GOS 2163010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091120566213
Annotathon code: GOS_2163010
Sample :
  • GPS :0°35'38s; 91°4'10w
  • Galapagos Islands: Mangrove on Isabella Island - Ecuador
  • Mangrove (-0.1m, 25.4°C, 0.1-0.8 microns)
Authors
Team : Algarve 2011
Username : ANVBQ
Annotated on : 2011-05-24 16:01:17
  • Calheiros André dos Santos
  • Martins Vânia Carina Correia
  • Rosinha Nádia Alexandra Saragoça

Synopsis

  • Taxonomy: Alphaproteobacteria (NCBI info)
    Rank: class - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 28211
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order:
    Bacteria; Proteobacteria; Alphaproteobacteria;

Genomic Sequence

>JCVI_READ_1091120566213 GOS_2163010 Genomic DNA
TTAGCCATTTTCCCTTCATCCAGCATCATGGAGCCCGTTTCCTTAAAGGATTTCATCATTTCAGCAAGCTTCGCGCTGTCTTTATCCAGTAGGAAATAGA
GATAACGCTCGAAATTGCTGGAAATCTGGATATCCATGGACGGACTTAAGGTCGGATGGGCTTGGGTGATTTTCATCTCACCGGTTTCGAAAAAGCGCGT
GAGGATATCGTTTTTATTGGTGGAAATACTGAGAAATTCCATCGGCAGTCCCATTTGCCGCGCACAATAGGCTGCAAAGACATTCCCGAAATTCCCCGTC
GGCACGACGAAAGACACGGACTTGGTACCCGCATCTAATTGAAGGCCGCAATAAACGTAATAGACGATCTGCGCCATGATCCGCGCCCAGTTGATGGAGT
TTACAGCCGATAAATTGACGCTCTGACGGAAATCCTCATCGGCAAACATGGCCTTGACCATATTCTGGCAATCATCAAAGGTCCCTTCCAGCGCGATATT
ATGCACATTACCGGCCAGAACGGTGGTCATTTGCCGGCGCTGCACCTCTGAAATGCGGCCCTTCGGGTGGAGGATAAAAATATCGATATGATTGCTCTTA
TAACACCCCTCAATCGCCGCCGAGCCCGTATCGCCCGAAGTCGCCCCGACAATGGTGATGTTCTTATGCTCTCTGGCCAGCACATAATCAAACAGCTGTC
CCAGTAATTGCAGTGCCACATCCTTAAAAGCAATGGTCGGTCCGTGAAACTGTTCCATGACATAGATTTTATCGTTTTCATAGCCTTTAAGATGATGGAG
TGGCACAATGCCATCACAGAAATTTTCCGGGCCATAAACACGTTTTAAAATTTCCCTGAAATCATCTTGCGGGATCGAACTGCCGACAAAGGGGTACATA
ACCATTTCCGCCGTCTCGATATATGATTTACCATTCAGGCAAGGAGGTTCAACTCTGCCAGTGA

Translation

[3 - 962/964]   indirect strand
>GOS_2163010 Translation [3-962   indirect strand]
TGRVEPPCLNGKSYIETAEMVMYPFVGSSIPQDDFREILKRVYGPENFCDGIVPLHHLKGYENDKIYVMEQFHGPTIAFKDVALQLLGQLFDYVLAREHK
NITIVGATSGDTGSAAIEGCYKSNHIDIFILHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSAVNSINWARIMAQIV
YYVYCGLQLDAGTKSVSFVVPTGNFGNVFAAYCARQMGLPMEFLSISTNKNDILTRFFETGEMKITQAHPTLSPSMDIQISSNFERYLYFLLDKDSAKLA
EMMKSFKETGSMMLDEGKMA

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

The sequence is coding because it is greater than 60 amino acids and it presents significant homologous with low E-values.The molecular weight was not calculated because the ORF is not complete.

The results obtained by InterProScan (E_6.7e-70) and BLASTp (E_3e-103) suggest that the protein is a threonine synthase.This protein is envolved in the biosynthesis of amino acids, because it is responsible for a terminal step in the synthesis of threonine synthase, catalyzing the conversion of phospho-homoserine to threonine and inorganic phosphate. (1) The most probable taxon for this organism is alpha-proteobacteria, according the results of the taxonomy reports (this is the taxon with the higher number of hits, lowest E-values and high scores) and the phylogenetic tree (the GOS sequence is in the same branch than the ingroups and these are well separeted from the outgroups with a branch support value 1, in BioNJ, and 0.99, in PhyML). The organism is nearnest to Azospirillum sp., but we can not say with certainty that it is this organism because the identity in the parallel alignmemt is 58% and although in PhyML the branch support value is 0.95, in BioNJ the branch support value is 0.66.



(1) Parsot, C. (1987), A common origin for enzymes involved in the terminal step of the threonine and tryptophan biosynthetic pathways, Biochemistry, 84: 5207-5210.

ORF finding

PROTOCOL


a)SMS ORFinder / direct strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

b)SMS ORFinder / reverse strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code




RESULTS ANALYSIS


The sms/ORFinder returned four ORFs: one in the direct strand (on the reading frame 3 with 63 amino acids) and three in the reverse strand (one in the reading frame 1 with 106 amino acids, one in reading frame 2 with 74 amino acids, one in the reading frame 3 with 320 amino acids). The longest ORF is in the reading frame 3 of the reverse strand, and it probably has a biological function. This ORF has 960 nucleotides from base 3 to base 962. It has not a STOP codon, so it has incomplete in 3' end; because it does not start with a methionine it could be incomplete in 5' end (this will be confirmed in the multiple alignment). This is a coding ORF because it has homologous proteins and it is greater than 200 amino acids. There was no reported a biological function for the others ORF (although in the ORF 1 in the reading frame 3 of the direct strand was reported a alignment with a hypothetical protein, this is not a homologous considerable because the E-value is high, E_8,4).


RAW RESULTS

a) Forward strand

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 150 to base 338.
GGTCGGATGGGCTTGGGTGATTTTCATCTCACCGGTTTCGAAAAAGCGCGTGAGGATATC
GTTTTTATTGGTGGAAATACTGAGAAATTCCATCGGCAGTCCCATTTGCCGCGCACAATA
GGCTGCAAAGACATTCCCGAAATTCCCCGTCGGCACGACGAAAGACACGGACTTGGTACC
CGCATCTAA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
GRMGLGDFHLTGFEKAREDIVFIGGNTEKFHRQSHLPRTIGCKDIPEIPRRHDERHGLGT
RI*

--------------------------------------------------------------------------

b) reverse strand

>ORF number 1 in reading frame 1 on the reverse strand extends from base 121 to base 438.
AACGTGTTTATGGCCCGGAAAATTTCTGTGATGGCATTGTGCCACTCCATCATCTTAAAG
GCTATGAAAACGATAAAATCTATGTCATGGAACAGTTTCACGGACCGACCATTGCTTTTA
AGGATGTGGCACTGCAATTACTGGGACAGCTGTTTGATTATGTGCTGGCCAGAGAGCATA
AGAACATCACCATTGTCGGGGCGACTTCGGGCGATACGGGCTCGGCGGCGATTGAGGGGT
GTTATAAGAGCAATCATATCGATATTTTTATCCTCCACCCGAAGGGCCGCATTTCAGAGG
TGCAGCGCCGGCAAATGA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
NVFMARKISVMALCHSIILKAMKTIKSMSWNSFTDRPLLLRMWHCNYWDSCLIMCWPESI
RTSPLSGRLRAIRARRRLRGVIRAIISIFLSSTRRAAFQRCSAGK*

>ORF number 1 in reading frame 2 on the reverse strand extends from base 530 to base 751.
GGATTTCCGTCAGAGCGTCAATTTATCGGCTGTAAACTCCATCAACTGGGCGCGGATCAT
GGCGCAGATCGTCTATTACGTTTATTGCGGCCTTCAATTAGATGCGGGTACCAAGTCCGT
GTCTTTCGTCGTGCCGACGGGGAATTTCGGGAATGTCTTTGCAGCCTATTGTGCGCGGCA
AATGGGACTGCCGATGGAATTTCTCAGTATTTCCACCAATAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
GFPSERQFIGCKLHQLGADHGADRLLRLLRPSIRCGYQVRVFRRADGEFRECLCSLLCAA
NGTADGISQYFHQ*

>ORF number 1 in reading frame 3 on the reverse strand extends from base 3 to base 962.
ACTGGCAGAGTTGAACCTCCTTGCCTGAATGGTAAATCATATATCGAGACGGCGGAAATG
GTTATGTACCCCTTTGTCGGCAGTTCGATCCCGCAAGATGATTTCAGGGAAATTTTAAAA
CGTGTTTATGGCCCGGAAAATTTCTGTGATGGCATTGTGCCACTCCATCATCTTAAAGGC
TATGAAAACGATAAAATCTATGTCATGGAACAGTTTCACGGACCGACCATTGCTTTTAAG
GATGTGGCACTGCAATTACTGGGACAGCTGTTTGATTATGTGCTGGCCAGAGAGCATAAG
AACATCACCATTGTCGGGGCGACTTCGGGCGATACGGGCTCGGCGGCGATTGAGGGGTGT
TATAAGAGCAATCATATCGATATTTTTATCCTCCACCCGAAGGGCCGCATTTCAGAGGTG
CAGCGCCGGCAAATGACCACCGTTCTGGCCGGTAATGTGCATAATATCGCGCTGGAAGGG
ACCTTTGATGATTGCCAGAATATGGTCAAGGCCATGTTTGCCGATGAGGATTTCCGTCAG
AGCGTCAATTTATCGGCTGTAAACTCCATCAACTGGGCGCGGATCATGGCGCAGATCGTC
TATTACGTTTATTGCGGCCTTCAATTAGATGCGGGTACCAAGTCCGTGTCTTTCGTCGTG
CCGACGGGGAATTTCGGGAATGTCTTTGCAGCCTATTGTGCGCGGCAAATGGGACTGCCG
ATGGAATTTCTCAGTATTTCCACCAATAAAAACGATATCCTCACGCGCTTTTTCGAAACC
GGTGAGATGAAAATCACCCAAGCCCATCCGACCTTAAGTCCGTCCATGGATATCCAGATT
TCCAGCAATTTCGAGCGTTATCTCTATTTCCTACTGGATAAAGACAGCGCGAAGCTTGCT
GAAATGATGAAATCCTTTAAGGAAACGGGCTCCATGATGCTGGATGAAGGGAAAATGGCT


>Translation of ORF number 1 in reading frame 3 on the reverse strand.
TGRVEPPCLNGKSYIETAEMVMYPFVGSSIPQDDFREILKRVYGPENFCDGIVPLHHLKG
YENDKIYVMEQFHGPTIAFKDVALQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEGC
YKSNHIDIFILHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQ
SVNLSAVNSINWARIMAQIVYYVYCGLQLDAGTKSVSFVVPTGNFGNVFAAYCARQMGLP
MEFLSISTNKNDILTRFFETGEMKITQAHPTLSPSMDIQISSNFERYLYFLLDKDSAKLA
EMMKSFKETGSMMLDEGKMA

Multiple Alignement

PROTOCOL


Phylogeny.fr/MUSCLE


RESULTS ANALYSIS


The sequences used in the multiple alignment have approximately the same size.

The sequence is incomplete in 5' end, because the homologous have four more aminoacids in this end and also is incomplete in 3'end, because the homologous have more aminoacids in this end (more than a hundred).

The results of the multiple alignment are concordant with the results of the protein domain, because the coordinates of the domain (64-302) are in the region very conserved in the alignment (approximately 56-353).

RAW RESULTS

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
out_gi_Ralstoni  -----MQYRSTRGHAEPQSFSRILLGGLAPDGGLYLPEQYPQVSVDELTRWRDLPYADLA
out_gi_Neisseri  -----MKYISTRGETAHKPFSEVLLMGLAPDGGLMLPEHYPQIGREALDKWRGLAYPELA
out_gi_Allochro  -----MHYISTRGGIEPIGFAQAVMMGLATDGGLLVPAEIPALEPARLRTWADLSFQDLA
out_gi_Pelobact  -----MRYISTRGGIQPINFKDAVMMGLATDGGLLLPESYPQISRQELDQWRSLSYPDLA
out_gi_Geobacte  -----MKYISTRGNIQPVGFKEAVMMGLATDGGLLLPERIPAIDAATLSSWRQLPYRELA
GOS_2163010      ---------TGRVEPPCLN---------------------------------GKSYIETA
gi_Zymomonas_mo  -----MRYISTRGAAAAQDFKGVTLTGLASDGGLYVPENWPAFSREDIAALAGLSYVDTA
gi_Citromicrobi  -----MRYVSTRGQAPVLDFEDVTLTGLASDGGLYLPQEWPQFSREEIAALRGLPYSKLA
gi_Sphingobium   -----MHYVSTRGSAPALGFEDVTLAGLASDGGLYVPESWPSFSADQIRALSGLSYVETA
gi_Erythrobacte  -----MEYISTRGSAPTLDFEGATLAGLASDGGLYLPREWPRLSHEEIRELRGLSYAQLA
gi_Azospirillum  -----MRYVSTRGAAPVLGFEDVLLAGLARDGGLYVPESWPQFTADDIRALRGLPYSEIA
gi_Pseudovibrio  -----MRYVSTRGDAPELDFSEVLLTGLARDGGLYLPKEFPQLSTEEISGFAGKPYSEVA
gi_Brucella_cet  -----MKYVSTRGEAPVLGFSDALLAGLARDGGLYLPQEYPQFTAEQIRALRGKSYVEVA
gi_Brucella_mel  -----MKYVSTRGEAPVLGFSDALLAGLARDGGLYLPQEYPQFTAEQIRALRGKSYVEVA
gi_Brucella_ovi  -----MKYVSTRGEAPVLGFSDALLAGLARDGGLYLPQEYPQFTAEQIRALRGKSYVEVA
gi_Ochrobactr_i  -----MKYVSTRGEAPVLGFSDALLAGLARDGGLYLPQDYPQFSPEQIRDLRGKSYVDIA
gi_Ochrobactr    MKAQEMKYVSTRGEAPVLGFSDALLAGLARDGGLYLPQDYPQFSPEQIRDLRGKSYVDIA
gi_Methylobacte  -----MLHVSTRGAAAPLSFSDALLAGLARDGGLYVPESWPQISRAEIAGFAGMRYAEVA
gi_Parvibaculum  -----MKYVSTRGIAPELEFEDALLAGLARDGGLYVPVEWPQLSERKIRALAGLPYEEVA
gi_Xanthobacter  -----MRYVSTRGEAPVLSFSDALLAGLARDGGLYLPEAWPTLSRDEIAALAGKPYAAVA
gi_Azorhizobium  -----MRYVSTRGEAPTLSFADALLAGLARDGGLYVPETWPTLSAAEIAGLAGKSYADVA
                                                                        #####


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
out_gi_Ralstoni  FEILRKFA-TDIPEDDLRALTRRTY--TPDVYCNARAGDNTADITPLHKLGEEGGTSLSL
out_gi_Neisseri  FEIMRLFV-TDIPEDDLRDILNRTYTEAAFGT---------KEITPVRTL----SDGIKI
out_gi_Allochro  LEVSTLFVGDEIPRADLKALIERSY--ATFSH---------PEVTPIVT-----AGETRI
out_gi_Pelobact  LRIISPFV-DDIPVDDLKGLIQRSY--ATFNH---------PQVTPVVH-----RDGVHI
out_gi_Geobacte  FRIISLFA-DDIPANDLKRLIDSSY--DSFDH---------KEITPVVK-----ENGVYI
GOS_2163010      EMVMYPFVGSSIPQDDFREILKRVY--GPENFC--------DGIVPLHHLKGYENDKIYV
gi_Zymomonas_mo  VAVMRPFVSGVLDDQALKNLCGAAY--GQFNH---------AAVTPLVQL----DERHFL
gi_Citromicrobi  VQIMAPFVGESLTEAELRDLCQRAY--GNFSH---------AATTPLVQL----DEQHWL
gi_Sphingobium   VRVMAPFVAGSLNEEELRELCAAAY--GRFSH---------DAVTPLVQL----DHRHWL
gi_Erythrobacte  ARIMLPFVEGALTEDELEELCETVY--GDFGH---------ASVTPLVQM----DETHWL
gi_Azospirillum  VRVMLPFLGGSIAEDEFRAIVRDAY--ASFDH---------AAVTPLVQV----DPTTWV
gi_Pseudovibrio  LKVIAPFVGDSIPHDDLKQMIDEAY--ASFAH---------RAVTPLVQT----APNTYV
gi_Brucella_cet  LAVLTPFTGGEIPAADFERTVREAY--GTFRH---------DAVCPLVQT----DANEFV
gi_Brucella_mel  LAVLTPFTGGEIPAADFERMVREAY--GTFRH---------DAVCPLVQT----DANEFV
gi_Brucella_ovi  LAVLTPFTGGEIPAADFERMVREAY--GTFRH---------DAVCPLVQT----DANEFV
gi_Ochrobactr_i  LAVLTPFVDGEIPHSDFRRMVHEAY--GSFRH---------DAVCPLVQT----GANEFV
gi_Ochrobactr    LAVLTPFVDGEIPHSDFRRMVHEAY--GTFRH---------DAVCPLVQT----GANEFV
gi_Methylobacte  KRVLRPLIDGEIPDDALDEMIEAAY--ATFRH---------PAICPLTQI----DDNLFL
gi_Parvibaculum  FRVMRPFIGEAIGDDDLQRMIGEAY--ASFRH---------KAIVPLRQL----GSNDWL
gi_Xanthobacter  KAVIGPFVGDALPPRALDLMIDDAY--AGFRH---------PAVAPLTQI----GANRFL
gi_Azorhizobium  RAVITPFVGDALPKAALDTMISDAY--RAFRH---------PATTPVVQL----GPNRFL
                 ########   ##############                                   


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
out_gi_Ralstoni  LCLSNGPTLAFKDMAMQLLGNLFEYAL-DREHAELNILGATSGDTGSAAEYAMRGKRGVR
out_gi_Neisseri  QALSNGPTLAFKDMAMQFLGNAFEYVL-NKEGKKLNILGATSGDTGSAAEYALRGKKGVN
out_gi_Allochro  LELFHGPTAAFKDVALQWLGNLFEYLL-EREGGRLNIVGATSGDTGSAAIYGVRGKERIQ
out_gi_Pelobact  LELFHGVTLAFKDVALQLLGNLFEYIL-AERGERLNILGATSGDTGSAAIHGVRGKKGIT
out_gi_Geobacte  AELFHGPTLAFKDVALQFLGNLFEYLL-KESGQKMNIVGATSGDTGSAAIYGVRGKENIN
GOS_2163010      MEQFHGPTIAFKDVALQLLGQLFDYVL-AREHKNITIVGATSGDTGSAAIEGCYKSNHID
gi_Zymomonas_mo  LELFHGPTLAFKDVALQLLGHLFEKFLSEEKGQDLTIVGATSGDTGSAAISAVAGRAGVQ
gi_Citromicrobi  LELFHGPTLAFKDVALQLLGLFFETFL-EKRERPLTIIGATSGDTGSAAIHAVAGRENAQ
gi_Sphingobium   LELFHGPTLAFKDVALQLLGQLFERFL-SRRDDHLTIVGATSGDTGSAAIDAVAGREKID
gi_Erythrobacte  LELFHGPTLAFKDVALQMLGHLFEIFL-ARSDERLTIVGATSGDTGSAAINAVAGRERVE
gi_Azospirillum  LELFHGPTLAFKDVALQLLGRLFDHVL-AKRGQRVTIVGATSGDTGSAAIEACRDRQNVD
gi_Pseudovibrio  LELFHGPTLAFKDVAMQLLGRLMDYVL-AQKGARATIVGATSGDTGGAAIEAFRGRERTD
gi_Brucella_cet  LELFHGPTLAFKDVAMQLLARMMDYVL-AQRGERATIVGATSGDTGGAAIEAFGGRDNTD
gi_Brucella_mel  LELFHGPTLAFKDVAMQLLARMMDYVL-AQRGERATIVGATSGDTGGAAIEAFGGRDNTD
gi_Brucella_ovi  LELFHGPTLAFKDVAMQLLARMMDYVL-AQRGERATIVGATSGDTGGAAIEAFGGRDNTD
gi_Ochrobactr_i  LELFHGPTLAFKDVAMQLLARMMDYVL-AQRGERATIVGATSGDTGGAAIEAFGGRDNTD
gi_Ochrobactr    LELFHGPTLAFKDVAMQLLARMMDYVL-AQRGERATIVGATSGDTGGAAIEAFGGRDNTD
gi_Methylobacte  MELFHGPTLAFKDVAMQLLGRLMDYVL-RQKGGRATIVGATSGDTGSAAVEAFKGLDQVD
gi_Parvibaculum  LELFHGPTLAFKDVAMQILARLFDHVL-AAKGRRVTVVGATSGDTGSAAIEAFKGRDTTD
gi_Xanthobacter  LELFHGPTLAFKDVAMQLLARLMDHVL-ASRGSRATIVGATSGDTGSAAIEAFRRSDAVD
gi_Azorhizobium  LELFHGPTLAFKDVAMQLLARLMDHVL-ATRNGRATIVGATSGDTGSAAIEAFRHTDAVD
                 ########################### ################################


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
out_gi_Ralstoni  VFMLSPHRKMSAFQTAQMFSLQDKNIFNIAIEGVFDDAQDIVKAVSNDLDYKARQKIGTV
out_gi_Neisseri  VFMLSPDGKMSAFQRAQMYSLQDGNIHNIAVKGMFDDCQDIVKAVQNDAAFKEKYHIGTV
out_gi_Allochro  IFILHPKGRVSPIQERQMTTVLDGNVHNVAVRGTFDDAQNIVKTLFNDLPFKSAYRLGAV
out_gi_Pelobact  IFILHPHGKTSPVQALQMITVGDANVHNIAIRGTFDDCQNMVKALFNDLQFKEKYSLGAV
out_gi_Geobacte  IFILHPHGKTSPIQARQMTTVLDANVHNIAVKGTFDDCQNIVKELFNDLTFKEKYALGAV
GOS_2163010      IFILHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSAV
gi_Zymomonas_mo  IVMLHPNGRVSEVQRRQMTTVLDKNVHNVAIDGSFDDAQAIVKAMFNDSDFRKRHRLGAV
gi_Citromicrobi  IFMLHPEGRVSEIQRRQMTTVSAPNVHNIAIAGSFDDAQAMVKRMFADPALTATLDIGAV
gi_Sphingobium   IFMLHPDGRVSDVQRRQMTTVLAPNVHNIAIDGSFDDAQALVKAMFNDADFARRFNLSAV
gi_Erythrobacte  IFMLHPSGRVSEVQRRQMTTVRAPNVHNLAIEGSFDDAQRHVKRMFADESVTGTLNLGAV
gi_Azospirillum  IFILHPKGRTSEVQRRQMTSVLSSNVHNIALDGTFDDCQDLVKAMFNDGAFRDRMGLSAV
gi_Pseudovibrio  VFILFPEGRVSPVQQRQMTTAKEDNIHALAIKGNFDDCQGILKDLFNNFSFRERVGLSGV
gi_Brucella_cet  IFILFPNGRVSPVQQRQMTSSGFSNVHALSIEGNFDDCQNLVKGMFNDLEFRDALSLSGV
gi_Brucella_mel  IFILFPNGRVSPVQQRQMTSSGFSNVHALSIEGNFDDCQNLVKGMFNDLEFCDALSLSGV
gi_Brucella_ovi  IFILFPNGRVSPVQQRQMTSSGFSNVHALSIEGNFDDCQNLVKGMFNDLEFRDALSLSGV
gi_Ochrobactr_i  IFILFPNGRVSPVQQRQMTSSGFSNVHALSIEGNFDDCQNLVKAMFNDLQFRDALSLSGV
gi_Ochrobactr    IFILFPNGRVSPVQQRQMTSSGFSNVHALSIEGNFDDCQNLVKGMFNDLQFRDALSLSGV
gi_Methylobacte  VFILFPHGRVSEVQRRQMTTVNAPNVHALAIDGNFDDCQNIVKAMFQHGDFADKVKLSGV
gi_Parvibaculum  IFILHPKGRVSEVQRRQMTTVLDANVHNIAIEGSFDDCQALVKAMFNDHGFRDEVSLAGV
gi_Xanthobacter  VFILYPHGRVSEVQRRQMTTVNSPSVHAIAVEGTFDDCQNLVKAMFNHHAFRDSLALAGV
gi_Azorhizobium  VFILYPHNRVSEVQRRQMTTVGGANVHAIAVEGTFDDCQAHVKAMFNHAAFRDRLALAGV
                 ############################################################


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
out_gi_Ralstoni  NSINWARVVAQVVYYFKGYLLAA-PKIGDKVSFCVPSGNFGNVCAGHIARMMGLPIDKLV
out_gi_Neisseri  NSINWGRIVAQVVYYFAGYFNAT-SSNDETVSFCVPSGNFGNVCAGHIAKQMGLPVRRLI
out_gi_Allochro  NSINWARILAQTVYYFYAWGRITGGDTERRISFSVPTGNFGDVFAGYLARRMGLPIDRLV
out_gi_Pelobact  NSINWARVLAQVVYYFYAWLRVT-DEGDRPVCFSVPTGNFGDIFAGYVAKRMGLPMGRLL
out_gi_Geobacte  NSINWARVLAQVVYYFYAWFRVS-DEVDSPITFSVPTGNFGDIFAGFVAKRMGLPIDKLL
GOS_2163010      NSINWARIMAQIVYYVYCGLQL--DAGTKSVSFVVPTGNFGNVFAAYCARQMGLPMEFLS
gi_Zymomonas_mo  NSINWARLMAQIVYYFYAAVRL--GAPDRKVAFSVPTGNFGDVFAGYAAKKMGLPVEKLI
gi_Citromicrobi  NSINWARLMAQVVYYFYAALQL--GAPDRKMSFSVPTGNFGDVFAGYVAAQMGLPVERLI
gi_Sphingobium   NSINWARLMAQVVYYFYAAVRL--GAPDRAIAFSVPTGNFGDVFAGYVAAKMGLPVAKLM
gi_Erythrobacte  NSINWARLMAQVVYYFYSALQL--GGPDRKIAYSVPTGNFGDVFAGYVAAQMGLPIERLI
gi_Azospirillum  NSINWARIMAQIVYYFTAAVAL--GAPDRKVAFTVPTGNFGNVYAAYGARAMGLPVETLV
gi_Pseudovibrio  NSINWARIVAQVVYYFTSAVSL--GAPHRKVSFTVPTGNFGDVFAGYVAQQMGLPIEKLV
gi_Brucella_cet  NSINWARIMPQVVYYFTAALSL--GAPDRAVSFTVPTGNFGDIFAGYVAKRMGLPIEQLI
gi_Brucella_mel  NSINWARIMPQVVYYFTAALSL--GAPDRAVSFTVPTGNFGDIFAGYVAKRMGLPIEQLI
gi_Brucella_ovi  NSINWARIMPQVVYYFTAALSL--GAPDRAVSFTVPTGNFGDIFAGYVAKRMGLPIEQLI
gi_Ochrobactr_i  NSINWARIMPQVVYYFTAALSL--GAPDRAVSFTVPTGNFGDIFAGYVAKRMGLPIDRLI
gi_Ochrobactr    NSINWARIMPQVVYYFTAALSL--GAPDRAVSFTVPTGNFGDIFAGYVAKRMGLPIDQLI
gi_Methylobacte  NSINWARVAAQTVYYFTSAVAL--GAPHRKVSFAVPTGNFGDVLAGWVAKRMGLPIERLM
gi_Parvibaculum  NSINWGRVMAQIVYFFTAAVAL--GGPARPVAFSVPTGNFGDIFAGYAAARMGLPIEKLI
gi_Xanthobacter  NSINWARIVAQVVYYFYAATAL--GAPHRDVSFVVPTGNFGDILAGWVAKKMGLPIRDLT
gi_Azorhizobium  NSINWARIVAQVVYYFYAAVAL--GAPHREVSFVVPTGNFGDIFAGWVAKRMGLPVRDLT
                 ######################  ####################################


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
out_gi_Ralstoni  VATNENDVLDEFFRTGTYRVRSAAQTYHTSSPSMDISKASNFERFVFDLLDRDPARLAQL
out_gi_Neisseri  VATNENDVLDEFFKTGAYRPRNSAHTYVTSSPSMDISKASNFERFVFDLMDRDPQEINTL
out_gi_Allochro  IATNRNDILTRFIHSGVYAVEDAVHQ--TLSPAMDIQIASNFERYLYYLHDGDQARVCAL
out_gi_Pelobact  LATNENNILTRFVRDGDYSLANVV-A--TVSPSMDIQLASNFERYLFHLYDQDPGRVRAA
out_gi_Geobacte  LATNENNILTRFINEGDYSIGSVV-Q--TVSPSMDIQVASNFERYLYYLFDENPARVRDI
GOS_2163010      ISTNKNDILTRFFETGEMKITQAH-P--TLSPSMDIQISSNFERYLYFLLDKDSAKLAEM
gi_Zymomonas_mo  VATNINDILYRALSAGDYSVGNVT-P--TDAPSMDIQISSNFERLLFDLHGRDAASLAAT
gi_Citromicrobi  VATNKNDILARAIRDGDYSMGESH-A--TITPSMDIQVSSNFERLLFEANGRDAAALAAQ
gi_Sphingobium   VATNVNDILHRALAEGDYSQGQVV-A--TATPSMDIQVSSNFERLLFDAGGRDGKALAEQ
gi_Erythrobacte  VATNVNDILHRALTKGDYSAGETT-A--TITPSMDIQVSSNFERLLFDVGGRDGPAMAHQ
gi_Azospirillum  VGSNSNDILARFFASGSMVAAPVV-P--TLSPSMDIQISSNFERLLFDLLDRDGTAVTAA
gi_Pseudovibrio  IATNTNDILARTLETGRYETRGVV-A--TTAPSMDIQVSSNFERLLFAANDKDSATVKSQ
gi_Brucella_cet  IATNDNDILSRTLESGAYEMRGVA-Q--TTSPSMDIQISSNFERLLFEAHGRDAAAVRGL
gi_Brucella_mel  IATNDNDILSRTLESGAYEMRGVA-Q--TTSPSMDIQISSNFERLLFEAHGRDAAAVRGL
gi_Brucella_ovi  IATNDNDILSRTLESGAYEMRGVA-Q--TTSPSMDIQISSNFERLLFEAHGRDAAAVRGL
gi_Ochrobactr_i  IATNDNDILSRTLETGAYEMRGVA-Q--TTSPSMDIQISSNFERLLFEAHGRDAAALRGL
gi_Ochrobactr    IATNDNDILSRTLETGAYEMRGVA-Q--TTSPSMDIQISSNFERLLFEAHGRDAAALRGL
gi_Methylobacte  IGTNANDILARTLEHGAYEPRGVQ-P--TTSPSMDIQISSNFERLLFEALGRDASALGRL
gi_Parvibaculum  VATNVNDILARTMESGRYEVDKVV-P--TISPSMDIQVSSNFERLLFDAYGRDGATVTRL
gi_Xanthobacter  IATNVNDILVRTLDTGRYEVKGVL-P--SSSPSMDIQISSNFERLLFEALDRDSAVLRQL
gi_Azorhizobium  IATNVNDILARTLATGRYEVKGVQ-P--SSSPSMDIQVSSNFERLLFEAVDRDAGTVRQL
                 #######################     #########################       


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
out_gi_Ralstoni  FRDVDEKGGFSMTGKPEFDRIAEFGFVSGRSSHDDRVDTIRDVFATYGTMIDTHTADGVK
out_gi_Neisseri  WTEVAAGKGFDLQFA-LDKVGGKYGFTSGKSTHADRLATIKQVYEQDQELIDPHTADGVK
out_gi_Allochro  LDDLKRTGRLEVSAERHRQAQAD--FDAVAVSDAETLDQIRATYEASGYILCPHTAVGVR
out_gi_Pelobact  FAELRECGRISFTPAEMEQVRAD--FCSATVDQAATLETIGSFNRETGYLLDPHTAVGVR
out_gi_Geobacte  FTRFAATGRMDFTDEEMRTVRRE--FASRSVNEQETLDTIAAFHQETGYLLDPHTAVGVK
GOS_2163010      MKSFKETGSMMLDEGKMA------------------------------------------
gi_Zymomonas_mo  MAQFEQSRAIQISDAMRQQAATI--FSSKRIDPDEMAATMRWASDKAGQVIDPHTAIGLA
gi_Citromicrobi  MDGFASSKTLPLESAQREAIAAM--FSAERATPEETLAAMRWAHERCGEVIDPHTAVGLH
gi_Sphingobium   MKGFEASKAMRLTNAQRDGASAL--FTSARVDADAMTMAMRWAYDAAGQVIDPHSAIGLA
gi_Erythrobacte  MSGFDASKAMQLTNAQREGASAL--FSSARADQDETARALQWAYRNAGQVIDPHTGVGLH
gi_Azospirillum  LNRFRAEGKFTVTDAQLARALAI--FSGHRVDEAATMATIADVWKGSLYLLDPHTAVGIG
gi_Pseudovibrio  MDSLKQSGGFTLSEKALGFIKEK--FSAGRASEEDTAQTITDTLKESGYLLDPHTAVAIH
gi_Brucella_cet  MQGLKQSGGFTISEKPLSAIRSE--FSAGRSTVDETAATIESVLSKDGYLLDPHSAIGVK
gi_Brucella_mel  MQGLKQSGGFTISEKPLSAIRSE--FSAGRSTVDETAATIESVLSKDGYLLDPHSAIGVK
gi_Brucella_ovi  MQGLKQSGGFTISEKPLSAIRSE--FSAGRSTVDETAATIESVLSKDGYLLDPHSAIGVK
gi_Ochrobactr_i  MAGLKQSGGFSISEKPLSAIRSE--FSAGRSTVDETAETIKSVLEADGYLLDPHSAIGVK
gi_Ochrobactr    MDSLKQSGGFSISEKPLSAIRSE--FSAGRSTVDETAETIKSVLEADGYLLDPHSAIGLK
gi_Methylobacte  MAGLKQSGGFSLSPEVLGTVRNE--FDATAVREPDVVEEIAGTFRKTGLVLDPHSAIGVR
gi_Parvibaculum  MQSLSQSGAFTIDALRLEAIRAQ--FGAARVDESETSATIKETLAATGELLDPHSAVGLA
gi_Xanthobacter  MDQLAQSGSFSVPRAALAAICAD--FSAGRADEPETAATIARLYQSAGYLCDPHTAVGLA
gi_Azorhizobium  MASLGQSGAFTLPHAAQAAIAGE--FSADRADEPETAATISRLYRESGYVADPHTAVALA
                                                                             


                        430       440       450       460       470       480
                 =========+=========+=========+=========+=========+=========+
out_gi_Ralstoni  VARE-----NLTPGVPMVVLETALPAKFGDTIREAL-DREPERPAGYADIESLPQRFEVM
out_gi_Neisseri  VARE-----VREEGETVVCLETALAAKFDATICEAVGDVAIPRPAALEGLENLPQRVQTV
out_gi_Allochro  AARDL---------PEAVCLATAHPAKFGEAVVQAI-GCEAPPPPSLLGLLEKEARCAEL
out_gi_Pelobact  AALD-----LLPSDAARVCLATAHPAKFGEAVEKAV-GTPAPVPGSIAALAGMETRCTVM
out_gi_Geobacte  AALA------CVTDGTAVCLATAHPAKFGEAVEKAT-GTAPPFPACLAGIEQLPTRCEIM
GOS_2163010      ------------------------------------------------------------
gi_Zymomonas_mo  AARET----DLPKDVPVVTLATAHPAKFPDAVSRIT-GKNAPLPHRLADLYSREERYVEL
gi_Citromicrobi  AARAL----AAEAAVPVVTLATAHPAKFPDAVEQAI-GIEAELPARVGDLFALEERFETL
gi_Sphingobium   AARSI----DLDPAVPVVTLATAHAAKFPTAVERAT-GIRPSLPSRVGDLFAREEAYAKL
gi_Erythrobacte  AAQVAE---GIAPGTPIVTLATAHPAKFRDAVERAV-GVRPSLPARVGDLFGREEMFTEL
gi_Azospirillum  AAKAAVAAGRVDPTVAMVVLATAHPAKFPDAVEKAT-GRRPDLPPRLSDLYVREERLSEL
gi_Pseudovibrio  VAKE-----HNDGVTPMIVLSTAHPAKFPAAVESAS-GIHPDLPAHLSDLMEREEKFSVL
gi_Brucella_cet  VARE-----KASGTAPMVVLATAHPAKFPDAVKAAC-GVEPQLPAWLCDLMQRKESFTVL
gi_Brucella_mel  VARE-----KASGTAPMVVLATAHPAKFPDAVKAAC-GVEPQLPAWLCDLMQRKESFTVL
gi_Brucella_ovi  VARE-----KASGTAPMVVLATAHPAKFPDAVKAAC-GVEPQLPAWLCDLMQRKESFTVL
gi_Ochrobactr_i  VARE-----NQSSEAPMVVLATAHPAKFPDAVKAAS-GVEPQLPAWLSDLMQRKESFTVL
gi_Ochrobactr    VARE-----NVSNTAPMVVLATAHPAKFPDAVKAAS-GVEPQLPAWLSDLMERKESFTVL
gi_Methylobacte  AGRRLL---EKDPATPVVALATAHPAKFPDAVSQATGGGRPVLPPHLAELMTRPETVANL
gi_Parvibaculum  AAARL----RGDPSVPMITLATAHPAKFPDAVKAAT-GIHPDLPPAMADIFTREERLAAL
gi_Xanthobacter  VADKV----EHAARVPQVVLSTAHPAKFPDAVEAAT-GHRPALPPHMADLMTRRESVSVL
gi_Azorhizobium  VAEKV----EHARAVPQIVLSTAHPAKFPDAVEAAT-GKRPVLPPHMADLFNRKERLSVL
                                                                             


                        490       500
                 =========+=========+===
out_gi_Ralstoni  PADVDRIKGYIAQHTGL------
out_gi_Neisseri  PNSADAVKGIIEQTLA-------
out_gi_Allochro  DASAEAVKEHIEATLKTVSAA--
out_gi_Pelobact  DADLEKVRQFVVEHVA-------
out_gi_Geobacte  EANRTAIEKFIAEKAR-------
GOS_2163010      -----------------------
gi_Zymomonas_mo  PASRQTIQAYIDAGFQL------
gi_Citromicrobi  PADYDAVRDYISAKATR------
gi_Sphingobium   PGTFEAVTAYVAGRATPRG----
gi_Erythrobacte  GGDYEASRDFVLQTATPSAI---
gi_Azospirillum  PNDLSAVQDFVAKRARAAQEAA-
gi_Pseudovibrio  PADALEVAKFVEGSARAVKAGV-
gi_Brucella_cet  HNELKIVEEYVRHHSRA------
gi_Brucella_mel  HNELKIVEEYVRHHSRA------
gi_Brucella_ovi  HNELKIVEEYVRHHSRA------
gi_Ochrobactr_i  HNDLKIVEEYVRRHSRA------
gi_Ochrobactr    HNDLKIVEEYVRRHSRA------
gi_Methylobacte  ANDQAAIERYITEHARITRGN--
gi_Parvibaculum  PNDLGAVETFIRERARSVAA---
gi_Xanthobacter  PNDLAAIETFIRAHARIARGAAA
gi_Azorhizobium  PNDLDAIEAFISARARIVSGAAA

Protein Domains

PROTOCOL


Interpro, default parameters at EBI


RESULTS ANALYSIS


InterProScan returned eight domains, all overlapped: three are unintegrated (THREONINE SYNTHASE; SER/THR DEHYDRATASE, TRP SYNTHASE and one without description), DEHYDRATASE_SER_THR, PALP, Tryptophan synthase beta subunit-like PLP-dependent and thrC: threonine synthase. The unintegrated domains will be ignored and DEHYDRATASE_SER_THR has a E-value -1.0, so it has no a statistical meaning. In the remaining three PALP has the highest E-value (6.1E-24), the E-value for Tryptophan synthase beta subunit-like PLP-dependent is 1.1E-105 and for thrC: threonine synthase is 6.7E-70. Then Tryptophan synthase beta subunit-like PLP-dependent has the lowest E-value, however thrC: threonine synthase also has a significant E-value, 6.7E-70. The protein domain is thrC: treonine synthase because Tryptophan synthase beta subunit-like PLP-dependent is a family of PLP-dependent protein similar to tryptophan synthase beta subunit and thrC: threonine synthase is a more specific domain and so more informative. Claude Parsot also proved that triptophan synthase beta and treonine synthase have a common evolutionary origin. Both domains are involved in the byosynthesis of amino acids and the cofactor is a pyridoxal-phosphate, as well as the other domains found.

Therefore, the protein is involved in the synthesis of treonine.


(1) Parsot, C. (1987), A common origin for enzymes involved in the terminal step of the threonine and tryptophan biosynthetic pathways, Biochemistry, 84: 5207-5210.

RAW RESULTS

Sequence_1	78A4CE8034F22B67	320	HMMTigr	        TIGR00260	        thrC: threonine synthase                                 	64	302	6.7e-70	T	28-Apr-2011	IPR004450	Threonine synthase	                                        Molecular Function: threonine synthase activity (GO:0004795), Biological Process: threonine biosynthetic process (GO:0009088)
Sequence_1	78A4CE8034F22B67	320	Gene3D	        G3DSA:3.40.50.1100	no description                                            	96	170	0.00012	T	28-Apr-2011	NULL     	NULL	
Sequence_1	78A4CE8034F22B67	320	Gene3D	        G3DSA:3.40.50.1100	no description	                                               171	317	9.5e-66	T	28-Apr-2011	NULL    	NULL	
Sequence_1	78A4CE8034F22B67	320	PatternScan	PS00165	                DEHYDRATASE_SER_THR	                                        70	84	NA	T	28-Apr-2011	IPR000634	Serine/threonine dehydratase, pyridoxal-phosphate-binding site	Biological Process: cellular amino acid metabolic process (GO:0006520), Molecular Function: pyridoxal phosphate binding (GO:0030170)
Sequence_1	78A4CE8034F22B67	320	HMMPanther	PTHR10314:SF1	        THREONINE SYNTHASE	                                        12	304	1.6e-72	T	28-Apr-2011	NULL    	NULL	
Sequence_1	78A4CE8034F22B67	320	HMMPanther	PTHR10314	        SER/THR DEHYDRATASE, TRP SYNTHASE                       	12	304	1.6e-72	T	28-Apr-2011	NULL	        NULL	
Sequence_1	78A4CE8034F22B67	320	superfamily	SSF53686	        Tryptophan synthase beta subunit-like PLP-dependent enzymes	7	320	1.1e-105T	28-Apr-2011	IPR001926	Pyridoxal phosphate-dependent enzyme, beta subunit	        Molecular Function: catalytic activity (GO:0003824), Biological Process: metabolic process (GO:0008152), Molecular Function: pyridoxal phosphate binding (GO:0030170)
Sequence_1	78A4CE8034F22B67	320	HMMPfam	        PF00291	                PALP                                                     	54	285	6.1e-24	T	28-Apr-2011	IPR001926	Pyridoxal phosphate-dependent enzyme, beta subunit	        Molecular Function: catalytic activity (GO:0003824), Biological Process: metabolic process (GO:0008152), Molecular Function: pyridoxal phosphate binding (GO:0030170)

Phylogeny

PROTOCOL


a) Phylogeny.fr / BioNJ method / ingroup: alpha-proteobacteria outgroup: other proteobacteria

b) Phylogeny.fr / PhyML method / no bootstrap / default substitution model / ingroup: alpha-proteobacteria outgroup: other proteobacteria


RESULTS ANALYSIS


The trees obtained by BioNJ method and PhyML are cocordant because ingroups and outgroup are arranged by the same way as well as the GOS sequence. The root with branch support values smaller than 0.70 have no statistical meaning.

We observed that the outgroups are well separeted from the ingroups with a high branch support value (1 in BioNJ method and 0.99 in PhyML, then both trees are correct).

The nearest organism to the GOS sequence is Azospirillum sp., however the root between them has a branch support value 0.66 witch is less then 0.70 in BioNJ and 0.95 in the PhyML, and the identity obtained in the parallel alignment is 58%. Therefore we can conclude that the organism is a alpha-proteobacteria but however it is probable we can not declare that it is a Azospirillum sp..

RAW RESULTS

a) Phylogeny.fr / BioNJ method / ingroup: alpha-proteobacteria outgroup: other proteobacteria


                                                                                                       ----0.05---
 
                                    +-----------------------------Zymomonas_mobilis_subsp._mobilis                                                 (alpha-proteobacteria)
                            1       |
                    +---------------+    +---------------------Sphingobium_japonicum                                                               (alpha-proteobacteria)
                    |               |0.69|
                    |               +----+  0.97  +-------------------------Citromicrobium_bathyomarinum                                           (alpha-proteobacteria)
                    |                    +--------+
                    |                             +------------------------Erythrobacter_sp.                                                       (alpha-proteobacteria)
           1        |
 +------------------+
 |                  |         0.66  +---------------------------------------------------------GOS_2163010
 |                  |     +---------+
 |                  |     |         +---------------------------Azospirillum_sp.                                                                   (alpha-proteobacteria)
 |                  |     |
 |                  |0.56 |         +-----------------------------Parvibaculum_lavamentivorans                                                     (alpha-proteobacteria)
 |                  +-----+         |
 |                        |         |             +-----------------------------Methylobacterium_extorquens                                        (alpha-proteobacteria)
 |                        |         |         0.71|
 |                        |  0.99   |        +----+         1         +------------Xanthobacter_autotrophicus                                      (alpha-proteobacteria)
 |                        +---------+        |    +-------------------+
 |                                  |        |                        +------------Azorhizobium_caulinodans                                        (alpha-proteobacteria)
 |                                  |        |
 |                                  |        |                               +Brucella_ovis                                                        (alpha-proteobacteria)
 |                                  |  0.98  |                              1|
 |                                  +--------+                            +--+0.94
 |                                           |                            |  |----Brucella_ceti_str.                                               (alpha-proteobacteria)
 |                                           |                 1          |  |
 |                                           |   +------------------------+  +----Brucella_melitensis_bv.                                          (alpha-proteobacteria)
 |                                           |   |                        |
 |                                           |0.7|                        |  +---Ochrobactrum_intermedium                                          (alpha-proteobacteria)
 |                                           +---+                        +--+0.95
 |                                               |                           +---Ochrobactrum_anthropi                                       (alpha-proteobacteria)
 |                                               |
 |                                               +-----------------------------Pseudovibrio_sp.                                                    (alpha-proteobacteria)
 |
 |                            1                            +----------------------------------out_Ralstonia_pickettii                              (beta-proteobacteria)
 | +-------------------------------------------------------+
 | |                                                       |
 |1|                                                       +-------------------------out_Neisseria_meningitidis                                    (beta-proteobacteria)
 +-+
   |  0.91 +--------------------------------------out_Allochromatium_vinosum                                                                       (gamma-proteobacteria)
   +-------+
           |    0.97    +---------------------out_Pelobacter_propionicus                                                                           (delta-proteobacteria)
           +------------+
                        +----------------------------out_Geobacter_uraniireducens                                                                  (delta-proteobacteria)

b) Phylogeny.fr / PhyML method / no bootstrap / default substitution model / ingroup: alpha-proteobacteria outgroup: other proteobacteria

                                                                                                        -----0.1---
 
                                        1                          +--------------------------out_Ralstonia_pickettii                             (beta-proteobacteria)
            +------------------------------------------------------+
     0.99   |                                                      +----------out_Neisseria_meningitidis                                           (beta-proteobacteria)
 +----------+
 |          |       +-----------------------------out_Allochromatium_vinosum                                                                       (gamma-proteobacteria)
 |          |  0.74 |
 |          +-------+         +---------------out_Pelobacter_propionicus                                                                           (delta-proteobacteria)
 |                  |   0.71  |
 |                  +---------+
 |                            +--------------out_Geobacter_uraniireducens                                                                          (delta-proteobacteria)
 |
 |                           +--------------Zymomonas_mobilis_subsp._mobilis                                                                       (alpha-proteobacteria)
 |                  0.99     |
 |          +----------------+         +--------Sphingobium_japonicum                                                                              (alpha-proteobacteria)
 |          |                |   0.92  |
 |          |                +---------+     0.98    +------------------Citromicrobium_bathyomarinum                                               (alpha-proteobacteria)
 |          |                          +-------------+
 |   0.99   |                                        +------------Erythrobacter_sp.                                                                (alpha-proteobacteria)
 +----------+
            |              0.95   +-------------------------------------------GOS_2163010
            |        +------------+
            |        |            +---------------Azospirillum_sp.                                                                                 (alpha-proteobacteria)
            |        |
            |  0.89  |
            +--------+       +------------------Parvibaculum_lavamentivorans                                                                       (alpha-proteobacteria)
                     |       |
                     | 0.93  |          0.92 +-----------------Methylobacterium_extorquens                                                         (alpha-proteobacteria)
                     +-------+         +-----+
                             |         |     |        1       +------Xanthobacter_autotrophicus                                                    (alpha-proteobacteria)
                             |         |     +----------------+
                             |   0.97  |                      +---------Azorhizobium_caulinodans                                                   (alpha-proteobacteria)
                             +---------+
                                       |    +-----------------Pseudovibrio_sp.                                                                     (alpha-proteobacteria)
                                       |0.81|
                                       +----+                 +Ochrobactrum_intermedium                                                            (alpha-proteobacteria)
                                            |        1        |
                                            +-----------------+
                                                          0.49|+Ochrobactrum_anthropi                                                        (alpha-proteobacteria)
                                                              ++
                                                               | 1 +Brucella_ovis                                                                  (alpha-proteobacteria)
                                                               +---+
                                                                   |-Brucella_ceti_str.                                                            (alpha-proteobacteria)
                                                                   |
                                                                   +-Brucella_melitensis_bv.                                                       (alpha-proteobacteria)

Taxonomy report

PROTOCOL


a) BLASTp versus NR, NCBI default parameters apart from "Number of descriptions_1000"

b) BLASTp versus Swissprot, NCBI default parameters apart from "Number of descriptions_1000"



RESULTS ANALYSIS


Analyzing the taxonomy data we concluded that the sequence pertence to an organism of the class a-proteobacteria because it has a great number of hits, lowest E-values and high scores.

The ingroup is alpha-proteobacteria because it presents the highest scores, lowest E-values and high number of hits. The outgroup is the other proteobacteria because it belongs to the same phylum (proteobacteria) and it is from diferent classes (beta-proteobacteria, gamma-proteobacteria and delta-proteobacteria). The choice of different classes permit obtained a greatest biological diversity. The chosen sequences has significant E-values and high scores.



Ingroup: proteobacteria


ref|YP_001525155.1 Azorhizobium caulinodans (ORS 571) 6e-86 (alpha-proteobacteria)

ref|YP_002964479.1 Methylobacterium extorquens (AM1) 2e-86 (alpha-proteobacteria)

ref|ZP_01039048.1 Erythrobacter sp. (NAP1) 1e-86 (alpha-proteobacteria)

ref|NP_540367.1 Brucella melitensis bv. (1 str. 16M) 1e-86 (alpha-proteobacteria)

ref|YP_003226378.1 Zymomonas mobilis subsp. mobilis (NCIMB 11163) 9e-87 (alpha-proteobacteria)

ref|ZP_05085169.1 Pseudovibrio sp. (JE062) 8e-87 (alpha-proteobacteria)

ref|ZP_03785028.1 Brucella ceti (str. Cudo) 1e-87 (alpha-proteobacteria)

ref|YP_001369159.1 Ochrobactrum anthropi (ATCC 49188) 1e-87 (alpha-proteobacteria)

ref|YP_001258501.1 Brucella ovis (ATCC 25840) 9e-88 (alpha-proteobacteria)

ref|ZP_04679682.1 Ochrobactrum intermedium (LMG 3301) 9e-88 (alpha-proteobacteria)

ref|ZP_06862247.1 Citromicrobium bathyomarinum (JL354) 2e-88 (alpha-proteobacteria)

ref|YP_001418410.1 Xanthobacter autotrophicus (Py2) 1e-88 (alpha-proteobacteria)

ref|YP_001411957.1 Parvibaculum lavamentivorans (DS-1) 2e-92 (alpha-proteobacteria)

ref|YP_003544123.1 Sphingobium japonicum (UT26S) 1e-92 (alpha-proteobacteria)

ref|YP_003448135.1 Azospirillum sp. (B510) 9e-102 (alpha-proteobacteria)


Outgroup: other proteobacteria


ref|YP_002981225.1 Ralstonia pickettii (12D) 1e-67 (beta-proteobacteria)

gb|ADY97499.1 Neisseria meningitidis (M01-240149) 2e-66 (beta-proteobacteria)

ref|YP_001230655.1 Geobacter uraniireducens (Rf4) 1e-79 (delta-proteobacteria)

ref|YP_902059.1 Pelobacter propionicus (DSM 2379) 1e-82 (delta-proteobacteria)

ref|YP_003444894.1 Allochromatium vinosum (DSM 180) 1e-85 (gamma-proteobacteria)


RAW RESULTS

a) BLASTp versus NR, NCBI default parameters apart from "Number of descriptions=1000"

root
. cellular organisms
. . Bacteria            [bacteria]
. . . Proteobacteria      [proteobacteria]
. . . . Alphaproteobacteria [a-proteobacteria]
. . . . . Rhodospirillales    [a-proteobacteria]
. . . . . . Rhodospirillaceae   [a-proteobacteria]
. . . . . . . Rhodospirillum      [a-proteobacteria]
. . . . . . . . Rhodospirillum centenum SW ----------------------------  379 2 hits [a-proteobacteria]      threonine synthase [Rhodospirillum centenum SW] >gi|2099603
. . . . . . . . Rhodospirillum rubrum ATCC 11170 ......................  350 2 hits [a-proteobacteria]      threonine synthase [Rhodospirillum rubrum ATCC 11170] >gi|8
. . . . . . . Azospirillum sp. B510 -----------------------------------  374 2 hits [a-proteobacteria]      threonine synthase [Azospirillum sp. B510] >gi|288910102|db
. . . . . . . Magnetospirillum magneticum AMB-1 .......................  353 2 hits [a-proteobacteria]      threonine synthase [Magnetospirillum magneticum AMB-1] >gi|
. . . . . . . Magnetospirillum magnetotacticum MS-1 ...................  350 1 hit  [a-proteobacteria]      COG0498: Threonine synthase [Magnetospirillum magnetotactic
. . . . . . . Magnetospirillum gryphiswaldense MSR-1 ..................  344 1 hit  [a-proteobacteria]      threonine synthase [Magnetospirillum gryphiswaldense MSR-1]
. . . . . . Granulibacter bethesdensis CGDNIH1 ------------------------  353 2 hits [a-proteobacteria]      threonine synthase [Granulibacter bethesdensis CGDNIH1] >gi
. . . . . . Acetobacter pasteurianus IFO 3283-01 ......................  352 2 hits [a-proteobacteria]      threonine synthase [Acetobacter pasteurianus IFO 3283-01] >
. . . . . . Acetobacter pasteurianus IFO 3283-03 ......................  352 1 hit  [a-proteobacteria]      threonine synthase [Acetobacter pasteurianus IFO 3283-01] >
. . . . . . Acetobacter pasteurianus IFO 3283-07 ......................  352 1 hit  [a-proteobacteria]      threonine synthase [Acetobacter pasteurianus IFO 3283-01] >
. . . . . . Acetobacter pasteurianus IFO 3283-22 ......................  352 1 hit  [a-proteobacteria]      threonine synthase [Acetobacter pasteurianus IFO 3283-01] >
. . . . . . Acetobacter pasteurianus IFO 3283-26 ......................  352 1 hit  [a-proteobacteria]      threonine synthase [Acetobacter pasteurianus IFO 3283-01] >
. . . . . . Acetobacter pasteurianus IFO 3283-32 ......................  352 1 hit  [a-proteobacteria]      threonine synthase [Acetobacter pasteurianus IFO 3283-01] >
. . . . . . Acetobacter pasteurianus IFO 3283-01-42C ..................  352 1 hit  [a-proteobacteria]      threonine synthase [Acetobacter pasteurianus IFO 3283-01] >
. . . . . . Acetobacter pasteurianus IFO 3283-12 ......................  352 1 hit  [a-proteobacteria]      threonine synthase [Acetobacter pasteurianus IFO 3283-01] >
. . . . . . Gluconacetobacter hansenii ATCC 23769 .....................  352 2 hits [a-proteobacteria]      threonine synthase [Gluconacetobacter hansenii ATCC 23769] 
. . . . . . Roseomonas cervicalis ATCC 49957 ..........................  351 2 hits [a-proteobacteria]      threonine synthase [Roseomonas cervicalis ATCC 49957] >gi|2
. . . . . . Acetobacter pomorum DM001 .................................  351 2 hits [a-proteobacteria]      Threonine synthase [Acetobacter pomorum DM001] >gi|32669612
. . . . . . Gluconacetobacter diazotrophicus PAl 5 ....................  350 4 hits [a-proteobacteria]      threonine synthase [Gluconacetobacter diazotrophicus PAl 5]
. . . . . . Gluconacetobacter sp. SXCC-1 ..............................  341 1 hit  [a-proteobacteria]      Threonine synthase [Gluconacetobacter sp. SXCC-1]
. . . . . . Gluconobacter oxydans 621H ................................  337 2 hits [a-proteobacteria]      threonine synthase [Gluconobacter oxydans 621H] >gi|5800271
. . . . . . Acidiphilium multivorum AIU301 ............................  320 2 hits [a-proteobacteria]      threonine synthase [Acidiphilium multivorum AIU301] >gi|325
. . . . . . Acidiphilium cryptum JF-5 .................................  320 2 hits [a-proteobacteria]      threonine synthase [Acidiphilium cryptum JF-5] >gi|14640246
. . . . . alpha proteobacterium BAL199 --------------------------------  350 2 hits [a-proteobacteria]      Threonine synthase [alpha proteobacterium BAL199] >gi|15917
. . . . . Sphingobium japonicum UT26S .................................  343 2 hits [a-proteobacteria]      threonine synthase [Sphingobium japonicum UT26S] >gi|292673
. . . . . Parvibaculum lavamentivorans DS-1 ...........................  343 2 hits [a-proteobacteria]      threonine synthase [Parvibaculum lavamentivorans DS-1] >gi|
. . . . . Sphingomonas wittichii RW1 ..................................  340 2 hits [a-proteobacteria]      threonine synthase [Sphingomonas wittichii RW1] >gi|1484995
. . . . . Sphingopyxis alaskensis RB2256 ..............................  340 2 hits [a-proteobacteria]      threonine synthase [Sphingopyxis alaskensis RB2256] >gi|989
. . . . . Sphingobium chlorophenolicum L-1 ............................  336 2 hits [a-proteobacteria]      threonine synthase [Sphingobium chlorophenolicum L-1] >gi|3
. . . . . Sphingomonas sp. SKA58 ......................................  335 2 hits [a-proteobacteria]      threonine synthase [Sphingomonas sp. SKA58] >gi|94424748|gb
. . . . . Xanthobacter autotrophicus Py2 ..............................  330 2 hits [a-proteobacteria]      threonine synthase [Xanthobacter autotrophicus Py2] >gi|154
. . . . . Citromicrobium bathyomarinum JL354 ..........................  330 1 hit  [a-proteobacteria]      threonine synthase [Citromicrobium bathyomarinum JL354]
. . . . . Brucella sp. BO2 ............................................  328 2 hits [a-proteobacteria]      threonine synthase [Brucella sp. BO2] >gi|306287612|gb|EFM5
. . . . . Brucella suis 1330 ..........................................  328 2 hits [a-proteobacteria]      threonine synthase [Brucella suis 1330] >gi|161618455|ref|Y
. . . . . Brucella canis ATCC 23365 ...................................  328 2 hits [a-proteobacteria]      threonine synthase [Brucella suis 1330] >gi|161618455|ref|Y
. . . . . Brucella suis bv. 3 str. 686 ................................  328 3 hits [a-proteobacteria]      threonine synthase [Brucella suis 1330] >gi|161618455|ref|Y
. . . . . Brucella suis bv. 4 str. 40 .................................  328 2 hits [a-proteobacteria]      threonine synthase [Brucella suis 1330] >gi|161618455|ref|Y
. . . . . Brucella sp. 83/13 ..........................................  328 3 hits [a-proteobacteria]      threonine synthase [Brucella sp. 83/13] >gi|265983639|ref|Z
. . . . . Brucella sp. NF 2653 ........................................  328 2 hits [a-proteobacteria]      threonine synthase [Brucella sp. 83/13] >gi|265983639|ref|Z
. . . . . Brucella ceti M490/95/1 .....................................  328 3 hits [a-proteobacteria]      threonine synthase [Brucella ceti M490/95/1] >gi|256254524|
. . . . . Brucella ceti B1/94 .........................................  328 3 hits [a-proteobacteria]      threonine synthase [Brucella ceti M490/95/1] >gi|256254524|
. . . . . Ochrobactrum intermedium LMG 3301 ...........................  328 2 hits [a-proteobacteria]      threonine synthase [Ochrobactrum intermedium LMG 3301] >gi|
. . . . . Brucella sp. NVSL 07-0026 ...................................  328 2 hits [a-proteobacteria]      threonine synthase [Brucella sp. NVSL 07-0026] >gi|29482044
. . . . . Brucella suis bv. 5 str. 513 ................................  328 3 hits [a-proteobacteria]      threonine synthase [Brucella suis bv. 5 str. 513] >gi|26175
. . . . . Brucella ovis ATCC 25840 ....................................  328 2 hits [a-proteobacteria]      threonine synthase [Brucella ovis ATCC 25840] >gi|256060618
. . . . . Brucella neotomae 5K33 ......................................  328 3 hits [a-proteobacteria]      threonine synthase [Brucella ovis ATCC 25840] >gi|256060618
. . . . . Brucella microti CCM 4915 ...................................  328 2 hits [a-proteobacteria]      threonine synthase [Brucella ovis ATCC 25840] >gi|256060618
. . . . . Ochrobactrum anthropi ATCC 49188 ............................  327 2 hits [a-proteobacteria]      threonine synthase [Ochrobactrum anthropi ATCC 49188] >gi|1
. . . . . Brucella ceti str. Cudo .....................................  327 2 hits [a-proteobacteria]      threonine synthase [Brucella ceti str. Cudo] >gi|254707788|
. . . . . Brucella pinnipedialis M163/99/10 ...........................  327 3 hits [a-proteobacteria]      threonine synthase [Brucella ceti str. Cudo] >gi|254707788|
. . . . . Brucella pinnipedialis B2/94 ................................  327 3 hits [a-proteobacteria]      threonine synthase [Brucella ceti str. Cudo] >gi|254707788|
. . . . . Brucella pinnipedialis M292/94/1 ............................  327 3 hits [a-proteobacteria]      threonine synthase [Brucella ceti str. Cudo] >gi|254707788|
. . . . . Brucella sp. F5/99 ..........................................  327 3 hits [a-proteobacteria]      threonine synthase [Brucella ceti str. Cudo] >gi|254707788|
. . . . . Brucella ceti M644/93/1 .....................................  327 3 hits [a-proteobacteria]      threonine synthase [Brucella ceti M644/93/1] >gi|254716690|
. . . . . Brucella ceti M13/05/1 ......................................  327 3 hits [a-proteobacteria]      threonine synthase [Brucella ceti M644/93/1] >gi|254716690|
. . . . . Brucella sp. BO1 ............................................  326 2 hits [a-proteobacteria]      threonine synthase [Brucella sp. BO1] >gi|306274527|gb|EFM5
. . . . . Brucella suis ATCC 23445 ....................................  325 2 hits [a-proteobacteria]      threonine synthase [Brucella suis ATCC 23445] >gi|163673488
. . . . . Pseudovibrio sp. JE062 ......................................  324 2 hits [a-proteobacteria]      threonine synthase [Pseudovibrio sp. JE062] >gi|211958970|g
. . . . . Zymomonas mobilis subsp. mobilis NCIMB 11163 ................  324 2 hits [a-proteobacteria]      threonine synthase [Zymomonas mobilis subsp. mobilis NCIMB 
. . . . . Zymomonas mobilis subsp. mobilis ZM4 ........................  324 2 hits [a-proteobacteria]      threonine synthase [Zymomonas mobilis subsp. mobilis NCIMB 
. . . . . Brucella melitensis bv. 1 str. 16M ..........................  324 4 hits [a-proteobacteria]      threonine synthase [Brucella melitensis bv. 1 str. 16M] >gi
. . . . . Brucella abortus bv. 1 str. 9-941 ...........................  324 2 hits [a-proteobacteria]      threonine synthase [Brucella melitensis bv. 1 str. 16M] >gi
. . . . . Brucella melitensis biovar Abortus 2308 .....................  324 2 hits [a-proteobacteria]      threonine synthase [Brucella melitensis bv. 1 str. 16M] >gi
. . . . . Brucella abortus S19 ........................................  324 2 hits [a-proteobacteria]      threonine synthase [Brucella melitensis bv. 1 str. 16M] >gi
. . . . . Brucella melitensis ATCC 23457 ..............................  324 2 hits [a-proteobacteria]      threonine synthase [Brucella melitensis bv. 1 str. 16M] >gi
. . . . . Brucella abortus str. 2308 A ................................  324 2 hits [a-proteobacteria]      threonine synthase [Brucella melitensis bv. 1 str. 16M] >gi
. . . . . Brucella abortus bv. 3 str. Tulya ...........................  324 3 hits [a-proteobacteria]      threonine synthase [Brucella melitensis bv. 1 str. 16M] >gi
. . . . . Brucella abortus bv. 2 str. 86/8/59 .........................  324 3 hits [a-proteobacteria]      threonine synthase [Brucella melitensis bv. 1 str. 16M] >gi
. . . . . Brucella abortus bv. 4 str. 292 .............................  324 3 hits [a-proteobacteria]      threonine synthase [Brucella melitensis bv. 1 str. 16M] >gi
. . . . . Brucella melitensis bv. 1 str. Rev.1 ........................  324 3 hits [a-proteobacteria]      threonine synthase [Brucella melitensis bv. 1 str. 16M] >gi
. . . . . Brucella abortus bv. 9 str. C68 .............................  324 3 hits [a-proteobacteria]      threonine synthase [Brucella melitensis bv. 1 str. 16M] >gi
. . . . . Brucella melitensis bv. 2 str. 63/9 .........................  324 2 hits [a-proteobacteria]      threonine synthase [Brucella melitensis bv. 1 str. 16M] >gi
. . . . . Brucella abortus NCTC 8038 ..................................  324 2 hits [a-proteobacteria]      threonine synthase [Brucella melitensis bv. 1 str. 16M] >gi
. . . . . Brucella abortus bv. 5 str. B3196 ...........................  324 2 hits [a-proteobacteria]      threonine synthase [Brucella melitensis bv. 1 str. 16M] >gi
. . . . . Brucella melitensis M28 .....................................  324 1 hit  [a-proteobacteria]      threonine synthase [Brucella melitensis bv. 1 str. 16M] >gi
. . . . . Brucella melitensis M5-90 ...................................  324 1 hit  [a-proteobacteria]      threonine synthase [Brucella melitensis bv. 1 str. 16M] >gi
. . . . . Brucella abortus bv. 6 str. 870 .............................  324 3 hits [a-proteobacteria]      threonine synthase [Brucella abortus bv. 6 str. 870] >gi|26
. . . . . Erythrobacter sp. NAP1 ......................................  324 2 hits [a-proteobacteria]      threonine synthase [Erythrobacter sp. NAP1] >gi|85689516|gb
. . . . . Zymomonas mobilis subsp. mobilis ATCC 10988 .................  323 2 hits [a-proteobacteria]      threonine synthase [Zymomonas mobilis subsp. mobilis ATCC 1
. . . . . Methylobacterium extorquens AM1 .............................  323 2 hits [a-proteobacteria]      threonine synthase [Methylobacterium extorquens AM1] >gi|24
. . . . . Rhodobacter capsulatus SB 1003 ..............................  322 2 hits [a-proteobacteria]      threonine synthase [Rhodobacter capsulatus SB 1003] >gi|294
. . . . . Methylobacterium extorquens DM4 .............................  322 2 hits [a-proteobacteria]      threonine synthase [Methylobacterium extorquens DM4] >gi|25
. . . . . Erythrobacter litoralis HTCC2594 ............................  322 2 hits [a-proteobacteria]      threonine synthase [Erythrobacter litoralis HTCC2594] >gi|8
. . . . . Brucella melitensis bv. 3 str. Ether ........................  322 3 hits [a-proteobacteria]      threonine synthase [Brucella melitensis bv. 3 str. Ether] >
. . . . . Methylobacterium chloromethanicum CM4 .......................  322 2 hits [a-proteobacteria]      threonine synthase [Methylobacterium chloromethanicum CM4] 
. . . . . Azorhizobium caulinodans ORS 571 ............................  322 2 hits [a-proteobacteria]      threonine synthase [Azorhizobium caulinodans ORS 571] >gi|1
. . . . . Methylobacterium radiotolerans JCM 2831 .....................  321 2 hits [a-proteobacteria]      threonine synthase [Methylobacterium radiotolerans JCM 2831
. . . . . Methylobacterium extorquens PA1 .............................  321 2 hits [a-proteobacteria]      threonine synthase [Methylobacterium extorquens PA1] >gi|16
. . . . . Sinorhizobium fredii NGR234 .................................  320 2 hits [a-proteobacteria]      threonine synthase [Sinorhizobium fredii NGR234] >gi|227340
. . . . . Erythrobacter sp. SD-21 .....................................  320 2 hits [a-proteobacteria]      threonine synthase [Erythrobacter sp. SD-21] >gi|148830570|
. . . . . Methylobacterium populi BJ001 ...............................  319 2 hits [a-proteobacteria]      threonine synthase [Methylobacterium populi BJ001] >gi|1793
. . . . . Rhizobium etli CFN 42 .......................................  319 2 hits [a-proteobacteria]      threonine synthase [Rhizobium etli CFN 42] >gi|86280727|gb|
. . . . . Sinorhizobium meliloti 1021 .................................  318 2 hits [a-proteobacteria]      threonine synthase [Sinorhizobium meliloti 1021] >gi|307304
. . . . . Sinorhizobium meliloti BL225C ...............................  318 2 hits [a-proteobacteria]      threonine synthase [Sinorhizobium meliloti 1021] >gi|307304
. . . . . Sinorhizobium meliloti AK83 .................................  318 2 hits [a-proteobacteria]      threonine synthase [Sinorhizobium meliloti 1021] >gi|307304
. . . . . Roseovarius sp. TM1035 ......................................  318 2 hits [a-proteobacteria]      threonine synthase [Roseovarius sp. TM1035] >gi|149145164|g
. . . . . Rhizobium leguminosarum bv. viciae 3841 .....................  318 2 hits [a-proteobacteria]      threonine synthase [Rhizobium leguminosarum bv. viciae 3841
. . . . . Rhizobium leguminosarum bv. trifolii WSM2304 ................  318 2 hits [a-proteobacteria]      threonine synthase [Rhizobium leguminosarum bv. trifolii WS
. . . . . Rhizobium etli GR56 .........................................  317 1 hit  [a-proteobacteria]      threonine synthase [Rhizobium etli GR56]
. . . . . Rhizobium leguminosarum bv. trifolii WSM1325 ................  317 2 hits [a-proteobacteria]      threonine synthase [Rhizobium leguminosarum bv. trifolii WS
. . . . . Dinoroseobacter shibae DFL 12 ...............................  316 2 hits [a-proteobacteria]      threonine synthase [Dinoroseobacter shibae DFL 12] >gi|1579
. . . . . Octadecabacter antarcticus 238 ..............................  315 2 hits [a-proteobacteria]      threonine synthase [Octadecabacter antarcticus 238] >gi|198
. . . . . Hoeflea phototrophica DFL-43 ................................  314 2 hits [a-proteobacteria]      putative threonine synthase [Hoeflea phototrophica DFL-43] 
. . . . . Roseobacter sp. SK209-2-6 ...................................  314 2 hits [a-proteobacteria]      threonine synthase [Roseobacter sp. SK209-2-6] >gi|12672185
. . . . . Labrenzia aggregata IAM 12614 ...............................  314 2 hits [a-proteobacteria]      threonine synthase [Stappia aggregata IAM 12614] >gi|118436
. . . . . Octadecabacter antarcticus 307 ..............................  313 2 hits [a-proteobacteria]      threonine synthase [Octadecabacter antarcticus 307] >gi|198
. . . . . Ketogulonicigenium vulgare Y25 ..............................  313 2 hits [a-proteobacteria]      L-threonine synthase [Ketogulonicigenium vulgare Y25] >gi|3
. . . . . Mesorhizobium loti MAFF303099 ...............................  313 2 hits [a-proteobacteria]      threonine synthase [Mesorhizobium loti MAFF303099] >gi|1402
. . . . . Agrobacterium sp. H13-3 .....................................  313 2 hits [a-proteobacteria]      Threonine synthase [Agrobacterium sp. H13-3] >gi|325060024|
. . . . . Ahrensia sp. R2A130 .........................................  313 2 hits [a-proteobacteria]      threonine synthase [Ahrensia sp. R2A130] >gi|303294525|gb|E
. . . . . Rhizobium etli CNPAF512 .....................................  313 1 hit  [a-proteobacteria]      threonine synthase protein [Rhizobium etli CNPAF512]
. . . . . Roseovarius sp. 217 .........................................  312 2 hits [a-proteobacteria]      threonine synthase [Roseovarius sp. 217] >gi|85670445|gb|EA
. . . . . Citreicella sp. SE45 ........................................  312 2 hits [a-proteobacteria]      threonine synthase [Citreicella sp. SE45] >gi|260422045|gb|
. . . . . Roseovarius nubinhibens ISM .................................  311 2 hits [a-proteobacteria]      threonine synthase [Roseovarius nubinhibens ISM] >gi|838379
. . . . . Labrenzia alexandrii DFL-11 .................................  311 2 hits [a-proteobacteria]      threonine synthase [Labrenzia alexandrii DFL-11] >gi|222437
. . . . . Sinorhizobium medicae WSM419 ................................  311 2 hits [a-proteobacteria]      threonine synthase [Sinorhizobium medicae WSM419] >gi|15002
. . . . . Rhodobacter sphaeroides 2.4.1 ...............................  311 2 hits [a-proteobacteria]      threonine synthase [Rhodobacter sphaeroides 2.4.1] >gi|7738
. . . . . Rhodobacter sphaeroides ATCC 17029 ..........................  311 2 hits [a-proteobacteria]      threonine synthase [Rhodobacter sphaeroides ATCC 17029] >gi
. . . . . Pelagibaca bermudensis HTCC2601 .............................  311 2 hits [a-proteobacteria]      threonine synthase [Pelagibaca bermudensis HTCC2601] >gi|11
. . . . . Rhizobium etli CIAT 652 .....................................  311 2 hits [a-proteobacteria]      threonine synthase protein [Rhizobium etli CIAT 652] >gi|19
. . . . . Methylobacterium nodulans ORS 2060 ..........................  311 2 hits [a-proteobacteria]      threonine synthase [Methylobacterium nodulans ORS 2060] >gi
. . . . . Roseobacter sp. AzwK-3b .....................................  311 2 hits [a-proteobacteria]      threonine synthase [Roseobacter sp. AzwK-3b] >gi|149810553|
. . . . . Mesorhizobium ciceri biovar biserrulae WSM1271 ..............  311 2 hits [a-proteobacteria]      threonine synthase [Mesorhizobium ciceri biovar biserrulae 
. . . . . Rhodobacteraceae bacterium HTCC2083 .........................  311 2 hits [a-proteobacteria]      threonine synthase [Rhodobacterales bacterium HTCC2083] >gi
. . . . . Rhodobacter sphaeroides KD131 ...............................  310 2 hits [a-proteobacteria]      threonine synthase [Rhodobacter sphaeroides KD131] >gi|2211
. . . . . Thalassiobium sp. R2A62 .....................................  310 2 hits [a-proteobacteria]      threonine synthase [Thalassiobium sp. R2A62] >gi|255106198|
. . . . . Candidatus Puniceispirillum marinum IMCC1322 ................  310 2 hits [a-proteobacteria]      threonine synthase [Candidatus Puniceispirillum marinum IMC
. . . . . Roseobacter sp. MED193 ......................................  310 2 hits [a-proteobacteria]      threonine synthase [Roseobacter sp. MED193] >gi|85825567|gb
. . . . . Rhodobacter sp. SW2 .........................................  310 2 hits [a-proteobacteria]      threonine synthase [Rhodobacter sp. SW2] >gi|259022103|gb|E
. . . . . Silicibacter sp. TrichCH4B ..................................  309 2 hits [a-proteobacteria]      threonine synthase [Silicibacter sp. TrichCH4B] >gi|2593466
. . . . . Roseobacter sp. CCS2 ........................................  309 2 hits [a-proteobacteria]      threonine synthase [Roseobacter sp. CCS2] >gi|126716423|gb|
. . . . . Agrobacterium radiobacter K84 ...............................  309 2 hits [a-proteobacteria]      threonine synthetase protein [Agrobacterium radiobacter K84
. . . . . Mesorhizobium opportunistum WSM2075 .........................  309 2 hits [a-proteobacteria]      threonine synthase [Mesorhizobium opportunistum WSM2075] >g
. . . . . Silicibacter lacuscaerulensis ITI-1157 ......................  308 2 hits [a-proteobacteria]      threonine synthase [Silicibacter lacuscaerulensis ITI-1157]
. . . . . Rhodobacterales bacterium HTCC2255 ..........................  308 2 hits [a-proteobacteria]      threonine synthase [alpha proteobacterium HTCC2255] >gi|114
. . . . . Maritimibacter alkaliphilus HTCC2654 ........................  308 2 hits [a-proteobacteria]      threonine synthase [Maritimibacter alkaliphilus HTCC2654] >
. . . . . Agrobacterium tumefaciens str. C58 ..........................  308 2 hits [a-proteobacteria]      threonine synthase [Agrobacterium tumefaciens str. C58]
. . . . . Rhodobacteraceae bacterium KLH11 ............................  308 2 hits [a-proteobacteria]      threonine synthase [Rhodobacteraceae bacterium KLH11] >gi|2
. . . . . Loktanella vestfoldensis SKA53 ..............................  307 2 hits [a-proteobacteria]      threonine synthase [Loktanella vestfoldensis SKA53] >gi|845
. . . . . Novosphingobium nitrogenifigens DSM 19370 ...................  307 2 hits [a-proteobacteria]      threonine synthase [Novosphingobium nitrogenifigens DSM 193
. . . . . Rhodobacteraceae bacterium HTCC2150 .........................  306 2 hits [a-proteobacteria]      threonine synthase [Rhodobacterales bacterium HTCC2150] >gi
. . . . . Paracoccus denitrificans PD1222 .............................  306 2 hits [a-proteobacteria]      threonine synthase [Paracoccus denitrificans PD1222] >gi|11
. . . . . Bartonella schoenbuchensis R1 ...............................  306 1 hit  [a-proteobacteria]      Threonine synthase [Bartonella schoenbuchensis R1]
. . . . . Roseobacter litoralis Och 149 ...............................  305 2 hits [a-proteobacteria]      threonine synthase [Roseobacter litoralis Och 149] >gi|1613
. . . . . Oceanicola granulosus HTCC2516 ..............................  305 2 hits [a-proteobacteria]      threonine synthase [Oceanicola granulosus HTCC2516] >gi|890
. . . . . Bartonella tribocorum CIP 105476 ............................  305 2 hits [a-proteobacteria]      threonine synthase [Bartonella tribocorum CIP 105476] >gi|1
. . . . . Chelativorans sp. BNC1 ......................................  305 2 hits [a-proteobacteria]      L-threonine synthase [Chelativorans sp. BNC1]
. . . . . Starkeya novella DSM 506 ....................................  305 2 hits [a-proteobacteria]      threonine synthase [Starkeya novella DSM 506] >gi|296927116
. . . . . Bartonella henselae str. Houston-1 ..........................  305 2 hits [a-proteobacteria]      threonine synthase [Bartonella henselae str. Houston-1] >gi
. . . . . Sagittula stellata E-37 .....................................  305 2 hits [a-proteobacteria]      threonine synthase [Sagittula stellata E-37] >gi|126710097|
. . . . . Ruegeria sp. TM1040 .........................................  305 2 hits [a-proteobacteria]      threonine synthase [Ruegeria sp. TM1040] >gi|99038450|gb|AB
. . . . . Ruegeria pomeroyi DSS-3 .....................................  304 2 hits [a-proteobacteria]      threonine synthase [Ruegeria pomeroyi DSS-3] >gi|56679640|g
. . . . . Methylocystis sp. ATCC 49242 ................................  304 2 hits [a-proteobacteria]      threonine synthase [Methylocystis sp. ATCC 49242] >gi|32239
. . . . . Beijerinckia indica subsp. indica ATCC 9039 .................  304 2 hits [a-proteobacteria]      threonine synthase [Beijerinckia indica subsp. indica ATCC 
. . . . . Nitrobacter winogradskyi Nb-255 .............................  304 2 hits [a-proteobacteria]      threonine synthase [Nitrobacter winogradskyi Nb-255] >gi|74
. . . . . Sulfitobacter sp. EE-36 .....................................  304 2 hits [a-proteobacteria]      threonine synthase [Sulfitobacter sp. EE-36] >gi|83845203|g
. . . . . Sulfitobacter sp. NAS-14.1 ..................................  304 2 hits [a-proteobacteria]      threonine synthase [Sulfitobacter sp. NAS-14.1] >gi|8384081
. . . . . Polymorphum gilvum SL003B-26A1 ..............................  304 2 hits [a-proteobacteria]      Threonine synthetase protein [Polymorphum gilvum SL003B-26A
. . . . . Rhodobacter sphaeroides ATCC 17025 ..........................  304 2 hits [a-proteobacteria]      threonine synthase [Rhodobacter sphaeroides ATCC 17025] >gi
. . . . . Oceanibulbus indolifex HEL-45 ...............................  303 2 hits [a-proteobacteria]      threonine synthase [Oceanibulbus indolifex HEL-45] >gi|1613
. . . . . Aurantimonas manganoxydans SI85-9A1 .........................  303 2 hits [a-proteobacteria]      threonine synthase [Aurantimonas manganoxydans SI85-9A1] >g
. . . . . Roseobacter denitrificans OCh 114 ...........................  303 2 hits [a-proteobacteria]      threonine synthase [Roseobacter denitrificans OCh 114] >gi|
. . . . . Nitrobacter sp. Nb-311A .....................................  303 2 hits [a-proteobacteria]      threonine synthase [Nitrobacter sp. Nb-311A] >gi|85697967|g
. . . . . Agrobacterium vitis S4 ......................................  303 2 hits [a-proteobacteria]      threonine synthase [Agrobacterium vitis S4] >gi|221734803|g
. . . . . Ruegeria sp. R11 ............................................  303 2 hits [a-proteobacteria]      threonine synthase [Ruegeria sp. R11] >gi|214031251|gb|EEB7
. . . . . Oceanicola batsensis HTCC2597 ...............................  303 2 hits [a-proteobacteria]      threonine synthase [Oceanicola batsensis HTCC2597] >gi|8439
. . . . . Bartonella grahamii as4aup ..................................  303 2 hits [a-proteobacteria]      threonine synthase ThrC [Bartonella grahamii as4aup] >gi|24
. . . . . Novosphingobium aromaticivorans DSM 12444 ...................  302 2 hits [a-proteobacteria]      threonine synthase [Novosphingobium aromaticivorans DSM 124
. . . . . Hyphomicrobium denitrificans ATCC 51888 .....................  302 2 hits [a-proteobacteria]      threonine synthase [Hyphomicrobium denitrificans ATCC 51888
. . . . . Methylobacterium sp. 4-46 ...................................  301 2 hits [a-proteobacteria]      threonine synthase [Methylobacterium sp. 4-46] >gi|16819485
. . . . . Bradyrhizobium japonicum USDA 110 ...........................  301 2 hits [a-proteobacteria]      threonine synthase [Bradyrhizobium japonicum USDA 110] >gi|
. . . . . Phaeobacter gallaeciensis 2.10 ..............................  301 2 hits [a-proteobacteria]      threonine synthase [Phaeobacter gallaeciensis 2.10] >gi|161
. . . . . Roseibium sp. TrichSKD4 .....................................  301 2 hits [a-proteobacteria]      threonine synthase [Roseibium sp. TrichSKD4] >gi|307775264|
. . . . . Roseobacter sp. GAI101 ......................................  301 2 hits [a-proteobacteria]      threonine synthase [Roseobacter sp. GAI101] >gi|214042920|g
. . . . . Methylocella silvestris BL2 .................................  300 2 hits [a-proteobacteria]      threonine synthase [Methylocella silvestris BL2] >gi|217502
. . . . . Rhodobacterales bacterium Y4I ...............................  299 2 hits [a-proteobacteria]      threonine synthase [Rhodobacterales bacterium Y4I] >gi|2066
. . . . . Phaeobacter gallaeciensis BS107 .............................  298 2 hits [a-proteobacteria]      threonine synthase [Phaeobacter gallaeciensis BS107] >gi|16
. . . . . Rhodopseudomonas palustris BisA53 ...........................  298 2 hits [a-proteobacteria]      threonine synthase [Rhodopseudomonas palustris BisA53] >gi|
. . . . . Methylosinus trichosporium OB3b .............................  298 2 hits [a-proteobacteria]      threonine synthase [Methylosinus trichosporium OB3b] >gi|29
. . . . . Rhodopseudomonas palustris BisB18 ...........................  298 2 hits [a-proteobacteria]      L-threonine synthase [Rhodopseudomonas palustris BisB18]
. . . . . Bradyrhizobium sp. ORS278 ...................................  296 2 hits [a-proteobacteria]      threonine synthase [Bradyrhizobium sp. ORS278] >gi|14619627
. . . . . Candidatus Pelagibacter sp. HTCC7211 ........................  296 2 hits [a-proteobacteria]      threonine synthase [Candidatus Pelagibacter sp. HTCC7211] >
. . . . . Nitrobacter hamburgensis X14 ................................  296 2 hits [a-proteobacteria]      threonine synthase [Nitrobacter hamburgensis X14] >gi|91798
. . . . . Caulobacter sp. K31 .........................................  296 2 hits [a-proteobacteria]      threonine synthase [Caulobacter sp. K31] >gi|167350883|gb|A
. . . . . Fulvimarina pelagi HTCC2506 .................................  295 2 hits [a-proteobacteria]      threonine synthase [Fulvimarina pelagi HTCC2506] >gi|114538
. . . . . Bradyrhizobium sp. BTAi1 ....................................  295 2 hits [a-proteobacteria]      threonine synthase [Bradyrhizobium sp. BTAi1] >gi|146404595
. . . . . Jannaschia sp. CCS1 .........................................  295 2 hits [a-proteobacteria]      threonine synthase [Jannaschia sp. CCS1] >gi|88865189|gb|AB
. . . . . Afipia sp. 1NLS2 ............................................  294 2 hits [a-proteobacteria]      threonine synthase [Afipia sp. 1NLS2] >gi|298590808|gb|EFI5
. . . . . Candidatus Liberibacter solanacearum CLso-ZC1 ...............  292 2 hits [a-proteobacteria]      threonine synthase [Candidatus Liberibacter solanacearum CL
. . . . . Rhodopseudomonas palustris BisB5 ............................  292 2 hits [a-proteobacteria]      threonine synthase [Rhodopseudomonas palustris BisB5] >gi|9
. . . . . Rhodopseudomonas palustris HaA2 .............................  291 2 hits [a-proteobacteria]      threonine synthase [Rhodopseudomonas palustris HaA2] >gi|86
. . . . . Oligotropha carboxidovorans OM5 .............................  291 2 hits [a-proteobacteria]      threonine synthase [Oligotropha carboxidovorans OM5] >gi|20
. . . . . Rhodopseudomonas palustris DX-1 .............................  290 2 hits [a-proteobacteria]      threonine synthase [Rhodopseudomonas palustris DX-1] >gi|31
. . . . . Rhodopseudomonas palustris CGA009 ...........................  290 2 hits [a-proteobacteria]      threonine synthase [Rhodopseudomonas palustris CGA009]
. . . . . Rhodopseudomonas palustris TIE-1 ............................  289 2 hits [a-proteobacteria]      threonine synthase [Rhodopseudomonas palustris TIE-1] >gi|1
. . . . . Caulobacter crescentus CB15 .................................  288 2 hits [a-proteobacteria]      threonine synthase [Caulobacter crescentus CB15] >gi|221236
. . . . . Caulobacter crescentus NA1000 ...............................  288 2 hits [a-proteobacteria]      threonine synthase [Caulobacter crescentus CB15] >gi|221236
. . . . . Candidatus Pelagibacter ubique HTCC1062 .....................  287 2 hits [a-proteobacteria]      threonine synthase [Candidatus Pelagibacter ubique HTCC1062
. . . . . Candidatus Pelagibacter ubique HTCC1002 .....................  287 2 hits [a-proteobacteria]      threonine synthase [Candidatus Pelagibacter ubique HTCC1062
. . . . . alpha proteobacterium HIMB114 ...............................  280 2 hits [a-proteobacteria]      threonine synthase [alpha proteobacterium HIMB114] >gi|2622
. . . . . Phenylobacterium zucineum HLK1 ..............................  277 2 hits [a-proteobacteria]      threonine synthetase protein [Phenylobacterium zucineum HLK
. . . . . Candidatus Pelagibacter sp. IMCC9063 ........................  277 2 hits [a-proteobacteria]      threonine synthase [Candidatus Pelagibacter sp. IMCC9063] >
. . . . . Candidatus Liberibacter asiaticus str. psy62 ................  274 2 hits [a-proteobacteria]      threonine synthase [Candidatus Liberibacter asiaticus str. 
. . . . . Rhizobium etli Brasil 5 .....................................  271 1 hit  [a-proteobacteria]      threonine synthase [Rhizobium etli Brasil 5]
. . . . . Rhodomicrobium vannielii ATCC 17100 .........................  267 2 hits [a-proteobacteria]      threonine synthase [Rhodomicrobium vannielii ATCC 17100] >g
. . . . . Parvularcula bermudensis HTCC2503 ...........................  261 2 hits [a-proteobacteria]      threonine synthase [Parvularcula bermudensis HTCC2503] >gi|
. . . . . Hyphomonas neptunium ATCC 15444 .............................  248 2 hits [a-proteobacteria]      threonine synthase [Hyphomonas neptunium ATCC 15444] >gi|11
. . . . Pseudomonas fluorescens Pf-5 ----------------------------------  356 2 hits [g-proteobacteria]      threonine synthase [Pseudomonas fluorescens Pf-5] >gi|68342
. . . . Pseudomonas stutzeri A1501 ....................................  355 2 hits [g-proteobacteria]      threonine synthase [Pseudomonas stutzeri A1501] >gi|1455697
. . . . Pseudomonas stutzeri DSM 4166 .................................  355 1 hit  [g-proteobacteria]      threonine synthase [Pseudomonas stutzeri A1501] >gi|1455697
. . . . Pseudomonas entomophila L48 ...................................  354 2 hits [g-proteobacteria]      threonine synthase [Pseudomonas entomophila L48] >gi|951122
. . . . Pseudomonas mendocina ymp .....................................  354 2 hits [g-proteobacteria]      threonine synthase [Pseudomonas mendocina ymp] >gi|14557661
. . . . Pseudomonas mendocina NK-01 ...................................  353 2 hits [g-proteobacteria]      threonine synthase [Pseudomonas mendocina NK-01] >gi|328918
. . . . Pseudomonas syringae pv. syringae B728a .......................  353 2 hits [g-proteobacteria]      threonine synthase [Pseudomonas syringae pv. syringae B728a
. . . . Pseudomonas syringae pv. syringae FF5 .........................  353 1 hit  [g-proteobacteria]      threonine synthase [Pseudomonas syringae pv. syringae B728a
. . . . Pseudomonas syringae pv. aesculi str. NCPPB3681 ...............  353 1 hit  [g-proteobacteria]      threonine synthase [Pseudomonas syringae pv. aesculi str. N
. . . . Pseudomonas syringae pv. aesculi str. 2250 ....................  353 1 hit  [g-proteobacteria]      threonine synthase [Pseudomonas syringae pv. aesculi str. N
. . . . Pseudomonas syringae pv. phaseolicola 1448A ...................  353 2 hits [g-proteobacteria]      threonine synthase [Pseudomonas syringae pv. phaseolicola 1
. . . . Pseudomonas savastanoi pv. savastanoi NCPPB 3335 ..............  353 2 hits [g-proteobacteria]      threonine synthase [Pseudomonas syringae pv. phaseolicola 1
. . . . Pseudomonas syringae pv. glycinea str. B076 ...................  353 1 hit  [g-proteobacteria]      threonine synthase [Pseudomonas syringae pv. phaseolicola 1
. . . . Pseudomonas syringae pv. glycinea str. race 4 .................  353 1 hit  [g-proteobacteria]      threonine synthase [Pseudomonas syringae pv. phaseolicola 1
. . . . Pseudomonas aeruginosa PAO1 ...................................  353 3 hits [g-proteobacteria]      threonine synthase [Pseudomonas aeruginosa PAO1] >gi|122310
. . . . Pseudomonas aeruginosa ........................................  353 1 hit  [g-proteobacteria]      threonine synthase [Pseudomonas aeruginosa PAO1] >gi|122310
. . . . Pseudomonas aeruginosa PACS2 ..................................  353 1 hit  [g-proteobacteria]      hypothetical protein PaerPA_01004319 [Pseudomonas aeruginos
. . . . Pseudomonas aeruginosa UCBPP-PA14 .............................  353 2 hits [g-proteobacteria]      hypothetical protein PaerPA_01004319 [Pseudomonas aeruginos
. . . . Pseudomonas aeruginosa LESB58 .................................  353 2 hits [g-proteobacteria]      hypothetical protein PaerPA_01004319 [Pseudomonas aeruginos
. . . . Pseudomonas aeruginosa C3719 ..................................  353 2 hits [g-proteobacteria]      hypothetical protein PaerPA_01004319 [Pseudomonas aeruginos
. . . . Pseudomonas aeruginosa 2192 ...................................  353 2 hits [g-proteobacteria]      hypothetical protein PaerPA_01004319 [Pseudomonas aeruginos
. . . . Pseudomonas aeruginosa PAb1 ...................................  353 1 hit  [g-proteobacteria]      hypothetical protein PaerPA_01004319 [Pseudomonas aeruginos
. . . . Pseudomonas aeruginosa 39016 ..................................  353 2 hits [g-proteobacteria]      hypothetical protein PaerPA_01004319 [Pseudomonas aeruginos
. . . . Pseudomonas fluorescens Pf0-1 .................................  352 2 hits [g-proteobacteria]      threonine synthase [Pseudomonas fluorescens Pf0-1] >gi|7738
. . . . Pseudomonas syringae pv. syringae 642 .........................  352 1 hit  [g-proteobacteria]      threonine synthase [Pseudomonas syringae pv. syringae 642]
. . . . Pseudomonas syringae pv. tabaci ATCC 11528 ....................  352 1 hit  [g-proteobacteria]      threonine synthase [Pseudomonas syringae pv. tabaci ATCC 11
. . . . Pseudomonas brassicacearum subsp. brassicacearum NFM421 .......  352 2 hits [g-proteobacteria]      threonine synthase [Pseudomonas brassicacearum subsp. brass
. . . . Pseudomonas aeruginosa PA7 ....................................  352 2 hits [g-proteobacteria]      threonine synthase [Pseudomonas aeruginosa PA7] >gi|1509589
. . . . Pseudomonas syringae pv. tomato str. DC3000 ...................  349 2 hits [g-proteobacteria]      threonine synthase [Pseudomonas syringae pv. tomato str. DC
. . . . Pseudomonas syringae pv. tomato T1 ............................  348 2 hits [g-proteobacteria]      threonine synthase [Pseudomonas syringae pv. tomato T1] >gi
. . . . Pseudomonas syringae pv. tomato Max13 .........................  348 1 hit  [g-proteobacteria]      threonine synthase [Pseudomonas syringae pv. tomato T1] >gi
. . . . Pseudomonas syringae pv. tomato K40 ...........................  348 1 hit  [g-proteobacteria]      threonine synthase [Pseudomonas syringae pv. tomato T1] >gi
. . . . Pseudomonas syringae pv. tomato NCPPB 1108 ....................  348 1 hit  [g-proteobacteria]      threonine synthase [Pseudomonas syringae pv. tomato T1] >gi
. . . . Pseudomonas putida GB-1 .......................................  348 2 hits [g-proteobacteria]      threonine synthase [Pseudomonas putida GB-1] >gi|166858577|
. . . . Pseudomonas sp. TJI-51 ........................................  348 2 hits [g-proteobacteria]      threonine synthase [Pseudomonas sp. TJI-51] >gi|324101040|g
. . . . Pseudomonas putida KT2440 .....................................  348 2 hits [g-proteobacteria]      threonine synthase [Pseudomonas putida KT2440] >gi|24982942
. . . . Pseudomonas putida W619 .......................................  348 2 hits [g-proteobacteria]      threonine synthase [Pseudomonas putida W619] >gi|169761312|
. . . . Pseudomonas fluorescens SBW25 .................................  348 2 hits [g-proteobacteria]      threonine synthase [Pseudomonas fluorescens SBW25] >gi|2293
. . . . Pseudomonas putida BIRD-1 .....................................  348 1 hit  [g-proteobacteria]      Threonine synthase [Pseudomonas putida BIRD-1]
. . . . Pseudomonas putida F1 .........................................  348 2 hits [g-proteobacteria]      threonine synthase [Pseudomonas putida F1] >gi|148513514|gb
. . . . Pseudomonas fluorescens WH6 ...................................  348 2 hits [g-proteobacteria]      threonine synthase [Pseudomonas fluorescens WH6] >gi|311282
. . . . Pseudomonas syringae pv. oryzae str. 1_6 ......................  344 1 hit  [g-proteobacteria]      threonine synthase [Pseudomonas syringae pv. oryzae str. 1_
. . . . Azotobacter vinelandii DJ .....................................  342 2 hits [g-proteobacteria]      threonine synthase [Azotobacter vinelandii DJ] >gi|22672091
. . . . Hahella chejuensis KCTC 2396 ..................................  332 2 hits [g-proteobacteria]      threonine synthase [Hahella chejuensis KCTC 2396] >gi|83632
. . . . marine gamma proteobacterium HTCC2148 .........................  332 2 hits [g-proteobacteria]      threonine synthase [marine gamma proteobacterium HTCC2148] 
. . . . Saccharophagus degradans 2-40 .................................  330 2 hits [g-proteobacteria]      threonine synthase [Saccharophagus degradans 2-40] >gi|8995
. . . . Marinobacter algicola DG893 ...................................  330 2 hits [g-proteobacteria]      threonine synthase [Marinobacter algicola DG893] >gi|149358
. . . . marine gamma proteobacterium HTCC2080 .........................  330 2 hits [g-proteobacteria]      threonine synthase [marine gamma proteobacterium HTCC2080] 
. . . . gamma proteobacterium HTCC2207 ................................  328 2 hits [g-proteobacteria]      Threonine synthase [marine gamma proteobacterium HTCC2207] 
. . . . Cellvibrio japonicus Ueda107 ..................................  326 2 hits [g-proteobacteria]      threonine synthase [Cellvibrio japonicus Ueda107] >gi|19068
. . . . Teredinibacter turnerae T7901 .................................  324 2 hits [g-proteobacteria]      threonine synthase [Teredinibacter turnerae T7901] >gi|2376
. . . . Marinomonas mediterranea MMB-1 ................................  322 2 hits [g-proteobacteria]      threonine synthase [Marinomonas mediterranea MMB-1] >gi|326
. . . . Marinobacter aquaeolei VT8 ....................................  322 2 hits [g-proteobacteria]      threonine synthase [Marinobacter aquaeolei VT8] >gi|1203250
. . . . Marinobacter sp. ELB17 ........................................  322 2 hits [g-proteobacteria]      threonine synthase [Marinobacter sp. ELB17] >gi|126630440|g
. . . . gamma proteobacterium NOR51-B .................................  321 2 hits [g-proteobacteria]      threonine synthase [gamma proteobacterium NOR51-B] >gi|2196
. . . . Allochromatium vinosum DSM 180 ................................  321 2 hits [g-proteobacteria]      threonine synthase [Allochromatium vinosum DSM 180] >gi|288
. . . . Halomonas elongata DSM 2581 ...................................  320 2 hits [g-proteobacteria]      threonine synthase [Halomonas elongata DSM 2581] >gi|307218
. . . . marine bacterium HP15 .........................................  319 1 hit  [g-proteobacteria]      threonine synthase [marine bacterium HP15]
. . . . Chromohalobacter salexigens DSM 3043 ..........................  318 2 hits [g-proteobacteria]      threonine synthase [Chromohalobacter salexigens DSM 3043] >
. . . . Neptuniibacter caesariensis ...................................  317 2 hits [g-proteobacteria]      threonine synthase [Oceanospirillum sp. MED92] >gi|89083734
. . . . Reinekea blandensis MED297 ....................................  315 2 hits [g-proteobacteria]      threonine synthase [Reinekea sp. MED297] >gi|88779170|gb|EA
. . . . marine gamma proteobacterium HTCC2143 .........................  315 2 hits [g-proteobacteria]      threonine synthase [marine gamma proteobacterium HTCC2143] 
. . . . Marinomonas sp. MWYL1 .........................................  315 2 hits [g-proteobacteria]      threonine synthase [Marinomonas sp. MWYL1] >gi|150838689|gb
. . . . Congregibacter litoralis KT71 .................................  314 2 hits [g-proteobacteria]      Threonine synthase [Congregibacter litoralis KT71] >gi|8869
. . . . gamma proteobacterium IMCC3088 ................................  312 2 hits [g-proteobacteria]      Threonine synthase [gamma proteobacterium IMCC3088] >gi|328
. . . . gamma proteobacterium IMCC1989 ................................  311 1 hit  [g-proteobacteria]      Threonine synthase [gamma proteobacterium IMCC1989]
. . . . Pelobacter propionicus DSM 2379 ...............................  310 2 hits [d-proteobacteria]      threonine synthase [Pelobacter propionicus DSM 2379] >gi|11
. . . . Magnetococcus sp. MC-1 ........................................  310 2 hits [proteobacteria]        threonine synthase [Magnetococcus sp. MC-1] >gi|117607529|g
. . . . Bermanella marisrubri .........................................  308 2 hits [g-proteobacteria]      threonine synthase [Oceanobacter sp. RED65] >gi|94426741|gb
. . . . Geobacter lovleyi SZ ..........................................  308 2 hits [d-proteobacteria]      threonine synthase [Geobacter lovleyi SZ] >gi|189421598|gb|
. . . . Marinomonas sp. MED121 ........................................  308 2 hits [g-proteobacteria]      threonine synthase [Marinomonas sp. MED121] >gi|86161782|gb
. . . . Desulfuromonas acetoxidans DSM 684 ............................  307 2 hits [d-proteobacteria]      threonine synthase [Desulfuromonas acetoxidans DSM 684] >gi
. . . . Geobacter uraniireducens Rf4 ..................................  301 2 hits [d-proteobacteria]      threonine synthase [Geobacter uraniireducens Rf4] >gi|14639
. . . . Desulfurivibrio alkaliphilus AHT2 .............................  300 2 hits [d-proteobacteria]      threonine synthase [Desulfurivibrio alkaliphilus AHT2] >gi|
. . . . Geobacter metallireducens GS-15 ...............................  299 2 hits [d-proteobacteria]      threonine synthase [Geobacter metallireducens GS-15] >gi|78
. . . . Geobacter sp. M21 .............................................  298 2 hits [d-proteobacteria]      threonine synthase [Geobacter sp. M21] >gi|251776433|gb|ACT
. . . . Geobacter sp. FRC-32 ..........................................  298 2 hits [d-proteobacteria]      threonine synthase [Geobacter sp. FRC-32] >gi|221565061|gb|
. . . . Geobacter sulfurreducens PCA ..................................  297 2 hits [d-proteobacteria]      threonine synthase [Geobacter sulfurreducens PCA] >gi|39983
. . . . Geobacter sulfurreducens KN400 ................................  297 1 hit  [d-proteobacteria]      threonine synthase [Geobacter sulfurreducens PCA] >gi|39983
. . . . Geobacter bemidjiensis Bem ....................................  296 2 hits [d-proteobacteria]      threonine synthase [Geobacter bemidjiensis Bem] >gi|1970870
. . . . Desulfobulbus propionicus DSM 2032 ............................  295 2 hits [d-proteobacteria]      L-threonine synthase [Desulfobulbus propionicus DSM 2032] >
. . . . Geobacter sp. M18 .............................................  295 2 hits [d-proteobacteria]      threonine synthase [Geobacter sp. M18] >gi|320125073|gb|ADW
. . . . Hippea maritima DSM 10411 .....................................  294 2 hits [d-proteobacteria]      threonine synthase [Hippea maritima DSM 10411] >gi|32718183
. . . . delta proteobacterium MLMS-1 ..................................  291 2 hits [d-proteobacteria]      Threonine synthase [delta proteobacterium MLMS-1] >gi|93452
. . . . Desulfotalea psychrophila LSv54 ...............................  291 2 hits [d-proteobacteria]      threonine synthase [Desulfotalea psychrophila LSv54] >gi|50
. . . . Pelobacter carbinolicus DSM 2380 ..............................  291 2 hits [d-proteobacteria]      threonine synthase [Pelobacter carbinolicus DSM 2380] >gi|7
. . . . Psychrobacter cryohalolentis K5 ...............................  278 2 hits [g-proteobacteria]      threonine synthase [Psychrobacter cryohalolentis K5] >gi|92
. . . . Psychrobacter arcticus 273-4 ..................................  277 2 hits [g-proteobacteria]      threonine synthase [Psychrobacter arcticus 273-4] >gi|71039
. . . . Psychrobacter sp. PRwf-1 ......................................  275 2 hits [g-proteobacteria]      threonine synthase [Psychrobacter sp. PRwf-1] >gi|148573260
. . . . Moraxella catarrhalis 7169 ....................................  271 1 hit  [g-proteobacteria]      threonine synthase [Moraxella catarrhalis 7169] >gi|3265690
. . . . Moraxella catarrhalis BC1 .....................................  271 1 hit  [g-proteobacteria]      threonine synthase [Moraxella catarrhalis 7169] >gi|3265690
. . . . Moraxella catarrhalis RH4 .....................................  271 2 hits [g-proteobacteria]      threonine synthase [Moraxella catarrhalis RH4] >gi|29592179
. . . . Moraxella catarrhalis 46P47B1 .................................  271 1 hit  [g-proteobacteria]      threonine synthase [Moraxella catarrhalis RH4] >gi|29592179
. . . . Moraxella catarrhalis 103P14B1 ................................  271 1 hit  [g-proteobacteria]      threonine synthase [Moraxella catarrhalis RH4] >gi|29592179
. . . . Moraxella catarrhalis BC8 .....................................  271 1 hit  [g-proteobacteria]      threonine synthase [Moraxella catarrhalis RH4] >gi|29592179
. . . . Moraxella catarrhalis O35E ....................................  271 1 hit  [g-proteobacteria]      threonine synthase [Moraxella catarrhalis RH4] >gi|29592179
. . . . Moraxella catarrhalis CO72 ....................................  271 1 hit  [g-proteobacteria]      threonine synthase [Moraxella catarrhalis RH4] >gi|29592179
. . . . Moraxella catarrhalis 101P30B1 ................................  271 1 hit  [g-proteobacteria]      threonine synthase [Moraxella catarrhalis RH4] >gi|29592179
. . . . Moraxella catarrhalis 12P80B1 .................................  270 1 hit  [g-proteobacteria]      threonine synthase [Moraxella catarrhalis 12P80B1] >gi|3265
. . . . Moraxella catarrhalis BC7 .....................................  270 1 hit  [g-proteobacteria]      threonine synthase [Moraxella catarrhalis 12P80B1] >gi|3265
. . . . Lautropia mirabilis ATCC 51599 ................................  269 2 hits [b-proteobacteria]      threonine synthase [Lautropia mirabilis ATCC 51599] >gi|319
. . . . Ralstonia pickettii 12D .......................................  261 2 hits [b-proteobacteria]      threonine synthase [Ralstonia pickettii 12D] >gi|309782209|
. . . . Ralstonia sp. 5_7_47FAA .......................................  261 2 hits [b-proteobacteria]      threonine synthase [Ralstonia pickettii 12D] >gi|309782209|
. . . . Neisseria subflava NJ9703 .....................................  260 2 hits [b-proteobacteria]      threonine synthase [Neisseria subflava NJ9703] >gi|28479689
. . . . Curvibacter putative symbiont of Hydra magnipapillata .........  260 1 hit  [b-proteobacteria]      Threonine synthase [Curvibacter putative symbiont of Hydra 
. . . . Neisseria mucosa C102 .........................................  259 2 hits [b-proteobacteria]      threonine synthase [Neisseria mucosa C102] >gi|317400695|gb
. . . . Ralstonia solanacearum UW551 ..................................  259 2 hits [b-proteobacteria]      Threonine synthase [Ralstonia solanacearum UW551] >gi|83724
. . . . Chromobacterium violaceum ATCC 12472 ..........................  259 2 hits [b-proteobacteria]      threonine synthase [Chromobacterium violaceum ATCC 12472] >
. . . . Ralstonia solanacearum MolK2 ..................................  259 2 hits [b-proteobacteria]      threonine synthase protein [Ralstonia solanacearum MolK2] >
. . . . Ralstonia solanacearum IPO1609 ................................  259 2 hits [b-proteobacteria]      threonine synthase protein [Ralstonia solanacearum MolK2] >
. . . . Ralstonia solanacearum GMI1000 ................................  258 2 hits [b-proteobacteria]      threonine synthase [Ralstonia solanacearum GMI1000] >gi|174
. . . . Enhydrobacter aerosaccus SK60 .................................  258 2 hits [g-proteobacteria]      threonine synthase [Enhydrobacter aerosaccus SK60] >gi|2574
. . . . Ralstonia solanacearum CFBP2957 ...............................  258 2 hits [b-proteobacteria]      threonine synthase [Ralstonia solanacearum CFBP2957] >gi|29
. . . . Thiomonas intermedia K12 ......................................  258 2 hits [b-proteobacteria]      threonine synthase [Thiomonas intermedia K12] >gi|295796672
. . . . Ralstonia solanacearum CMR15 ..................................  258 1 hit  [b-proteobacteria]      threonine synthase [Ralstonia solanacearum CMR15]
. . . . Pusillimonas sp. T7-7 .........................................  258 1 hit  [b-proteobacteria]      threonine synthase [Pusillimonas sp. T7-7]
. . . . Thiomonas sp. 3As .............................................  257 1 hit  [b-proteobacteria]      Threonine synthase [Thiomonas sp. 3As]
. . . . Neisseria lactamica ATCC 23970 ................................  257 2 hits [b-proteobacteria]      threonine synthase [Neisseria lactamica ATCC 23970] >gi|269
. . . . Neisseria meningitidis M01-240149 .............................  257 1 hit  [b-proteobacteria]      threonine synthase [Neisseria meningitidis M01-240149]
. . . . Ralstonia pickettii 12J .......................................  257 2 hits [b-proteobacteria]      threonine synthase [Ralstonia pickettii 12J] >gi|187725182|
. . . . Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1 .  257 2 hits [b-proteobacteria]      threonine synthase [Polynucleobacter necessarius subsp. asy
. . . . Neisseria lactamica 020-06 ....................................  256 2 hits [b-proteobacteria]      threonine synthase [Neisseria lactamica ST-640] >gi|3130058
. . . . Neisseria meningitidis NZ-05/33 ...............................  256 1 hit  [b-proteobacteria]      threonine synthase [Neisseria meningitidis NZ-05/33]
. . . . Neisseria polysaccharea ATCC 43768 ............................  256 2 hits [b-proteobacteria]      threonine synthase [Neisseria polysaccharea ATCC 43768] >gi
. . . . Polaromonas sp. JS666 .........................................  256 2 hits [b-proteobacteria]      threonine synthase [Polaromonas sp. JS666] >gi|91697289|gb|
. . . . Acidovorax sp. JS42 ...........................................  256 2 hits [b-proteobacteria]      threonine synthase [Acidovorax sp. JS42] >gi|222111729|ref|
. . . . Acidovorax ebreus TPSY ........................................  256 2 hits [b-proteobacteria]      threonine synthase [Acidovorax sp. JS42] >gi|222111729|ref|
. . . . Methylibium petroleiphilum PM1 ................................  256 2 hits [b-proteobacteria]      threonine synthase [Methylibium petroleiphilum PM1] >gi|124
. . . . Neisseria meningitidis 8013 ...................................  256 1 hit  [b-proteobacteria]      threonine synthase [Neisseria meningitidis 8013]
. . . . Neisseria meningitidis ES14902 ................................  256 1 hit  [b-proteobacteria]      threonine synthase [Neisseria meningitidis ES14902]
. . . . Neisseria meningitidis FAM18 ..................................  256 2 hits [b-proteobacteria]      threonine synthase [Neisseria meningitidis FAM18] >gi|12086
. . . . Neisseria meningitidis M01-240355 .............................  256 1 hit  [b-proteobacteria]      threonine synthase [Neisseria meningitidis M01-240355]
. . . . Neisseria meningitidis alpha710 ...............................  256 1 hit  [b-proteobacteria]      putative threonine synthase [Neisseria meningitidis alpha71
. . . . Neisseria meningitidis M0579 ..................................  256 1 hit  [b-proteobacteria]      threonine synthase [Neisseria meningitidis M0579]
. . . . Neisseria meningitidis ATCC 13091 .............................  256 2 hits [b-proteobacteria]      threonine synthase [Neisseria meningitidis ATCC 13091] >gi|
. . . . Neisseria meningitidis M13399 .................................  255 1 hit  [b-proteobacteria]      threonine synthase [Neisseria meningitidis M13399]
. . . . Neisseria meningitidis OX99.30304 .............................  255 1 hit  [b-proteobacteria]      threonine synthase [Neisseria meningitidis OX99.30304]
. . . . Neisseria gonorrhoeae NCCP11945 ...............................  255 2 hits [b-proteobacteria]      threonine synthase [Neisseria gonorrhoeae NCCP11945] >gi|19
. . . . Neisseria gonorrhoeae TCDC-NG08107 ............................  255 1 hit  [b-proteobacteria]      threonine synthase [Neisseria gonorrhoeae NCCP11945] >gi|19
. . . . Neisseria meningitidis alpha153 ...............................  255 1 hit  [b-proteobacteria]      Threonine synthase [Neisseria meningitidis alpha153]
. . . . Neisseria meningitidis N1568 ..................................  255 1 hit  [b-proteobacteria]      threonine synthase [Neisseria meningitidis N1568]
. . . . Neisseria flavescens NRL30031/H210 ............................  255 2 hits [b-proteobacteria]      hypothetical protein NEIFLAOT_00733 [Neisseria flavescens N
. . . . Neisseria gonorrhoeae FA 1090 .................................  255 2 hits [b-proteobacteria]      threonine synthase [Neisseria gonorrhoeae FA 1090] >gi|2399
. . . . Neisseria gonorrhoeae 35/02 ...................................  255 3 hits [b-proteobacteria]      threonine synthase [Neisseria gonorrhoeae FA 1090] >gi|2399
. . . . Neisseria gonorrhoeae DGI18 ...................................  255 1 hit  [b-proteobacteria]      threonine synthase [Neisseria gonorrhoeae FA 1090] >gi|2399
. . . . Neisseria gonorrhoeae FA6140 ..................................  255 1 hit  [b-proteobacteria]      threonine synthase [Neisseria gonorrhoeae FA 1090] >gi|2399
. . . . Neisseria gonorrhoeae FA19 ....................................  255 3 hits [b-proteobacteria]      threonine synthase [Neisseria gonorrhoeae FA 1090] >gi|2399
. . . . Neisseria gonorrhoeae MS11 ....................................  255 3 hits [b-proteobacteria]      threonine synthase [Neisseria gonorrhoeae FA 1090] >gi|2399
. . . . Neisseria gonorrhoeae PID18 ...................................  255 3 hits [b-proteobacteria]      threonine synthase [Neisseria gonorrhoeae FA 1090] >gi|2399
. . . . Neisseria gonorrhoeae PID1 ....................................  255 3 hits [b-proteobacteria]      threonine synthase [Neisseria gonorrhoeae FA 1090] >gi|2399
. . . . Neisseria gonorrhoeae PID24-1 .................................  255 1 hit  [b-proteobacteria]      threonine synthase [Neisseria gonorrhoeae FA 1090] >gi|2399
. . . . Neisseria gonorrhoeae PID332 ..................................  255 3 hits [b-proteobacteria]      threonine synthase [Neisseria gonorrhoeae FA 1090] >gi|2399
. . . . Neisseria gonorrhoeae SK-92-679 ...............................  255 3 hits [b-proteobacteria]      threonine synthase [Neisseria gonorrhoeae FA 1090] >gi|2399
. . . . Neisseria gonorrhoeae SK-93-1035 ..............................  255 3 hits [b-proteobacteria]      threonine synthase [Neisseria gonorrhoeae FA 1090] >gi|2399
. . . . Neisseria gonorrhoeae 1291 ....................................  255 2 hits [b-proteobacteria]      threonine synthase [Neisseria gonorrhoeae FA 1090] >gi|2399
. . . . Neisseria meningitidis Z2491 ..................................  255 2 hits [b-proteobacteria]      threonine synthase [Neisseria meningitidis Z2491] >gi|12105
. . . . Neisseria meningitidis MC58 ...................................  255 2 hits [b-proteobacteria]      threonine synthase [Neisseria meningitidis MC58] >gi|722628
. . . . Neisseria meningitidis H44/76 .................................  255 2 hits [b-proteobacteria]      threonine synthase [Neisseria meningitidis MC58] >gi|722628
. . . . Neisseria meningitidis M04-240196 .............................  255 1 hit  [b-proteobacteria]      threonine synthase [Neisseria meningitidis MC58] >gi|722628
. . . . Neisseria gonorrhoeae DGI2 ....................................  255 3 hits [b-proteobacteria]      threonine synthase [Neisseria gonorrhoeae DGI2]
. . . . Neisseria gonorrhoeae F62 .....................................  255 2 hits [b-proteobacteria]      threonine synthase [Neisseria gonorrhoeae F62] >gi|29161039
. . . . Neisseria meningitidis CU385 ..................................  255 1 hit  [b-proteobacteria]      threonine synthase [Neisseria meningitidis CU385] >gi|32514
. . . . Neisseria meningitidis M01-240013 .............................  255 1 hit  [b-proteobacteria]      threonine synthase [Neisseria meningitidis CU385] >gi|32514
. . . . Cardiobacterium hominis ATCC 15826 ............................  255 2 hits [g-proteobacteria]      threonine synthase [Cardiobacterium hominis ATCC 15826] >gi
. . . . Neisseria flavescens SK114 ....................................  254 2 hits [b-proteobacteria]      threonine synthase [Neisseria flavescens SK114] >gi|2413194
. . . . Rhodoferax ferrireducens T118 .................................  254 2 hits [b-proteobacteria]      threonine synthase [Rhodoferax ferrireducens T118] >gi|8934
. . . . Achromobacter xylosoxidans C54 ................................  254 1 hit  [b-proteobacteria]      ThrC protein [Achromobacter xylosoxidans C54]
. . . . Neisseria meningitidis WUE 2594 ...............................  253 1 hit  [b-proteobacteria]      threonine synthase [Neisseria meningitidis WUE 2594]
. . . . Neisseria meningitidis M6190 ..................................  253 1 hit  [b-proteobacteria]      threonine synthase [Neisseria meningitidis M6190]
. . . . Neisseria lactamica Y92-1009 ..................................  253 1 hit  [b-proteobacteria]      unnamed protein product [Neisseria lactamica Y92-1009]
. . . . Neisseria meningitidis alpha14 ................................  253 2 hits [b-proteobacteria]      Threonine synthase [Neisseria meningitidis alpha14] >gi|254
. . . . Lutiella nitroferrum 2002 .....................................  253 2 hits [b-proteobacteria]      threonine synthase [Lutiella nitroferrum 2002] >gi|22460134
. . . . Nitrosomonas eutropha C91 .....................................  253 2 hits [b-proteobacteria]      threonine synthase [Nitrosomonas eutropha C91] >gi|11430788
. . . . Eikenella corrodens ATCC 23834 ................................  253 2 hits [b-proteobacteria]      hypothetical protein EIKCOROL_01094 [Eikenella corrodens AT
. . . . Neisseria meningitidis alpha275 ...............................  253 1 hit  [b-proteobacteria]      Threonine synthase [Neisseria meningitidis alpha275]
. . . . Ralstonia eutropha H16 ........................................  253 2 hits [b-proteobacteria]      threonine synthase [Ralstonia eutropha H16] >gi|113527017|e
. . . . Alicycliphilus denitrificans BC ...............................  252 2 hits [b-proteobacteria]      threonine synthase [Alicycliphilus denitrificans BC] >gi|31
. . . . Variovorax paradoxus EPS ......................................  252 2 hits [b-proteobacteria]      threonine synthase [Variovorax paradoxus EPS] >gi|315595235
. . . . Alicycliphilus denitrificans K601 .............................  252 2 hits [b-proteobacteria]      threonine synthase [Alicycliphilus denitrificans K601] >gi|
. . . . Neisseria meningitidis 053442 .................................  252 2 hits [b-proteobacteria]      threonine synthase [Neisseria meningitidis 053442] >gi|1615
. . . . Neisseria meningitidis 961-5945 ...............................  252 1 hit  [b-proteobacteria]      threonine synthase [Neisseria meningitidis 961-5945] >gi|32
. . . . Neisseria meningitidis G2136 ..................................  252 1 hit  [b-proteobacteria]      threonine synthase [Neisseria meningitidis 961-5945] >gi|32
. . . . Acidovorax delafieldii 2AN ....................................  252 2 hits [b-proteobacteria]      threonine synthase [Acidovorax delafieldii 2AN] >gi|2413646
. . . . Variovorax paradoxus S110 .....................................  252 2 hits [b-proteobacteria]      threonine synthase [Variovorax paradoxus S110] >gi|23980141
. . . . Sideroxydans lithotrophicus ES-1 ..............................  252 2 hits [b-proteobacteria]      threonine synthase [Sideroxydans lithotrophicus ES-1] >gi|2
. . . . Polynucleobacter necessarius subsp. necessarius STIR1 .........  252 2 hits [b-proteobacteria]      threonine synthase [Polynucleobacter necessarius subsp. nec
. . . . Nitrosomonas europaea ATCC 19718 ..............................  252 2 hits [b-proteobacteria]      thrC; probable threonine synthase protein [Nitrosomonas eur
. . . . Bordetella petrii DSM 12804 ...................................  252 1 hit  [b-proteobacteria]      threonine synthase [Bordetella petrii DSM 12804] >gi|163260
. . . . Bordetella petrii .............................................  252 1 hit  [b-proteobacteria]      threonine synthase [Bordetella petrii DSM 12804] >gi|163260
. . . . Neisseria elongata subsp. glycolytica ATCC 29315 ..............  251 2 hits [b-proteobacteria]      hypothetical protein NEIELOOT_02771 [Neisseria elongata sub
. . . . Aromatoleum aromaticum EbN1 ...................................  251 2 hits [b-proteobacteria]      threonine synthase [Aromatoleum aromaticum EbN1] >gi|563142
. . . . Neisseria cinerea ATCC 14685 ..................................  251 2 hits [b-proteobacteria]      threonine synthase [Neisseria cinerea ATCC 14685] >gi|26914
. . . . Cupriavidus taiwanensis LMG 19424 .............................  251 2 hits [b-proteobacteria]      threonine synthase [Cupriavidus taiwanensis LMG 19424] >gi|
. . . . Achromobacter piechaudii ATCC 43553 ...........................  250 2 hits [b-proteobacteria]      threonine synthase [Achromobacter piechaudii ATCC 43553] >g
. . . . Comamonas testosteroni S44 ....................................  249 2 hits [b-proteobacteria]      threonine synthase [Comamonas testosteroni S44] >gi|2987212
. . . . Kingella oralis ATCC 51147 ....................................  249 2 hits [b-proteobacteria]      hypothetical protein GCWU000324_00652 [Kingella oralis ATCC
. . . . Neisseria mucosa ATCC 25996 ...................................  249 2 hits [b-proteobacteria]      threonine synthase [Neisseria mucosa ATCC 25996] >gi|288567
. . . . Kingella denitrificans ATCC 33394 .............................  249 2 hits [b-proteobacteria]      threonine synthase [Kingella denitrificans ATCC 33394] >gi|
. . . . Bordetella avium 197N .........................................  249 2 hits [b-proteobacteria]      threonine synthase [Bordetella avium 197N] >gi|115423238|em
. . . . Comamonas testosteroni CNB-2 ..................................  248 2 hits [b-proteobacteria]      threonine synthase [Comamonas testosteroni CNB-2] >gi|26220
. . . . Neisseria sp. oral taxon 014 str. F0314 .......................  248 2 hits [b-proteobacteria]      threonine synthase [Neisseria sp. oral taxon 014 str. F0314
. . . . Neisseria sicca ATCC 29256 ....................................  248 2 hits [b-proteobacteria]      threonine synthase [Neisseria sicca ATCC 29256] >gi|2550497
. . . . Burkholderia phymatum STM815 ..................................  248 2 hits [b-proteobacteria]      threonine synthase [Burkholderia phymatum STM815] >gi|18419
. . . . Acidovorax avenae subsp. avenae ATCC 19860 ....................  248 2 hits [b-proteobacteria]      threonine synthase [Acidovorax avenae subsp. avenae ATCC 19
. . . . Comamonas testosteroni KF-1 ...................................  248 2 hits [b-proteobacteria]      threonine synthase [Comamonas testosteroni KF-1] >gi|220713
. . . . Acidovorax citrulli AAC00-1 ...................................  248 2 hits [b-proteobacteria]      threonine synthase [Acidovorax citrulli AAC00-1] >gi|120588
. . . . Verminephrobacter eiseniae EF01-2 .............................  246 2 hits [b-proteobacteria]      threonine synthase [Verminephrobacter eiseniae EF01-2] >gi|
. . . . Ralstonia solanacearum PSI07 ..................................  246 2 hits [b-proteobacteria]      threonine synthase [Ralstonia solanacearum PSI07] >gi|29907
. . . . Burkholderia phytofirmans PsJN ................................  246 2 hits [b-proteobacteria]      threonine synthase [Burkholderia phytofirmans PsJN] >gi|187
. . . . Burkholderia sp. H160 .........................................  246 2 hits [b-proteobacteria]      threonine synthase [Burkholderia sp. H160] >gi|209500019|gb
. . . . Ralstonia eutropha JMP134 .....................................  246 2 hits [b-proteobacteria]      threonine synthase [Ralstonia eutropha JMP134] >gi|72119093
. . . . Polaromonas naphthalenivorans CJ2 .............................  246 2 hits [b-proteobacteria]      threonine synthase [Polaromonas naphthalenivorans CJ2] >gi|
. . . . Achromobacter xylosoxidans A8 .................................  245 2 hits [b-proteobacteria]      threonine synthase [Achromobacter xylosoxidans A8] >gi|3107
. . . . Simonsiella muelleri ATCC 29453 ...............................  245 2 hits [b-proteobacteria]      threonine synthase [Simonsiella muelleri ATCC 29453] >gi|29
. . . . Burkholderia sp. CCGE1001 .....................................  245 2 hits [b-proteobacteria]      threonine synthase [Burkholderia sp. CCGE1001] >gi|32338317
. . . . Burkholderia sp. 383 ..........................................  245 2 hits [b-proteobacteria]      threonine synthase [Burkholderia sp. 383] >gi|77967368|gb|A
. . . . Burkholderia sp. CCGE1002 .....................................  245 2 hits [b-proteobacteria]      threonine synthase [Burkholderia sp. CCGE1002] >gi|29543628
. . . . Delftia acidovorans SPH-1 .....................................  244 2 hits [b-proteobacteria]      threonine synthase [Delftia acidovorans SPH-1] >gi|16036623
. . . . Burkholderia sp. CCGE1003 .....................................  244 2 hits [b-proteobacteria]      threonine synthase [Burkholderia sp. CCGE1003] >gi|30758409
. . . . Methylobacillus glycogenes ....................................  244 2 hits [b-proteobacteria]      RecName: Full=Threonine synthase; Short=TS >gi|2160269|dbj|
. . . . Burkholderia vietnamiensis G4 .................................  244 2 hits [b-proteobacteria]      threonine synthase [Burkholderia vietnamiensis G4] >gi|1341
. . . . Burkholderia rhizoxinica HKI 454 ..............................  244 2 hits [b-proteobacteria]      Threonine synthase [Burkholderia rhizoxinica HKI 454] >gi|3
. . . . Burkholderia sp. TJI49 ........................................  244 1 hit  [b-proteobacteria]      threonine synthase [Burkholderia sp. TJI49]
. . . . Neisseria bacilliformis ATCC BAA-1200 .........................  243 2 hits [b-proteobacteria]      threonine synthase [Neisseria bacilliformis ATCC BAA-1200] 
. . . . Laribacter hongkongensis HLHK9 ................................  243 2 hits [b-proteobacteria]      threonine synthase [Laribacter hongkongensis HLHK9] >gi|226
. . . Elusimicrobium minutum Pei191 -----------------------------------  323 2 hits [bacteria]              threonine synthase [Elusimicrobium minutum Pei191] >gi|1869
. . . uncultured bacterium ............................................  317 1 hit  [bacteria]              L-threonine synthase [uncultured bacterium]
. . . Deferribacter desulfuricans SSM1 ................................  310 2 hits [bacteria]              threonine synthase [Deferribacter desulfuricans SSM1] >gi|2
. . . Denitrovibrio acetiphilus DSM 12809 .............................  307 2 hits [bacteria]              threonine synthase [Denitrovibrio acetiphilus DSM 12809] >g
. . . Lentisphaera araneosa HTCC2155 ..................................  292 2 hits [bacteria]              threonine synthase [Lentisphaera araneosa HTCC2155] >gi|149
. . . Calditerrivibrio nitroreducens DSM 19672 ........................  291 2 hits [bacteria]              l-threonine synthase [Calditerrivibrio nitroreducens DSM 19
. . . Paenibacillus curdlanolyticus YK9 ...............................  289 2 hits [firmicutes]            threonine synthase [Paenibacillus curdlanolyticus YK9] >gi|
. . . Paenibacillus sp. JDR-2 .........................................  286 2 hits [firmicutes]            threonine synthase [Paenibacillus sp. JDR-2] >gi|247546956|
. . . Opitutus terrae PB90-1 ..........................................  286 2 hits [verrucomicrobia]       threonine synthase [Opitutus terrae PB90-1] >gi|177842543|g
. . . Paenibacillus polymyxa SC2 ......................................  281 2 hits [firmicutes]            threonine synthase [Paenibacillus polymyxa SC2] >gi|3092482
. . . Paenibacillus polymyxa E681 .....................................  281 2 hits [firmicutes]            Threonine synthase (TS) [Paenibacillus polymyxa E681] >gi|3
. . . Coraliomargarita akajimensis DSM 45221 ..........................  276 2 hits [verrucomicrobia]       threonine synthase [Coraliomargarita akajimensis DSM 45221]
. . . Verrucomicrobium spinosum DSM 4136 ..............................  276 1 hit  [verrucomicrobia]       threonine synthase [Verrucomicrobium spinosum DSM 4136]
. . . Verrucomicrobiae bacterium DG1235 ...............................  271 2 hits [verrucomicrobia]       threonine synthase [Verrucomicrobiae bacterium DG1235] >gi|
. . . Deinococcus proteolyticus MRP ...................................  271 2 hits [bacteria]              threonine synthase [Deinococcus proteolyticus MRP] >gi|3243
. . . Corynebacterium urealyticum DSM 7109 ............................  266 2 hits [high GC Gram+]         threonine synthase [Corynebacterium urealyticum DSM 7109] >
. . . Corynebacterium tuberculostearicum SK141 ........................  266 2 hits [high GC Gram+]         threonine synthase [Corynebacterium tuberculostearicum SK14
. . . Corynebacterium pseudogenitalium ATCC 33035 .....................  265 2 hits [high GC Gram+]         threonine synthase [Corynebacterium pseudogenitalium ATCC 3
. . . Corynebacterium kroppenstedtii DSM 44385 ........................  265 2 hits [high GC Gram+]         threonine synthase [Corynebacterium kroppenstedtii DSM 4438
. . . Corynebacterium resistens DSM 45100 .............................  262 1 hit  [high GC Gram+]         threonine synthase [Corynebacterium resistens DSM 45100]
. . . Corynebacterium matruchotii ATCC 33806 ..........................  262 2 hits [high GC Gram+]         hypothetical protein CORMATOL_01880 [Corynebacterium matruc
. . . Corynebacterium pseudotuberculosis FRC41 ........................  262 2 hits [high GC Gram+]         threonine synthase [Corynebacterium pseudotuberculosis FRC4
. . . Corynebacterium pseudotuberculosis C231 .........................  262 1 hit  [high GC Gram+]         threonine synthase [Corynebacterium pseudotuberculosis FRC4
. . . Corynebacterium pseudotuberculosis 1002 .........................  262 1 hit  [high GC Gram+]         threonine synthase [Corynebacterium pseudotuberculosis FRC4
. . . Corynebacterium pseudotuberculosis I19 ..........................  262 1 hit  [high GC Gram+]         threonine synthase [Corynebacterium pseudotuberculosis FRC4
. . . Corynebacterium matruchotii ATCC 14266 ..........................  261 2 hits [high GC Gram+]         threonine synthase [Corynebacterium matruchotii ATCC 14266]
. . . Corynebacterium amycolatum SK46 .................................  259 2 hits [high GC Gram+]         threonine synthase [Corynebacterium amycolatum SK46] >gi|21
. . . Corynebacterium efficiens YS-314 ................................  258 4 hits [high GC Gram+]         threonine synthase [Corynebacterium efficiens YS-314] >gi|2
. . . Corynebacterium ammoniagenes DSM 20306 ..........................  258 2 hits [high GC Gram+]         threonine synthase [Corynebacterium ammoniagenes DSM 20306]
. . . Corynebacterium glutamicum ......................................  257 3 hits [high GC Gram+]         threonine synthase [Corynebacterium glutamicum]
. . . Corynebacterium glutamicum ATCC 13032 ...........................  257 4 hits [high GC Gram+]         threonine synthase [Corynebacterium glutamicum ATCC 13032] 
. . . Corynebacterium glutamicum R ....................................  257 2 hits [high GC Gram+]         threonine synthase [Corynebacterium glutamicum R] >gi|14084
. . . Corynebacterium accolens ATCC 49725 .............................  256 2 hits [high GC Gram+]         threonine synthase [Corynebacterium accolens ATCC 49725] >g
. . . Corynebacterium aurimucosum ATCC 700975 .........................  254 3 hits [high GC Gram+]         Threonine synthase [Corynebacterium aurimucosum ATCC 700975
. . . Corynebacterium accolens ATCC 49726 .............................  253 2 hits [high GC Gram+]         threonine synthase [Corynebacterium accolens ATCC 49726] >g
. . . Corynebacterium striatum ATCC 6940 ..............................  253 2 hits [high GC Gram+]         threonine synthase [Corynebacterium striatum ATCC 6940] >gi
. . . Deinococcus radiodurans R1 ......................................  253 2 hits [bacteria]              threonine synthase [Deinococcus radiodurans R1] >gi|6460724
. . . Corynebacterium diphtheriae NCTC 13129 ..........................  253 1 hit  [high GC Gram+]         threonine synthase [Corynebacterium diphtheriae NCTC 13129]
. . . Corynebacterium diphtheriae .....................................  253 1 hit  [high GC Gram+]         threonine synthase [Corynebacterium diphtheriae NCTC 13129]
. . . Corynebacterium variabile DSM 44702 .............................  248 1 hit  [high GC Gram+]         threonine synthase [Corynebacterium variabile DSM 44702]
. . . Actinomyces sp. oral taxon 178 str. F0338 .......................  248 2 hits [high GC Gram+]         threonine synthase [Actinomyces sp. oral taxon 178 str. F03
. . . Actinomyces sp. oral taxon 180 str. F0310 .......................  245 2 hits [high GC Gram+]         threonine synthase [Actinomyces sp. oral taxon 180 str. F03
. . Ectocarpus siliculosus --------------------------------------------  294 1 hit  [brown algae]           Threonine synthase [Ectocarpus siliculosus]
. . Monosiga brevicollis MX1 ..........................................  293 2 hits [choanoflagellates]     hypothetical protein [Monosiga brevicollis MX1] >gi|1637738
. . Thalassiosira pseudonana CCMP1335 .................................  291 2 hits [diatoms]               threonine synthase [Thalassiosira pseudonana CCMP1335] >gi|
. . Botryotinia fuckeliana B05.10 .....................................  291 2 hits [ascomycetes]           hypothetical protein BC1G_06474 [Botryotinia fuckeliana B05
. . Sclerotinia sclerotiorum 1980 UF-70 ...............................  290 2 hits [ascomycetes]           hypothetical protein SS1G_13483 [Sclerotinia sclerotiorum 1
. . Glomerella graminicola M1.001 .....................................  290 1 hit  [ascomycetes]           threonine synthase [Glomerella graminicola M1.001]
. . Salpingoeca sp. ATCC 50818 ........................................  289 1 hit  [choanoflagellates]     threonine synthase [Salpingoeca sp. ATCC 50818]
. . Albugo laibachii Nc14 .............................................  288 1 hit  [oomycetes]             unnamed protein product [Albugo laibachii Nc14]
. . Phytophthora infestans T30-4 ......................................  286 2 hits [oomycetes]             threonine synthase [Phytophthora infestans T30-4] >gi|26210
. . Polysphondylium pallidum PN500 ....................................  286 1 hit  [cellular slime molds]  threonine synthase [Polysphondylium pallidum PN500]
. . Aspergillus clavatus NRRL 1 .......................................  283 2 hits [ascomycetes]           threonine synthase [Aspergillus clavatus NRRL 1] >gi|119399
. . Malassezia globosa CBS 7966 .......................................  282 2 hits [basidiomycetes]        hypothetical protein MGL_4122 [Malassezia globosa CBS 7966]
. . Tuber melanosporum Mel28 ..........................................  281 1 hit  [ascomycetes]           hypothetical protein [Tuber melanosporum Mel28] >gi|2956367
. . Tuber melanosporum (French truffle) ...............................  281 1 hit  [ascomycetes]           hypothetical protein [Tuber melanosporum Mel28] >gi|2956367
. . Meyerozyma guilliermondii ATCC 6260 ...............................  279 2 hits [ascomycetes]           hypothetical protein PGUG_00240 [Meyerozyma guilliermondii 
. . Talaromyces stipitatus ATCC 10500 .................................  279 2 hits [ascomycetes]           threonine synthase Thr4, putative [Talaromyces stipitatus A
. . Phaeodactylum tricornutum CCAP 1055/1 .............................  279 2 hits [diatoms]               predicted protein [Phaeodactylum tricornutum CCAP 1055/1] >
. . Aspergillus fumigatus Af293 .......................................  278 2 hits [ascomycetes]           threonine synthase Thr4 [Aspergillus fumigatus Af293] >gi|6
. . Aspergillus fumigatus A1163 .......................................  278 1 hit  [ascomycetes]           threonine synthase Thr4 [Aspergillus fumigatus Af293] >gi|6
. . Aspergillus niger CBS 513.88 ......................................  278 1 hit  [ascomycetes]           threonine synthase [Aspergillus niger CBS 513.88]
. . Aspergillus niger .................................................  278 1 hit  [ascomycetes]           unnamed protein product [Aspergillus niger]
. . Trichophyton equinum CBS 127.97 ...................................  277 1 hit  [ascomycetes]           threonine synthase [Trichophyton equinum CBS 127.97]
. . Trichophyton tonsurans CBS 112818 .................................  277 1 hit  [ascomycetes]           threonine synthase [Trichophyton tonsurans CBS 112818]
. . Trichophyton rubrum CBS 118892 ....................................  277 2 hits [ascomycetes]           threonine synthase [Trichophyton rubrum CBS 118892] >gi|326
. . Penicillium marneffei ATCC 18224 ..................................  277 2 hits [ascomycetes]           threonine synthase Thr4, putative [Penicillium marneffei AT
. . Arthroderma otae CBS 113480 .......................................  277 2 hits [ascomycetes]           threonine synthase [Arthroderma otae CBS 113480] >gi|238838
. . Arthroderma gypseum CBS 118893 ....................................  276 2 hits [ascomycetes]           threonine synthase [Arthroderma gypseum CBS 118893] >gi|311
. . Magnaporthe oryzae 70-15 ..........................................  276 2 hits [ascomycetes]           hypothetical protein MGG_08923 [Magnaporthe oryzae 70-15] >
. . Pichia pastoris GS115 .............................................  276 2 hits [ascomycetes]           Threonine synthase, conserved protein that catalyzes format
. . Pichia pastoris CBS 7435 ..........................................  276 1 hit  [ascomycetes]           Threonine synthase, conserved protein that catalyzes format
. . Clavispora lusitaniae ATCC 42720 ..................................  276 2 hits [ascomycetes]           hypothetical protein CLUG_03293 [Clavispora lusitaniae ATCC
. . Lodderomyces elongisporus NRRL YB-4239 ............................  276 2 hits [ascomycetes]           threonine synthase [Lodderomyces elongisporus NRRL YB-4239]
. . Candida glabrata CBS 138 ..........................................  276 1 hit  [ascomycetes]           hypothetical protein [Candida glabrata CBS 138] >gi|4952793
. . Candida glabrata ..................................................  276 1 hit  [ascomycetes]           hypothetical protein [Candida glabrata CBS 138] >gi|4952793
. . Candida dubliniensis CD36 .........................................  275 2 hits [ascomycetes]           threonine synthase, putative [Candida dubliniensis CD36] >g
. . Saccharomyces cerevisiae FostersO .................................  275 1 hit  [ascomycetes]           Thr4p [Saccharomyces cerevisiae FostersO]
. . Paracoccidioides brasiliensis Pb01 ................................  275 2 hits [ascomycetes]           threonine synthase [Paracoccidioides brasiliensis Pb01] >gi
. . Saccharomyces cerevisiae S288c ....................................  275 2 hits [ascomycetes]           Thr4p [Saccharomyces cerevisiae S288c] >gi|135816|sp|P16120
. . Saccharomyces cerevisiae (yeast) ..................................  275 6 hits [ascomycetes]           Thr4p [Saccharomyces cerevisiae S288c] >gi|135816|sp|P16120
. . Saccharomyces cerevisiae YJM789 ...................................  275 1 hit  [ascomycetes]           Thr4p [Saccharomyces cerevisiae S288c] >gi|135816|sp|P16120
. . Saccharomyces cerevisiae RM11-1a ..................................  275 1 hit  [ascomycetes]           Thr4p [Saccharomyces cerevisiae S288c] >gi|135816|sp|P16120
. . Saccharomyces cerevisiae JAY291 ...................................  275 1 hit  [ascomycetes]           Thr4p [Saccharomyces cerevisiae S288c] >gi|135816|sp|P16120
. . Saccharomyces cerevisiae EC1118 ...................................  275 1 hit  [ascomycetes]           Thr4p [Saccharomyces cerevisiae S288c] >gi|135816|sp|P16120
. . Saccharomyces cerevisiae AWRI796 ..................................  275 1 hit  [ascomycetes]           Thr4p [Saccharomyces cerevisiae S288c] >gi|135816|sp|P16120
. . Saccharomyces cerevisiae VL3 ......................................  275 1 hit  [ascomycetes]           Thr4p [Saccharomyces cerevisiae VL3]
. . Saccharomyces cerevisiae AWRI1631 .................................  275 1 hit  [ascomycetes]           YCR053Wp-like protein [Saccharomyces cerevisiae AWRI1631]
. . Metarhizium acridum CQMa 102 ......................................  275 1 hit  [ascomycetes]           threonine synthase [Metarhizium acridum CQMa 102]
. . Scheffersomyces stipitis CBS 6054 .................................  275 2 hits [ascomycetes]           threonine synthase [Scheffersomyces stipitis CBS 6054] >gi|
. . Neosartorya fischeri NRRL 181 .....................................  275 2 hits [ascomycetes]           threonine synthase [Neosartorya fischeri NRRL 181] >gi|1194
. . Chaetomium globosum CBS 148.51 ....................................  274 2 hits [ascomycetes]           threonine synthase [Chaetomium globosum CBS 148.51] >gi|881
. . Arthroderma benhamiae CBS 112371 ..................................  273 2 hits [ascomycetes]           hypothetical protein ARB_03793 [Arthroderma benhamiae CBS 1
. . Trichophyton verrucosum HKI 0517 ..................................  273 2 hits [ascomycetes]           hypothetical protein TRV_02602 [Trichophyton verrucosum HKI
. . Aspergillus oryzae RIB40 ..........................................  273 1 hit  [ascomycetes]           threonine synthase [Aspergillus oryzae RIB40]
. . Saccharomyces cerevisiae Lalvin QA23 ..............................  273 1 hit  [ascomycetes]           Thr4p [Saccharomyces cerevisiae Lalvin QA23]
. . Grosmannia clavigera kw1407 .......................................  273 1 hit  [ascomycetes]           threonine synthase [Grosmannia clavigera kw1407]
. . Coccidioides posadasii C735 delta SOWgp ...........................  273 2 hits [ascomycetes]           threonine synthase, putative [Coccidioides posadasii C735 d
. . Coccidioides posadasii str. Silveira ..............................  273 1 hit  [ascomycetes]           threonine synthase [Coccidioides posadasii str. Silveira]
. . Coccidioides immitis RS ...........................................  273 1 hit  [ascomycetes]           hypothetical protein CIMG_04773 [Coccidioides immitis RS]
. . Debaryomyces hansenii CBS767 ......................................  273 1 hit  [ascomycetes]           DEHA2F18986p [Debaryomyces hansenii CBS767] >gi|49656839|em
. . Debaryomyces hansenii .............................................  273 1 hit  [ascomycetes]           DEHA2F18986p [Debaryomyces hansenii CBS767] >gi|49656839|em
. . Candida albicans SC5314 ...........................................  273 4 hits [ascomycetes]           hypothetical protein CaO19.11708 [Candida albicans SC5314] 
. . Capsaspora owczarzaki ATCC 30864 ..................................  272 1 hit  [eukaryotes]            threonine synthase [Capsaspora owczarzaki ATCC 30864]
. . Kluyveromyces lactis NRRL Y-1140 ..................................  272 1 hit  [ascomycetes]           hypothetical protein [Kluyveromyces lactis NRRL Y-1140] >gi
. . Kluyveromyces lactis ..............................................  272 1 hit  [ascomycetes]           hypothetical protein [Kluyveromyces lactis NRRL Y-1140] >gi
. . Podospora anserina S mat+ .........................................  272 2 hits [ascomycetes]           hypothetical protein [Podospora anserina S mat+] >gi|170944
. . Paracoccidioides brasiliensis Pb03 ................................  272 1 hit  [ascomycetes]           threonine synthase [Paracoccidioides brasiliensis Pb03]
. . Paracoccidioides brasiliensis Pb18 ................................  272 1 hit  [ascomycetes]           threonine synthase [Paracoccidioides brasiliensis Pb18]
. . Ustilago maydis 521 ...............................................  272 2 hits [basidiomycetes]        hypothetical protein UM04341.1 [Ustilago maydis 521] >gi|46
. . Metarhizium anisopliae ARSEF 23 ...................................  272 1 hit  [ascomycetes]           threonine synthase [Metarhizium anisopliae ARSEF 23]
. . Candida tropicalis MYA-3404 .......................................  272 2 hits [ascomycetes]           threonine synthase [Candida tropicalis MYA-3404] >gi|240131
. . Aspergillus terreus NIH2624 .......................................  272 2 hits [ascomycetes]           threonine synthase [Aspergillus terreus NIH2624] >gi|114191
. . Yarrowia lipolytica CLIB122 .......................................  271 1 hit  [ascomycetes]           YALI0F23221p [Yarrowia lipolytica] >gi|49651649|emb|CAG7859
. . Yarrowia lipolytica ...............................................  271 1 hit  [ascomycetes]           YALI0F23221p [Yarrowia lipolytica] >gi|49651649|emb|CAG7859
. . Lachancea thermotolerans CBS 6340 .................................  271 1 hit  [ascomycetes]           KLTH0A06336p [Lachancea thermotolerans] >gi|238933111|emb|C
. . Lachancea thermotolerans ..........................................  271 1 hit  [ascomycetes]           KLTH0A06336p [Lachancea thermotolerans] >gi|238933111|emb|C
. . Sordaria macrospora ...............................................  271 1 hit  [ascomycetes]           unnamed protein product [Sordaria macrospora]
. . Ajellomyces dermatitidis ER-3 .....................................  271 1 hit  [ascomycetes]           threonine synthase [Ajellomyces dermatitidis ER-3] >gi|3273
. . Ajellomyces dermatitidis ATCC 18188 ...............................  271 1 hit  [ascomycetes]           threonine synthase [Ajellomyces dermatitidis ER-3] >gi|3273
. . Candida albicans WO-1 .............................................  271 1 hit  [ascomycetes]           threonine synthase [Candida albicans WO-1]
. . Ajellomyces dermatitidis SLH14081 .................................  270 2 hits [ascomycetes]           threonine synthase [Ajellomyces dermatitidis SLH14081] >gi|
. . Pichia angusta DL-1 ...............................................  269 1 hit  [ascomycetes]           threonine synthase [Pichia angusta DL-1]
. . Coprinopsis cinerea okayama7#130 ..................................  269 2 hits [basidiomycetes]        threonine synthase [Coprinopsis cinerea okayama7#130] >gi|2
. . Ashbya gossypii ATCC 10895 ........................................  268 3 hits [ascomycetes]           AAR059Cp [Ashbya gossypii ATCC 10895] >gi|3334375|sp|Q00063
. . Eremothecium gossypii .............................................  268 1 hit  [ascomycetes]           AAR059Cp [Ashbya gossypii ATCC 10895] >gi|3334375|sp|Q00063
. . Schizophyllum commune H4-8 ........................................  268 2 hits [basidiomycetes]        hypothetical protein SCHCODRAFT_82488 [Schizophyllum commun
. . Schizosaccharomyces japonicus yFS275 ..............................  268 2 hits [ascomycetes]           threonine synthase [Schizosaccharomyces japonicus yFS275] >
. . Leptosphaeria maculans (blackleg of crucifers ...) ................  267 1 hit  [ascomycetes]           similar to threonine synthase [Leptosphaeria maculans]
. . Perkinsus marinus ATCC 50983 ......................................  267 2 hits [eukaryotes]            Threonine synthase, putative [Perkinsus marinus ATCC 50983]
. . Laccaria bicolor S238N-H82 ........................................  267 2 hits [basidiomycetes]        predicted protein [Laccaria bicolor S238N-H82] >gi|16464625
. . Aspergillus oryzae ................................................  266 1 hit  [ascomycetes]           unnamed protein product [Aspergillus oryzae]
. . Vanderwaltozyma polyspora DSM 70294 ...............................  266 2 hits [ascomycetes]           hypothetical protein Kpol_289p2 [Vanderwaltozyma polyspora 
. . Ajellomyces capsulatus NAm1 .......................................  266 2 hits [ascomycetes]           threonine synthase [Ajellomyces capsulatus NAm1] >gi|150407
. . Neurospora crassa OR74A ...........................................  266 2 hits [ascomycetes]           threonine synthase [Neurospora crassa OR74A] >gi|18376360|e
. . Neurospora crassa .................................................  266 1 hit  [ascomycetes]           threonine synthase [Neurospora crassa OR74A] >gi|18376360|e
. . Nectria haematococca mpVI 77-13-4 .................................  264 2 hits [ascomycetes]           predicted protein [Nectria haematococca mpVI 77-13-4] >gi|2
. . Ajellomyces capsulatus G186AR .....................................  264 1 hit  [ascomycetes]           threonine synthase [Ajellomyces capsulatus G186AR]
. . Ajellomyces capsulatus H143 .......................................  264 1 hit  [ascomycetes]           threonine synthase [Ajellomyces capsulatus H143] >gi|325094
. . Ajellomyces capsulatus H88 ........................................  264 1 hit  [ascomycetes]           threonine synthase [Ajellomyces capsulatus H143] >gi|325094
. . Aspergillus nidulans FGSC A4 ......................................  263 3 hits [ascomycetes]           hypothetical protein AN3031.2 [Aspergillus nidulans FGSC A4
. . Pyrenophora tritici-repentis Pt-1C-BFP ............................  263 2 hits [ascomycetes]           threonine synthase [Pyrenophora tritici-repentis Pt-1C-BFP]
. . Melampsora larici-populina 98AG31 .................................  262 1 hit  [basidiomycetes]        hypothetical protein MELLADRAFT_42682 [Melampsora larici-po
. . Zygosaccharomyces rouxii CBS 732 ..................................  261 1 hit  [ascomycetes]           ZYRO0D08602p [Zygosaccharomyces rouxii] >gi|186703898|emb|C
. . Zygosaccharomyces rouxii ..........................................  261 4 hits [ascomycetes]           ZYRO0D08602p [Zygosaccharomyces rouxii] >gi|186703898|emb|C
. . Gibberella zeae PH-1 ..............................................  261 1 hit  [ascomycetes]           hypothetical protein FG05713.1 [Gibberella zeae PH-1]
. . Pyrenophora teres f. teres 0-1 ....................................  260 1 hit  [ascomycetes]           hypothetical protein PTT_19137 [Pyrenophora teres f. teres 
. . Puccinia graminis f. sp. tritici CRL 75-36-700-3 ..................  258 1 hit  [basidiomycetes]        threonine synthase [Puccinia graminis f. sp. tritici CRL 75
. . Phaeosphaeria nodorum SN15 ........................................  257 2 hits [ascomycetes]           hypothetical protein SNOG_06886 [Phaeosphaeria nodorum SN15
. . Batrachochytrium dendrobatidis JAM81 ..............................  257 1 hit  [chytrids]              hypothetical protein BATDEDRAFT_33849 [Batrachochytrium den
. . Cryptococcus gattii WM276 .........................................  254 2 hits [basidiomycetes]        threonine synthase [Cryptococcus gattii WM276] >gi|31745883
. . Aureococcus anophagefferens .......................................  253 1 hit  [pelagophytes]          hypothetical protein AURANDRAFT_22578 [Aureococcus anophage
. . Cryptococcus neoformans var. neoformans JEC21 .....................  253 2 hits [basidiomycetes]        threonine synthase [Cryptococcus neoformans var. neoformans
. . Cryptococcus neoformans var. neoformans B-3501A ...................  253 2 hits [basidiomycetes]        threonine synthase [Cryptococcus neoformans var. neoformans
. . Schizosaccharomyces pombe 972h- ...................................  252 1 hit  [ascomycetes]           threonine synthase (predicted) [Schizosaccharomyces pombe 9
. . Schizosaccharomyces pombe .........................................  252 3 hits [ascomycetes]           threonine synthase (predicted) [Schizosaccharomyces pombe 9
. . Arabidopsis thaliana (thale-cress) ................................  252 1 hit  [eudicots]              threonine synthase (predicted) [Schizosaccharomyces pombe 9
. . Cryptococcus neoformans ...........................................  252 1 hit  [basidiomycetes]        threonine synthase Thr4 [Cryptococcus neoformans]
. . Cryptococcus neoformans var. grubii ...............................  252 1 hit  [basidiomycetes]        threonine synthase [Cryptococcus neoformans var. grubii]
. . Penicillium chrysogenum Wisconsin 54-1255 .........................  247 2 hits [ascomycetes]           Pc20g04020 [Penicillium chrysogenum Wisconsin 54-1255] >gi|
. uncultured organism -------------------------------------------------  335 1 hit  [unclassified]          threonine synthase [uncultured organism]


b) BLASTp versus Swissprot, NCBI default parameters apart from "Number of descriptions=1000"

root
. cellular organisms
. . Bacteria            [bacteria]
. . . Proteobacteria      [proteobacteria]
. . . . Gammaproteobacteria [g-proteobacteria]
. . . . . Pseudomonas aeruginosa ----------------------------  353 1 hit  [g-proteobacteria]     RecName: Full=Threonine synthase; Short=TS
. . . . . Buchnera aphidicola str. Bp (Baizongia pistaciae) .  176 1 hit  [enterobacteria]       RecName: Full=Threonine synthase; Short=TS
. . . . . Buchnera aphidicola (Schizaphis graminum) .........  176 1 hit  [enterobacteria]       RecName: Full=Threonine synthase; Short=TS
. . . . . Haemophilus influenzae Rd KW20 ....................  175 1 hit  [g-proteobacteria]     RecName: Full=Threonine synthase; Short=TS
. . . . . Buchnera aphidicola (Acyrthosiphon pisum) .........  175 1 hit  [enterobacteria]       RecName: Full=Threonine synthase; Short=TS
. . . . . Serratia marcescens ...............................  174 1 hit  [enterobacteria]       RecName: Full=Threonine synthase; Short=TS
. . . . . Escherichia coli K-12 .............................  172 1 hit  [enterobacteria]       RecName: Full=Threonine synthase; Short=TS
. . . . . Teredinibacter turnerae T7901 .....................   31 1 hit  [g-proteobacteria]     RecName: Full=Glycerol-3-phosphate dehydrogenase [NAD(P)+];
. . . . Methylobacillus glycogenes --------------------------  244 1 hit  [b-proteobacteria]     RecName: Full=Threonine synthase; Short=TS
. . . . Helicobacter pylori J99 .............................  186 1 hit  [e-proteobacteria]     RecName: Full=Threonine synthase; Short=TS
. . . . Helicobacter pylori .................................  182 1 hit  [e-proteobacteria]     RecName: Full=Threonine synthase; Short=TS
. . . . Jannaschia sp. CCS1 .................................   33 1 hit  [a-proteobacteria]     RecName: Full=Orotate phosphoribosyltransferase; Short=OPRT
. . . . Campylobacter jejuni ................................   33 1 hit  [e-proteobacteria]     RecName: Full=Cysteine synthase B; Short=CSase B; AltName: 
. . . . Helicobacter hepaticus ..............................   32 1 hit  [e-proteobacteria]     RecName: Full=Sec-independent protein translocase protein t
. . . Corynebacterium glutamicum ----------------------------  257 1 hit  [high GC Gram+]        RecName: Full=Threonine synthase; Short=TS
. . . Bacillus subtilis .....................................   50 1 hit  [firmicutes]           RecName: Full=Threonine synthase; Short=TS
. . . Bacillus halodurans ...................................   46 1 hit  [firmicutes]           RecName: Full=Threonine synthase; Short=TS
. . . Bacillus sp. ULM1 .....................................   46 1 hit  [firmicutes]           RecName: Full=Threonine synthase; Short=TS
. . . Mycobacterium leprae ..................................   45 1 hit  [high GC Gram+]        RecName: Full=Threonine synthase; Short=TS
. . . Mycobacterium bovis ...................................   43 1 hit  [high GC Gram+]        RecName: Full=Threonine synthase >gi|54042241|sp|P66902.1|T
. . . Mycobacterium tuberculosis ............................   43 1 hit  [high GC Gram+]        RecName: Full=Threonine synthase >gi|54042241|sp|P66902.1|T
. . . Mycobacterium smegmatis str. MC2 155 ..................   38 1 hit  [high GC Gram+]        RecName: Full=Threonine synthase; Short=TS
. . . Enterococcus faecalis .................................   35 1 hit  [firmicutes]           RecName: Full=Tagatose-6-phosphate kinase; AltName: Full=Ph
. . Saccharomyces cerevisiae (yeast) ------------------------  275 1 hit  [ascomycetes]          RecName: Full=Threonine synthase; Short=TS
. . Ashbya gossypii ATCC 10895 ..............................  268 1 hit  [ascomycetes]          RecName: Full=Threonine synthase; Short=TS
. . Schizosaccharomyces pombe ...............................  252 1 hit  [ascomycetes]          RecName: Full=Threonine synthase; Short=TS
. . Xenopus laevis (common platanna) ........................  223 1 hit  [frogs & toads]        RecName: Full=Threonine synthase-like 2; Short=TSH2
. . Mus musculus (mouse) ....................................  199 2 hits [rodents]              RecName: Full=Threonine synthase-like 2; Short=TSH2; Short=
. . Homo sapiens (man) ......................................  198 2 hits [primates]             RecName: Full=Threonine synthase-like 2; Short=TSH2
. . Rattus norvegicus (brown rat) ...........................  197 1 hit  [rodents]              RecName: Full=Threonine synthase-like 2; Short=TSH2
. . Pongo abelii (Orang-utan) ...............................  197 2 hits [primates]             RecName: Full=Threonine synthase-like 2; Short=TSH2
. . Danio rerio (zebra fish) ................................  185 1 hit  [bony fishes]          RecName: Full=Threonine synthase-like 2; Short=TSH2
. . Macaca fascicularis (cynomolgus monkey) .................  184 1 hit  [primates]             RecName: Full=Threonine synthase-like 1; Short=TSH1
. . Solanum tuberosum (potatoes) ............................   51 1 hit  [eudicots]             RecName: Full=Threonine synthase, chloroplastic; Short=TS; 
. . Methanocaldococcus jannaschii ...........................   48 1 hit  [euryarchaeotes]       RecName: Full=Threonine synthase; Short=TS
. . Methanosarcina acetivorans ..............................   48 1 hit  [euryarchaeotes]       RecName: Full=Threonine synthase; Short=TS
. . Arabidopsis thaliana (thale-cress) ......................   48 2 hits [eudicots]             RecName: Full=Threonine synthase 1, chloroplastic; AltName:
. . Bos taurus (cow) ........................................   34 1 hit  [even-toed ungulates]  RecName: Full=Pentatricopeptide repeat-containing protein 3
. Fiji disease virus isolate Sugarcane ----------------------   32 1 hit  [viruses]              RecName: Full=Uncharacterized protein VP6

BLAST

PROTOCOL


a) BLASTp versus NR, NCBI default parameters apart from "Number of descriptions_1000"

b) BLASTp versus Swissprot, NCBI default parameters apart from "Number of descriptions_1000"



RESULTS ANALYSIS


The BLASTp versus NR returned several significant homologies to the ORF, most of that with threonine synthase (and some with hypothetical proteins), these is significant homologies because have a low E-value (the lowest is 3e-103 and the highest is 4e-46) and high scores (the highest is 379 and the smallest is 189). The BLASTp versus Swissprot also returned some significant homologies with threonine synthase but less than BLASTp versus NR (the significant homology with the lowest E-value has E-value_1e-96 and the highest E-value_3e-42).

The more significant homology was obtained with BLASTp versus nr and it is with threonine synthase because it has the lowest E-value (3e-103) and the highest score (379).

So it is possible that the protein is responsible for the synthesis of threonine.

RAW RESULTS

a. BLASTp versus NR, NCBI default parameters apart from "Number of descriptions=1000"
                                                                   Score    E
Sequences producing significant alignments:                       (Bits)  Value

ref|YP_002299803.1|  threonine synthase [Rhodospirillum centen...   379    3e-103
ref|YP_003448135.1|  threonine synthase [Azospirillum sp. B510...   374    9e-102
ref|YP_258235.1|  threonine synthase [Pseudomonas fluorescens ...   356    3e-96 
ref|YP_001171736.1|  threonine synthase [Pseudomonas stutzeri ...   355    5e-96 
ref|YP_609722.1|  threonine synthase [Pseudomonas entomophila ...   354    9e-96 
ref|YP_001188877.1|  threonine synthase [Pseudomonas mendocina...   354    9e-96 
ref|YP_234380.1|  threonine synthase [Pseudomonas syringae pv....   353    2e-95 
ref|YP_746074.1|  threonine synthase [Granulibacter bethesdens...   353    2e-95 
ref|YP_422751.1|  threonine synthase [Magnetospirillum magneti...   353    2e-95 
ref|ZP_06458842.1|  threonine synthase [Pseudomonas syringae p...   353    2e-95 
ref|YP_273619.2|  threonine synthase [Pseudomonas syringae pv....   353    2e-95 
ref|NP_252424.1|  threonine synthase [Pseudomonas aeruginosa P...   353    2e-95 
ref|ZP_01367168.1|  hypothetical protein PaerPA_01004319 [Pseu...   353    2e-95 
gb|AAZ36174.1|  threonine synthase [Pseudomonas syringae pv. p...   353    2e-95 
ref|YP_346760.1|  threonine synthase [Pseudomonas fluorescens ...   352    3e-95 
ref|ZP_07262205.1|  threonine synthase [Pseudomonas syringae p...   352    3e-95 
ref|ZP_05641192.1|  threonine synthase [Pseudomonas syringae p...   352    3e-95 
ref|YP_003188186.1|  threonine synthase [Acetobacter pasteuria...   352    4e-95 
ref|YP_001346768.1|  threonine synthase [Pseudomonas aeruginos...   352    6e-95 
ref|ZP_06833737.1|  threonine synthase [Gluconacetobacter hans...   352    6e-95 
ref|ZP_06895307.1|  threonine synthase [Roseomonas cervicalis ...   351    7e-95 
ref|ZP_02188823.1|  Threonine synthase [alpha proteobacterium ...   350    2e-94 
ref|YP_002274720.1|  threonine synthase [Gluconacetobacter dia...   350    2e-94 
ref|YP_001602333.1|  threonine synthase [Gluconacetobacter dia...   350    2e-94 
ref|ZP_00054597.2|  COG0498: Threonine synthase [Magnetospiril...   350    2e-94 
ref|YP_428315.1|  threonine synthase [Rhodospirillum rubrum AT...   350    2e-94 
ref|NP_791307.1|  threonine synthase [Pseudomonas syringae pv....   349    4e-94 
ref|ZP_03397202.1|  threonine synthase [Pseudomonas syringae p...   348    4e-94 
ref|YP_001667320.1|  threonine synthase [Pseudomonas putida GB...   348    5e-94 
ref|ZP_08140019.1|  threonine synthase [Pseudomonas sp. TJI-51...   348    5e-94 
ref|NP_743629.1|  threonine synthase [Pseudomonas putida KT244...   348    5e-94 
ref|YP_001750997.1|  threonine synthase [Pseudomonas putida W6...   348    6e-94 
ref|YP_002874510.1|  threonine synthase [Pseudomonas fluoresce...   348    6e-94 
gb|ADR61670.1|  Threonine synthase [Pseudomonas putida BIRD-1]      348    6e-94 
ref|YP_001269558.1|  threonine synthase [Pseudomonas putida F1...   348    7e-94 
ref|ZP_07777333.1|  threonine synthase [Pseudomonas fluorescen...   348    8e-94 
emb|CAM76272.1|  threonine synthase [Magnetospirillum gryphisw...   344    9e-93 
ref|ZP_04588552.1|  threonine synthase [Pseudomonas syringae p...   344    1e-92 
ref|YP_003544123.1|  threonine synthase [Sphingobium japonicum...   343    1e-92 
ref|YP_001411957.1|  threonine synthase [Parvibaculum lavament...   343    2e-92 
ref|YP_002801062.1|  threonine synthase [Azotobacter vinelandi...   342    5e-92 
ref|YP_001261915.1|  threonine synthase [Sphingomonas wittichi...   340    1e-91 
ref|YP_616445.1|  threonine synthase [Sphingopyxis alaskensis ...   340    2e-91 
ref|YP_192262.1|  threonine synthase [Gluconobacter oxydans 62...   337    2e-90 
ref|ZP_07573472.1|  threonine synthase [Sphingobium chlorophen...   336    3e-90 
ref|ZP_01302635.1|  threonine synthase [Sphingomonas sp. SKA58...   335    4e-90 
gb|ACY24786.1|  threonine synthase [uncultured organism]            335    7e-90 
ref|YP_433049.1|  threonine synthase [Hahella chejuensis KCTC ...   332    5e-89 
ref|ZP_05094935.1|  threonine synthase [marine gamma proteobac...   332    6e-89 
ref|YP_001418410.1|  threonine synthase [Xanthobacter autotrop...   330    1e-88 
ref|YP_526684.1|  threonine synthase [Saccharophagus degradans...   330    1e-88 
ref|ZP_01894814.1|  threonine synthase [Marinobacter algicola ...   330    2e-88 
ref|ZP_06862247.1|  threonine synthase [Citromicrobium bathyom...   330    2e-88 
ref|ZP_01627290.1|  threonine synthase [marine gamma proteobac...   330    2e-88 
ref|ZP_07474895.1|  threonine synthase [Brucella sp. BO2] >gb|...   328    6e-88 
ref|NP_697512.1|  threonine synthase [Brucella suis 1330] >ref...   328    7e-88 
ref|ZP_05180469.1|  threonine synthase [Brucella sp. 83/13] >r...   328    8e-88 
ref|ZP_05457008.1|  threonine synthase [Brucella ceti M490/95/...   328    8e-88 
ref|ZP_01225477.1|  Threonine synthase [marine gamma proteobac...   328    8e-88 
ref|ZP_04679682.1|  threonine synthase [Ochrobactrum intermedi...   328    9e-88 
ref|ZP_06792533.1|  threonine synthase [Brucella sp. NVSL 07-0...   328    9e-88 
ref|ZP_05163116.1|  threonine synthase [Brucella suis bv. 5 st...   328    9e-88 
ref|YP_001258501.1|  threonine synthase [Brucella ovis ATCC 25...   328    9e-88 
ref|YP_001369159.1|  threonine synthase [Ochrobactrum anthropi...   327    1e-87 
ref|ZP_03785028.1|  threonine synthase [Brucella ceti str. Cud...   327    1e-87 
ref|ZP_05174767.1|  threonine synthase [Brucella ceti M644/93/...   327    1e-87 
ref|YP_001981929.1|  threonine synthase [Cellvibrio japonicus ...   326    2e-87 
ref|ZP_07477692.1|  threonine synthase [Brucella sp. BO1] >gb|...   326    3e-87 
ref|YP_001627169.1|  threonine synthase [Brucella suis ATCC 23...   325    7e-87 
ref|ZP_05085169.1|  threonine synthase [Pseudovibrio sp. JE062...   324    8e-87 
ref|YP_003226378.1|  threonine synthase [Zymomonas mobilis sub...   324    9e-87 
ref|YP_003072744.1|  threonine synthase [Teredinibacter turner...   324    1e-86 
ref|NP_540367.1|  threonine synthase [Brucella melitensis bv. ...   324    1e-86 
ref|ZP_05152031.1|  threonine synthase [Brucella abortus bv. 6...   324    1e-86 
ref|ZP_01039048.1|  threonine synthase [Erythrobacter sp. NAP1...   324    1e-86 
ref|ZP_04760550.1|  threonine synthase [Zymomonas mobilis subs...   323    2e-86 
ref|YP_001875751.1|  threonine synthase [Elusimicrobium minutu...   323    2e-86 
ref|YP_002964479.1|  threonine synthase [Methylobacterium exto...   323    2e-86 
ref|YP_003579227.1|  threonine synthase [Rhodobacter capsulatu...   322    3e-86 
ref|YP_003069524.1|  threonine synthase [Methylobacterium exto...   322    4e-86 
ref|YP_457441.1|  threonine synthase [Erythrobacter litoralis ...   322    4e-86 
ref|ZP_05453910.1|  threonine synthase [Brucella melitensis bv...   322    4e-86 
ref|YP_002422326.1|  threonine synthase [Methylobacterium chlo...   322    4e-86 
ref|YP_959538.1|  threonine synthase [Marinobacter aquaeolei V...   322    5e-86 
ref|ZP_01736053.1|  threonine synthase [Marinobacter sp. ELB17...   322    5e-86 
ref|YP_001525155.1|  threonine synthase [Azorhizobium caulinod...   322    5e-86 
ref|YP_001754266.1|  threonine synthase [Methylobacterium radi...   321    7e-86 
ref|ZP_04959037.1|  threonine synthase [gamma proteobacterium ...   321    9e-86 
ref|YP_001640712.1|  threonine synthase [Methylobacterium exto...   321    9e-86 
ref|YP_003444894.1|  threonine synthase [Allochromatium vinosu...   321    1e-85 
dbj|BAJ81181.1|  threonine synthase [Acidiphilium multivorum A...   320    1e-85 
ref|YP_003898925.1|  threonine synthase [Halomonas elongata DS...   320    1e-85 
ref|YP_002825092.1|  threonine synthase [Sinorhizobium fredii ...   320    2e-85 
ref|YP_001234909.1|  threonine synthase [Acidiphilium cryptum ...   320    2e-85 
ref|ZP_01864324.1|  threonine synthase [Erythrobacter sp. SD-2...   320    2e-85 
ref|YP_001926136.1|  threonine synthase [Methylobacterium popu...   319    3e-85 
gb|ADP96529.1|  threonine synthase [marine bacterium HP15]          319    4e-85 
ref|YP_468517.1|  threonine synthase [Rhizobium etli CFN 42] >...   319    4e-85 
ref|NP_385027.1|  threonine synthase [Sinorhizobium meliloti 1...   318    5e-85 
ref|ZP_01877806.1|  threonine synthase [Roseovarius sp. TM1035...   318    6e-85 
ref|YP_766673.1|  threonine synthase [Rhizobium leguminosarum ...   318    7e-85 
ref|YP_002280158.1|  threonine synthase [Rhizobium leguminosar...   318    1e-84 
ref|YP_575052.1|  threonine synthase [Chromohalobacter salexig...   318    1e-84 
ref|ZP_01164954.1|  threonine synthase [Oceanospirillum sp. ME...   317    1e-84 
ref|ZP_03524415.1|  threonine synthase [Rhizobium etli GR56]        317    2e-84 
ref|YP_002974535.1|  threonine synthase [Rhizobium leguminosar...   317    2e-84 
emb|CAX83930.1|  L-threonine synthase [uncultured bacterium]        317    2e-84 
ref|YP_001532489.1|  threonine synthase [Dinoroseobacter shiba...   316    4e-84 
ref|ZP_01113560.1|  threonine synthase [Reinekea sp. MED297] >...   315    4e-84 
ref|ZP_05065236.1|  threonine synthase [Octadecabacter antarct...   315    6e-84 
ref|ZP_01616144.1|  threonine synthase [marine gamma proteobac...   315    7e-84 
ref|YP_001342600.1|  threonine synthase [Marinomonas sp. MWYL1...   315    7e-84 
ref|ZP_02167431.1|  putative threonine synthase [Hoeflea photo...   314    8e-84 
ref|ZP_01104611.1|  Threonine synthase [Congregibacter litoral...   314    9e-84 
ref|ZP_01753007.1|  threonine synthase [Roseobacter sp. SK209-...   314    1e-83 
ref|ZP_01548138.1|  threonine synthase [Stappia aggregata IAM ...   314    1e-83 
ref|ZP_05051670.1|  threonine synthase [Octadecabacter antarct...   313    2e-83 
ref|YP_003963228.1|  L-threonine synthase [Ketogulonicigenium ...   313    2e-83 
ref|NP_107815.1|  threonine synthase [Mesorhizobium loti MAFF3...   313    2e-83 
ref|YP_004278035.1|  Threonine synthase [Agrobacterium sp. H13...   313    2e-83 
ref|ZP_07375446.1|  threonine synthase [Ahrensia sp. R2A130] >...   313    3e-83 
ref|ZP_01036223.1|  threonine synthase [Roseovarius sp. 217] >...   312    3e-83 
ref|ZP_05781532.1|  threonine synthase [Citreicella sp. SE45] ...   312    4e-83 
ref|ZP_00958780.1|  threonine synthase [Roseovarius nubinhiben...   311    5e-83 
ref|ZP_05113482.1|  threonine synthase [Labrenzia alexandrii D...   311    6e-83 
ref|YP_001326227.1|  threonine synthase [Sinorhizobium medicae...   311    7e-83 
ref|YP_351881.1|  threonine synthase [Rhodobacter sphaeroides ...   311    7e-83 
ref|YP_001042368.1|  threonine synthase [Rhodobacter sphaeroid...   311    9e-83 
ref|ZP_01444110.1|  threonine synthase [Pelagibaca bermudensis...   311    9e-83 
ref|YP_001977237.1|  threonine synthase protein [Rhizobium etl...   311    9e-83 
ref|YP_002495615.1|  threonine synthase [Methylobacterium nodu...   311    1e-82 
ref|ZP_01904187.1|  threonine synthase [Roseobacter sp. AzwK-3...   311    1e-82 
ref|YP_004144158.1|  threonine synthase [Mesorhizobium ciceri ...   311    1e-82 
ref|ZP_05076970.1|  threonine synthase [Rhodobacterales bacter...   311    1e-82 
ref|YP_002524499.1|  threonine synthase [Rhodobacter sphaeroid...   310    1e-82 
ref|ZP_05343205.1|  threonine synthase [Thalassiobium sp. R2A6...   310    1e-82 
ref|YP_902059.1|  threonine synthase [Pelobacter propionicus D...   310    1e-82 
ref|YP_003551440.1|  threonine synthase [Candidatus Puniceispi...   310    2e-82 
ref|YP_864390.1|  threonine synthase [Magnetococcus sp. MC-1] ...   310    2e-82 
ref|ZP_01056551.1|  threonine synthase [Roseobacter sp. MED193...   310    2e-82 
ref|YP_003495358.1|  threonine synthase [Deferribacter desulfu...   310    3e-82 
ref|ZP_05843702.1|  threonine synthase [Rhodobacter sp. SW2] >...   310    3e-82 
ref|ZP_05741637.1|  threonine synthase [Silicibacter sp. Trich...   309    3e-82 
ref|ZP_01749304.1|  threonine synthase [Roseobacter sp. CCS2] ...   309    3e-82 
ref|YP_002543677.1|  threonine synthetase protein [Agrobacteri...   309    3e-82 
ref|ZP_05808534.1|  threonine synthase [Mesorhizobium opportun...   309    4e-82 
ref|ZP_05785036.1|  threonine synthase [Silicibacter lacuscaer...   308    5e-82 
ref|ZP_01307688.1|  threonine synthase [Oceanobacter sp. RED65...   308    5e-82 
ref|ZP_01447954.1|  threonine synthase [alpha proteobacterium ...   308    6e-82 
ref|ZP_01013493.1|  threonine synthase [Maritimibacter alkalip...   308    6e-82 
gb|AAK86596.1|  threonine synthase [Agrobacterium tumefaciens ...   308    7e-82 
ref|YP_001952516.1|  threonine synthase [Geobacter lovleyi SZ]...   308    8e-82 
ref|ZP_05122428.1|  threonine synthase [Rhodobacteraceae bacte...   308    9e-82 
ref|ZP_01078797.1|  threonine synthase [Marinomonas sp. MED121...   308    9e-82 
ref|NP_353811.2|  threonine synthase [Agrobacterium tumefacien...   307    1e-81 
ref|ZP_01003975.1|  threonine synthase [Loktanella vestfoldens...   307    1e-81 
ref|YP_003505172.1|  threonine synthase [Denitrovibrio acetiph...   307    1e-81 
ref|ZP_01312382.1|  threonine synthase [Desulfuromonas acetoxi...   307    1e-81 
gb|EGD59767.1|  threonine synthase [Novosphingobium nitrogenif...   307    1e-81 
emb|CAA46168.1|  threonine synthase [Pseudomonas aeruginosa PAO1]   307    2e-81 
ref|ZP_01741789.1|  threonine synthase [Rhodobacterales bacter...   306    2e-81 
ref|YP_918075.1|  threonine synthase [Paracoccus denitrificans...   306    2e-81 
emb|CBI81881.1|  Threonine synthase [Bartonella schoenbuchensi...   306    2e-81 
ref|ZP_02141003.1|  threonine synthase [Roseobacter litoralis ...   305    4e-81 
ref|ZP_01158249.1|  threonine synthase [Oceanicola granulosus ...   305    4e-81 
ref|YP_001609092.1|  threonine synthase [Bartonella tribocorum...   305    5e-81 
gb|ABG62160.1|  L-threonine synthase [Chelativorans sp. BNC1]       305    5e-81 
ref|YP_003692544.1|  threonine synthase [Starkeya novella DSM ...   305    6e-81 
ref|YP_033286.1|  threonine synthase [Bartonella henselae str....   305    6e-81 
ref|ZP_01744921.1|  threonine synthase [Sagittula stellata E-3...   305    6e-81 
ref|YP_614324.1|  threonine synthase [Ruegeria sp. TM1040] >gb...   305    6e-81 
ref|YP_673325.2|  threonine synthase [Mesorhizobium sp. BNC1]       305    7e-81 
ref|YP_168274.1|  threonine synthase [Ruegeria pomeroyi DSS-3]...   304    9e-81 
ref|ZP_08071809.1|  threonine synthase [Methylocystis sp. ATCC...   304    1e-80 
ref|YP_001831861.1|  threonine synthase [Beijerinckia indica s...   304    1e-80 
ref|YP_316849.1|  threonine synthase [Nitrobacter winogradskyi...   304    1e-80 
ref|ZP_00956413.1|  threonine synthase [Sulfitobacter sp. EE-3...   304    1e-80 
ref|ZP_00963240.1|  threonine synthase [Sulfitobacter sp. NAS-...   304    1e-80 
ref|YP_001166831.1|  threonine synthase [Rhodobacter sphaeroid...   304    1e-80 
ref|ZP_02153223.1|  threonine synthase [Oceanibulbus indolifex...   303    2e-80 
ref|ZP_01228009.1|  threonine synthase [Aurantimonas manganoxy...   303    2e-80 
ref|YP_682423.1|  threonine synthase [Roseobacter denitrifican...   303    2e-80 
ref|ZP_01046304.1|  threonine synthase [Nitrobacter sp. Nb-311...   303    2e-80 
ref|YP_002548772.1|  threonine synthase [Agrobacterium vitis S...   303    2e-80 
ref|ZP_05090394.1|  threonine synthase [Ruegeria sp. R11] >gb|...   303    2e-80 
ref|ZP_00999867.1|  threonine synthase [Oceanicola batsensis H...   303    3e-80 
ref|YP_002971488.1|  threonine synthase ThrC [Bartonella graha...   303    3e-80 
ref|YP_496200.1|  threonine synthase [Novosphingobium aromatic...   302    3e-80 
ref|YP_003757017.1|  threonine synthase [Hyphomicrobium denitr...   302    4e-80 
ref|YP_001769234.1|  threonine synthase [Methylobacterium sp. ...   301    6e-80 
ref|NP_767821.1|  threonine synthase [Bradyrhizobium japonicum...   301    8e-80 
ref|ZP_02149584.1|  threonine synthase [Phaeobacter gallaecien...   301    8e-80 
ref|YP_001230655.1|  threonine synthase [Geobacter uraniireduc...   301    9e-80 
ref|ZP_07657011.1|  threonine synthase [Roseibium sp. TrichSKD...   301    1e-79 
ref|ZP_05099256.1|  threonine synthase [Roseobacter sp. GAI101...   301    1e-79 
ref|YP_002361582.1|  threonine synthase [Methylocella silvestr...   300    2e-79 
ref|YP_003689967.1|  threonine synthase [Desulfurivibrio alkal...   300    2e-79 
ref|YP_384587.1|  threonine synthase [Geobacter metallireducen...   299    3e-79 
ref|ZP_05080023.1|  threonine synthase [Rhodobacterales bacter...   299    4e-79 
ref|ZP_02145802.1|  threonine synthase [Phaeobacter gallaecien...   298    5e-79 
ref|YP_003022772.1|  threonine synthase [Geobacter sp. M21] >g...   298    5e-79 
ref|YP_002538134.1|  threonine synthase [Geobacter sp. FRC-32]...   298    5e-79 
ref|YP_783658.1|  threonine synthase [Rhodopseudomonas palustr...   298    6e-79 
ref|ZP_06889787.1|  threonine synthase [Methylosinus trichospo...   298    8e-79 
gb|ABD90317.1|  L-threonine synthase [Rhodopseudomonas palustr...   298    8e-79 
ref|YP_534636.2|  threonine synthase [Rhodopseudomonas palustr...   297    1e-78 
ref|NP_952746.1|  threonine synthase [Geobacter sulfurreducens...   297    1e-78 
ref|YP_001208512.1|  threonine synthase [Bradyrhizobium sp. OR...   296    2e-78 
ref|YP_002138113.1|  threonine synthase [Geobacter bemidjiensi...   296    2e-78 
ref|ZP_05068931.1|  threonine synthase [Candidatus Pelagibacte...   296    2e-78 
ref|YP_575622.1|  threonine synthase [Nitrobacter hamburgensis...   296    2e-78 
ref|YP_001686116.1|  threonine synthase [Caulobacter sp. K31] ...   296    3e-78 
ref|YP_004194355.1|  L-threonine synthase [Desulfobulbus propi...   295    4e-78 
ref|ZP_01439589.1|  threonine synthase [Fulvimarina pelagi HTC...   295    5e-78 
ref|YP_004197909.1|  threonine synthase [Geobacter sp. M18] >g...   295    6e-78 
ref|YP_001237007.1|  threonine synthase [Bradyrhizobium sp. BT...   295    7e-78 
ref|YP_511091.1|  threonine synthase [Jannaschia sp. CCS1] >gb...   295    7e-78 
ref|ZP_07027254.1|  threonine synthase [Afipia sp. 1NLS2] >gb|...   294    1e-77 
emb|CBN76262.1|  Threonine synthase [Ectocarpus siliculosus]        294    1e-77 
ref|XP_001747762.1|  hypothetical protein [Monosiga brevicolli...   293    3e-77 
ref|YP_004062575.1|  threonine synthase [Candidatus Liberibact...   292    3e-77 
ref|YP_567961.1|  threonine synthase [Rhodopseudomonas palustr...   292    4e-77 
ref|ZP_01877259.1|  threonine synthase [Lentisphaera araneosa ...   292    5e-77 
ref|ZP_01290413.1|  Threonine synthase [delta proteobacterium ...   291    6e-77 
ref|YP_488172.1|  threonine synthase [Rhodopseudomonas palustr...   291    7e-77 
ref|XP_002293628.1|  threonine synthase [Thalassiosira pseudon...   291    7e-77 
ref|YP_066355.1|  threonine synthase [Desulfotalea psychrophil...   291    9e-77 
ref|YP_004051309.1|  l-threonine synthase [Calditerrivibrio ni...   291    1e-76 
ref|YP_002287700.1|  threonine synthase [Oligotropha carboxido...   291    1e-76 
ref|YP_356918.1|  threonine synthase [Pelobacter carbinolicus ...   291    1e-76 
ref|XP_001554826.1|  hypothetical protein BC1G_06474 [Botryoti...   291    1e-76 
ref|YP_004107365.1|  threonine synthase [Rhodopseudomonas palu...   290    2e-76 
ref|XP_001585599.1|  hypothetical protein SS1G_13483 [Scleroti...   290    2e-76 
gb|EFQ35194.1|  threonine synthase [Glomerella graminicola M1....   290    2e-76 
ref|NP_946192.2|  threonine synthase [Rhodopseudomonas palustr...   290    2e-76 
emb|CAE26283.1|  threonine synthase [Rhodopseudomonas palustri...   290    3e-76 
ref|YP_001989940.1|  threonine synthase [Rhodopseudomonas palu...   289    3e-76 
ref|ZP_07386979.1|  threonine synthase [Paenibacillus curdlano...   289    5e-76 
emb|CCA22521.1|  unnamed protein product [Albugo laibachii Nc14]    288    7e-76 
ref|NP_422193.1|  threonine synthase [Caulobacter crescentus C...   288    9e-76 
ref|YP_265555.1|  threonine synthase [Candidatus Pelagibacter ...   287    1e-75 
ref|XP_002900661.1|  threonine synthase [Phytophthora infestan...   286    2e-75 
ref|YP_003014061.1|  threonine synthase [Paenibacillus sp. JDR...   286    2e-75 
ref|YP_001820395.1|  threonine synthase [Opitutus terrae PB90-...   286    3e-75 
gb|EFA74789.1|  threonine synthase [Polysphondylium pallidum P...   286    3e-75 
ref|XP_001270916.1|  threonine synthase [Aspergillus clavatus ...   283    2e-74 
ref|XP_001728787.1|  hypothetical protein MGL_4122 [Malassezia...   282    4e-74 
ref|XP_002840509.1|  hypothetical protein [Tuber melanosporum ...   281    9e-74 
ref|YP_003948090.1|  threonine synthase [Paenibacillus polymyx...   281    1e-73 
ref|YP_003871786.1|  Threonine synthase (TS) [Paenibacillus po...   281    1e-73 
ref|ZP_06054610.1|  threonine synthase [alpha proteobacterium ...   280    2e-73 
ref|XP_001486863.1|  hypothetical protein PGUG_00240 [Meyerozy...   279    3e-73 
ref|XP_002488063.1|  threonine synthase Thr4, putative [Talaro...   279    4e-73 
ref|XP_002183750.1|  predicted protein [Phaeodactylum tricornu...   279    4e-73 
gb|EDK36142.2|  hypothetical protein PGUG_00240 [Meyerozyma gu...   279    4e-73 
ref|XP_754718.1|  threonine synthase Thr4 [Aspergillus fumigat...   278    7e-73 
ref|XP_001397565.2|  threonine synthase [Aspergillus niger CBS...   278    7e-73 
emb|CAL00476.1|  unnamed protein product [Aspergillus niger]        278    7e-73 
ref|YP_581726.1|  threonine synthase [Psychrobacter cryohalole...   278    8e-73 
ref|YP_002129392.1|  threonine synthetase protein [Phenylobact...   277    1e-72 
ref|YP_265418.1|  threonine synthase [Psychrobacter arcticus 2...   277    1e-72 
ref|XP_002153368.1|  threonine synthase Thr4, putative [Penici...   277    2e-72 
ref|XP_002848537.1|  threonine synthase [Arthroderma otae CBS ...   277    2e-72 
ref|XP_003174426.1|  threonine synthase [Arthroderma gypseum C...   276    2e-72 
ref|XP_364078.2|  hypothetical protein MGG_08923 [Magnaporthe ...   276    2e-72 
ref|XP_002491161.1|  Threonine synthase, conserved protein tha...   276    3e-72 
ref|XP_002616052.1|  hypothetical protein CLUG_03293 [Clavispo...   276    3e-72 
ref|YP_003549793.1|  threonine synthase [Coraliomargarita akaj...   276    3e-72 
ref|XP_001524649.1|  threonine synthase [Lodderomyces elongisp...   276    3e-72 
ref|ZP_02927266.1|  threonine synthase [Verrucomicrobium spino...   276    3e-72 
ref|XP_448625.1|  hypothetical protein [Candida glabrata CBS 1...   276    4e-72 
ref|XP_002420513.1|  threonine synthase, putative [Candida dub...   275    5e-72 
gb|EGA63199.1|  Thr4p [Saccharomyces cerevisiae FostersO]           275    5e-72 
ref|XP_002790461.1|  threonine synthase [Paracoccidioides bras...   275    5e-72 
ref|NP_009982.1|  Thr4p [Saccharomyces cerevisiae S288c] >sp|P...   275    5e-72 
gb|EGA87763.1|  Thr4p [Saccharomyces cerevisiae VL3]                275    5e-72 
gb|EDZ73500.1|  YCR053Wp-like protein [Saccharomyces cerevisia...   275    6e-72 
gb|AAU09679.1|  YCR053W [Saccharomyces cerevisiae]                  275    6e-72 
gb|EFY90337.1|  threonine synthase [Metarhizium acridum CQMa 102]   275    7e-72 
ref|XP_001385124.2|  threonine synthase [Scheffersomyces stipi...   275    7e-72 
ref|YP_001281269.1|  threonine synthase [Psychrobacter sp. PRw...   275    7e-72 
ref|XP_001263543.1|  threonine synthase [Neosartorya fischeri ...   275    9e-72 
ref|YP_003064878.1|  threonine synthase [Candidatus Liberibact...   274    1e-71 
ref|XP_001225818.1|  threonine synthase [Chaetomium globosum C...   274    1e-71 
ref|XP_003009995.1|  hypothetical protein ARB_03793 [Arthroder...   273    2e-71 
ref|XP_003023268.1|  hypothetical protein TRV_02602 [Trichophy...   273    2e-71 
ref|XP_001825174.2|  threonine synthase [Aspergillus oryzae RI...   273    2e-71 
gb|EGA83757.1|  Thr4p [Saccharomyces cerevisiae Lalvin QA23]        273    2e-71 
gb|EFX06494.1|  threonine synthase [Grosmannia clavigera kw1407]    273    2e-71 
ref|XP_003071526.1|  threonine synthase, putative [Coccidioide...   273    2e-71 
gb|EFW15297.1|  threonine synthase [Coccidioides posadasii str...   273    2e-71 
ref|XP_001245332.1|  hypothetical protein CIMG_04773 [Coccidio...   273    3e-71 
ref|XP_461170.1|  DEHA2F18986p [Debaryomyces hansenii CBS767] ...   273    3e-71 
ref|XP_720670.1|  hypothetical protein CaO19.11708 [Candida al...   273    3e-71 
gb|EFW41314.1|  threonine synthase [Capsaspora owczarzaki ATCC...   272    4e-71 
ref|XP_452601.1|  hypothetical protein [Kluyveromyces lactis N...   272    4e-71 
ref|XP_001909890.1|  hypothetical protein [Podospora anserina ...   272    4e-71 
gb|EEH17801.1|  threonine synthase [Paracoccidioides brasilien...   272    4e-71 
gb|EEH46679.1|  threonine synthase [Paracoccidioides brasilien...   272    4e-71 
ref|XP_760488.1|  hypothetical protein UM04341.1 [Ustilago may...   272    4e-71 
gb|EFZ01374.1|  threonine synthase [Metarhizium anisopliae ARS...   272    5e-71 
ref|XP_002551220.1|  threonine synthase [Candida tropicalis MY...   272    5e-71 
ref|XP_001215587.1|  threonine synthase [Aspergillus terreus N...   272    6e-71 
ref|XP_505779.1|  YALI0F23221p [Yarrowia lipolytica] >emb|CAG7...   271    6e-71 
ref|XP_002551734.1|  KLTH0A06336p [Lachancea thermotolerans] >...   271    7e-71 
emb|CBI61632.1|  unnamed protein product [Sordaria macrospora]      271    7e-71 
ref|ZP_05056543.1|  threonine synthase [Verrucomicrobiae bacte...   271    7e-71 
gb|EEQ88850.1|  threonine synthase [Ajellomyces dermatitidis E...   271    8e-71 
gb|EEQ46263.1|  threonine synthase [Candida albicans WO-1]          271    8e-71 
ref|YP_004256143.1|  threonine synthase [Deinococcus proteolyt...   271    9e-71 
ref|ZP_03507906.1|  threonine synthase [Rhizobium etli Brasil 5]    271    1e-70 
ref|YP_003628043.1|  threonine synthase [Moraxella catarrhalis...   271    1e-70 
ref|XP_002628053.1|  threonine synthase [Ajellomyces dermatiti...   270    2e-70 
ref|ZP_08017595.1|  threonine synthase [Lautropia mirabilis AT...   269    3e-70 
gb|EFW95123.1|  threonine synthase [Pichia angusta DL-1]            269    4e-70 
ref|XP_001837708.2|  threonine synthase [Coprinopsis cinerea o...   269    5e-70 
ref|NP_982600.1|  AAR059Cp [Ashbya gossypii ATCC 10895] >sp|Q0...   268    7e-70 
ref|XP_003030956.1|  hypothetical protein SCHCODRAFT_82488 [Sc...   268    8e-70 
ref|XP_002171711.1|  threonine synthase [Schizosaccharomyces j...   268    8e-70 
ref|YP_004012087.1|  threonine synthase [Rhodomicrobium vannie...   267    1e-69 
pdb|1KL7|A  Chain A, Crystal Structure Of Threonine Synthase F...   267    1e-69 
emb|CBX92747.1|  similar to threonine synthase [Leptosphaeria ...   267    1e-69 
ref|XP_002780997.1|  Threonine synthase, putative [Perkinsus m...   267    1e-69 
ref|XP_001878951.1|  predicted protein [Laccaria bicolor S238N...   267    2e-69 
ref|YP_001800679.1|  threonine synthase [Corynebacterium ureal...   266    2e-69 
dbj|BAE64041.1|  unnamed protein product [Aspergillus oryzae]       266    2e-69 
ref|ZP_05365963.1|  threonine synthase [Corynebacterium tuberc...   266    2e-69 
ref|XP_001642435.1|  hypothetical protein Kpol_289p2 [Vanderwa...   266    3e-69 
ref|XP_001543747.1|  threonine synthase [Ajellomyces capsulatu...   266    3e-69 
ref|XP_956711.1|  threonine synthase [Neurospora crassa OR74A]...   266    4e-69 
ref|ZP_07715293.1|  threonine synthase [Corynebacterium pseudo...   265    6e-69 
ref|YP_002905998.1|  threonine synthase [Corynebacterium kropp...   265    9e-69 
ref|XP_003046372.1|  predicted protein [Nectria haematococca m...   264    1e-68 
gb|EEH06546.1|  threonine synthase [Ajellomyces capsulatus G18...   264    1e-68 
gb|EER40726.1|  threonine synthase [Ajellomyces capsulatus H14...   264    1e-68 
ref|XP_660635.1|  hypothetical protein AN3031.2 [Aspergillus n...   263    2e-68 
ref|XP_001931221.1|  threonine synthase [Pyrenophora tritici-r...   263    2e-68 
ref|ZP_07149398.1|  threonine synthase [Corynebacterium resist...   262    4e-68 
ref|ZP_03711040.1|  hypothetical protein CORMATOL_01880 [Coryn...   262    4e-68 
ref|YP_003783884.1|  threonine synthase [Corynebacterium pseud...   262    6e-68 
ref|ZP_07404151.1|  threonine synthase [Corynebacterium matruc...   261    6e-68 
ref|XP_002496807.1|  ZYRO0D08602p [Zygosaccharomyces rouxii] >...   261    7e-68 
ref|YP_003854549.1|  threonine synthase [Parvularcula bermuden...   261    9e-68 
ref|YP_002981225.1|  threonine synthase [Ralstonia pickettii 1...   261    1e-67 
emb|CAQ43295.1|  Threonine synthase [Zygosaccharomyces rouxii]      261    1e-67 
ref|XP_385889.1|  hypothetical protein FG05713.1 [Gibberella z...   261    1e-67 
emb|CAQ43281.1|  Threonine synthase [Zygosaccharomyces rouxii]      261    1e-67 
ref|ZP_05984945.1|  threonine synthase [Neisseria subflava NJ9...   260    2e-67 
emb|CBA26496.1|  Threonine synthase [Curvibacter putative symb...   260    2e-67 
gb|EFQ85780.1|  hypothetical protein PTT_19137 [Pyrenophora te...   260    2e-67 
ref|ZP_03393965.1|  threonine synthase [Corynebacterium amycol...   259    3e-67 
ref|ZP_07992814.1|  threonine synthase [Neisseria mucosa C102]...   259    4e-67 
ref|ZP_00945561.1|  Threonine synthase [Ralstonia solanacearum...   259    5e-67 
ref|NP_900667.1|  threonine synthase [Chromobacterium violaceu...   259    5e-67 
ref|YP_002253682.1|  threonine synthase protein [Ralstonia sol...   259    5e-67 
ref|NP_738732.2|  threonine synthase [Corynebacterium efficien...   258    5e-67 
ref|NP_519449.1|  threonine synthase [Ralstonia solanacearum G...   258    5e-67 
ref|ZP_05620390.1|  threonine synthase [Enhydrobacter aerosacc...   258    6e-67 
ref|YP_003745900.1|  threonine synthase [Ralstonia solanacearu...   258    7e-67 
dbj|BAC18932.1|  threonine synthase [Corynebacterium efficiens...   258    7e-67 
ref|YP_003643792.1|  threonine synthase [Thiomonas intermedia ...   258    7e-67 
emb|CBJ38582.1|  threonine synthase [Ralstonia solanacearum CM...   258    8e-67 
gb|EFP76195.1|  threonine synthase [Puccinia graminis f. sp. t...   258    8e-67 
ref|ZP_06838292.1|  threonine synthase [Corynebacterium ammoni...   258    1e-66 
emb|CAZ89070.1|  Threonine synthase [Thiomonas sp. 3As]             257    1e-66 
emb|CAA39510.1|  threonine synthase [Corynebacterium glutamicum]    257    1e-66 
ref|XP_001797247.1|  hypothetical protein SNOG_06886 [Phaeosph...   257    2e-66 
ref|NP_601423.1|  threonine synthase [Corynebacterium glutamic...   257    2e-66 
ref|ZP_05987364.2|  threonine synthase [Neisseria lactamica AT...   257    2e-66 
emb|CAA82670.1|  THREONINE SYNTHASE [Corynebacterium glutamicum]    257    2e-66 
gb|ADY97499.1|  threonine synthase [Neisseria meningitidis M01...   257    2e-66 
ref|YP_001139001.1|  threonine synthase [Corynebacterium gluta...   257    2e-66 
ref|YP_001898779.1|  threonine synthase [Ralstonia pickettii 1...   257    2e-66 
ref|YP_001155223.1|  threonine synthase [Polynucleobacter nece...   257    2e-66 
ref|YP_004048661.1|  threonine synthase [Neisseria lactamica S...   256    2e-66 
gb|ADZ03654.1|  threonine synthase [Neisseria meningitidis NZ-...   256    3e-66 
ref|ZP_06863629.2|  threonine synthase [Neisseria polysacchare...   256    3e-66 
ref|YP_549016.1|  threonine synthase [Polaromonas sp. JS666] >...   256    3e-66 
ref|YP_987404.1|  threonine synthase [Acidovorax sp. JS42] >re...   256    3e-66 
ref|ZP_03933272.1|  threonine synthase [Corynebacterium accole...   256    4e-66 
ref|YP_001020739.1|  threonine synthase [Methylibium petroleip...   256    4e-66 
emb|CAX50023.1|  threonine synthase [Neisseria meningitidis 8013]   256    4e-66 
gb|EGC60896.1|  threonine synthase [Neisseria meningitidis ES1...   256    4e-66 
ref|YP_975200.1|  threonine synthase [Neisseria meningitidis F...   256    4e-66 
gb|ADY99699.1|  threonine synthase [Neisseria meningitidis M01...   256    4e-66 
gb|ADO31676.1|  putative threonine synthase [Neisseria meningi...   256    4e-66 
gb|EGC58861.1|  threonine synthase [Neisseria meningitidis M0579]   256    4e-66 
ref|ZP_07369660.1|  threonine synthase [Neisseria meningitidis...   256    4e-66 
gb|EGC56838.1|  threonine synthase [Neisseria meningitidis M13...   255    5e-66 
gb|EGC53059.1|  threonine synthase [Neisseria meningitidis OX9...   255    5e-66 
ref|YP_002001842.1|  threonine synthase [Neisseria gonorrhoeae...   255    5e-66 
emb|CBA08841.1|  Threonine synthase [Neisseria meningitidis al...   255    5e-66 
gb|EGC51217.1|  threonine synthase [Neisseria meningitidis N1568]   255    5e-66 
ref|ZP_03718916.1|  hypothetical protein NEIFLAOT_00733 [Neiss...   255    6e-66 
ref|YP_207828.1|  threonine synthase [Neisseria gonorrhoeae FA...   255    6e-66 
ref|YP_002342775.1|  threonine synthase [Neisseria meningitidi...   255    6e-66 
ref|NP_274080.1|  threonine synthase [Neisseria meningitidis M...   255    6e-66 
ref|ZP_05794194.1|  threonine synthase [Neisseria gonorrhoeae ...   255    6e-66 
ref|ZP_06643142.1|  threonine synthase [Neisseria gonorrhoeae ...   255    6e-66 
gb|EFV63637.1|  threonine synthase [Neisseria meningitidis H44...   255    6e-66 
ref|ZP_06569391.1|  threonine synthase [Neisseria gonorrhoeae ...   255    7e-66 
gb|EGC62762.1|  threonine synthase [Neisseria meningitidis CU3...   255    7e-66 
ref|ZP_05705878.1|  threonine synthase [Cardiobacterium homini...   255    8e-66 
ref|XP_003192362.1|  threonine synthase [Cryptococcus gattii W...   254    9e-66 
ref|ZP_04758120.1|  threonine synthase [Neisseria flavescens S...   254    1e-65 
ref|YP_523170.1|  threonine synthase [Rhodoferax ferrireducens...   254    1e-65 
ref|YP_002835263.1|  Threonine synthase [Corynebacterium aurim...   254    1e-65 
gb|EFV83329.1|  ThrC protein [Achromobacter xylosoxidans C54]       254    2e-65 
emb|CBY90875.1|  threonine synthase [Neisseria meningitidis WU...   253    2e-65 
gb|EGC55246.1|  threonine synthase [Neisseria meningitidis M6190]   253    2e-65 
gb|EGB10926.1|  hypothetical protein AURANDRAFT_22578 [Aureoco...   253    2e-65 
ref|ZP_07469516.1|  threonine synthase [Corynebacterium accole...   253    2e-65 
ref|XP_568789.1|  threonine synthase [Cryptococcus neoformans ...   253    2e-65 
ref|ZP_03934678.1|  threonine synthase [Corynebacterium striat...   253    2e-65 
emb|CBX22770.1|  unnamed protein product [Neisseria lactamica ...   253    2e-65 
ref|NP_285683.1|  threonine synthase [Deinococcus radiodurans ...   253    3e-65 
ref|NP_940006.1|  threonine synthase [Corynebacterium diphther...   253    3e-65 
ref|YP_003083267.1|  Threonine synthase [Neisseria meningitidi...   253    3e-65 
ref|ZP_03699345.1|  threonine synthase [Lutiella nitroferrum 2...   253    3e-65 
ref|YP_747092.1|  threonine synthase [Nitrosomonas eutropha C9...   253    3e-65 
ref|ZP_03713414.1|  hypothetical protein EIKCOROL_01094 [Eiken...   253    3e-65 
emb|CBA08959.1|  Threonine synthase [Neisseria meningitidis al...   253    4e-65 
ref|YP_726730.1|  threonine synthase [Ralstonia eutropha H16] ...   253    4e-65 
ref|YP_004127878.1|  threonine synthase [Alicycliphilus denitr...   252    4e-65 
ref|YP_004154412.1|  threonine synthase [Variovorax paradoxus ...   252    4e-65 
ref|YP_001599280.1|  threonine synthase [Neisseria meningitidi...   252    4e-65 
gb|EGC64872.1|  threonine synthase [Neisseria meningitidis 961...   252    4e-65 
ref|ZP_04763498.1|  threonine synthase [Acidovorax delafieldii...   252    5e-65 
ref|YP_002943748.1|  threonine synthase [Variovorax paradoxus ...   252    5e-65 
ref|YP_003524832.1|  threonine synthase [Sideroxydans lithotro...   252    5e-65 
ref|NP_594579.1|  threonine synthase (predicted) [Schizosaccha...   252    5e-65 
ref|YP_001797332.1|  threonine synthase [Polynucleobacter nece...   252    5e-65 
gb|AAK83373.1|  threonine synthase Thr4 [Cryptococcus neoformans]   252    6e-65 
gb|ACC94295.1|  threonine synthase [Cryptococcus neoformans va...   252    6e-65 
emb|CAD86282.1|  thrC; probable threonine synthase protein [Ni...   252    6e-65 
ref|YP_001631356.1|  threonine synthase [Bordetella petrii DSM...   252    6e-65 
ref|NP_842365.2|  threonine synthase [Nitrosomonas europaea AT...   251    7e-65 
ref|ZP_06735918.1|  hypothetical protein NEIELOOT_02771 [Neiss...   251    8e-65 
ref|YP_159845.1|  threonine synthase [Aromatoleum aromaticum E...   251    8e-65 
ref|ZP_05983281.1|  threonine synthase [Neisseria cinerea ATCC...   251    9e-65 
ref|YP_002005816.1|  threonine synthase [Cupriavidus taiwanens...   251    1e-64 
ref|ZP_06686744.1|  threonine synthase [Achromobacter piechaud...   250    1e-64 
ref|ZP_07044120.1|  threonine synthase [Comamonas testosteroni...   249    3e-64 
ref|ZP_04601188.1|  hypothetical protein GCWU000324_00652 [Kin...   249    3e-64 
ref|ZP_05977640.1|  threonine synthase [Neisseria mucosa ATCC ...   249    3e-64 
ref|ZP_08133941.1|  threonine synthase [Kingella denitrificans...   249    4e-64 
ref|YP_786676.1|  threonine synthase [Bordetella avium 197N] >...   249    4e-64 
ref|ZP_07991303.1|  threonine synthase [Corynebacterium variab...   248    6e-64 
ref|YP_003277067.1|  threonine synthase [Comamonas testosteron...   248    6e-64 
ref|YP_759767.1|  threonine synthase [Hyphomonas neptunium ATC...   248    7e-64 
ref|ZP_06980188.1|  threonine synthase [Neisseria sp. oral tax...   248    7e-64 
ref|ZP_05317719.1|  threonine synthase [Neisseria sicca ATCC 2...   248    7e-64 
ref|ZP_08027090.1|  threonine synthase [Actinomyces sp. oral t...   248    7e-64 
ref|YP_001857167.1|  threonine synthase [Burkholderia phymatum...   248    8e-64 
ref|YP_004233746.1|  threonine synthase [Acidovorax avenae sub...   248    9e-64 
ref|ZP_03544748.1|  threonine synthase [Comamonas testosteroni...   248    9e-64 
ref|YP_969604.1|  threonine synthase [Acidovorax avenae subsp....   248    1e-63 
ref|XP_002562952.1|  Pc20g04020 [Penicillium chrysogenum Wisco...   247    2e-63 
ref|YP_997425.1|  threonine synthase [Verminephrobacter eiseni...   246    2e-63 
ref|YP_003752679.1|  threonine synthase [Ralstonia solanacearu...   246    3e-63 
ref|YP_001895439.1|  threonine synthase [Burkholderia phytofir...   246    3e-63 
ref|ZP_03268333.1|  threonine synthase [Burkholderia sp. H160]...   246    4e-63 
ref|YP_296200.1|  threonine synthase [Ralstonia eutropha JMP13...   246    4e-63 
ref|YP_982459.1|  threonine synthase [Polaromonas naphthaleniv...   246    4e-63 
ref|YP_003977950.1|  threonine synthase [Achromobacter xylosox...   245    5e-63 
ref|ZP_06753769.1|  threonine synthase [Simonsiella muelleri A...   245    6e-63 
ref|ZP_07880293.1|  threonine synthase [Actinomyces sp. oral t...   245    6e-63 
ref|YP_004228322.1|  threonine synthase [Burkholderia sp. CCGE...   245    6e-63 
ref|YP_369392.1|  threonine synthase [Burkholderia sp. 383] >g...   245    6e-63 
ref|YP_003604967.1|  threonine synthase [Burkholderia sp. CCGE...   245    7e-63 
ref|YP_001566232.1|  threonine synthase [Delftia acidovorans S...   244    1e-62 
ref|YP_003906783.1|  threonine synthase [Burkholderia sp. CCGE...   244    1e-62 
sp|P37145.1|THRC_METGL  RecName: Full=Threonine synthase; Shor...   244    1e-62 
ref|YP_001119619.1|  threonine synthase [Burkholderia vietnami...   244    1e-62 
ref|YP_004029073.1|  Threonine synthase [Burkholderia rhizoxin...   244    2e-62 
gb|EGC99587.1|  threonine synthase [Burkholderia sp. TJI49]         244    2e-62 
ref|YP_002794589.1|  threonine synthase [Laribacter hongkongen...   243    2e-62 
ref|ZP_02362559.1|  threonine synthase [Burkholderia oklahomen...   243    2e-62 
ref|ZP_02355419.1|  threonine synthase [Burkholderia oklahomen...   243    2e-62 
ref|ZP_04576306.1|  threonine synthase [Oxalobacter formigenes...   243    2e-62 
ref|YP_626063.1|  threonine synthase [Burkholderia cenocepacia...   243    2e-62 
ref|YP_002231053.1|  threonine synthase [Burkholderia cenocepa...   243    2e-62 
ref|YP_001765160.1|  threonine synthase [Burkholderia cenocepa...   243    2e-62 
ref|YP_933584.1|  threonine synthase [Azoarcus sp. BH72] >emb|...   243    2e-62 
ref|ZP_02379397.1|  threonine synthase [Burkholderia ubonensis...   243    2e-62 
ref|YP_003687793.1|  Threonine synthase (O-phospho-L-homoserin...   243    3e-62 
ref|YP_003165794.1|  threonine synthase [Candidatus Accumuliba...   243    4e-62 
ref|YP_558642.1|  threonine synthase [Burkholderia xenovorans ...   243    4e-62 
ref|ZP_01915097.1|  threonine synthase [Limnobacter sp. MED105...   243    4e-62 
ref|ZP_07343696.1|  threonine synthase [Burkholderiales bacter...   243    4e-62 
ref|ZP_02907055.1|  threonine synthase [Burkholderia ambifaria...   243    4e-62 
ref|YP_545014.1|  threonine synthase [Methylobacillus flagella...   243    4e-62 
ref|ZP_04941354.1|  Threonine synthase [Burkholderia cenocepac...   242    5e-62 
ref|ZP_02893529.1|  threonine synthase [Burkholderia ambifaria...   242    6e-62 
ref|ZP_04945538.1|  Threonine synthase [Burkholderia dolosa AU...   242    6e-62 
ref|YP_001808464.1|  threonine synthase [Burkholderia ambifari...   242    6e-62 
ref|YP_773681.1|  threonine synthase [Burkholderia ambifaria A...   242    6e-62 
ref|YP_002889552.1|  threonine synthase [Thauera sp. MZ1T] >gb...   241    7e-62 
ref|YP_002911269.1|  Threonine synthase [Burkholderia glumae B...   241    8e-62 
ref|YP_001059266.1|  threonine synthase [Burkholderia pseudoma...   241    8e-62 
ref|YP_062412.1|  threonine synthase [Leifsonia xyli subsp. xy...   241    9e-62 
ref|ZP_04579126.1|  threonine synthase [Oxalobacter formigenes...   241    1e-61 
ref|ZP_03571169.1|  threonine synthase [Burkholderia multivora...   241    1e-61 
ref|YP_004130386.1|  Threonine synthase [Taylorella equigenita...   241    1e-61 
ref|YP_001579605.1|  threonine synthase [Burkholderia multivor...   241    1e-61 
ref|ZP_07360318.1|  threonine synthase [Actinomyces viscosus C...   241    1e-61 
ref|YP_003048963.1|  threonine synthase [Methylotenera mobilis...   240    2e-61 
ref|ZP_03588103.1|  threonine synthase [Burkholderia multivora...   240    2e-61 
ref|ZP_02463238.1|  threonine synthase [Burkholderia thailande...   240    2e-61 
ref|YP_285588.1|  threonine synthase [Dechloromonas aromatica ...   240    2e-61 
ref|ZP_02402453.1|  threonine synthase [Burkholderia pseudomal...   240    2e-61 
ref|YP_003775504.1|  threonine synthase [Herbaspirillum serope...   240    2e-61 
ref|ZP_01764523.1|  threonine synthase [Burkholderia pseudomal...   240    3e-61 
ref|YP_001066533.1|  threonine synthase [Burkholderia pseudoma...   239    3e-61 
ref|YP_108098.1|  threonine synthase [Burkholderia pseudomalle...   239    3e-61 
ref|ZP_03453124.1|  threonine synthase [Burkholderia pseudomal...   239    3e-61 
ref|ZP_02883477.1|  threonine synthase [Burkholderia graminis ...   239    3e-61 
ref|ZP_06840580.1|  threonine synthase [Burkholderia sp. Ch1-1...   239    4e-61 
ref|YP_412245.1|  threonine synthase [Nitrosospira multiformis...   239    4e-61 
ref|YP_001353003.1|  threonine synthase [Janthinobacterium sp....   239    4e-61 
ref|ZP_02374538.1|  threonine synthase [Burkholderia thailande...   238    6e-61 
ref|ZP_03978904.1|  threonine synthase [Corynebacterium lipoph...   238    6e-61 
ref|YP_314602.1|  threonine synthase [Thiobacillus denitrifica...   238    7e-61 
ref|YP_003674062.1|  threonine synthase [Methylotenera sp. 301...   238    9e-61 
ref|YP_004039318.1|  threonine synthase [Methylovorus sp. MP68...   238    9e-61 
ref|YP_003050651.1|  threonine synthase [Methylovorus sp. SIP3...   238    9e-61 
ref|YP_003847593.1|  threonine synthase [Gallionella capsiferr...   238    1e-60 
ref|YP_584113.1|  threonine synthase [Cupriavidus metalliduran...   238    1e-60 
ref|YP_001100409.1|  threonine synthase [Herminiimonas arsenic...   237    1e-60 
ref|YP_001791056.1|  threonine synthase [Leptothrix cholodnii ...   237    1e-60 
ref|ZP_01552031.1|  threonine synthase [Methylophilales bacter...   236    3e-60 
ref|ZP_07090624.1|  threonine synthase [Corynebacterium genita...   236    3e-60 
ref|ZP_03926894.1|  threonine synthase [Actinomyces urogenital...   236    4e-60 
ref|NP_884711.1|  threonine synthase [Bordetella parapertussis...   236    4e-60 
ref|NP_881383.1|  threonine synthase [Bordetella pertussis Toh...   236    4e-60 
ref|YP_003059422.1|  threonine synthase [Hirschia baltica ATCC...   235    5e-60 
ref|YP_442720.1|  threonine synthase [Burkholderia thailandens...   235    5e-60 
ref|NP_888472.1|  threonine synthase [Bordetella bronchiseptic...   235    5e-60 
gb|AAF78806.1|  threonine synthase ThrC [Bradyrhizobium japoni...   235    7e-60 
gb|AAF21130.1|L78665_4  threonine synthase [Methylobacillus fl...   234    1e-59 
ref|ZP_08033610.1|  threonine synthase [Actinomyces sp. oral t...   234    1e-59 
ref|YP_003818006.1|  threonine synthase [Brevundimonas subvibr...   234    2e-59 
ref|ZP_08125006.1|  threonine synthase [Actinomyces oris K20]       233    3e-59 
ref|YP_004294653.1|  threonine synthase [Nitrosomonas sp. AL21...   233    4e-59 
ref|ZP_05081293.1|  threonine synthase [beta proteobacterium K...   232    7e-59 
ref|ZP_05033303.1|  threonine synthase [Brevundimonas sp. BAL3...   232    7e-59 
ref|YP_001213220.1|  threonine synthase [Pelotomaculum thermop...   231    1e-58 
ref|ZP_03918395.1|  threonine synthase [Corynebacterium glucur...   230    2e-58 
ref|ZP_06609934.1|  threonine synthase [Actinomyces odontolyti...   230    2e-58 
ref|ZP_02044144.1|  hypothetical protein ACTODO_01003 [Actinom...   230    2e-58 
ref|ZP_08191661.1|  threonine synthase [Clostridium papyrosolv...   229    4e-58 
ref|YP_003190470.1|  threonine synthase [Desulfotomaculum acet...   226    4e-57 
ref|YP_002505784.1|  threonine synthase [Clostridium celluloly...   225    7e-57 
ref|YP_003703084.1|  threonine synthase [Syntrophothermus lipo...   224    1e-56 
ref|YP_003639701.1|  threonine synthase [Thermincola sp. JR] >...   224    1e-56 
ref|YP_003827692.1|  L-threonine synthase [Acetohalobium araba...   223    2e-56 
ref|NP_001088267.1|  threonine synthase-like 2 [Xenopus laevis...   223    2e-56 
emb|CBI61169.1|  unnamed protein product [Sordaria macrospora]      223    3e-56 
ref|YP_002122448.1|  threonine synthase [Streptococcus equi su...   222    4e-56 
ref|YP_003772558.1|  threonine synthase [Leuconostoc gasicomit...   222    5e-56 
ref|YP_002743610.1|  threonine synthase [Streptococcus equi su...   222    6e-56 
ref|ZP_04775997.1|  threonine synthase [Gemella haemolysans AT...   221    9e-56 
ref|YP_002745480.1|  threonine synthase [Streptococcus equi su...   221    1e-55 
ref|YP_003994948.1|  threonine synthase [Halanaerobium sp. 'sa...   221    1e-55 
ref|YP_003483975.1|  putative threonine synthase [Streptococcu...   220    3e-55 
ref|NP_720550.1|  threonine synthase [Streptococcus mutans UA1...   219    3e-55 
ref|XP_002585152.1|  threonine synthase [Uncinocarpus reesii 1...   219    4e-55 
ref|ZP_01667012.1|  threonine synthase [Thermosinus carboxydiv...   219    5e-55 
ref|ZP_08113031.1|  threonine synthase [Desulfotomaculum nigri...   219    6e-55 
ref|YP_003802611.1|  threonine synthase [Spirochaeta smaragdin...   219    6e-55 
ref|ZP_03499818.1|  threonine synthase [Rhizobium etli Kim 5]       218    7e-55 
ref|XP_002937321.1|  PREDICTED: threonine synthase-like 2 [Xen...   218    9e-55 
ref|ZP_08077006.1|  threonine synthase [Phascolarctobacterium ...   218    1e-54 
ref|YP_001112734.1|  threonine synthase [Desulfotomaculum redu...   217    2e-54 
ref|YP_753981.1|  threonine synthase [Syntrophomonas wolfei su...   216    3e-54 
ref|ZP_06603082.1|  threonine synthase [Selenomonas noxia ATCC...   215    6e-54 
ref|ZP_03626175.1|  threonine synthase [Streptococcus suis 89/...   214    9e-54 
ref|ZP_07329201.1|  threonine synthase [Acetivibrio cellulolyt...   214    1e-53 
ref|ZP_07864118.1|  threonine synthase [Streptococcus anginosu...   214    2e-53 
dbj|BAA13852.1|  unnamed protein product [Schizosaccharomyces ...   213    2e-53 
ref|XP_002735308.1|  PREDICTED: hypothetical protein [Saccoglo...   213    2e-53 
ref|YP_001037806.1|  threonine synthase [Clostridium thermocel...   213    2e-53 
ref|ZP_02080914.1|  hypothetical protein CLOLEP_02372 [Clostri...   213    3e-53 
ref|ZP_03709130.1|  hypothetical protein CLOSTMETH_03892 [Clos...   213    4e-53 
ref|ZP_03914214.1|  threonine synthase [Leuconostoc mesenteroi...   212    5e-53 
ref|YP_004292418.1|  threonine synthase [Lactobacillus acidoph...   212    5e-53 
ref|ZP_05429988.1|  threonine synthase [Clostridium thermocell...   212    5e-53 
ref|YP_003238566.1|  threonine synthase [Ammonifex degensii KC...   212    6e-53 
ref|ZP_04062685.1|  threonine synthase [Streptococcus salivari...   212    6e-53 
ref|ZP_07634281.1|  threonine synthase [Ruminococcaceae bacter...   212    7e-53 
ref|ZP_07758038.1|  threonine synthase [Megasphaera micronucif...   212    7e-53 
ref|YP_818269.1|  threonine synthase [Leuconostoc mesenteroide...   212    7e-53 
ref|YP_002871631.1|  threonine synthase [Pseudomonas fluoresce...   211    8e-53 
ref|ZP_07829569.1|  threonine synthase [Selenomonas sp. oral t...   211    9e-53 
ref|YP_004090751.1|  threonine synthase [Ethanoligenens harbin...   211    9e-53 
gb|EEF08852.1|  predicted protein [Populus trichocarpa]             211    1e-52 
ref|ZP_08014754.1|  threonine synthase [Streptococcus anginosu...   211    1e-52 
ref|ZP_03989892.1|  threonine synthase [Acidaminococcus sp. D2...   211    1e-52 
ref|YP_004032096.1|  threonine synthase [Lactobacillus amylovo...   211    1e-52 
ref|XP_001511943.1|  PREDICTED: hypothetical protein [Ornithor...   211    2e-52 
ref|YP_001728000.1|  threonine synthase [Leuconostoc citreum K...   210    2e-52 
ref|YP_003622489.1|  threonine synthase [Leuconostoc kimchii I...   210    2e-52 
ref|XP_420866.2|  PREDICTED: hypothetical protein [Gallus gallus]   210    2e-52 
ref|YP_004088130.1|  threonine synthase [Asticcacaulis excentr...   210    2e-52 
ref|ZP_01995087.1|  hypothetical protein DORLON_01078 [Dorea l...   210    2e-52 
ref|ZP_08031710.1|  threonine synthase [Selenomonas artemidis ...   209    3e-52 
ref|ZP_08068849.1|  threonine synthase [Streptococcus vestibul...   209    5e-52 
ref|ZP_07722664.1|  threonine synthase [Streptococcus vestibul...   209    5e-52 
emb|CBL20925.1|  threonine synthase [Ruminococcus sp. SR1/5]        209    5e-52 
gb|ADJ79521.1|  Threonine synthase [Lactobacillus salivarius C...   209    5e-52 
ref|YP_003966804.1|  L-threonine synthase [Ilyobacter polytrop...   209    6e-52 
ref|ZP_04971095.1|  threonine synthase [Fusobacterium nucleatu...   208    6e-52 
ref|ZP_07954305.1|  threonine synthase [Gemella moribillum M42...   208    7e-52 
ref|ZP_06026693.2|  threonine synthase [Fusobacterium periodon...   208    7e-52 
ref|ZP_08060000.1|  threonine synthase [Streptococcus cristatu...   208    7e-52 
ref|ZP_05901021.1|  threonine synthase [Leptotrichia hofstadii...   208    7e-52 
ref|YP_002561437.1|  threonine synthase [Streptococcus uberis ...   208    8e-52 
ref|YP_003143975.1|  L-threonine synthase [Slackia heliotrinir...   208    8e-52 
ref|ZP_01965638.1|  hypothetical protein RUMOBE_03377 [Ruminoc...   208    9e-52 
gb|EGD31182.1|  threonine synthase [Streptococcus sanguinis SK...   208    9e-52 
ref|NP_347635.1|  threonine synthase [Clostridium acetobutylic...   208    9e-52 
ref|ZP_04009261.1|  threonine synthase [Lactobacillus salivari...   207    1e-51 
ref|YP_003844332.1|  threonine synthase [Clostridium cellulovo...   207    1e-51 
ref|YP_001716474.1|  threonine synthase [Candidatus Desulforud...   207    1e-51 
ref|ZP_08064157.1|  threonine synthase [Streptococcus parasang...   207    1e-51 
gb|ADV69373.1|  putative threonine synthase [Streptococcus sui...   207    1e-51 
ref|ZP_06884147.1|  threonine synthase [Clostridium lentocellu...   207    1e-51 
ref|YP_003445346.1|  threonine synthase [Streptococcus mitis B...   207    1e-51 
ref|YP_003024303.1|  putative threonine synthase [Streptococcu...   207    1e-51 
gb|EGD37211.1|  threonine synthase [Streptococcus sanguinis SK...   207    1e-51 
ref|ZP_03682355.1|  hypothetical protein CATMIT_00988 [Catenib...   207    2e-51 
ref|ZP_06899495.1|  threonine synthase [Streptococcus parasang...   207    2e-51 
ref|YP_001449461.1|  threonine synthase [Streptococcus gordoni...   207    2e-51 
ref|ZP_07886919.1|  threonine synthase [Streptococcus sanguini...   207    2e-51 
gb|ADE30723.1|  Threonine synthase [Streptococcus suis GZ1]         207    2e-51 
ref|ZP_07727166.1|  threonine synthase [Streptococcus parasang...   207    2e-51 
gb|ABP89249.1|  Threonine synthase [Streptococcus suis 05ZYH33]     207    2e-51 
ref|ZP_02442989.1|  hypothetical protein ANACOL_02289 [Anaerot...   207    2e-51 
ref|ZP_01819058.1|  threonine synthase [Streptococcus pneumoni...   207    2e-51 
ref|YP_194080.1|  threonine synthase [Lactobacillus acidophilu...   207    2e-51 
ref|YP_001197649.2|  threonine synthase [Streptococcus suis 05...   207    2e-51 
gb|EGC24585.1|  threonine synthase [Streptococcus sanguinis SK...   207    2e-51 
ref|ZP_01821073.1|  threonine synthase [Streptococcus pneumoni...   207    2e-51 
ref|ZP_06756679.1|  threonine synthase [Scardovia inopinata F0...   207    2e-51 
ref|ZP_07693372.1|  threonine synthase [Streptococcus infantis...   207    2e-51 
ref|ZP_08086586.1|  threonine synthase [Streptococcus sanguini...   207    2e-51 
ref|ZP_01833070.1|  threonine synthase [Streptococcus pneumoni...   207    2e-51 
ref|YP_003163775.1|  threonine synthase [Leptotrichia buccalis...   207    2e-51 
emb|CBL24150.1|  threonine synthase [Ruminococcus obeum A2-162]     207    2e-51 
ref|ZP_08062256.1|  threonine synthase [Streptococcus infantis...   206    3e-51 
ref|ZP_07666438.1|  threonine synthase [Gardnerella vaginalis ...   206    3e-51 
ref|YP_003399206.1|  threonine synthase [Acidaminococcus ferme...   206    3e-51 
ref|ZP_07646499.1|  threonine synthase [Streptococcus mitis SK...   206    3e-51 
ref|ZP_05627507.1|  threonine synthase [Fusobacterium sp. D12]...   206    3e-51 
ref|ZP_08009220.1|  threonine synthase [Coprobacillus sp. 29_1...   206    3e-51 
ref|ZP_08048618.1|  threonine synthase [Streptococcus sp. C150...   206    3e-51 
ref|ZP_08029890.1|  threonine synthase [Solobacterium moorei F...   206    3e-51 
ref|YP_001034107.1|  threonine synthase [Streptococcus sanguin...   206    3e-51 
ref|YP_001394105.1|  threonine synthase [Clostridium kluyveri ...   206    4e-51 
gb|EGD28423.1|  threonine synthase [Streptococcus sanguinis SK72]   206    4e-51 
ref|ZP_08066071.1|  threonine synthase [Streptococcus peroris ...   206    4e-51 
ref|ZP_07463436.1|  threonine synthase [Streptococcus mitis AT...   206    4e-51 
ref|ZP_03567863.1|  threonine synthase [Atopobium rimae ATCC 4...   206    4e-51 
ref|YP_003125061.1|  threonine synthase [Chitinophaga pinensis...   206    4e-51 
ref|YP_003180941.1|  threonine synthase [Eggerthella lenta DSM...   206    4e-51 
ref|YP_002739151.1|  threonine synthase [Streptococcus pneumon...   206    4e-51 
emb|CBL39955.1|  L-threonine synthase [butyrate-producing bact...   206    5e-51 
ref|ZP_02433285.1|  hypothetical protein CLOSCI_03563 [Clostri...   206    5e-51 
ref|ZP_03487456.1|  hypothetical protein EUBIFOR_00014 [Eubact...   206    5e-51 
ref|YP_003309053.1|  threonine synthase [Sebaldella termitidis...   206    5e-51 
ref|ZP_05965729.1|  threonine synthase [Bifidobacterium gallic...   206    5e-51 
ref|XP_002757606.1|  PREDICTED: threonine synthase-like 2-like...   206    5e-51 
ref|ZP_08081255.1|  threonine synthase [Lactobacillus ruminis ...   206    5e-51 
ref|ZP_07644229.1|  threonine synthase [Streptococcus mitis NC...   206    5e-51 
ref|YP_003374225.1|  threonine synthase [Gardnerella vaginalis...   206    5e-51 
ref|ZP_05898625.1|  threonine synthase [Selenomonas sputigena ...   205    5e-51 
ref|ZP_02614958.1|  threonine synthase [Clostridium botulinum ...   205    5e-51 
ref|ZP_07647357.1|  threonine synthase [Streptococcus mitis SK...   205    6e-51 
emb|CBK98346.1|  L-threonine synthase [Faecalibacterium prausn...   205    6e-51 
ref|ZP_06571977.1|  threonine synthase [Clostridium sp. M62/1]...   205    6e-51 
ref|ZP_06645968.1|  threonine synthase [Erysipelotrichaceae ba...   205    6e-51 
ref|YP_821178.1|  threonine synthase [Streptococcus thermophil...   205    6e-51 
gb|ADQ63850.1|  Threonine synthase, putative [Streptococcus th...   205    7e-51 
gb|EGC21955.1|  threonine synthase [Streptococcus sanguinis SK...   205    7e-51 
ref|ZP_08052721.1|  threonine synthase [Streptococcus sp. M334...   205    7e-51 
ref|ZP_07341766.1|  threonine synthase [Streptococcus pneumoni...   205    7e-51 
emb|CBL34915.1|  L-threonine synthase [Eubacterium siraeum V10...   205    8e-51 
ref|ZP_02716631.1|  threonine synthase [Streptococcus pneumoni...   205    8e-51 
ref|ZP_06611291.1|  threonine synthase [Streptococcus oralis A...   205    8e-51 
ref|ZP_02422939.1|  hypothetical protein EUBSIR_01794 [Eubacte...   205    8e-51 
emb|CBK77002.1|  L-threonine synthase [Clostridium cf. sacchar...   205    9e-51 
ref|NP_359469.1|  threonine synthase [Streptococcus pneumoniae...   205    9e-51 
ref|YP_142207.1|  threonine synthase [Streptococcus thermophil...   205    9e-51 
ref|YP_003961087.1|  threonine synthase [Eubacterium limosum K...   204    9e-51 
ref|YP_140292.1|  threonine synthase [Streptococcus thermophil...   204    1e-50 
ref|YP_004090069.1|  threonine synthase [Ruminococcus albus 7]...   204    1e-50 
gb|EGD39138.1|  threonine synthase [Streptococcus sanguinis SK...   204    1e-50 
ref|ZP_07726725.1|  threonine synthase [Streptococcus downei F...   204    1e-50 
ref|ZP_01836142.1|  threonine synthase [Streptococcus pneumoni...   204    1e-50 
ref|YP_003151664.1|  threonine synthase [Cryptobacterium curtu...   204    1e-50 
emb|CBK96278.1|  L-threonine synthase [Eubacterium siraeum 70/3]    204    1e-50 
ref|ZP_03657009.1|  threonine synthase [Helicobacter canadensi...   204    1e-50 
ref|ZP_04570505.1|  threonine synthase [Fusobacterium sp. 2_1_...   204    1e-50 
ref|ZP_08020095.1|  threonine synthase [Streptococcus australi...   204    1e-50 
ref|ZP_02711548.1|  threonine synthase [Streptococcus pneumoni...   204    1e-50 
ref|ZP_06059542.1|  threonine synthase [Streptococcus sp. 2_1_...   204    1e-50 
ref|ZP_01828825.1|  threonine synthase [Streptococcus pneumoni...   204    1e-50 
ref|ZP_07205997.1|  threonine synthase [Lactobacillus salivari...   204    1e-50 
ref|YP_001390975.1|  threonine synthase [Clostridium botulinum...   204    1e-50 
ref|ZP_05403554.2|  threonine synthase [Mitsuokella multacida ...   204    1e-50 
ref|ZP_05732651.1|  threonine synthase [Dialister invisus DSM ...   204    1e-50 
ref|ZP_06927373.1|  threonine synthase [Gardnerella vaginalis ...   204    1e-50 
ref|YP_003429486.1|  threonine synthase [Streptococcus galloly...   204    2e-50 
ref|ZP_01771940.1|  Hypothetical protein COLAER_00930 [Collins...   204    2e-50 
ref|ZP_06748208.1|  threonine synthase [Fusobacterium sp. 1_1_...   204    2e-50 
ref|ZP_05979878.1|  threonine synthase [Subdoligranulum variab...   204    2e-50 
ref|ZP_07642584.1|  threonine synthase [Streptococcus mitis SK...   204    2e-50 
ref|ZP_06199675.1|  threonine synthase [Streptococcus sp. M143...   204    2e-50 
ref|ZP_02693603.1|  threonine synthase [Epulopiscium sp. 'N.t....   204    2e-50 
ref|ZP_08050695.1|  threonine synthase [Streptococcus sp. C300...   204    2e-50 
emb|CBK74262.1|  threonine synthase [Butyrivibrio fibrisolvens...   204    2e-50 
ref|YP_004266264.1|  L-threonine synthase [Syntrophobotulus gl...   203    2e-50 
ref|ZP_02919550.1|  hypothetical protein STRINF_00401 [Strepto...   203    2e-50 
ref|YP_536408.1|  threonine synthase [Lactobacillus salivarius...   203    2e-50 
ref|ZP_04599310.1|  hypothetical protein VEIDISOL_00744 [Veill...   203    2e-50 
ref|ZP_01821867.1|  threonine synthase [Streptococcus pneumoni...   203    2e-50 
ref|YP_002323301.1|  threonine synthase [Bifidobacterium longu...   203    3e-50 
ref|ZP_05615574.1|  threonine synthase [Faecalibacterium praus...   203    3e-50 
ref|YP_002804056.1|  threonine synthase [Clostridium botulinum...   203    3e-50 
ref|YP_001513488.1|  threonine synthase [Alkaliphilus oremland...   203    3e-50 
ref|YP_676709.1|  threonine synthase [Cytophaga hutchinsonii A...   203    3e-50 
emb|CBZ03520.1|  threonine synthase [Clostridium botulinum H04...   203    3e-50 
ref|YP_003088175.1|  threonine synthase [Dyadobacter fermentan...   203    3e-50 
ref|YP_003195579.1|  threonine synthase [Robiginitalea biforma...   203    3e-50 
ref|ZP_07397296.1|  threonine synthase [Selenomonas sp. oral t...   203    3e-50 
ref|ZP_08160354.1|  threonine synthase [Ruminococcus albus 8] ...   202    4e-50 
ref|ZP_05401504.1|  threonine synthase [Clostridium difficile ...   202    4e-50 
ref|ZP_03953339.1|  threonine synthase [Lactobacillus hilgardi...   202    4e-50 
ref|YP_002263902.1|  threonine synthase [Aliivibrio salmonicid...   202    4e-50 
gb|ADX70058.1|  Threonine synthase [Lactobacillus helveticus H10]   202    4e-50 
ref|ZP_05330229.1|  threonine synthase [Clostridium difficile ...   202    5e-50 
ref|YP_003601705.1|  threonine synthase [Lactobacillus crispat...   202    5e-50 
ref|ZP_05633992.1|  threonine synthase [Fusobacterium ulcerans...   202    5e-50 
ref|ZP_05351298.1|  threonine synthase [Clostridium difficile ...   202    5e-50 
ref|YP_811964.1|  threonine synthase [Lactococcus lactis subsp...   202    6e-50 
ref|ZP_07799639.1|  threonine synthase [Faecalibacterium cf. p...   202    6e-50 
ref|ZP_05760759.1|  threonine synthase [Bacteroides sp. D2] >r...   202    6e-50 
ref|ZP_03941154.1|  threonine synthase [Lactobacillus buchneri...   202    6e-50 
ref|ZP_07456044.1|  threonine synthase [Bifidobacterium dentiu...   202    6e-50 
ref|YP_003660973.1|  threonine synthase [Bifidobacterium longu...   202    6e-50 
ref|ZP_07459694.1|  threonine synthase [Streptococcus sp. oral...   202    6e-50 
ref|ZP_06159548.1|  threonine synthase [Slackia exigua ATCC 70...   202    6e-50 
ref|ZP_03702400.1|  threonine synthase [Flavobacteria bacteriu...   202    7e-50 
ref|ZP_04855221.1|  conserved hypothetical protein [Ruminococc...   202    7e-50 
ref|YP_001088632.1|  threonine synthase [Clostridium difficile...   202    7e-50 
ref|YP_003354743.1|  threonine synthase [Lactococcus lactis su...   202    7e-50 
ref|ZP_02918617.1|  hypothetical protein BIFDEN_01924 [Bifidob...   202    7e-50 
ref|ZP_06808799.1|  threonine synthase [Aerococcus viridans AT...   202    7e-50 
ref|YP_002038648.1|  threonine synthase [Streptococcus pneumon...   202    8e-50 
ref|ZP_03778141.1|  hypothetical protein CLOHYLEM_05196 [Clost...   202    8e-50 
ref|ZP_07037260.1|  threonine synthase [Peptoniphilus sp. oral...   201    8e-50 
ref|ZP_01826269.1|  threonine synthase [Streptococcus pneumoni...   201    8e-50 
ref|NP_346489.1|  threonine synthase [Streptococcus pneumoniae...   201    8e-50 
ref|ZP_05281873.1|  threonine synthase [Bacteroides fragilis 3...   201    8e-50 
ref|YP_002741333.1|  threonine synthase [Streptococcus pneumon...   201    8e-50 
ref|YP_003781466.1|  threonine synthase [Clostridium ljungdahl...   201    9e-50 
ref|ZP_05272183.1|  threonine synthase [Clostridium difficile ...   201    9e-50 
ref|YP_002737067.1|  threonine synthase [Streptococcus pneumon...   201    9e-50 
ref|ZP_03938132.1|  threonine synthase [Lactobacillus brevis s...   201    9e-50 
emb|CBK66155.1|  L-threonine synthase [Bacteroides xylanisolve...   201    9e-50 
ref|YP_001781271.1|  threonine synthase [Clostridium botulinum...   201    1e-49 
ref|ZP_07001333.1|  threonine synthase [Bacteroides sp. D22] >...   201    1e-49 
ref|ZP_06112292.1|  threonine synthase [Clostridium hathewayi ...   201    1e-49 
ref|YP_097893.1|  threonine synthase [Bacteroides fragilis YCH...   201    1e-49 
ref|ZP_05390230.1|  threonine synthase [Clostridium carboxidiv...   201    1e-49 
ref|ZP_01960029.1|  hypothetical protein BACCAC_01639 [Bactero...   201    1e-49 
ref|ZP_05427477.1|  threonine synthase [Eubacterium saphenum A...   201    1e-49 
ref|NP_268260.1|  threonine synthase [Lactococcus lactis subsp...   201    1e-49 
ref|YP_001836750.1|  threonine synthase [Streptococcus pneumon...   201    1e-49 
ref|YP_002743394.1|  threonine synthase [Streptococcus pneumon...   201    1e-49 
ref|ZP_06595846.1|  threonine synthase [Bifidobacterium breve ...   201    1e-49 
ref|ZP_06759208.1|  threonine synthase [Veillonella sp. 3_1_44...   201    2e-49 
ref|ZP_07318125.1|  threonine synthase [Veillonella atypica AC...   201    2e-49 
ref|ZP_05791171.2|  threonine synthase [Butyrivibrio crossotus...   201    2e-49 
ref|YP_004000386.1|  thrc [Bifidobacterium longum subsp. longu...   200    2e-49 
ref|YP_004220349.1|  threonine synthase [Bifidobacterium longu...   200    2e-49 
ref|ZP_04665235.1|  threonine synthase [Bifidobacterium longum...   200    2e-49 
ref|ZP_04548503.1|  threonine synthase [Bacteroides sp. 2_2_4]...   200    2e-49 
ref|XP_002709680.1|  PREDICTED: hypothetical protein [Oryctola...   200    2e-49 
ref|NP_696205.1|  threonine synthase [Bifidobacterium longum N...   200    2e-49 
ref|YP_210272.1|  threonine synthase [Bacteroides fragilis NCT...   200    2e-49 
ref|ZP_00206672.1|  COG0498: Threonine synthase [Bifidobacteri...   200    2e-49 
ref|ZP_04452570.1|  hypothetical protein GCWU000182_01876 [Abi...   200    2e-49 
ref|YP_892243.1|  threonine synthase [Campylobacter fetus subs...   200    2e-49 
ref|ZP_03976250.1|  possible threonine synthase [Bifidobacteri...   200    3e-49 
ref|ZP_04543785.1|  threonine synthase [Bacteroides sp. D1] >r...   200    3e-49 
ref|ZP_07316213.1|  threonine synthase [Veillonella atypica AC...   200    3e-49 
ref|ZP_02078546.1|  hypothetical protein EUBDOL_02375 [Eubacte...   199    3e-49 
ref|ZP_08091333.1|  hypothetical protein HMPREF9474_03084 [Clo...   199    3e-49 
ref|ZP_02066029.1|  hypothetical protein BACOVA_03023 [Bactero...   199    3e-49 
ref|ZP_08042339.1|  threonine synthase [Streptococcus equinus ...   199    3e-49 
ref|ZP_04841501.1|  threonine synthase [Bacteroides sp. 3_2_5]...   199    3e-49 
ref|ZP_03323912.1|  hypothetical protein BIFCAT_00684 [Bifidob...   199    3e-49 
ref|ZP_02963093.1|  threonine synthase [Bifidobacterium animal...   199    3e-49 
ref|ZP_08014893.1|  hypothetical protein HMPREF9464_00112 [Sut...   199    3e-49 
ref|ZP_02996166.1|  hypothetical protein CLOSPO_03289 [Clostri...   199    3e-49 
ref|YP_003997963.1|  l-threonine synthase [Leadbetterella byss...   199    4e-49 
ref|ZP_06616560.1|  threonine synthase [Bacteroides ovatus SD ...   199    4e-49 
ref|YP_003179561.1|  threonine synthase [Atopobium parvulum DS...   199    4e-49 
ref|ZP_05553594.1|  threonine synthase [Lactobacillus coleohom...   199    4e-49 
ref|NP_435501.1|  threonine synthase [Sinorhizobium meliloti 1...   199    4e-49 
ref|ZP_02621941.1|  threonine synthase [Clostridium botulinum ...   199    4e-49 
ref|ZP_05347882.1|  threonine synthase [Bryantella formatexige...   199    4e-49 
ref|ZP_07673237.1|  threonine synthase [Erysipelotrichaceae ba...   199    4e-49 
ref|ZP_02212410.1|  hypothetical protein CLOBAR_02027 [Clostri...   199    4e-49 
ref|ZP_06144971.1|  threonine synthase [Ruminococcus flavefaci...   199    4e-49 
ref|YP_001033630.1|  threonine synthase [Lactococcus lactis su...   199    4e-49 
ref|ZP_02619375.1|  threonine synthase [Clostridium botulinum ...   199    4e-49 
dbj|BAE88070.1|  unnamed protein product [Macaca fascicularis]      199    4e-49 
ref|ZP_06997537.1|  threonine synthase [Bacteroides sp. 1_1_14...   199    5e-49 
ref|ZP_02042558.1|  hypothetical protein RUMGNA_03360 [Ruminoc...   199    5e-49 
ref|ZP_04849598.1|  threonine synthase [Bacteroides sp. 1_1_6]...   199    5e-49 
ref|ZP_04659096.1|  threonine synthase [Selenomonas flueggei A...   199    5e-49 
ref|YP_001695414.1|  threonine synthase [Streptococcus pneumon...   199    5e-49 
ref|ZP_01889616.1|  threonine synthase [unidentified eubacteri...   199    5e-49 
ref|XP_515606.2|  PREDICTED: hypothetical protein [Pan troglod...   199    6e-49 
ref|NP_848500.3|  threonine synthase-like 2 [Mus musculus] >re...   199    6e-49 
ref|ZP_03782351.1|  hypothetical protein RUMHYD_01790 [Blautia...   199    6e-49 
ref|NP_811314.1|  threonine synthase [Bacteroides thetaiotaomi...   199    6e-49 
ref|ZP_06259960.1|  threonine synthase [Veillonella parvula AT...   199    6e-49 
gb|AAH25604.1|  Threonine synthase-like 2 (bacterial) [Mus mus...   199    6e-49 
ref|YP_001254140.1|  threonine synthase [Clostridium botulinum...   199    6e-49 
ref|YP_003584789.1|  threonine synthase [Zunongwangia profunda...   199    6e-49 
ref|ZP_05852397.1|  threonine synthase [Granulicatella elegans...   198    7e-49 
ref|YP_328781.1|  threonine synthase [Streptococcus agalactiae...   198    8e-49 
ref|ZP_07823200.1|  threonine synthase [Streptococcus pseudopo...   198    8e-49 
gb|AAH35315.1|  THNSL2 protein [Homo sapiens]                       198    8e-49 
ref|YP_003284116.1|  threonine synthase [Blattabacterium sp. (...   198    8e-49 
ref|ZP_07826596.1|  threonine synthase [Veillonella sp. oral t...   198    9e-49 
ref|ZP_06599156.1|  threonine synthase [Oribacterium sp. oral ...   198    1e-48 
ref|YP_843997.1|  threonine synthase [Methanosaeta thermophila...   198    1e-48 
dbj|BAG53023.1|  unnamed protein product [Homo sapiens]             198    1e-48 
ref|NP_060741.3|  threonine synthase-like 2 [Homo sapiens] >sp...   198    1e-48 
ref|ZP_03743185.1|  hypothetical protein BIFPSEUDO_03778 [Bifi...   198    1e-48 
ref|NP_734525.1|  threonine synthase [Streptococcus agalactiae...   197    1e-48 
ref|ZP_08129203.1|  threonine synthase [Clostridium sp. D5] >g...   197    1e-48 
ref|ZP_03734643.1|  threonine synthase [Dethiobacter alkaliphi...   197    1e-48 
ref|ZP_01968314.1|  hypothetical protein RUMTOR_01882 [Ruminoc...   197    1e-48 
ref|ZP_07960598.1|  threonine synthase [Lachnospiraceae bacter...   197    1e-48 
ref|ZP_00788582.1|  threonine synthase [Streptococcus agalacti...   197    1e-48 
ref|YP_518127.1|  threonine synthase [Desulfitobacterium hafni...   197    1e-48 
ref|YP_002575478.1|  threonine synthase [Campylobacter lari RM...   197    1e-48 
ref|ZP_03290985.1|  hypothetical protein CLONEX_03204 [Clostri...   197    1e-48 
ref|NP_001009658.1|  threonine synthase-like 2 [Rattus norvegi...   197    1e-48 
gb|EDL90982.1|  similar to Hypothetical protein MGC59076, isof...   197    1e-48 
ref|NP_687091.1|  threonine synthase [Streptococcus agalactiae...   197    1e-48 
gb|EFV96378.1|  threonine synthase [Streptococcus agalactiae A...   197    1e-48 
ref|ZP_05737755.1|  threonine synthase [Granulicatella adiacen...   197    1e-48 
ref|ZP_03461956.1|  hypothetical protein BACPEC_01014 [Bactero...   197    2e-48 
ref|ZP_07822662.1|  homoserine kinase [Peptoniphilus harei ACS...   197    2e-48 
ref|NP_001127159.1|  threonine synthase-like 2 [Pongo abelii] ...   197    2e-48 
ref|YP_001787042.1|  threonine synthase [Clostridium botulinum...   197    2e-48 
ref|ZP_03990443.1|  possible threonine synthase [Oribacterium ...   197    2e-48 
ref|ZP_02092330.1|  hypothetical protein FAEPRAM212_02623 [Fae...   197    2e-48 
ref|ZP_07321877.1|  homoserine kinase [Finegoldia magna BVS033...   197    2e-48 
ref|YP_003800754.1|  L-threonine synthase [Olsenella uli DSM 7...   197    2e-48 
emb|CBK94971.1|  threonine synthase [Eubacterium rectale M104/1]    197    2e-48 
ref|ZP_07904449.1|  threonine synthase [Eubacterium saburreum ...   197    2e-48 
emb|CBL03191.1|  L-threonine synthase [Faecalibacterium prausn...   197    2e-48 
emb|CBK90713.1|  threonine synthase [Eubacterium rectale DSM 1...   197    2e-48 
ref|YP_002937867.1|  threonine synthase [Eubacterium rectale A...   196    2e-48 
ref|ZP_03915796.1|  threonine synthase [Anaerococcus lactolyti...   196    3e-48 
ref|ZP_01049307.1|  Threonine synthase [Dokdonia donghaensis M...   196    3e-48 
ref|YP_877002.1|  threonine synthase [Clostridium novyi NT] >g...   196    3e-48 
ref|ZP_04449768.1|  hypothetical protein GCWU000282_01001 [Cat...   196    3e-48 
ref|ZP_05416880.1|  threonine synthase [Bacteroides finegoldii...   196    3e-48 
ref|ZP_06200828.1|  threonine synthase [Bacteroides sp. D20] >...   196    3e-48 
ref|XP_001505451.1|  PREDICTED: hypothetical protein [Ornithor...   196    4e-48 
ref|ZP_03756487.1|  hypothetical protein CLOSTASPAR_00471 [Clo...   196    4e-48 
ref|YP_003820723.1|  threonine synthase [Clostridium saccharol...   196    4e-48 
ref|ZP_06011005.1|  threonine synthase [Leptotrichia goodfello...   196    4e-48 
ref|YP_003873303.1|  threonine synthase [Spirochaeta thermophi...   196    4e-48 
ref|YP_003312242.1|  threonine synthase [Veillonella parvula D...   196    4e-48 
ref|ZP_07057971.1|  threonine synthase [Lactobacillus gasseri ...   196    5e-48 
ref|YP_814887.1|  threonine synthase [Lactobacillus gasseri AT...   196    5e-48 
ref|ZP_08015799.1|  hypothetical protein HMPREF9464_01018 [Sut...   196    5e-48 
ref|ZP_07268492.1|  threonine synthase [Finegoldia magna ACS-1...   196    5e-48 
ref|ZP_02029446.1|  hypothetical protein BIFADO_01904 [Bifidob...   196    5e-48 
ref|YP_002930806.1|  threonine synthase [Eubacterium eligens A...   196    5e-48 
ref|ZP_06554182.1|  hypothetical protein AWRIB429_1572 [Oenoco...   195    6e-48 
ref|ZP_04744634.1|  threonine synthase [Roseburia intestinalis...   195    6e-48 
emb|CBL09220.1|  threonine synthase [Roseburia intestinalis M5...   195    6e-48 
ref|ZP_06757355.1|  threonine synthase [Veillonella sp. 6_1_27...   195    6e-48 
ref|ZP_03168173.1|  hypothetical protein RUMLAC_01852 [Ruminoc...   195    6e-48 
ref|YP_003938848.1|  Threonine synthase [Bifidobacterium bifid...   195    6e-48 
ref|ZP_02235469.1|  hypothetical protein DORFOR_02355 [Dorea f...   195    7e-48 
ref|YP_003971231.1|  threonine synthase [Bifidobacterium bifid...   195    7e-48 
ref|YP_260911.1|  threonine synthase [Pseudomonas fluorescens ...   195    7e-48 
ref|ZP_04448207.1|  hypothetical protein BIFANG_03212 [Bifidob...   195    7e-48 
ref|ZP_01544736.1|  threonine synthase [Oenococcus oeni ATCC B...   195    7e-48 
ref|YP_002014964.1|  threonine synthase [Prosthecochloris aest...   195    8e-48 
ref|YP_128779.1|  threonine synthase [Photobacterium profundum...   195    8e-48 
ref|YP_001131142.1|  threonine synthase [Prosthecochloris vibr...   195    8e-48 
ref|ZP_02070949.1|  hypothetical protein BACUNI_02380 [Bactero...   195    9e-48 
ref|ZP_03799179.1|  hypothetical protein COPCOM_01436 [Coproco...   195    9e-48 
ref|ZP_07940467.1|  threonine synthase [Bacteroides sp. 4_1_36...   195    9e-48 
gb|EFU21143.1|  threonine synthase [Spirochaeta thermophila DS...   195    9e-48 
ref|ZP_07774763.1|  threonine synthase [Pseudomonas fluorescen...   194    1e-47 
ref|YP_909766.1|  threonine synthase [Bifidobacterium adolesce...   194    1e-47 
ref|ZP_03646553.1|  threonine synthase [Bifidobacterium bifidu...   194    1e-47 
ref|XP_001496840.2|  PREDICTED: similar to Threonine synthase-...   194    1e-47 
ref|ZP_02433859.1|  hypothetical protein BACSTE_00070 [Bactero...   194    1e-47 
ref|ZP_02036320.1|  hypothetical protein BACCAP_01922 [Bactero...   194    1e-47 
ref|YP_001691628.1|  threonine synthase [Finegoldia magna ATCC...   194    1e-47 
ref|ZP_04808236.1|  threonine synthase [Helicobacter pullorum ...   194    1e-47 
ref|ZP_07078427.1|  threonine synthase [Lactobacillus plantaru...   194    1e-47 
ref|YP_001995784.1|  threonine synthase [Chloroherpeton thalas...   194    1e-47 
ref|XP_002933192.1|  PREDICTED: threonine synthase-like 1-like...   194    1e-47 
ref|ZP_08077941.1|  threonine synthase [Succinatimonas hippei ...   194    2e-47 
ref|ZP_03296344.1|  hypothetical protein COLSTE_00228 [Collins...   194    2e-47 
ref|ZP_02866428.1|  hypothetical protein CLOSPI_00208 [Clostri...   194    2e-47 
ref|YP_004258423.1|  threonine synthase [Bacteroides salanitro...   194    2e-47 
gb|AAH64423.1|  Threonine synthase-like 2 (S. cerevisiae) [Hom...   194    2e-47 
ref|ZP_04010368.1|  threonine synthase [Lactobacillus ultunens...   194    2e-47 
ref|ZP_03209210.1|  hypothetical protein BACPLE_02875 [Bactero...   194    2e-47 
ref|ZP_03008684.1|  hypothetical protein BACCOP_00532 [Bactero...   194    2e-47 
gb|ADX23604.1|  threonine synthase [Streptococcus dysgalactiae...   194    2e-47 
ref|YP_811066.1|  threonine synthase [Oenococcus oeni PSU-1] >...   194    2e-47 
ref|NP_786138.1|  threonine synthase [Lactobacillus plantarum ...   193    2e-47 
ref|XP_532965.2|  PREDICTED: hypothetical protein XP_532965 [C...   193    2e-47 
ref|ZP_07934181.1|  threonine synthase [Bacteroides eggerthii ...   193    3e-47 
ref|YP_001299339.1|  threonine synthase [Bacteroides vulgatus ...   193    3e-47 
ref|ZP_06742205.1|  threonine synthase [Bacteroides vulgatus P...   193    3e-47 
ref|ZP_03457935.1|  hypothetical protein BACEGG_00705 [Bactero...   193    3e-47 
ref|ZP_02085217.1|  hypothetical protein CLOBOL_02750 [Clostri...   193    3e-47 
emb|CAG32314.1|  hypothetical protein RCJMB04_22o14 [Gallus ga...   193    3e-47 
ref|NP_001179773.1|  threonine synthase-like 2 [Bos taurus] >r...   193    3e-47 
emb|CBK80717.1|  threonine synthase [Coprococcus catus GD/7]        193    3e-47 
ref|XP_002717347.1|  PREDICTED: hypothetical protein [Oryctola...   193    3e-47 
ref|ZP_02948275.1|  threonine synthase [Clostridium butyricum ...   193    3e-47 
ref|ZP_04446787.1|  hypothetical protein COLINT_03540 [Collins...   193    3e-47 
ref|YP_002995811.1|  threonine synthase [Streptococcus dysgala...   193    3e-47 
ref|YP_004054949.1|  threonine synthase [Marivirga tractuosa D...   193    3e-47 
ref|YP_002156916.1|  threonine synthase [Vibrio fischeri MJ11]...   193    3e-47 
ref|XP_001234746.1|  PREDICTED: hypothetical protein [Gallus g...   193    3e-47 
ref|ZP_04821123.1|  threonine synthase [Clostridium botulinum ...   193    3e-47 
ref|YP_004160762.1|  L-threonine synthase [Bacteroides helcoge...   193    3e-47 
ref|YP_205499.1|  threonine synthase [Vibrio fischeri ES114] >...   193    3e-47 
ref|ZP_04538995.1|  threonine synthase [Bacteroides sp. 9_1_42...   193    3e-47 
ref|ZP_03302017.1|  hypothetical protein BACDOR_03411 [Bactero...   193    3e-47 
ref|ZP_06087388.1|  threonine synthase [Bacteroides sp. 3_1_33...   193    3e-47 
ref|ZP_03975565.1|  possible threonine synthase [Lactobacillus...   193    3e-47 
ref|YP_001922019.1|  threonine synthase [Clostridium botulinum...   192    4e-47 
ref|ZP_04554466.1|  threonine synthase [Bacteroides sp. D4] >g...   192    4e-47 
ref|YP_003171900.1|  threonine synthase [Lactobacillus rhamnos...   192    4e-47 
ref|YP_002019482.1|  threonine synthase [Pelodictyon phaeoclat...   192    4e-47 
ref|YP_003256912.1|  threonine synthase [Blattabacterium sp. (...   192    5e-47 
ref|ZP_03644915.1|  hypothetical protein BACCOPRO_03306 [Bacte...   192    5e-47 
ref|YP_001843960.1|  threonine synthase [Lactobacillus ferment...   192    5e-47 
ref|ZP_02428237.1|  hypothetical protein CLORAM_01630 [Clostri...   192    5e-47 
ref|ZP_03755415.1|  hypothetical protein ROSEINA2194_03854 [Ro...   192    5e-47 
ref|ZP_02862085.1|  hypothetical protein ANASTE_01298 [Anaerof...   192    5e-47 
ref|XP_001376199.1|  PREDICTED: hypothetical protein [Monodelp...   192    6e-47 
ref|YP_001406580.1|  threonine synthase [Campylobacter hominis...   192    6e-47 
gb|ADJ41351.1|  Threonine synthase [Lactobacillus fermentum CE...   192    6e-47 
ref|NP_782895.1|  threonine synthase [Clostridium tetani E88] ...   192    7e-47 
ref|XP_002922389.1|  PREDICTED: threonine synthase-like 2-like...   192    7e-47 
ref|ZP_05863915.1|  threonine synthase [Lactobacillus fermentu...   192    8e-47 
ref|YP_001988257.1|  threonine synthase [Lactobacillus casei B...   191    8e-47 
ref|ZP_05072694.1|  threonine synthase [Campylobacterales bact...   191    9e-47 
ref|ZP_05255783.1|  threonine synthase [Bacteroides sp. 4_3_47...   191    9e-47 
ref|ZP_03675750.1|  hypothetical protein BACCELL_00072 [Bacter...   191    9e-47 
ref|ZP_03944944.1|  possible threonine synthase [Lactobacillus...   191    9e-47 
ref|YP_565192.1|  L-threonine synthase [Methanococcoides burto...   191    1e-46 
ref|ZP_02027508.1|  hypothetical protein EUBVEN_02783 [Eubacte...   191    1e-46 
ref|YP_003094055.1|  threonine synthase [Pedobacter heparinus ...   191    1e-46 
ref|ZP_03210860.1|  threonine synthase [Lactobacillus rhamnosu...   191    1e-46 
ref|ZP_03017169.1|  hypothetical protein BACINT_04781 [Bactero...   191    1e-46 
ref|ZP_04671733.1|  conserved hypothetical protein [Clostridia...   191    1e-46 
ref|YP_001999503.1|  threonine synthase [Chlorobaculum parvum ...   191    1e-46 
ref|ZP_06052748.1|  threonine synthase [Grimontia hollisae CIP...   191    1e-46 
ref|YP_378459.1|  threonine synthase [Chlorobium chlorochromat...   191    1e-46 
ref|ZP_06290471.1|  threonine synthase [Peptoniphilus lacrimal...   191    1e-46 
ref|ZP_04441760.1|  possible threonine synthase [Lactobacillus...   191    2e-46 
ref|YP_004043866.1|  L-threonine synthase [Paludibacter propio...   191    2e-46 
emb|CBK89170.1|  threonine synthase [Eubacterium cylindroides ...   190    2e-46 
ref|ZP_01236399.1|  threonine synthase [Vibrio angustum S14] >...   190    2e-46 
ref|ZP_01690315.1|  threonine synthase [Microscilla marina ATC...   190    2e-46 
ref|ZP_03636243.1|  hypothetical protein HOLDEFILI_03553 [Hold...   190    2e-46 
ref|YP_003716241.1|  threonine synthase [Croceibacter atlantic...   190    2e-46 
ref|YP_001180015.1|  threonine synthase [Caldicellulosiruptor ...   190    2e-46 
emb|CBL25149.1|  L-threonine synthase [Ruminococcus torques L2...   190    2e-46 
ref|ZP_04673040.1|  L-threonine synthase [Lactobacillus paraca...   190    3e-46 
ref|ZP_01221162.1|  threonine synthase [Photobacterium profund...   190    3e-46 
ref|ZP_03963886.1|  threonine synthase [Lactobacillus paracase...   190    3e-46 
ref|NP_742823.1|  threonine synthase [Pseudomonas putida KT244...   189    3e-46 
ref|YP_001308429.1|  threonine synthase [Clostridium beijerinc...   189    3e-46 
ref|YP_807341.1|  threonine synthase [Lactobacillus casei ATCC...   189    3e-46 
ref|ZP_07095080.1|  threonine synthase [Peptoniphilus sp. oral...   189    3e-46 
ref|YP_001490954.1|  threonine synthase [Arcobacter butzleri R...   189    4e-46 

ALIGNMENTS
>ref|YP_002299803.1| threonine synthase [Rhodospirillum centenum SW]
 gb|ACJ00991.1| threonine synthase [Rhodospirillum centenum SW]
Length=471

 Score =  379 bits (973),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 181/314 (58%), Positives = 224/314 (72%), Gaps = 5/314 (1%)

Query  8    CLNGKSYIETAEMVMYPFVGSSIPQDDFREILKRVYGPENFCD-GIVPLHHLKGYENDKI  66
             L G+ Y E A  VM PF+G  I + DFR +L   YGP  F    + PL  L    + + 
Sbjct  45   ALRGRPYDEVAAAVMLPFLGGRIAEADFRRLLADTYGPSVFAHRAVTPLVQL----DQRT  100

Query  67   YVMEQFHGPTIAFKDVALQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEGCYKSNHI  126
            ++ME FHGPT+AFKDVALQLLG+LFD+VLA   + +T+VGATSGDTGSAAIE C     +
Sbjct  101  WLMELFHGPTLAFKDVALQLLGRLFDHVLAVRGERMTVVGATSGDTGSAAIEACRDRERV  160

Query  127  DIFILHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSA  186
            DI ILHP GR S VQRRQMTTVL+ NVHN+AL+GTFDDCQ+ VKAMF D  FR  ++LSA
Sbjct  161  DIVILHPHGRTSAVQRRQMTTVLSPNVHNVALQGTFDDCQDAVKAMFNDAAFRDGLHLSA  220

Query  187  VNSINWARIMAQIVYYVYCGLQLDAGTKSVSFVVPTGNFGNVFAAYCARQMGLPMEFLSI  246
            VNSINWARIMAQIVYYV   + L A  + V+F VPTGNFGNV+AAY AR MG+P+  L +
Sbjct  221  VNSINWARIMAQIVYYVAAAVALGAPDRPVAFAVPTGNFGNVYAAYAARAMGVPVAKLIV  280

Query  247  STNKNDILTRFFETGEMKITQAHPTLSPSMDIQISSNFERYLYFLLDKDSAKLAEMMKSF  306
             +N NDIL RFF +G M+     PT+SPSMDIQISSNFER L+ L+D+D A +A  M  F
Sbjct  281  GSNANDILARFFASGRMETRAVVPTISPSMDIQISSNFERLLFDLMDRDGAAVATSMAEF  340

Query  307  KETGSMMLDEGKMA  320
            + +G   + +G++A
Sbjct  341  RRSGRFAVSQGQLA  354


>ref|YP_003448135.1| threonine synthase [Azospirillum sp. B510]
 dbj|BAI71591.1| threonine synthase [Azospirillum sp. B510]
Length=473

 Score =  374 bits (960),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 181/313 (58%), Positives = 223/313 (72%), Gaps = 5/313 (1%)

Query  8    CLNGKSYIETAEMVMYPFVGSSIPQDDFREILKRVYGPENFCDGIVPLHHLKGYENDKIY  67
             L G  Y E A  VM PF+G SI +D+FR I++  Y   +    + PL  +    +   +
Sbjct  45   ALRGLPYSEIAVRVMLPFLGGSIAEDEFRAIVRDAYASFDHA-AVTPLVQV----DPTTW  99

Query  68   VMEQFHGPTIAFKDVALQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEGCYKSNHID  127
            V+E FHGPT+AFKDVALQLLG+LFD+VLA+  + +TIVGATSGDTGSAAIE C    ++D
Sbjct  100  VLELFHGPTLAFKDVALQLLGRLFDHVLAKRGQRVTIVGATSGDTGSAAIEACRDRQNVD  159

Query  128  IFILHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSAV  187
            IFILHPKGR SEVQRRQMT+VL+ NVHNIAL+GTFDDCQ++VKAMF D  FR  + LSAV
Sbjct  160  IFILHPKGRTSEVQRRQMTSVLSSNVHNIALDGTFDDCQDLVKAMFNDGAFRDRMGLSAV  219

Query  188  NSINWARIMAQIVYYVYCGLQLDAGTKSVSFVVPTGNFGNVFAAYCARQMGLPMEFLSIS  247
            NSINWARIMAQIVYY    + L A  + V+F VPTGNFGNV+AAY AR MGLP+E L + 
Sbjct  220  NSINWARIMAQIVYYFTAAVALGAPDRKVAFTVPTGNFGNVYAAYGARAMGLPVETLVVG  279

Query  248  TNKNDILTRFFETGEMKITQAHPTLSPSMDIQISSNFERYLYFLLDKDSAKLAEMMKSFK  307
            +N NDIL RFF +G M      PTLSPSMDIQISSNFER L+ LLD+D   +   +  F+
Sbjct  280  SNSNDILARFFASGSMVAAPVVPTLSPSMDIQISSNFERLLFDLLDRDGTAVTAALNRFR  339

Query  308  ETGSMMLDEGKMA  320
              G   + + ++A
Sbjct  340  AEGKFTVTDAQLA  352


>ref|YP_258235.1| threonine synthase [Pseudomonas fluorescens Pf-5]
 gb|AAY90391.1| threonine synthase [Pseudomonas fluorescens Pf-5]
Length=469

 Score =  356 bits (913),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 174/308 (57%), Positives = 218/308 (71%), Gaps = 5/308 (1%)

Query  11   GKSYIETAEMVMYPFVGSSIPQDDFREILKRVYGPENFCDGIVPLHHLKGYENDKIYVME  70
            G  Y E A  VM PFV  SIP  DF++IL+  YG  +  + I PL  L G E    +V+E
Sbjct  48   GLPYHELAFRVMRPFVTGSIPDADFKKILEETYGAFSH-NAIAPLRQLNGNE----WVLE  102

Query  71   QFHGPTIAFKDVALQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEGCYKSNHIDIFI  130
             FHGPT+AFKD ALQLLG+L DYVL +  + + I+GATSGDTGSAAIEGC + +++DIFI
Sbjct  103  LFHGPTLAFKDFALQLLGRLLDYVLEKRGERVVIIGATSGDTGSAAIEGCKRCDNVDIFI  162

Query  131  LHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSAVNSI  190
            LHP  R+SEVQRRQMTT+L  N+HNIA+EG FDDCQ MVKA FAD+ F +   L AVNSI
Sbjct  163  LHPHNRVSEVQRRQMTTILGENIHNIAIEGNFDDCQEMVKASFADQGFLKGTRLVAVNSI  222

Query  191  NWARIMAQIVYYVYCGLQLDAGTKSVSFVVPTGNFGNVFAAYCARQMGLPMEFLSISTNK  250
            NWARIMAQIVYY +  LQL    +S++F VPTGNFG++FA Y AR MGLP+  L ++TN+
Sbjct  223  NWARIMAQIVYYFHAALQLGGPARSIAFSVPTGNFGDIFAGYLARNMGLPISQLIVATNR  282

Query  251  NDILTRFFETGEMKITQAHPTLSPSMDIQISSNFERYLYFLLDKDSAKLAEMMKSFKETG  310
            NDIL RF    +      H TLSPSMDI +SSNFER L+ L  ++ A LA +M SFK+ G
Sbjct  283  NDILHRFMSGNQYVKETLHATLSPSMDIMVSSNFERLLFDLHGRNGAALAALMDSFKQGG  342

Query  311  SMMLDEGK  318
               +++ +
Sbjct  343  GFSVEQDR  350


>ref|YP_001171736.1| threonine synthase [Pseudomonas stutzeri A1501]
 gb|ABP78894.1| threonine synthase [Pseudomonas stutzeri A1501]
Length=469

 Score =  355 bits (911),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 174/309 (57%), Positives = 218/309 (71%), Gaps = 7/309 (2%)

Query  11   GKSYIETAEMVMYPFVGSSIPQDDFREILKRVYGPENFCDG-IVPLHHLKGYENDKIYVM  69
            G  Y E A  VM PFV  SIP  DF++IL+  YG   F  G I PL  L G E    +V+
Sbjct  48   GLPYHELAFRVMRPFVAGSIPDADFKKILEETYGV--FAHGAIAPLRQLNGNE----WVL  101

Query  70   EQFHGPTIAFKDVALQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEGCYKSNHIDIF  129
            E FHGPT+AFKD ALQLLG+L DYVLA+  + + I+GATSGDTGSAAIEGC +  ++DIF
Sbjct  102  ELFHGPTLAFKDFALQLLGRLLDYVLAKRGERVVIMGATSGDTGSAAIEGCRRCENVDIF  161

Query  130  ILHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSAVNS  189
            ILHP  R+SEVQRRQMTT+L  N+HNIA+EG FDDCQ MVKA FAD+ F +   L AVNS
Sbjct  162  ILHPHQRVSEVQRRQMTTILGDNIHNIAIEGNFDDCQEMVKASFADQGFLKGTRLVAVNS  221

Query  190  INWARIMAQIVYYVYCGLQLDAGTKSVSFVVPTGNFGNVFAAYCARQMGLPMEFLSISTN  249
            INWARIMAQIVYY +  LQL    +SV+F VPTGNFG++FA Y AR MGLP+  L ++TN
Sbjct  222  INWARIMAQIVYYFHAALQLGGPARSVAFSVPTGNFGDIFAGYLARNMGLPINQLIVATN  281

Query  250  KNDILTRFFETGEMKITQAHPTLSPSMDIQISSNFERYLYFLLDKDSAKLAEMMKSFKET  309
            +NDIL RF           HP+LSPSMDI +SSNFER L+ L  ++   +A+++  F+ +
Sbjct  282  RNDILHRFMSGNHYDKDTLHPSLSPSMDIMVSSNFERLLFDLHGRNGKAVADLLDGFRAS  341

Query  310  GSMMLDEGK  318
            G + ++E +
Sbjct  342  GRLSVEEDR  350


>ref|YP_609722.1| threonine synthase [Pseudomonas entomophila L48]
 emb|CAK16938.1| threonine synthase [Pseudomonas entomophila L48]
Length=469

 Score =  354 bits (909),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 176/309 (57%), Positives = 217/309 (71%), Gaps = 7/309 (2%)

Query  11   GKSYIETAEMVMYPFVGSSIPQDDFREILKRVYGPENFCDGIV-PLHHLKGYENDKIYVM  69
            G  Y E A  VM PFV  SI   DF++IL+  YG  NF    V PL  L G E    +VM
Sbjct  48   GLPYHELAFRVMRPFVDGSIADADFKKILEETYG--NFAHAAVAPLRQLNGNE----WVM  101

Query  70   EQFHGPTIAFKDVALQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEGCYKSNHIDIF  129
            E FHGPT+AFKD ALQLLG+L D+VL +  + + IVGATSGDTGSAAIEGC + +++DIF
Sbjct  102  ELFHGPTLAFKDFALQLLGRLLDHVLVKRGERVVIVGATSGDTGSAAIEGCRRCDNVDIF  161

Query  130  ILHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSAVNS  189
            ILHP  R+SEVQRRQMTT+L  N+HNIA+EG FDDCQ MVKA FAD+ F +   L AVNS
Sbjct  162  ILHPHQRVSEVQRRQMTTILGDNIHNIAIEGNFDDCQEMVKASFADQSFLKGTRLVAVNS  221

Query  190  INWARIMAQIVYYVYCGLQLDAGTKSVSFVVPTGNFGNVFAAYCARQMGLPMEFLSISTN  249
            INWARIMAQIVYY +  LQL    +SV+F VPTGNFG++FA Y AR MGLP+  L ++TN
Sbjct  222  INWARIMAQIVYYFHAALQLGGPARSVAFSVPTGNFGDIFAGYLARNMGLPISQLVVATN  281

Query  250  KNDILTRFFETGEMKITQAHPTLSPSMDIQISSNFERYLYFLLDKDSAKLAEMMKSFKET  309
            +NDIL RF    +      HPTLSPSMDI +SSNFER L+ L  ++ A +A +M +FK+ 
Sbjct  282  RNDILHRFMSGNQYVKDALHPTLSPSMDIMVSSNFERLLFDLHGRNGAAVAALMDTFKQG  341

Query  310  GSMMLDEGK  318
            G   ++  +
Sbjct  342  GGFSVEADR  350


>ref|YP_001188877.1| threonine synthase [Pseudomonas mendocina ymp]
 gb|ABP86145.1| threonine synthase [Pseudomonas mendocina ymp]
Length=469

 Score =  354 bits (909),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 175/309 (57%), Positives = 219/309 (71%), Gaps = 7/309 (2%)

Query  11   GKSYIETAEMVMYPFVGSSIPQDDFREILKRVYGPENFC-DGIVPLHHLKGYENDKIYVM  69
            G  Y E A  VM PFV  SI   DF++IL+  YG   F  + + PL  L G E    +V+
Sbjct  48   GLPYHELAFRVMRPFVAGSIADADFKKILEETYGV--FAHNAVAPLRQLNGNE----WVL  101

Query  70   EQFHGPTIAFKDVALQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEGCYKSNHIDIF  129
            E FHGPT+AFKD ALQLLG+L D+VLA+  + + I+GATSGDTGSAAIEGC   +++DIF
Sbjct  102  ELFHGPTLAFKDFALQLLGRLLDHVLAKRGERVVIMGATSGDTGSAAIEGCKACDNVDIF  161

Query  130  ILHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSAVNS  189
            I+HP  R+SEVQRRQMTT+L  N+HNIA+EG FDDCQ MVKA FAD+ F +   L AVNS
Sbjct  162  IMHPHNRVSEVQRRQMTTILGDNIHNIAIEGNFDDCQEMVKASFADQGFLKGTRLVAVNS  221

Query  190  INWARIMAQIVYYVYCGLQLDAGTKSVSFVVPTGNFGNVFAAYCARQMGLPMEFLSISTN  249
            INWARIMAQIVYY +  LQL A  +SV+F VPTGNFG++FA Y AR MGLP+  L ++TN
Sbjct  222  INWARIMAQIVYYFHAALQLGAPARSVAFSVPTGNFGDIFAGYLARNMGLPVSQLIVATN  281

Query  250  KNDILTRFFETGEMKITQAHPTLSPSMDIQISSNFERYLYFLLDKDSAKLAEMMKSFKET  309
            +NDIL RF    +      HPTLSPSMDI +SSNFER L+ L  ++ A +A +M SFK+ 
Sbjct  282  RNDILHRFMSGNQYVKETLHPTLSPSMDIMVSSNFERLLFDLHGRNGAAIASLMDSFKQG  341

Query  310  GSMMLDEGK  318
            G   ++E +
Sbjct  342  GGFSVEEDR  350


>ref|YP_234380.1| threonine synthase [Pseudomonas syringae pv. syringae B728a]
 ref|ZP_06496057.1| threonine synthase [Pseudomonas syringae pv. syringae FF5]
 gb|AAY36342.1| Threonine synthase [Pseudomonas syringae pv. syringae B728a]
Length=469

 Score =  353 bits (906),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 172/309 (56%), Positives = 218/309 (71%), Gaps = 7/309 (2%)

Query  11   GKSYIETAEMVMYPFVGSSIPQDDFREILKRVYGPENFC-DGIVPLHHLKGYENDKIYVM  69
            G  Y E A  VM PFV  SIP  DF++IL+  YG   F    + PL  L G E    +V+
Sbjct  48   GLPYHELAFRVMRPFVAGSIPDADFKKILEETYGV--FAHSAVAPLRQLHGNE----WVL  101

Query  70   EQFHGPTIAFKDVALQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEGCYKSNHIDIF  129
            E FHGPT+AFKD ALQLLG+L DY+LA+  + + I+GATSGDTGSAAIEGC + +++DIF
Sbjct  102  ELFHGPTLAFKDFALQLLGRLLDYILAKRGQRVVIIGATSGDTGSAAIEGCRRCDNVDIF  161

Query  130  ILHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSAVNS  189
            ILHP  R+S+VQRRQMTT+   N+HNIA+EG FDDCQ MVKA FAD+ F +   L AVNS
Sbjct  162  ILHPNNRVSDVQRRQMTTIFGDNIHNIAVEGNFDDCQEMVKASFADQSFLKGTPLVAVNS  221

Query  190  INWARIMAQIVYYVYCGLQLDAGTKSVSFVVPTGNFGNVFAAYCARQMGLPMEFLSISTN  249
            INWARIMAQIVYY +  LQL    +SVSF VPTGNFG++FA Y AR MGLP+  L ++TN
Sbjct  222  INWARIMAQIVYYFHASLQLGGPARSVSFSVPTGNFGDIFAGYLARNMGLPINQLIVATN  281

Query  250  KNDILTRFFETGEMKITQAHPTLSPSMDIQISSNFERYLYFLLDKDSAKLAEMMKSFKET  309
            +NDIL RF    +      H TLSPSMDI +SSNFER L+ +  ++ A +AE+M +F++ 
Sbjct  282  RNDILHRFMSGNQYVKETLHATLSPSMDIMVSSNFERLLFDMHGRNGAAIAELMSTFRQG  341

Query  310  GSMMLDEGK  318
            G   ++E +
Sbjct  342  GGFSVEEER  350


>ref|YP_746074.1| threonine synthase [Granulibacter bethesdensis CGDNIH1]
 gb|ABI63151.1| threonine synthase [Granulibacter bethesdensis CGDNIH1]
Length=482

 Score =  353 bits (906),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 171/306 (56%), Positives = 216/306 (71%), Gaps = 7/306 (2%)

Query  8    CLNGKSYIETAEMVMYPFVGSSIPQDDFREILKRVYGPENFC-DGIVPLHHLKGYENDKI  66
             + G  Y + A  ++ PFVG  IP +    + +  Y    F    IVPL  L    +  +
Sbjct  45   AMRGLPYPDLAARIIQPFVGDCIPAETLLTLCRDAYA--GFTHPAIVPLVQL----DHDV  98

Query  67   YVMEQFHGPTIAFKDVALQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEGCYKSNHI  126
            Y  E FHGPT+AFKD+A+QLLG+LFDYVL++  + ITIVGATSGDTGSAAIE     + +
Sbjct  99   YTQELFHGPTLAFKDMAMQLLGRLFDYVLSQSDRRITIVGATSGDTGSAAIEAVRGRDRV  158

Query  127  DIFILHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSA  186
            DI ILHP+GR S VQRRQMTT +A N+ N+A+ GTFDDCQ++VKAMFAD  FRQ ++LSA
Sbjct  159  DIVILHPEGRTSTVQRRQMTTAIAPNIGNVAVRGTFDDCQDLVKAMFADTPFRQEMSLSA  218

Query  187  VNSINWARIMAQIVYYVYCGLQLDAGTKSVSFVVPTGNFGNVFAAYCARQMGLPMEFLSI  246
            VNSINWARI AQI YYVY  LQL A  ++V+F VPTGNFGNV AAY A +MGLP+  L +
Sbjct  219  VNSINWARIAAQIPYYVYAALQLGAPDRAVAFSVPTGNFGNVLAAYAAHRMGLPVGKLVV  278

Query  247  STNKNDILTRFFETGEMKITQAHPTLSPSMDIQISSNFERYLYFLLDKDSAKLAEMMKSF  306
            ++N+NDIL RF    +M      P+LSPSMDIQ+SSNFER L+ LLD+D A  A  +++F
Sbjct  279  ASNRNDILYRFLSANDMSARPVEPSLSPSMDIQVSSNFERVLFELLDRDPAATAATIRAF  338

Query  307  KETGSM  312
            +ETG M
Sbjct  339  RETGRM  344


>ref|YP_422751.1| threonine synthase [Magnetospirillum magneticum AMB-1]
 dbj|BAE52192.1| Threonine synthase [Magnetospirillum magneticum AMB-1]
Length=467

 Score =  353 bits (906),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 176/311 (57%), Positives = 220/311 (71%), Gaps = 7/311 (2%)

Query  8    CLNGKSYIETAEMVMYPFVGSSIPQDDFREILKRVYGPENFCD-GIVPLHHLKGYENDKI  66
             + G SY E A  VM PFV   + + +   +    YG   F    + PL  L G+     
Sbjct  45   AMRGLSYAELAVRVMRPFVEGCLTEAELTRLCAESYGA--FAHPAVAPLKQL-GHNQ---  98

Query  67   YVMEQFHGPTIAFKDVALQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEGCYKSNHI  126
            +VME FHGPT+AFKD ALQL+G+LFD+VL ++ + +TIVGATSGDTGSAAIE C     +
Sbjct  99   WVMELFHGPTLAFKDYALQLVGRLFDHVLKKKGQKVTIVGATSGDTGSAAIEACRDRAAV  158

Query  127  DIFILHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSA  186
            DI ILHP GR+SEVQRRQMTTVL+ NV N+A++GTFDDCQ++VKA+F D  FR  +NLSA
Sbjct  159  DIVILHPHGRVSEVQRRQMTTVLSSNVRNVAVDGTFDDCQDLVKALFNDAAFRDEMNLSA  218

Query  187  VNSINWARIMAQIVYYVYCGLQLDAGTKSVSFVVPTGNFGNVFAAYCARQMGLPMEFLSI  246
            VNSINWAR+MAQIVYY   G+ L A    +SF VPTGNFGNVFA Y A+ MGLP+E L I
Sbjct  219  VNSINWARVMAQIVYYFAAGVALGAPDVPMSFSVPTGNFGNVFAGYAAKLMGLPVEKLII  278

Query  247  STNKNDILTRFFETGEMKITQAHPTLSPSMDIQISSNFERYLYFLLDKDSAKLAEMMKSF  306
             +N NDILTRFFE G MK     PTLSPSMDIQ+SSNFER ++  L  D A +A++M  F
Sbjct  279  GSNTNDILTRFFEGGVMKADGVVPTLSPSMDIQVSSNFERLMFLALGGDGAAVAKLMDDF  338

Query  307  KETGSMMLDEG  317
            ++ G+M++ +G
Sbjct  339  RKNGAMVMPQG  349


>ref|ZP_06458842.1| threonine synthase [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 ref|ZP_06477557.1| threonine synthase [Pseudomonas syringae pv. aesculi str. 2250]
Length=469

 Score =  353 bits (905),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 172/309 (56%), Positives = 218/309 (71%), Gaps = 7/309 (2%)

Query  11   GKSYIETAEMVMYPFVGSSIPQDDFREILKRVYGPENFC-DGIVPLHHLKGYENDKIYVM  69
            G  Y E A  VM PFV  SIP  DF++IL+  YG   F    + PL  L G E    +V+
Sbjct  48   GLPYHELAFRVMRPFVAGSIPDADFKKILEETYGV--FAHSAVAPLRQLNGNE----WVL  101

Query  70   EQFHGPTIAFKDVALQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEGCYKSNHIDIF  129
            E FHGPT+AFKD ALQLLG+L DYVLA+  + + I+GATSGDTGSAAIEGC + +++DIF
Sbjct  102  ELFHGPTLAFKDFALQLLGRLLDYVLAKRGERVVIIGATSGDTGSAAIEGCRRCDNVDIF  161

Query  130  ILHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSAVNS  189
            ILHP  R+S+VQRRQMTT+   N+HNIA+EG FDDCQ MVKA FAD+ F +   L AVNS
Sbjct  162  ILHPNNRVSDVQRRQMTTIFGDNIHNIAVEGNFDDCQEMVKASFADQGFLKGTRLVAVNS  221

Query  190  INWARIMAQIVYYVYCGLQLDAGTKSVSFVVPTGNFGNVFAAYCARQMGLPMEFLSISTN  249
            INWARIMAQIVYY +  LQL    +SVSF VPTGNFG++FA Y AR MGLP+  L ++TN
Sbjct  222  INWARIMAQIVYYFHASLQLGGPARSVSFSVPTGNFGDIFAGYLARNMGLPVNQLIVATN  281

Query  250  KNDILTRFFETGEMKITQAHPTLSPSMDIQISSNFERYLYFLLDKDSAKLAEMMKSFKET  309
            +NDIL RF    +      H TLSPSMDI +SSNFER L+ +  ++ + +AE+M +F++ 
Sbjct  282  RNDILHRFMSGNQYVKETLHATLSPSMDIMVSSNFERLLFDMHGRNGSAIAELMSTFRQG  341

Query  310  GSMMLDEGK  318
            G   ++E +
Sbjct  342  GGFSVEEER  350


>ref|YP_273619.2| threonine synthase [Pseudomonas syringae pv. phaseolicola 1448A]
 ref|ZP_07006314.1| Threonine synthase [Pseudomonas savastanoi pv. savastanoi NCPPB 
3335]
 gb|EFH98307.1| Threonine synthase [Pseudomonas savastanoi pv. savastanoi NCPPB 
3335]
 gb|EFW79260.1| threonine synthase [Pseudomonas syringae pv. glycinea str. B076]
 gb|EFW85547.1| threonine synthase [Pseudomonas syringae pv. glycinea str. race 
4]
Length=469

 Score =  353 bits (905),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 172/309 (56%), Positives = 218/309 (71%), Gaps = 7/309 (2%)

Query  11   GKSYIETAEMVMYPFVGSSIPQDDFREILKRVYGPENFC-DGIVPLHHLKGYENDKIYVM  69
            G  Y E A  VM PFV  SIP  DF++IL+  YG   F    + PL  L G E    +V+
Sbjct  48   GLPYHELAFRVMRPFVAGSIPDADFKKILEETYGV--FAHSAVAPLRQLNGNE----WVL  101

Query  70   EQFHGPTIAFKDVALQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEGCYKSNHIDIF  129
            E FHGPT+AFKD ALQLLG+L DYVLA+  + + I+GATSGDTGSAAIEGC + +++DIF
Sbjct  102  ELFHGPTLAFKDFALQLLGRLLDYVLAKRGERVVIIGATSGDTGSAAIEGCRRCDNVDIF  161

Query  130  ILHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSAVNS  189
            ILHP  R+S+VQRRQMTT+   N+HNIA+EG FDDCQ MVKA FAD+ F +   L AVNS
Sbjct  162  ILHPNNRVSDVQRRQMTTIFGDNIHNIAVEGNFDDCQEMVKASFADQGFLKGTRLVAVNS  221

Query  190  INWARIMAQIVYYVYCGLQLDAGTKSVSFVVPTGNFGNVFAAYCARQMGLPMEFLSISTN  249
            INWARIMAQIVYY +  LQL    +SVSF VPTGNFG++FA Y AR MGLP+  L ++TN
Sbjct  222  INWARIMAQIVYYFHASLQLGGPARSVSFSVPTGNFGDIFAGYLARNMGLPVNQLIVATN  281

Query  250  KNDILTRFFETGEMKITQAHPTLSPSMDIQISSNFERYLYFLLDKDSAKLAEMMKSFKET  309
            +NDIL RF    +      H TLSPSMDI +SSNFER L+ +  ++ + +AE+M +F++ 
Sbjct  282  RNDILHRFMSGNQYVKETLHATLSPSMDIMVSSNFERLLFDMHGRNGSAIAELMSTFRQG  341

Query  310  GSMMLDEGK  318
            G   ++E +
Sbjct  342  GGFSVEEER  350


>ref|NP_252424.1| threonine synthase [Pseudomonas aeruginosa PAO1]
 sp|P29363.3|THRC_PSEAE RecName: Full=Threonine synthase; Short=TS
 gb|AAG07122.1|AE004792_7 threonine synthase [Pseudomonas aeruginosa PAO1]
Length=469

 Score =  353 bits (905),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 172/309 (56%), Positives = 220/309 (72%), Gaps = 7/309 (2%)

Query  11   GKSYIETAEMVMYPFVGSSIPQDDFREILKRVYGPENFC-DGIVPLHHLKGYENDKIYVM  69
            G  Y E A  VM PFV  SI   DF++IL+  YG   F  D + PL  L G E    +V+
Sbjct  48   GLPYHELAFRVMRPFVAGSIADADFKKILEETYGV--FAHDAVAPLRQLNGNE----WVL  101

Query  70   EQFHGPTIAFKDVALQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEGCYKSNHIDIF  129
            E FHGPT+AFKD ALQLLG+L D+VLA+  + + I+GATSGDTGSAAIEGC + +++DIF
Sbjct  102  ELFHGPTLAFKDFALQLLGRLLDHVLAKRGERVVIMGATSGDTGSAAIEGCRRCDNVDIF  161

Query  130  ILHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSAVNS  189
            I+HP  R+SEVQRRQMTT+L  N+HNIA+EG FDDCQ MVKA FAD+ F +   L AVNS
Sbjct  162  IMHPHNRVSEVQRRQMTTILGDNIHNIAIEGNFDDCQEMVKASFADQGFLKGTRLVAVNS  221

Query  190  INWARIMAQIVYYVYCGLQLDAGTKSVSFVVPTGNFGNVFAAYCARQMGLPMEFLSISTN  249
            INWARIMAQIVYY +  LQL A  +SV+F VPTGNFG++FA Y AR MGLP+  L ++TN
Sbjct  222  INWARIMAQIVYYFHAALQLGAPHRSVAFSVPTGNFGDIFAGYLARNMGLPVSQLIVATN  281

Query  250  KNDILTRFFETGEMKITQAHPTLSPSMDIQISSNFERYLYFLLDKDSAKLAEMMKSFKET  309
            +NDIL RF           HP+LSPSMDI +SSNFER L+ L  ++   +AE++ +FK +
Sbjct  282  RNDILHRFMSGNRYDKDTLHPSLSPSMDIMVSSNFERLLFDLHGRNGKAVAELLDAFKAS  341

Query  310  GSMMLDEGK  318
            G + +++ +
Sbjct  342  GKLSVEDQR  350

-----------------------------------------------------------------------------------------------------

b)BLASTp versus Swissprot, NCBI default parameters apart from "Number of descriptions=1000"

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|P29363.3|THRC_PSEAE  RecName: Full=Threonine synthase; Shor...   353    1e-96
sp|P16120.1|THRC_YEAST  RecName: Full=Threonine synthase; Shor...   275    2e-73
sp|Q00063.1|THRC_ASHGO  RecName: Full=Threonine synthase; Shor...   268    3e-71
sp|P23669.2|THRC_CORGL  RecName: Full=Threonine synthase; Shor...   257    8e-68
sp|Q42598.1|THRC_SCHPO  RecName: Full=Threonine synthase; Shor...   252    2e-66
sp|P37145.1|THRC_METGL  RecName: Full=Threonine synthase; Shor...   244    5e-64
sp|Q5XH07.1|THNS2_XENLA  RecName: Full=Threonine synthase-like...   223    1e-57
sp|Q80W22.1|THNS2_MOUSE  RecName: Full=Threonine synthase-like...   199    3e-50
sp|Q86YJ6.3|THNS2_HUMAN  RecName: Full=Threonine synthase-like...   198    4e-50
sp|Q5M7T9.1|THNS2_RAT  RecName: Full=Threonine synthase-like 2...   197    6e-50
sp|Q5RFE6.1|THNS2_PONAB  RecName: Full=Threonine synthase-like...   197    9e-50
sp|Q9ZMX5.1|THRC_HELPJ  RecName: Full=Threonine synthase; Shor...   186    2e-46
sp|Q2YDP8.1|THNS2_DANRE  RecName: Full=Threonine synthase-like...   185    4e-46
sp|Q5R5P3.1|THNS1_PONAB  RecName: Full=Threonine synthase-like...   184    8e-46
sp|Q9BH05.1|THNS1_MACFA  RecName: Full=Threonine synthase-like...   184    9e-46
sp|Q8BH55.1|THNS1_MOUSE  RecName: Full=Threonine synthase-like...   183    1e-45
sp|Q8IYQ7.2|THNS1_HUMAN  RecName: Full=Threonine synthase-like...   183    2e-45
sp|O24924.1|THRC_HELPY  RecName: Full=Threonine synthase; Shor...   182    2e-45
sp|Q89AR5.1|THRC_BUCBP  RecName: Full=Threonine synthase; Shor...   176    1e-43
sp|Q8K9V1.1|THRC_BUCAP  RecName: Full=Threonine synthase; Shor...   176    2e-43
sp|P44503.1|THRC_HAEIN  RecName: Full=Threonine synthase; Shor...   175    4e-43
sp|P57289.1|THRC_BUCAI  RecName: Full=Threonine synthase; Shor...   175    4e-43
sp|P27735.1|THRC_SERMA  RecName: Full=Threonine synthase; Shor...   174    5e-43
sp|P00934.1|THRC_ECOLI  RecName: Full=Threonine synthase; Shor...   172    3e-42
sp|Q9MT28.1|THRC_SOLTU  RecName: Full=Threonine synthase, chlo...  51.6    7e-06
sp|P04990.1|THRC_BACSU  RecName: Full=Threonine synthase; Shor...  50.1    2e-05
sp|Q58860.1|THRC_METJA  RecName: Full=Threonine synthase; Shor...  48.9    4e-05
sp|Q8TQD4.1|THRC_METAC  RecName: Full=Threonine synthase; Shor...  48.5    6e-05
sp|Q9S7B5.1|THRC1_ARATH  RecName: Full=Threonine synthase 1, c...  48.5    6e-05
sp|Q9K7E3.1|THRC_BACHD  RecName: Full=Threonine synthase; Shor...  47.0    2e-04
sp|P09123.1|THRC_BACSL  RecName: Full=Threonine synthase; Shor...  46.6    2e-04
sp|Q9SSP5.1|THRC2_ARATH  RecName: Full=Threonine synthase 2, c...  45.8    4e-04
sp|P45837.1|THRC_MYCLE  RecName: Full=Threonine synthase; Shor...  45.1    6e-04
sp|P66903.1|THRC_MYCBO  RecName: Full=Threonine synthase >sp|P...  43.1    0.003
sp|A0R220.1|THRC_MYCS2  RecName: Full=Threonine synthase; Shor...  38.5    0.056
sp|Q833W9.1|LACC_ENTFA  RecName: Full=Tagatose-6-phosphate kin...  35.8    0.38 
sp|Q2KI62.1|PTCD3_BOVIN  RecName: Full=Pentatricopeptide repea...  34.7    0.91 
sp|Q28RK4.1|PYRE_JANSC  RecName: Full=Orotate phosphoribosyltr...  33.9    1.5  
sp|P71128.2|CYSM_CAMJE  RecName: Full=Cysteine synthase B; Sho...  33.1    2.7  
sp|Q8QV05.1|VP6_FDVS  RecName: Full=Uncharacterized protein VP6    32.7    2.9  
sp|Q7VG35.1|TATB_HELHP  RecName: Full=Sec-independent protein ...  32.7    3.2  
sp|C5BL79.1|GPDA_TERTT  RecName: Full=Glycerol-3-phosphate deh...  31.6    6.9  

ALIGNMENTS
>sp|P29363.3|THRC_PSEAE RecName: Full=Threonine synthase; Short=TS
Length=469

 Score =  353 bits (905),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 172/309 (56%), Positives = 220/309 (72%), Gaps = 7/309 (2%)

Query  11   GKSYIETAEMVMYPFVGSSIPQDDFREILKRVYGPENFC-DGIVPLHHLKGYENDKIYVM  69
            G  Y E A  VM PFV  SI   DF++IL+  YG   F  D + PL  L G E    +V+
Sbjct  48   GLPYHELAFRVMRPFVAGSIADADFKKILEETYGV--FAHDAVAPLRQLNGNE----WVL  101

Query  70   EQFHGPTIAFKDVALQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEGCYKSNHIDIF  129
            E FHGPT+AFKD ALQLLG+L D+VLA+  + + I+GATSGDTGSAAIEGC + +++DIF
Sbjct  102  ELFHGPTLAFKDFALQLLGRLLDHVLAKRGERVVIMGATSGDTGSAAIEGCRRCDNVDIF  161

Query  130  ILHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSAVNS  189
            I+HP  R+SEVQRRQMTT+L  N+HNIA+EG FDDCQ MVKA FAD+ F +   L AVNS
Sbjct  162  IMHPHNRVSEVQRRQMTTILGDNIHNIAIEGNFDDCQEMVKASFADQGFLKGTRLVAVNS  221

Query  190  INWARIMAQIVYYVYCGLQLDAGTKSVSFVVPTGNFGNVFAAYCARQMGLPMEFLSISTN  249
            INWARIMAQIVYY +  LQL A  +SV+F VPTGNFG++FA Y AR MGLP+  L ++TN
Sbjct  222  INWARIMAQIVYYFHAALQLGAPHRSVAFSVPTGNFGDIFAGYLARNMGLPVSQLIVATN  281

Query  250  KNDILTRFFETGEMKITQAHPTLSPSMDIQISSNFERYLYFLLDKDSAKLAEMMKSFKET  309
            +NDIL RF           HP+LSPSMDI +SSNFER L+ L  ++   +AE++ +FK +
Sbjct  282  RNDILHRFMSGNRYDKDTLHPSLSPSMDIMVSSNFERLLFDLHGRNGKAVAELLDAFKAS  341

Query  310  GSMMLDEGK  318
            G + +++ +
Sbjct  342  GKLSVEDQR  350


>sp|P16120.1|THRC_YEAST RecName: Full=Threonine synthase; Short=TS
Length=514

 Score =  275 bits (704),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 147/325 (46%), Positives = 207/325 (64%), Gaps = 22/325 (6%)

Query  13   SYIETAEMVMYPFVG-SSIPQDDFREILKRVYGPENFCDGIVPLHHLKGYENDKIYVMEQ  71
            S+ + A  +M  ++    IP  D ++++KR Y      D + PL      + + ++++E 
Sbjct  57   SFQDLAFAIMRLYIAQEEIPDADLKDLIKRSYSTFR-SDEVTPLVQNVTGDKENLHILEL  115

Query  72   FHGPTIAFKDVALQLLGQLFDYVLAR--------EHKNITIVGATSGDTGSAAIEGCYKS  123
            FHGPT AFKDVALQ +G LF+Y L R        E K IT+VGATSGDTGSAAI G    
Sbjct  116  FHGPTYAFKDVALQFVGNLFEYFLQRTNANLPEGEKKQITVVGATSGDTGSAAIYGLRGK  175

Query  124  NHIDIFILHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVN  183
              + +FIL+P GRIS +Q  QMTTV   NV  +++ GTFD+CQ++VKA+F D++F    N
Sbjct  176  KDVSVFILYPTGRISPIQEEQMTTVPDENVQTLSVTGTFDNCQDIVKAIFGDKEFNSKHN  235

Query  184  LSAVNSINWARIMAQIVYYVYCGLQLDAG--TKSVSFVVPTGNFGNVFAAYCARQMGLPM  241
            + AVNSINWARI+AQ+ YY Y   Q   G  +K V FVVP+GNFG++ A Y A++MGLP+
Sbjct  236  VGAVNSINWARILAQMTYYFYSFFQATNGKDSKKVKFVVPSGNFGDILAGYFAKKMGLPI  295

Query  242  EFLSISTNKNDILTRFFETGEMKIT-QAHPTLSPSMDIQISSNFERYLY-----FLLDKD  295
            E L+I+TN+NDIL RF ++G  + + +   TLSP+MDI ISSNFER L+     +L + D
Sbjct  296  EKLAIATNENDILDRFLKSGLYERSDKVAATLSPAMDILISSNFERLLWYLAREYLANGD  355

Query  296  SAKLAEMMKSF----KETGSMMLDE  316
              K  E++ ++    K  G   +D+
Sbjct  356  DLKAGEIVNNWFQELKTNGKFQVDK  380


>sp|Q00063.1|THRC_ASHGO RecName: Full=Threonine synthase; Short=TS
Length=512

 Score =  268 bits (685),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 133/283 (47%), Positives = 190/283 (68%), Gaps = 11/283 (3%)

Query  19   EMVMYPFVGSSIPQDDFREILKRVYGPENFCDGIVPLHHLKGYENDKIYVMEQFHGPTIA  78
            E++ +      IP  + RE+++R Y      + + PL      +++ ++++E FHGPT A
Sbjct  61   EIMKFYIADWEIPAPELRELIERSYSSFR-SEEVTPLRKNVTGDDENLHILELFHGPTYA  119

Query  79   FKDVALQLLGQLFDYVLAREHKNI--------TIVGATSGDTGSAAIEGCYKSNHIDIFI  130
            FKDVALQ +G LF+Y L R+++++        T+VGATSGDTGSAAI G      + +FI
Sbjct  120  FKDVALQFVGNLFEYFLERKNRDVSEEERTHLTVVGATSGDTGSAAIYGLRGKQDVSVFI  179

Query  131  LHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSAVNSI  190
            L+P GRIS +Q  QMTTV   NVH +A+EG+FD+CQ++VK++F DE+F +  N++AVNSI
Sbjct  180  LYPHGRISPIQEEQMTTVEDENVHTMAIEGSFDNCQDIVKSIFVDEEFNRKHNIAAVNSI  239

Query  191  NWARIMAQIVYYVYCGLQ-LDAGTKSVSFVVPTGNFGNVFAAYCARQMGLPMEFLSISTN  249
            NWARI+AQI YY Y   +  D     V F+VP+GNFG++ A + A+QMGLP+E L I+TN
Sbjct  240  NWARILAQITYYFYSYFRATDGQPGRVKFIVPSGNFGDILAGFYAKQMGLPIEKLVIATN  299

Query  250  KNDILTRFFETGEMKITQ-AHPTLSPSMDIQISSNFERYLYFL  291
            +NDIL RF   G  + ++    T SP+MDI +SSNFER L+F 
Sbjct  300  ENDILDRFLREGVYERSEDVTATHSPAMDILVSSNFERLLWFF  342


>sp|P23669.2|THRC_CORGL RecName: Full=Threonine synthase; Short=TS
Length=481

 Score =  257 bits (656),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 137/312 (44%), Positives = 199/312 (64%), Gaps = 10/312 (3%)

Query  8    CLNGKSYIETAEMVMYPFVGSSIPQDDFREILKRVYG-PENFCDGIVPLHHLKGYENDKI  66
             L  + Y   A  V+  FV   IP +D + I  R Y  P+   + IVP+  L+    D I
Sbjct  50   VLANEGYAALAAEVISLFV-DDIPVEDIKAITARAYTYPKFNSEDIVPVTELE----DNI  104

Query  67   YVMEQFHGPTIAFKDVALQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEGCYKSNHI  126
            Y+     GPT AFKD+A+QLLG+LF+Y L R ++ I I+GATSGDTGS+A         I
Sbjct  105  YLGHLSEGPTAAFKDMAMQLLGELFEYELRRRNETINILGATSGDTGSSAEYAMRGREGI  164

Query  127  DIFILHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSA  186
             +F+L P GR++  Q+ QM  +   N+ NIAL+G FDDCQ++VKA+ AD +F++   + A
Sbjct  165  RVFMLTPAGRMTPFQQAQMFGLDDPNIFNIALDGVFDDCQDVVKAVSADAEFKKDNRIGA  224

Query  187  VNSINWARIMAQIVYYVYCGLQ-LDAGTKSVSFVVPTGNFGNVFAAYCARQMGLPMEFLS  245
            VNSINWAR+MAQ+VYYV   ++   +  + VSF VPTGNFG++ A + ARQMGLP++ L 
Sbjct  225  VNSINWARLMAQVVYYVSSWIRTTTSNDQKVSFSVPTGNFGDICAGHIARQMGLPIDRLI  284

Query  246  ISTNKNDILTRFFETGEMKITQA---HPTLSPSMDIQISSNFERYLYFLLDKDSAKLAEM  302
            ++TN+ND+L  FF TG+ ++  +   H T SPSMDI  +SNFER+++ LL +D+ ++ ++
Sbjct  285  VATNENDVLDEFFRTGDYRVRSSADTHETSSPSMDISRASNFERFIFDLLGRDATRVNDL  344

Query  303  MKSFKETGSMML  314
              +    G   L
Sbjct  345  FGTQVRQGGFSL  356


>sp|Q42598.1|THRC_SCHPO RecName: Full=Threonine synthase; Short=TS
Length=514

 Score =  252 bits (643),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 153/339 (46%), Positives = 203/339 (60%), Gaps = 45/339 (13%)

Query  12   KSYIETAEMVMYPFVG-SSIPQDDFREILKRVYG----PENFCDGIVPLHHLKGYENDKI  66
            KS+ E A  VM  ++  S I  D+ ++++ R Y     PE       PL  LK   N   
Sbjct  53   KSFPEIAFEVMSLYIPRSEISADELKKLVDRSYSTFRHPET-----TPLKSLKNGLN---  104

Query  67   YVMEQFHGPTIAFKDVALQLLGQLFDYVLAREHKN--------ITIVGATSGDTGSAAIE  118
             V+E FHGPT AFKDVALQ LG LF++ L R++ N        +T+VGATSGDTGSAAI 
Sbjct  105  -VLELFHGPTFAFKDVALQFLGNLFEFFLTRKNGNKPEDERDHLTVVGATSGDTGSAAIY  163

Query  119  GCYKSNHIDIFILHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDF  178
            G      + +FIL P GR+S +Q  QMTTV   NVH I + G FDDCQ++VK +F D +F
Sbjct  164  GLRGKKDVSVFILFPNGRVSPIQEAQMTTVTDPNVHCITVNGVFDDCQDLVKQIFGDVEF  223

Query  179  RQSVNLSAVNSINWARIMAQIVYYVYCGLQLDAGTKS--VSFVVPTGNFGNVFAAYCARQ  236
             +  ++ AVNSINWARI++QI YY+Y  L +    K+  V F+VPTGNFG++ A Y A++
Sbjct  224  NKKHHIGAVNSINWARILSQITYYLYSYLSVYKQGKADDVRFIVPTGNFGDILAGYYAKR  283

Query  237  MGLPMEFLSISTNKNDILTRFFETGEMK---ITQAHP--------TLSPSMDIQISSNFE  285
            MGLP + L I+TN+NDIL RFF+TG  +    TQ  P        T SP+MDI +SSNFE
Sbjct  284  MGLPTKQLVIATNENDILNRFFKTGRYEKADSTQVSPSGPISAKETYSPAMDILVSSNFE  343

Query  286  RYLYFLLDKDSAK----------LAEMMKSFKETGSMML  314
            RYL++L     A           L+  M  FK  G++ +
Sbjct  344  RYLWYLALATEAPNHTPAEASEILSRWMNEFKRDGTVTV  382


>sp|P37145.1|THRC_METGL RecName: Full=Threonine synthase; Short=TS
Length=475

 Score =  244 bits (623),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 133/323 (42%), Positives = 196/323 (61%), Gaps = 19/323 (5%)

Query  8    CLNGKSYIETAEMVMYPFVGSSIPQDDFREILKRVYG--------PENFCDGIVPLHHLK  59
             + G +Y + A  ++   +   IP DD R I+ + Y         P    + I P + L+
Sbjct  45   AMRGMNYRDLAFTILSRLI-DDIPADDLRIIVDKTYRADVYAYARPGQDAEDITPTYKLE  103

Query  60   GYENDKIYVMEQFHGPTIAFKDVALQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEG  119
                D +Y++   +GPT+AFKD+A+QLLG LF+YVLA++ +   I+GATSGDTGSAA   
Sbjct  104  ----DDLYLLSLSNGPTLAFKDMAMQLLGNLFEYVLAQKGETTNILGATSGDTGSAAEYA  159

Query  120  CYKSNHIDIFILHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFR  179
                  + +F+L P  ++S  Q  QM ++   N+ NIA++G FDDCQ++VKA+  D  F+
Sbjct  160  MRGKQGVKVFMLSPHQKMSRFQTAQMFSLQDDNIFNIAVKGVFDDCQDIVKAVSNDHAFK  219

Query  180  QSVNLSAVNSINWARIMAQIVYYV--YCGLQLDAGTKSVSFVVPTGNFGNVFAAYCARQM  237
                + AVNSINWAR+ AQ+VYY   Y  +  D   + VSF VP+GNFGNV A + AR M
Sbjct  220  AKNKIGAVNSINWARVAAQVVYYFKGYFAVTAD-NAQQVSFAVPSGNFGNVCAGHIARMM  278

Query  238  GLPMEFLSISTNKNDILTRFFETGEMK---ITQAHPTLSPSMDIQISSNFERYLYFLLDK  294
            GLP+  L ++TN+ND+L  FF+TG  +       + T SPSMDI  +SNFER+++ L+ +
Sbjct  279  GLPIAKLVVATNENDVLDEFFKTGVYRPRGSANTYHTSSPSMDISKASNFERFVFDLVGR  338

Query  295  DSAKLAEMMKSFKETGSMMLDEG  317
            D+AK+ E+       GS  L++G
Sbjct  339  DAAKVRELWGKVDAGGSFDLNDG  361


>sp|Q5XH07.1|THNS2_XENLA RecName: Full=Threonine synthase-like 2; Short=TSH2
Length=472

 Score =  223 bits (568),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 122/307 (40%), Positives = 185/307 (61%), Gaps = 9/307 (2%)

Query  13   SYIETAEMVMYPFVG-SSIPQDDFREILKRVYGPENFCDGIVPLHHLKGYENDKIYVMEQ  71
            SYI+  + +   F+   SIP+ D   ++ R +      D IVP+  LK   N    VME 
Sbjct  50   SYIQLVKEICSLFISPESIPRADLEGLIDRAFIRFRHRD-IVPITRLKSGLN----VMEM  104

Query  72   FHGPTIAFKDVALQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEGCYKSNHIDIFIL  131
            +HG T AFKD+A+  +G+L DY L R++K++TI+ ATSGDTGS+AIE   +  ++DI +L
Sbjct  105  WHGVTHAFKDLAMSCVGELLDYFLKRKNKHVTILVATSGDTGSSAIESVRRRENMDIIVL  164

Query  132  HPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSAVNSIN  191
             P GR +++Q  QMTTV+  NVH  +++GT D+    +K +FAD DF +  N+ + NS+N
Sbjct  165  LPHGRCTKIQELQMTTVIEDNVHVFSVDGTSDELDYPIKRLFADSDFVKKHNIMSTNSVN  224

Query  192  WARIMAQIVYYVYCGLQLDAGTK--SVSFVVPTGNFGNVFAAYCARQMGLPMEFLSISTN  249
            WARI+ QI ++ Y  +Q    T+   V  +VPTG  GN+ A   A+ MGLP+  +++  N
Sbjct  225  WARILVQIAHFFYGYMQCAPLTELTPVEIIVPTGGAGNITAGCIAQAMGLPIHLVAV-VN  283

Query  250  KNDILTRFFETGEMKITQAHPTLSPSMDIQISSNFERYLYFLLDKDSAKLAEMMKSFKET  309
            +NDI+ R  + G+  +     TL+ +MDIQ   N ER L+ L   + + + EMMK F+E 
Sbjct  284  RNDIVHRTVQYGDFSLGDTKATLASAMDIQEPYNMERILWLLAGSEKSHIKEMMKEFQEK  343

Query  310  GSMMLDE  316
              + L E
Sbjct  344  KRVKLPE  350


>sp|Q80W22.1|THNS2_MOUSE RecName: Full=Threonine synthase-like 2; Short=TSH2; Short=mTSH2
Length=483

 Score =  199 bits (505),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 116/297 (40%), Positives = 170/297 (58%), Gaps = 13/297 (4%)

Query  25   FVGSS-IPQDDFREILKRVYGPENFCDGIVPLHHLKGYENDKIYVMEQFHGPTIAFKDVA  83
            F+G   IP+ D  +++ R +        +V L  LK   N    ++E +HG T AFKD++
Sbjct  62   FIGLELIPRHDLNDLIDRAFSRFRH-RNVVHLCKLKNGLN----ILELWHGVTYAFKDLS  116

Query  84   LQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEGCYKSNHIDIFILHPKGRISEVQRR  143
            L    Q   Y L ++ K++TIV  TSGDTGSAAIE    S ++DI +L PKG  S++Q  
Sbjct  117  LSCTAQFLQYFLEKKKKHVTIVVGTSGDTGSAAIESVQGSKNVDIIVLLPKGHCSKIQEL  176

Query  144  QMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSAVNSINWARIMAQIVY--  201
            QMTTVL  NVH   +EG  D+    +KA+FAD  F Q  N+ ++NSINW+R++ Q+ +  
Sbjct  177  QMTTVLKENVHVFEVEGNSDELDEPIKAVFADVAFVQRHNVMSLNSINWSRVLVQMAHHF  236

Query  202  --YVYCGLQLDAGT-KSVSFVVPTGNFGNVFAAYCARQMGLPMEFLSISTNKNDILTRFF  258
              Y  C   LD     +V  VVPTG  GN+ A   A++MGLP+  L ++ N+NDI+ R  
Sbjct  237  FAYFQCTPSLDTHPLPTVEVVVPTGAGGNLAAGCIAQKMGLPI-CLVVAVNRNDIIHRTV  295

Query  259  ETGEMKITQA-HPTLSPSMDIQISSNFERYLYFLLDKDSAKLAEMMKSFKETGSMML  314
            + G+  + +    TL+ +MDIQ+  N ER  + L   DS     +M+ F+ T S+ L
Sbjct  296  QKGDFSLCEVLRTTLASAMDIQVPYNMERIFWLLSGSDSQTTRALMEQFERTQSLQL  352


>sp|Q86YJ6.3|THNS2_HUMAN RecName: Full=Threonine synthase-like 2; Short=TSH2
Length=484

 Score =  198 bits (503),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 112/297 (38%), Positives = 172/297 (58%), Gaps = 13/297 (4%)

Query  25   FVGSSI-PQDDFREILKRVYGPENFCDGIVPLHHLKGYENDKIYVMEQFHGPTIAFKDVA  83
            F+GS + P+D+  +++ R +      + +    HL    N  + V+E +HG T AFKD++
Sbjct  62   FIGSELLPKDELNDLIDRAFSRFRHREVV----HLSRLRNG-LNVLELWHGVTYAFKDLS  116

Query  84   LQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEGCYKSNHIDIFILHPKGRISEVQRR  143
            L    Q   Y L +  K++T+V  TSGDTGSAAIE    + ++DI +L PKG  +++Q  
Sbjct  117  LSCTTQFLQYFLEKREKHVTVVVGTSGDTGSAAIESVQGAKNMDIIVLLPKGHCTKIQEL  176

Query  144  QMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSAVNSINWARIMAQIVY--  201
            QMTTVL  NVH   +EG  D+    +K +FAD  F +  NL ++NSINW+R++ Q+ +  
Sbjct  177  QMTTVLKQNVHVFGVEGNSDELDEPIKTVFADVAFVKKHNLMSLNSINWSRVLVQMAHHF  236

Query  202  --YVYCGLQLDAGTKS-VSFVVPTGNFGNVFAAYCARQMGLPMEFLSISTNKNDILTRFF  258
              Y  C   LD      V  VVPTG  GN+ A Y A+++GLP+  L ++ N+NDI+ R  
Sbjct  237  FAYFQCTPSLDTHPLPLVEVVVPTGAAGNLAAGYIAQKIGLPIR-LVVAVNRNDIIHRTV  295

Query  259  ETGEMKITQA-HPTLSPSMDIQISSNFERYLYFLLDKDSAKLAEMMKSFKETGSMML  314
            + G+  +++A   TL+ +MDIQ+  N ER  + L   DS     +M+ F+ T S+ L
Sbjct  296  QQGDFSLSEAVKSTLASAMDIQVPYNMERVFWLLSGSDSQVTRALMEQFERTQSVNL  352


>sp|Q5M7T9.1|THNS2_RAT RecName: Full=Threonine synthase-like 2; Short=TSH2
Length=485

 Score =  197 bits (502),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 117/297 (40%), Positives = 170/297 (58%), Gaps = 13/297 (4%)

Query  25   FVGSS-IPQDDFREILKRVYGPENFCDGIVPLHHLKGYENDKIYVMEQFHGPTIAFKDVA  83
            FVG   IP+ D   ++ + +      D +V L  LK   N    ++E +HG T AFKD++
Sbjct  62   FVGLELIPRHDLNGLIDQAFSRFRHRD-VVHLCKLKNGLN----ILELWHGVTYAFKDLS  116

Query  84   LQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEGCYKSNHIDIFILHPKGRISEVQRR  143
            L    Q   Y L ++ K++TIV  TSGDTGSAAIE    S ++DI +L PKG  S++Q  
Sbjct  117  LSCTAQFLQYFLEKKKKHVTIVVGTSGDTGSAAIESVQGSKNVDIIVLLPKGHCSKIQEL  176

Query  144  QMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSAVNSINWARIMAQIVY--  201
            QMTTV+  NVH   +EG  D+    +KA+FAD  F Q  NL ++NSINW+R++ Q+ +  
Sbjct  177  QMTTVVKENVHVFGVEGNSDELDEPIKAVFADVAFVQRHNLMSLNSINWSRVLVQMAHHF  236

Query  202  --YVYCGLQLDAG-TKSVSFVVPTGNFGNVFAAYCARQMGLPMEFLSISTNKNDILTRFF  258
              Y  C   LD     +V  VVPTG  GN+ A   A++MGLP+  L ++ N+NDI+ R  
Sbjct  237  FAYFQCTPSLDMHLLPTVEVVVPTGAGGNLAAGCIAQKMGLPIS-LVVAVNRNDIIHRTV  295

Query  259  ETGEMKITQ-AHPTLSPSMDIQISSNFERYLYFLLDKDSAKLAEMMKSFKETGSMML  314
            + G+  + +    TL+ +MDIQ+  N ER  + L   DS     +M+ F+ T S+ L
Sbjct  296  QKGDFSLCEVVRKTLASAMDIQVPYNMERIFWLLAGSDSQTTRALMEQFERTQSLHL  352


>sp|Q5RFE6.1|THNS2_PONAB RecName: Full=Threonine synthase-like 2; Short=TSH2
Length=484

 Score =  197 bits (500),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 113/297 (39%), Positives = 171/297 (58%), Gaps = 13/297 (4%)

Query  25   FVGSS-IPQDDFREILKRVYGPENFCDGIVPLHHLKGYENDKIYVMEQFHGPTIAFKDVA  83
            F+GS  IP+D+  +++ R +      + +    HL    N  + V+E +HG T AFKD++
Sbjct  62   FIGSELIPKDELNDLIDRAFSRFRHREVV----HLSRLRNG-LNVLELWHGVTYAFKDLS  116

Query  84   LQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEGCYKSNHIDIFILHPKGRISEVQRR  143
            L    Q   Y L +  K++T+V  TSGDTGSAAIE    + ++DI +L PKG  +++Q  
Sbjct  117  LSCTAQFLQYFLEKREKHVTVVVGTSGDTGSAAIESVQGAKNMDIIVLLPKGHCTKIQEL  176

Query  144  QMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQSVNLSAVNSINWARIMAQIVY--  201
            QMTTVL  NVH   +EG  D+    +K +FAD  F +  NL ++NSINW+R++ Q+ +  
Sbjct  177  QMTTVLKENVHVFGVEGNSDELDEPIKTVFADVAFVKKHNLMSLNSINWSRVLVQMAHHF  236

Query  202  --YVYCGLQLDAGTKS-VSFVVPTGNFGNVFAAYCARQMGLPMEFLSISTNKNDILTRFF  258
              Y  C   LD      V  VVPTG  GN+ A Y A+++GLP+  L ++ N NDI+ R  
Sbjct  237  FAYFQCMPSLDTHPLPLVEVVVPTGAAGNLAAGYIAQKIGLPVR-LVVAVNGNDIIHRTV  295

Query  259  ETGEMKITQA-HPTLSPSMDIQISSNFERYLYFLLDKDSAKLAEMMKSFKETGSMML  314
            + G+  +++A   TL+ +MDIQ+  N ER  + L   DS     +M+ F+ T S+ L
Sbjct  296  QQGDFSLSEAVKSTLASAMDIQVPYNMERVFWLLSGSDSQVTRALMEQFERTQSVNL  352


>sp|Q9ZMX5.1|THRC_HELPJ RecName: Full=Threonine synthase; Short=TS
Length=486

 Score =  186 bits (472),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 116/327 (36%), Positives = 181/327 (56%), Gaps = 25/327 (7%)

Query  8    CLNGKSYIETAEMVMYPFVGSSIPQDDFREILKRVYGPENFCD--GIVPLHHLKGYENDK  65
            CL G SY E  E V +  +   IP++     LKR    ENF +     P+  L    N++
Sbjct  44   CL-GMSYSELVEHV-FELLNLEIPKNLLASALKRY---ENFDNPKNPAPIFAL----NER  94

Query  66   IYVMEQFHGPTIAFKDVALQLLGQLFDYVLAREHKNITIVGATSGDTGSAAIEGCYKSNH  125
            ++V E +HGP++AFKD+ALQ L  LF  +   +++   ++ +TSGDTG A +EG     +
Sbjct  95   LFVQELYHGPSLAFKDMALQPLASLFSNLAVGKNEKYLVLVSTSGDTGPATLEGLAGMPN  154

Query  126  IDIFILHPKGRISEVQRRQMTTVLAGNVHNIALEGTFDDCQNMVKAMFADEDFRQS----  181
            + +  L+PK   S VQ+ QM T  A N+    + G FDD QN +K +  D+DF ++    
Sbjct  155  VFVVCLYPKDGTSLVQKLQMVTQNASNLKVFGVSGDFDDAQNALKNLLKDDDFNEALKAR  214

Query  182  -VNLSAVNSINWARIMAQIVYYVYCGLQLDA-----GTKSVSFVVPTGNFGNVFAAYCAR  235
             + LS  NS+N+ RI  QIVY+++  L+L         + ++  +P+GNFGN   A+ A+
Sbjct  215  QLKLSVANSVNFGRIAFQIVYHIWGFLELYKKGAINSKEKITLAIPSGNFGNALGAFYAK  274

Query  236  QMGLPMEFLSISTNKNDILTRFFETGEMKITQA--HPTLSPSMDIQISSNFERYLYFLLD  293
            +MGL +  + + TN ND+L  F ETG   +T+     T SP+MDI  SSN ER L+ L  
Sbjct  275  KMGLNIAKIKVVTNSNDVLREFIETGRYDLTKRSLKQTFSPAMDILKSSNVERALFSLFG  334

Query  294  KDSAKLAEMMKSFKETGSMMLDEGKMA  320
             +  +  E+M++ +E     L   ++A
Sbjct  335  FE--RTLELMQALEEEKFYALKPKELA  359