GOS 2163020

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091118858894
Annotathon code: GOS_2163020
Sample :
  • GPS :24°10'29n; 84°20'40w
  • Caribbean Sea: Gulf of Mexico - USA
  • Coastal Sea (-2m, 26.4°C, 0.1-0.8 microns)
Authors
Team : Algarve 2011
Username : ANVBQ
Annotated on : 2011-05-24 16:01:17
  • Calheiros André dos Santos
  • Martins Vânia Carina Correia
  • Rosinha Nádia Alexandra Saragoça

Synopsis

Genomic Sequence

>JCVI_READ_1091118858894 GOS_2163020 Genomic DNA
CCCTCGCACTCAAAGTGGACAGATGATGAAACCAAATCGGTGTGATCTATCAGTTCCATGCAACCTTGTGAACCCCTGATTAGACTTGAGTTGAGGTATG
AAGTCATGCCTCCGATAGCAGTCCATTTAATTCCATAATTAGAGCCGACAATCTCTAAATTATCGATAGTCGCATCAGCTAAATTGAGTTCCACAGAATG
AGTACTTGAGTTCTGGAATACGGTTATGTTTGACAGTGAGACACTTCCTTCCCTCTCTGTTATGCCACTATTATCGATGTCTAATGAGGGTCCTGATAGG
GGCTCTCTTGAGATTATTCCATCAAGAAATATGTCAATGCTATCTCTGATCACCACCCCGTGCTGATCATGGGATGATGAGCAATTCATGCAACTAACAT
TCTTACCAGCACTCACCACATCATTCGATTCTTCAAAGTATATGCCCGATCCAGAAGACGGAAAAAGGGTTCCTATGCCATTGGAGGAGGTGTGAATTTG
CTCCAGTTCAACATTGCTGGAGTCTATCACGGATACACCGTGGCCTGAATTATTGTGACTGGTCACTAAGAACAGATCCGGATGAAACTCTCTGATATCC
AAACCAGTGGCTCCATTGTTGCTGATGTCCCAATAACTACCCTGAATTCCTCCTTTCCAGAGTAACACACCCGGGCCCGTTGAATTACGAACGACTAGGT
CGTTTACTGTGGGGGCCCAGTTAGCACTTCTAAAGAACATCCCGGCTCTGTCATTATAGGGGGAGATTGCTGAGGGGTTGCCGTTCCCGATTATGTTGAG
TCTATTGATTATTGTGGAGGAGTCTATCATATAGCCCCTCAATCCGACTGCTGAGTTATCTTCTATCAACCCGACATCTATGTGCACCCCACTTGTGTTG
ATATCGAATGCGGCCACGGAAAGTCCGGATGTTTTTGCCCCCGCACTCCTGTTCCCCTAACT

Translation

[7 - 960/962]   indirect strand
>GOS_2163020 Translation [7-960   indirect strand]
GNRSAGAKTSGLSVAAFDINTSGVHIDVGLIEDNSAVGLRGYMIDSSTIINRLNIIGNGNPSAISPYNDRAGMFFRSANWAPTVNDLVVRNSTGPGVLLW
KGGIQGSYWDISNNGATGLDIREFHPDLFLVTSHNNSGHGVSVIDSSNVELEQIHTSSNGIGTLFPSSGSGIYFEESNDVVSAGKNVSCMNCSSSHDQHG
VVIRDSIDIFLDGIISREPLSGPSLDIDNSGITEREGSVSLSNITVFQNSSTHSVELNLADATIDNLEIVGSNYGIKWTAIGGMTSYLNSSLIRGSQGCM
ELIDHTDLVSSSVHFECE

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

The biggest ORF presents a big number of codons (321), it does not contain a start nor stop codon, but we can not exclude the possibility this protein starts in a alternative codon.

The sequence is most likely to belong to a Archaea organism since this was the one with closest relation in protein, only relating with a E-Value of 8e-25 with a hypothetical protein, since this protein only stands as hypothetical we can not guarantee this result.

The "Taxonomy report", "Multiple Alignement", "Tree" and "Biological Process" were left undone because the low relations with any other proteins.

ORF finding

PROTOCOL


a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code




RESULTS ANALYSIS


By analysing all reading frames we see 2 possible choices, in reading frame 2 in the direct strand we can see a 66 codons, incomplete at 5', and in the 1 reading frame in the reverse straind containing 318 codons, we will choose the second one for analysis.


The longest ORF is on the 1 frame on the reverse strand, starting on 7 and ending at 960, containing 318codons, as so we will select this sequence for analysis. This ORF is incomplete on the 3' end.



This ORF presents no similar domains to any other, this is something that would be expectable due to the fact in the blast we find it in a closer relation with a uncultured archaeon. The 1 ORF has also been tested and found no similarity with any other sequence.

RAW RESULTS

a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code 

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 398 to base 595.
CATTCTTACCAGCACTCACCACATCATTCGATTCTTCAAAGTATATGCCCGATCCAGAAG
ACGGAAAAAGGGTTCCTATGCCATTGGAGGAGGTGTGAATTTGCTCCAGTTCAACATTGC
TGGAGTCTATCACGGATACACCGTGGCCTGAATTATTGTGACTGGTCACTAAGAACAGAT
CCGGATGAAACTCTCTGA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
HSYQHSPHHSILQSICPIQKTEKGFLCHWRRCEFAPVQHCWSLSRIHRGLNYCDWSLRTD
PDETL*

No ORFs were found in reading frame 3.

----------------------------------------------------------------------------------------------

b) SMS ORFinder / reverse strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

>ORF number 1 in reading frame 1 on the reverse strand extends from base 7 to base 960.
GGGAACAGGAGTGCGGGGGCAAAAACATCCGGACTTTCCGTGGCCGCATTCGATATCAAC
ACAAGTGGGGTGCACATAGATGTCGGGTTGATAGAAGATAACTCAGCAGTCGGATTGAGG
GGCTATATGATAGACTCCTCCACAATAATCAATAGACTCAACATAATCGGGAACGGCAAC
CCCTCAGCAATCTCCCCCTATAATGACAGAGCCGGGATGTTCTTTAGAAGTGCTAACTGG
GCCCCCACAGTAAACGACCTAGTCGTTCGTAATTCAACGGGCCCGGGTGTGTTACTCTGG
AAAGGAGGAATTCAGGGTAGTTATTGGGACATCAGCAACAATGGAGCCACTGGTTTGGAT
ATCAGAGAGTTTCATCCGGATCTGTTCTTAGTGACCAGTCACAATAATTCAGGCCACGGT
GTATCCGTGATAGACTCCAGCAATGTTGAACTGGAGCAAATTCACACCTCCTCCAATGGC
ATAGGAACCCTTTTTCCGTCTTCTGGATCGGGCATATACTTTGAAGAATCGAATGATGTG
GTGAGTGCTGGTAAGAATGTTAGTTGCATGAATTGCTCATCATCCCATGATCAGCACGGG
GTGGTGATCAGAGATAGCATTGACATATTTCTTGATGGAATAATCTCAAGAGAGCCCCTA
TCAGGACCCTCATTAGACATCGATAATAGTGGCATAACAGAGAGGGAAGGAAGTGTCTCA
CTGTCAAACATAACCGTATTCCAGAACTCAAGTACTCATTCTGTGGAACTCAATTTAGCT
GATGCGACTATCGATAATTTAGAGATTGTCGGCTCTAATTATGGAATTAAATGGACTGCT
ATCGGAGGCATGACTTCATACCTCAACTCAAGTCTAATCAGGGGTTCACAAGGTTGCATG
GAACTGATAGATCACACCGATTTGGTTTCATCATCTGTCCACTTTGAGTGCGAG

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
GNRSAGAKTSGLSVAAFDINTSGVHIDVGLIEDNSAVGLRGYMIDSSTIINRLNIIGNGN
PSAISPYNDRAGMFFRSANWAPTVNDLVVRNSTGPGVLLWKGGIQGSYWDISNNGATGLD
IREFHPDLFLVTSHNNSGHGVSVIDSSNVELEQIHTSSNGIGTLFPSSGSGIYFEESNDV
VSAGKNVSCMNCSSSHDQHGVVIRDSIDIFLDGIISREPLSGPSLDIDNSGITEREGSVS
LSNITVFQNSSTHSVELNLADATIDNLEIVGSNYGIKWTAIGGMTSYLNSSLIRGSQGCM
ELIDHTDLVSSSVHFECE

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOL



RESULTS ANALYSIS


As there were no proteins with high similarity we can not align to see conserved regions.

RAW RESULTS

Protein Domains

PROTOCOL

InterPro default parameters at EBI


RESULTS ANALYSIS


There were found no similar protein domains, with this information we can not conclude anything about this protein's function.

RAW RESULTS

No hits found.

Phylogeny

It is impossible to create a tree due to low similarity between proteins.

RAW RESULTS

Taxonomy report

Due to low similarity in the Blast E-Values we the taxonomy report will not be analyzed.

RAW RESULTS
cellular organisms .........................    15 hits    7 orgs [root]
. Archaea ..................................     3 hits    2 orgs 
. . uncultured archaeon MedDCM-OCT-S09-C13 .     1 hits    1 orgs [environmental samples]
. . Methanosphaerula palustris E1-9c .......     2 hits    1 orgs [Euryarchaeota; Methanomicrobia; Methanomicrobiales; unclassified Methanomicrobiales; Genera incertae sedis; Methanosphaerula; Methanosphaerula palustris]
. Bacteria .................................     6 hits    3 orgs 
. . Streptococcus parauberis NCFD 2020 .....     2 hits    1 orgs [Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus parauberis]
. . Gammaproteobacteria ....................     4 hits    2 orgs [Proteobacteria]
. . . Serratia odorifera DSM 4582 ..........     2 hits    1 orgs [Enterobacteriales; Enterobacteriaceae; Serratia; Serratia odorifera]
. . . Actinobacillus minor 202 .............     2 hits    1 orgs [Pasteurellales; Pasteurellaceae; Actinobacillus; Actinobacillus minor]
. Oryza sativa .............................     6 hits    2 orgs [Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Liliopsida; commelinids; Poales; Poaceae; BEP clade; Ehrhartoideae; Oryzeae; Oryza]
. . Oryza sativa Japonica Group ............     5 hits    1 orgs 
. . Oryza sativa Indica Group ..............     1 hits    1 orgs

BLAST

Protocol:

a.BLASTp versus NR, NCBI default parameters apart from "Number of descriptions_1000"

b.BLASTp versus SwissProt, NCBI default parameters apart from "Number of descriptions_1000"


RESULTS ANALYSIS


From the scoes we can see this sequence is closer to ADD93285.1, that is a hypothetical protein belonging to a uncultured archaeon with the lowest E value, and also only with any significance (8e-25) and score of 119.

From the scores found on swissprot we can not take any conclusions(E-Values between 0.98 and 9.6)

As so our conlusion is that closest protein that was found is a archeon protein with unknown function.

a.BLASTp versus NR, NCBI default parameters apart from "Number of descriptions=1000"
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

gb|ADD93285.1|  hypothetical protein [uncultured archaeon MedD...   119    8e-25
ref|ZP_06640422.1|  bacterial luciferase [Serratia odorifera D...  40.0    0.40 
ref|YP_002466996.1|  periplasmic copper-binding [Methanosphaer...  37.0    3.7  
dbj|BAD87908.1|  putative tryptophanyl-tRNA synthetase [Oryza ...  36.6    5.2  
ref|NP_001044218.1|  Os01g0743400 [Oryza sativa Japonica Group...  36.6    5.3  
ref|ZP_05629211.1|  cytochrome c nitrite reductase pentaheme s...  35.8    8.1  

ALIGNMENTS
>gb|ADD93285.1| hypothetical protein [uncultured archaeon MedDCM-OCT-S09-C13]
Length=1551

 Score =  119 bits (297),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 95/316 (31%), Positives = 173/316 (55%), Gaps = 12/316 (3%)

Query  1    GNRSAGAKTSGLSVAAFDINTSGVHIDVGLIEDNSAVGLRGYMIDSSTIINRLNIIGNGN  60
            G  S+GA T G++ AA +IN +G  ++  L++D+S+VG+R + +DSST +  + I   G 
Sbjct  299  GTGSSGATTPGIAFAAIEINATGAWLENVLVDDSSSVGVRLFFVDSSTTLRNMTIRDAGE  358

Query  61   PSAISPYNDRAGMFFRSANWAPTVNDLVVRNSTGPGVLLWKGG-IQGSYWDISNNGATGL  119
             +   P++  AG+  +++ +A  + D+ +  S GPG+    GG +QG  W++ NN   GL
Sbjct  359  -AGQGPHS--AGLSIQTSYFAAHLEDIEISGSPGPGIHSSSGGSLQGFDWNLHNNSEQGL  415

Query  120  DIREFHPDLFLVTSHNNSGHGVSVIDSSNVELEQIHTSSNGIGTLFPSSGSGIYFEESND  179
             I      +  +T+ NN   GV   D+  + L  + +  +G         +G+ +++SND
Sbjct  416  FIDSATVVVDGITTSNNGFSGVHTFDARYIHLSNLSSVGDGALGGNDMDQAGLSYQKSND  475

Query  180  VVSAGKNVSCMNCSSSHDQ-HGVVIRDSIDIFLDGI-ISREPLSGPSLDIDNSGITEREG  237
            + +   +V CM+C     Q HGV + DS+D++LD + IS    S P++ ++N G+T    
Sbjct  476  LETTSGDVVCMDCQIESPQGHGVYVIDSVDLWLDNLSISDVDSSLPAMYVNNGGLTLGTQ  535

Query  238  S--VSLSNITVFQNSST-HSVELNLADATIDNLEIVGSNYGIKWTA--IGGMTSYLNSSL  292
                +L N  +   S+T H++ +  A   ID L ++G++ G+ W A   G   S L+++ 
Sbjct  536  GGRFNLLNANIEHESTTEHALYIEQAAGNIDALTLIGNHSGVYWDANHNGNFPSTLSNTE  595

Query  293  IRGSQGCMELIDHTDL  308
              G++ C++L++H  L
Sbjct  596  FVGTE-CLKLVNHPYL  610


>ref|ZP_06640422.1| bacterial luciferase [Serratia odorifera DSM 4582]
 gb|EFE94524.1| bacterial luciferase [Serratia odorifera DSM 4582]
Length=345

 Score = 40.0 bits (92),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 47/112 (42%), Gaps = 14/112 (12%)

Query  99   LWKGGI--QGSYWDISNNGATGLDIREFHPDLFLVTSHNNSGHGVSVIDSSNVELEQIHT  156
            LW+G    QG YW   +  ++ L  ++ HP +++     NS H  +V +  NV++  +H 
Sbjct  141  LWQGDYAHQGEYWSFPSTTSSPLPKQQPHPPIWVAARDPNS-HEFAVKNGCNVQVTPLHQ  199

Query  157  SSNGIGTLFPSSGSGIYFEESNDVVSAGKNVSCMNCSSSHDQHGVVIRDSID  208
                I  L         F+E+   +   + +  M       QHG V  D  D
Sbjct  200  GEEEIVRLVTC------FKETCQRIKPEQPLKIMLL-----QHGYVAEDEAD  240


>ref|YP_002466996.1| periplasmic copper-binding [Methanosphaerula palustris E1-9c]
 gb|ACL17273.1| periplasmic copper-binding [Methanosphaerula palustris E1-9c]
Length=1931

 Score = 37.0 bits (84),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 70/138 (51%), Gaps = 18/138 (13%)

Query  144   IDSSNVELEQIHTSSNGIGTLFPSSGSGIYFEESNDVVSAGKNVSCMNCSSSHDQHGVVI  203
             + ++NV+L  +   S  +G  +P +G  +       +   G+ +   + S+S  Q G+ I
Sbjct  1250  LTATNVDLYPLRNVS-PLGLYYPITGPTV-------ITRPGRYLVMQDFSASDAQVGIDI  1301

Query  204   RDSIDIFLDGIISREPLSGPSLDIDNSGITEREGSVSLSNITVFQNSSTHSV-----ELN  258
             R S D+ +DG+     ++G +   +++G++    SV LSNIT+  N S  S       LN
Sbjct  1302  RSS-DVIVDGM--GHTITG-AKKFNSNGLSVYNDSVQLSNITI-SNLSMGSWFIGANYLN  1356

Query  259   LADATIDNLEIVGSNYGI  276
               D   DN+  VG++YGI
Sbjct  1357  TRDCRTDNVTTVGNDYGI  1374


>dbj|BAD87908.1| putative tryptophanyl-tRNA synthetase [Oryza sativa Japonica 
Group]
 gb|EAY75781.1| hypothetical protein OsI_03697 [Oryza sativa Indica Group]
 gb|EAZ13498.1| hypothetical protein OsJ_03415 [Oryza sativa Japonica Group]
Length=399

 Score = 36.6 bits (83),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 38/153 (25%), Positives = 65/153 (43%), Gaps = 22/153 (14%)

Query  164  LFPSSGSGIYFEESNDVVSAGKNVSCMNCSSSHDQHGVVIRDSIDIFLDGIISREPLSGP  223
            L P +G+         V+S    +S M+ S+  DQ  + + D  D+ ++ I   +  S P
Sbjct  246  LIPPAGA--------RVMSLTDGLSKMSKSAPSDQSRINLLDPKDVIMNKIKRCKTDSFP  297

Query  224  SLDIDNSGITEREGSVSLSNITV----------FQNSSTHSVELNLADATIDNLEIVGSN  273
             L+ DN    E    +S+  I             +N +  S +  L DA ID+L+ +   
Sbjct  298  GLEFDNPERPECNNLLSIYQIITGKTKEEVIRECENMNWGSFKTTLTDALIDHLQPI---  354

Query  274  YGIKWTAIGGMTSYLNSSLIRGSQGCMELIDHT  306
              +++  I     YL+  L+ GS    E+ D T
Sbjct  355  -QVRYEEIMSDPGYLDGVLLEGSGKAAEIADIT  386


>ref|NP_001044218.1| Os01g0743400 [Oryza sativa Japonica Group]
 dbj|BAD87909.1| putative tryptophanyl-tRNA synthetase [Oryza sativa Japonica 
Group]
 dbj|BAF06132.1| Os01g0743400 [Oryza sativa Japonica Group]
Length=393

 Score = 36.6 bits (83),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 38/153 (25%), Positives = 65/153 (43%), Gaps = 22/153 (14%)

Query  164  LFPSSGSGIYFEESNDVVSAGKNVSCMNCSSSHDQHGVVIRDSIDIFLDGIISREPLSGP  223
            L P +G+         V+S    +S M+ S+  DQ  + + D  D+ ++ I   +  S P
Sbjct  240  LIPPAGA--------RVMSLTDGLSKMSKSAPSDQSRINLLDPKDVIMNKIKRCKTDSFP  291

Query  224  SLDIDNSGITEREGSVSLSNITV----------FQNSSTHSVELNLADATIDNLEIVGSN  273
             L+ DN    E    +S+  I             +N +  S +  L DA ID+L+ +   
Sbjct  292  GLEFDNPERPECNNLLSIYQIITGKTKEEVIRECENMNWGSFKTTLTDALIDHLQPI---  348

Query  274  YGIKWTAIGGMTSYLNSSLIRGSQGCMELIDHT  306
              +++  I     YL+  L+ GS    E+ D T
Sbjct  349  -QVRYEEIMSDPGYLDGVLLEGSGKAAEIADIT  380


>ref|ZP_05629211.1| cytochrome c nitrite reductase pentaheme subunit [Actinobacillus 
minor 202]
 gb|EEV24543.1| cytochrome c nitrite reductase pentaheme subunit [Actinobacillus 
minor 202]
Length=211

 Score = 35.8 bits (81),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 21/63 (34%), Positives = 30/63 (48%), Gaps = 2/63 (3%)

Query  130  LVTSHNNSGHGVSVIDSSNVELEQIHTSSNGIGTLFPSSGSGIYFEESNDVVSAGKNVSC  189
            L T  +NS          N    Q H S+N  G  F  S +G +F+ES    + GK V+C
Sbjct  39   LWTEQSNSQMAEDARRDPNKYCTQCHESANATGKPF--SHAGKHFQESAKSPNNGKQVTC  96

Query  190  MNC  192
            ++C
Sbjct  97   VSC  99

---------------------------------------------------------------------------------

b. BLASTp versus SwissProt, NCBI default parameters apart from "Number of descriptions=1000"

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q6NWA8.1|TADA1_DANRE  RecName: Full=Transcriptional adapter...  34.3    0.98 
sp|Q92KW1.2|MNME_RHIME  RecName: Full=tRNA modification GTPase...  33.9    1.5  
sp|A5ULA6.1|Y779_METS3  RecName: Full=UPF0173 metal-dependent ...  33.1    2.6  
sp|Q6ME13.1|LON_PARUW  RecName: Full=Lon protease; AltName: Fu...  32.7    2.8  
sp|P07390.2|PT494_YEAST  RecName: Full=COX3 mRNA-specific tran...  32.3    4.4  
sp|Q6NU22.1|SH34A_XENLA  RecName: Full=SH3 domain-binding prot...  32.3    4.5  
sp|Q6NU51.1|SH34B_XENLA  RecName: Full=SH3 domain-binding prot...  32.3    4.5  
sp|A7HK39.1|LON_FERNB  RecName: Full=Lon protease; AltName: Fu...  31.6    6.4  
sp|Q8CAQ8.1|IMMT_MOUSE  RecName: Full=Mitochondrial inner memb...  31.2    9.6  

ALIGNMENTS
>sp|Q6NWA8.1|TADA1_DANRE RecName: Full=Transcriptional adapter 1; AltName: Full=Transcriptional 
adapter 1-like protein
Length=332

 Score = 34.3 bits (77),  Expect = 0.98, Method: Compositional matrix adjust.
 Identities = 34/125 (28%), Positives = 47/125 (38%), Gaps = 28/125 (22%)

Query  83   TVNDLVVRNSTGPGVLLWKGGIQGSYWDISNNGATGLDIRE-----FHPDLFLVTSHNNS  137
            T   ++V  S GPG L W GG        S        +R+     F P         N 
Sbjct  68   TRCQIIVSTSEGPGSLQWSGGSASKPGKPSRGKKKFPSVRQKFDHRFQP--------QNP  119

Query  138  GHGVSVIDSSNVELEQIHTSSNGIGTLFPSSGSGIYFEESNDVVSAGKN---------VS  188
              GV V      E E++  S+  +  L PS G      E+  +VSA ++         VS
Sbjct  120  LAGVPVFSPREAEEEELKLSAQTL--LLPSRGQL----EARMMVSAFESDLDSVAEDAVS  173

Query  189  CMNCS  193
            CM C+
Sbjct  174  CMLCA  178


>sp|Q92KW1.2|MNME_RHIME RecName: Full=tRNA modification GTPase mnmE
Length=439

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 39/167 (24%), Positives = 69/167 (42%), Gaps = 23/167 (13%)

Query  10   SGLSVAAFDINTSGVHIDVGLIEDNSAVGLRGYMIDSSTIINRLNIIGNGNPSAISPYN-  68
            +G SV  FD  T+G+     L+E       R  + D+  ++      G+     + P N 
Sbjct  263  AGFSVKLFD--TAGLRETDELVEREGIRRARQVIADADLVLLLSEKPGHFRIDEVLPENV  320

Query  69   ---------DRAGMFFRSANWAPTVNDLVVRNSTGPGVLLWKGGIQGSYWDISNNGATGL  119
                     DR      S +WAP+  D+ +   TG G+      +Q    D++   A  +
Sbjct  321  PVIRVATKVDRP-----SPSWAPSDADIFLSTRTGEGMADLLTALQSHLPDLAGRTALAM  375

Query  120  DIREFHPDLFLVTSHNNSGHGVSVIDSSNVEL--EQIHTSSNGIGTL  164
              R+ H D        ++    S+I SS++EL  EQ+  + + +G +
Sbjct  376  PSRKRHVDCL---RQASAALERSLI-SSDLELRAEQLRQAGDALGRI  418


>sp|A5ULA6.1|Y779_METS3 RecName: Full=UPF0173 metal-dependent hydrolase Msm_0779
Length=239

 Score = 33.1 bits (74),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 20/51 (40%), Positives = 30/51 (59%), Gaps = 4/51 (7%)

Query  111  ISNNGATGLDIREFHPDLFLVTSHNNSGH---GVSVIDSSNVELEQIHTSS  158
            ISNN A  + + EF+PD+ LVT H +S H    + + + +NV +  IH  S
Sbjct  27   ISNNPACQIPVEEFNPDIILVT-HGHSDHLGDAMELSNKNNVPVAAIHEIS  76


>sp|Q6ME13.1|LON_PARUW RecName: Full=Lon protease; AltName: Full=ATP-dependent protease 
La
Length=835

 Score = 32.7 bits (73),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 14/33 (43%), Positives = 20/33 (61%), Gaps = 0/33 (0%)

Query  270  VGSNYGIKWTAIGGMTSYLNSSLIRGSQGCMEL  302
            VG   G+ WTA+GG T Y+ S  + G +  M+L
Sbjct  649  VGVCMGLAWTAMGGATLYIESIKVAGEKTVMKL  681


>sp|P07390.2|PT494_YEAST RecName: Full=COX3 mRNA-specific translational activator PET494
Length=489

 Score = 32.3 bits (72),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 36/139 (26%), Positives = 60/139 (44%), Gaps = 14/139 (10%)

Query  63   AISPYNDRAGMFFRSANWAPTVNDLVVRNSTGPGVLLWKGGIQ----GSYWDISNNGATG  118
             ++PYN+R  +FF + N +P+VN  V   S      L KG I     G  +D ++N    
Sbjct  359  VMNPYNERTQLFFPNVN-SPSVNKPVPSISLETYTRLLKGYINLQETGCKYDYNDNIFKL  417

Query  119  LDIREFHPDLFLVTSHNNSGHGVSVIDSSNVELEQIHTSSNGIGTLFPSSGSGIY--FEE  176
            + I +   + FL    N   H    +    + L +    S  +GT+  +     Y    +
Sbjct  418  ISILKL--NCFL--QRNKKKHAGPTV---RILLPRDEDRSQILGTISQAEKRTCYQILSK  470

Query  177  SNDVVSAGKNVSCMNCSSS  195
            + DVV+  K +S +   SS
Sbjct  471  NRDVVALLKRISDIQADSS  489


>sp|Q6NU22.1|SH34A_XENLA RecName: Full=SH3 domain-binding protein 4-A
Length=957

 Score = 32.3 bits (72),  Expect = 4.5, Method: Composition-based stats.
 Identities = 19/56 (34%), Positives = 23/56 (42%), Gaps = 10/56 (17%)

Query  65   SPYNDRAGMFFRSANWAPTVNDLVVRNSTGPGVLLWKGGIQGSYWDISNNGATGLD  120
            +P+ DR GM    A W P  + L          L W   I  SY D+     TGLD
Sbjct  871  APHRDRNGMLDSEAMWKPAYDFL----------LTWSAQIGESYRDVIQELHTGLD  916


>sp|Q6NU51.1|SH34B_XENLA RecName: Full=SH3 domain-binding protein 4-B
Length=957

 Score = 32.3 bits (72),  Expect = 4.5, Method: Composition-based stats.
 Identities = 19/56 (34%), Positives = 23/56 (42%), Gaps = 10/56 (17%)

Query  65   SPYNDRAGMFFRSANWAPTVNDLVVRNSTGPGVLLWKGGIQGSYWDISNNGATGLD  120
            +P+ DR GM    A W P  + L          L W   I  SY D+     TGLD
Sbjct  871  APHRDRNGMLDSEAMWKPAYDFL----------LTWSAQIGESYRDVIQELHTGLD  916


>sp|A7HK39.1|LON_FERNB RecName: Full=Lon protease; AltName: Full=ATP-dependent protease 
La
Length=810

 Score = 31.6 bits (70),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 16/38 (43%), Positives = 23/38 (61%), Gaps = 2/38 (5%)

Query  265  DNLE--IVGSNYGIKWTAIGGMTSYLNSSLIRGSQGCM  300
            D LE  ++G   G+ WT  GG T Y+ S+LI G+ G +
Sbjct  608  DKLEKPMIGVTTGLAWTPNGGTTLYIESTLIPGNGGLI  645


>sp|Q8CAQ8.1|IMMT_MOUSE RecName: Full=Mitochondrial inner membrane protein; AltName: 
Full=Mitofilin
Length=757

 Score = 31.2 bits (69),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 17/51 (34%), Positives = 26/51 (51%), Gaps = 3/51 (5%)

Query  235  REGSVSLSNITVFQNSSTHSVEL--NLADATIDNLEIVGSNYGIKWTAIGG  283
            R  SV+L  IT  QN++  +V+   N+    +DN EI G     +W  + G
Sbjct  229  RTSSVTLQTITA-QNAAVQAVKAHSNILKTAMDNSEIAGEKKSAQWRTVEG  278