit, bios...   266    7e-70
ref|NP_386220.1|  acetolactate synthase 3 catalytic subunit [S...   266    8e-70
ref|ZP_03499530.1|  acetolactate synthase 3 catalytic subunit ...   266    8e-70
ref|YP_002976591.1|  acetolactate synthase 3 catalytic subunit...   266    8e-70
ref|YP_318949.1|  acetolactate synthase 3 catalytic subunit [N...   265    1e-69
ref|XP_002667534.1|  PREDICTED: acetolactate synthase large su...   265    1e-69
ref|YP_002544904.1|  acetolactate synthase, large subunit, bio...   265    2e-69
ref|YP_004142414.1|  acetolactate synthase, large subunit, bio...   263    7e-69
ref|ZP_05810427.1|  acetolactate synthase, large subunit, bios...   262    1e-68
ref|YP_002363282.1|  acetolactate synthase, large subunit, bio...   261    2e-68
ref|NP_103022.1|  acetolactate synthase 3 catalytic subunit [M...   261    2e-68
ref|YP_001525292.1|  acetolactate synthase large subunit [Azor...   261    2e-68
ref|ZP_08073520.1|  acetolactate synthase, large subunit, bios...   261    2e-68
ref|YP_003692279.1|  acetolactate synthase, large subunit, bio...   261    2e-68
ref|YP_002517558.1|  acetolactate synthase 3 catalytic subunit...   261    3e-68
ref|ZP_01446513.1|  acetolactate synthase III large subunit [a...   260    3e-68
ref|YP_001413730.1|  acetolactate synthase large subunit [Parv...   260    4e-68
ref|NP_420903.1|  acetolactate synthase 3 catalytic subunit [C...   260    4e-68
ref|YP_004012605.1|  acetolactate synthase, large subunit, bio...   260    4e-68
ref|YP_003592435.1|  acetolactate synthase large subunit [Caul...   259    5e-68
ref|YP_001684976.1|  acetolactate synthase 3 catalytic subunit...   259    6e-68
ref|ZP_06888137.1|  acetolactate synthase, large subunit, bios...   258    1e-67
ref|YP_003756200.1|  acetolactate synthase, large subunit, bio...   258    1e-67
ref|YP_001416393.1|  acetolactate synthase, large subunit, bio...   258    2e-67
ref|YP_577961.1|  acetolactate synthase 3 catalytic subunit [N...   257    4e-67
ref|ZP_01003737.1|  acetolactate synthase III large subunit [L...   256    6e-67
ref|YP_768032.1|  acetolactate synthase [Rhizobium leguminosar...   256    7e-67
ref|ZP_01751661.1|  acetolactate synthase, large subunit [Rose...   256    8e-67
ref|YP_002525309.1|  acetolactate synthase 3 catalytic subunit...   256    9e-67
ref|YP_352693.1|  acetolactate synthase 3 catalytic subunit [R...   256    9e-67
ref|YP_001043176.1|  acetolactate synthase 3 catalytic subunit...   256    1e-66
ref|YP_683026.1|  acetolactate synthase 3 catalytic subunit [R...   255    1e-66
ref|ZP_02139017.1|  acetolactate synthase, large subunit [Rose...   255    1e-66
ref|ZP_01745694.1|  acetolactate synthase III large subunit [S...   255    1e-66
ref|YP_001167379.1|  acetolactate synthase 3 catalytic subunit...   255    1e-66
ref|ZP_05122435.1|  acetolactate synthase, large subunit, bios...   255    2e-66
ref|YP_002975782.1|  acetolactate synthase, large subunit, bio...   254    2e-66
ref|YP_003963623.1|  acetolactate synthase, large subunit, bio...   254    2e-66
ref|ZP_00960667.1|  acetolactate synthase III large subunit [R...   254    2e-66
ref|YP_001533122.1|  acetolactate synthase 3 catalytic subunit...   254    3e-66
ref|ZP_01012831.1|  acetolactate synthase III large subunit [M...   254    3e-66
ref|YP_003577695.1|  acetolactate synthase large subunit [Rhod...   254    3e-66
ref|ZP_01903510.1|  acetolactate synthase III large subunit [R...   254    4e-66
ref|ZP_05742983.1|  acetolactate synthase, large subunit, bios...   253    4e-66
ref|YP_004142386.1|  acetolactate synthase, large subunit, bio...   253    4e-66
ref|ZP_01880740.1|  acetolactate synthase III large subunit [R...   253    4e-66
ref|YP_533116.1|  acetolactate synthase 3 catalytic subunit [R...   253    5e-66
ref|ZP_05077896.1|  acetolactate synthase, large subunit, bios...   253    7e-66
ref|ZP_01440176.1|  acetolactate synthase III large subunit [F...   253    7e-66
ref|ZP_01754806.1|  acetolactate synthase III large subunit [R...   253    7e-66
ref|ZP_01036354.1|  acetolactate synthase III large subunit [R...   253    7e-66
ref|YP_425559.1|  acetolactate synthase, large subunit [Rhodos...   253    7e-66
ref|YP_001833518.1|  acetolactate synthase, large subunit, bio...   253    8e-66
ref|YP_486952.1|  acetolactate synthase 3 catalytic subunit [R...   253    8e-66
ref|YP_167791.1|  acetolactate synthase 3 catalytic subunit [R...   252    9e-66
ref|ZP_05090390.1|  acetolactate synthase, large subunit, bios...   252    9e-66
ref|YP_612870.1|  acetolactate synthase 3 catalytic subunit [R...   252    1e-65
ref|ZP_05787379.1|  acetolactate synthase, large subunit, bios...   252    1e-65
ref|ZP_02147154.1|  acetolactate synthase III large subunit [P...   252    1e-65
ref|YP_422870.1|  thiamine pyrophosphate-requiring enzyme [Mag...   252    1e-65
ref|ZP_02150478.1|  acetolactate synthase III large subunit [P...   252    1e-65
ref|ZP_05101692.1|  acetolactate synthase, large subunit, bios...   252    1e-65
ref|ZP_03530589.1|  acetolactate synthase 3 catalytic subunit ...   251    2e-65
ref|ZP_00999100.1|  acetolactate synthase III large subunit [O...   251    2e-65
ref|ZP_01055250.1|  acetolactate synthase III large subunit [R...   251    2e-65
ref|YP_001609896.1|  acetolactate synthase 3 catalytic subunit...   251    2e-65
ref|YP_003544910.1|  acetolactate synthase large subunit [Sphi...   251    2e-65
emb|CBI82455.1|  acetolactate synthase large subunit [Bartonel...   251    2e-65
ref|YP_001767245.1|  acetolactate synthase, large subunit, bio...   251    3e-65
ref|YP_002281782.1|  acetolactate synthase, large subunit, bio...   251    3e-65
ref|YP_002500595.1|  acetolactate synthase large subunit, bios...   251    3e-65
ref|NP_947376.1|  acetolactate synthase 3 catalytic subunit [R...   251    3e-65
ref|ZP_05075584.1|  acetolactate synthase, large subunit, bios...   250    3e-65
ref|YP_509839.1|  acetolactate synthase 3 catalytic subunit [J...   250    3e-65
ref|YP_569234.1|  acetolactate synthase 3 catalytic subunit [R...   250    3e-65
ref|ZP_07572496.1|  acetolactate synthase, large subunit, bios...   250    4e-65
ref|ZP_01039582.1|  acetolactate synthase III large subunit [E...   250    4e-65
ref|YP_001241920.1|  acetolactate synthase 3 catalytic subunit...   250    5e-65
ref|YP_004109784.1|  acetolactate synthase large subunit, bios...   250    5e-65
ref|YP_001207454.1|  acetolactate synthase 3 catalytic subunit...   250    5e-65
ref|YP_001757953.1|  acetolactate synthase, large subunit, bio...   249    7e-65
ref|ZP_05340789.1|  acetolactate synthase, large subunit, bios...   249    8e-65
ref|YP_781111.1|  acetolactate synthase 3 catalytic subunit [R...   249    8e-65
ref|ZP_05781083.1|  acetolactate synthase, large subunit, bios...   249    9e-65
ref|ZP_02187332.1|  Acetolactate synthase, large subunit, bios...   249    9e-65
ref|YP_002129716.1|  acetolactate synthase, large subunit [Phe...   249    1e-64
ref|ZP_01742236.1|  acetolactate synthase III large subunit [R...   248    1e-64
ref|ZP_00964123.1|  acetolactate synthase III large subunit [S...   248    1e-64
ref|ZP_01303923.1|  acetolactate synthase, large subunit, bios...   248    1e-64
ref|YP_003551040.1|  acetolactate synthase large subunit biosy...   248    2e-64
ref|ZP_05050176.1|  acetolactate synthase, large subunit, bios...   248    2e-64
ref|YP_003058866.1|  acetolactate synthase, large subunit, bio...   247    3e-64
ref|YP_915957.1|  acetolactate synthase 3 catalytic subunit [P...   247    4e-64
ref|YP_002298182.1|  acetolactate synthase, large subunit, bio...   247    4e-64
ref|ZP_01443875.1|  acetolactate synthase III large subunit [P...   247    4e-64
ref|YP_001642303.1|  acetolactate synthase, large subunit, bio...   247    4e-64
ref|YP_002424037.1|  acetolactate synthase, large subunit, bio...   247    4e-64
ref|YP_003449356.1|  acetolactate synthase large subunit [Azos...   247    4e-64
ref|ZP_02154409.1|  acetolactate synthase III large subunit [O...   247    5e-64
ref|YP_745302.1|  acetolactate synthase large subunit [Granuli...   246    6e-64
ref|ZP_05843929.1|  acetolactate synthase, large subunit, bios...   246    6e-64
ref|YP_002972263.1|  acetolactate synthase isozyme III large s...   246    8e-64
ref|YP_344503.1|  acetolactate synthase large subunit biosynth...   246    8e-64
ref|YP_003759891.1|  acetolactate synthase large subunit [Nitr...   246    1e-63
ref|YP_759181.1|  acetolactate synthase large subunit, biosynt...   246    1e-63
ref|ZP_05064477.1|  acetolactate synthase, large subunit, bios...   245    1e-63
emb|CAM76489.1|  Acetolactate synthase, large subunit, biosynt...   245    1e-63
ref|ZP_00954718.1|  acetolactate synthase III large subunit [S...   244    2e-63
dbj|BAJ82519.1|  acetolactate synthase large subunit [Acidiphi...   244    2e-63
ref|YP_001235942.1|  acetolactate synthase, large subunit, bio...   244    2e-63
ref|ZP_07374123.1|  acetolactate synthase, large subunit, bios...   244    3e-63
ref|YP_001928031.1|  acetolactate synthase, large subunit, bio...   243    4e-63
ref|YP_003673592.1|  acetolactate synthase, large subunit, bio...   243    5e-63
ref|YP_001353840.1|  acetolactate synthase large subunit [Jant...   243    5e-63
ref|ZP_00051726.2|  COG0028: Thiamine pyrophosphate-requiring ...   243    5e-63
ref|YP_114688.1|  acetolactate synthase, large subunit, biosyn...   243    6e-63
ref|ZP_06895520.1|  acetolactate synthase large subunit [Roseo...   243    9e-63
ref|YP_002514225.1|  acetolactate synthase, large subunit, bio...   243    9e-63
ref|ZP_01156537.1|  acetolactate synthase III large subunit [O...   242    1e-62
ref|YP_003526222.1|  acetolactate synthase, large subunit, bio...   242    1e-62
ref|YP_411174.1|  acetolactate synthase, large subunit, biosyn...   241    3e-62
ref|ZP_05105662.1|  acetolactate synthase, large subunit, bios...   240    4e-62
ref|YP_001099540.1|  acetolactate synthase III large subunit [...   240    4e-62
ref|YP_033867.1|  acetolactate synthase 3 catalytic subunit [B...   240    5e-62
ref|YP_002219348.1|  acetolactate synthase large subunit [Acid...   239    9e-62
ref|ZP_07653501.1|  acetolactate synthase, large subunit, bios...   239    1e-61
ref|ZP_01915784.1|  acetolactate synthase large subunit [Limno...   238    1e-61
ref|YP_001261115.1|  acetolactate synthase large subunit [Sphi...   238    2e-61
ref|YP_003263771.1|  acetolactate synthase, large subunit, bio...   238    2e-61
ref|YP_616516.1|  acetolactate synthase, large subunit, biosyn...   238    2e-61
ref|YP_003461009.1|  acetolactate synthase, large subunit, bio...   238    2e-61
ref|YP_374534.1|  acetolactate synthase large subunit biosynth...   238    2e-61
ref|YP_002015437.1|  acetolactate synthase large subunit, bios...   238    2e-61
ref|NP_841374.1|  thiamine pyrophosphate dependent enzyme [Nit...   238    2e-61
ref|YP_747479.1|  acetolactate synthase, large subunit, biosyn...   237    4e-61
ref|YP_004295175.1|  acetolactate synthase, large subunit, bio...   236    6e-61
ref|YP_003525017.1|  acetolactate synthase, large subunit, bio...   236    8e-61
ref|NP_661518.1|  acetolactate synthase, large subunit [Chloro...   236    1e-60
ref|YP_286275.1|  acetolactate synthase, large subunit [Dechlo...   236    1e-60
ref|YP_001960116.1|  acetolactate synthase, large subunit, bio...   236    1e-60
ref|YP_380198.1|  acetolactate synthase large subunit biosynth...   235    1e-60
ref|ZP_02462916.1|  acetolactate synthase 3 catalytic subunit ...   235    2e-60
ref|YP_002018988.1|  acetolactate synthase, large subunit, bio...   235    2e-60
ref|YP_003169291.1|  acetolactate synthase large subunit [Cand...   234    3e-60
ref|YP_003848281.1|  acetolactate synthase, large subunit, bio...   234    3e-60
ref|YP_161069.1|  thiamine pyrophosphate dependent acetolactat...   234    4e-60
ref|YP_911328.1|  acetolactate synthase, large subunit [Chloro...   234    4e-60
ref|YP_001942801.1|  acetolactate synthase, large subunit, bio...   234    4e-60
ref|YP_864823.1|  acetolactate synthase, large subunit [Magnet...   234    4e-60
ref|YP_001996536.1|  acetolactate synthase, large subunit, bio...   233    4e-60
ref|YP_003775156.1|  acetolactate synthase isozyme III large s...   233    5e-60
ref|YP_934657.1|  acetolactate synthase [Azoarcus sp. BH72] >e...   233    5e-60
ref|YP_103451.1|  acetolactate synthase 3 catalytic subunit [B...   233    5e-60
ref|ZP_04913806.1|  acetolactate synthase, large subunit, bios...   233    5e-60
ref|ZP_01770640.1|  acetolactate synthase, large subunit, bios...   233    5e-60
ref|YP_107818.1|  acetolactate synthase 3 catalytic subunit [B...   233    5e-60
ref|YP_001894967.1|  acetolactate synthase 3 catalytic subunit...   233    6e-60
ref|ZP_02355077.1|  acetolactate synthase 3 catalytic subunit ...   233    7e-60
ref|ZP_02362280.1|  acetolactate synthase 3 catalytic subunit ...   233    7e-60
ref|YP_441599.1|  acetolactate synthase 3 catalytic subunit [B...   233    7e-60
ref|ZP_06686242.1|  acetolactate synthase large subunit [Achro...   232    1e-59
ref|YP_003977293.1|  acetolactate synthase large subunit, bios...   232    1e-59
ref|YP_001130684.1|  acetolactate synthase, large subunit [Pro...   232    1e-59
ref|YP_002249089.1|  acetolactate synthase, large subunit, bio...   232    1e-59
ref|ZP_04760072.1|  acetolactate synthase, large subunit, bios...   232    1e-59
ref|YP_162874.1|  acetolactate synthase large subunit [Zymomon...   232    1e-59
gb|EFV82693.1|  acetolactate synthase large subunit [Achromoba...   231    2e-59
ref|ZP_01552517.1|  acetolactate synthase, large subunit [Meth...   231    2e-59
gb|EEZ80474.1|  acetolactate synthase, large subunit [uncultur...   231    2e-59
ref|ZP_07331777.1|  acetolactate synthase, large subunit, bios...   231    2e-59
ref|YP_002889750.1|  acetolactate synthase, large subunit, bio...   231    2e-59
ref|YP_546227.1|  acetolactate synthase, large subunit [Methyl...   231    3e-59
ref|YP_003156950.1|  acetolactate synthase, large subunit, bio...   230    4e-59
ref|YP_001998254.1|  acetolactate synthase, large subunit, bio...   230    4e-59
ref|YP_295170.1|  acetolactate synthase 3 catalytic subunit [R...   230    5e-59
ref|ZP_05081215.1|  acetolactate synthase, large subunit, bios...   229    6e-59
ref|YP_787172.1|  acetolactate synthase isozyme III large subu...   229    8e-59
ref|YP_002005051.1|  acetolactate synthase 3 catalytic subunit...   229    8e-59
ref|YP_583066.1|  acetolactate synthase 3 catalytic subunit [C...   229    1e-58
ref|NP_879604.1|  acetolactate synthase large subunit [Bordete...   229    1e-58
ref|ZP_03696574.1|  acetolactate synthase, large subunit, bios...   228    1e-58
ref|YP_457992.1|  acetolactate synthase large subunit [Erythro...   228    1e-58
ref|ZP_01386649.1|  acetolactate synthase, large subunit, bios...   228    1e-58
ref|YP_002794161.1|  IlvI [Laribacter hongkongensis HLHK9] >gb...   228    2e-58
ref|YP_001680097.1|  acetolactate synthase, large subunit, bio...   228    2e-58
ref|YP_001630212.1|  acetolactate synthase large subunit [Bord...   228    2e-58
ref|YP_725545.1|  acetolactate synthase 3 catalytic subunit [R...   228    2e-58
ref|YP_003432299.1|  acetolactate synthase large subunit [Hydr...   228    2e-58
ref|YP_004126400.1|  acetolactate synthase, large subunit, bio...   228    2e-58
ref|ZP_05040620.1|  acetolactate synthase, large subunit, bios...   228    3e-58
ref|NP_900256.1|  acetolactate synthase isozyme III, large sub...   228    3e-58
gb|ADI20008.1|  hypothetical protein [uncultured gamma proteob...   228    3e-58
ref|ZP_03311582.1|  hypothetical protein DESPIG_01498 [Desulfo...   226    6e-58
ref|YP_692201.1|  acetolactate synthase 3 catalytic subunit [A...   226    7e-58
ref|YP_002434582.1|  acetolactate synthase, large subunit, bio...   226    8e-58
ref|YP_986033.1|  acetolactate synthase 3 catalytic subunit [A...   226    9e-58
ref|ZP_07015521.1|  acetolactate synthase, large subunit, bios...   226    9e-58
ref|YP_002553409.1|  acetolactate synthase 3 catalytic subunit...   226    9e-58
ref|YP_463020.1|  acetolactate synthase large subunit [Syntrop...   226    1e-57
ref|ZP_01863139.1|  acetolactate synthase large subunit [Eryth...   225    1e-57
ref|ZP_01617210.1|  acetolactate synthase III large subunit [m...   225    1e-57
ref|YP_002480477.1|  acetolactate synthase, large subunit, bio...   225    1e-57
ref|NP_777835.1|  acetolactate synthase large subunit [Buchner...   225    1e-57
ref|ZP_05049811.1|  acetolactate synthase, large subunit, bios...   225    1e-57
ref|ZP_02177150.1|  acetolactate synthase large subunit [Hydro...   225    2e-57
gb|ADI23718.1|  thiamine pyrophosphate-requiring enzymes [uncu...   225    2e-57
ref|YP_001791923.1|  acetolactate synthase 3 catalytic subunit...   224    2e-57
ref|YP_191512.1|  acetolactate synthase large subunit [Glucono...   224    2e-57
ref|YP_003021309.1|  acetolactate synthase, large subunit, bio...   224    3e-57
ref|XP_002945370.1|  PREDICTED: acetolactate synthase isozyme ...   224    3e-57
ref|YP_967136.1|  acetolactate synthase, large subunit, biosyn...   224    3e-57
ref|YP_010595.1|  acetolactate synthase large subunit, biosynt...   224    3e-57
ref|YP_004199339.1|  acetolactate synthase large subunit [Geob...   224    4e-57
ref|YP_971450.1|  acetolactate synthase 3 catalytic subunit [A...   224    4e-57
ref|YP_002991993.1|  acetolactate synthase, large subunit, bio...   223    4e-57
ref|YP_004234650.1|  acetolactate synthase large subunit, bios...   223    5e-57
ref|YP_002139546.1|  acetolactate synthase, large subunit, bio...   223    5e-57
ref|ZP_07944123.1|  acetolactate synthase [Bilophila wadsworth...   223    5e-57
ref|YP_903675.1|  acetolactate synthase, large subunit [Candid...   223    5e-57
ref|YP_384221.1|  acetolactate synthase, large subunit [Geobac...   223    5e-57
ref|ZP_04762853.1|  acetolactate synthase, large subunit, bios...   223    5e-57
gb|EGD58882.1|  acetolactate synthase, large subunit [Novosphi...   223    6e-57
ref|YP_001232446.1|  acetolactate synthase, large subunit, bio...   223    6e-57
gb|ADI21464.1|  thiamine pyrophosphate-requiring enzymes [uncu...   223    6e-57
ref|YP_393654.1|  acetolactate synthase 3 catalytic subunit [S...   223    6e-57
gb|ADI22552.1|  thiamine pyrophosphate-requiring enzymes [uncu...   223    6e-57
ref|YP_003188431.1|  acetolactate synthase large subunit [Acet...   223    6e-57
ref|YP_390904.1|  acetolactate synthase, large subunit, biosyn...   223    7e-57
ref|YP_001111658.1|  acetolactate synthase, large subunit, bio...   223    7e-57
ref|YP_549138.1|  acetolactate synthase 3 catalytic subunit [P...   223    7e-57
ref|YP_001093901.1|  acetolactate synthase 3 catalytic subunit...   223    7e-57
ref|YP_003474341.1|  acetolactate synthase, large subunit, bio...   223    7e-57
ref|YP_002254257.1|  acetolactate synthase isozyme III (large ...   223    8e-57
ref|ZP_00943336.1|  Acetolactate synthase large subunit [Ralst...   223    8e-57
gb|ADI19776.1|  hypothetical protein [uncultured gamma proteob...   223    9e-57
ref|YP_003752004.1|  acetolactate synthase, large subunit [Ral...   223    9e-57
ref|YP_002536969.1|  acetolactate synthase, large subunit, bio...   223    9e-57
sp|Q9RQ65.1|ILVI_BUCSC  RecName: Full=Acetolactate synthase la...   223    9e-57
ref|YP_847091.1|  acetolactate synthase, large subunit, biosyn...   222    1e-56
ref|ZP_01627667.1|  diguanylate cyclase/phosphodiesterase (GGD...   222    1e-56
gb|ADI16254.1|  unknown protein [uncultured bacterium HF0010_1...   222    1e-56
ref|YP_003745230.1|  acetolactate synthase, large subunit [Ral...   222    1e-56
ref|ZP_07542868.1|  Acetolactate synthase large subunit [Actin...   222    1e-56
ref|YP_001968564.1|  acetolactate synthase large subunit [Acti...   222    1e-56
ref|YP_388660.1|  acetolactate synthase large subunit [Desulfo...   222    1e-56
ref|YP_003442923.1|  acetolactate synthase large subunit, bios...   222    1e-56
ref|YP_001651736.1|  acetolactate synthase 3 catalytic subunit...   222    1e-56
ref|ZP_06367917.1|  acetolactate synthase, large subunit, bios...   222    1e-56
ref|ZP_05293677.1|  Acetolactate synthase large subunit [Acidi...   222    1e-56
ref|YP_003796685.1|  acetolactate synthase large subunit [Cand...   222    1e-56
ref|YP_002981858.1|  acetolactate synthase 3 catalytic subunit...   222    1e-56
ref|NP_213319.1|  acetolactate synthase large subunit [Aquifex...   222    2e-56
ref|YP_001899794.1|  acetolactate synthase 3 catalytic subunit...   221    2e-56
ref|YP_847132.1|  acetolactate synthase, large subunit, biosyn...   221    2e-56
gb|AAF13795.1|AF129503_2  acetohydroxy acid synthase large sub...   221    2e-56
ref|NP_952960.1|  acetolactate synthase large subunit, biosynt...   221    2e-56
ref|YP_003639147.1|  acetolactate synthase, large subunit, bio...   221    2e-56
gb|ABL97373.1|  acetolactate synthase III large subunit [uncul...   221    2e-56
ref|YP_002771099.1|  acetolactate synthase large subunit [Brev...   221    2e-56
ref|ZP_04578022.1|  acetolactate synthase large subunit [Oxalo...   221    2e-56
ref|NP_520198.1|  acetolactate synthase 3 catalytic subunit [R...   221    2e-56
ref|YP_847090.1|  acetolactate synthase, large subunit, biosyn...   221    2e-56
ref|YP_004060350.1|  acetolactate synthase, large subunit [Sul...   221    2e-56
ref|YP_001760334.1|  acetolactate synthase 3 catalytic subunit...   221    2e-56
ref|YP_003190137.1|  acetolactate synthase, large subunit, bio...   221    3e-56
ref|YP_001219254.1|  acetolactate synthase large subunit [Cand...   221    3e-56
ref|YP_003190133.1|  acetolactate synthase, large subunit, bio...   221    3e-56
ref|ZP_02159491.1|  acetolactate synthase III large subunit [S...   221    3e-56
ref|YP_996517.1|  acetolactate synthase 3 catalytic subunit [V...   221    3e-56
ref|ZP_07344095.1|  acetolactate synthase, large subunit, bios...   221    3e-56
ref|YP_003238243.1|  acetolactate synthase, large subunit, bio...   221    3e-56
ref|ZP_07896651.1|  acetolactate synthase large subunit [Enter...   220    4e-56
ref|YP_003039938.1|  acetolactate synthase 3 catalytic subunit...   220    4e-56
ref|YP_001674604.1|  acetolactate synthase large subunit [Shew...   220    4e-56
ref|YP_001600322.1|  putative acetolactate synthase isozyme II...   220    4e-56
gb|ADI18771.1|  thiamine pyrophosphate-requiring enzymes [uncu...   220    4e-56
emb|CBJ37503.1|  acetolactate synthase, large subunit [Ralston...   220    4e-56
ref|YP_001211080.1|  thiamine pyrophosphate-requiring enzymes ...   220    4e-56
ref|YP_002276157.1|  acetolactate synthase large subunit [Gluc...   220    4e-56
ref|YP_001529918.1|  acetolactate synthase, large subunit, bio...   220    5e-56
ref|NP_930874.1|  acetolactate synthase 3 catalytic subunit [P...   220    5e-56
ref|YP_003892151.1|  acetolactate synthase large subunit [Sulf...   220    5e-56
ref|YP_001053432.1|  acetolactate synthase 3 catalytic subunit...   220    5e-56
ref|ZP_07944740.1|  acetolactate synthase [Bilophila wadsworth...   220    5e-56
ref|NP_759633.1|  acetolactate synthase 3 catalytic subunit [V...   220    5e-56
ref|YP_524562.1|  acetolactate synthase 3 catalytic subunit [R...   220    6e-56
gb|ADI84749.1|  acetolactate synthase, large subunit, biosynth...   219    6e-56
ref|YP_003335081.1|  acetolactate synthase large subunit [Dick...   219    7e-56
ref|ZP_01451944.1|  acetolactate synthase, large subunit, bios...   219    7e-56
ref|YP_003002957.1|  acetolactate synthase 3 catalytic subunit...   219    7e-56
ref|YP_002603361.1|  IlvG [Desulfobacterium autotrophicum HRM2...   219    7e-56
ref|ZP_08109647.1|  acetolactate synthase, large subunit, bios...   219    7e-56
ref|YP_002953560.1|  acetolactate synthase large subunit [Desu...   219    7e-56
ref|YP_001579201.1|  acetolactate synthase 3 catalytic subunit...   219    7e-56
ref|YP_004227573.1|  acetolactate synthase large subunit [Burk...   219    7e-56
ref|ZP_07741517.1|  acetolactate synthase 3 catalytic subunit ...   219    7e-56
ref|YP_003655945.1|  acetolactate synthase large subunit [Arco...   219    7e-56
ref|YP_003884614.1|  acetolactate synthase large subunit [Dick...   219    8e-56
ref|YP_003261135.1|  acetolactate synthase, large subunit, bio...   219    8e-56
ref|YP_557803.1|  acetolactate synthase 3 catalytic subunit [B...   219    8e-56
ref|YP_004121533.1|  acetolactate synthase large subunit [Desu...   219    8e-56
ref|YP_003907579.1|  acetolactate synthase large subunit, bios...   219    9e-56
ref|ZP_08114906.1|  acetolactate synthase, large subunit, bios...   219    9e-56
ref|ZP_02882853.1|  acetolactate synthase, large subunit, bios...   219    9e-56
ref|ZP_03572683.1|  acetolactate synthase, large subunit, bios...   219    1e-55
ref|YP_002429734.1|  acetolactate synthase, large subunit, bio...   219    1e-55
ref|YP_003604546.1|  acetolactate synthase, large subunit, bio...   219    1e-55
ref|YP_001501768.1|  acetolactate synthase large subunit [Shew...   219    1e-55
ref|YP_003740099.1|  Acetolactate synthase isozyme III large s...   219    1e-55
ref|YP_003469370.1|  acetolactate synthase III, valine-sensiti...   219    1e-55
ref|YP_001155843.1|  acetolactate synthase, large subunit, bio...   218    1e-55
gb|AAT38570.1|  prediced acetolactate synthase III large subun...   218    2e-55
ref|YP_902220.1|  acetolactate synthase, large subunit, biosyn...   218    2e-55
ref|YP_001126680.1|  acetolactate synthase catalytic subunit [...   218    2e-55
ref|ZP_02478424.1|  acetolactate synthase 3 catalytic subunit ...   218    2e-55
ref|NP_660569.1|  acetolactate synthase large subunit [Buchner...   218    2e-55
ref|ZP_08095819.1|  acetolactate synthase large subunit [Plano...   218    2e-55
ref|YP_774193.1|  acetolactate synthase 3 catalytic subunit [B...   218    2e-55
ref|YP_003019156.1|  acetolactate synthase, large subunit, bio...   218    2e-55
ref|YP_002121866.1|  acetolactate synthase, large subunit, bio...   218    2e-55
ref|ZP_03827861.1|  acetolactate synthase 3 catalytic subunit ...   218    2e-55
ref|YP_001797629.1|  acetolactate synthase, large subunit, bio...   218    2e-55
ref|YP_051917.1|  acetolactate synthase 3 catalytic subunit [P...   218    2e-55
ref|ZP_04945165.1|  acetolactate synthase III large subunit [B...   218    2e-55
ref|YP_502706.1|  acetolactate synthase, large subunit, biosyn...   218    2e-55
ref|YP_001474401.1|  acetolactate synthase 3 catalytic subunit...   218    2e-55
gb|EGD05506.1|  acetolactate synthase 3 catalytic subunit [Bur...   218    2e-55
ref|YP_003627698.1|  acetolactate synthase large subunit [Mora...   218    2e-55
ref|ZP_02196570.1|  acetolactate synthase III large subunit [V...   218    2e-55
ref|YP_001808876.1|  acetolactate synthase 3 catalytic subunit...   218    2e-55
ref|ZP_08101048.1|  acetolactate synthase 3 catalytic subunit ...   218    2e-55
gb|EDZ37939.1|  acetolactate synthase, large subunit [Leptospi...   218    2e-55
ref|ZP_04577932.1|  acetolactate synthase large subunit [Oxalo...   218    2e-55
ref|XP_002907637.1|  acetolactate synthase, mitochondrial prec...   218    2e-55
ref|YP_497532.1|  acetolactate synthase, large subunit [Novosp...   218    3e-55
ref|ZP_02889174.1|  acetolactate synthase, large subunit, bios...   218    3e-55
ref|YP_002986267.1|  acetolactate synthase, large subunit, bio...   218    3e-55
ref|ZP_03831127.1|  acetolactate synthase 3 catalytic subunit ...   218    3e-55
ref|ZP_06843429.1|  acetolactate synthase, large subunit, bios...   218    3e-55
ref|ZP_05129240.1|  acetolactate synthase, large subunit, bios...   218    3e-55
ref|ZP_01870938.1|  acetolactate synthase III large subunit [C...   217    3e-55
ref|YP_001444053.1|  acetolactate synthase 3 catalytic subunit...   217    3e-55
ref|YP_750317.1|  acetolactate synthase 3 catalytic subunit [S...   217    3e-55
ref|ZP_06192214.1|  acetolactate synthase 3 catalytic subunit ...   217    3e-55
ref|YP_001476982.1|  acetolactate synthase 3 catalytic subunit...   217    3e-55
ref|ZP_01986889.1|  acetolactate synthase, large subunit, bios...   217    3e-55
ref|ZP_07358170.1|  acetolactate synthase, large subunit, bios...   217    3e-55
ref|YP_436992.1|  acetolactate synthase 3 catalytic subunit [H...   217    4e-55
ref|YP_003198524.1|  acetolactate synthase, large subunit, bio...   217    4e-55
ref|ZP_06175306.1|  Acetolactate synthase 3 large subunit [Vib...   217    4e-55
ref|ZP_05946494.1|  acetolactate synthase large subunit [Vibri...   217    4e-55
emb|CBX29494.1|  Acetolactate synthase large subunit [uncultur...   217    4e-55
ref|YP_001356279.1|  acetolactate synthase 3 catalytic subunit...   217    4e-55
ref|ZP_04617092.1|  Acetolactate synthase large subunit [Yersi...   217    4e-55
ref|YP_465186.1|  acetolactate synthase, large subunit [Anaero...   217    4e-55
ref|ZP_01991840.1|  acetolactate synthase, large subunit, bios...   217    4e-55
emb|CAJ43227.1|  acetolactate synthase large subunit [Buchnera...   217    4e-55
ref|YP_003252005.1|  acetolactate synthase, large subunit, bio...   217    4e-55
ref|NP_253384.1|  acetolactate synthase 3 catalytic subunit [P...   217    4e-55
ref|YP_001350734.1|  acetolactate synthase 3 catalytic subunit...   217    4e-55
ref|NP_240056.1|  acetolactate synthase large subunit [Buchner...   217    4e-55
ref|ZP_07889647.1|  acetolactate synthase large subunit [Aggre...   217    4e-55
ref|NP_796731.1|  acetolactate synthase 3 catalytic subunit [V...   217    4e-55
ref|YP_004246980.1|  acetolactate synthase, large subunit, bio...   217    4e-55
ref|ZP_06178887.1|  Acetolactate synthase 3 large subunit [Vib...   217    4e-55
ref|YP_003304351.1|  acetolactate synthase, large subunit, bio...   217    4e-55
ref|ZP_04630511.1|  Acetolactate synthase large subunit [Yersi...   217    5e-55
ref|YP_148514.1|  acetolactate synthase catalytic subunit [Geo...   217    5e-55
ref|YP_003670450.1|  acetolactate synthase, large subunit, bio...   217    5e-55
ref|ZP_04602142.1|  hypothetical protein GCWU000324_01619 [Kin...   217    5e-55
ref|YP_001858247.1|  acetolactate synthase 3 catalytic subunit...   217    5e-55
ref|ZP_04923160.1|  acetolactate synthase, large subunit, bios...   217    5e-55
ref|ZP_07951714.1|  acetolactate synthase [Enterobacteriaceae ...   217    5e-55
ref|YP_002932179.1|  acetolactate synthase isozyme III, large ...   217    5e-55
ref|YP_003826821.1|  acetolactate synthase, large subunit [Ace...   217    5e-55
ref|ZP_01261609.1|  acetolactate synthase III large subunit [V...   217    5e-55
gb|EES52253.1|  acetolactate synthase, large subunit, biosynth...   216    5e-55
ref|YP_001120183.1|  acetolactate synthase 3 catalytic subunit...   216    5e-55
ref|ZP_08114909.1|  acetolactate synthase, large subunit, bios...   216    5e-55
ref|YP_001366575.1|  acetolactate synthase 3 catalytic subunit...   216    5e-55
ref|ZP_05629184.1|  acetolactate synthase 3 catalytic subunit ...   216    6e-55
ref|ZP_04613896.1|  Acetolactate synthase large subunit [Yersi...   216    6e-55
ref|ZP_03656625.1|  acetolactate synthase 3 catalytic subunit ...   216    6e-55
ref|YP_528016.1|  acetolactate synthase 3 catalytic subunit [S...   216    6e-55
ref|ZP_04753960.1|  acetolactate synthase 3 catalytic subunit ...   216    6e-55
ref|XP_721571.1|  hypothetical protein CaO19.9180 [Candida alb...   216    6e-55
ref|YP_002357900.1|  acetolactate synthase 3 catalytic subunit...   216    6e-55
ref|YP_001607309.1|  acetolactate synthase 3 catalytic subunit...   216    6e-55
ref|ZP_05120848.1|  acetolactate synthase, large subunit, bios...   216    6e-55
ref|YP_001164433.1|  acetolactate synthase 3 catalytic subunit...   216    6e-55
ref|ZP_05884128.1|  acetolactate synthase large subunit [Vibri...   216    6e-55
ref|ZP_04622519.1|  Acetolactate synthase large subunit [Yersi...   216    6e-55
ref|YP_001050748.1|  acetolactate synthase 3 catalytic subunit...   216    6e-55
ref|XP_721692.1|  hypothetical protein CaO19.1613 [Candida alb...   216    6e-55
ref|YP_069216.1|  acetolactate synthase 3 catalytic subunit [Y...   216    6e-55
ref|ZP_04634799.1|  Acetolactate synthase large subunit [Yersi...   216    7e-55
gb|ADV54327.1|  acetolactate synthase, large subunit, biosynth...   216    7e-55
ref|YP_002264043.1|  acetolactate synthase 3 catalytic subunit...   216    7e-55
ref|YP_001183658.1|  acetolactate synthase 3 catalytic subunit...   216    7e-55
ref|YP_963262.1|  acetolactate synthase 3 catalytic subunit [S...   216    7e-55
ref|YP_001005008.1|  acetolactate synthase 3 catalytic subunit...   216    7e-55
gb|ADZ41273.1|  acetolactate synthase 3 catalytic subunit [Yer...   216    7e-55
ref|ZP_05363345.1|  acetolactate synthase, large subunit, bios...   216    8e-55
ref|ZP_04621234.1|  Acetolactate synthase large subunit [Yersi...   216    8e-55
ref|NP_693544.1|  acetolactate synthase large subunit [Oceanob...   216    8e-55
ref|ZP_02905508.1|  acetolactate synthase, large subunit, bios...   216    8e-55
ref|YP_001554918.1|  acetolactate synthase 3 catalytic subunit...   216    8e-55
ref|ZP_01104736.1|  Acetolactate synthase isozyme III large su...   216    8e-55
ref|XP_002548114.1|  acetolactate synthase, mitochondrial prec...   216    8e-55
ref|YP_754808.1|  acetolactate synthase large subunit [Syntrop...   216    8e-55
emb|CBY28639.1|  acetolactate synthase large subunit [Yersinia...   216    8e-55
ref|XP_002419168.1|  acetolactate synthase, putative [Candida ...   216    9e-55
ref|YP_369830.1|  acetolactate synthase 3 catalytic subunit [B...   216    9e-55
ref|YP_002231483.1|  acetolactate synthase 3 catalytic subunit...   216    9e-55
ref|YP_003294683.1|  acetolactate synthase 3 catalytic subunit...   216    9e-55
ref|ZP_03267352.1|  thiamine pyrophosphate protein TPP binding...   216    9e-55
ref|YP_001379064.1|  acetolactate synthase, large subunit, bio...   216    9e-55
ref|YP_821479.1|  acetolactate synthase large subunit [Candida...   216    9e-55
ref|ZP_06637191.1|  acetolactate synthase large subunit [Serra...   216    9e-55
ref|YP_002134257.1|  acetolactate synthase, large subunit, bio...   216    1e-54
ref|ZP_02334215.1|  acetolactate synthase 3 catalytic subunit ...   216    1e-54
gb|AAL99356.1|  acetohydroxy acid synthase large subunit [Geob...   216    1e-54
ref|ZP_05705539.1|  biosynthetic family acetolactate synthase,...   216    1e-54
ref|YP_002950557.1|  acetolactate synthase, large subunit, bio...   216    1e-54
ref|YP_003557342.1|  acetolactate synthase III large subunit [...   216    1e-54
ref|YP_002492392.1|  acetolactate synthase, large subunit, bio...   216    1e-54
ref|ZP_08067532.1|  acetolactate synthase large subunit [Actin...   215    1e-54
ref|YP_621531.1|  acetolactate synthase 3 catalytic subunit [B...   215    1e-54
ref|YP_004195962.1|  acetolactate synthase large subunit [Desu...   215    1e-54
ref|ZP_01116331.1|  acetolactate synthase III large subunit [R...   215    1e-54
gb|ADI20597.1|  hypothetical protein [uncultured gamma proteob...   215    1e-54
ref|ZP_04452327.1|  hypothetical protein GCWU000182_01630 [Abi...   215    1e-54
gb|ABL09941.1|  IlvI [Pseudomonas aeruginosa] >gb|ABL09942.1| ...   215    1e-54
ref|YP_003072654.1|  acetolactate synthase 3 catalytic subunit...   215    1e-54
ref|ZP_05071418.1|  acetolactate synthase, large subunit, bios...   215    1e-54
ref|YP_003519002.1|  IlvI [Pantoea ananatis LMG 20103] >gb|ADD...   215    1e-54
gb|EGA77573.1|  Ilv2p [Saccharomyces cerevisiae Vin13]              215    1e-54
gb|EGA57329.1|  Ilv2p [Saccharomyces cerevisiae FostersB]           215    1e-54
ref|YP_003277700.1|  acetolactate synthase, large subunit [Com...   215    1e-54
ref|ZP_04919853.1|  acetolactate synthase III, large subunit [...   215    1e-54
ref|YP_004138967.1|  acetolactate synthase large subunit [Haem...   215    2e-54
gb|EDV11602.1|  acetolactate synthase [Saccharomyces cerevisia...   215    2e-54
gb|EGA73480.1|  Ilv2p [Saccharomyces cerevisiae AWRI796]            215    2e-54
ref|YP_733881.1|  acetolactate synthase 3 catalytic subunit [S...   215    2e-54
ref|YP_737879.1|  acetolactate synthase 3 catalytic subunit [S...   215    2e-54
ref|NP_717875.1|  acetolactate synthase 3 catalytic subunit [S...   215    2e-54
ref|YP_001344340.1|  acetolactate synthase 3 catalytic subunit...   215    2e-54
ref|YP_003588829.1|  acetolactate synthase, large subunit, bio...   215    2e-54
pdb|1JSC|A  Chain A, Crystal Structure Of The Catalytic Subuni...   215    2e-54
ref|YP_003050384.1|  acetolactate synthase, large subunit, bio...   215    2e-54
ref|XP_001642609.1|  hypothetical protein Kpol_297p12 [Vanderw...   215    2e-54
ref|ZP_08097747.1|  acetolactate synthase 3 catalytic subunit ...   215    2e-54
ref|ZP_03544003.1|  acetolactate synthase, large subunit, bios...   215    2e-54
ref|ZP_07045018.1|  acetolactate synthase 3 catalytic subunit ...   215    2e-54
ref|YP_869904.1|  acetolactate synthase 3 catalytic subunit [S...   215    2e-54
ref|YP_004039053.1|  acetolactate synthase, large subunit, bio...   215    2e-54
ref|XP_002617216.1|  hypothetical protein CLUG_02660 [Clavispo...   215    2e-54
ref|NP_013826.1|  Ilv2p [Saccharomyces cerevisiae S288c] >sp|P...   215    2e-54
pdb|1N0H|A  Chain A, Crystal Structure Of Yeast Acetohydroxyac...   215    2e-54
ref|YP_003896401.1|  acetolactate synthase 3 catalytic subunit...   215    2e-54
ref|ZP_01814076.1|  acetolactate synthase III large subunit [V...   215    2e-54
ref|YP_003513096.1|  acetolactate synthase large subunit, bios...   214    2e-54
ref|YP_002891826.1|  acetolactate synthase, large subunit, bio...   214    2e-54
ref|YP_572562.1|  acetolactate synthase, large subunit [Chromo...   214    2e-54
ref|YP_563127.1|  acetolactate synthase 3 catalytic subunit [S...   214    2e-54
ref|ZP_04809193.1|  acetolactate synthase 3 subunit [Helicobac...   214    2e-54
ref|ZP_02887335.1|  thiamine pyrophosphate protein TPP binding...   214    2e-54
ref|YP_001111655.1|  acetolactate synthase, large subunit, bio...   214    2e-54
ref|ZP_01786788.1|  acetolactate synthase 3 catalytic subunit ...   214    2e-54
ref|ZP_07966008.1|  acetolactate synthase [Segniliparus rugosu...   214    2e-54
ref|YP_002416047.1|  acetolactate synthase 3 catalytic subunit...   214    2e-54
ref|ZP_04582409.1|  acetolactate synthase large subunit [Helic...   214    2e-54
ref|ZP_05720240.1|  Acetolactate synthase 3 large subunit [Vib...   214    2e-54
ref|ZP_01066405.1|  acetolactate synthase III large subunit [V...   214    2e-54
ref|ZP_02326419.1|  acetolactate synthase catalytic subunit [P...   214    2e-54
ref|ZP_05880223.1|  acetolactate synthase large subunit [Vibri...   214    3e-54
ref|YP_001217983.1|  acetolactate synthase 3 catalytic subunit...   214    3e-54
ref|YP_003842841.1|  acetolactate synthase, large subunit, bio...   214    3e-54
ref|ZP_05717389.1|  Acetolactate synthase 3 large subunit [Vib...   214    3e-54
ref|ZP_04416484.1|  acetolactate synthase large subunit [Vibri...   214    3e-54
ref|ZP_04962886.1|  acetolactate synthase III, large subunit [...   214    3e-54
ref|ZP_01219928.1|  acetolactate synthase III large subunit [P...   214    3e-54
ref|YP_248943.1|  acetolactate synthase 3 catalytic subunit [H...   214    3e-54
ref|NP_232112.1|  acetolactate synthase 3 catalytic subunit [V...   214    3e-54
ref|XP_002143669.1|  acetolactate synthase, large subunit, put...   214    3e-54
ref|ZP_05925864.1|  acetolactate synthase large subunit [Vibri...   214    3e-54
ref|ZP_05849999.1|  acetolactate synthase, large subunit, bios...   214    3e-54
ref|NP_439730.1|  acetolactate synthase 3 catalytic subunit [H...   214    3e-54
ref|ZP_04403569.1|  acetolactate synthase large subunit [Vibri...   214    3e-54
ref|ZP_01983141.1|  acetolactate synthase III, large subunit [...   214    3e-54
ref|ZP_01793476.1|  acetolactate synthase 3 catalytic subunit ...   214    3e-54
gb|ADO81060.1|  Acetolactate synthase III large subunit [Haemo...   214    3e-54
ref|ZP_06943031.1|  acetolactate synthase III [Vibrio cholerae...   214    3e-54
ref|YP_001490085.1|  acetolactate synthase 3 catalytic subunit...   214    3e-54
ref|ZP_06081349.1|  acetolactate synthase large subunit [Vibri...   214    3e-54
ref|YP_128659.1|  acetolactate synthase 3 catalytic subunit [P...   214    3e-54
ref|YP_004167496.1|  acetolactate synthase, large subunit [Nit...   214    3e-54
ref|ZP_06125988.2|  acetolactate synthase, large subunit [Prov...   214    3e-54
ref|YP_001290857.1|  acetolactate synthase 3 catalytic subunit...   214    3e-54
ref|ZP_04467204.1|  acetolactate synthase 3 catalytic subunit ...   214    3e-54
ref|XP_001525930.1|  acetolactate synthase, mitochondrial prec...   214    3e-54
ref|YP_002801350.1|  acetolactate synthase 3 catalytic subunit...   214    3e-54
ref|ZP_06034257.1|  acetolactate synthase large subunit [Vibri...   214    3e-54
ref|YP_927893.1|  acetolactate synthase 3 catalytic subunit [S...   214    3e-54
ref|ZP_05920800.1|  acetolactate synthase [Pasteurella dagmati...   214    3e-54
ref|YP_952943.1|  acetolactate synthase 1 catalytic subunit [M...   214    4e-54
ref|NP_613816.1|  acetolactate synthase catalytic subunit [Met...   214    4e-54
ref|ZP_02961406.1|  hypothetical protein PROSTU_03434 [Provide...   214    4e-54
ref|YP_003827243.1|  acetolactate synthase, large subunit [Ace...   214    4e-54
ref|ZP_04410728.1|  acetolactate synthase large subunit [Vibri...   214    4e-54
ref|YP_088511.1|  acetolactate synthase 3 catalytic subunit [M...   214    4e-54
ref|XP_001384614.2|  acetolactate synthase [Scheffersomyces st...   214    4e-54
ref|ZP_07378432.1|  acetolactate synthase, large subunit, bios...   214    4e-54
ref|YP_001135496.1|  acetolactate synthase 1 catalytic subunit...   214    4e-54
ref|YP_004214459.1|  acetolactate synthase, large subunit, bio...   214    4e-54
gb|AAG10502.2|AF279106_64  predicted acetolactate synthase III...   214    4e-54
ref|YP_003809594.1|  Acetolactate synthase isoenzyme I large s...   214    4e-54
ref|ZP_05973301.1|  acetolactate synthase, large subunit [Prov...   214    4e-54
ref|YP_205646.1|  acetolactate synthase 3 catalytic subunit [V...   214    4e-54
ref|ZP_00992427.1|  acetolactate synthase III large subunit [V...   214    4e-54
gb|AAD29667.1|AF124757_27  acetolactate synthase large subunit...   214    4e-54
ref|YP_004149883.1|  Acetolactate synthase large subunit [Stap...   213    4e-54
ref|YP_001466735.1|  acetolactate synthase 3 catalytic subunit...   213    4e-54
ref|YP_565425.1|  acetolactate synthase 3 catalytic subunit [M...   213    5e-54
ref|ZP_00135474.1|  COG0028: Thiamine pyrophosphate-requiring ...   213    5e-54
ref|XP_002493637.1|  Acetolactate synthase, catalyses the firs...   213    5e-54
ref|NP_906370.1|  acetolactate synthase 3 catalytic subunit [W...   213    5e-54
ref|YP_001568611.1|  acetolactate synthase, large subunit, bio...   213    5e-54
ref|YP_003425564.1|  acetolactate synthase large subunit [Baci...   213    5e-54
ref|YP_001565881.1|  acetolactate synthase 3 catalytic subunit...   213    5e-54
ref|ZP_01898340.1|  putative acetolactate synthase III, larges...   213    5e-54
ref|ZP_01950704.1|  acetolactate synthase isozyme III large su...   213    5e-54
ref|YP_003532259.1|  acetolactate synthase large subunit [Erwi...   213    6e-54
ref|ZP_07902127.1|  acetolactate synthase, large subunit, bios...   213    6e-54
ref|YP_002647760.1|  Acetolactate synthase isozyme III large s...   213    6e-54
ref|ZP_05129599.1|  acetolactate synthase [Clostridium sp. 7_2...   213    6e-54
ref|ZP_01783510.1|  acetolactate synthase III large subunit [H...   213    6e-54
gb|ADP10045.1|  Acetolactate synthase isozyme III large subuni...   213    6e-54
ref|YP_003726441.1|  acetolactate synthase large subunit, bios...   213    7e-54
ref|YP_003929778.1|  acetolactate synthase large subunit [Pant...   213    7e-54
ref|ZP_01791401.1|  acetolactate synthase 3 catalytic subunit ...   213    7e-54
ref|YP_003678127.1|  acetolactate synthase, large subunit, bio...   213    7e-54
ref|YP_001406720.1|  acetolactate synthase 3 catalytic subunit...   213    7e-54
ref|ZP_02078793.1|  hypothetical protein CLOLEP_00230 [Clostri...   213    7e-54
ref|YP_004114532.1|  acetolactate synthase large subunit [Pant...   213    7e-54
ref|YP_002912388.1|  Acetolactate synthase, large subunit, bio...   213    7e-54
ref|YP_003659302.1|  acetolactate synthase large subunit, bios...   213    8e-54
ref|ZP_08148322.1|  acetolactate synthase large subunit [Haemo...   213    9e-54
ref|ZP_05620563.1|  acetolactate synthase, large subunit, bios...   213    9e-54
ref|YP_004001925.1|  acetolactate synthase, large subunit, bio...   213    9e-54
ref|ZP_01795497.1|  acetolactate synthase III large subunit [H...   213    9e-54
ref|YP_001186506.1|  acetolactate synthase 3 catalytic subunit...   213    9e-54
ref|ZP_01161985.1|  acetolactate synthase III large subunit [P...   213    9e-54
ref|ZP_05062163.1|  acetolactate synthase, large subunit, bios...   213    9e-54
ref|YP_001680548.1|  acetolactate synthase, large subunit, bio...   213    9e-54
emb|CBW15561.1|  acetolactate synthase III, large subunit [Hae...   213    9e-54
ref|YP_002607212.1|  acetolactate synthase 3 catalytic subunit...   213    1e-53
ref|ZP_01171799.1|  acetolactate synthase large subunit [Bacil...   212    1e-53
ref|ZP_04978911.1|  acetolactate synthase [Mannheimia haemolyt...   212    1e-53
gb|EAY58027.1|  Acetolactate synthase, large subunit [Leptospi...   212    1e-53
ref|YP_003711327.1|  acetolactate synthase III, valine-sensiti...   212    1e-53
ref|YP_001211077.1|  thiamine pyrophosphate-requiring enzymes ...   212    1e-53
ref|YP_003988334.1|  acetolactate synthase, large subunit, bio...   212    1e-53
ref|ZP_05993201.1|  acetolactate synthase [Mannheimia haemolyt...   212    1e-53
ref|ZP_05988636.1|  acetolactate synthase [Mannheimia haemolyt...   212    1e-53
ref|ZP_03320873.1|  hypothetical protein PROVALCAL_03842 [Prov...   212    1e-53
gb|EFW94728.1|  acetolactate synthase, mitochondrial precursor...   212    1e-53
ref|YP_004029838.1|  acetolactate synthase large subunit [Burk...   212    1e-53
ref|ZP_03971497.1|  acetolactate synthase 1 catalytic subunit ...   212    1e-53
ref|YP_003245160.1|  acetolactate synthase large subunit [Paen...   212    1e-53
ref|YP_002314957.1|  acetolactate synthase catalytic subunit [...   212    1e-53
gb|EDZ39884.1|  Acetolactate synthase, large subunit [Leptospi...   212    1e-53
ref|ZP_06884805.1|  acetolactate synthase, large subunit, bios...   212    1e-53
ref|YP_003839926.1|  acetolactate synthase, large subunit, bio...   212    1e-53
ref|YP_003110142.1|  acetolactate synthase, large subunit, bio...   212    1e-53
ref|ZP_01236581.1|  acetolactate synthase III large subunit [V...   212    1e-53
ref|ZP_02378341.1|  acetolactate synthase 3 catalytic subunit ...   212    1e-53
gb|EGC06486.1|  acetolactate synthase [Escherichia fergusonii ...   212    1e-53
ref|ZP_02233750.1|  hypothetical protein DORFOR_00602 [Dorea f...   212    2e-53
ref|ZP_08017621.1|  acetolactate synthase large subunit [Lautr...   212    2e-53
ref|YP_357321.1|  acetolactate synthase, large subunit, biosyn...   212    2e-53
ref|ZP_06713513.1|  acetolactate synthase, large subunit [Edwa...   212    2e-53
ref|YP_003945692.1|  acetolactate synthase [Paenibacillus poly...   211    2e-53
ref|YP_001863483.1|  acetolactate synthase, large subunit, bio...   211    2e-53
ref|ZP_08005882.1|  acetolactate synthase large subunit [Bacil...   211    2e-53
ref|ZP_06809405.1|  acetolactate synthase, large subunit, bios...   211    2e-53
ref|ZP_03114516.1|  acetolactate synthase, large subunit, bios...   211    2e-53
gb|AAF13787.1|AF129501_2  acetohydroxy acid synthase large sub...   211    2e-53
ref|ZP_06874091.1|  acetolactate synthase catalytic subunit [B...   211    2e-53
gb|EGB86982.1|  acetolactate synthase, large subunit [Escheric...   211    2e-53
ref|ZP_07147097.1|  acetolactate synthase, large subunit [Esch...   211    2e-53
ref|ZP_07737864.1|  acetolactate synthase, large subunit, bios...   211    2e-53
ref|ZP_03071494.1|  acetolactate synthase, large subunit, isoz...   211    2e-53
ref|YP_894109.1|  acetolactate synthase catalytic subunit [Bac...   211    2e-53
ref|ZP_06156229.1|  acetolactate synthase large subunit [Photo...   211    2e-53
ref|ZP_04070990.1|  hypothetical protein bthur0013_12990 [Baci...   211    2e-53
ref|ZP_04173682.1|  hypothetical protein bcere0030_13200 [Baci...   211    2e-53
ref|YP_001742200.1|  acetolactate synthase, large subunit, iso...   211    2e-53
ref|YP_001143127.1|  acetolactate synthase isozyme III, large ...   211    2e-53
gb|AAN78592.1|AE016755_92  Acetolactate synthase isozyme III l...   211    2e-53
gb|AAP15618.1|  acetolactate synthase III, large subunit [Shig...   211    2e-53
ref|YP_003993068.1|  acetolactate synthase, large subunit, bio...   211    2e-53
ref|XP_001938976.1|  acetolactate synthase, mitochondrial prec...   211    2e-53
ref|ZP_07119029.1|  acetolactate synthase, large subunit [Esch...   211    2e-53
ref|YP_027577.1|  acetolactate synthase catalytic subunit [Bac...   211    2e-53
ref|ZP_03029579.1|  acetolactate synthase, large subunit, isoz...   211    2e-53
ref|ZP_03066681.1|  acetolactate synthase, large subunit, isoz...   211    2e-53
ref|ZP_04144750.1|  hypothetical protein bthur0001_12780 [Baci...   211    2e-53
ref|YP_851278.1|  acetolactate synthase 3 catalytic subunit [E...   211    2e-53
emb|CAD36014.1|  acetolactate synthase [Saccharomycopsis fibul...   211    2e-53
ref|YP_035615.1|  acetolactate synthase catalytic subunit [Bac...   211    2e-53
ref|ZP_04299700.1|  hypothetical protein bcere0006_12490 [Baci...   211    2e-53
ref|YP_855428.1|  acetolactate synthase, large subunit, biosyn...   211    2e-53
ref|YP_001179646.1|  acetolactate synthase, large subunit, bio...   211    2e-53
ref|ZP_04958014.1|  acetolactate synthase, large subunit, bios...   211    2e-53
ref|ZP_03046931.1|  acetolactate synthase, large subunit, isoz...   211    2e-53
ref|NP_977838.1|  acetolactate synthase catalytic subunit [Bac...   211    2e-53
ref|YP_002529190.1|  acetolactate synthase catalytic subunit [...   211    2e-53
ref|YP_002450439.1|  acetolactate synthase, large subunit, bio...   211    2e-53
ref|ZP_04283177.1|  hypothetical protein bcere0010_12570 [Baci...   211    2e-53
ref|YP_082881.1|  acetolactate synthase catalytic subunit [Bac...   211    2e-53
dbj|BAI86322.1|  acetolactate synthase catalytic subunit [Baci...   211    2e-53
gb|ADY20773.1|  acetolactate synthase catalytic subunit [Bacil...   211    2e-53
ref|ZP_04125576.1|  hypothetical protein bthur0004_13110 [Baci...   211    2e-53
ref|NP_843874.1|  acetolactate synthase catalytic subunit [Bac...   211    2e-53
ref|ZP_07096337.1|  acetolactate synthase, large subunit [Esch...   211    2e-53
ref|YP_001906687.1|  Acetolactate synthase isozyme III large s...   211    2e-53
ref|YP_002572563.1|  acetolactate synthase large subunit [Cald...   211    2e-53
ref|ZP_02215104.1|  acetolactate synthase, large subunit, bios...   211    2e-53
ref|ZP_04221693.1|  hypothetical protein bcere0021_12800 [Baci...   211    2e-53
ref|YP_004026628.1|  acetolactate synthase, large subunit, bio...   211    2e-53
ref|ZP_04083555.1|  hypothetical protein bthur0011_12230 [Baci...   211    3e-53
ref|YP_002748738.1|  acetolactate synthase, large subunit, bio...   211    3e-53
ref|ZP_04119514.1|  hypothetical protein bthur0005_12860 [Baci...   211    3e-53
ref|ZP_03102750.1|  acetolactate synthase, large subunit, bios...   211    3e-53
ref|ZP_04077691.1|  hypothetical protein bthur0012_13060 [Baci...   211    3e-53
ref|ZP_04167998.1|  hypothetical protein bmyco0001_12560 [Baci...   211    3e-53
ref|NP_390709.1|  acetolactate synthase catalytic subunit [Bac...   211    3e-53
ref|ZP_07841490.1|  acetolactate synthase, large subunit, bios...   211    3e-53
ref|ZP_04322459.1|  hypothetical protein bcere0001_12610 [Baci...   211    3e-53
ref|ZP_04871569.1|  acetolactate synthase [Escherichia sp. 1_1...   211    3e-53
ref|ZP_04089600.1|  hypothetical protein bthur0010_12470 [Baci...   211    3e-53
ref|YP_001708120.1|  acetolactate synthase 3 catalytic subunit...   211    3e-53
ref|YP_001644194.1|  acetolactate synthase catalytic subunit [...   211    3e-53
ref|YP_003048055.1|  acetolactate synthase, large subunit, bio...   211    3e-53
ref|ZP_04156246.1|  hypothetical protein bmyco0003_11940 [Baci...   211    3e-53
ref|ZP_04226963.1|  hypothetical protein bcere0020_12370 [Baci...   211    3e-53
ref|ZP_00739807.1|  Acetolactate synthase large subunit [Bacil...   211    3e-53
ref|ZP_04179474.1|  hypothetical protein bcere0029_13020 [Baci...   211    3e-53
ref|YP_002318028.1|  acetolactate synthase, large subunit [Aci...   211    3e-53
ref|XP_448375.1|  hypothetical protein [Candida glabrata CBS 1...   211    3e-53
ref|ZP_08078960.1|  acetolactate synthase, large subunit, bios...   211    3e-53
ref|ZP_03611551.1|  acetolactate synthase, large subunit, bios...   211    3e-53
ref|YP_002444839.1|  acetolactate synthase, large subunit, bio...   211    3e-53
ref|ZP_04310912.1|  hypothetical protein bcere0004_12620 [Baci...   211    3e-53
ref|ZP_03238495.1|  acetolactate synthase, large subunit, bios...   211    3e-53
ref|ZP_06058748.1|  thiamine pyrophosphate-requiring enzyme [A...   211    3e-53
ref|ZP_04232811.1|  hypothetical protein bcere0019_12630 [Baci...   211    3e-53
gb|AAG54381.1|AE005184_9  acetolactate synthase III, valine se...   211    3e-53
ref|ZP_04196520.1|  hypothetical protein bcere0026_12440 [Baci...   211    3e-53
dbj|BAB33504.1|  putative acetolactate synthase III large subu...   211    3e-53
ref|ZP_04294095.1|  hypothetical protein bcere0007_13110 [Baci...   211    3e-53
ref|YP_003733604.1|  acetolactate synthase 3 catalytic subunit...   211    3e-53
ref|ZP_05823274.1|  thiamine pyrophosphate-requiring enzyme [A...   211    3e-53
ref|YP_004024623.1|  acetolactate synthase, large subunit, bio...   211    3e-53
ref|ZP_04162057.1|  hypothetical protein bmyco0002_12210 [Baci...   211    3e-53
ref|YP_002366179.1|  acetolactate synthase catalytic subunit [...   211    3e-53
ref|ZP_04190960.1|  hypothetical protein bcere0027_12910 [Baci...   211    3e-53
ref|XP_001271036.1|  acetolactate synthase, large subunit, put...   211    3e-53
ref|NP_349766.1|  acetolactate synthase large subunit [Clostri...   211    3e-53
ref|ZP_00237314.1|  acetolactate synthase, large subunit, bios...   211    3e-53
ref|ZP_04244354.1|  hypothetical protein bcere0017_12380 [Baci...   211    3e-53
ref|XP_452091.1|  hypothetical protein [Kluyveromyces lactis N...   211    3e-53
ref|NP_984555.1|  AEL305Cp [Ashbya gossypii ATCC 10895] >gb|AA...   211    3e-53
ref|ZP_04207707.1|  hypothetical protein bcere0024_12430 [Baci...   211    3e-53
ref|YP_001307363.1|  acetolactate synthase, large subunit, bio...   211    3e-53
ref|YP_002312155.1|  acetolactate synthase large subunit, bios...   211    3e-53
ref|NP_243927.1|  acetolactate synthase large subunit [Bacillu...   211    3e-53
ref|ZP_04559857.1|  acetolactate synthase 3 catalytic subunit ...   211    3e-53
ref|ZP_06068181.1|  acetolactate synthase, large subunit, bios...   211    3e-53
ref|ZP_06067486.1|  acetolactate synthase, large subunit, bios...   211    4e-53
ref|YP_350516.1|  acetolactate synthase 3 catalytic subunit [P...   211    4e-53
ref|YP_610156.1|  acetolactate synthase 3 catalytic subunit [P...   211    4e-53
gb|ABY60980.1|  acetolactate synthase 3 catalytic subunit [unc...   211    4e-53
ref|YP_003542006.1|  acetolactate synthase, large subunit [Met...   210    4e-53
ref|ZP_03229570.1|  acetolactate synthase, large subunit, bios...   210    4e-53
ref|YP_080105.1|  acetolactate synthase catalytic subunit [Bac...   210    4e-53
ref|YP_002381326.1|  acetolactate synthase 3 catalytic subunit...   210    4e-53
ref|ZP_01725507.1|  acetolactate synthase large subunit [Bacil...   210    4e-53
ref|ZP_04138479.1|  hypothetical protein bthur0002_13040 [Baci...   210    4e-53
ref|ZP_04305276.1|  hypothetical protein bcere0005_12670 [Baci...   210    4e-53
ref|ZP_04316593.1|  hypothetical protein bcere0002_12560 [Baci...   210    4e-53
ref|YP_001699011.1|  acetolactate synthase large subunit [Lysi...   210    4e-53
ref|ZP_04288443.1|  hypothetical protein bcere0009_12400 [Baci...   210    4e-53
ref|YP_002113134.1|  acetolactate synthase 3 catalytic subunit...   210    4e-53
ref|YP_001269848.1|  acetolactate synthase 3 catalytic subunit...   210    4e-53
ref|ZP_04969796.1|  acetolactate synthase [Fusobacterium nucle...   210    4e-53
ref|YP_001747628.1|  acetolactate synthase 3 catalytic subunit...   210    4e-53
ref|YP_668018.1|  acetolactate synthase 3 catalytic subunit [E...   210    4e-53
ref|YP_002406130.1|  acetolactate synthase 3 catalytic subunit...   210    4e-53
ref|ZP_07153212.1|  acetolactate synthase, large subunit [Esch...   210    4e-53
ref|YP_359375.1|  acetolactate synthase large subunit [Carboxy...   210    4e-53
gb|EGB77573.1|  acetolactate synthase, large subunit [Escheric...   210    4e-53
ref|YP_003974247.1|  acetolactate synthase catalytic subunit [...   210    4e-53
ref|ZP_01166487.1|  acetolactate synthase large subunit [Ocean...   210    4e-53
ref|ZP_03218515.1|  acetolactate synthase, large subunit, bios...   210    4e-53
ref|YP_001670900.1|  acetolactate synthase 3 catalytic subunit...   210    4e-53
ref|ZP_06692618.1|  acetolactate synthase [Acinetobacter sp. S...   210    5e-53
ref|YP_003690048.1|  acetolactate synthase, large subunit, bio...   210    5e-53
ref|ZP_03109493.1|  acetolactate synthase, large subunit, bios...   210    5e-53
ref|ZP_02698236.2|  acetolactate synthase, large subunit, bios...   210    5e-53
gb|EFZ56888.1|  acetolactate synthase, large subunit, biosynth...   210    5e-53
ref|ZP_04113973.1|  hypothetical protein bthur0006_12890 [Baci...   210    5e-53
ref|ZP_03758441.1|  hypothetical protein CLOSTASPAR_02453 [Clo...   210    5e-53
ref|YP_002039348.1|  acetolactate synthase 3 catalytic subunit...   210    5e-53
ref|ZP_03035732.1|  acetolactate synthase, large subunit, isoz...   210    5e-53
ref|YP_003496879.1|  acetolactate synthase large subunit [Defe...   210    5e-53
ref|ZP_03800125.1|  hypothetical protein COPCOM_02391 [Coproco...   210    5e-53
ref|NP_752048.2|  acetolactate synthase 3 catalytic subunit [E...   210    5e-53
ref|NP_746789.1|  acetolactate synthase 3 catalytic subunit [P...   210    5e-53
ref|YP_002410857.1|  acetolactate synthase 3 catalytic subunit...   210    5e-53
gb|EGB60293.1|  acetolactate synthase [Escherichia coli M863]       210    5e-53
ref|YP_002474682.1|  acetolactate synthase 3 catalytic subunit...   210    5e-53
ref|ZP_03214847.1|  acetolactate synthase, large subunit, bios...   210    5e-53
ref|YP_002925275.1|  acetolactate synthase III, large subunit ...   210    5e-53
ref|ZP_03051769.1|  acetolactate synthase, large subunit, isoz...   210    5e-53
gb|ADY84039.1|  acetolactate synthase III, large subunit [Acin...   210    5e-53
ref|YP_539126.2|  acetolactate synthase 3 catalytic subunit [E...   210    5e-53
ref|ZP_07189591.1|  acetolactate synthase, large subunit [Esch...   210    5e-53
ref|YP_003363730.1|  acetolactate synthase isozyme III large s...   210    5e-53
ref|ZP_06026904.1|  acetolactate synthase, large subunit [Fuso...   210    5e-53
gb|EFQ94642.1|  hypothetical protein PTT_07605 [Pyrenophora te...   210    5e-53
ref|ZP_03918368.1|  acetolactate synthase 1 catalytic subunit ...   210    5e-53
ref|YP_262327.1|  acetolactate synthase 3 catalytic subunit [P...   210    5e-53
ref|XP_001819738.2|  acetolactate synthase catalytic subunit [...   210    5e-53
ref|YP_002327674.1|  acetolactate synthase 3 catalytic subunit...   210    5e-53
ref|YP_002145101.1|  acetolactate synthase 3 catalytic subunit...   210    5e-53
gb|EGB70854.1|  acetolactate synthase [Escherichia coli TW10509]    210    5e-53
ref|ZP_02684173.2|  acetolactate synthase, large subunit, bios...   210    5e-53
ref|NP_706030.3|  acetolactate synthase 3 catalytic subunit [S...   210    5e-53
ref|YP_001461247.1|  acetolactate synthase 3 catalytic subunit...   210    5e-53
ref|ZP_06475016.1|  acetolactate synthase, large subunit, bios...   210    5e-53
ref|ZP_03077562.1|  acetolactate synthase, large subunit, bios...   210    5e-53
ref|XP_002479984.1|  acetolactate synthase, large subunit, put...   210    5e-53
ref|ZP_01307827.1|  acetolactate synthase, large subunit, bios...   210    6e-53
ref|ZP_06726726.1|  acetolactate synthase large subunit [Acine...   210    6e-53
ref|ZP_03823351.1|  acetolactate synthase III, large subunit [...   210    6e-53
ref|YP_001716542.1|  acetolactate synthase, large subunit, bio...   210    6e-53
ref|YP_066505.1|  acetolactate synthase isozyme III, large sub...   210    6e-53
ref|YP_406628.1|  acetolactate synthase 3 catalytic subunit [S...   210    6e-53
ref|YP_309114.1|  acetolactate synthase 3 catalytic subunit [S...   210    6e-53
ref|ZP_05362105.1|  acetolactate synthase, large subunit, bios...   210    6e-53
ref|ZP_04150472.1|  hypothetical protein bpmyx0001_12690 [Baci...   210    6e-53
ref|ZP_03707224.1|  hypothetical protein CLOSTMETH_01968 [Clos...   210    6e-53
ref|YP_001456866.1|  acetolactate synthase 3 catalytic subunit...   210    6e-53
ref|AP_000741.1|  acetolactate synthase III, large subunit [Es...   210    6e-53
ref|NP_308108.2|  acetolactate synthase 3 catalytic subunit [E...   209    6e-53
ref|ZP_04095651.1|  hypothetical protein bthur0009_12550 [Baci...   209    7e-53
ref|YP_003370314.1|  acetolactate synthase large subunit [Pire...   209    7e-53
ref|YP_001952737.1|  acetolactate synthase, large subunit, bio...   209    7e-53
ref|YP_001547209.1|  acetolactate synthase large subunit, bios...   209    7e-53
ref|YP_004111419.1|  acetolactate synthase large subunit [Desu...   209    7e-53
ref|ZP_04107848.1|  hypothetical protein bthur0007_16580 [Baci...   209    7e-53
ref|ZP_07386621.1|  acetolactate synthase, large subunit, bios...   209    7e-53
ref|YP_003791247.1|  acetolactate synthase large subunit [Baci...   209    7e-53
ref|ZP_06354881.1|  acetolactate synthase, large subunit [Citr...   209    7e-53
ref|YP_003290022.1|  acetolactate synthase, large subunit, bio...   209    7e-53
ref|ZP_07777533.1|  acetolactate synthase, large subunit [Pseu...   209    7e-53
gb|EFP79038.1|  acetolactate synthase [Puccinia graminis f. sp...   209    8e-53
ref|NP_245807.1|  acetolactate synthase 3 catalytic subunit [P...   209    8e-53
ref|ZP_08142006.1|  acetolactate synthase 3 catalytic subunit ...   209    8e-53
ref|YP_004151074.1|  acetolactate synthase, large subunit, bio...   209    8e-53
ref|ZP_04185267.1|  hypothetical protein bcere0028_12710 [Baci...   209    8e-53
ref|ZP_03108556.1|  acetolactate synthase, large subunit, bios...   209    8e-53
ref|ZP_04096028.1|  hypothetical protein bthur0009_16380 [Baci...   209    8e-53
ref|ZP_04222087.1|  hypothetical protein bcere0021_16800 [Baci...   209    8e-53
ref|ZP_03100840.1|  acetolactate synthase, large subunit, bios...   209    8e-53
ref|YP_981951.1|  acetolactate synthase 3 catalytic subunit [P...   209    8e-53
ref|YP_003791631.1|  acetolactate synthase III large subunit N...   209    8e-53
ref|YP_001454821.1|  acetolactate synthase 3 catalytic subunit...   209    8e-53
emb|CAA38854.1|  acetohydroxy acid synthase AHAS III (IlvI) [E...   209    8e-53
dbj|BAE57736.1|  unnamed protein product [Aspergillus oryzae]       209    8e-53
ref|ZP_04078088.1|  hypothetical protein bthur0012_17080 [Baci...   209    8e-53
ref|YP_894460.1|  acetolactate synthase 3 catalytic subunit [B...   209    8e-53
ref|NP_844268.1|  acetolactate synthase 3 catalytic subunit [B...   209    8e-53
ref|YP_002749131.1|  acetolactate synthase, large subunit, bio...   209    9e-53
ref|ZP_04101215.1|  hypothetical protein bthur0008_12740 [Baci...   209    9e-53
ref|ZP_04272512.1|  hypothetical protein bcere0012_12610 [Baci...   209    9e-53
gb|EFZ03228.1|  acetolactate synthase [Metarhizium anisopliae ...   209    9e-53
ref|ZP_04238555.1|  hypothetical protein bcere0018_12270 [Baci...   209    9e-53
ref|ZP_04655010.1|  acetolactate synthase 3 catalytic subunit ...   209    9e-53
ref|YP_001439319.1|  acetolactate synthase 3 catalytic subunit...   209    9e-53
ref|YP_001359127.1|  acetolactate synthase 3 catalytic subunit...   209    1e-52
ref|YP_036023.1|  acetolactate synthase 3 catalytic subunit [B...   209    1e-52
ref|XP_002498845.1|  ZYRO0G19954p [Zygosaccharomyces rouxii] >...   209    1e-52
emb|CAA25755.1|  unnamed protein product [Escherichia coli]         209    1e-52
ref|ZP_04824307.1|  acetolactate synthase [Staphylococcus epid...   209    1e-52
ref|ZP_03601309.1|  acetolactate synthase catalytic subunit [B...   209    1e-52
ref|NP_765210.1|  acetolactate synthase large subunit [Staphyl...   209    1e-52
ref|ZP_06614367.1|  acetolactate synthase large subunit [Staph...   209    1e-52
ref|ZP_04581988.1|  acetolactate synthase 3 catalytic subunit ...   209    1e-52
ref|YP_047618.1|  acetolactate synthase 3 catalytic subunit [A...   209    1e-52
ref|ZP_06283377.1|  acetolactate synthase, large subunit, bios...   209    1e-52
ref|YP_003209074.1|  acetolactate synthase 3 catalytic subunit...   209    1e-52
ref|YP_001560439.1|  acetolactate synthase, large subunit, bio...   209    1e-52
ref|ZP_08078963.1|  acetolactate synthase, large subunit, bios...   209    1e-52
ref|YP_002044085.1|  acetolactate synthase 3 catalytic subunit...   209    1e-52
ref|YP_002214068.1|  acetolactate synthase 3 catalytic subunit...   209    1e-52
ref|XP_002840717.1|  hypothetical protein [Tuber melanosporum ...   209    1e-52
ref|ZP_02344448.2|  acetolactate synthase, large subunit, isoz...   209    1e-52
ref|YP_009584.1|  acetolactate synthase catalytic subunit [Des...   209    1e-52
emb|CBY94152.1|  acetolactate synthase, large subunit, biosynt...   209    1e-52
ref|YP_001981184.1|  acetolactate synthase 3 catalytic subunit...   209    1e-52
ref|YP_003653413.1|  acetolactate synthase large subunit [Ther...   209    1e-52
ref|XP_501277.1|  YALI0C00253p [Yarrowia lipolytica] >emb|CAG8...   209    1e-52
ref|YP_003002942.1|  acetolactate synthase catalytic subunit [...   209    1e-52
ref|YP_004094393.1|  acetolactate synthase, large subunit, bio...   209    1e-52
ref|YP_003943173.1|  acetolactate synthase, large subunit, bio...   209    1e-52
ref|YP_004281319.1|  acetolactate synthase, large subunit, bio...   209    1e-52
ref|YP_359378.1|  acetolactate synthase large subunit [Carboxy...   209    1e-52
ref|YP_189231.1|  acetolactate synthase, large subunit, biosyn...   209    1e-52
ref|ZP_06495793.1|  acetolactate synthase 3 catalytic subunit ...   209    1e-52
ref|ZP_04854896.1|  acetolactate synthase, large subunit, bios...   209    1e-52
ref|YP_004226038.1|  thiamine pyrophosphate-requiring enzyme [...   209    1e-52
ref|XP_001798477.1|  hypothetical protein SNOG_08152 [Phaeosph...   209    1e-52
ref|YP_004202014.1|  acetolactate synthase, large subunit [The...   208    1e-52
ref|XP_370371.1|  hypothetical protein MGG_06868 [Magnaporthe ...   208    1e-52
ref|YP_639071.1|  acetolactate synthase 1 catalytic subunit [M...   208    1e-52
gb|EDK36578.2|  conserved hypothetical protein [Meyerozyma gui...   208    2e-52
ref|YP_001021296.1|  acetolactate synthase 3 catalytic subunit...   208    2e-52
ref|ZP_04432151.1|  acetolactate synthase, large subunit, bios...   208    2e-52
gb|AAN10235.1|  acetolactate synthetase large subunit [Strepto...   208    2e-52
ref|YP_001704053.1|  acetolactate synthase 1 catalytic subunit...   208    2e-52
ref|YP_003869749.1|  Acetolactate synthase large subunit [Paen...   208    2e-52
ref|NP_790820.1|  acetolactate synthase, large subunit, biosyn...   208    2e-52
ref|YP_001279514.1|  acetolactate synthase 3 catalytic subunit...   208    2e-52
ref|ZP_04599105.1|  hypothetical protein VEIDISOL_00523 [Veill...   208    2e-52
ref|YP_300914.1|  acetolactate synthase large subunit [Staphyl...   208    2e-52
ref|ZP_03657680.1|  acetolactate synthase 3 catalytic subunit ...   208    2e-52
ref|ZP_06880995.1|  acetolactate synthase 3 catalytic subunit ...   208    2e-52
ref|ZP_05966786.1|  hypothetical protein ENTCAN_05128 [Enterob...   208    2e-52
gb|ADP96295.1|  acetolactate synthase, large subunit, biosynth...   208    2e-52
ref|YP_003884628.1|  acetolactate synthase large subunit [Dick...   208    2e-52
ref|YP_431086.1|  acetolactate synthase, large subunit [Moorel...   208    2e-52
ref|ZP_04059218.1|  acetolactate synthase, large subunit, bios...   208    2e-52
emb|CBK81950.1|  acetolactate synthase, large subunit, biosynt...   208    2e-52
emb|CBK87673.1|  acetolactate synthase, large subunit, biosynt...   208    2e-52
ref|YP_001039106.1|  acetolactate synthase, large subunit [Clo...   208    2e-52
ref|YP_003921234.1|  acetolactate synthase (acetohydroxy-acid ...   208    2e-52
ref|YP_001850014.1|  acetolactate synthase (large subunit) Ilv...   208    2e-52
ref|YP_905871.1|  acetolactate synthase 1 catalytic subunit [M...   208    2e-52
ref|ZP_04590550.1|  acetolactate synthase 3 catalytic subunit ...   208    2e-52
gb|ABU62921.1|  catalytic subunit protein [Klebsiella pneumoniae]   208    2e-52
ref|YP_002784418.1|  acetolactate synthase 1 catalytic subunit...   208    2e-52
ref|YP_001333772.1|  acetolactate synthase 3 catalytic subunit...   208    2e-52
ref|YP_273153.1|  acetolactate synthase 3 catalytic subunit [P...   208    2e-52
ref|YP_003441209.1|  acetolactate synthase, large subunit, bio...   208    2e-52
ref|ZP_06052851.1|  acetolactate synthase large subunit [Grimo...   208    2e-52
ref|YP_003994933.1|  acetolactate synthase, large subunit, bio...   208    2e-52
gb|ADY21178.1|  acetolactate synthase 3 catalytic subunit [Bac...   208    2e-52
ref|YP_001422128.1|  acetolactate synthase catalytic subunit [...   208    2e-52
ref|YP_002240450.1|  acetolactate synthase, large subunit, iso...   208    2e-52
ref|YP_003566691.1|  acetolactate synthase isozyme III large s...   208    2e-52
ref|ZP_07843339.1|  acetolactate synthase, large subunit, bios...   208    2e-52
ref|YP_003164615.1|  acetolactate synthase, large subunit, bio...   208    2e-52
ref|YP_482721.1|  acetolactate synthase 1 catalytic subunit [F...   208    2e-52
ref|YP_003274328.1|  acetolactate synthase large subunit [Gord...   208    2e-52
ref|ZP_02179310.1|  acetolactate synthase large subunit [Hydro...   208    2e-52
ref|ZP_01367713.1|  hypothetical protein PaerPA_01004866 [Pseu...   208    2e-52
ref|YP_083261.1|  acetolactate synthase 3 catalytic subunit [B...   208    2e-52
ref|ZP_06012413.1|  acetolactate synthase, large subunit, bios...   207    2e-52
ref|ZP_07053483.1|  acetolactate synthase large subunit [Liste...   207    2e-52
ref|YP_001571876.1|  acetolactate synthase 3 catalytic subunit...   207    2e-52
ref|ZP_04283573.1|  hypothetical protein bcere0010_16570 [Baci...   207    2e-52
ref|ZP_03614502.1|  acetolactate synthase, large subunit, bios...   207    2e-52
sp|P40811.3|ILVI_SALTY  RecName: Full=Acetolactate synthase is...   207    2e-52
ref|YP_003611386.1|  acetolactate synthase 3 catalytic subunit...   207    2e-52
ref|ZP_06017922.1|  acetolactate synthase [Klebsiella pneumoni...   207    2e-52
ref|YP_001175362.1|  acetolactate synthase 3 catalytic subunit...   207    2e-52
ref|ZP_04796267.1|  acetolactate synthase [Staphylococcus epid...   207    3e-52
ref|ZP_04145150.1|  hypothetical protein bthur0001_16840 [Baci...   207    3e-52
ref|YP_215100.2|  acetolactate synthase 3 catalytic subunit [S...   207    3e-52
ref|ZP_00236615.1|  acetolactate synthase, large subunit, bios...   207    3e-52
ref|ZP_02620902.1|  acetolactate synthase, large subunit, bios...   207    3e-52
ref|ZP_06064420.1|  acetolactate synthase III [Acinetobacter j...   207    3e-52
ref|ZP_06747214.1|  acetolactate synthase, large subunit, bios...   207    3e-52
ref|ZP_03235733.1|  acetolactate synthase, large subunit, bios...   207    3e-52
gb|EFV88923.1|  acetolactate synthase, large subunit, biosynth...   207    3e-52
ref|NP_454728.1|  acetolactate synthase 3 catalytic subunit [S...   207    3e-52
ref|ZP_03779507.1|  hypothetical protein CLOHYLEM_06583 [Clost...   207    3e-52
ref|YP_002560262.1|  acetolactate synthase large subunit [Macr...   207    3e-52
ref|YP_002529571.1|  acetolactate synthase 3 catalytic subunit...   207    3e-52
ref|YP_958165.1|  acetolactate synthase 3 catalytic subunit [M...   207    3e-52
ref|ZP_07091209.1|  acetolactate synthase large subunit [Coryn...   207    3e-52
ref|YP_149463.1|  acetolactate synthase 3 catalytic subunit [S...   207    3e-52
ref|YP_051936.1|  acetolactate synthase catalytic subunit [Pec...   207    3e-52
ref|ZP_04322847.1|  hypothetical protein bcere0001_16570 [Baci...   207    3e-52
ref|ZP_04238939.1|  hypothetical protein bcere0018_16120 [Baci...   207    3e-52
ref|ZP_04101600.1|  hypothetical protein bthur0008_16630 [Baci...   207    3e-52
ref|XP_001487299.1|  conserved hypothetical protein [Meyerozym...   207    3e-52
ref|YP_233942.1|  acetolactate synthase 3 catalytic subunit [P...   207    3e-52
emb|CBL11279.1|  acetolactate synthase, large subunit, biosynt...   207    3e-52
emb|CBL08469.1|  acetolactate synthase, large subunit, biosynt...   207    3e-52
ref|ZP_04743633.2|  acetolactate synthase, large subunit, bios...   207    3e-52
ref|YP_003960730.1|  acetolactate synthase [Eubacterium limosu...   207    3e-52
ref|XP_001244143.1|  conserved hypothetical protein [Coccidioi...   207    3e-52
ref|NP_831551.1|  acetolactate synthase 3 catalytic subunit [B...   207    3e-52
ref|YP_003664179.1|  acetolactate synthase 3 catalytic subunit...   207    3e-52
ref|ZP_04278314.1|  hypothetical protein bcere0011_16470 [Baci...   207    3e-52
ref|YP_003411009.1|  acetolactate synthase large subunit, bios...   207    4e-52
ref|ZP_07717870.1|  acetolactate synthase large subunit [Aerom...   207    4e-52
ref|YP_001243976.1|  acetolactate synthase, large subunit, bio...   207    4e-52
ref|ZP_02331707.1|  acetolactate synthase catalytic subunit [Y...   207    4e-52
ref|YP_003261154.1|  acetolactate synthase, large subunit, bio...   207    4e-52
ref|ZP_05392511.1|  acetolactate synthase, large subunit, bios...   207    4e-52
ref|XP_001397728.1|  acetolactate synthase catalytic subunit [...   207    4e-52
ref|YP_518691.1|  hypothetical protein DSY2458 [Desulfitobacte...   207    4e-52
gb|ADA72420.1|  Acetolactate synthase [Shigella flexneri 2002017]   207    4e-52
ref|YP_003010065.1|  acetolactate synthase, large subunit, bio...   207    4e-52
ref|ZP_07200766.1|  acetolactate synthase, large subunit, bios...   207    4e-52
ref|XP_461633.2|  DEHA2G02134p [Debaryomyces hansenii CBS767] ...   207    4e-52
ref|ZP_07805367.1|  acetolactate synthase [Helicobacter cinaed...   207    4e-52
ref|XP_003192039.1|  acetolactate synthase [Cryptococcus gatti...   207    4e-52
ref|ZP_03754390.1|  hypothetical protein ROSEINA2194_02815 [Ro...   207    4e-52
ref|NP_669437.1|  acetolactate synthase catalytic subunit [Yer...   207    4e-52
ref|YP_003335095.1|  acetolactate synthase large subunit [Dick...   207    4e-52
ref|ZP_04119901.1|  hypothetical protein bthur0005_16800 [Baci...   207    4e-52
ref|XP_962652.2|  acetolactate synthase, mitochondrial precurs...   207    4e-52
gb|EGC40934.1|  acetolactate synthase [Ajellomyces capsulatus ...   207    4e-52
ref|YP_002937754.1|  acetolactate synthase, large subunit, bio...   207    4e-52
ref|ZP_07051179.1|  acetolactate synthase large subunit [Lysin...   207    5e-52
ref|YP_001644574.1|  acetolactate synthase 3 catalytic subunit...   207    5e-52
emb|CBK94695.1|  acetolactate synthase, large subunit, biosynt...   207    5e-52
ref|YP_651553.1|  acetolactate synthase catalytic subunit [Yer...   207    5e-52
ref|ZP_04174088.1|  hypothetical protein bcere0030_17370 [Baci...   207    5e-52
ref|YP_446250.1|  acetolactate synthase, large subunit, biosyn...   207    5e-52
ref|YP_070731.1|  acetolactate synthase catalytic subunit [Yer...   207    5e-52
ref|YP_002140959.1|  acetolactate synthase 3 catalytic subunit...   207    5e-52
gb|AAK83371.1|  acetolactate synthase Ilv2 [Cryptococcus neofo...   207    5e-52
ref|ZP_05224126.1|  acetolactate synthase 1 catalytic subunit ...   207    5e-52
ref|YP_706419.1|  acetolactate synthase 1 catalytic subunit [R...   207    5e-52
sp|Q6SSJ3.1|ILVB_CRYNV  RecName: Full=Acetolactate synthase, m...   207    5e-52
ref|ZP_00740942.1|  Acetolactate synthase large subunit [Bacil...   207    5e-52
ref|YP_001736021.1|  acetolactate synthase 3 catalytic subunit...   206    5e-52
ref|ZP_05969519.1|  hypothetical protein ENTCAN_08130 [Enterob...   206    6e-52
ref|ZP_06013676.1|  acetolactate synthase [Klebsiella pneumoni...   206    6e-52
ref|YP_001337724.1|  acetolactate synthase catalytic subunit [...   206    6e-52
gb|EEH04904.1|  acetolactate synthase [Ajellomyces capsulatus ...   206    6e-52
ref|YP_001408223.1|  acetolactate synthase 3 catalytic subunit...   206    6e-52
ref|ZP_02084769.1|  hypothetical protein CLOBOL_02299 [Clostri...   206    6e-52
gb|AAS73040.1|  predicted acetolactate synthase III large subu...   206    6e-52
ref|YP_002921928.1|  acetolactate synthase catalytic subunit [...   206    6e-52
ref|YP_001174766.1|  acetolactate synthase catalytic subunit [...   206    6e-52
ref|YP_002874723.1|  acetolactate synthase 3 catalytic subunit...   206    6e-52
ref|XP_002559434.1|  Pc13g10120 [Penicillium chrysogenum Wisco...   206    6e-52
ref|YP_001930430.1|  acetolactate synthase, large subunit, bio...   206    6e-52
ref|ZP_04584533.1|  acetolactate synthase, large subunit, bios...   206    6e-52
ref|YP_288672.1|  acetolactate synthase 1 catalytic subunit [T...   206    6e-52
ref|YP_004154862.1|  acetolactate synthase, large subunit, bio...   206    6e-52
ref|ZP_04671373.1|  conserved hypothetical protein [Clostridia...   206    6e-52
ref|ZP_06008726.1|  acetolactate synthase 3 catalytic subunit ...   206    6e-52

ALIGNMENTS
>ref|ZP_05069586.1| acetolactate synthase, large subunit, biosynthetic type [Candidatus 
Pelagibacter sp. HTCC7211]
 gb|EDZ60585.1| acetolactate synthase, large subunit, biosynthetic type [Candidatus 
Pelagibacter sp. HTCC7211]
Length=588

 Score =  320 bits (819),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 148/164 (91%), Positives = 157/164 (96%), Gaps = 0/164 (0%)

Query  4    MSKLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAE  63
            M KLY+GAEIVFKCLEDQ VE+IFGYPGGAVLPIYDELKNH  IKHILVRHEQGAGHAAE
Sbjct  1    MPKLYTGAEIVFKCLEDQKVEHIFGYPGGAVLPIYDELKNHSSIKHILVRHEQGAGHAAE  60

Query  64   GYARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTT  123
            GYARSSGKPGVVLVTSGPGATN VTALTDAYMDS+PLVCISGQVPTHLIGTDAFQECDTT
Sbjct  61   GYARSSGKPGVVLVTSGPGATNVVTALTDAYMDSVPLVCISGQVPTHLIGTDAFQECDTT  120

Query  124  GITRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            GITRPCTKHNWLVKD+ DLS ++H+AF+VATTGRPGPVL+DIPK
Sbjct  121  GITRPCTKHNWLVKDINDLSNVMHEAFKVATTGRPGPVLIDIPK  164


>ref|YP_265431.1| acetolactate synthase 3 catalytic subunit [Candidatus Pelagibacter 
ubique HTCC1062]
 gb|AAZ20828.1| acetolactate synthase large subunit (ALS III) [Candidatus Pelagibacter 
ubique HTCC1062]
Length=588

 Score =  320 bits (819),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 150/164 (92%), Positives = 157/164 (96%), Gaps = 0/164 (0%)

Query  4    MSKLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAE  63
            M KLYSGAEIVFKCLEDQ VE+IFGYPGGAVLPIYDELKNH  IKHILVRHEQGAGHAAE
Sbjct  1    MPKLYSGAEIVFKCLEDQKVEHIFGYPGGAVLPIYDELKNHPTIKHILVRHEQGAGHAAE  60

Query  64   GYARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTT  123
            GYARS+GKPGVVLVTSGPGATN VTALTDAYMDS+PLVCISGQVPTHLIGTDAFQECDTT
Sbjct  61   GYARSTGKPGVVLVTSGPGATNVVTALTDAYMDSVPLVCISGQVPTHLIGTDAFQECDTT  120

Query  124  GITRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            GITRPCTKHNWLVKD+ DL +I+H+AFEVATTGRPGPVLVDIPK
Sbjct  121  GITRPCTKHNWLVKDINDLPRIMHEAFEVATTGRPGPVLVDIPK  164


>ref|ZP_01264833.1| acetolactate synthase III large subunit [Candidatus Pelagibacter 
ubique HTCC1002]
 gb|EAS85320.1| acetolactate synthase III large subunit [Candidatus Pelagibacter 
ubique HTCC1002]
Length=588

 Score =  319 bits (818),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 150/164 (92%), Positives = 157/164 (96%), Gaps = 0/164 (0%)

Query  4    MSKLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAE  63
            M KLYSGAEIVFKCLEDQ VE+IFGYPGGAVLPIYDELKNH  IKHILVRHEQGAGHAAE
Sbjct  1    MPKLYSGAEIVFKCLEDQKVEHIFGYPGGAVLPIYDELKNHPTIKHILVRHEQGAGHAAE  60

Query  64   GYARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTT  123
            GYARS+GKPGVVLVTSGPGATN VTALTDAYMDS+PLVCISGQVPTHLIGTDAFQECDTT
Sbjct  61   GYARSTGKPGVVLVTSGPGATNVVTALTDAYMDSVPLVCISGQVPTHLIGTDAFQECDTT  120

Query  124  GITRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            GITRPCTKHNWLVKD+ DL +I+H+AFEVATTGRPGPVLVDIPK
Sbjct  121  GITRPCTKHNWLVKDINDLPRIMHEAFEVATTGRPGPVLVDIPK  164


>gb|ABZ06607.1| putative Thiamine pyrophosphate enzyme, N-terminal TPP-binding 
domain protein [uncultured marine microorganism HF4000_133G03]
Length=590

 Score =  311 bits (797),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 156/164 (96%), Gaps = 0/164 (0%)

Query  4    MSKLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAE  63
            M KL +GAE+VFK LEDQ V +IFGYPGGAVLPIYDELKNH++IKHILVRHEQGAGHAAE
Sbjct  1    MGKLMTGAEMVFKALEDQGVRHIFGYPGGAVLPIYDELKNHKKIKHILVRHEQGAGHAAE  60

Query  64   GYARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTT  123
            GYARSSGKPGV+LVTSGPGATN VTALTDAYMDS+PLVCI+GQVPTHLIGTDAFQECDTT
Sbjct  61   GYARSSGKPGVILVTSGPGATNTVTALTDAYMDSVPLVCITGQVPTHLIGTDAFQECDTT  120

Query  124  GITRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            GITRPCTKHNWLVKD++ LS I+HKAFEVAT+GRPGPVLVDIPK
Sbjct  121  GITRPCTKHNWLVKDIEKLSSILHKAFEVATSGRPGPVLVDIPK  164


>ref|ZP_06055313.1| acetolactate synthase, large subunit, biosynthetic type [alpha 
proteobacterium HIMB114]
 gb|EEY75082.1| acetolactate synthase, large subunit, biosynthetic type [alpha 
proteobacterium HIMB114]
Length=586

 Score =  290 bits (743),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 135/164 (83%), Positives = 149/164 (91%), Gaps = 0/164 (0%)

Query  4    MSKLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAE  63
            MS+  +GAEIVFK L +  V++IFGYPGGAVLP+YD++   + IKHILVRHEQGAGHAAE
Sbjct  1    MSEQLTGAEIVFKALNEHGVDHIFGYPGGAVLPLYDQISKEKNIKHILVRHEQGAGHAAE  60

Query  64   GYARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTT  123
            GYARSSGKPG+ LVTSGPGATN VTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTT
Sbjct  61   GYARSSGKPGIALVTSGPGATNMVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTT  120

Query  124  GITRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            GITRPCTKHNWLVKDV  L++IIHKAF +AT+GRPGPVLVDIPK
Sbjct  121  GITRPCTKHNWLVKDVNQLAEIIHKAFHIATSGRPGPVLVDIPK  164


>ref|ZP_07025080.1| acetolactate synthase, large subunit, biosynthetic type [Afipia 
sp. 1NLS2]
 gb|EFI52222.1| acetolactate synthase, large subunit, biosynthetic type [Afipia 
sp. 1NLS2]
Length=592

 Score =  275 bits (703),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/163 (78%), Positives = 145/163 (89%), Gaps = 0/163 (0%)

Query  5    SKLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAEG  64
            S+  +GA +V + L+D  +++IFGYPGGAVLPIYDE+   + ++HILVRHEQGAGHAAEG
Sbjct  9    SRQMTGAAMVVQALKDHSIQHIFGYPGGAVLPIYDEIFQQDAVQHILVRHEQGAGHAAEG  68

Query  65   YARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTTG  124
            YARS+GKPGV LVTSGPGATN VTALTDA MDSIPLVCI+GQVPTHLIG DAFQECDT G
Sbjct  69   YARSTGKPGVALVTSGPGATNMVTALTDALMDSIPLVCITGQVPTHLIGNDAFQECDTVG  128

Query  125  ITRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            ITRPCTKHNWLV+DV DL+KI+H+AF VATTGRPGPV+VDIPK
Sbjct  129  ITRPCTKHNWLVRDVNDLAKILHEAFYVATTGRPGPVVVDIPK  171


>ref|ZP_07661127.1| acetolactate synthase, large subunit, biosynthetic type [Roseibium 
sp. TrichSKD4]
 gb|EFO30889.1| acetolactate synthase, large subunit, biosynthetic type [Roseibium 
sp. TrichSKD4]
Length=591

 Score =  275 bits (703),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/164 (79%), Positives = 148/164 (91%), Gaps = 0/164 (0%)

Query  4    MSKLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAE  63
            M++  +GAE+V + L+DQ V+ IFGYPGGAVLPIYDE+   E ++HILVRHEQGAGHAAE
Sbjct  1    MTREMTGAEMVIQALKDQGVDTIFGYPGGAVLPIYDEIIQQEGLEHILVRHEQGAGHAAE  60

Query  64   GYARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTT  123
            GYARS+GKPGVVLVTSGPGATN VTALTDA +DSIPLVCI+GQVPT LIG+DAFQECDT 
Sbjct  61   GYARSTGKPGVVLVTSGPGATNMVTALTDALLDSIPLVCITGQVPTQLIGSDAFQECDTV  120

Query  124  GITRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            GITRPCTKHNWLVKDV+DL +I+H+AF VAT+GRPGPV+VDIPK
Sbjct  121  GITRPCTKHNWLVKDVEDLPRILHEAFYVATSGRPGPVVVDIPK  164


>ref|ZP_01546242.1| acetolactate synthase III large subunit [Stappia aggregata IAM 
12614]
 gb|EAV45453.1| acetolactate synthase III large subunit [Stappia aggregata IAM 
12614]
Length=591

 Score =  274 bits (701),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/164 (79%), Positives = 146/164 (90%), Gaps = 0/164 (0%)

Query  4    MSKLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAE  63
            M++  +GAE+V + L+DQ V+ IFGYPGGAVLPIYDE+   E ++HILVRHEQGAGHAAE
Sbjct  1    MTREMTGAEMVIQALKDQGVDTIFGYPGGAVLPIYDEIIQQEGLEHILVRHEQGAGHAAE  60

Query  64   GYARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTT  123
            GYARS+GKPGV LVTSGPGATN VTALTDA +DSIPLVCISGQVPTHLIG DAFQECDT 
Sbjct  61   GYARSTGKPGVALVTSGPGATNMVTALTDAMLDSIPLVCISGQVPTHLIGNDAFQECDTV  120

Query  124  GITRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            GITRPCTKHNWLV+DV DL +I+H+AF VAT+GRPGPV+VDIPK
Sbjct  121  GITRPCTKHNWLVRDVDDLPRILHEAFYVATSGRPGPVVVDIPK  164


>ref|ZP_02166090.1| acetolactate synthase III large subunit [Hoeflea phototrophica 
DFL-43]
 gb|EDQ33693.1| acetolactate synthase III large subunit [Hoeflea phototrophica 
DFL-43]
Length=591

 Score =  274 bits (701),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 143/164 (88%), Gaps = 0/164 (0%)

Query  4    MSKLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAE  63
            M    +GAE+V + L+D  VE+IFGYPGGAVLPIYDEL   + I+HILVRHEQGAGH AE
Sbjct  4    MEMEMTGAEMVLQALKDNGVEHIFGYPGGAVLPIYDELHQQDAIEHILVRHEQGAGHMAE  63

Query  64   GYARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTT  123
            GYARS+GKPGVVLVTSGPGATN VTAL DA MDSIPLVCI+GQVPT LIG+DAFQECDT 
Sbjct  64   GYARSTGKPGVVLVTSGPGATNVVTALQDALMDSIPLVCITGQVPTSLIGSDAFQECDTV  123

Query  124  GITRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            GITRPCTKHNWLVKDV  LS+IIH+AF +ATTGRPGPV+VDIPK
Sbjct  124  GITRPCTKHNWLVKDVNQLSRIIHEAFRIATTGRPGPVVVDIPK  167


>ref|YP_002288287.1| large subunit of acetolactate synthase [Oligotropha carboxidovorans 
OM5]
 gb|ACI92422.1| large subunit of acetolactate synthase [Oligotropha carboxidovorans 
OM5]
Length=592

 Score =  273 bits (699),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 145/163 (89%), Gaps = 0/163 (0%)

Query  5    SKLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAEG  64
            S+  +GA +V + L+D  +++IFGYPGGAVLPIYDE+   + ++HILVRHEQGAGHAAEG
Sbjct  9    SRQMTGAAMVVQALKDHGIQHIFGYPGGAVLPIYDEIFQQDTVQHILVRHEQGAGHAAEG  68

Query  65   YARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTTG  124
            YARS+GKPGV LVTSGPGATN VTALTDA MDSIPL+CI+GQVPTHLIG DAFQECDT G
Sbjct  69   YARSTGKPGVALVTSGPGATNMVTALTDALMDSIPLICITGQVPTHLIGNDAFQECDTVG  128

Query  125  ITRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            ITRPCTKHNWLV+DV DL+KI+H+AF VATTGRPGPV+VDIPK
Sbjct  129  ITRPCTKHNWLVRDVNDLAKILHEAFYVATTGRPGPVVVDIPK  171


>ref|ZP_05115112.1| acetolactate synthase, large subunit, biosynthetic type [Labrenzia 
alexandrii DFL-11]
 gb|EEE45711.1| acetolactate synthase, large subunit, biosynthetic type [Labrenzia 
alexandrii DFL-11]
Length=591

 Score =  273 bits (697),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 146/164 (90%), Gaps = 0/164 (0%)

Query  4    MSKLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAE  63
            M++  +GAE+V + L+DQ V+ IFGYPGGAVLPIYDE+   + ++HILVRHEQGAGHAAE
Sbjct  1    MTREMTGAEMVIQALKDQGVDTIFGYPGGAVLPIYDEIIQQDGLEHILVRHEQGAGHAAE  60

Query  64   GYARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTT  123
            GYARS+GKPGV LVTSGPGATN VTALTDA +DSIPLVCISGQVPTHLIG DAFQECDT 
Sbjct  61   GYARSTGKPGVALVTSGPGATNMVTALTDAMLDSIPLVCISGQVPTHLIGNDAFQECDTV  120

Query  124  GITRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            GITRPCTKHNWLV++V DL +I+H+AF VAT+GRPGPV+VDIPK
Sbjct  121  GITRPCTKHNWLVRNVDDLPRILHEAFYVATSGRPGPVVVDIPK  164


>ref|ZP_07476880.1| acetolactate synthase, large subunit, biosynthetic type [Brucella 
sp. BO1]
 gb|EFM57101.1| acetolactate synthase, large subunit, biosynthetic type [Brucella 
sp. BO1]
Length=607

 Score =  270 bits (691),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 143/159 (90%), Gaps = 0/159 (0%)

Query  9    SGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAEGYARS  68
            +GAE+V + L DQ VE IFGYPGGAVLPIYDEL   ++I+H+LVRHEQGAGHAAEGYARS
Sbjct  25   TGAEMVIQALIDQGVESIFGYPGGAVLPIYDELFQQDQIQHVLVRHEQGAGHAAEGYARS  84

Query  69   SGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTTGITRP  128
            +GK GV+LVTSGPGATNAVT L DA MDSIPLVCISGQVPT LIG+DAFQECDT GITRP
Sbjct  85   TGKVGVMLVTSGPGATNAVTPLQDALMDSIPLVCISGQVPTTLIGSDAFQECDTIGITRP  144

Query  129  CTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            CTKHNWLVKDV DLS+I+H+AF VA+TGRPGPV+VDIPK
Sbjct  145  CTKHNWLVKDVNDLSRILHEAFHVASTGRPGPVVVDIPK  183




b)BLASTp versus swissport, NCBI default parameters apart from "Number of descriptions=1000"

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q89AP7.1|ILVI_BUCBP  RecName: Full=Acetolactate synthase la...   225    8e-59
sp|Q9RQ65.1|ILVI_BUCSC  RecName: Full=Acetolactate synthase la...   223    6e-58
sp|O85293.1|ILVI_BUCAP  RecName: Full=Acetolactate synthase la...   218    1e-56
sp|P57321.1|ILVI_BUCAI  RecName: Full=Acetolactate synthase la...   217    3e-56
sp|P07342.1|ILVB_YEAST  RecName: Full=Acetolactate synthase ca...   215    1e-55
sp|P45261.1|ILVI_HAEIN  RecName: Full=Acetolactate synthase la...   214    2e-55
sp|P37251.4|ILVB_BACSU  RecName: Full=Acetolactate synthase la...   211    2e-54
sp|P00893.2|ILVI_ECOLI  RecName: Full=Acetolactate synthase is...   210    4e-54
sp|P40811.3|ILVI_SALTY  RecName: Full=Acetolactate synthase is...   207    2e-53
sp|Q6SSJ3.1|ILVB_CRYNV  RecName: Full=Acetolactate synthase, m...   207    3e-53
sp|Q5KPJ5.1|ILVB_CRYNE  RecName: Full=Acetolactate synthase, m...   206    6e-53
sp|P08142.1|ILVB_ECOLI  RecName: Full=Acetolactate synthase is...   205    1e-52
sp|P0A622.1|ILVB1_MYCTU  RecName: Full=Acetolactate synthase l...   201    1e-51
sp|O33112.1|ILVB_MYCLE  RecName: Full=Acetolactate synthase; A...   201    2e-51
sp|P17597.1|ILVB_ARATH  RecName: Full=Acetolactate synthase, c...   199    8e-51
sp|P27818.1|ILVB1_BRANA  RecName: Full=Acetolactate synthase 1...   199    8e-51
sp|P27819.1|ILVB3_BRANA  RecName: Full=Acetolactate synthase 3...   199    9e-51
sp|P42463.1|ILVB_CORGL  RecName: Full=Acetolactate synthase la...   197    2e-50
sp|P36620.2|ILVB_SCHPO  RecName: Full=Acetolactate synthase, m...   197    2e-50
sp|P27868.1|ILVB_SPIPL  RecName: Full=Acetolactate synthase; A...   196    4e-50
sp|O78518.1|ILVB_GUITH  RecName: Full=Acetolactate synthase la...   192    5e-49
sp|Q7U5G1.1|ILVB_SYNPX  RecName: Full=Acetolactate synthase la...   192    1e-48
sp|Q59498.1|ILVB_MYCAV  RecName: Full=Acetolactate synthase; A...   190    4e-48
sp|P00892.3|ILVG_ECOLI  RecName: Full=Acetolactate synthase is...   189    7e-48
sp|Q02137.2|ILVB_LACLA  RecName: Full=Acetolactate synthase la...   189    8e-48
sp|Q7XKQ8.2|ILVB2_ORYSJ  RecName: Full=Probable acetolactate s...   187    2e-47
sp|Q1XDF6.1|ILVB_PORYE  RecName: Full=Acetolactate synthase la...   187    2e-47
sp|P14874.1|ILVB2_BRANA  RecName: Full=Acetolactate synthase 2...   186    6e-47
sp|P69683.1|ILVB_PORPU  RecName: Full=Acetolactate synthase la...   183    5e-46
sp|P09114.1|ILVB2_TOBAC  RecName: Full=Acetolactate synthase 2...   182    8e-46
sp|P09342.1|ILVB1_TOBAC  RecName: Full=Acetolactate synthase 1...   182    9e-46
sp|Q41768.1|ILVB1_MAIZE  RecName: Full=Acetolactate synthase 1...   181    1e-45
sp|Q6K2E8.1|ILVB1_ORYSJ  RecName: Full=Acetolactate synthase 1...   181    2e-45
sp|Q57725.1|ILVB_METJA  RecName: Full=Probable acetolactate sy...   178    1e-44
sp|Q41769.1|ILVB2_MAIZE  RecName: Full=Acetolactate synthase 2...   178    1e-44
sp|O08353.1|ILVB_METAO  RecName: Full=Probable acetolactate sy...   175    9e-44
sp|O19929.1|ILVB_CYACA  RecName: Full=Acetolactate synthase la...   164    2e-40
sp|O05031.1|Y737_HAEIN  RecName: Full=Putative uncharacterized...   149    1e-35
sp|P0AEP8.2|GCL_ECO57  RecName: Full=Glyoxylate carboligase; A...   136    6e-32
sp|Q04789.3|ILVX_BACSU  RecName: Full=Acetolactate synthase; A...   114    3e-25
sp|Q6DDK5.1|ILVBL_XENLA  RecName: Full=Acetolactate synthase-l...   100    4e-21
sp|O61856.2|ILVBL_CAEEL  RecName: Full=Acetolactate synthase-l...   100    5e-21
sp|Q6NV04.1|ILVBL_DANRE  RecName: Full=Acetolactate synthase-l...  99.0    1e-20
sp|P27696.1|ILVB_KLEPN  RecName: Full=Acetolactate synthase, c...  96.7    5e-20
sp|Q04524.1|ILVB_KLETE  RecName: Full=Acetolactate synthase, c...  95.1    2e-19
sp|Q58077.1|Y663_METJA  RecName: Full=Uncharacterized protein ...  94.4    3e-19
sp|Q9QXE0.2|HACL1_MOUSE  RecName: Full=2-hydroxyacyl-CoA lyase...  94.0    3e-19
sp|Q8CHM7.1|HACL1_RAT  RecName: Full=2-hydroxyacyl-CoA lyase 1...  93.2    6e-19
sp|A1L0T0.2|ILVBL_HUMAN  RecName: Full=Acetolactate synthase-l...  91.7    2e-18
sp|Q93PS3.1|XSC_DESTI  RecName: Full=Sulfoacetaldehyde acetylt...  91.7    2e-18
sp|Q9UJ83.2|HACL1_HUMAN  RecName: Full=2-hydroxyacyl-CoA lyase...  91.7    2e-18
sp|Q9LF46.1|HACL_ARATH  RecName: Full=2-hydroxyacyl-CoA lyase;...  89.7    6e-18
sp|A6QQT9.2|ILVBL_BOVIN  RecName: Full=Acetolactate synthase-l...  88.6    1e-17
sp|Q8BU33.1|ILVBL_MOUSE  RecName: Full=Acetolactate synthase-l...  88.6    2e-17
sp|P40149.1|OXC_OXAFO  RecName: Full=Oxalyl-CoA decarboxylase      86.3    8e-17
sp|Q54DA9.1|HACL1_DICDI  RecName: Full=Probable 2-hydroxyacyl-...  85.9    9e-17
sp|Q54970.2|POXB_STRPN  RecName: Full=Pyruvate oxidase; AltNam...  85.9    1e-16
sp|P66947.1|ILVG_MYCBO  RecName: Full=Probable acetolactate sy...  85.1    2e-16
sp|P0AFI1.1|OXC_ECO57  RecName: Full=Probable oxalyl-CoA decar...  82.0    1e-15
sp|Q92UW6.1|XSC_RHIME  RecName: Full=Probable sulfoacetaldehyd...  78.6    1e-14
sp|Q84H44.3|XSC_ALCDF  RecName: Full=Sulfoacetaldehyde acetylt...  77.4    3e-14
sp|P37063.3|POXB_LACPL  RecName: Full=Pyruvate oxidase; AltNam...  77.4    3e-14
sp|Q84H41.3|XSC_ALCXX  RecName: Full=Sulfoacetaldehyde acetylt...  75.5    1e-13
sp|P20906.2|MDLC_PSEPU  RecName: Full=Benzoylformate decarboxy...  73.9    4e-13
sp|P96591.1|YDAP_BACSU  RecName: Full=Putative thiamine pyroph...  72.0    2e-12
sp|O06335.1|ILVB2_MYCTU  RecName: Full=Putative acetolactate s...  69.3    1e-11
sp|Q2LXE3.2|MEND_SYNAS  RecName: Full=2-succinyl-5-enolpyruvyl...  69.3    1e-11
sp|Q9HUR2.1|MDLC_PSEAE  RecName: Full=Benzoylformate decarboxy...  65.9    1e-10
sp|B3EG68.1|MEND_CHLL2  RecName: Full=2-succinyl-5-enolpyruvyl...  65.5    1e-10
sp|A1BI74.1|MEND_CHLPD  RecName: Full=2-succinyl-5-enolpyruvyl...  64.7    2e-10
sp|P10343.1|YI42_PSEAY  RecName: Full=Uncharacterized 42.6 kDa...  60.5    5e-09
sp|P07003.1|POXB_ECOLI  RecName: Full=Pyruvate dehydrogenase [...  60.1    6e-09
sp|Q1AS21.1|MEND_RUBXD  RecName: Full=2-succinyl-5-enolpyruvyl...  59.7    7e-09
sp|P51846.1|PDC2_TOBAC  RecName: Full=Pyruvate decarboxylase i...  58.9    1e-08
sp|O53554.1|ILVX_MYCTU  RecName: Full=Putative acetolactate sy...  58.5    2e-08
sp|Q0HPY8.1|MEND_SHESR  RecName: Full=2-succinyl-5-enolpyruvyl...  58.2    2e-08
sp|P39994.1|YEC0_YEAST  RecName: Full=Putative 2-hydroxyacyl-C...  57.0    4e-08
sp|Q89YN0.1|MEND_BACTN  RecName: Full=2-succinyl-5-enolpyruvyl...  57.0    5e-08
sp|P51852.1|DCIP_AZOBR  RecName: Full=Indole-3-pyruvate decarb...  57.0    5e-08
sp|Q8FSB6.2|MEND_COREF  RecName: Full=2-succinyl-5-enolpyruvyl...  56.2    8e-08
sp|A3QJ17.1|MEND_SHELP  RecName: Full=2-succinyl-5-enolpyruvyl...  56.2    9e-08
sp|B4S4J4.1|MEND_PROA2  RecName: Full=2-succinyl-5-enolpyruvyl...  55.8    1e-07
sp|Q8E8T4.1|MEND_SHEON  RecName: Full=2-succinyl-5-enolpyruvyl...  55.8    1e-07
sp|Q3IQZ0.1|MEND_NATPD  RecName: Full=2-succinyl-5-enolpyruvyl...  55.1    2e-07
sp|A4QBE1.1|MEND_CORGB  RecName: Full=2-succinyl-5-enolpyruvyl...  55.1    2e-07
sp|Q0HDN7.1|MEND_SHESM  RecName: Full=2-succinyl-5-enolpyruvyl...  55.1    2e-07
sp|A0L2B4.1|MEND_SHESA  RecName: Full=2-succinyl-5-enolpyruvyl...  55.1    2e-07
sp|B4SET5.1|MEND_PELPB  RecName: Full=2-succinyl-5-enolpyruvyl...  54.7    2e-07
sp|A9KU65.1|MEND_SHEB9  RecName: Full=2-succinyl-5-enolpyruvyl...  54.7    2e-07
sp|A6WTY4.1|MEND_SHEB8  RecName: Full=2-succinyl-5-enolpyruvyl...  54.7    2e-07
sp|A3CYZ9.1|MEND_SHEB5  RecName: Full=2-succinyl-5-enolpyruvyl...  54.7    2e-07
sp|A8FPR6.1|MEND_SHESH  RecName: Full=2-succinyl-5-enolpyruvyl...  54.7    2e-07
sp|Q9CBD6.1|KDC_MYCLE  RecName: Full=Alpha-keto-acid decarboxy...  54.7    3e-07
sp|B1KM97.1|MEND_SHEWM  RecName: Full=2-succinyl-5-enolpyruvyl...  54.3    3e-07
sp|A0JZP6.1|MEND_ARTS2  RecName: Full=2-succinyl-5-enolpyruvyl...  53.9    4e-07
sp|B3QL00.1|MEND_CHLP8  RecName: Full=2-succinyl-5-enolpyruvyl...  53.9    4e-07
sp|A9WB45.1|MEND_CHLAA  RecName: Full=2-succinyl-5-enolpyruvyl...  53.9    4e-07
sp|C5B7I2.1|MEND_EDWI9  RecName: Full=2-succinyl-5-enolpyruvyl...  53.5    5e-07
sp|A1SBA6.1|MEND_SHEAM  RecName: Full=2-succinyl-5-enolpyruvyl...  53.5    5e-07
sp|Q8D820.1|MEND_VIBVU  RecName: Full=2-succinyl-5-enolpyruvyl...  53.5    6e-07
sp|A1RPV7.1|MEND_SHESW  RecName: Full=2-succinyl-5-enolpyruvyl...  53.1    7e-07
sp|A4Y259.1|MEND_SHEPC  RecName: Full=2-succinyl-5-enolpyruvyl...  53.1    7e-07
sp|A6LB35.1|MEND_PARD8  RecName: Full=2-succinyl-5-enolpyruvyl...  53.1    7e-07
sp|A9WRT6.1|MEND_RENSM  RecName: Full=2-succinyl-5-enolpyruvyl...  52.8    8e-07
sp|A0PL16.1|KDC_MYCUA  RecName: Full=Alpha-keto-acid decarboxy...  52.8    8e-07
sp|Q3B612.1|MEND_PELLD  RecName: Full=2-succinyl-5-enolpyruvyl...  52.8    8e-07
sp|A0KFN8.1|MEND_AERHH  RecName: Full=2-succinyl-5-enolpyruvyl...  52.8    9e-07
sp|A4SS26.1|MEND_AERS4  RecName: Full=2-succinyl-5-enolpyruvyl...  52.8    9e-07
sp|A0R480.1|KDC_MYCS2  RecName: Full=Alpha-keto-acid decarboxy...  52.8    1e-06
sp|A0QBE6.2|KDC_MYCA1  RecName: Full=Alpha-keto-acid decarboxy...  52.4    1e-06
sp|Q742Q2.1|KDC_MYCPA  RecName: Full=Alpha-keto-acid decarboxy...  52.4    1e-06
sp|A2YQ76.2|PDC3_ORYSI  RecName: Full=Pyruvate decarboxylase i...  52.4    1e-06
sp|Q0D3D2.1|PDC3_ORYSJ  RecName: Full=Pyruvate decarboxylase i...  52.4    1e-06
sp|A5YBJ6.2|IOLD_LACCA  RecName: Full=3D-(3,5/4)-trihydroxycyc...  52.0    2e-06
sp|Q9Y7M1.1|YGK4_SCHPO  RecName: Full=Putative 2-hydroxyacyl-C...  51.6    2e-06
sp|Q10XD8.1|MEND_TRIEI  RecName: Full=2-succinyl-5-enolpyruvyl...  51.6    2e-06
sp|P33287.1|PDC_NEUCR  RecName: Full=Pyruvate decarboxylase; A...  51.6    2e-06
sp|Q030P1.1|MEND_LACLS  RecName: Full=2-succinyl-5-enolpyruvyl...  51.6    2e-06
sp|Q10MW3.1|PDC2_ORYSJ  RecName: Full=Pyruvate decarboxylase i...  51.2    2e-06
sp|Q8KBE8.2|MEND_CHLTE  RecName: Full=2-succinyl-5-enolpyruvyl...  51.2    2e-06
sp|A2XFI3.2|PDC2_ORYSI  RecName: Full=Pyruvate decarboxylase i...  51.2    3e-06
sp|Q09737.2|PDC1_SCHPO  RecName: Full=Putative pyruvate decarb...  51.2    3e-06
sp|Q03Y61.1|MEND_LEUMM  RecName: Full=2-succinyl-5-enolpyruvyl...  51.2    3e-06
sp|Q11U88.1|MEND_CYTH3  RecName: Full=2-succinyl-5-enolpyruvyl...  51.2    3e-06
sp|O53865.1|KDC_MYCTU  RecName: Full=Alpha-keto-acid decarboxy...  51.2    3e-06
sp|Q92AY5.1|MEND_LISIN  RecName: Full=2-succinyl-5-enolpyruvyl...  51.2    3e-06
sp|Q2S2V6.1|MEND_SALRD  RecName: Full=2-succinyl-5-enolpyruvyl...  50.8    3e-06
sp|Q7MMF6.1|MEND_VIBVY  RecName: Full=2-succinyl-5-enolpyruvyl...  50.8    3e-06
sp|Q0DHF6.1|PDC1_ORYSJ  RecName: Full=Pyruvate decarboxylase i...  50.4    4e-06
sp|A0AJC9.1|MEND_LISW6  RecName: Full=2-succinyl-5-enolpyruvyl...  50.4    4e-06
sp|Q8Y6K9.1|MEND_LISMO  RecName: Full=2-succinyl-5-enolpyruvyl...  50.4    4e-06
sp|Q089C0.1|MEND_SHEFN  RecName: Full=2-succinyl-5-enolpyruvyl...  50.4    4e-06
sp|Q71YZ2.1|MEND_LISMF  RecName: Full=2-succinyl-5-enolpyruvyl...  50.4    4e-06
sp|A2Y5L9.1|PDC1_ORYSI  RecName: Full=Pyruvate decarboxylase i...  50.4    4e-06
sp|A9MJB6.1|MEND_SALAR  RecName: Full=2-succinyl-5-enolpyruvyl...  50.4    4e-06
sp|A9GFL5.2|MEND_SORC5  RecName: Full=2-succinyl-5-enolpyruvyl...  50.4    5e-06
sp|B0TNX0.1|MEND_SHEHH  RecName: Full=2-succinyl-5-enolpyruvyl...  50.4    5e-06
sp|Q55725.1|MEND_SYNY3  RecName: Full=2-succinyl-5-enolpyruvyl...  50.4    5e-06
sp|B1LLL9.1|MEND_ECOSM  RecName: Full=2-succinyl-5-enolpyruvyl...  50.1    6e-06
sp|A7GU91.1|MEND_BACCN  RecName: Full=2-succinyl-5-enolpyruvyl...  50.1    6e-06
sp|Q49WG6.1|MEND_STAS1  RecName: Full=2-succinyl-5-enolpyruvyl...  50.1    6e-06
sp|B5XNX0.1|MEND_KLEP3  RecName: Full=2-succinyl-5-enolpyruvyl...  49.7    7e-06
sp|A6TBV8.1|MEND_KLEP7  RecName: Full=2-succinyl-5-enolpyruvyl...  49.7    7e-06
sp|Q8DMI6.1|MEND_THEEB  RecName: Full=2-succinyl-5-enolpyruvyl...  49.7    8e-06
sp|A2RM73.1|MEND_LACLM  RecName: Full=2-succinyl-5-enolpyruvyl...  49.7    8e-06
sp|A9VM77.1|MEND_BACWK  RecName: Full=2-succinyl-5-enolpyruvyl...  49.7    9e-06
sp|P28516.1|PDC1_MAIZE  RecName: Full=Pyruvate decarboxylase i...  49.3    9e-06
sp|Q07471.1|THI3_YEAST  RecName: Full=Thiamine metabolism regu...  49.3    1e-05
sp|B5RCD4.1|MEND_SALG2  RecName: Full=2-succinyl-5-enolpyruvyl...  49.3    1e-05
sp|Q9P7P6.1|PDC3_SCHPO  RecName: Full=Probable pyruvate decarb...  49.3    1e-05
sp|A8H9P4.2|MEND_SHEPA  RecName: Full=2-succinyl-5-enolpyruvyl...  49.3    1e-05
sp|A7MHU4.1|MEND_ENTS8  RecName: Full=2-succinyl-5-enolpyruvyl...  49.3    1e-05
sp|Q6NJH8.1|MEND_CORDI  RecName: Full=2-succinyl-5-enolpyruvyl...  48.9    1e-05
sp|B4EZ42.1|MEND_PROMH  RecName: Full=2-succinyl-5-enolpyruvyl...  48.9    1e-05
sp|A0M345.1|MEND_GRAFK  RecName: Full=2-succinyl-5-enolpyruvyl...  48.9    1e-05
sp|A4SD60.1|MEND_PROVI  RecName: Full=2-succinyl-5-enolpyruvyl...  48.9    1e-05
sp|Q8CZD8.1|MEND_OCEIH  RecName: Full=2-succinyl-5-enolpyruvyl...  48.9    1e-05
sp|B7K8M6.1|MEND_CYAP7  RecName: Full=2-succinyl-5-enolpyruvyl...  48.9    1e-05
sp|P34734.1|PDC_HANUV  RecName: Full=Pyruvate decarboxylase        48.9    1e-05
sp|P51850.1|PDC1_PEA  RecName: Full=Pyruvate decarboxylase iso...  48.9    1e-05
sp|Q2UKV4.1|PDC_ASPOR  RecName: Full=Pyruvate decarboxylase        48.9    1e-05
sp|A8ADW9.1|MEND_CITK8  RecName: Full=2-succinyl-5-enolpyruvyl...  48.5    2e-05
sp|C0Q059.1|MEND_SALPC  RecName: Full=2-succinyl-5-enolpyruvyl...  48.1    2e-05
sp|B5FPE8.1|MEND_SALDC  RecName: Full=2-succinyl-5-enolpyruvyl...  48.1    2e-05
sp|B4TBH6.1|MEND_SALHS  RecName: Full=2-succinyl-5-enolpyruvyl...  48.1    2e-05
sp|B5EZI8.1|MEND_SALA4  RecName: Full=2-succinyl-5-enolpyruvyl...  48.1    2e-05
sp|A9N5A2.1|MEND_SALPB  RecName: Full=2-succinyl-5-enolpyruvyl...  48.1    2e-05
sp|Q57M47.1|MEND_SALCH  RecName: Full=2-succinyl-5-enolpyruvyl...  48.1    2e-05
sp|Q8ZNE8.1|MEND_SALTY  RecName: Full=2-succinyl-5-enolpyruvyl...  48.1    2e-05
sp|Q8Z533.1|MEND_SALTI  RecName: Full=2-succinyl-5-enolpyruvyl...  48.1    2e-05
sp|Q5PN76.1|MEND_SALPA  RecName: Full=2-succinyl-5-enolpyruvyl...  48.1    2e-05
sp|A4WCP9.1|MEND_ENT38  RecName: Full=2-succinyl-5-enolpyruvyl...  48.1    2e-05
sp|B4TPJ2.1|MEND_SALSV  RecName: Full=2-succinyl-5-enolpyruvyl...  48.1    2e-05
sp|B2V4K0.1|IOLD_CLOBA  RecName: Full=3D-(3,5/4)-trihydroxycyc...  48.1    2e-05
sp|B7LAT0.1|MEND_ECO55  RecName: Full=2-succinyl-5-enolpyruvyl...  48.1    2e-05
sp|B7M5U7.1|MEND_ECO8A  RecName: Full=2-succinyl-5-enolpyruvyl...  48.1    2e-05
sp|B7LM66.1|MEND_ESCF3  RecName: Full=2-succinyl-5-enolpyruvyl...  48.1    2e-05
sp|Q6D7W4.1|MEND_ERWCT  RecName: Full=2-succinyl-5-enolpyruvyl...  48.1    3e-05
sp|B7N5N0.1|MEND_ECOLU  RecName: Full=2-succinyl-5-enolpyruvyl...  47.8    3e-05
sp|B7NNU4.1|MEND_ECO7I  RecName: Full=2-succinyl-5-enolpyruvyl...  47.8    3e-05
sp|Q1R9E9.2|MEND_ECOUT  RecName: Full=2-succinyl-5-enolpyruvyl...  47.8    3e-05
sp|A1ADB6.2|MEND_ECOK1  RecName: Full=2-succinyl-5-enolpyruvyl...  47.8    3e-05
sp|Q31YJ3.1|MEND_SHIBS  RecName: Full=2-succinyl-5-enolpyruvyl...  47.8    3e-05
sp|Q3YZU2.1|MEND_SHISS  RecName: Full=2-succinyl-5-enolpyruvyl...  47.8    3e-05
sp|Q821B0.4|MEND_SHIFL  RecName: Full=2-succinyl-5-enolpyruvyl...  47.8    3e-05
sp|Q8XDX8.3|MEND_ECO57  RecName: Full=2-succinyl-5-enolpyruvyl...  47.8    3e-05
sp|A7ZP83.1|MEND_ECO24  RecName: Full=2-succinyl-5-enolpyruvyl...  47.8    3e-05
sp|P17109.4|MEND_ECOLI  RecName: Full=2-succinyl-5-enolpyruvyl...  47.8    3e-05
sp|B1HY21.1|MEND_LYSSC  RecName: Full=2-succinyl-5-enolpyruvyl...  47.8    3e-05
sp|B7UFS7.1|MEND_ECO27  RecName: Full=2-succinyl-5-enolpyruvyl...  47.8    3e-05
sp|B2TJ86.1|IOLD_CLOBB  RecName: Full=3D-(3,5/4)-trihydroxycyc...  47.8    3e-05
sp|Q632I2.1|MEND_BACCZ  RecName: Full=2-succinyl-5-enolpyruvyl...  47.8    3e-05
sp|B2TW50.1|MEND_SHIB3  RecName: Full=2-succinyl-5-enolpyruvyl...  47.8    3e-05
sp|Q816H7.1|MEND_BACCR  RecName: Full=2-succinyl-5-enolpyruvyl...  47.8    3e-05
sp|Q6HC26.1|MEND_BACHK  RecName: Full=2-succinyl-5-enolpyruvyl...  47.8    3e-05
sp|Q81K94.1|MEND_BACAN  RecName: Full=2-succinyl-5-enolpyruvyl...  47.8    3e-05
sp|A0RK76.1|MEND_BACAH  RecName: Full=2-succinyl-5-enolpyruvyl...  47.8    3e-05
sp|Q72YK6.1|MEND_BACC1  RecName: Full=2-succinyl-5-enolpyruvyl...  47.8    3e-05
sp|B0UT51.1|MEND_HAES2  RecName: Full=2-succinyl-5-enolpyruvyl...  47.8    3e-05
sp|Q6ARP3.1|MEND_DESPS  RecName: Full=2-succinyl-5-enolpyruvyl...  47.4    4e-05
sp|A1SRV2.1|MEND_PSYIN  RecName: Full=2-succinyl-5-enolpyruvyl...  47.4    4e-05
sp|C6DBP2.1|MEND_PECCP  RecName: Full=2-succinyl-5-enolpyruvyl...  47.4    4e-05
sp|Q47DK0.1|MEND_DECAR  RecName: Full=2-succinyl-5-enolpyruvyl...  47.4    4e-05
sp|P51844.1|PDC_ASPPA  RecName: Full=Pyruvate decarboxylase        47.4    4e-05
sp|A8GGZ1.1|MEND_SERP5  RecName: Full=2-succinyl-5-enolpyruvyl...  47.0    5e-05
sp|Q87R69.1|MEND_VIBPA  RecName: Full=2-succinyl-5-enolpyruvyl...  47.0    5e-05
sp|Q9HQN3.1|MEND_HALSA  RecName: Full=2-succinyl-5-enolpyruvyl...  47.0    5e-05
sp|Q5HH40.1|MEND_STAAC  RecName: Full=2-succinyl-5-enolpyruvyl...  47.0    5e-05
sp|O06421.1|MEND_MYCTU  RecName: Full=2-succinyl-5-enolpyruvyl...  47.0    5e-05
sp|P23234.1|DCIP_ENTCL  RecName: Full=Indole-3-pyruvate decarb...  47.0    6e-05
sp|Q0TFH7.2|MEND_ECOL5  RecName: Full=2-succinyl-5-enolpyruvyl...  46.6    6e-05
sp|Q9CPI4.1|MEND_PASMU  RecName: Full=2-succinyl-5-enolpyruvyl...  46.6    6e-05
sp|Q6GI39.1|MEND_STAAR  RecName: Full=2-succinyl-5-enolpyruvyl...  46.6    6e-05
sp|B1IXS2.1|MEND_ECOLC  RecName: Full=2-succinyl-5-enolpyruvyl...  46.6    6e-05
sp|Q3APX4.1|MEND_CHLCH  RecName: Full=2-succinyl-5-enolpyruvyl...  46.6    6e-05
sp|P87208.2|PDC_EMENI  RecName: Full=Pyruvate decarboxylase        46.6    6e-05
sp|Q5LFS5.1|MEND_BACFN  RecName: Full=2-succinyl-5-enolpyruvyl...  46.6    6e-05
sp|A7MZS0.1|MEND_VIBHB  RecName: Full=2-succinyl-5-enolpyruvyl...  46.6    7e-05
sp|Q5V3T2.2|MEND_HALMA  RecName: Full=2-succinyl-5-enolpyruvyl...  46.6    7e-05
sp|Q4JT09.2|MEND_CORJK  RecName: Full=2-succinyl-5-enolpyruvyl...  46.6    7e-05
sp|Q6GAG9.1|MEND_STAAS  RecName: Full=2-succinyl-5-enolpyruvyl...  46.6    7e-05
sp|Q7A6B1.1|MEND_STAAN  RecName: Full=2-succinyl-5-enolpyruvyl...  46.6    7e-05
sp|Q5E480.2|MEND_VIBF1  RecName: Full=2-succinyl-5-enolpyruvyl...  46.6    7e-05
sp|Q838J9.1|MEND_ENTFA  RecName: Full=2-succinyl-5-enolpyruvyl...  46.6    7e-05
sp|Q4WXX9.1|PDC_ASPFU  RecName: Full=Pyruvate decarboxylase        46.6    7e-05
sp|Q9CBB0.1|MEND_MYCLE  RecName: Full=2-succinyl-5-enolpyruvyl...  46.2    8e-05
sp|Q32DS4.1|MEND_SHIDS  RecName: Full=2-succinyl-5-enolpyruvyl...  46.2    9e-05
sp|Q0CNV1.1|PDC_ASPTN  RecName: Full=Pyruvate decarboxylase        46.2    9e-05
sp|A6H070.1|MEND_FLAPJ  RecName: Full=2-succinyl-5-enolpyruvyl...  46.2    9e-05
sp|A1JKT8.1|MEND_YERE8  RecName: Full=2-succinyl-5-enolpyruvyl...  46.2    1e-04
sp|Q7N2K3.1|MEND_PHOLL  RecName: Full=2-succinyl-5-enolpyruvyl...  46.2    1e-04
sp|Q5KVX6.1|MEND_GEOKA  RecName: Full=2-succinyl-5-enolpyruvyl...  45.8    1e-04
sp|Q06408.1|ARO10_YEAST  RecName: Full=Transaminated amino aci...  45.8    1e-04
sp|B0C1Y1.1|MEND_ACAM1  RecName: Full=2-succinyl-5-enolpyruvyl...  45.8    1e-04
sp|B2HRP6.1|MEND_MYCMM  RecName: Full=2-succinyl-5-enolpyruvyl...  45.8    1e-04
sp|Q0TUZ2.1|IOLD_CLOP1  RecName: Full=3D-(3,5/4)-trihydroxycyc...  45.4    1e-04
sp|Q8XP76.1|IOLD_CLOPE  RecName: Full=3D-(3,5/4)-trihydroxycyc...  45.4    1e-04
sp|Q92345.2|PDC2_SCHPO  RecName: Full=Probable pyruvate decarb...  45.4    2e-04
sp|Q18J11.1|MEND_HALWD  RecName: Full=2-succinyl-5-enolpyruvyl...  45.4    2e-04
sp|Q6MHQ6.1|MEND_BDEBA  RecName: Full=2-succinyl-5-enolpyruvyl...  45.4    2e-04
sp|Q2YX30.1|MEND_STAAB  RecName: Full=2-succinyl-5-enolpyruvyl...  45.4    2e-04
sp|Q47Q20.1|MEND_THEFY  RecName: Full=2-succinyl-5-enolpyruvyl...  45.1    2e-04
sp|Q8CPQ5.2|MEND_STAES  RecName: Full=2-succinyl-5-enolpyruvyl...  45.1    2e-04
sp|Q0I316.1|MEND_HAES1  RecName: Full=2-succinyl-5-enolpyruvyl...  45.1    2e-04
sp|Q7MUI9.1|MEND_PORGI  RecName: Full=2-succinyl-5-enolpyruvyl...  45.1    2e-04
sp|Q4L547.1|MEND_STAHJ  RecName: Full=2-succinyl-5-enolpyruvyl...  45.1    2e-04
sp|Q5N5V7.1|MEND_SYNP6  RecName: Full=2-succinyl-5-enolpyruvyl...  44.7    2e-04
sp|B1MZ27.1|MEND_LEUCK  RecName: Full=2-succinyl-5-enolpyruvyl...  44.7    3e-04
sp|Q5HQC5.2|MEND_STAEQ  RecName: Full=2-succinyl-5-enolpyruvyl...  44.7    3e-04
sp|B7VHY7.1|MEND_VIBSL  RecName: Full=2-succinyl-5-enolpyruvyl...  44.3    3e-04
sp|Q6FJA3.1|PDC1_CANGA  RecName: Full=Pyruvate decarboxylase       44.3    3e-04
sp|Q7VBN8.1|MEND_PROMA  RecName: Full=2-succinyl-5-enolpyruvyl...  44.3    3e-04
sp|B1MHC6.1|MEND_MYCA9  RecName: Full=2-succinyl-5-enolpyruvyl...  44.3    3e-04
sp|A0PLU9.1|MEND_MYCUA  RecName: Full=2-succinyl-5-enolpyruvyl...  44.3    3e-04
sp|Q9KQM3.1|MEND_VIBCH  RecName: Full=2-succinyl-5-enolpyruvyl...  44.3    4e-04
sp|Q5YPA6.1|MEND_NOCFA  RecName: Full=2-succinyl-5-enolpyruvyl...  44.3    4e-04
sp|Q9CHK0.1|MEND_LACLA  RecName: Full=2-succinyl-5-enolpyruvyl...  43.9    4e-04
sp|B0JII8.1|MEND_MICAN  RecName: Full=2-succinyl-5-enolpyruvyl...  43.9    5e-04
sp|A4IS14.1|MEND_GEOTN  RecName: Full=2-succinyl-5-enolpyruvyl...  43.5    5e-04
sp|B2K7Z3.1|MEND_YERPB  RecName: Full=2-succinyl-5-enolpyruvyl...  43.5    5e-04
sp|Q669C7.1|MEND_YERPS  RecName: Full=2-succinyl-5-enolpyruvyl...  43.5    5e-04
sp|A7FGT2.1|MEND_YERP3  RecName: Full=2-succinyl-5-enolpyruvyl...  43.5    5e-04
sp|A4TM08.1|MEND_YERPP  RecName: Full=2-succinyl-5-enolpyruvyl...  43.5    5e-04
sp|Q1CHS9.1|MEND_YERPN  RecName: Full=2-succinyl-5-enolpyruvyl...  43.5    5e-04
sp|A6L313.1|MEND_BACV8  RecName: Full=2-succinyl-5-enolpyruvyl...  43.5    6e-04
sp|A1R996.1|MEND_ARTAT  RecName: Full=2-succinyl-5-enolpyruvyl...  43.1    8e-04
sp|A8FGK9.1|MEND_BACP2  RecName: Full=2-succinyl-5-enolpyruvyl...  42.7    9e-04
sp|Q6AHC2.1|MEND_LEIXX  RecName: Full=2-succinyl-5-enolpyruvyl...  42.7    9e-04
sp|Q2JY06.1|MEND_SYNJA  RecName: Full=2-succinyl-5-enolpyruvyl...  42.7    9e-04
sp|A5GT34.1|MEND_SYNR3  RecName: Full=2-succinyl-5-enolpyruvyl...  42.7    0.001
sp|Q5WKY8.1|IOLD_BACSK  RecName: Full=3D-(3,5/4)-trihydroxycyc...  42.7    0.001
sp|A5FG67.1|MEND_FLAJO  RecName: Full=2-succinyl-5-enolpyruvyl...  42.7    0.001
sp|P26263.3|PDC6_YEAST  RecName: Full=Pyruvate decarboxylase i...  42.4    0.001
sp|P06169.7|PDC1_YEAST  RecName: Full=Pyruvate decarboxylase i...  42.4    0.001
sp|A4IPB6.1|IOLD_GEOTN  RecName: Full=3D-(3,5/4)-trihydroxycyc...  42.4    0.001
sp|Q1D6K1.1|MEND_MYXXD  RecName: Full=2-succinyl-5-enolpyruvyl...  42.4    0.001
sp|A0QRG5.2|MEND_MYCS2  RecName: Full=2-succinyl-5-enolpyruvyl...  42.4    0.001
sp|A5UPB5.1|MEND_ROSS1  RecName: Full=2-succinyl-5-enolpyruvyl...  42.4    0.001
sp|A4FPV1.1|MEND_SACEN  RecName: Full=2-succinyl-5-enolpyruvyl...  42.0    0.001
sp|Q5KYR0.1|IOLD_GEOKA  RecName: Full=3D-(3,5/4)-trihydroxycyc...  42.0    0.002
sp|Q6A9B0.2|MEND_PROAC  RecName: Full=2-succinyl-5-enolpyruvyl...  42.0    0.002
sp|A7NRP8.1|MEND_ROSCS  RecName: Full=2-succinyl-5-enolpyruvyl...  42.0    0.002
sp|A6VMF8.1|MEND_ACTSZ  RecName: Full=2-succinyl-5-enolpyruvyl...  42.0    0.002
sp|P0CH62.1|CHDH_AZOSP  RecName: Full=Cyclohexane-1,2-dione hy...  41.6    0.002
sp|P33149.1|PDC1_KLUMA  RecName: Full=Pyruvate decarboxylase       41.6    0.002
sp|Q3M3Y3.2|MEND_ANAVT  RecName: Full=2-succinyl-5-enolpyruvyl...  41.6    0.002
sp|B9LNE4.1|MEND_HALLT  RecName: Full=2-succinyl-5-enolpyruvyl...  41.6    0.002
sp|Q65RK9.1|MEND_MANSM  RecName: Full=2-succinyl-5-enolpyruvyl...  41.2    0.003
sp|A3N348.1|MEND_ACTP2  RecName: Full=2-succinyl-5-enolpyruvyl...  41.2    0.003
sp|B0BSH8.1|MEND_ACTPJ  RecName: Full=2-succinyl-5-enolpyruvyl...  41.2    0.003
sp|C0ZV17.1|MEND_RHOE4  RecName: Full=2-succinyl-5-enolpyruvyl...  41.2    0.003
sp|P51845.1|PDC1_TOBAC  RecName: Full=Pyruvate decarboxylase i...  40.8    0.003
sp|B3EMZ5.1|MEND_CHLPB  RecName: Full=2-succinyl-5-enolpyruvyl...  40.8    0.003
sp|A2C165.1|MEND_PROM1  RecName: Full=2-succinyl-5-enolpyruvyl...  40.8    0.003
sp|Q46LU3.1|MEND_PROMT  RecName: Full=2-succinyl-5-enolpyruvyl...  40.8    0.003
sp|Q7VKM9.1|MEND_HAEDU  RecName: Full=2-succinyl-5-enolpyruvyl...  40.8    0.003
sp|B0RCZ5.1|MEND_CLAMS  RecName: Full=2-succinyl-5-enolpyruvyl...  40.8    0.004
sp|A5CUV9.1|MEND_CLAM3  RecName: Full=2-succinyl-5-enolpyruvyl...  40.8    0.004
sp|B3GZ01.1|MEND_ACTP7  RecName: Full=2-succinyl-5-enolpyruvyl...  40.8    0.004
sp|A1SE17.1|MEND_NOCSJ  RecName: Full=2-succinyl-5-enolpyruvyl...  40.8    0.004
sp|Q8YZZ2.2|MEND_ANASP  RecName: Full=2-succinyl-5-enolpyruvyl...  40.8    0.004
sp|Q0SF82.1|MEND_RHOSR  RecName: Full=2-succinyl-5-enolpyruvyl...  40.8    0.004
sp|Q12629.2|PDC1_KLULA  RecName: Full=Pyruvate decarboxylase       40.4    0.004
sp|C1AYZ0.1|MEND_RHOOB  RecName: Full=2-succinyl-5-enolpyruvyl...  40.4    0.004
sp|P42415.2|IOLD_BACSU  RecName: Full=3D-(3,5/4)-trihydroxycyc...  40.4    0.005
sp|B1WZR3.1|MEND_CYAA5  RecName: Full=2-succinyl-5-enolpyruvyl...  40.4    0.005
sp|Q2JK10.1|MEND_SYNJB  RecName: Full=2-succinyl-5-enolpyruvyl...  40.4    0.005
sp|A7Z812.1|MEND_BACA2  RecName: Full=2-succinyl-5-enolpyruvyl...  40.0    0.006
sp|B7JPM3.1|IOLD_BACC0  RecName: Full=3D-(3,5/4)-trihydroxycyc...  40.0    0.007
sp|Q81QB5.1|IOLD_BACAN  RecName: Full=3D-(3,5/4)-trihydroxycyc...  40.0    0.007
sp|Q6HIK2.1|IOLD_BACHK  RecName: Full=3D-(3,5/4)-trihydroxycyc...  40.0    0.007
sp|Q4V1F5.1|IOLD2_BACCZ  RecName: Full=3D-(3,5/4)-trihydroxycy...  39.7    0.007
sp|Q63B73.1|IOLD1_BACCZ  RecName: Full=3D-(3,5/4)-trihydroxycy...  39.7    0.007
sp|A0REB6.1|IOLD_BACAH  RecName: Full=3D-(3,5/4)-trihydroxycyc...  39.7    0.007
sp|Q65FT2.1|MEND_BACLD  RecName: Full=2-succinyl-5-enolpyruvyl...  39.7    0.008
sp|A1WW41.1|MEND_HALHL  RecName: Full=2-succinyl-5-enolpyruvyl...  39.7    0.008
sp|A1T3R3.2|MEND_MYCVP  RecName: Full=2-succinyl-5-enolpyruvyl...  39.7    0.009
sp|Q65D03.1|IOLD_BACLD  RecName: Full=3D-(3,5/4)-trihydroxycyc...  39.3    0.010
sp|A3PUH9.1|MEND_MYCSJ  RecName: Full=2-succinyl-5-enolpyruvyl...  39.3    0.010
sp|Q1BE13.1|MEND_MYCSS  RecName: Full=2-succinyl-5-enolpyruvyl...  39.3    0.010
sp|P16467.4|PDC5_YEAST  RecName: Full=Pyruvate decarboxylase i...  39.3    0.010
sp|Q92EQ4.1|IOLD_LISIN  RecName: Full=3D-(3,5/4)-trihydroxycyc...  39.3    0.012
sp|Q7U7I5.1|MEND_SYNPX  RecName: Full=2-succinyl-5-enolpyruvyl...  38.9    0.012
sp|A5GKI2.1|MEND_SYNPW  RecName: Full=2-succinyl-5-enolpyruvyl...  38.9    0.014
sp|A5UAK7.1|MEND_HAEIE  RecName: Full=2-succinyl-5-enolpyruvyl...  38.9    0.015
sp|Q0I9Z1.1|MEND_SYNS3  RecName: Full=2-succinyl-5-enolpyruvyl...  38.5    0.018
sp|B7K0T5.1|MEND_CYAP8  RecName: Full=2-succinyl-5-enolpyruvyl...  38.5    0.018
sp|A4T174.2|MEND_MYCGI  RecName: Full=2-succinyl-5-enolpyruvyl...  38.5    0.018
sp|P23970.3|MEND_BACSU  RecName: Full=2-succinyl-5-enolpyruvyl...  38.5    0.018
sp|Q6LNX3.1|MEND_PHOPR  RecName: Full=2-succinyl-5-enolpyruvyl...  38.1    0.022
sp|A6W5P6.1|MEND_KINRD  RecName: Full=2-succinyl-5-enolpyruvyl...  38.1    0.025
sp|A5UGA0.1|MEND_HAEIG  RecName: Full=2-succinyl-5-enolpyruvyl...  37.7    0.027
sp|Q4QNQ7.1|MEND_HAEI8  RecName: Full=2-succinyl-5-enolpyruvyl...  37.7    0.027
sp|Q8Y9Y1.1|IOLD_LISMO  RecName: Full=3D-(3,5/4)-trihydroxycyc...  37.7    0.032
sp|Q723S8.2|IOLD_LISMF  RecName: Full=3D-(3,5/4)-trihydroxycyc...  37.7    0.033
sp|Q6MCA7.1|MEND_PARUW  RecName: Full=2-succinyl-5-enolpyruvyl...  37.4    0.036
sp|Q73SM1.1|MEND_MYCPA  RecName: Full=2-succinyl-5-enolpyruvyl...  37.4    0.038
sp|P44612.1|MEND_HAEIN  RecName: Full=2-succinyl-5-enolpyruvyl...  37.4    0.043
sp|Q13CJ6.1|PYRE_RHOPS  RecName: Full=Orotate phosphoribosyltr...  37.0    0.054
sp|Q2J1V2.1|PYRE_RHOP2  RecName: Full=Orotate phosphoribosyltr...  36.2    0.077
sp|Q3AVF6.1|MEND_SYNS9  RecName: Full=2-succinyl-5-enolpyruvyl...  36.2    0.081
sp|B2UPN5.1|MEND_AKKM8  RecName: Full=2-succinyl-5-enolpyruvyl...  36.2    0.085
sp|P51853.1|BZNB_PSEFL  RecName: Full=Benzaldehyde lyase; AltN...  35.8    0.12 
sp|Q250I5.1|MEND_DESHY  RecName: Full=2-succinyl-5-enolpyruvyl...  35.0    0.20 
sp|B3QC92.1|PYRE_RHOPT  RecName: Full=Orotate phosphoribosyltr...  34.7    0.27 
sp|Q6N0N8.1|PYRE_RHOPA  RecName: Full=Orotate phosphoribosyltr...  34.7    0.27 
sp|Q9KAG9.1|IOLD_BACHD  RecName: Full=3D-(3,5/4)-trihydroxycyc...  33.9    0.40 
sp|Q3AKK3.1|MEND_SYNSC  RecName: Full=2-succinyl-5-enolpyruvyl...  33.9    0.44 
sp|A2BVS0.1|MEND_PROM5  RecName: Full=2-succinyl-5-enolpyruvyl...  33.9    0.46 
sp|A7ZAH8.1|IOLD_BACA2  RecName: Full=3D-(3,5/4)-trihydroxycyc...  33.5    0.55 
sp|Q20WV6.1|PYRE_RHOPB  RecName: Full=Orotate phosphoribosyltr...  32.7    0.90 
sp|Q7V8E7.1|MEND_PROMM  RecName: Full=2-succinyl-5-enolpyruvyl...  32.7    1.0  
sp|A8G3X3.1|MEND_PROM2  RecName: Full=2-succinyl-5-enolpyruvyl...  32.3    1.1  
sp|A2CAW2.2|MEND_PROM3  RecName: Full=2-succinyl-5-enolpyruvyl...  32.3    1.2  
sp|B0CS49.1|CLP1_LACBS  RecName: Full=Protein CLP1                 32.0    1.7  
sp|Q6NP60.1|MOX12_DROME  RecName: Full=MOXD1 homolog 2             31.6    2.4  
sp|A3PBY1.1|MEND_PROM0  RecName: Full=2-succinyl-5-enolpyruvyl...  31.6    2.4  
sp|Q5FNP1.1|UVRC_GLUOX  RecName: Full=UvrABC system protein C;...  31.2    2.5  
sp|Q31BS7.1|MEND_PROM9  RecName: Full=2-succinyl-5-enolpyruvyl...  31.2    2.6  
sp|P06672.1|PDC_ZYMMO  RecName: Full=Pyruvate decarboxylase; S...  31.2    2.6  
sp|Q05470.3|PKSL_BACSU  RecName: Full=Polyketide synthase PksL...  31.2    2.6  
sp|A9B4J6.1|T23O_HERA2  RecName: Full=Tryptophan 2,3-dioxygena...  31.2    2.6  
sp|A1WFG0.1|CAAL_VEREI  RecName: Full=Carboxylate-amine ligase...  31.2    3.0  
sp|P03975.1|IGEB_MOUSE  RecName: Full=IgE-binding protein          31.2    3.1  
sp|A5EST0.1|PYRE_BRASB  RecName: Full=Orotate phosphoribosyltr...  31.2    3.1  
sp|A2BQ88.1|MEND_PROMS  RecName: Full=2-succinyl-5-enolpyruvyl...  30.0    5.9  
sp|Q5KAM7.1|SEC23_CRYNE  RecName: Full=Protein transport prote...  30.0    5.9  
sp|A4YL97.1|PYRE_BRASO  RecName: Full=Orotate phosphoribosyltr...  30.0    7.0  
sp|Q67A25.1|NCS_THLFG  RecName: Full=S-norcoclaurine synthase;...  29.6    7.9  
sp|C4K1I8.1|UVRC_RICPU  RecName: Full=UvrABC system protein C;...  29.6    8.7  
sp|C3PP03.1|UVRC_RICAE  RecName: Full=UvrABC system protein C;...  29.6    8.7  
sp|Q92HA7.1|UVRC_RICCN  RecName: Full=UvrABC system protein C;...  29.6    8.7  
sp|B0BYA6.1|UVRC_RICRO  RecName: Full=UvrABC system protein C;...  29.6    8.7  
sp|Q12X65.1|GATD_METBU  RecName: Full=Glutamyl-tRNA(Gln) amido...  29.3    9.8  

ALIGNMENTS
>sp|Q89AP7.1|ILVI_BUCBP RecName: Full=Acetolactate synthase large subunit; Short=AHAS; 
AltName: Full=Acetohydroxy-acid synthase large subunit; Short=ALS
Length=576

 Score =  225 bits (574),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 104/162 (65%), Positives = 131/162 (81%), Gaps = 0/162 (0%)

Query  6    KLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAEGY  65
            K+ SG+++V + L DQ ++YIFGYPGGAVL IYD LK    IKHILVRHEQ A H A+GY
Sbjct  2    KMLSGSDMVIRSLIDQGIKYIFGYPGGAVLDIYDSLKQMHGIKHILVRHEQSATHMADGY  61

Query  66   ARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTTGI  125
            AR++GK GVVLVTSGPGATN++T +  AYMDSIPLV ISGQV + LIG DAFQECD  GI
Sbjct  62   ARATGKIGVVLVTSGPGATNSITGIATAYMDSIPLVVISGQVASSLIGYDAFQECDMIGI  121

Query  126  TRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            +RP  KH++LVK+ +D+ KI  KAF +A++GRPGP+++D+PK
Sbjct  122  SRPIVKHSFLVKNTEDIPKIFKKAFWLASSGRPGPIVIDLPK  163


>sp|Q9RQ65.1|ILVI_BUCSC RecName: Full=Acetolactate synthase large subunit; Short=AHAS; 
AltName: Full=Acetohydroxy-acid synthase large subunit; Short=ALS
Length=574

 Score =  223 bits (567),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/162 (63%), Positives = 132/162 (82%), Gaps = 0/162 (0%)

Query  6    KLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAEGY  65
            ++ SG+E++ + L DQ ++YIFGYPGGAVL IYD LK+ ++IKHILVRHEQGA H A+GY
Sbjct  2    EMLSGSEMIIQSLIDQGIKYIFGYPGGAVLDIYDSLKSTKKIKHILVRHEQGATHMADGY  61

Query  66   ARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTTGI  125
            AR++GK GVVLVTSGPGATN++T +  AYMDSIP+V ISGQV + LIG DAFQECD  GI
Sbjct  62   ARATGKIGVVLVTSGPGATNSITGIATAYMDSIPIVVISGQVSSSLIGYDAFQECDMIGI  121

Query  126  TRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            +RP  KH++LVK  +D+     KAF +A++GRPGP+++D+PK
Sbjct  122  SRPIVKHSFLVKKTEDIPITFKKAFWLASSGRPGPIVIDLPK  163


>sp|O85293.1|ILVI_BUCAP RecName: Full=Acetolactate synthase large subunit; Short=AHAS; 
AltName: Full=Acetohydroxy-acid synthase large subunit; Short=ALS
Length=571

 Score =  218 bits (556),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 129/162 (80%), Gaps = 0/162 (0%)

Query  6    KLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAEGY  65
            ++ SGAE+V + L +Q +++IFGYPGGAVL IYD LK    ++HILVRHEQ A H A+GY
Sbjct  2    EILSGAEMVIRSLINQGIQHIFGYPGGAVLDIYDALKTVGGVEHILVRHEQAATHMADGY  61

Query  66   ARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTTGI  125
            ARS+GK GVVLVTSGPGATNA+T +  AYMDSIP+V ISGQV + LIG DAFQECD  GI
Sbjct  62   ARSTGKIGVVLVTSGPGATNAITGIATAYMDSIPMVVISGQVASSLIGYDAFQECDMIGI  121

Query  126  TRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            +RP  KH++LVK  +D+  I  KAF +A+TGRPGPV++D+PK
Sbjct  122  SRPIVKHSFLVKRTEDIPIIFKKAFWLASTGRPGPVVIDLPK  163


>sp|P57321.1|ILVI_BUCAI RecName: Full=Acetolactate synthase large subunit; Short=AHAS; 
AltName: Full=Acetohydroxy-acid synthase large subunit; Short=ALS
Length=571

 Score =  217 bits (552),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/162 (63%), Positives = 129/162 (80%), Gaps = 0/162 (0%)

Query  6    KLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAEGY  65
            ++ SGAE+V + L DQ +++IFGYPGGAVL IYD LK    I+HILVRHEQ A H A+GY
Sbjct  2    EILSGAEMVVRSLIDQGIQHIFGYPGGAVLDIYDALKTVGGIEHILVRHEQAATHMADGY  61

Query  66   ARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTTGI  125
            +RS+GK GVVLVTSGPGATNA+T +  AYMDSIP+V ISGQV + LIG DAFQECD  GI
Sbjct  62   SRSTGKTGVVLVTSGPGATNAITGIATAYMDSIPMVVISGQVASSLIGYDAFQECDMIGI  121

Query  126  TRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            +RP  KH++LVK  +D+  +  KAF +A++GRPGP+++D+PK
Sbjct  122  SRPIVKHSFLVKKTEDIPIVFKKAFWLASSGRPGPIVIDLPK  163


>sp|P07342.1|ILVB_YEAST RecName: Full=Acetolactate synthase catalytic subunit, mitochondrial; 
AltName: Full=Acetohydroxy-acid synthase catalytic 
subunit; Short=AHAS; Short=ALS; Flags: Precursor
Length=687

 Score =  215 bits (547),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/159 (62%), Positives = 125/159 (79%), Gaps = 0/159 (0%)

Query  9    SGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAEGYARS  68
            +G +I  + +  Q+V+ +FGYPGGA+LP+YD + N ++   +L +HEQGAGH AEGYAR+
Sbjct  93   TGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYARA  152

Query  69   SGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTTGITRP  128
            SGKPGVVLVTSGPGATN VT + DA+ D IP+V  +GQVPT  IGTDAFQE D  GI+R 
Sbjct  153  SGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVGISRS  212

Query  129  CTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            CTK N +VK V++L   I++AFE+AT+GRPGPVLVD+PK
Sbjct  213  CTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPK  251


>sp|P45261.1|ILVI_HAEIN RecName: Full=Acetolactate synthase large subunit; Short=AHAS; 
AltName: Full=Acetohydroxy-acid synthase large subunit; Short=ALS
Length=573

 Score =  214 bits (545),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/164 (64%), Positives = 129/164 (79%), Gaps = 1/164 (0%)

Query  4    MSKLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAE  63
            M KL SGAE+V + L D+ VEY+FGYPGGAVL IYD +     I+HILVRHEQ A H A+
Sbjct  1    MKKL-SGAEMVVQSLRDEGVEYVFGYPGGAVLDIYDAIHTLGGIEHILVRHEQAAVHMAD  59

Query  64   GYARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTT  123
            GYARS+GK G VLVTSGPGATNA+T +  AY DS+P+V ISGQV ++LIG+DAFQECD  
Sbjct  60   GYARSTGKVGCVLVTSGPGATNAITGILTAYTDSVPMVIISGQVMSNLIGSDAFQECDML  119

Query  124  GITRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            GI+RP  KH+++VK  +D+   + KAF +A+TGRPGPV+VDIPK
Sbjct  120  GISRPVVKHSFIVKKAEDIPSTLKKAFYIASTGRPGPVVVDIPK  163


>sp|P37251.4|ILVB_BACSU RecName: Full=Acetolactate synthase large subunit; Short=AHAS; 
AltName: Full=Acetohydroxy-acid synthase large subunit; Short=ALS; 
AltName: Full=Vegetative protein 105; Short=VEG105
Length=574

 Score =  211 bits (537),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 127/163 (78%), Gaps = 1/163 (0%)

Query  5    SKLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAEG  64
            ++  SGA ++ + L+ + VE IFGYPGGAVLPIYD+L N   + HIL RHEQGA HAAEG
Sbjct  15   TQTMSGALMLIESLKKEKVEMIFGYPGGAVLPIYDKLYNSGLV-HILPRHEQGAIHAAEG  73

Query  65   YARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTTG  124
            YAR SGKPGVV+ TSGPGATN VT L DA +DS+PLV  +GQV T +IG+DAFQE D  G
Sbjct  74   YARVSGKPGVVIATSGPGATNLVTGLADAMIDSLPLVVFTGQVATSVIGSDAFQEADILG  133

Query  125  ITRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            IT P TKH++ V+  +DL +II +AF +ATTGRPGPVL+DIPK
Sbjct  134  ITMPVTKHSYQVRQPEDLPRIIKEAFHIATTGRPGPVLIDIPK  176


>sp|P00893.2|ILVI_ECOLI RecName: Full=Acetolactate synthase isozyme 3 large subunit; 
AltName: Full=AHAS-III; AltName: Full=ALS-III; AltName: Full=Acetohydroxy-acid 
synthase III large subunit
Length=574

 Score =  210 bits (534),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 126/162 (78%), Gaps = 0/162 (0%)

Query  6    KLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAEGY  65
            ++ SGAE+V + L DQ V+ +FGYPGGAVL IYD L     I H+LVRHEQ A H A+G 
Sbjct  2    EMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQAAVHMADGL  61

Query  66   ARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTTGI  125
            AR++G+ GVVLVTSGPGATNA+T +  AYMDSIPLV +SGQV T LIG DAFQECD  GI
Sbjct  62   ARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVATSLIGYDAFQECDMVGI  121

Query  126  TRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            +RP  KH++LVK  +D+ +++ KAF +A +GRPGPV+VD+PK
Sbjct  122  SRPVVKHSFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPK  163


>sp|P40811.3|ILVI_SALTY RecName: Full=Acetolactate synthase isozyme 3 large subunit; 
AltName: Full=AHAS-III; AltName: Full=ALS-III; AltName: Full=Acetohydroxy-acid 
synthase III large subunit
Length=574

 Score =  207 bits (528),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 124/162 (77%), Gaps = 0/162 (0%)

Query  6    KLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAEGY  65
            ++ SGAE+V + L DQ V+ +FGYPGGAVL IYD L     I H+LVRHEQ A H A+G 
Sbjct  2    EMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQAAVHMADGL  61

Query  66   ARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTTGI  125
            AR++G  GVVLVTSGPGATNA+T +  AYMDSIPLV +SGQV T LIG DAFQECD  GI
Sbjct  62   ARATGDVGVVLVTSGPGATNAITGIATAYMDSIPLVILSGQVATSLIGYDAFQECDMVGI  121

Query  126  TRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            +RP  KH++LVK  +D+  ++ KAF +A +GRPGPV+VD+PK
Sbjct  122  SRPVVKHSFLVKQTEDIPLVLKKAFWLAASGRPGPVVVDLPK  163


>sp|Q6SSJ3.1|ILVB_CRYNV RecName: Full=Acetolactate synthase, mitochondrial; AltName: 
Full=AHAS; AltName: Full=ALS; AltName: Full=Acetohydroxy-acid 
synthase; Flags: Precursor
Length=718

 Score =  207 bits (526),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 122/159 (77%), Gaps = 0/159 (0%)

Query  9    SGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAEGYARS  68
            SG +I  + +   DV+ +FGYPGGA+LP++D + N    + +L RHEQGAGH AEGYAR 
Sbjct  127  SGGQIFQEMMLRHDVKQVFGYPGGAILPVFDAIYNSPHFEFVLPRHEQGAGHMAEGYARV  186

Query  69   SGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTTGITRP  128
            SGKPGVVLVTSGPGATN +T + DA  D +P+V   GQV T+LIG+DAFQE D  GI+R 
Sbjct  187  SGKPGVVLVTSGPGATNVITPMQDALSDGVPMVVFCGQVATNLIGSDAFQEADVVGISRS  246

Query  129  CTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            CTK N +VKD+ +L + I++AF++ATTGRPGPVLVD+PK
Sbjct  247  CTKWNVMVKDIAELPRRINEAFKIATTGRPGPVLVDLPK  285


>sp|Q5KPJ5.1|ILVB_CRYNE RecName: Full=Acetolactate synthase, mitochondrial; AltName: 
Full=AHAS; AltName: Full=ALS; AltName: Full=Acetohydroxy-acid 
synthase; Flags: Precursor
Length=718

 Score =  206 bits (523),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 121/159 (77%), Gaps = 0/159 (0%)

Query  9    SGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAEGYARS  68
            SG +I  + +   DV+ +FGYPGGA+LP++D + N      +L RHEQGAGH AEGYAR 
Sbjct  127  SGGQIFQEMMLRHDVKQVFGYPGGAILPVFDAIYNSPHFDFVLPRHEQGAGHMAEGYARV  186

Query  69   SGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTTGITRP  128
            SGKPGVVLVTSGPGATN +T + DA  D +P+V   GQV T+LIG+DAFQE D  GI+R 
Sbjct  187  SGKPGVVLVTSGPGATNVITPMQDALSDGVPMVVFCGQVATNLIGSDAFQEADVVGISRS  246

Query  129  CTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            CTK N +VKD+ +L + I++AF++ATTGRPGPVLVD+PK
Sbjct  247  CTKWNVMVKDIAELPRRINEAFKIATTGRPGPVLVDLPK  285


>sp|P08142.1|ILVB_ECOLI RecName: Full=Acetolactate synthase isozyme 1 large subunit; 
Short=AHAS-I; AltName: Full=Acetohydroxy-acid synthase I large 
subunit; Short=ALS-I
Length=562

 Score =  205 bits (521),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/162 (57%), Positives = 122/162 (76%), Gaps = 0/162 (0%)

Query  6    KLYSGAEIVFKCLEDQDVEYIFGYPGGAVLPIYDELKNHERIKHILVRHEQGAGHAAEGY  65
            K ++GAE +   LE Q ++ + G PGG++LP+YD L    +I+HIL RHEQGAG  A+G 
Sbjct  11   KRFTGAEFIVHFLEQQGIKIVTGIPGGSILPVYDALSQSTQIRHILARHEQGAGFIAQGM  70

Query  66   ARSSGKPGVVLVTSGPGATNAVTALTDAYMDSIPLVCISGQVPTHLIGTDAFQECDTTGI  125
            AR+ GKP V +  SGPGATN VTA+ DA +DSIPL+CI+GQVP  +IGTDAFQE DT GI
Sbjct  71   ARTDGKPAVCMACSGPGATNLVTAIADARLDSIPLICITGQVPASMIGTDAFQEVDTYGI  130

Query  126  TRPCTKHNWLVKDVKDLSKIIHKAFEVATTGRPGPVLVDIPK  167
            + P TKHN+LV+ +++L +++  AF +A +GRPGPV +DIPK
Sbjct  131  SIPITKHNYLVRHIEELPQVMSDAFRIAQSGRPGPVWIDIPK  172