GOS 2162030

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091119955965
Annotathon code: GOS_2162030
Sample :
  • GPS :6°29'34n; 82°54'14w
  • Eastern Tropical Pacific: 250 miles from Panama City - Panama
  • Open Ocean (-2m, 29.3°C, 0.1-0.8 microns)
Authors
Team : Algarve 2011
Username : mord
Annotated on : 2011-07-19 02:46:51
  • Francisco Lucas Rodrigo Silva
  • Furtado Ricardo Jorge Marques
  • Guerreiro José Miguel Almeida

Synopsis

Genomic Sequence

>JCVI_READ_1091119955965 GOS_2162030 Genomic DNA
ACTCGCGAGGACTTAATTGAACCATACCCCATAACCTTGATTTCTCAATACTAGTTCCGAGCATCTCCTCAATCTCTTCCGCGTCTTTCCTTGTTGGTAT
CGGGTTGTATTTTTCATAAAGATCGGGTCTCAGTTTGAGGCCAAATCGTTTTGCATATGTGTTTGATTTGTACCCCTCTTTATGCTGTTCAAATCGAATA
TGTGGTTTCTTTGAAGATTGACCTACATACACGCAAGGATCTCCTTTGAAGTATTTGGGGTTATTGTCTCTAAATTTTTTTATATCTGAGACCGACTGCT
CTAGCTCAATGACATACACATAGTATTTTCTCATTTAAAATAATAAGGATTATACGCTGGGCCAATCAGGAGGATTTTCAAATGGATCAGGTCCAGTAGA
GCTATCTCCATTAATGATTCCATATCCAACAATTAGCACAAGCAAAGCCAATAAACCTTTAGCTCTACTTGATCGAAACATTGTGTTGTCTATAATGCTA
TCAAATTTTCCTTTTGGTGGCTTTAATCCTAAGGCCTTCCATGTATTCATTCGCATTGCAAGTATCATCTCATCCACATTTTCAGTCTTTAGGTTCATTT
TTACGGATTTAACTTTACTCTTCTTTTCTTCGCCTTGTTTAAAAACATAGTGTGTAAAGTTGGCGGAATACCTATTACCAGATTTTTCCAGAGACCACAA
AAGAAAATTTTCAATATCGAAGGTTTGGGAAAGCTGCCTTAGGCACTCTTCATCAAAACATTCATCATATTCCGATTCTTTAAACTGCTCATTTGAAACT
GACTTAAATTTAAATGTTTCATCTATTTCGTCTTTAATATATTCACCAATAACTTCGGGATTCCA

Translation

[ - /865]   indirect strand


Annotator commentaries

The ORF analysed has 171 aa, the e-values obtained from the BLASTp are high therefore without biological significance, concluding that this ORF is non-coding.

It was not possible to predict the protein's function and taxonomy classification because it was found no knowned homologies in the database.


ORF finding

PROTOCOL


a) SMS ORFinder / direct strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code


RESULTS ANALYSIS


In the analysis of this genomic sequence with the SMS ORFinder it was obtained a total of 4 ORFs, 2 ORFs were found in the direct chain (both in the reading frame 3) and 2 in the reverse chain (both in the reading frame 1). The chosen ORF for study was the ORF number 1 of the reverse chain, in reading frame 1 that extends from base 1 to base 516, has it is the longest ORF obtained (171 aa).

Other ORFs have an e-value extremly high (>1E-2), therefore without biological significance. However, the ORF number 2 of the reverse chain have an e-value better (1E-18) then the ORF chosen (1.5E-2), but all of the results of homology where with hypothetical proteins. These two ORFs are in the same reading frame and don't overlap, so the longest ORF remains the chosen for study.

RAW RESULTS

a) Forward strand

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 339 to base 650.
AATAATAAGGATTATACGCTGGGCCAATCAGGAGGATTTTCAAATGGATCAGGTCCAGTA
GAGCTATCTCCATTAATGATTCCATATCCAACAATTAGCACAAGCAAAGCCAATAAACCT
TTAGCTCTACTTGATCGAAACATTGTGTTGTCTATAATGCTATCAAATTTTCCTTTTGGT
GGCTTTAATCCTAAGGCCTTCCATGTATTCATTCGCATTGCAAGTATCATCTCATCCACA
TTTTCAGTCTTTAGGTTCATTTTTACGGATTTAACTTTACTCTTCTTTTCTTCGCCTTGT
TTAAAAACATAG

>Translation of ORF number 1 in reading frame 3 on the direct strand.
NNKDYTLGQSGGFSNGSGPVELSPLMIPYPTISTSKANKPLALLDRNIVLSIMLSNFPFG
GFNPKAFHVFIRIASIISSTFSVFRFIFTDLTLLFFSSPCLKT*

>ORF number 2 in reading frame 3 on the direct strand extends from base 651 to base 863.
TGTGTAAAGTTGGCGGAATACCTATTACCAGATTTTTCCAGAGACCACAAAAGAAAATTT
TCAATATCGAAGGTTTGGGAAAGCTGCCTTAGGCACTCTTCATCAAAACATTCATCATAT
TCCGATTCTTTAAACTGCTCATTTGAAACTGACTTAAATTTAAATGTTTCATCTATTTCG
TCTTTAATATATTCACCAATAACTTCGGGATTC

>Translation of ORF number 2 in reading frame 3 on the direct strand.
CVKLAEYLLPDFSRDHKRKFSISKVWESCLRHSSSKHSSYSDSLNCSFETDLNLNVSSIS
SLIYSPITSGF

---------------------------------------------------------------------------------------------------
b) Reverse Strand

>ORF number 1 in reading frame 1 on the reverse strand extends from base 1 to base 516.
TGGAATCCCGAAGTTATTGGTGAATATATTAAAGACGAAATAGATGAAACATTTAAATTT
AAGTCAGTTTCAAATGAGCAGTTTAAAGAATCGGAATATGATGAATGTTTTGATGAAGAG
TGCCTAAGGCAGCTTTCCCAAACCTTCGATATTGAAAATTTTCTTTTGTGGTCTCTGGAA
AAATCTGGTAATAGGTATTCCGCCAACTTTACACACTATGTTTTTAAACAAGGCGAAGAA
AAGAAGAGTAAAGTTAAATCCGTAAAAATGAACCTAAAGACTGAAAATGTGGATGAGATG
ATACTTGCAATGCGAATGAATACATGGAAGGCCTTAGGATTAAAGCCACCAAAAGGAAAA
TTTGATAGCATTATAGACAACACAATGTTTCGATCAAGTAGAGCTAAAGGTTTATTGGCT
TTGCTTGTGCTAATTGTTGGATATGGAATCATTAATGGAGATAGCTCTACTGGACCTGAT
CCATTTGAAAATCCTCCTGATTGGCCCAGCGTATAA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
WNPEVIGEYIKDEIDETFKFKSVSNEQFKESEYDECFDEECLRQLSQTFDIENFLLWSLE
KSGNRYSANFTHYVFKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNTWKALGLKPPKGK
FDSIIDNTMFRSSRAKGLLALLVLIVGYGIINGDSSTGPDPFENPPDWPSV*

>ORF number 2 in reading frame 1 on the reverse strand extends from base 532 to base 864.
ATGAGAAAATACTATGTGTATGTCATTGAGCTAGAGCAGTCGGTCTCAGATATAAAAAAA
TTTAGAGACAATAACCCCAAATACTTCAAAGGAGATCCTTGCGTGTATGTAGGTCAATCT
TCAAAGAAACCACATATTCGATTTGAACAGCATAAAGAGGGGTACAAATCAAACACATAT
GCAAAACGATTTGGCCTCAAACTGAGACCCGATCTTTATGAAAAATACAACCCGATACCA
ACAAGGAAAGACGCGGAAGAGATTGAGGAGATGCTCGGAACTAGTATTGAGAAATCAAGG
TTATGGGGTATGGTTCAATTAAGTCCTCGCGAG

>Translation of ORF number 2 in reading frame 1 on the reverse strand.
MRKYYVYVIELEQSVSDIKKFRDNNPKYFKGDPCVYVGQSSKKPHIRFEQHKEGYKSNTY
AKRFGLKLRPDLYEKYNPIPTRKDAEEIEEMLGTSIEKSRLWGMVQLSPRE

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOL



RESULTS ANALYSIS


It wasn't possible to preform a multiple alignement because there wasn't obtained any homologue sequences as described in the BLAST section.


RAW RESULTS

Protein Domains

PROTOCOL


INTERPRO, default parameters at EBI


RESULTS ANALYSIS


The only result obtained in the interpro was tagged unintegraded. The result indicats a possible transmenbrane regions, however it does not have a e-value available, therefore one can't conclude the significance of this result.

RAW RESULTS

Sequence_1	6B447A6482F006D2	171	TMHMM	tmhmm	transmembrane_regions	138	158	NA	?	17-Mar-2011	NULL	NULL

Phylogeny

PROTOCOL



RESULTS ANALYSIS


It was not possible to build a tree, as described in the taxonomy report section.

RAW RESULTS

Taxonomy report

PROTOCOL


a) BLASTp versus NR, NCBI default parameters apart from "Number of descriptions_1000"

b) BLASTp versus SWISSPROT, NCBI default parameters apart from "Number of descriptions_1000"

c) BLASTp versus ENV_NR, NCBI default parameters apart from "Number of descriptions_1000"



RESULTS ANALYSIS


It was not possible to build a tree because the scores and the e-values made it impossible to define the in and out groups.

RAW RESULTS

a) BLASTp versus NR

root
. cellular organisms
. . Eukaryota          [eukaryotes]
. . . Spermatophyta      [seed plants]
. . . . rosids             [eudicots]
. . . . . Vitis vinifera (wine grape) ------------------   43 16 hits [eudicots]            unnamed protein product [Vitis vinifera]
. . . . . Ricinus communis .............................   34  2 hits [eudicots]            cation-transporting atpase plant, putative [Ricinus communi
. . . . Picea sitchensis -------------------------------   33  1 hit  [conifers]            unknown [Picea sitchensis]
. . . Acyrthosiphon pisum ------------------------------   35  1 hit  [aphids]              PREDICTED: similar to Melk protein [Acyrthosiphon pisum]
. . . Camponotus floridanus ............................   34  1 hit  [ants]                Transmembrane channel-like protein 3 [Camponotus floridanus]
. . . Botryotinia fuckeliana B05.10 ....................   34  2 hits [ascomycetes]         hypothetical protein BC1G_11788 [Botryotinia fuckeliana B05
. . . Monosiga brevicollis MX1 .........................   34  2 hits [choanoflagellates]   hypothetical protein [Monosiga brevicollis MX1] >gi|1637750
. . . Neospora caninum Liverpool .......................   33  1 hit  [apicomplexans]       putative STE kinase [Neospora caninum Liverpool]
. . Blattabacterium sp. (Blattella germanica) str. Bge -   36  2 hits [CFB group bacteria]  penicillin-binding protein [Blattabacterium sp. (Blattella 
. . Proteus penneri ATCC 35198 .........................   34  2 hits [enterobacteria]      hypothetical protein PROPEN_04895 [Proteus penneri ATCC 351
. . Segniliparus rotundus DSM 44985 ....................   34  2 hits [high GC Gram+]       AMP-dependent synthetase and ligase [Segniliparus rotundus 
. . Brevundimonas sp. BAL3 .............................   33  2 hits [a-proteobacteria]    conserved domain protein, putative [Brevundimonas sp. BAL3]
. . Anaerostipes sp. 3_2_56FAA .........................   33  2 hits [firmicutes]          EAL domain-containing protein [Anaerostipes sp. 3_2_56FAA] 
. . Anaerostipes caccae DSM 14662 ......................   33  2 hits [firmicutes]          hypothetical protein ANACAC_01106 [Anaerostipes caccae DSM 
. uncultured organism ----------------------------------   36  1 hit  [unclassified]        putative carbohydrate-active enzyme [uncultured organism]

--------------------------------------------------------------------------------------------------------------------------------------------------------------------

b) BLASTp versus SWISSPROT

cellular organisms
. Eukaryota          [eukaryotes]
. . Arabidopsis thaliana (thale-cress) -   30 1 hit  [eudicots]          RecName: Full=Calcium-transporting ATPase 12, plasma membra
. . Saccharomyces cerevisiae (yeast) ...   30 1 hit  [ascomycetes]       RecName: Full=Exosome complex exonuclease DIS3; AltName: Fu
. Pasteurella multocida ----------------   30 1 hit  [g-proteobacteria]  RecName: Full=Putative 4'-phosphopantetheinyl transferase P
. Finegoldia magna ATCC 29328 ..........   30 1 hit  [firmicutes]        RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine
. Chlamydophila felis Fe/C-56 ..........   29 1 hit  [chlamydias]        RecName: Full=Chaperone protein dnaK; AltName: Full=HSP70; 

--------------------------------------------------------------------------------------------------------------------------------------------------------------------

c) BLASTp versus ENV_NR

marine metagenome [metagenomes]
. marine metagenome -   50 70 hits [metagenomes]  hypothetical protein GOS_7358034 [marine metagenome]

BLAST

PROTOCOL


a) BLASTp versus NR, NCBI default parameters apart from "Number of descriptions_1000"

b) BLASTp versus SWISSPROT, NCBI default parameters apart from "Number of descriptions_1000"

c) BLASTp versus ENV_NR, NCBI default parameters apart from "Number of descriptions_1000"




RESULTS ANALYSIS


The number of hits obtained are very limited and they all have scores too low and e-values too high in all of the databases used, the only conclusion is that there is no known homologue proteins and therefore it is impossible to analyse the protein's function. For the same reason it is not possible to define the in and out groups.

RAW RESULTS

a) BLASTp versus NR
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

emb|CBI26329.3|  unnamed protein product [Vitis vinifera]          43.1    0.015
ref|XP_002279567.1|  PREDICTED: hypothetical protein [Vitis vi...  37.0    0.90 
emb|CBI26325.3|  unnamed protein product [Vitis vinifera]          37.0    0.90 
emb|CAN83227.1|  hypothetical protein VITISV_029568 [Vitis vin...  36.6    1.3  
emb|CBI26322.3|  unnamed protein product [Vitis vinifera]          36.2    1.5  
ref|XP_002279593.1|  PREDICTED: hypothetical protein [Vitis vi...  36.2    1.6  
gb|ADD61979.1|  putative carbohydrate-active enzyme [unculture...  36.2    1.6  
ref|YP_003284010.1|  penicillin-binding protein [Blattabacteri...  36.2    1.8  
emb|CAN71613.1|  hypothetical protein VITISV_016249 [Vitis vin...  36.2    1.8  
ref|XP_002279443.1|  PREDICTED: hypothetical protein [Vitis vi...  35.8    1.9  
ref|XP_002279818.1|  PREDICTED: hypothetical protein [Vitis vi...  35.8    2.0  
ref|XP_002279629.1|  PREDICTED: hypothetical protein [Vitis vi...  35.8    2.1  
ref|XP_002283579.1|  PREDICTED: hypothetical protein [Vitis vi...  35.8    2.3  
emb|CAN67182.1|  hypothetical protein VITISV_002535 [Vitis vin...  35.4    2.8  
ref|XP_001952136.1|  PREDICTED: similar to Melk protein [Acyrt...  35.0    3.5  
emb|CAN81891.1|  hypothetical protein VITISV_023611 [Vitis vin...  34.7    4.2  
ref|XP_002279888.1|  PREDICTED: hypothetical protein [Vitis vi...  34.7    4.3  
ref|ZP_03806490.1|  hypothetical protein PROPEN_04895 [Proteus...  34.7    5.0  
ref|YP_003660031.1|  AMP-dependent synthetase and ligase [Segn...  34.7    5.3  
ref|XP_002517055.1|  cation-transporting atpase plant, putativ...  34.7    5.3  
gb|EFN72383.1|  Transmembrane channel-like protein 3 [Camponot...  34.3    5.6  
ref|XP_001550030.1|  hypothetical protein BC1G_11788 [Botryoti...  34.3    6.2  
ref|XP_001746298.1|  hypothetical protein [Monosiga brevicolli...  34.3    6.6  
ref|ZP_05034142.1|  conserved domain protein, putative [Brevun...  33.9    7.4  
ref|XP_002274787.1|  PREDICTED: similar to type IIB calcium AT...  33.9    7.8  
ref|ZP_07930186.1|  EAL domain-containing protein [Anaerostipe...  33.9    7.9  
gb|ADE77933.1|  unknown [Picea sitchensis]                         33.9    7.9  
ref|ZP_02418524.1|  hypothetical protein ANACAC_01106 [Anaeros...  33.9    8.1  
emb|CBZ54255.1|  putative STE kinase [Neospora caninum Liverpool]  33.5    10.0 

ALIGNMENTS
>emb|CBI26329.3| unnamed protein product [Vitis vinifera]
Length=4083

 Score = 43.1 bits (100),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 34/137 (25%), Positives = 63/137 (46%), Gaps = 10/137 (7%)

Query  15    DETFKFKSVSNE------QFKESEYDECFDEECLRQLSQTFDIENFLLWSLEKSGNRYSA  68
             D  F  ++++ E        + S +D+    +CL+Q      +  F+ + L  +      
Sbjct  2948  DNVFTARAIATEFDKICVMARSSPFDKLLMVQCLKQKGHV--VAKFIQFQLTVNVAALVI  3005

Query  69    NFTHYVFKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNTWKALGLKPPKGKFDSIIDNT  128
             NF   V   GE   + V+ + +NL  + +  + LA    T K L  KPP G+ + +I N 
Sbjct  3006  NFVAAV-SAGEVPLTAVQLLWVNLIMDTLGALALATEQPT-KELMEKPPMGRKEPLISNV  3063

Query  129   MFRSSRAKGLLALLVLI  145
             M+R+  A+ L  + +L+
Sbjct  3064  MWRNLLAQALYQIAILL  3080


>ref|XP_002279567.1| PREDICTED: hypothetical protein [Vitis vinifera]
Length=1007

 Score = 37.0 bits (84),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 28/96 (30%), Positives = 48/96 (50%), Gaps = 2/96 (2%)

Query  50   DIENFLLWSLEKSGNRYSANFTHYVFKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNTW  109
            +I+ F+ + L  +      NF   V   GE   + V+ + +NL  + +  + LA    T 
Sbjct  795  NIQKFIQFQLTVNVAALVINFVAAV-SAGEIPLTAVQLLWVNLIMDTLGALALATEQPT-  852

Query  110  KALGLKPPKGKFDSIIDNTMFRSSRAKGLLALLVLI  145
            K L  KPP G+ + +I N M+R+  A+ L  + VL+
Sbjct  853  KELMEKPPMGRTEPLISNIMWRNLLAQALYQIAVLL  888


>emb|CBI26325.3| unnamed protein product [Vitis vinifera]
Length=3100

 Score = 37.0 bits (84),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 28/96 (30%), Positives = 48/96 (50%), Gaps = 2/96 (2%)

Query  50    DIENFLLWSLEKSGNRYSANFTHYVFKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNTW  109
             +I+ F+ + L  +      NF   V   GE   + V+ + +NL  + +  + LA    T 
Sbjct  2889  NIQKFIQFQLTVNVAALVINFVAAV-SAGEVPLTAVQLLWVNLIMDTLGALALATEQPT-  2946

Query  110   KALGLKPPKGKFDSIIDNTMFRSSRAKGLLALLVLI  145
             K L  KPP G+ + +I N M+R+  A+ L  + VL+
Sbjct  2947  KELMEKPPMGRTEPLISNIMWRNLLAQALYQIAVLL  2982


 Score = 36.6 bits (83),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 28/96 (30%), Positives = 48/96 (50%), Gaps = 2/96 (2%)

Query  50    DIENFLLWSLEKSGNRYSANFTHYVFKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNTW  109
             +I+ F+ + L  +      NF   V   GE   + V+ + +NL  + +  + LA    T 
Sbjct  1536  NIQKFIQFQLTVNVAALVINFVAAV-SAGEIPLTAVQLLWVNLIMDTLGALALATEQPT-  1593

Query  110   KALGLKPPKGKFDSIIDNTMFRSSRAKGLLALLVLI  145
             K L  KPP G+ + +I N M+R+  A+ L  + VL+
Sbjct  1594  KELMEKPPMGRTEPLISNIMWRNLLAQALYQIAVLL  1629


>emb|CAN83227.1| hypothetical protein VITISV_029568 [Vitis vinifera]
Length=565

 Score = 36.6 bits (83),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 27/97 (28%), Positives = 48/97 (50%), Gaps = 2/97 (2%)

Query  50   DIENFLLWSLEKSGNRYSANFTHYVFKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNTW  109
            +I+ F+ + L  +      NF   V   GE   + V+ + +NL  + +  + LA    T 
Sbjct  353  NIQKFIQFQLTVNVAALVINFVAAV-SAGEVPLTAVQLLWVNLIMDTLGALALATEQPT-  410

Query  110  KALGLKPPKGKFDSIIDNTMFRSSRAKGLLALLVLIV  146
            K L  +PP G+   +I N M+R+  A+ L  + VL++
Sbjct  411  KELMDRPPVGRTGPLITNIMWRNLLAQALYQIAVLLI  447


>emb|CBI26322.3| unnamed protein product [Vitis vinifera]
Length=1732

 Score = 36.2 bits (82),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 32/113 (29%), Positives = 54/113 (48%), Gaps = 4/113 (3%)

Query  50   DIENFLLWSLEKSGNRYSANFTHYVFKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNTW  109
            +I+ F+ + L  +      NF       GE   + V+ + +NL  + +  + LA    T 
Sbjct  702  NIQKFIQFQLTVNVAALVINFVAAA-SAGEVPLTAVQLLWVNLIMDTLGALALATERPT-  759

Query  110  KALGLKPPKGKFDSIIDNTMFRSSRAKGLLALLVLIVGYGIINGDSSTGPDPF  162
            K L  KPP G+ + +I N M+R+  A+ L  ++VL+      NG+S  G   F
Sbjct  760  KELMEKPPVGRAEPLITNIMWRNLLAQALYQIVVLLTLQ--FNGESIFGNKLF  810


>ref|XP_002279593.1| PREDICTED: hypothetical protein [Vitis vinifera]
Length=1011

 Score = 36.2 bits (82),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 27/96 (29%), Positives = 48/96 (50%), Gaps = 2/96 (2%)

Query  50   DIENFLLWSLEKSGNRYSANFTHYVFKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNTW  109
            +I+ F+ + L  +      NF   V   GE   + V+ + +NL  + +  + LA    T 
Sbjct  799  NIQKFIQFQLTVNVAALVINFVAAV-SAGEVPLTAVQLLWVNLIMDTLGALALATEQPT-  856

Query  110  KALGLKPPKGKFDSIIDNTMFRSSRAKGLLALLVLI  145
            + L  KPP G+ + +I N M+R+  A+ L  + VL+
Sbjct  857  RELMEKPPVGRTEPLISNIMWRNILAQALYQIAVLL  892


>gb|ADD61979.1| putative carbohydrate-active enzyme [uncultured organism]
Length=367

 Score = 36.2 bits (82),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 25/73 (35%), Positives = 37/73 (51%), Gaps = 9/73 (12%)

Query  57   WSLEKSGNRYSAN-FTHYVF-KQGEEKKSKVKSVKMNLKTENVDEMILAMRMNT---WK-  110
            W  E  GN +  N   HYV   QG E+ + +K   +++  + + E + ++RMNT   WK 
Sbjct  151  WYYETGGNGWGNNELQHYVAGNQGNEQLAAIKDGILSIIAKKIGETVYSIRMNTKESWKY  210

Query  111  ---ALGLKPPKGK  120
                  LK PKGK
Sbjct  211  GYFEARLKLPKGK  223


>ref|YP_003284010.1| penicillin-binding protein [Blattabacterium sp. (Blattella germanica) 
str. Bge]
 gb|ACY40400.1| penicillin-binding protein [Blattabacterium sp. (Blattella germanica) 
str. Bge]
Length=656

 Score = 36.2 bits (82),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 20/52 (39%), Positives = 30/52 (58%), Gaps = 3/52 (5%)

Query  15   DETFKFKSVSNEQFKESEYDECFDEECLRQLSQTFDIENFLLWSLEKSGNRY  66
            D    F+S+S + F+E+ Y  C   E L +  + F I+NF   S++K GNRY
Sbjct  77   DIHIDFRSISEKLFQENIYSLCNSLESLFKKPKFFSIKNF---SMKKKGNRY  125


>emb|CAN71613.1| hypothetical protein VITISV_016249 [Vitis vinifera]
Length=585

 Score = 36.2 bits (82),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 31/109 (29%), Positives = 52/109 (48%), Gaps = 4/109 (3%)

Query  50   DIENFLLWSLEKSGNRYSANFTHYVFKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNTW  109
            +I+ F+ + L  +      NF       GE   + V+ + +NL  + +  + LA    T 
Sbjct  349  NIQKFIQFQLTVNVAALVINFVAAA-SAGEVPLTAVQLLWVNLIMDTLGALALATERPT-  406

Query  110  KALGLKPPKGKFDSIIDNTMFRSSRAKGLLALLVLIVGYGIINGDSSTG  158
            K L  KPP G+ + +I N M+R+  A+ L  + VL+      NG+S  G
Sbjct  407  KELMEKPPVGRAEPLITNIMWRNLLAQALYQIAVLLTLQ--FNGESIFG  453


>ref|XP_002279443.1| PREDICTED: hypothetical protein [Vitis vinifera]
Length=1005

 Score = 35.8 bits (81),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 28/96 (30%), Positives = 48/96 (50%), Gaps = 2/96 (2%)

Query  50   DIENFLLWSLEKSGNRYSANFTHYVFKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNTW  109
            +I+ F+ + L  +    + NF   V   GE   + V+ + +NL  + +  + LA    T 
Sbjct  793  NIQKFIQFQLTVNLAALAINFV-AVLSAGEVPLTAVQLLWVNLIMDTLGALALATEQPT-  850

Query  110  KALGLKPPKGKFDSIIDNTMFRSSRAKGLLALLVLI  145
            K L  K P GK + +I N M+R+  A+ L  + VL+
Sbjct  851  KELMEKQPVGKVEPLITNIMWRNLLAQALYQIAVLL  886


>ref|XP_002279818.1| PREDICTED: hypothetical protein [Vitis vinifera]
Length=1011

 Score = 35.8 bits (81),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 27/96 (29%), Positives = 48/96 (50%), Gaps = 2/96 (2%)

Query  50   DIENFLLWSLEKSGNRYSANFTHYVFKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNTW  109
            +I+ F+ + L  +      NF   V   GE   + V+ + +NL  + +  + LA    T 
Sbjct  799  NIQKFIQFQLTVNVAALVINFVAAV-SAGEVPLTAVQLLWVNLIMDTLGALALATEQPT-  856

Query  110  KALGLKPPKGKFDSIIDNTMFRSSRAKGLLALLVLI  145
            K L  KPP G+ + +I N M+R+  A+ L  + +L+
Sbjct  857  KELMEKPPMGRKEPLISNVMWRNLLAQALYQIAILL  892

--------------------------------------------------------------------------------------------------------
b) BLASTp versus SWISSPROT
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q9LY77.1|ACA12_ARATH  RecName: Full=Calcium-transporting AT...  30.4    5.0  
sp|Q9CPD1.1|Y116_PASMU  RecName: Full=Putative 4'-phosphopante...  30.4    5.2  
sp|Q08162.1|RRP44_YEAST  RecName: Full=Exosome complex exonucl...  30.0    6.4  
sp|B0S104.1|SYA_FINM2  RecName: Full=Alanyl-tRNA synthetase; A...  30.0    7.2  
sp|Q253K1.1|DNAK_CHLFF  RecName: Full=Chaperone protein dnaK; ...  29.6    8.7  

ALIGNMENTS
>sp|Q9LY77.1|ACA12_ARATH RecName: Full=Calcium-transporting ATPase 12, plasma membrane-type; 
AltName: Full=Ca(2+)-ATPase isoform 12
Length=1033

 Score = 30.4 bits (67),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 24/97 (25%), Positives = 48/97 (50%), Gaps = 2/97 (2%)

Query  50   DIENFLLWSLEKSGNRYSANFTHYVFKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNTW  109
            +I+ F+ + L  +      NF   +   GE   + V+ + +NL  + +  + LA    T 
Sbjct  805  NIQKFIQFQLTVNVAALVINFIAAI-SAGEVPLTAVQLLWVNLIMDTLGALALATERPTN  863

Query  110  KALGLKPPKGKFDSIIDNTMFRSSRAKGLLALLVLIV  146
            + L  KP  G+ +++I N M+R+   + L  + VL++
Sbjct  864  ELLKRKPV-GRTEALITNVMWRNLLVQSLYQIAVLLI  899


>sp|Q9CPD1.1|Y116_PASMU RecName: Full=Putative 4'-phosphopantetheinyl transferase PM0116
Length=240

 Score = 30.4 bits (67),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 21/95 (23%), Positives = 43/95 (46%), Gaps = 1/95 (1%)

Query  14   IDETFKFKSVSNEQFKESEYDECFDEECLRQLSQTFDIENFLLWSLEKSGNRYSANFTHY  73
            I++T+   S+  E   E         + +++  +   + +FLLW L K   + +A   H 
Sbjct  10   INDTYPLDSIPRELLIEKLRQPQSSNQRVQKRHRCRWVAHFLLWQLLKISQKPTALLKHI  69

Query  74   VFKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNT  108
             + Q    +  V  V  N+ + + D + + +R+NT
Sbjct  70   DYSQSGRPQLPVHDVDFNI-SHSGDWVAVILRVNT  103


>sp|Q08162.1|RRP44_YEAST RecName: Full=Exosome complex exonuclease DIS3; AltName: Full=Chromosome 
disjunction protein 3; AltName: Full=Ribosomal RNA-processing 
protein 44
Length=1001

 Score = 30.0 bits (66),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 15/51 (30%), Positives = 28/51 (55%), Gaps = 1/51 (1%)

Query  55   LLWSLEKSGNRYSANFTHYVFKQGEEKKSKVKSVKMNLKTENVDEMILAMR  105
            ++W L+ S N  + NF   V +  E    +   ++++ KT+N DE+ + MR
Sbjct  626  VIWELDDSANIVNVNFMKSVIRSREAFSYEQAQLRIDDKTQN-DELTMGMR  675


>sp|B0S104.1|SYA_FINM2 RecName: Full=Alanyl-tRNA synthetase; AltName: Full=Alanine--tRNA 
ligase; Short=AlaRS
Length=873

 Score = 30.0 bits (66),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 18/51 (36%), Positives = 27/51 (53%), Gaps = 0/51 (0%)

Query  65   RYSANFTHYVFKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNTWKALGLK  115
            R  A     V+K  +E+   + +VK +LK  N DE+   + MNT +  GLK
Sbjct  688  RIEAITGRAVYKYLKERDRLIDNVKHSLKASNEDEITRRIEMNTEEIKGLK  738


>sp|Q253K1.1|DNAK_CHLFF RecName: Full=Chaperone protein dnaK; AltName: Full=HSP70; AltName: 
Full=Heat shock 70 kDa protein; AltName: Full=Heat shock 
protein 70
Length=664

 Score = 29.6 bits (65),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 18/58 (32%), Positives = 32/58 (56%), Gaps = 1/58 (1%)

Query  43   RQLSQTFDIENFLLWSLEKSGNRYSANFTHYVFKQGEEKKSKVKS-VKMNLKTENVDE  99
            R+ S   +  + +++  EK+ N Y AN    + K+ EE+  KV+S +K +  TE + E
Sbjct  528  REASDVRNEADSMIFRAEKAINDYKANIPESLVKEIEERVEKVRSALKEDASTEKIKE  585

-----------------------------------------------------------------------------------------------------
c) BLASTp versus ENV_NR
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

gb|EBS92486.1|  hypothetical protein GOS_7358034 [marine metag...  50.1    3e-05
gb|ECS68390.1|  hypothetical protein GOS_3740647 [marine metag...  48.9    6e-05
gb|ECD71201.1|  hypothetical protein GOS_5864109 [marine metag...  48.9    6e-05
gb|EDA06033.1|  hypothetical protein GOS_2071063 [marine metag...  46.2    4e-04
gb|EBS89874.1|  hypothetical protein GOS_7362303 [marine metag...  45.1    0.001
gb|ECE66339.1|  hypothetical protein GOS_5794067 [marine metag...  44.3    0.001
gb|EDD55984.1|  hypothetical protein GOS_1283699 [marine metag...  44.3    0.002
gb|EBD49087.1|  hypothetical protein GOS_9920985 [marine metag...  44.3    0.002
gb|EDC91528.1|  hypothetical protein GOS_1392210 [marine metag...  43.9    0.002
gb|ECU83831.1|  hypothetical protein GOS_3011200 [marine metag...  43.9    0.002
gb|EBI08929.1|  hypothetical protein GOS_9151354 [marine metag...  41.2    0.012
gb|ECA18520.1|  hypothetical protein GOS_5871058 [marine metag...  41.2    0.013
gb|EBR90165.1|  hypothetical protein GOS_7522984 [marine metag...  41.2    0.014
gb|EBS36434.1|  hypothetical protein GOS_7449036 [marine metag...  40.8    0.016
gb|EBS82186.1|  hypothetical protein GOS_7375121 [marine metag...  40.8    0.017
gb|ECU89436.1|  hypothetical protein GOS_3000734 [marine metag...  40.0    0.028
gb|EBI08659.1|  hypothetical protein GOS_9151817 [marine metag...  39.7    0.031
gb|ECH03431.1|  hypothetical protein GOS_3389571 [marine metag...  38.9    0.055
gb|EBE00690.1|  hypothetical protein GOS_9836319 [marine metag...  38.9    0.066
gb|ECZ71503.1|  hypothetical protein GOS_2133978 [marine metag...  38.5    0.078
gb|ECL62944.1|  hypothetical protein GOS_6139050 [marine metag...  38.5    0.078
gb|ECJ90768.1|  hypothetical protein GOS_5980217 [marine metag...  38.1    0.092
gb|ECT61495.1|  hypothetical protein GOS_5260178 [marine metag...  38.1    0.10 
gb|EBW30081.1|  hypothetical protein GOS_6768212 [marine metag...  37.4    0.18 
gb|ECZ25625.1|  hypothetical protein GOS_2215138 [marine metag...  37.4    0.18 
gb|ECY90271.1|  hypothetical protein GOS_2276408 [marine metag...  37.0    0.22 
gb|EBR68163.1|  hypothetical protein GOS_7558709 [marine metag...  36.6    0.29 
gb|ECL36788.1|  hypothetical protein GOS_3680726 [marine metag...  36.2    0.36 
gb|ECQ91876.1|  hypothetical protein GOS_3759536 [marine metag...  36.2    0.39 
gb|EBL95496.1|  hypothetical protein GOS_8486935 [marine metag...  36.2    0.40 
gb|EBS47520.1|  hypothetical protein GOS_7431452 [marine metag...  36.2    0.43 
gb|EBS55995.1|  hypothetical protein GOS_7417994 [marine metag...  36.2    0.43 
gb|EDF65769.1|  hypothetical protein GOS_916573 [marine metage...  35.8    0.45 
gb|EDF57547.1|  hypothetical protein GOS_931100 [marine metage...  35.8    0.47 
gb|ECZ17487.1|  hypothetical protein GOS_2229055 [marine metag...  35.8    0.49 
gb|ECZ07473.1|  hypothetical protein GOS_2246272 [marine metag...  35.8    0.50 
gb|EBS91201.1|  hypothetical protein GOS_7360139 [marine metag...  35.8    0.50 
gb|EBZ84336.1|  hypothetical protein GOS_3739432 [marine metag...  35.4    0.61 
gb|EDG07031.1|  hypothetical protein GOS_845643 [marine metage...  35.4    0.61 
gb|EBV08280.1|  hypothetical protein GOS_6959120 [marine metag...  35.0    0.98 
gb|EBR66612.1|  hypothetical protein GOS_7561228 [marine metag...  34.7    0.99 
gb|ECF94468.1|  hypothetical protein GOS_4228498 [marine metag...  34.7    1.1  
gb|ECM13537.1|  hypothetical protein GOS_4106608 [marine metag...  34.3    1.3  
gb|EBY43697.1|  hypothetical protein GOS_5850376 [marine metag...  34.3    1.4  
gb|EDF06245.1|  hypothetical protein GOS_1021712 [marine metag...  34.3    1.4  
gb|EBP09650.1|  hypothetical protein GOS_7967799 [marine metag...  34.3    1.6  
gb|ECK31630.1|  hypothetical protein GOS_4330000 [marine metag...  33.9    1.7  
gb|EBE08754.1|  hypothetical protein GOS_9823091 [marine metag...  33.9    1.7  
gb|EDG42582.1|  hypothetical protein GOS_784085 [marine metage...  33.9    1.9  
gb|EBU18575.1|  hypothetical protein GOS_7153342 [marine metag...  33.5    2.7  
gb|ECZ26809.1|  hypothetical protein GOS_2213238 [marine metag...  33.1    3.5  
gb|EBL76956.1|  hypothetical protein GOS_8517190 [marine metag...  32.7    4.3  
gb|EBO86927.1|  hypothetical protein GOS_8006527 [marine metag...  32.7    4.5  
gb|ECC78617.1|  hypothetical protein GOS_6028486 [marine metag...  32.7    4.5  
gb|ECJ92243.1|  hypothetical protein GOS_5921360 [marine metag...  32.3    4.9  
gb|EDG32255.1|  hypothetical protein GOS_801838 [marine metage...  32.3    5.5  
gb|ECC56015.1|  hypothetical protein GOS_3431175 [marine metag...  32.3    5.5  
gb|EDG25197.1|  hypothetical protein GOS_814101 [marine metage...  32.3    5.7  
gb|EBS80804.1|  hypothetical protein GOS_7377347 [marine metag...  32.3    6.1  
gb|EBM26168.1|  hypothetical protein GOS_8437712 [marine metag...  32.0    6.4  
gb|ECE04690.1|  hypothetical protein GOS_4496345 [marine metag...  32.0    7.0  
gb|EDF20203.1|  hypothetical protein GOS_996917 [marine metage...  32.0    7.3  
gb|ECL37826.1|  hypothetical protein GOS_3640481 [marine metag...  32.0    8.1  
gb|EDG38213.1|  hypothetical protein GOS_791481 [marine metage...  32.0    8.2  
gb|ECU18581.1|  hypothetical protein GOS_5367858 [marine metag...  31.6    8.6  
gb|ECU57492.1|  hypothetical protein GOS_3822242 [marine metag...  31.6    8.9  
gb|EBS39001.1|  hypothetical protein GOS_7444971 [marine metag...  31.6    9.2  

ALIGNMENTS
>gb|EBS92486.1| hypothetical protein GOS_7358034 [marine metagenome]
Length=190

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/170 (26%), Positives = 75/170 (45%), Gaps = 25/170 (14%)

Query  11   KDEIDETFKFKSVSNEQ-FKESEYDECFDEECLRQLSQTFDIENFLLWSLEKSGNRYSAN  69
            ++++DE        NEQ F++S    C   EC  ++     ++N +  S  K GN Y+ +
Sbjct  31   RNQMDEIL------NEQGFQQSG---CTSSECAAEVGALLGVQNMVSGSFGKLGNSYTID  81

Query  70   FTHYVFKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNTWKALGLKPPKGKFDSIIDNTM  129
               +  + G   ++  K+ K       VD ++  + +  W+ +GL+PP+ K D +     
Sbjct  82   AKMFSVETGATIRTVSKTYK-----GAVDNLLTVIEVVAWEIVGLQPPQEKLDILAAADP  136

Query  130  F------RSSRAKGLLALL--VLIVGYGIINGDSST--GPDPFENPPDWP  169
                   +SS  K L  L+   L++G G     +ST   P P   PP  P
Sbjct  137  ALAASNQKSSGGKTLRRLMWTTLLLGGGAAAYLASTVEDPVPLPEPPTLP  186


>gb|ECS68390.1| hypothetical protein GOS_3740647 [marine metagenome]
Length=229

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/170 (25%), Positives = 74/170 (44%), Gaps = 25/170 (14%)

Query  11   KDEIDETFKFKSVSNEQ-FKESEYDECFDEECLRQLSQTFDIENFLLWSLEKSGNRYSAN  69
            ++++DE        NEQ F++S    C   EC  ++     ++N +  S  K GN Y+ +
Sbjct  70   RNQMDEIL------NEQGFQQSG---CTSSECAAEVGALLGVQNMVSGSFGKLGNSYTID  120

Query  70   FTHYVFKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNTWKALGLKPPKGKFDSIIDNTM  129
               +  + G   ++  K+ K       VD ++  + +  W+ +GL+PP+ K D +     
Sbjct  121  AKMFSVETGATIRTVSKTYK-----GAVDNLLTVIEVVAWEIVGLQPPQEKLDILAAADP  175

Query  130  F------RSSRAKGLLALL--VLIVGYGIINGDSST--GPDPFENPPDWP  169
                   +S   K L  L+   L++G G     +ST   P P   PP  P
Sbjct  176  ALAASNQKSGGGKTLRRLMWTTLLLGGGAAAYLASTVEDPVPLPEPPTLP  225


>gb|ECD71201.1| hypothetical protein GOS_5864109 [marine metagenome]
Length=197

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/167 (25%), Positives = 72/167 (44%), Gaps = 21/167 (12%)

Query  16   ETFKFKSVSNEQ-FKESEYDECFDEECLRQLSQTFDIENFLLWSLEKSGNRYSANFTHYV  74
            E  +   + NEQ F++S    C   EC  ++     ++N +  S  K GN Y+ +   + 
Sbjct  37   ERNQMDEILNEQGFQQSG---CTSSECAAEVGALLGVQNMVSGSFGKLGNSYTIDAKMFS  93

Query  75   FKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNTWKALGLKPPKGKFD-------SIIDN  127
             + G   ++  K+ K       VD ++  + +  W+ +GL+PP+ K D       +++ +
Sbjct  94   VETGATIRTVSKTYK-----GPVDNLLTVIEVVGWEIVGLQPPQDKLDILAAADPAVVGD  148

Query  128  TMFRSSRAKGLLALL--VLIVGYGIIN--GDSSTGPDPFENPPDWPS  170
            T  +S   K L  L+   LI+G G           P P   PP  P 
Sbjct  149  TK-KSGGGKTLRRLMWTTLILGGGAAAYLAMPPEDPTPLPEPPALPG  194


>gb|EDA06033.1| hypothetical protein GOS_2071063 [marine metagenome]
Length=229

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 54/113 (48%), Gaps = 15/113 (13%)

Query  11   KDEIDETFKFKSVSNEQ-FKESEYDECFDEECLRQLSQTFDIENFLLWSLEKSGNRYSAN  69
            ++++DE        NEQ F++S    C   EC  ++     ++N +  S  K GN Y+ +
Sbjct  69   RNQMDEIL------NEQGFQQSG---CTSSECAAEVGALLGVQNMVSGSFGKLGNSYTID  119

Query  70   FTHYVFKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNTWKALGLKPPKGKFD  122
               +  + G   ++  K+ K       VD ++  + +  W+ +GLKPP+ K D
Sbjct  120  AKMFSVETGATIRTVSKTYK-----GPVDNLLTVIEVVGWEIVGLKPPQDKLD  167


>gb|EBS89874.1| hypothetical protein GOS_7362303 [marine metagenome]
Length=182

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 54/113 (48%), Gaps = 15/113 (13%)

Query  11   KDEIDETFKFKSVSNEQ-FKESEYDECFDEECLRQLSQTFDIENFLLWSLEKSGNRYSAN  69
            ++++DE        NEQ F++S    C   EC  ++     ++N +  S  K GN Y+ +
Sbjct  70   RNQMDEIL------NEQGFQQSG---CTSSECAAEVGALLGVQNMVSGSFGKLGNSYTID  120

Query  70   FTHYVFKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNTWKALGLKPPKGKFD  122
               +  + G   ++  K+ K       VD ++  + +  W+ +GLKPP+ K D
Sbjct  121  AKMFSVETGATIRTVSKTYK-----GPVDNLLTVIEVVGWEIVGLKPPQDKLD  168


>gb|ECE66339.1| hypothetical protein GOS_5794067 [marine metagenome]
Length=183

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 52/125 (42%), Gaps = 7/125 (5%)

Query  21   KSVSNEQFKESEYDE--CFDEECLRQLSQTFDIENFLLWSLEKSGNRYSANFTHYVFKQG  78
            ++V NE  +E  Y E  C  EEC  ++     ++  +  +L K G  Y+ +   +    G
Sbjct  16   RNVVNEVMQEQGYSEAECSSEECAAEVGAMLGVQYMISGALGKLGETYTIDAKMFEVATG  75

Query  79   EEKKSKVKSVKMNLKTENVDEMILAMRMNTWKALGLKPPKGKFDSIIDNTMFRSSRAKGL  138
              +K+   +      +  VD +I  + +  W+ +GLKPP           +    R K  
Sbjct  76   AAEKTINTTY-----SGQVDGLITEIEILAWEMMGLKPPNSLVRKRKGGAVATGPRQKSR  130

Query  139  LALLV  143
            L  LV
Sbjct  131  LGALV  135


>gb|EDD55984.1| hypothetical protein GOS_1283699 [marine metagenome]
Length=482

 Score = 44.3 bits (103),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 41/150 (28%), Positives = 68/150 (46%), Gaps = 19/150 (12%)

Query  25   NEQFKESEYDE--CFDEECLRQLSQTFDIENFLLWSLEKSGNRYSANFTHYVFKQGEEKK  82
            NE  +E  +DE  C  EEC  ++     +E  +  ++ K G+ Y+ +   +    G   K
Sbjct  220  NEVMQEQGFDEAGCTSEECAAEVGALLGVEFMINGAIGKLGDTYTIDAKMFEVATGAASK  279

Query  83   SKVKSVKMNLKTENVDEMILAMRMNTWKALGLKPP----KGKFDSIIDNTMFRSSRAKGL  138
            +K  +      T  VD +I  + +  W+ +GLK P    K +  +I+  T  R  +  G 
Sbjct  280  TKNATY-----TGPVDGLITEIEILAWEMMGLKAPNTLTKKRKGTIVSET--RKVKTPGG  332

Query  139  LALLVLIV-GYGIINGDSSTGPDPFENPPD  167
             AL  L++ G+G     SS+     ENP D
Sbjct  333  AALRSLLIPGWGQHYNFSSS-----ENPSD  357


 Score = 37.0 bits (84),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 28/124 (23%), Positives = 55/124 (45%), Gaps = 11/124 (8%)

Query  1    WNPEVIGEYIKDEIDETFKFKSVSNEQF----KESEYDE--CFDEECLRQLSQTFDIENF  54
            +  E + E ++ EI  T   + V  +      KE    +  C  EEC  ++ +    +  
Sbjct  43   YEVETLVERLRSEIPNTKAMRLVDRKMLENILKEQGLQQSGCTTEECAAEIGELLGAQFM  102

Query  55   LLWSLEKSGNRYSANFTHYVFKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNTWKALGL  114
            +  S+ K G+ +S +        GE   ++ KSV  +     V  +++ M++  W+ + L
Sbjct  103  ISGSVGKLGSTFSVDAKMVSVSTGE--MTRTKSVSFD---GTVGGLLIEMQILAWEMMDL  157

Query  115  KPPK  118
            KPP+
Sbjct  158  KPPQ  161


>gb|EBD49087.1| hypothetical protein GOS_9920985 [marine metagenome]
Length=194

 Score = 44.3 bits (103),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/87 (25%), Positives = 42/87 (49%), Gaps = 5/87 (5%)

Query  32   EYDECFDEECLRQLSQTFDIENFLLWSLEKSGNRYSANFTHYVFKQGEEKKSKVKSVKMN  91
            E  EC  +EC  ++     +E+ +  ++ K G+ Y+ +   +    G       +S+K  
Sbjct  51   EAGECASDECAAEVGAMLGVESMISGAIGKLGDTYTIDAKMFSVATG-----AAESMKSI  105

Query  92   LKTENVDEMILAMRMNTWKALGLKPPK  118
              +  VD +I+ + +  W+ LGL PP+
Sbjct  106  TYSGKVDGLIVEIEVLAWEILGLDPPR  132


>gb|EDC91528.1| hypothetical protein GOS_1392210 [marine metagenome]
Length=189

 Score = 43.9 bits (102),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/87 (25%), Positives = 42/87 (49%), Gaps = 5/87 (5%)

Query  32   EYDECFDEECLRQLSQTFDIENFLLWSLEKSGNRYSANFTHYVFKQGEEKKSKVKSVKMN  91
            E  EC  +EC  ++     +E+ +  ++ K G+ Y+ +   +    G       +S+K  
Sbjct  46   EAGECASDECAAEVGAMLGVESMISGAIGKLGDTYTIDAKMFSVATG-----AAESMKSI  100

Query  92   LKTENVDEMILAMRMNTWKALGLKPPK  118
              +  VD +I+ + +  W+ LGL PP+
Sbjct  101  TYSGKVDGLIVEIEVLAWEILGLDPPR  127


>gb|ECU83831.1| hypothetical protein GOS_3011200 [marine metagenome]
Length=175

 Score = 43.9 bits (102),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 28/113 (25%), Positives = 54/113 (48%), Gaps = 15/113 (13%)

Query  11   KDEIDETFKFKSVSNEQ-FKESEYDECFDEECLRQLSQTFDIENFLLWSLEKSGNRYSAN  69
            ++++DE        NEQ F++S    C   EC  ++     ++N +  S  K GN Y+ +
Sbjct  73   RNQMDEIL------NEQGFQQSG---CTSSECAAEVGALLGVQNMVSGSFGKLGNSYTID  123

Query  70   FTHYVFKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNTWKALGLKPPKGKFD  122
               +  + G   ++  K+ K       VD ++  + +  W+ +GL+PP+ K D
Sbjct  124  AKMFSVETGATIRTVSKTYK-----GPVDNLLTVIEVVGWEIVGLQPPQDKLD  171


>gb|EBI08929.1| hypothetical protein GOS_9151354 [marine metagenome]
Length=261

 Score = 41.2 bits (95),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 30/126 (24%), Positives = 52/126 (42%), Gaps = 15/126 (11%)

Query  1    WNPEVIGEYIKDEIDETFKFK--------SVSNEQFKESEYDECFDEECLRQLSQTFDIE  52
            +  E + E ++ EI  T  F+         + NEQ  +     C  +EC  ++ Q    +
Sbjct  43   YEAETLTERLRSEIANTKAFRITDRKLLDKIINEQALQQ--SGCTTDECAAEVGQLLGAQ  100

Query  53   NFLLWSLEKSGNRYSANFTHYVFKQGEEKKSKVKSVKMNLKTENVDEMILAMRMNTWKAL  112
              +  S+ K G  Y+ +        G  +++K  S K       V  +I  M +  W+  
Sbjct  101  YMISGSIGKLGETYTIDIKLVSVTTGAAERTKTASYK-----GPVAGLITEMEILAWEIS  155

Query  113  GLKPPK  118
            GLKPP+
Sbjct  156  GLKPPQ  161