GOS 2140020

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091118858888
Annotathon code: GOS_2140020
Sample :
  • GPS :24°10'29n; 84°20'40w
  • Caribbean Sea: Gulf of Mexico - USA
  • Coastal Sea (-2m, 26.4°C, 0.1-0.8 microns)
Authors
Team : Algarve 2011
Username : ccj2011
Annotated on : 2011-07-19 01:22:09
  • Domingues Joana Manuel Portela
  • Guerreiro Carla Sofia de Jesus
  • Serra Carolina Alves

Synopsis

Genomic Sequence

>JCVI_READ_1091118858888 GOS_2140020 Genomic DNA
CGCGGTAACTCGGTAGTAATACGTCTGATTCATTTCATACTCGACATCCATAAAAGTAGTGTCTACCAACTCATAGGCTGTTGGTGATGAAAAAGATTCA
TTGGTTGATTTCTCAAGTAGAAAATATTGAAAATCTTCATCCAGGCTAGGACTCCATGTAAGCTCAATACCATCTTCAAGTACCATCGCCATGAGACCAT
TTGGAACACCAGGGGCGATGTTGTCTACACTATATCCTTCCTCGTGATCATCGAAAATTCCACCTTCCATCGAAGCCACTATTTTGAAATTAGTCCAACC
GTTTGACTCTTCTGATGTTGAATCCATTAGAGTTGTTGCTTCAAAAGTGTAAGCAGGTTCCCCTATAGCACCCACCGAGCTCAGTGCAACCCAGCCTGAG
GAATCGTTATCAAAATCATCCCATCTAAAAAGACTATAGGATTGCCCACTAGGCTCTCCATTGTCAAAGTAAGATGCGTTGAAGCTCACATACACTCTTC
CACCCTGATCATTAGGCACATCCTCAACAGACGTAATGACTGGTTTGAAGTGCTCGACATGAAGGTGCAAGGTATCTACCATTGCGTCCATACCATCATC
TAGCTGAAGTGCGATTGGATAGTATCCAAGATCTGTTGGCATACCAAATAAGTGGTTACCATCTAAAGAGTGTGTCCATGCTGGACCACTAAGTAGAGTT
AGCTCTAATTCTTCATAATCTGTATCTACGTCACCATAATGGATCTCCATATGGAAGTCTAGATCCAAGCCAACTACCTGATGCATGTCCATCGCAAAGA
ATGGTGCATCATTTACAGACTCAACTACGACCTCAAAATCTGAACACGCTTCATAATCTCCATCATAAATACACAAGGTCGCCATAGTAGTACCATGGAG
GTTCTCATGTGGATAAAGCATTGGAGCATCCTGAGAATTGTGACTCCACTCAATGTGAAACAGGCTGTGATCATGATGTAATGCAAACTCAAGCTCTTCA
AGAGTA

Translation

[2 - 1006/1006]   indirect strand
>GOS_2140020 Translation [2-1006   indirect strand]
TLEELEFALHHDHSLFHIEWSHNSQDAPMLYPHENLHGTTMATLCIYDGDYEACSDFEVVVESVNDAPFFAMDMHQVVGLDLDFHMEIHYGDVDTDYEEL
ELTLLSGPAWTHSLDGNHLFGMPTDLGYYPIALQLDDGMDAMVDTLHLHVEHFKPVITSVEDVPNDQGGRVYVSFNASYFDNGEPSGQSYSLFRWDDFDN
DSSGWVALSSVGAIGEPAYTFEATTLMDSTSEESNGWTNFKIVASMEGGIFDDHEEGYSVDNIAPGVPNGLMAMVLEDGIELTWSPSLDEDFQYFLLEKS
TNESFSSPTAYELVDTTFMDVEYEMNQTYYYRVTA

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

For the study of this genomic sequence >GOS_2140020 Genomic DNA (Caribbean Sea: Gulf of Mexico) of the Caribbean Sea: Gulf of Mexico (USA) it was done the search of the several ORF's and it was chose one ORF to study, and trough that find the origin, function, phylogeny, tree and so one.


The ORF chosed was the ORF number 1 in reading frame 2 on the reverse strand extended from base 2 to base 1006. The reasonwhy this was the chosen one are related to the fact that this ORF is the biggest one, it has more than 60 aminoacids, whatmeans that it has more probability to have a function discribed.

Other caracteristic of that ORF is the fact that it is an ORFan, this is because it has more than two hundred aminoacids. Beyond that, this ORFan is codan.


Taking into account the several studys done it was not found any homologous sequences, it was not possible to find any protein domains, it was not possible to find out the phylogeny and consequently it was not possible to build the tree and deduce the biological process, the molecular function and the gene.

ORF finding

PROTOCOL


a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code



RESULTS ANALYSIS


In forward strand it was found two ORF's in reading frame 1 and one ORF in reading frame 3, in reading frame 2 ORF's were not found.

In reverse strand it was found one ORF in reading frame 2 and one ORF in reading frame 3, in reading frame 1 ORF's were not found.


The ORF chosed was the ORF number 1 in reading frame 2 on the reverse strand extended from base 2 to base 1006. The reason why this was the chosen one are related to the fact that this ORF is the biggest one, it has more than sixty aminoacids, what means that it has more probability to have a function discribed.

Other caracteristic of that ORF is the fact that it is an ORFan, this is because it has more than two hundred aminoacids(it has three hundred and thirty five aminoacids). Beyond that, this ORFan is codant because is has quite more than two hundred aminoacids.

Based on the values of the blastp vs NR it could be concluded that this ORF has no homologous sequences, the score value was to low (the best one was forty eight)and the E-value was to high (the best one was 0.002). However the values of the blastx were acceptable, the best score value was 53.5 and the best E-value was 5e-05 which was not reflected in the existence of homologous.Concluding this ORF has no homologous sequences.



The ORF number 1 in reading frame 1 on the direct strand extended from base 121 to base 306 has no homologous sequences atending to the blastp values (the scores was to low and the E-values was to high). Based on the blastp vs nr the best score value was 34.7 and the best E-value was 4.3.



The ORF number 2 in reading frame 1 on the direct strand extended from base 400 to base 603 has no homologous sequences atending to the blastp values (the scores was to low and the e-values was to high). Based on the blastp vs nr the best score value and e-value was ,respectively, 34.7 and 4.3.


The ORF number 1 in reading frame 3 on the direct strand extended from base 693 to base 887 has no homologous sequences atending to the blastp values (the scores was to low and the E-values was to high). Based on the blastp vs nr the best score value and E-value was ,respectively, 33.5 and 9.3.



The ORF number 1 in reading frame 3 on the reverse strand extended from base 3 to base 182 has no homologous sequences atending to the blastp values (the scores was to low and the E-values was to high). Based on the blastp vs swissprot the best score value and E-value was ,respectively, 31.2 and 1.5.




RAW RESULTS

a)forward strand

>ORF number 1 in reading frame 1 on the direct strand extends from base 121 to base 306.
AAAATATTGAAAATCTTCATCCAGGCTAGGACTCCATGTAAGCTCAATACCATCTTCAAG
TACCATCGCCATGAGACCATTTGGAACACCAGGGGCGATGTTGTCTACACTATATCCTTC
CTCGTGATCATCGAAAATTCCACCTTCCATCGAAGCCACTATTTTGAAATTAGTCCAACC
GTTTGA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
KILKIFIQARTPCKLNTIFKYHRHETIWNTRGDVVYTISFLVIIENSTFHRSHYFEISPT
V*

>ORF number 2 in reading frame 1 on the direct strand extends from base 400 to base 603.
GGAATCGTTATCAAAATCATCCCATCTAAAAAGACTATAGGATTGCCCACTAGGCTCTCC
ATTGTCAAAGTAAGATGCGTTGAAGCTCACATACACTCTTCCACCCTGATCATTAGGCAC
ATCCTCAACAGACGTAATGACTGGTTTGAAGTGCTCGACATGAAGGTGCAAGGTATCTAC
CATTGCGTCCATACCATCATCTAG

>Translation of ORF number 2 in reading frame 1 on the direct strand.
GIVIKIIPSKKTIGLPTRLSIVKVRCVEAHIHSSTLIIRHILNRRNDWFEVLDMKVQGIY
HCVHTII*

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 693 to base 887.
GTAGAGTTAGCTCTAATTCTTCATAATCTGTATCTACGTCACCATAATGGATCTCCATAT
GGAAGTCTAGATCCAAGCCAACTACCTGATGCATGTCCATCGCAAAGAATGGTGCATCAT
TTACAGACTCAACTACGACCTCAAAATCTGAACACGCTTCATAATCTCCATCATAAATAC
ACAAGGTCGCCATAG

>Translation of ORF number 1 in reading frame 3 on the direct strand.
VELALILHNLYLRHHNGSPYGSLDPSQLPDACPSQRMVHHLQTQLRPQNLNTLHNLHHKY
TRSP*

b)reverse strand

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 2 to base 1006.
ACTCTTGAAGAGCTTGAGTTTGCATTACATCATGATCACAGCCTGTTTCACATTGAGTGG
AGTCACAATTCTCAGGATGCTCCAATGCTTTATCCACATGAGAACCTCCATGGTACTACT
ATGGCGACCTTGTGTATTTATGATGGAGATTATGAAGCGTGTTCAGATTTTGAGGTCGTA
GTTGAGTCTGTAAATGATGCACCATTCTTTGCGATGGACATGCATCAGGTAGTTGGCTTG
GATCTAGACTTCCATATGGAGATCCATTATGGTGACGTAGATACAGATTATGAAGAATTA
GAGCTAACTCTACTTAGTGGTCCAGCATGGACACACTCTTTAGATGGTAACCACTTATTT
GGTATGCCAACAGATCTTGGATACTATCCAATCGCACTTCAGCTAGATGATGGTATGGAC
GCAATGGTAGATACCTTGCACCTTCATGTCGAGCACTTCAAACCAGTCATTACGTCTGTT
GAGGATGTGCCTAATGATCAGGGTGGAAGAGTGTATGTGAGCTTCAACGCATCTTACTTT
GACAATGGAGAGCCTAGTGGGCAATCCTATAGTCTTTTTAGATGGGATGATTTTGATAAC
GATTCCTCAGGCTGGGTTGCACTGAGCTCGGTGGGTGCTATAGGGGAACCTGCTTACACT
TTTGAAGCAACAACTCTAATGGATTCAACATCAGAAGAGTCAAACGGTTGGACTAATTTC
AAAATAGTGGCTTCGATGGAAGGTGGAATTTTCGATGATCACGAGGAAGGATATAGTGTA
GACAACATCGCCCCTGGTGTTCCAAATGGTCTCATGGCGATGGTACTTGAAGATGGTATT
GAGCTTACATGGAGTCCTAGCCTGGATGAAGATTTTCAATATTTTCTACTTGAGAAATCA
ACCAATGAATCTTTTTCATCACCAACAGCCTATGAGTTGGTAGACACTACTTTTATGGAT
GTCGAGTATGAAATGAATCAGACGTATTACTACCGAGTTACCGCG

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
TLEELEFALHHDHSLFHIEWSHNSQDAPMLYPHENLHGTTMATLCIYDGDYEACSDFEVV
VESVNDAPFFAMDMHQVVGLDLDFHMEIHYGDVDTDYEELELTLLSGPAWTHSLDGNHLF
GMPTDLGYYPIALQLDDGMDAMVDTLHLHVEHFKPVITSVEDVPNDQGGRVYVSFNASYF
DNGEPSGQSYSLFRWDDFDNDSSGWVALSSVGAIGEPAYTFEATTLMDSTSEESNGWTNF
KIVASMEGGIFDDHEEGYSVDNIAPGVPNGLMAMVLEDGIELTWSPSLDEDFQYFLLEKS
TNESFSSPTAYELVDTTFMDVEYEMNQTYYYRVTA

>ORF number 1 in reading frame 3 on the reverse strand extends from base 3 to base 182.
CTCTTGAAGAGCTTGAGTTTGCATTACATCATGATCACAGCCTGTTTCACATTGAGTGGA
GTCACAATTCTCAGGATGCTCCAATGCTTTATCCACATGAGAACCTCCATGGTACTACTA
TGGCGACCTTGTGTATTTATGATGGAGATTATGAAGCGTGTTCAGATTTTGAGGTCGTAG


>Translation of ORF number 1 in reading frame 3 on the reverse strand.
LLKSLSLHYIMITACFTLSGVTILRMLQCFIHMRTSMVLLWRPCVFMMEIMKRVQILRS*

Multiple Alignement

PROTOCOL



RESULTS ANALYSIS


Taking into account that the sequence in study is an ORFan and that it has no homologous sequences (as it was showned in the field 'BLAST')it wasn't possible to do a multiple alignment because there weren't sufficient sequences to align.






RAW RESULTS

Protein Domains

PROTOCOL

1)InterPro, default parameters at EBI


RESULTS ANALYSIS


The results from Interproscan confirm the results obtained on Blast,concluding that there is no annotated protein domains.


RAW RESULTS

1)InterPro, default parameters at EBI

No hits found.

Phylogeny

PROTOCOL



RESULTS ANALYSIS



It was not possible to build the tree because the scores were to low and the E-values were to high, so there was no homologous sequences. It was also not possible to built the phylogeny and the taxonomy of the ORF because of the same reasons.

If it is not possible to compare the ORF with its homologous it is also impossible to do its phylogeny and consequently tits tree.




RAW RESULTS

Taxonomy report

PROTOCOL


Lineage report

1)BLASTp vs NR, default NCBI parameters other than "1000 max target sequences"

2)BLASTp vs SWISSPROT NCBI default parameters other than "1000 max target sequences"

3)BLASTx NCBI default parameters other than "1000 max target sequences"



RESULTS ANALYSIS


Such as in the field 'BLAST' the results found in the three lineage reports from BLASTp vs NR, BLASTp vs SWISSPROT and BLASTx were not good enough, the proteins has different functions so there was no homologous sequences, which means there is no way of comparing the ORF sequence and their homologous sequences, which would make possible conclude something about the organism to which it belongs. Taking that into account the phylogeny and taxonomy can not be determined.



1)Blastp vs NR,  default NCBI  parameters other than "1000 max target sequences"

cellular organisms .................................................   299 hits   90 orgs [root]
. Bacteria .........................................................   284 hits   83 orgs 
. . Thermotogales ..................................................     4 hits    2 orgs [Thermotogae; Thermotogae (class)]
. . . Thermosipho melanesiensis BI429 ..............................     2 hits    1 orgs [Thermotogaceae; Thermosipho; Thermosipho melanesiensis]
. . . Thermotogales bacterium mesG1.Ag.4.2 .........................     2 hits    1 orgs [unclassified Thermotogales; unclassified Thermotogales (miscellaneous)]
. . Actinobacteria (class) .........................................     6 hits    3 orgs [Actinobacteria]
. . . Micrococcineae ...............................................     4 hits    2 orgs [Actinobacteridae; Actinomycetales]
. . . . Beutenbergia cavernae DSM 12333 ............................     2 hits    1 orgs [Beutenbergiaceae; Beutenbergia; Beutenbergia cavernae]
. . . . Sanguibacter keddieii DSM 10542 ............................     2 hits    1 orgs [Sanguibacteraceae; Sanguibacter; Sanguibacter keddieii]
. . . marine actinobacterium PHSC20C1 ..............................     2 hits    1 orgs [unclassified Actinobacteria; unclassified Actinobacteria (miscellaneous)]
. . Verrucomicrobia ................................................    16 hits    4 orgs [Chlamydiae/Verrucomicrobia group]
. . . Verrucomicrobiales ...........................................    12 hits    2 orgs [Verrucomicrobiae]
. . . . Verrucomicrobiae bacterium DG1235 ..........................    10 hits    1 orgs [unclassified Verrucomicrobiales; unclassified Verrucomicrobiales (miscellaneous)]
. . . . bacterium Ellin514 .........................................     2 hits    1 orgs [Verrucomicrobia subdivision 3]
. . . Opitutus terrae PB90-1 .......................................     2 hits    1 orgs [Opitutae; Opitutales; Opitutaceae; Opitutus; Opitutus terrae]
. . . Chthoniobacter flavus Ellin428 ...............................     2 hits    1 orgs [Spartobacteria; Chthoniobacter; Chthoniobacter flavus]
. . Firmicutes .....................................................    44 hits   15 orgs 
. . . Clostridia ...................................................    32 hits   10 orgs 
. . . . Clostridiales ..............................................    30 hits    9 orgs 
. . . . . Acetivibrio cellulolyticus CD2 ...........................     8 hits    1 orgs [Ruminococcaceae; Acetivibrio; Acetivibrio cellulolyticus]
. . . . . Thermincola potens JR ....................................     2 hits    1 orgs [Peptococcaceae; Thermincola; Thermincola potens]
. . . . . Syntrophothermus lipocalidus DSM 12680 ...................     2 hits    1 orgs [Syntrophomonadaceae; Syntrophothermus; Syntrophothermus lipocalidus]
. . . . . Blautia hydrogenotrophica DSM 10507 ......................     2 hits    1 orgs [unclassified Clostridiales; Blautia; Blautia hydrogenotrophica]
. . . . . Symbiobacterium thermophilum IAM 14863 ...................     2 hits    1 orgs [Clostridiales incertae sedis; Clostridiales Family XVIII. Incertae Sedis; Symbiobacterium; Symbiobacterium thermophilum]
. . . . . Clostridium thermocellum .................................    14 hits    4 orgs [Clostridiaceae; Clostridium]
. . . . . . Clostridium thermocellum ATCC 27405 ....................     4 hits    1 orgs 
. . . . . . Clostridium thermocellum DSM 2360 ......................     4 hits    1 orgs 
. . . . . . Clostridium thermocellum JW20 ..........................     4 hits    1 orgs 
. . . . . . Clostridium thermocellum DSM 1313 ......................     2 hits    1 orgs 
. . . . Caldicellulosiruptor kronotskyensis 2002 ...................     2 hits    1 orgs [Thermoanaerobacterales; Thermoanaerobacterales Family III. Incertae Sedis; Caldicellulosiruptor; Caldicellulosiruptor kronotskyensis]
. . . Bacillales ...................................................    12 hits    5 orgs [Bacilli]
. . . . Paenibacillus ..............................................     6 hits    2 orgs [Paenibacillaceae]
. . . . . Paenibacillus sp. JDR-2 ..................................     4 hits    1 orgs 
. . . . . Paenibacillus sp. oral taxon 786 str. D14 ................     2 hits    1 orgs [Paenibacillus sp. oral taxon 786]
. . . . Bacillus cereus ............................................     6 hits    3 orgs [Bacillaceae; Bacillus; Bacillus cereus group]
. . . . . Bacillus cereus G9842 ....................................     2 hits    1 orgs 
. . . . . Bacillus cereus E33L .....................................     2 hits    1 orgs 
. . . . . Bacillus cereus AH603 ....................................     2 hits    1 orgs 
. . Proteobacteria .................................................   178 hits   49 orgs 
. . . Gammaproteobacteria ..........................................   109 hits   32 orgs 
. . . . Cellvibrio japonicus Ueda107 ...............................    12 hits    1 orgs [Pseudomonadales; Pseudomonadaceae; Cellvibrio; Cellvibrio japonicus]
. . . . Pectobacterium .............................................    15 hits    3 orgs [Enterobacteriales; Enterobacteriaceae]
. . . . . Pectobacterium carotovorum ...............................     9 hits    2 orgs 
. . . . . . Pectobacterium carotovorum subsp. brasiliensis PBR1692 .     3 hits    1 orgs [Pectobacterium carotovorum subsp. brasiliensis]
. . . . . . Pectobacterium carotovorum subsp. carotovorum PC1 ......     6 hits    1 orgs [Pectobacterium carotovorum subsp. carotovorum]
. . . . . Pectobacterium wasabiae WPP163 ...........................     6 hits    1 orgs [Pectobacterium wasabiae]
. . . . Oceanospirillales ..........................................     4 hits    2 orgs 
. . . . . Kangiella koreensis DSM 16069 ............................     2 hits    1 orgs [Alcanivoracaceae; Kangiella; Kangiella koreensis]
. . . . . Hahella chejuensis KCTC 2396 .............................     2 hits    1 orgs [Hahellaceae; Hahella; Hahella chejuensis]
. . . . Vibrio .....................................................    32 hits   14 orgs [Vibrionales; Vibrionaceae]
. . . . . Vibrio harveyi group .....................................    20 hits   10 orgs 
. . . . . . Vibrio harveyi .........................................     4 hits    2 orgs 
. . . . . . . Vibrio harveyi HY01 ..................................     2 hits    1 orgs 
. . . . . . . Vibrio harveyi ATCC BAA-1116 .........................     2 hits    1 orgs 
. . . . . . Vibrio alginolyticus ...................................     4 hits    2 orgs 
. . . . . . . Vibrio alginolyticus 12G01 ...........................     2 hits    1 orgs 
. . . . . . . Vibrio alginolyticus 40B .............................     2 hits    1 orgs 
. . . . . . Vibrio parahaemolyticus ................................    12 hits    6 orgs 
. . . . . . . Vibrio parahaemolyticus K5030 ........................     2 hits    1 orgs 
. . . . . . . Vibrio parahaemolyticus AN-5034 ......................     2 hits    1 orgs 
. . . . . . . Vibrio parahaemolyticus Peru-466 .....................     2 hits    1 orgs 
. . . . . . . Vibrio parahaemolyticus AQ4037 .......................     2 hits    1 orgs 
. . . . . . . Vibrio parahaemolyticus RIMD 2210633 .................     2 hits    1 orgs 
. . . . . . . Vibrio parahaemolyticus AQ3810 .......................     2 hits    1 orgs 
. . . . . Vibrio splendidus ........................................     4 hits    2 orgs 
. . . . . . Vibrio splendidus LGP32 ................................     2 hits    1 orgs 
. . . . . . Vibrio splendidus 12B01 ................................     2 hits    1 orgs 
. . . . . Vibrio sp. Ex25 ..........................................     6 hits    1 orgs 
. . . . . Vibrio sp. MED222 ........................................     2 hits    1 orgs 
. . . . Alteromonadales ............................................    42 hits   10 orgs 
. . . . . Shewanella ...............................................    32 hits    8 orgs [Shewanellaceae]
. . . . . . Shewanella putrefaciens ................................    13 hits    2 orgs 
. . . . . . . Shewanella putrefaciens 200 ..........................    11 hits    1 orgs 
. . . . . . . Shewanella putrefaciens CN-32 ........................     2 hits    1 orgs 
. . . . . . Shewanella sp. W3-18-1 .................................     2 hits    1 orgs 
. . . . . . Shewanella halifaxensis HAW-EB4 ........................     2 hits    1 orgs [Shewanella halifaxensis]
. . . . . . Shewanella baltica .....................................     7 hits    3 orgs 
. . . . . . . Shewanella baltica OS185 .............................     4 hits    1 orgs 
. . . . . . . Shewanella baltica OS195 .............................     2 hits    1 orgs 
. . . . . . . Shewanella baltica OS678 .............................     1 hits    1 orgs 
. . . . . . Shewanella sp. ANA-3 ...................................     8 hits    1 orgs 
. . . . . Saccharophagus degradans 2-40 ............................     6 hits    1 orgs [Alteromonadaceae; Saccharophagus; Saccharophagus degradans]
. . . . . Ferrimonas balearica DSM 9799 ............................     4 hits    1 orgs [Ferrimonadaceae; Ferrimonas; Ferrimonas balearica]
. . . . Reinekea blandensis MED297 .................................     2 hits    1 orgs [unclassified Gammaproteobacteria; Reinekea; Reinekea blandensis]
. . . . Beggiatoa sp. SS ...........................................     2 hits    1 orgs [Thiotrichales; Thiotrichaceae; Beggiatoa]
. . . Alphaproteobacteria ..........................................    14 hits    5 orgs 
. . . . Rhodobacteraceae ...........................................    12 hits    4 orgs [Rhodobacterales]
. . . . . Oceanicola granulosus HTCC2516 ...........................     4 hits    1 orgs [Oceanicola; Oceanicola granulosus]
. . . . . Ahrensia sp. R2A130 ......................................     4 hits    1 orgs [Ahrensia]
. . . . . Roseibium sp. TrichSKD4 ..................................     2 hits    1 orgs [Roseibium]
. . . . . Roseovarius sp. TM1035 ...................................     2 hits    1 orgs [Roseovarius]
. . . . Agrobacterium tumefaciens str. C58 .........................     2 hits    1 orgs [Rhizobiales; Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium; Agrobacterium tumefaciens]
. . . delta/epsilon subdivisions ...................................    21 hits   10 orgs 
. . . . Campylobacterales ..........................................    11 hits    5 orgs [Epsilonproteobacteria]
. . . . . Campylobacteraceae .......................................     5 hits    3 orgs 
. . . . . . Arcobacter butzleri RM4018 .............................     2 hits    1 orgs [Arcobacter; Arcobacter butzleri]
. . . . . . Campylobacter fetus ....................................     3 hits    2 orgs [Campylobacter]
. . . . . . . Campylobacter fetus subsp. fetus 82-40 ...............     2 hits    1 orgs [Campylobacter fetus subsp. fetus]
. . . . . . . Campylobacter fetus subsp. venerealis str. Azul-94 ...     1 hits    1 orgs [Campylobacter fetus subsp. venerealis]
. . . . . Helicobacter winghamensis ATCC BAA-430 ...................     2 hits    1 orgs [Helicobacteraceae; Helicobacter; Helicobacter winghamensis]
. . . . . Campylobacterales bacterium GD 1 .........................     4 hits    1 orgs [unclassified Campylobacterales]
. . . . Deltaproteobacteria ........................................    10 hits    5 orgs 
. . . . . Desulfarculus baarsii DSM 2075 ...........................     2 hits    1 orgs [Desulfarculales; Desulfarculaceae; Desulfarculus; Desulfarculus baarsii]
. . . . . delta proteobacterium NaphS2 .............................     2 hits    1 orgs [unclassified Deltaproteobacteria; unclassified Deltaproteobacteria (miscellaneous)]
. . . . . Desulfotalea psychrophila LSv54 ..........................     2 hits    1 orgs [Desulfobacterales; Desulfobulbaceae; Desulfotalea; Desulfotalea psychrophila]
. . . . . Anaeromyxobacter dehalogenans 2CP-C ......................     2 hits    1 orgs [Myxococcales; Cystobacterineae; Myxococcaceae; Anaeromyxobacter; Anaeromyxobacter dehalogenans]
. . . . . Desulfohalobium retbaense DSM 5692 .......................     2 hits    1 orgs [Desulfovibrionales; Desulfohalobiaceae; Desulfohalobium; Desulfohalobium retbaense]
. . . Burkholderiales ..............................................    34 hits    2 orgs [Betaproteobacteria]
. . . . Leptothrix cholodnii SP-6 ..................................    32 hits    1 orgs [unclassified Burkholderiales; Burkholderiales Genera incertae sedis; Leptothrix; Leptothrix cholodnii]
. . . . Achromobacter piechaudii ATCC 43553 ........................     2 hits    1 orgs [Alcaligenaceae; Achromobacter; Achromobacter piechaudii]
. . Acidobacteria ..................................................     6 hits    3 orgs [Fibrobacteres/Acidobacteria group]
. . . Candidatus Koribacter versatilis Ellin345 ....................     2 hits    1 orgs [unclassifed Acidobacteria; Candidatus Koribacter; Candidatus Koribacter versatilis]
. . . Candidatus Solibacter usitatus Ellin6076 .....................     2 hits    1 orgs [Solibacteres; Solibacterales; Solibacteraceae; Candidatus Solibacter; Candidatus Solibacter usitatus]
. . . Acidobacterium sp. MP5ACTX8 ..................................     2 hits    1 orgs [Acidobacteria (class); Acidobacteriales; Acidobacteriaceae; Acidobacterium]
. . Bacteroidetes/Chlorobi group ...................................    28 hits    6 orgs 
. . . Chlorobiaceae ................................................     4 hits    2 orgs [Chlorobi; Chlorobia; Chlorobiales]
. . . . Chloroherpeton thalassium ATCC 35110 .......................     2 hits    1 orgs [Chloroherpeton; Chloroherpeton thalassium]
. . . . Chlorobium chlorochromatii CaD3 ............................     2 hits    1 orgs [Chlorobium/Pelodictyon group; Chlorobium; Chlorobium chlorochromatii]
. . . Bacteroidetes ................................................    24 hits    4 orgs 
. . . . Flavobacterium johnsoniae UW101 ............................    12 hits    1 orgs [Flavobacteria; Flavobacteriales; Flavobacteriaceae; Flavobacterium; Flavobacterium johnsoniae]
. . . . Sphingobacteriales .........................................    12 hits    3 orgs [Sphingobacteria]
. . . . . Salinibacter ruber .......................................    10 hits    2 orgs [Rhodothermaceae; Salinibacter]
. . . . . . Salinibacter ruber M8 ..................................     8 hits    1 orgs 
. . . . . . Salinibacter ruber DSM 13855 ...........................     2 hits    1 orgs 
. . . . . Pedobacter saltans DSM 12145 .............................     2 hits    1 orgs [Sphingobacteriaceae; Pedobacter; Pedobacter saltans]
. . Deinococcus geothermalis DSM 11300 .............................     2 hits    1 orgs [Deinococcus-Thermus; Deinococci; Deinococcales; Deinococcaceae; Deinococcus; Deinococcus geothermalis]
. Archaea ..........................................................    12 hits    5 orgs 
. . Staphylothermus ................................................     4 hits    2 orgs [Crenarchaeota; Thermoprotei; Desulfurococcales; Desulfurococcaceae]
. . . Staphylothermus hellenicus DSM 12710 .........................     2 hits    1 orgs [Staphylothermus hellenicus]
. . . Staphylothermus marinus F1 ...................................     2 hits    1 orgs [Staphylothermus marinus]
. . Euryarchaeota ..................................................     4 hits    2 orgs 
. . . Aciduliprofundum boonei T469 .................................     2 hits    1 orgs [unclassified Euryarchaeota; Aciduliprofundum; Aciduliprofundum boonei]
. . . Methanosphaerula palustris E1-9c .............................     2 hits    1 orgs [Methanomicrobia; Methanomicrobiales; unclassified Methanomicrobiales; Genera incertae sedis; Methanosphaerula; Methanosphaerula palustris]
. . Nitrosopumilus maritimus SCM1 ..................................     4 hits    1 orgs [Thaumarchaeota; marine archaeal group 1; Nitrosopumilales; Nitrosopumilaceae; Nitrosopumilus; Nitrosopumilus maritimus]
. Eukaryota ........................................................     3 hits    2 orgs 
. . Physcomitrella patens subsp. patens ............................     2 hits    1 orgs [Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Moss Superclass V; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella; Physcomitrella patens]
. . Hydra magnipapillata ...........................................     1 hits    1 orgs [Fungi/Metazoa group; Metazoa; Eumetazoa; Cnidaria; Hydrozoa; Hydroida; Anthomedusae; Hydridae; Hydra]



2)BLASTp vs swissprot    NCBI default parameters other than "1000 max target sequences"    


Lineage Report
cellular organisms
. Bacteria           [bacteria]
. . Thermotogales      [thermotogales]
. . . Thermosipho melanesiensis BI429 -------------------------   48  2 hits [thermotogales]          fibronectin, type III domain-containing protein [Thermosiph
. . . Thermotogales bacterium mesG1.Ag.4.2 ....................   36  2 hits [thermotogales]          hypothetical protein ThebaDRAFT_0397 [Thermotogales bacteri
. . Beutenbergia cavernae DSM 12333 ---------------------------   45  2 hits [high GC Gram+]          PA14 domain protein [Beutenbergia cavernae DSM 12333] >gi|2
. . Verrucomicrobiae bacterium DG1235 .........................   45 10 hits [verrucomicrobia]        Putative Ig domain family [Verrucomicrobiae bacterium DG123
. . Acetivibrio cellulolyticus CD2 ............................   44  6 hits [firmicutes]             PKD domain containing protein [Acetivibrio cellulolyticus C
. . Cellvibrio japonicus Ueda107 ..............................   43 12 hits [g-proteobacteria]       glucan exo-1,3-beta glucosidase glu5A [Cellvibrio japonicus
. . Photobacterium leiognathi subsp. mandapamensis svers.1.1. .   43  1 hit  [g-proteobacteria]       putative Ig domain protein [Photobacterium leiognathi subsp
. . Thermincola potens JR .....................................   43  2 hits [firmicutes]             cytochrome C family protein [Thermincola sp. JR] >gi|296032
. . Oceanicola granulosus HTCC2516 ............................   42  4 hits [a-proteobacteria]       Peptidase S8 and S53, subtilisin, kexin, sedolisin [Oceanic
. . Arcobacter butzleri RM4018 ................................   42  2 hits [e-proteobacteria]       fibronectin type III domain-containing protein [Arcobacter 
. . Pectobacterium carotovorum subsp. brasiliensis PBR1692 ....   42  3 hits [enterobacteria]         outer membrane adhesin like proteiin [Pectobacterium caroto
. . Kangiella koreensis DSM 16069 .............................   42  2 hits [g-proteobacteria]       hypothetical protein Kkor_2600 [Kangiella koreensis DSM 160
. . Syntrophothermus lipocalidus DSM 12680 ....................   41  2 hits [firmicutes]             Fibronectin type III domain protein [Syntrophothermus lipoc
. . Pectobacterium wasabiae WPP163 ............................   41  6 hits [enterobacteria]         Ig family protein [Pectobacterium wasabiae WPP163] >gi|2616
. . Candidatus Koribacter versatilis Ellin345 .................   41  2 hits [bacteria]               fibronectin, type III [Candidatus Koribacter versatilis Ell
. . Desulfarculus baarsii DSM 2075 ............................   41  2 hits [d-proteobacteria]       fibronectin type III domain protein [Desulfarculus baarsii 
. . delta proteobacterium NaphS2 ..............................   41  2 hits [d-proteobacteria]       tetratricopeptide repeat protein [delta proteobacterium Nap
. . Chloroherpeton thalassium ATCC 35110 ......................   41  2 hits [green sulfur bacteria]  peptidase S8/S53 subtilisin kexin sedolisin [Chloroherpeton
. . Pectobacterium carotovorum subsp. carotovorum PC1 .........   40  6 hits [enterobacteria]         Ig family protein [Pectobacterium carotovorum subsp. caroto
. . Vibrio harveyi HY01 .......................................   40  2 hits [g-proteobacteria]       calx-beta domain family [Vibrio harveyi HY01] >gi|148870632
. . Shewanella putrefaciens 200 ...............................   39 11 hits [g-proteobacteria]       outer membrane adhesin like proteiin [Shewanella putrefacie
. . Vibrio splendidus LGP32 ...................................   39  2 hits [g-proteobacteria]       hypothetical protein VS_II0856 [Vibrio splendidus LGP32] >g
. . Shewanella sp. W3-18-1 ....................................   39  2 hits [g-proteobacteria]       fibronectin, type III domain-containing protein [Shewanella
. . Leptothrix cholodnii SP-6 .................................   39 32 hits [b-proteobacteria]       outer membrane adhesin-like protein [Leptothrix cholodnii S
. . Shewanella halifaxensis HAW-EB4 ...........................   39  2 hits [g-proteobacteria]       GLUG domain-containing protein [Shewanella halifaxensis HAW
. . Shewanella baltica OS185 ..................................   39  4 hits [g-proteobacteria]       putative outer membrane adhesin-like protein [Shewanella ba
. . Candidatus Solibacter usitatus Ellin6076 ..................   39  2 hits [bacteria]               fibronectin, type III domain-containing protein [Candidatus
. . Vibrio sp. Ex25 ...........................................   39  6 hits [g-proteobacteria]       putative RTX toxin [Vibrio sp. Ex25] >gi|262337769|gb|ACY51
. . Saccharophagus degradans 2-40 .............................   39  6 hits [g-proteobacteria]       hypothetical protein Sde_0798 [Saccharophagus degradans 2-4
. . Vibrio splendidus 12B01 ...................................   38  2 hits [g-proteobacteria]       hypothetical protein V12B01_12555 [Vibrio splendidus 12B01]
. . Paenibacillus sp. JDR-2 ...................................   38  4 hits [firmicutes]             S-layer domain protein [Paenibacillus sp. JDR-2] >gi|247542
. . Opitutus terrae PB90-1 ....................................   38  2 hits [verrucomicrobia]        fibronectin type III domain-containing protein [Opitutus te
. . Vibrio sp. MED222 .........................................   38  2 hits [g-proteobacteria]       hypothetical protein MED222_04835 [Vibrio sp. MED222] >gi|8
. . Vibrio alginolyticus 12G01 ................................   38  2 hits [g-proteobacteria]       putative RTX toxin [Vibrio alginolyticus 12G01] >gi|9118743
. . bacterium Ellin514 ........................................   38  2 hits [verrucomicrobia]        coagulation factor 5/8 type domain protein [bacterium Ellin
. . Flavobacterium johnsoniae UW101 ...........................   38 12 hits [CFB group bacteria]     hypothetical protein Fjoh_3952 [Flavobacterium johnsoniae U
. . Ahrensia sp. R2A130 .......................................   38  4 hits [a-proteobacteria]       rhizobiocin RzcA [Ahrensia sp. R2A130] >gi|303293819|gb|EFL
. . Desulfotalea psychrophila LSv54 ...........................   38  2 hits [d-proteobacteria]       hypothetical protein DP0434 [Desulfotalea psychrophila LSv5
. . Shewanella baltica OS195 ..................................   38  2 hits [g-proteobacteria]       outer membrane adhesin-like protein [Shewanella baltica OS1
. . Shewanella baltica OS678 ..................................   38  1 hit  [g-proteobacteria]       conserved hypothetical protein [Shewanella baltica OS678]
. . Chthoniobacter flavus Ellin428 ............................   38  2 hits [verrucomicrobia]        Fibronectin type III domain protein [Chthoniobacter flavus 
. . Campylobacter fetus subsp. fetus 82-40 ....................   37  2 hits [e-proteobacteria]       fibronectin type III domain-containing protein [Campylobact
. . Chlorobium chlorochromatii CaD3 ...........................   37  2 hits [green sulfur bacteria]  VCBS [Chlorobium chlorochromatii CaD3] >gi|78171404|gb|ABB2
. . Vibrio alginolyticus 40B ..................................   37  2 hits [g-proteobacteria]       conserved hypothetical protein [Vibrio alginolyticus 40B] >
. . Helicobacter winghamensis ATCC BAA-430 ....................   37  2 hits [e-proteobacteria]       fibronectin domain-containing lipoprotein [Helicobacter win
. . Roseibium sp. TrichSKD4 ...................................   37  2 hits [a-proteobacteria]       outer membrane adhesin like protein [Roseibium sp. TrichSKD
. . Caldicellulosiruptor kronotskyensis 2002 ..................   37  2 hits [firmicutes]             glycoside hydrolase family 16 [Caldicellulosiruptor kronots
. . Campylobacter fetus subsp. venerealis str. Azul-94 ........   37  1 hit  [e-proteobacteria]       fibronectin type III domain-containing protein [Campylobact
. . Shewanella putrefaciens CN-32 .............................   37  2 hits [g-proteobacteria]       fibronectin, type III domain-containing protein [Shewanella
. . Campylobacterales bacterium GD 1 ..........................   37  4 hits [e-proteobacteria]       fibronectin, type III [Campylobacterales bacterium GD 1] >g
. . Paenibacillus sp. oral taxon 786 str. D14 .................   37  2 hits [firmicutes]             predicted protein [Paenibacillus sp. oral taxon 786 str. D1
. . Blautia hydrogenotrophica DSM 10507 .......................   37  2 hits [firmicutes]             hypothetical protein RUMHYD_00802 [Blautia hydrogenotrophic
. . Shewanella sp. ANA-3 ......................................   37  8 hits [g-proteobacteria]       Ig family protein [Shewanella sp. ANA-3] >gi|117610958|gb|A
. . Salinibacter ruber M8 .....................................   37  8 hits [CFB group bacteria]     cellulase [Salinibacter ruber M8] >gi|294342265|emb|CBH2304
. . Ferrimonas balearica DSM 9799 .............................   37  4 hits [g-proteobacteria]       Dystroglycan-type cadherin domain protein [Ferrimonas balea
. . Deinococcus geothermalis DSM 11300 ........................   37  2 hits [bacteria]               glycosy hydrolase family protein [Deinococcus geothermalis 
. . Symbiobacterium thermophilum IAM 14863 ....................   36  2 hits [firmicutes]             putative S-layer associated protein [Symbiobacterium thermo
. . Reinekea blandensis MED297 ................................   36  2 hits [g-proteobacteria]       putative RTX toxin [Reinekea sp. MED297] >gi|88779842|gb|EA
. . Paraprevotella xylaniphila YIT 11841 ......................   36  2 hits [CFB group bacteria]     fibronectin type III domain protein [Paraprevotella xylanip
. . Clostridium thermocellum ATCC 27405 .......................   36  4 hits [firmicutes]             fibronectin, type III [Clostridium thermocellum ATCC 27405]
. . Clostridium thermocellum DSM 2360 .........................   36  4 hits [firmicutes]             fibronectin, type III [Clostridium thermocellum ATCC 27405]
. . Clostridium thermocellum JW20 .............................   36  4 hits [firmicutes]             fibronectin, type III [Clostridium thermocellum ATCC 27405]
. . Clostridium thermocellum DSM 1313 .........................   36  2 hits [firmicutes]             fibronectin, type III [Clostridium thermocellum ATCC 27405]
. . Pedobacter saltans DSM 12145 ..............................   36  2 hits [CFB group bacteria]     Fibronectin type III domain protein [Pedobacter saltans DSM
. . Vibrio parahaemolyticus K5030 .............................   36  2 hits [g-proteobacteria]       Ig domain protein [Vibrio parahaemolyticus K5030] >gi|26087
. . Vibrio parahaemolyticus AN-5034 ...........................   36  2 hits [g-proteobacteria]       Ig domain protein [Vibrio parahaemolyticus K5030] >gi|26087
. . Vibrio parahaemolyticus Peru-466 ..........................   36  2 hits [g-proteobacteria]       Ig domain protein [Vibrio parahaemolyticus K5030] >gi|26087
. . Vibrio parahaemolyticus AQ4037 ............................   36  2 hits [g-proteobacteria]       Ig domain protein [Vibrio parahaemolyticus AQ4037] >gi|3081
. . Vibrio parahaemolyticus RIMD 2210633 ......................   36  2 hits [g-proteobacteria]       putative RTX toxin [Vibrio parahaemolyticus RIMD 2210633] >
. . Anaeromyxobacter dehalogenans 2CP-C .......................   36  2 hits [d-proteobacteria]       fibronectin, type III/multicopper oxidase, type 2 [Anaeromy
. . Beggiatoa sp. SS ..........................................   36  2 hits [g-proteobacteria]       Fibronectin, type III [Beggiatoa sp. SS] >gi|152145510|gb|E
. . Salinibacter ruber DSM 13855 ..............................   36  2 hits [CFB group bacteria]     cellulose 1,4-beta-cellobiosidase-like protein [Salinibacte
. . Streptomyces venezuelae ATCC 10712 ........................   36  1 hit  [high GC Gram+]          hypothetical protein SVEN_4161 [Streptomyces venezuelae ATC
. . Achromobacter piechaudii ATCC 43553 .......................   36  2 hits [b-proteobacteria]       outer membrane adhesin like protein [Achromobacter piechaud
. . Bacillus cereus G9842 .....................................   36  2 hits [firmicutes]             fibronectin type III domain protein [Bacillus cereus G9842]
. . Roseovarius sp. TM1035 ....................................   36  2 hits [a-proteobacteria]       hypothetical protein RTM1035_05035 [Roseovarius sp. TM1035]
. . Acidobacterium sp. MP5ACTX8 ...............................   35  2 hits [bacteria]               Fibronectin type III domain protein [Acidobacterium sp. MP5
. . marine actinobacterium PHSC20C1 ...........................   35  2 hits [high GC Gram+]          hypothetical protein A20C1_09539 [marine actinobacterium PH
. . Sanguibacter keddieii DSM 10542 ...........................   35  2 hits [high GC Gram+]          hypothetical protein Sked_04370 [Sanguibacter keddieii DSM 
. . Desulfohalobium retbaense DSM 5692 ........................   35  2 hits [d-proteobacteria]       type 1 secretion C-terminal target domain-containing protei
. . Vibrio parahaemolyticus AQ3810 ............................   35  2 hits [g-proteobacteria]       putative RTX toxin [Vibrio parahaemolyticus AQ3810] >gi|149
. . Hahella chejuensis KCTC 2396 ..............................   35  2 hits [g-proteobacteria]       Rhs family protein [Hahella chejuensis KCTC 2396] >gi|83636
. . Bacillus cereus E33L ......................................   35  2 hits [firmicutes]             chitin-binding protein [Bacillus cereus E33L] >gi|66970452|
. Staphylothermus hellenicus DSM 12710 ------------------------   40  2 hits [crenarchaeotes]         Fibronectin type III domain protein [Staphylothermus hellen
. Staphylothermus marinus F1 ..................................   39  2 hits [crenarchaeotes]         fibronectin, type III domain-containing protein [Staphyloth
. Aciduliprofundum boonei T469 ................................   39  2 hits [euryarchaeotes]         Fibronectin type III domain protein [Aciduliprofundum boone
. Physcomitrella patens subsp. patens .........................   38  2 hits [mosses]                 predicted protein [Physcomitrella patens subsp. patens] >gi
. Hydra magnipapillata ........................................   36  1 hit  [hydrozoans]             PREDICTED: similar to paired basic amino acid cleaving syst
. Nitrosopumilus maritimus SCM1 ...............................   36  4 hits [archaea]                fibronectin type III domain-containing protein [Nitrosopumi
. Methanosphaerula palustris E1-9c ............................   36  2 hits [euryarchaeotes]         Fibronectin type III domain protein [Methanosphaerula palus




3)BLASTx NCBI default parameters other than "1000 max target sequences"    

Lineage Report
cellular organisms
. Bacteria           [bacteria]
. . Firmicutes         [firmicutes]
. . . Clostridia         [firmicutes]
. . . . Clostridiales      [firmicutes]
. . . . . Acetivibrio cellulolyticus CD2 ---------------------   53 12 hits [firmicutes]             PKD domain containing protein [Acetivibrio cellulolyticus C
. . . . . Clostridium cellulolyticum H10 .....................   44  6 hits [firmicutes]             cellulosome anchoring protein cohesin region [Clostridium c
. . . . . Syntrophothermus lipocalidus DSM 12680 .............   43  4 hits [firmicutes]             Fibronectin type III domain protein [Syntrophothermus lipoc
. . . . . Clostridium thermocellum DSM 1313 ..................   43  4 hits [firmicutes]             PKD domain containing protein [Clostridium thermocellum DSM
. . . . . Clostridium thermocellum DSM 2360 ..................   43  8 hits [firmicutes]             PKD domain containing protein [Clostridium thermocellum DSM
. . . . . Clostridium thermocellum ATCC 27405 ................   43  8 hits [firmicutes]             cellulose 1,4-beta-cellobiosidase [Clostridium thermocellum
. . . . . Thermincola potens JR ..............................   42  2 hits [firmicutes]             cytochrome C family protein [Thermincola sp. JR] >gi|296032
. . . . . Clostridium thermocellum JW20 ......................   42  8 hits [firmicutes]             PKD domain containing protein [Clostridium thermocellum JW2
. . . . . Coprococcus eutactus ATCC 27759 ....................   38  2 hits [firmicutes]             hypothetical protein COPEUT_02248 [Coprococcus eutactus ATC
. . . . . Syntrophobotulus glycolicus DSM 8271 ...............   36  2 hits [firmicutes]             cell wall binding repeat 2-containing protein [Syntrophobot
. . . . . Clostridium lentocellum DSM 5427 ...................   36  2 hits [firmicutes]             RHS repeat-associated core domain protein [Clostridium lent
. . . . Caldicellulosiruptor kronotskyensis 2002 -------------   38  2 hits [firmicutes]             glycoside hydrolase family 16 [Caldicellulosiruptor kronots
. . . Paenibacillus sp. oral taxon 786 str. D14 --------------   51  2 hits [firmicutes]             predicted protein [Paenibacillus sp. oral taxon 786 str. D1
. . . Paenibacillus sp. JDR-2 ................................   42  6 hits [firmicutes]             S-layer domain protein [Paenibacillus sp. JDR-2] >gi|247542
. . . Bacillus cereus AH621 ..................................   38  2 hits [firmicutes]             Chitin-binding domain 3 protein [Bacillus cereus AH621] >gi
. . . Bacillus thuringiensis serovar sotto str. T04001 .......   38  2 hits [firmicutes]             Chitin-binding domain 3 protein [Bacillus thuringiensis ser
. . . Bacillus thuringiensis IBL 4222 ........................   37  2 hits [firmicutes]             Chitin-binding domain 3 protein [Bacillus thuringiensis IBL
. . . Bacillus thuringiensis IBL 200 .........................   37  2 hits [firmicutes]             Chitin-binding domain 3 protein [Bacillus thuringiensis IBL
. . . Bacillus thuringiensis serovar huazhongensis BGSC 4BD1 .   37  4 hits [firmicutes]             Chitin-binding domain 3 protein [Bacillus thuringiensis ser
. . . Bacillus cereus AH603 ..................................   37  4 hits [firmicutes]             Chitin-binding domain 3 protein [Bacillus cereus AH603] >gi
. . . Bacillus cereus Rock4-2 ................................   37  2 hits [firmicutes]             Chitin-binding domain 3 protein [Bacillus cereus Rock4-2] >
. . . Bacillus cereus ATCC 10876 .............................   37  2 hits [firmicutes]             Chitin-binding domain 3 protein [Bacillus cereus ATCC 10876
. . . Bacillus thuringiensis serovar israelensis ATCC 35646 ..   37  2 hits [firmicutes]             Carbohydrate binding domain protein [Bacillus thuringiensis
. . . Bacillus cereus G9842 ..................................   37  2 hits [firmicutes]             Carbohydrate binding domain protein [Bacillus thuringiensis
. . . Bacillus cereus F65185 .................................   37  2 hits [firmicutes]             Chitin-binding domain 3 protein [Bacillus cereus F65185] >g
. . . Bacillus cereus 172560W ................................   37  2 hits [firmicutes]             Chitin-binding domain 3 protein [Bacillus cereus 172560W] >
. . . Bacillus cereus AH1134 .................................   37  2 hits [firmicutes]             chitin-binding domain 3 protein [Bacillus cereus AH1134] >g
. . . Bacillus thuringiensis serovar kurstaki str. T03a001 ...   36  2 hits [firmicutes]             Chitin-binding domain 3 protein [Bacillus thuringiensis ser
. . . Bacillus cereus R309803 ................................   36  2 hits [firmicutes]             Chitin-binding domain 3 protein [Bacillus cereus R309803] >
. . . Bacillus cereus Q1 .....................................   36  2 hits [firmicutes]             Chitin binding protein [Bacillus cereus Q1] >gi|229021190|r
. . . Bacillus cereus AH1273 .................................   36  2 hits [firmicutes]             Chitin binding protein [Bacillus cereus Q1] >gi|229021190|r
. . . Bacillus cereus AH1272 .................................   36  2 hits [firmicutes]             Chitin binding protein [Bacillus cereus Q1] >gi|229021190|r
. . . Bacillus cereus ........................................   36  2 hits [firmicutes]             chitin-binding domain protein [Bacillus cereus] >gi|2087020
. . . Bacillus cereus H3081.97 ...............................   36  2 hits [firmicutes]             chitin-binding domain protein [Bacillus cereus] >gi|2087020
. . . Bacillus cereus AH187 ..................................   36  2 hits [firmicutes]             chitin-binding domain protein [Bacillus cereus] >gi|2087020
. . . Bacillus cereus BDRD-ST26 ..............................   36  2 hits [firmicutes]             chitin-binding domain protein [Bacillus cereus] >gi|2087020
. . . Bacillus cereus E33L ...................................   36  2 hits [firmicutes]             chitin-binding protein [Bacillus cereus E33L] >gi|66970452|
. . . Listeria innocua FSL J1-023 ............................   36  1 hit  [firmicutes]             chitin-binding protein/carbohydrate-binding protein [Lister
. . . Bacillus cereus BDRD-ST196 .............................   36  2 hits [firmicutes]             Chitin-binding domain 3 protein [Bacillus cereus BDRD-ST196
. . . Bacillus weihenstephanensis KBAB4 ......................   36  2 hits [firmicutes]             chitin-binding domain-containing protein [Bacillus weihenst
. . . Enterococcus casseliflavus ATCC 12755 ..................   36  2 hits [firmicutes]             trans-hexaprenyltranstransferase [Enterococcus casseliflavu
. . . Paenibacillus polymyxa SC2 .............................   36  2 hits [firmicutes]             exoglucanase a [Paenibacillus polymyxa SC2] >gi|309245481|g
. . . Enterococcus casseliflavus EC20 ........................   36  2 hits [firmicutes]             polyprenyl synthetase [Enterococcus casseliflavus EC20] >gi
. . . Enterococcus casseliflavus EC30 ........................   36  2 hits [firmicutes]             polyprenyl synthetase [Enterococcus casseliflavus EC30] >gi
. . . Enterococcus casseliflavus EC10 ........................   36  2 hits [firmicutes]             polyprenyl synthetase [Enterococcus casseliflavus EC30] >gi
. . . Bacillus mycoides DSM 2048 .............................   36  2 hits [firmicutes]             Chitin-binding domain 3 protein [Bacillus mycoides DSM 2048
. . Thermosipho melanesiensis BI429 --------------------------   50  2 hits [thermotogales]          fibronectin, type III domain-containing protein [Thermosiph
. . Cellvibrio japonicus Ueda107 .............................   46  6 hits [g-proteobacteria]       glucan exo-1,3-beta glucosidase glu5A [Cellvibrio japonicus
. . Terriglobus saanensis SP1PR4 .............................   44  2 hits [bacteria]               coagulation factor 5/8 type domain-containing protein [Terr
. . Arcobacter butzleri RM4018 ...............................   44  4 hits [e-proteobacteria]       fibronectin type III domain-containing protein [Arcobacter 
. . Chloroherpeton thalassium ATCC 35110 .....................   43  2 hits [green sulfur bacteria]  peptidase S8/S53 subtilisin kexin sedolisin [Chloroherpeton
. . Salinibacter ruber M8 ....................................   42 10 hits [CFB group bacteria]     cellulase [Salinibacter ruber M8] >gi|294342265|emb|CBH2304
. . Candidatus Solibacter usitatus Ellin6076 .................   42  2 hits [bacteria]               fibronectin, type III domain-containing protein [Candidatus
. . Candidatus Koribacter versatilis Ellin345 ................   42  2 hits [bacteria]               fibronectin, type III [Candidatus Koribacter versatilis Ell
. . delta proteobacterium NaphS2 .............................   41  2 hits [d-proteobacteria]       tetratricopeptide repeat protein [delta proteobacterium Nap
. . Beutenbergia cavernae DSM 12333 ..........................   41  2 hits [high GC Gram+]          PA14 domain protein [Beutenbergia cavernae DSM 12333] >gi|2
. . Campylobacterales bacterium GD 1 .........................   41  4 hits [e-proteobacteria]       fibronectin, type III [Campylobacterales bacterium GD 1] >g
. . Verrucomicrobiae bacterium DG1235 ........................   41 10 hits [verrucomicrobia]        Putative Ig domain family [Verrucomicrobiae bacterium DG123
. . Mycobacterium gilvum PYR-GCK .............................   41  2 hits [high GC Gram+]          YVTN beta-propeller repeat-containing protein [Mycobacteriu
. . Deinococcus geothermalis DSM 11300 .......................   41  2 hits [bacteria]               glycosy hydrolase family protein [Deinococcus geothermalis 
. . Vibrio splendidus LGP32 ..................................   40  2 hits [g-proteobacteria]       hypothetical protein VS_II0856 [Vibrio splendidus LGP32] >g
. . Campylobacter fetus subsp. venerealis str. Azul-94 .......   40  1 hit  [e-proteobacteria]       fibronectin type III domain-containing protein [Campylobact
. . Campylobacter fetus subsp. fetus 82-40 ...................   40  2 hits [e-proteobacteria]       fibronectin type III domain-containing protein [Campylobact
. . Desulfarculus baarsii DSM 2075 ...........................   40  2 hits [d-proteobacteria]       fibronectin type III domain protein [Desulfarculus baarsii 
. . Helicobacter winghamensis ATCC BAA-430 ...................   40  2 hits [e-proteobacteria]       fibronectin domain-containing lipoprotein [Helicobacter win
. . Chthoniobacter flavus Ellin428 ...........................   40  4 hits [verrucomicrobia]        Fibronectin type III domain protein [Chthoniobacter flavus 
. . Salinibacter ruber DSM 13855 .............................   40  4 hits [CFB group bacteria]     cellulose 1,4-beta-cellobiosidase-like protein [Salinibacte
. . Vibrio splendidus 12B01 ..................................   39  2 hits [g-proteobacteria]       hypothetical protein V12B01_12555 [Vibrio splendidus 12B01]
. . Vibrio sp. MED222 ........................................   39  2 hits [g-proteobacteria]       hypothetical protein MED222_04835 [Vibrio sp. MED222] >gi|8
. . Sulfuricurvum kujiense DSM 16994 .........................   38  2 hits [e-proteobacteria]       fibronectin type iii domain protein [Sulfuricurvum kujiense
. . Bacteroides cellulosilyticus DSM 14838 ...................   38  2 hits [CFB group bacteria]     hypothetical protein BACCELL_00850 [Bacteroides cellulosily
. . Opitutus terrae PB90-1 ...................................   38  2 hits [verrucomicrobia]        fibronectin type III domain-containing protein [Opitutus te
. . Paraprevotella xylaniphila YIT 11841 .....................   38  2 hits [CFB group bacteria]     fibronectin type III domain protein [Paraprevotella xylanip
. . Pedobacter saltans DSM 12145 .............................   38  2 hits [CFB group bacteria]     Fibronectin type III domain protein [Pedobacter saltans DSM
. . Roseibium sp. TrichSKD4 ..................................   37  4 hits [a-proteobacteria]       outer membrane adhesin like protein [Roseibium sp. TrichSKD
. . Beggiatoa sp. SS .........................................   37  2 hits [g-proteobacteria]       Fibronectin, type III [Beggiatoa sp. SS] >gi|152145510|gb|E
. . Saccharophagus degradans 2-40 ............................   37  2 hits [g-proteobacteria]       endoglucanase-like protein [Saccharophagus degradans 2-40] 
. . Kangiella koreensis DSM 16069 ............................   37  2 hits [g-proteobacteria]       hypothetical protein Kkor_2600 [Kangiella koreensis DSM 160
. . Shewanella piezotolerans WP3 .............................   37  2 hits [g-proteobacteria]       collagenase [Shewanella piezotolerans WP3] >gi|212556809|gb
. . Anaeromyxobacter dehalogenans 2CP-C ......................   37  2 hits [d-proteobacteria]       fibronectin, type III/multicopper oxidase, type 2 [Anaeromy
. . Thermobaculum terrenum ATCC BAA-798 ......................   36  2 hits [bacteria]               serine/threonine protein kinase [Thermobaculum terrenum ATC
. . Dictyoglomus turgidum DSM 6724 ...........................   36  2 hits [bacteria]               Fibronectin type III domain protein [Dictyoglomus turgidum 
. . Roseovarius sp. TM1035 ...................................   36  2 hits [a-proteobacteria]       hypothetical protein RTM1035_05035 [Roseovarius sp. TM1035]
. . Vibrio parahaemolyticus AQ4037 ...........................   36  2 hits [g-proteobacteria]       Ig domain protein [Vibrio parahaemolyticus AQ4037] >gi|3081
. . Helicobacter pylori Cuz20 ................................   36  1 hit  [e-proteobacteria]       hypothetical protein HPCU_03980 [Helicobacter pylori Cuz20]
. . Ferrimonas balearica DSM 9799 ............................   36  2 hits [g-proteobacteria]       Dystroglycan-type cadherin domain protein [Ferrimonas balea
. . Vibrio parahaemolyticus K5030 ............................   36  2 hits [g-proteobacteria]       Ig domain protein [Vibrio parahaemolyticus K5030] >gi|26087
. . Vibrio parahaemolyticus AN-5034 ..........................   36  2 hits [g-proteobacteria]       Ig domain protein [Vibrio parahaemolyticus K5030] >gi|26087
. . Vibrio parahaemolyticus Peru-466 .........................   36  2 hits [g-proteobacteria]       Ig domain protein [Vibrio parahaemolyticus K5030] >gi|26087
. . Shewanella halifaxensis HAW-EB4 ..........................   36  2 hits [g-proteobacteria]       GLUG domain-containing protein [Shewanella halifaxensis HAW
. . Lentisphaera araneosa HTCC2155 ...........................   36  2 hits [bacteria]               GTP-binding protein [Lentisphaera araneosa HTCC2155] >gi|14
. . Vibrio parahaemolyticus RIMD 2210633 .....................   36  2 hits [g-proteobacteria]       putative RTX toxin [Vibrio parahaemolyticus RIMD 2210633] >
. . Bacteroides helcogenes P 36-108 ..........................   36  2 hits [CFB group bacteria]     TonB-dependent receptor plug [Bacteroides helcogenes P 36-1
. . bacterium Ellin514 .......................................   36  2 hits [verrucomicrobia]        Carbohydrate binding family 6 [bacterium Ellin514] >gi|2238
. Halorubrum lacusprofundi ATCC 49239 ------------------------   42  2 hits [euryarchaeotes]         Fibronectin type III domain protein [Halorubrum lacusprofun
. Physcomitrella patens subsp. patens ........................   42  2 hits [mosses]                 predicted protein [Physcomitrella patens subsp. patens] >gi
. Staphylothermus hellenicus DSM 12710 .......................   41  2 hits [crenarchaeotes]         Fibronectin type III domain protein [Staphylothermus hellen
. Aciduliprofundum boonei T469 ...............................   41  6 hits [euryarchaeotes]         Fibronectin type III domain protein [Aciduliprofundum boone
. Staphylothermus marinus F1 .................................   40  2 hits [crenarchaeotes]         fibronectin, type III domain-containing protein [Staphyloth
. Nitrosopumilus maritimus SCM1 ..............................   39  2 hits [archaea]                fibronectin type III domain-containing protein [Nitrosopumi
. Haloquadratum walsbyi DSM 16790 ............................   37  2 hits [euryarchaeotes]         hypothetical protein HQ2117A [Haloquadratum walsbyi DSM 167
. Magnaporthe oryzae 70-15 ...................................   37  2 hits [ascomycetes]            hypothetical protein MGG_10250 [Magnaporthe oryzae 70-15] >
. Archaeoglobus veneficus SNP6 ...............................   36  2 hits [euryarchaeotes]         Subtilisin [Archaeoglobus veneficus SNP6] >gi|327316291|gb|
. Harpegnathos saltator ......................................   36  1 hit  [ants]                   Protein dopey-1-like protein [Harpegnathos saltator]

BLAST

PROTOCOL


1)BLASTp vs NR NCBI default parameters other than "1000 max target sequences"

2)BLASTp vs Swissprot NCBI default parameters other than "1000 max target sequences"

3)BLASTx NCBI default parameters other than "1000 max target sequences"



RESULTS ANALYSIS


Primarily it was runed the BLASTp vs NR because it is the most embracing data base. The results produce significant alignments however the results were not conclusive, the scores were to low and the E-values were to high. The values of the score were between 35.8 and 48.1 meaning it were to low. Besides that the E-values were between 10.0 and 0.002 meaning it were to high. From this data it could be concluded that there is no homologous sequences for the ORF in study.


Then it was runed the BLASTp vs SWISSPROT to compare results, unlike the BLASTp vs NR this is more specific. The results produce significant alignments however once again the results were not conclusive, the scores were to low and the E-values were to high. The values of the score were between 31.6 and 33.1 meaning it were to low. Besides that the E-values were between 8.5 and 2.8 meaning it qere to high. It could be concluded that there is no homologous sequences for the ORF in study.


Finally it was runed the BLASTx,contrary to the BLASTp the results from the BLASTx were more acceptable.The results produce significant alignments and, the score values and the E-values were within the expected ones. The values of the score were between 36.2 and 53.5 meaning it were good. Besides that the E-values were between 7.8 and 5e-05 meaning it were good. Those results could indicate the existence of homologous sequences however through the lineage report it could be seen that the proteins has different functions which suggests that there is no homologous sequences.




RAW RESULTS

1)BLASTp vs NR   NCBI default parameters other than "1000 max target sequences"



                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|YP_001306678.1|  fibronectin, type III domain-containing p...  48.1    0.002
ref|YP_002880980.1|  PA14 domain protein [Beutenbergia caverna...  45.1    0.015
ref|ZP_05058881.1|  Putative Ig domain family [Verrucomicrobia...  45.1    0.016
ref|ZP_07325212.1|  PKD domain containing protein [Acetivibrio...  44.7    0.018
ref|YP_001983759.1|  glucan exo-1,3-beta glucosidase, putative...  43.5    0.043
ref|YP_003641596.1|  cytochrome C family protein [Thermincola ...  43.1    0.060
ref|ZP_01156643.1|  Peptidase S8 and S53, subtilisin, kexin, s...  42.7    0.074
ref|YP_001489931.1|  fibronectin type III domain-containing pr...  42.7    0.078
ref|ZP_03829128.1|  outer membrane adhesin like proteiin [Pect...  42.7    0.082
ref|YP_003147776.1|  hypothetical protein Kkor_2600 [Kangiella...  42.4    0.086
ref|YP_003703131.1|  Fibronectin type III domain protein [Synt...  42.0    0.11 
ref|YP_003258000.1|  Ig family protein [Pectobacterium wasabia...  42.0    0.11 
ref|YP_589275.1|  fibronectin, type III [Candidatus Koribacter...  42.0    0.12 
ref|YP_001980651.1|  RHS Repeat family [Cellvibrio japonicus U...  42.0    0.13 
ref|YP_003807838.1|  fibronectin type III domain protein [Desu...  41.6    0.18 
ref|ZP_07203774.1|  tetratricopeptide repeat protein [delta pr...  41.6    0.18 
ref|YP_001997480.1|  peptidase S8/S53 subtilisin kexin sedolis...  41.2    0.24 
ref|YP_003668251.1|  Fibronectin type III domain protein [Stap...  40.4    0.33 
ref|YP_003016062.1|  Ig family protein [Pectobacterium carotov...  40.0    0.47 
ref|ZP_01985731.1|  calx-beta domain family [Vibrio harveyi HY...  40.0    0.54 
gb|ADV52892.1|  outer membrane adhesin like proteiin [Shewanel...  39.7    0.58 
ref|YP_002395438.1|  hypothetical protein VS_II0856 [Vibrio sp...  39.7    0.58 
ref|YP_001040604.1|  fibronectin, type III domain-containing p...  39.7    0.58 
ref|ZP_04876209.1|  Fibronectin type III domain protein [Acidu...  39.7    0.59 
ref|YP_965050.1|  fibronectin, type III domain-containing prot...  39.7    0.62 
ref|YP_001792758.1|  outer membrane adhesin-like protein [Lept...  39.7    0.66 
ref|ZP_07327784.1|  PKD domain containing protein [Acetivibrio...  39.7    0.69 
ref|YP_001672389.1|  GLUG domain-containing protein [Shewanell...  39.7    0.70 
ref|YP_001364400.1|  putative outer membrane adhesin-like prot...  39.3    0.84 
ref|YP_822347.1|  fibronectin, type III domain-containing prot...  39.3    0.87 
ref|YP_003286029.1|  putative RTX toxin [Vibrio sp. Ex25] >gb|...  39.3    0.89 
ref|YP_526272.1|  hypothetical protein Sde_0798 [Saccharophagu...  39.3    0.90 
ref|ZP_01156198.1|  calcium binding hemolysin protein, putativ...  38.9    1.0  
ref|ZP_05060048.1|  Carbohydrate binding domain protein [Verru...  38.9    1.0  
ref|XP_001783331.1|  predicted protein [Physcomitrella patens ...  38.9    1.0  
ref|ZP_00988886.1|  hypothetical protein V12B01_12555 [Vibrio ...  38.9    1.2  
ref|YP_003009931.1|  S-layer domain protein [Paenibacillus sp....  38.5    1.4  
ref|YP_001820314.1|  fibronectin type III domain-containing pr...  38.5    1.4  
ref|ZP_01063545.1|  hypothetical protein MED222_04835 [Vibrio ...  38.5    1.4  
ref|ZP_04921150.1|  putative Ig domain family [Vibrio sp. Ex25...  38.1    1.6  
ref|ZP_01262901.1|  putative RTX toxin [Vibrio alginolyticus 1...  38.1    1.7  
ref|ZP_03631272.1|  coagulation factor 5/8 type domain protein...  38.1    1.7  
ref|YP_001196281.1|  hypothetical protein Fjoh_3952 [Flavobact...  38.1    1.8  
ref|ZP_07376302.1|  rhizobiocin RzcA [Ahrensia sp. R2A130] >gb...  38.1    1.8  
ref|YP_064170.1|  hypothetical protein DP0434 [Desulfotalea ps...  38.1    1.8  
ref|YP_001552612.1|  outer membrane adhesin-like protein [Shew...  38.1    1.8  
gb|ADT92376.1|  conserved hypothetical protein [Shewanella bal...  38.1    1.9  
ref|NP_356242.2|  rhizobiocin/RTX toxin [Agrobacterium tumefac...  38.1    2.0  
ref|ZP_07374766.1|  Ig family protein [Ahrensia sp. R2A130] >g...  38.1    2.0  
ref|ZP_03128650.1|  Fibronectin type III domain protein [Chtho...  38.1    2.0  
ref|YP_892377.1|  fibronectin type III domain-containing prote...  37.7    2.1  
ref|YP_379543.1|  VCBS [Chlorobium chlorochromatii CaD3] >gb|A...  37.7    2.2  
ref|ZP_06182281.1|  conserved hypothetical protein [Vibrio alg...  37.7    2.3  
ref|ZP_04582857.1|  fibronectin domain-containing lipoprotein ...  37.7    2.3  
ref|ZP_07662659.1|  outer membrane adhesin like protein [Rosei...  37.7    2.3  
ref|YP_004022856.1|  glycoside hydrolase family 16 [Caldicellu...  37.7    2.4  
ref|ZP_06009630.1|  fibronectin type III domain-containing pro...  37.7    2.6  
ref|YP_001185058.1|  fibronectin, type III domain-containing p...  37.7    2.6  
ref|ZP_05072737.1|  fibronectin, type III [Campylobacterales b...  37.4    2.8  
ref|ZP_04854074.1|  predicted protein [Paenibacillus sp. oral ...  37.4    2.9  
ref|ZP_03781369.1|  hypothetical protein RUMHYD_00802 [Blautia...  37.4    2.9  
ref|YP_867818.1|  Ig family protein [Shewanella sp. ANA-3] >gb...  37.4    3.2  
ref|YP_003569995.1|  cellulase [Salinibacter ruber M8] >emb|CB...  37.4    3.3  
ref|YP_003914290.1|  Dystroglycan-type cadherin domain protein...  37.4    3.4  
ref|YP_594173.1|  glycosy hydrolase family protein [Deinococcu...  37.4    3.5  
ref|YP_076026.1|  putative S-layer associated protein [Symbiob...  37.0    3.7  
ref|ZP_01113259.1|  putative RTX toxin [Reinekea sp. MED297] >...  37.0    3.8  
ref|YP_001038849.1|  fibronectin, type III [Clostridium thermo...  37.0    4.0  
ref|YP_528492.1|  endoglucanase-like protein [Saccharophagus d...  37.0    4.2  
ref|YP_004274781.1|  Fibronectin type III domain protein [Pedo...  37.0    4.3  
ref|ZP_05776284.1|  Ig domain protein [Vibrio parahaemolyticus...  37.0    4.6  
ref|ZP_05909176.2|  Ig domain protein [Vibrio parahaemolyticus...  36.6    4.6  
ref|ZP_05430708.1|  PKD domain containing protein [Clostridium...  36.6    4.7  
ref|NP_798012.1|  putative RTX toxin [Vibrio parahaemolyticus ...  36.6    4.7  
ref|YP_001037660.1|  cellulose 1,4-beta-cellobiosidase [Clostr...  36.6    5.1  
ref|YP_464124.1|  fibronectin, type III/multicopper oxidase, t...  36.6    5.2  
ref|XP_002157323.1|  PREDICTED: similar to paired basic amino ...  36.6    5.5  
gb|ADU74089.1|  PKD domain containing protein [Clostridium the...  36.6    5.7  
ref|YP_001582407.1|  fibronectin type III domain-containing pr...  36.2    6.0  
ref|YP_002466447.1|  Fibronectin type III domain protein [Meth...  36.2    6.1  
ref|YP_003569744.1|  Conserved hypothetical protein containing...  36.2    6.2  
ref|ZP_07577426.1|  hypothetical protein ThebaDRAFT_0397 [Ther...  36.2    6.4  
ref|ZP_01997689.1|  Fibronectin, type III [Beggiatoa sp. SS] >...  36.2    6.9  
ref|YP_446963.1|  cellulose 1,4-beta-cellobiosidase-like prote...  36.2    7.1  
ref|ZP_06248927.1|  PKD domain containing protein [Clostridium...  36.2    7.3  
ref|ZP_07326021.1|  PKD domain containing protein [Acetivibrio...  36.2    7.4  
ref|ZP_06685417.1|  outer membrane adhesin like protein [Achro...  36.2    7.5  
ref|YP_002454579.1|  fibronectin type III domain protein [Baci...  36.2    7.5  
ref|ZP_01878851.1|  hypothetical protein RTM1035_05035 [Roseov...  36.2    7.6  
ref|ZP_07032573.1|  Fibronectin type III domain protein [Acido...  35.8    8.1  
ref|YP_003569994.1|  Conserved hypothetical protein, secreted ...  35.8    8.2  
ref|ZP_01129117.1|  hypothetical protein A20C1_09539 [marine a...  35.8    8.4  
ref|YP_003313237.1|  hypothetical protein Sked_04370 [Sanguiba...  35.8    8.7  
ref|YP_003197438.1|  type 1 secretion C-terminal target domain...  35.8    9.5  
ref|ZP_01991551.1|  putative RTX toxin [Vibrio parahaemolyticu...  35.8    9.5  
ref|YP_436726.1|  Rhs family protein [Hahella chejuensis KCTC ...  35.8    9.5  
ref|YP_003014267.1|  Fibronectin type III domain protein [Paen...  35.8    9.6  
ref|YP_245766.1|  chitin-binding protein [Bacillus cereus E33L...  35.8    9.6  
ref|ZP_04197570.1|  Chitin-binding domain 3 protein [Bacillus ...  35.8    9.9  
ref|ZP_07325211.1|  PKD domain containing protein [Acetivibrio...  35.8    10.0 
ref|YP_001445567.1|  hypothetical protein VIBHAR_02378 [Vibrio...  35.8    10.0 

ALIGNMENTS
>ref|YP_001306678.1| fibronectin, type III domain-containing protein [Thermosipho 
melanesiensis BI429]
 gb|ABR31293.1| Fibronectin, type III domain protein [Thermosipho melanesiensis 
BI429]
Length=1089

 Score = 48.1 bits (113),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 0/75 (0%)

Query  261  DNIAPGVPNGLMAMVLEDGIELTWSPSLDEDFQYFLLEKSTNESFSSPTAYELVDTTFMD  320
            D + P VP GL    L   I + W+P+ ++DF +++L+  T   FS+     L  T+ + 
Sbjct  637  DEVPPAVPTGLTPTGLFQTIMVKWNPNTEDDFDHYVLQYDTKSDFSTAKEIVLNATSAVI  696

Query  321  VEYEMNQTYYYRVTA  335
             +  +N TYY R+ A
Sbjct  697  KDLAVNTTYYLRIKA  711


>ref|YP_002880980.1| PA14 domain protein [Beutenbergia cavernae DSM 12333]
 gb|ACQ79218.1| PA14 domain protein [Beutenbergia cavernae DSM 12333]
Length=3802

 Score = 45.1 bits (105),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 36/78 (46%), Gaps = 3/78 (4%)

Query  261   DNIAPGVPNGLMAMVLEDGIELTWSPSLDEDFQYFLLEKSTNE--SFSSPTAYELVDTT-  317
             D  AP  P GL       G++LTW PS   D   + +E+ST    ++S  +    V TT 
Sbjct  3543  DTSAPAAPTGLAGTADAGGVDLTWEPSAAVDIAGYRVERSTGPIGTWSLISGATPVRTTA  3602

Query  318   FMDVEYEMNQTYYYRVTA  335
             F D       T  YRVTA
Sbjct  3603  FRDAAVPFASTVAYRVTA  3620


>ref|ZP_05058881.1| Putative Ig domain family [Verrucomicrobiae bacterium DG1235]
 gb|EDY84021.1| Putative Ig domain family [Verrucomicrobiae bacterium DG1235]
Length=6102

 Score = 45.1 bits (105),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 71/145 (49%), Gaps = 15/145 (10%)

Query  32    PHENLHGTTMATLCIYDGDYEACSDFEVVVESVNDAPFF--AMDMHQVVGLDLDFHMEI-  88
             P  +  GT    +   DG+  A + F++ V++ NDAP    ++D  Q +  D  F +++ 
Sbjct  1081  PANSDVGTISLKVTASDGEVAAETTFQIEVDNENDAPVVWTSLD-DQTIDEDAAFSLDLS  1139

Query  89    -HYGDVDT-DYEELELTLLSG---PAW-THSLDGNHLFGMPT--DLGYYPIALQLDDGMD  140
              ++GDVD  D      TL +G   P W + + +   + G P   D+G   I +   DG  
Sbjct  1140  SNFGDVDFFDTLTFSATLENGDPLPGWLSFNSETGEISGTPENGDIGSLSITVSASDGQQ  1199

Query  141   AMVDTLHLHVEHFK--PVITS-VED  162
             +  DT  L VE+    PV+T+ +ED
Sbjct  1200  SARDTFTLTVENTNDGPVVTTDIED  1224


 Score = 40.0 bits (92),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 63/141 (45%), Gaps = 14/141 (10%)

Query  32    PHENLHGTTMATLCIYDGDYEACSD-FEVVVESVNDAPFFAMDMHQVVGLDLDFHMEI--  88
             P     G+   T+   D      SD F + +++ ND P       Q    D  F +++  
Sbjct  1477  PENRDVGSISVTVTATDEAGATVSDTFGIQIDNTNDGPTATAIADQSATEDSAFSLDVSS  1536

Query  89    HYGDVDTDYEEL--ELTLLSG---PAW-THSLDGNHLFGMPT--DLGYYPIALQLDDGMD  140
             ++GDVD  ++EL    TL +G   P W T   +   L G P   D+G   I +  +DG+ 
Sbjct  1537  NFGDVDF-FDELTFSATLENGDPLPDWLTIDNETGVLSGTPGNGDVGELNIIVSANDGIA  1595

Query  141   AMVDTLHLHVEHFK--PVITS  159
                D  HL VE+    PV+TS
Sbjct  1596  TTTDAFHLTVENTNDGPVVTS  1616


 Score = 37.4 bits (85),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 38/143 (27%), Positives = 59/143 (41%), Gaps = 13/143 (9%)

Query  32   PHENLHGTTMATLCIYDGDYEACSDFEVVVESVNDAPFFAMDMHQVVGLDLDFHMEI--H  89
            P  +  G    T+   DG+  A   F ++V++ ND P  +   +Q    DL F +++   
Sbjct  786  PTNDDVGMLAVTVTATDGEKSASDTFAIMVQNTNDGPVASGIANQTASEDLSFSLDVSDS  845

Query  90   YGDVDT-DYEELELTLLSG---PAWTH--SLDGNHLFGMP--TDLGYYPIALQLDDGMDA  141
            + D+D  D      TL +G   P W       GN  +G P   D+G   I +   DG   
Sbjct  846  FSDIDAGDALTYSATLTNGSDLPDWLEFDEATGN-FYGTPGNEDVGELAILVVASDGQAN  904

Query  142  MVDTLHLHVEHFK--PVITSVED  162
                  + VE+    PV T + D
Sbjct  905  ANAIFSIEVENTNDGPVATFIPD  927


 Score = 36.6 bits (83),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 58/144 (40%), Gaps = 14/144 (10%)

Query  32    PHENLHGTTMATLCIYDGDYEACSD-FEVVVESVNDAPFFAMDMHQVVGLDLDFHMEI--  88
             P     GT   T+   D    + SD F + V++ ND P      +Q    D  F ++   
Sbjct  1774  PKNGDVGTITVTVTATDASGSSASDTFGIQVDNTNDGPTATAIANQTTDEDAAFSLDASS  1833

Query  89    HYGDVDT-DYEELELTLLSG---PAWTHSLD--GNHLFGMPT--DLGYYPIALQLDDGMD  140
              + DVD  D      TL +    P W  S+D     L G P   D+G   I +  +DG  
Sbjct  1834  SFADVDAGDTLTFSATLENDDPLPDWI-SIDPATGKLTGTPRNEDVGTLSINVTANDGES  1892

Query  141   AMVDTLHLHVEHFK--PVITSVED  162
              +  T  + +E+    PV T + D
Sbjct  1893  TVTSTFTIEIENTNDGPVATEISD  1916


>ref|ZP_07325212.1| PKD domain containing protein [Acetivibrio cellulolyticus CD2]
 gb|EFL63513.1| PKD domain containing protein [Acetivibrio cellulolyticus CD2]
Length=4244

 Score = 44.7 bits (104),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 77/194 (40%), Gaps = 22/194 (11%)

Query  153   FKPVITSVEDVPNDQ-GGRVYVSFNASYFDN-----GEPSGQSYSL--FRWDDFDNDSSG  204
              KP I SVE V     GG     F+  YF N     G      YS+    W DF +   G
Sbjct  2229  LKPQILSVEPVAGTTVGGNTSRWFHV-YFANSNNLAGTKGKFEYSVDGITWSDFGSTVYG  2287

Query  205   WVALSSVGAIGEPAYTFEATTLMDSTSEESNGWTNFKIVASMEGGIFDDHEEGYSVDNIA  264
                       G  AY +     +D TS  S G    +   + E G FD  E  Y +D  +
Sbjct  2288  PYTS------GSSAYLY---CRLDFTSLSS-GTYKVRYTVTDEEGSFDKIEAAYQLDRTS  2337

Query  265   PGVPNGLMAMVLEDGIELTWSPSLDEDFQYFLLEKSTNESF---SSPTAYELVDTTFMDV  321
             P  P  L A  +   I+L+W   ++ D  ++++ +S   S    S  T     +  + D 
Sbjct  2338  PNAPGSLNASGVAGKIDLSWDIPVNNDVHHYVVYRSLTSSGTYNSIATINGAANNYYSDS  2397

Query  322   EYEMNQTYYYRVTA  335
                   TYYY+VTA
Sbjct  2398  NVTNGTTYYYKVTA  2411


>ref|YP_001983759.1| glucan exo-1,3-beta glucosidase, putative, glu5A [Cellvibrio 
japonicus Ueda107]
 gb|ACE82980.1| glucan exo-1,3-beta glucosidase, putative, glu5A [Cellvibrio 
japonicus Ueda107]
Length=876

 Score = 43.5 bits (101),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 22/71 (31%), Positives = 34/71 (48%), Gaps = 0/71 (0%)

Query  265  PGVPNGLMAMVLEDGIELTWSPSLDEDFQYFLLEKSTNESFSSPTAYELVDTTFMDVEYE  324
            P  P  L      + + L+WSP+  +   Y +   +T  +   P A EL   T+ D   +
Sbjct  660  PPRPTNLQLTESGNSVSLSWSPANGDTVSYSVYRATTPGAKGEPIAEELTQNTYSDTRPD  719

Query  325  MNQTYYYRVTA  335
             +QTY+Y VTA
Sbjct  720  ADQTYFYTVTA  730


>ref|YP_003641596.1| cytochrome C family protein [Thermincola sp. JR]
 gb|ADG83695.1| cytochrome C family protein [Thermincola potens JR]
Length=3091

 Score = 43.1 bits (100),  Expect = 0.060, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 44/89 (49%), Gaps = 12/89 (13%)

Query  259   SVDNIAPGVP-NGLMAMVLED-----GIELTWSPSLD--EDFQYFLLEKSTNESFSSPTA  310
             S D   P +P N   ++ L++      I L WSPS D  E  +Y +   ++  +   P A
Sbjct  1679  SADTTKPDIPLNVTASLPLKEEMQSTSIVLNWSPSSDNYEVRRYNIYRTASASAKDDPGA  1738

Query  311   YELV----DTTFMDVEYEMNQTYYYRVTA  335
             Y LV     T+F+D     N TYYYR+TA
Sbjct  1739  YTLVGSTGSTSFVDGSLSENTTYYYRITA  1767


>ref|ZP_01156643.1| Peptidase S8 and S53, subtilisin, kexin, sedolisin [Oceanicola 
granulosus HTCC2516]
 gb|EAR51224.1| Peptidase S8 and S53, subtilisin, kexin, sedolisin [Oceanicola 
granulosus HTCC2516]
Length=12869

 Score = 42.7 bits (99),  Expect = 0.074, Method: Compositional matrix adjust.
 Identities = 60/263 (23%), Positives = 95/263 (36%), Gaps = 30/263 (11%)

Query  20     WSHNSQDAPMLYPHENLHGTTMATLCIYDGDYEACSDFEVVVESVNDAPFFAMDMHQVVG  79
              W   + D  +        G+ +  + + DGD    SD   +  +V  AP       QV+ 
Sbjct  12166  WIRVAPDGRVSGDSAGRVGSHVVRVRVSDGD--GLSDEASLAVTVQAAPVIGAVAPQVLL  12223

Query  80     LDLDFHMEIHYGDVDTDYEELELTLLSGPAW-THSLDGNHLFG-MPTDLGYYPIALQLDD  137
                    + +   D DT  + L+L ++S P W T    G  L G    D+G + + L   D
Sbjct  12224  EGAVLDVPLSLADADTPADALDLRIVSAPRWITLDAAGRRLTGDSNGDVGRHSVTLLASD  12283

Query  138    GMDAMVDTLHLHVEHFKPVITSVEDVPNDQGGRVYVSFNASYFDNGEPSGQSYSLFRWDD  197
                          +    PV+  + DV    G  V +   AS  D   P+  +Y L     
Sbjct  12284  PEGHRTTRTVSVIVQAAPVLAPISDVRIVSG--VALGAQASARDADSPT-LTYRL-----  12335

Query  198    FDNDSSGWVAL-SSVGAIGEPAYTFEATTLMDSTSEESNGWTNFKIVASMEGGIFDDHEE  256
                  + GW+ + S  GAI               + + +     F +V S          +
Sbjct  12336  --ESAPGWIGIDSRTGAI---------------SGDSAGNIGTFAVVVSATDEAGHSSRQ  12378

Query  257    GYSVDNIAPGVPNGLMAMVLEDG  279
              G+SV  +A  V   +  M LEDG
Sbjct  12379  GFSVQVLAAPVLQEVAPMELEDG  12401


>ref|YP_001489931.1| fibronectin type III domain-containing protein [Arcobacter butzleri 
RM4018]
 gb|ABV67262.1| fibronectin type III domain protein [Arcobacter butzleri RM4018]
Length=420

 Score = 42.7 bits (99),  Expect = 0.078, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 68/157 (43%), Gaps = 14/157 (9%)

Query  184  EPSGQSYSLFRWDDFDNDSSGWVALSSVGAIGEPAYTFEATTLMDSTSEESNGWTNFKIV  243
            +P    Y+ +R D      SG   L  + AI E  YT   T  +D   E    +  ++I 
Sbjct  65   DPRVVGYNFYRTDL----QSGEKTLKLIRAI-ESRYT---THYVDKELEPKTKYA-YQIS  115

Query  244  ASMEGGIFDDHEEGYSVDNIAPGVP-NGLMAMV-LEDGIELTWSPSLDEDFQYFLLEK--  299
            + +  G      + Y  + +   VP NG  A+  L   I+L W P  D+  QY+ +EK  
Sbjct  116  SRLNDGSESVTTDAYVAETLPRIVPVNGAQAISNLPKKIKLLWQPHPDQRIQYYRVEKYN  175

Query  300  -STNESFSSPTAYELVDTTFMDVEYEMNQTYYYRVTA  335
             + NE     T  + +   ++D   E N TY YR+ A
Sbjct  176  TTLNEWIHLATVNQRLSAEYLDTGLENNTTYQYRIKA  212


>ref|ZP_03829128.1| outer membrane adhesin like proteiin [Pectobacterium carotovorum 
subsp. brasiliensis PBR1692]
Length=2162

 Score = 42.7 bits (99),  Expect = 0.082, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 54/143 (38%), Gaps = 16/143 (11%)

Query  32    PHENLHGTTMATLCIYDGDYEACSDFEVVVESVNDAPFFAMDM-HQVVGLDLDFHMEIHY  90
             P  +  GT    +   DG     + F + V +VNDAP  A  +  Q V  D   +  I  
Sbjct  1684  PGNSDVGTLSIKVTANDGSASVSTTFSLTVTNVNDAPIVATPIPAQSVAQDGSLNFAIPV  1743

Query  91    G---DVDTDYEELELTLLSG---PAW-THSLDGNHLFGMP--TDLGYYPIALQLDDGMDA  141
             G   D D D   L  TL  G   P W T +       G P   D+G   I +   D   A
Sbjct  1744  GTFTDPDGDTLSLSATLADGSPLPGWLTFNAATGTFSGTPGNADVGSLSIKVTATDTASA  1803

Query  142   MVDTLHLHVEHFKPVITSVEDVP  164
              V T       F   +T+V D P
Sbjct  1804  AVST------TFSLTVTNVNDAP  1820


2)BLASTp vs Swissprot    NCBI default parameters other than "1000 max target sequences"

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q7A884.2|Y095_STAAN  RecName: Full=Uncharacterized lipoprot...  33.1    2.8  
sp|Q23551.3|UNC22_CAEEL  RecName: Full=Twitchin; AltName: Full...  32.7    3.4  
sp|Q96JQ0.1|PCD16_HUMAN  RecName: Full=Protocadherin-16; AltNa...  32.3    4.6  
sp|Q6GKK2.2|Y106_STAAR  RecName: Full=Uncharacterized lipoprot...  32.3    4.8  
sp|Q9Y5H4.1|PCDG1_HUMAN  RecName: Full=Protocadherin gamma-A1;...  32.3    4.9  
sp|O60330.1|PCDGC_HUMAN  RecName: Full=Protocadherin gamma-A12...  32.0    5.7  
sp|Q5DRB9.1|PCDGC_PANTR  RecName: Full=Protocadherin gamma-A12...  32.0    6.6  
sp|Q5WVY8.1|EFTS_LEGPL  RecName: Full=Elongation factor Ts; Sh...  31.6    7.1  
sp|O97069.1|ASSY_DROME  RecName: Full=Argininosuccinate syntha...  31.6    7.1  
sp|Q5ZUS9.2|EFTS_LEGPH  RecName: Full=Elongation factor Ts; Sh...  31.6    7.4  
sp|Q63418.1|PCDH3_RAT  RecName: Full=Protocadherin-3; Flags: P...  31.6    7.8  
sp|Q5X4J8.1|EFTS_LEGPA  RecName: Full=Elongation factor Ts; Sh...  31.6    8.4  
sp|Q820K3.1|EFTS_NITEU  RecName: Full=Elongation factor Ts; Sh...  31.6    8.5  

ALIGNMENTS
>sp|Q7A884.2|Y095_STAAN RecName: Full=Uncharacterized lipoprotein SA0095; Flags: Precursor
 sp|Q99XB3.2|Y099_STAAM RecName: Full=Uncharacterized lipoprotein SAV0099; Flags: Precursor
Length=255

 Score = 33.1 bits (74),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 24/107 (23%), Positives = 49/107 (46%), Gaps = 10/107 (9%)

Query  193  FRWDDFD-NDSSGWVALS--SVGAIGEPAYTFEATTLMDSTSEESNGWTNFKIVASMEGG  249
            +R D FD ND   W+  S  ++   GEP  +      M+  +  +NG+    ++   + G
Sbjct  57   YRDDQFDKNDKGTWIVNSQMAIQNKGEPMKSKGMVLYMNRNTRTTNGYYYVNVIKGEDKG  116

Query  250  IFDDHEEGYSVDNIAPGVPNGLMAMVLEDGIELTWSPSLDEDFQYFL  296
               D+E+ Y V  +   +   L   + ++ I++       E+F++F+
Sbjct  117  KHQDNEKRYPVKMVDNKII--LTKEIKDENIKIEI-----ENFKFFV  156


>sp|Q23551.3|UNC22_CAEEL RecName: Full=Twitchin; AltName: Full=Uncoordinated protein 22
Length=7158

 Score = 32.7 bits (73),  Expect = 3.4, Method: Composition-based stats.
 Identities = 23/76 (31%), Positives = 35/76 (47%), Gaps = 5/76 (6%)

Query  265   PGVPNGLMAM--VLEDGIELTWSPSLD---EDFQYFLLEKSTNESFSSPTAYELVDTTFM  319
             P  PNG + +  V ED + L+W P  D   E  +Y+ +EK    +       ++ DT   
Sbjct  2186  PSKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKLDTATGRWVPCAKVKDTKAH  2245

Query  320   DVEYEMNQTYYYRVTA  335
                 +  QTY +RV A
Sbjct  2246  IDGLKKGQTYQFRVKA  2261


>sp|Q96JQ0.1|PCD16_HUMAN RecName: Full=Protocadherin-16; AltName: Full=Cadherin-19; AltName: 
Full=Cadherin-25; AltName: Full=Fibroblast cadherin-1; 
AltName: Full=Protein dachsous homolog 1; Flags: Precursor
Length=3298

 Score = 32.3 bits (72),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 16/39 (42%), Positives = 26/39 (67%), Gaps = 1/39 (2%)

Query  44    LCIYDGDYEACSDFEVVVESVND-APFFAMDMHQVVGLD  81
             L  +DG +E  ++  V+VE VND AP F+  ++QV+ L+
Sbjct  2349  LLAHDGPHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLE  2387


>sp|Q6GKK2.2|Y106_STAAR RecName: Full=Uncharacterized lipoprotein SAR0106; Flags: Precursor
Length=255

 Score = 32.3 bits (72),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 20/71 (29%), Positives = 32/71 (46%), Gaps = 3/71 (4%)

Query  193  FRWDDFD-NDSSGWVALSS--VGAIGEPAYTFEATTLMDSTSEESNGWTNFKIVASMEGG  249
            +R D FD ND   W+  SS  +   G+          M+  S  +NG+    ++   + G
Sbjct  57   YRDDQFDKNDKGTWIVRSSMSIQPNGKDMNVKGMVLYMNRNSRTTNGYYYVDVIERQDKG  116

Query  250  IFDDHEEGYSV  260
            I  D+E+ Y V
Sbjct  117  IHRDNEKKYPV  127


>sp|Q9Y5H4.1|PCDG1_HUMAN RecName: Full=Protocadherin gamma-A1; Short=PCDH-gamma-A1; Flags: 
Precursor
Length=931

 Score = 32.3 bits (72),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 39/85 (46%), Gaps = 17/85 (20%)

Query  181  DNGEP---SGQSYSLFRWDDFDN-----------DSSGWVALSSVGAIGEPAYTFEATTL  226
            D+G+P   S  S SLF  D  DN           D S  V L+ + A  EP Y       
Sbjct  536  DSGDPPLSSNVSLSLFLLDQNDNAPEILYPALPTDGSTGVELAPLSA--EPGYLVTKVVA  593

Query  227  MDSTSEESNGWTNFKIVASMEGGIF  251
            +D  S + N W +++++ + E G+F
Sbjct  594  VDRDSGQ-NAWLSYRLLKASEPGLF  617


>sp|O60330.1|PCDGC_HUMAN RecName: Full=Protocadherin gamma-A12; Short=PCDH-gamma-A12; 
AltName: Full=Cadherin-21; AltName: Full=Fibroblast cadherin-3; 
Flags: Precursor
Length=932

 Score = 32.0 bits (71),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 37/85 (44%), Gaps = 17/85 (20%)

Query  181  DNGEP---SGQSYSLFRWDDFDN-----------DSSGWVALSSVGAIGEPAYTFEATTL  226
            DNG P   S  S SLF  D  DN           D S  V L+   A  EP Y       
Sbjct  536  DNGHPPLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSA--EPGYLVTKVVA  593

Query  227  MDSTSEESNGWTNFKIVASMEGGIF  251
            +D  S + N W +++++ + E G+F
Sbjct  594  VDRDSGQ-NAWLSYRLLKASEPGLF  617


>sp|Q5DRB9.1|PCDGC_PANTR RecName: Full=Protocadherin gamma-A12; Short=PCDH-gamma-A12; 
Flags: Precursor
Length=932

 Score = 32.0 bits (71),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 37/85 (44%), Gaps = 17/85 (20%)

Query  181  DNGEP---SGQSYSLFRWDDFDN-----------DSSGWVALSSVGAIGEPAYTFEATTL  226
            DNG P   S  S SLF  D  DN           D S  V L+   A  EP Y       
Sbjct  536  DNGHPPLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTSVELAPRSA--EPGYLVTKVVA  593

Query  227  MDSTSEESNGWTNFKIVASMEGGIF  251
            +D  S + N W +++++ + E G+F
Sbjct  594  VDRDSGQ-NAWLSYRLLKASEPGLF  617


>sp|Q5WVY8.1|EFTS_LEGPL RecName: Full=Elongation factor Ts; Short=EF-Ts
Length=292

 Score = 31.6 bits (70),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 37/80 (47%), Gaps = 9/80 (11%)

Query  112  HSLDGNHLFGMPTDLGYY------PIALQLDDGMDAMVDTLHLHVEHFKPVITSVEDVPN  165
              L+  H  G+   +GYY       + + L +G +A+   + +HV   KP++ S + VP 
Sbjct  142  RRLEKMHCDGV---IGYYLHGSRIGVMVALKNGSEALAKDIAMHVAASKPMVVSRDQVPA  198

Query  166  DQGGRVYVSFNASYFDNGEP  185
            +        F A   ++G+P
Sbjct  199  EAIENEREIFTAQAKESGKP  218


>sp|O97069.1|ASSY_DROME RecName: Full=Argininosuccinate synthase; AltName: Full=Citrulline--aspartate 
ligase
Length=419

 Score = 31.6 bits (70),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 28/89 (32%), Positives = 40/89 (45%), Gaps = 7/89 (7%)

Query  133  LQLDDGMDAMVDTLHLHVEHFKPVITSVEDVPNDQGGRVYVSFNASYFDNGEPSGQSYSL  192
            + +D    A  D +HL ++  + + +SVED+P   GGRVY        D     G SY +
Sbjct  208  MTVDPLTRAPRDPVHLVIQFDRGLPSSVEDLP---GGRVYTK-PLEMLDFLNKLGGSYGI  263

Query  193  FRWDDFDNDSSGWVALSSVGAIGEPAYTF  221
             R D  +N    +V L S G    P  T 
Sbjct  264  GRIDIVENR---FVGLKSRGVYETPGGTI  289


>sp|Q5ZUS9.2|EFTS_LEGPH RecName: Full=Elongation factor Ts; Short=EF-Ts
 sp|A5ICK9.1|EFTS_LEGPC RecName: Full=Elongation factor Ts; Short=EF-Ts
Length=292

 Score = 31.6 bits (70),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 37/80 (47%), Gaps = 9/80 (11%)

Query  112  HSLDGNHLFGMPTDLGYY------PIALQLDDGMDAMVDTLHLHVEHFKPVITSVEDVPN  165
              L+  H  G+   +GYY       + + L +G +A+   + +HV   KP++ S + VP 
Sbjct  142  RRLEKMHCDGV---IGYYLHGSRIGVMVALKNGSEALAKDIAMHVAASKPMVVSRDQVPA  198

Query  166  DQGGRVYVSFNASYFDNGEP  185
            +        F A   ++G+P
Sbjct  199  EAIENEREIFTAQAKESGKP  218


>sp|Q63418.1|PCDH3_RAT RecName: Full=Protocadherin-3; Flags: Precursor
Length=797

 Score = 31.6 bits (70),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 23/82 (29%), Positives = 34/82 (42%), Gaps = 12/82 (14%)

Query  181  DNGEPSGQSYSLFR---WDDFDNDSSGWVALSSVGA--------IGEPAYTFEATTLMDS  229
            D G P+  S +L R    DD DN       L +  A          EP Y       +D 
Sbjct  534  DGGSPALSSQTLVRMVVLDDNDNAPFVLYPLQNASAPCTELLPRAAEPGYLITKVVAVDR  593

Query  230  TSEESNGWTNFKIVASMEGGIF  251
             S + N W +F+++ + E G+F
Sbjct  594  DSGQ-NAWLSFQLLKATEPGLF  614


>sp|Q5X4J8.1|EFTS_LEGPA RecName: Full=Elongation factor Ts; Short=EF-Ts
Length=292

 Score = 31.6 bits (70),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 37/80 (47%), Gaps = 9/80 (11%)

Query  112  HSLDGNHLFGMPTDLGYY------PIALQLDDGMDAMVDTLHLHVEHFKPVITSVEDVPN  165
              L+  H  G+   +GYY       + + L +G +A+   + +HV   KP++ S + VP 
Sbjct  142  RRLERMHCDGV---IGYYLHGSRIGVMVALKNGSEALAKDIAMHVAASKPMVVSRDQVPA  198

Query  166  DQGGRVYVSFNASYFDNGEP  185
            +        F A   ++G+P
Sbjct  199  EAIENEREIFTAQAKESGKP  218



3)BLASTx   NCBI default parameters other than "1000 max target sequences"


                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_07325212.1|  PKD domain containing protein [Acetivibrio...  53.5    5e-05
ref|ZP_04854074.1|  predicted protein [Paenibacillus sp. oral ...  51.6    2e-04
ref|YP_001306678.1|  fibronectin, type III domain-containing p...  50.8    3e-04
ref|YP_001983759.1|  glucan exo-1,3-beta glucosidase glu5A [Ce...  46.2    0.008
ref|YP_004182898.1|  coagulation factor 5/8 type domain-contai...  44.7    0.022
ref|YP_001489931.1|  fibronectin type III domain-containing pr...  44.7    0.022
ref|YP_002505875.1|  cellulosome anchoring protein cohesin reg...  44.7    0.022
ref|YP_003703131.1|  Fibronectin type III domain protein [Synt...  43.9    0.038
ref|YP_001997480.1|  peptidase S8/S53 subtilisin kexin sedolis...  43.9    0.038
gb|ADU74089.1|  PKD domain containing protein [Clostridium the...  43.1    0.064
ref|ZP_05430708.1|  PKD domain containing protein [Clostridium...  43.1    0.064
ref|YP_001037660.1|  cellulose 1,4-beta-cellobiosidase [Clostr...  43.1    0.064
ref|YP_003641596.1|  cytochrome C family protein [Thermincola ...  42.7    0.084
ref|ZP_06248927.1|  PKD domain containing protein [Clostridium...  42.7    0.084
ref|YP_003009931.1|  S-layer domain protein [Paenibacillus sp....  42.7    0.084
ref|YP_002565443.1|  Fibronectin type III domain protein [Halo...  42.7    0.084
ref|YP_003569995.1|  cellulase [Salinibacter ruber M8] >emb|CB...  42.4    0.11 
ref|XP_001786869.1|  predicted protein [Physcomitrella patens ...  42.4    0.11 
ref|YP_822347.1|  fibronectin, type III domain-containing prot...  42.4    0.11 
ref|YP_589275.1|  fibronectin, type III [Candidatus Koribacter...  42.4    0.11 
ref|ZP_07203774.1|  tetratricopeptide repeat protein [delta pr...  41.6    0.19 
ref|YP_002880980.1|  PA14 domain protein [Beutenbergia caverna...  41.6    0.19 
ref|ZP_05072737.1|  fibronectin, type III [Campylobacterales b...  41.6    0.19 
ref|ZP_05058881.1|  Putative Ig domain family [Verrucomicrobia...  41.6    0.19 
ref|YP_001136111.1|  YVTN beta-propeller repeat-containing pro...  41.6    0.19 
ref|YP_003569744.1|  Conserved hypothetical protein containing...  41.2    0.24 
ref|YP_003668251.1|  Fibronectin type III domain protein [Stap...  41.2    0.24 
ref|ZP_04876209.1|  Fibronectin type III domain protein [Acidu...  41.2    0.24 
ref|YP_594173.1|  glycosy hydrolase family protein [Deinococcu...  41.2    0.24 
ref|YP_002395438.1|  hypothetical protein VS_II0856 [Vibrio sp...  40.8    0.32 
ref|ZP_06009630.1|  fibronectin type III domain-containing pro...  40.4    0.42 
ref|ZP_05060048.1|  Carbohydrate binding domain protein [Verru...  40.4    0.42 
ref|YP_001040604.1|  fibronectin, type III domain-containing p...  40.4    0.42 
ref|YP_892377.1|  fibronectin type III domain-containing prote...  40.4    0.42 
ref|YP_003807838.1|  fibronectin type III domain protein [Desu...  40.0    0.54 
ref|ZP_04582857.1|  fibronectin domain-containing lipoprotein ...  40.0    0.54 
ref|ZP_03128650.1|  Fibronectin type III domain protein [Chtho...  40.0    0.54 
ref|YP_446963.1|  cellulose 1,4-beta-cellobiosidase-like prote...  40.0    0.54 
ref|YP_446962.1|  transmembrane protein, putative [Salinibacte...  40.0    0.54 
ref|YP_001038849.1|  fibronectin, type III [Clostridium thermo...  40.0    0.54 
ref|YP_001582407.1|  fibronectin type III domain-containing pr...  39.7    0.71 
ref|ZP_00988886.1|  hypothetical protein V12B01_12555 [Vibrio ...  39.7    0.71 
ref|ZP_07325211.1|  PKD domain containing protein [Acetivibrio...  39.3    0.93 
ref|ZP_01063545.1|  hypothetical protein MED222_04835 [Vibrio ...  39.3    0.93 
ref|YP_004060595.1|  fibronectin type iii domain protein [Sulf...  38.5    1.6  
ref|ZP_07326021.1|  PKD domain containing protein [Acetivibrio...  38.5    1.6  
ref|ZP_04297922.1|  Chitin-binding domain 3 protein [Bacillus ...  38.5    1.6  
ref|ZP_03676525.1|  hypothetical protein BACCELL_00850 [Bacter...  38.5    1.6  
ref|YP_001820314.1|  fibronectin type III domain-containing pr...  38.5    1.6  
gb|EGG57060.1|  fibronectin type III domain protein [Paraprevo...  38.1    2.1  
ref|YP_004274781.1|  Fibronectin type III domain protein [Pedo...  38.1    2.1  
ref|YP_004022856.1|  glycoside hydrolase family 16 [Caldicellu...  38.1    2.1  
ref|ZP_04127463.1|  Chitin-binding domain 3 protein [Bacillus ...  38.1    2.1  
ref|YP_001980651.1|  RHS Repeat family [Cellvibrio japonicus U...  38.1    2.1  
ref|YP_003009930.1|  hypothetical protein Pjdr2_1166 [Paenibac...  38.1    2.1  
ref|ZP_02207438.1|  hypothetical protein COPEUT_02248 [Coproco...  38.1    2.1  
gb|EGG51513.1|  ricin-type beta-trefoil lectin domain protein ...  37.7    2.7  
ref|ZP_07662659.1|  outer membrane adhesin like protein [Rosei...  37.7    2.7  
ref|ZP_04069300.1|  Chitin-binding domain 3 protein [Bacillus ...  37.7    2.7  
ref|ZP_04073154.1|  Chitin-binding domain 3 protein [Bacillus ...  37.7    2.7  
ref|ZP_04087713.1|  Chitin-binding domain 3 protein [Bacillus ...  37.7    2.7  
ref|ZP_04200779.1|  Chitin-binding domain 3 protein [Bacillus ...  37.7    2.7  
ref|ZP_04215242.1|  Chitin-binding domain 3 protein [Bacillus ...  37.7    2.7  
ref|ZP_04321162.1|  Chitin-binding domain 3 protein [Bacillus ...  37.7    2.7  
ref|ZP_01997689.1|  Fibronectin, type III [Beggiatoa sp. SS] >...  37.7    2.7  
ref|YP_657873.1|  hypothetical protein HQ2117A [Haloquadratum ...  37.7    2.7  
ref|YP_528492.1|  endoglucanase-like protein [Saccharophagus d...  37.7    2.7  
ref|ZP_00741075.1|  Carbohydrate binding domain protein [Bacil...  37.7    2.7  
ref|ZP_04206728.1|  Chitin-binding domain 3 protein [Bacillus ...  37.4    3.5  
ref|ZP_04309489.1|  Chitin-binding domain 3 protein [Bacillus ...  37.4    3.5  
ref|YP_003147776.1|  hypothetical protein Kkor_2600 [Kangiella...  37.4    3.5  
ref|YP_002311850.1|  collagenase [Shewanella piezotolerans WP3...  37.4    3.5  
ref|YP_003014267.1|  Fibronectin type III domain protein [Paen...  37.4    3.5  
ref|ZP_03234049.1|  chitin-binding domain 3 protein [Bacillus ...  37.4    3.5  
ref|XP_366030.2|  hypothetical protein MGG_10250 [Magnaporthe ...  37.4    3.5  
ref|YP_464124.1|  fibronectin, type III/multicopper oxidase, t...  37.4    3.5  
ref|ZP_07327784.1|  PKD domain containing protein [Acetivibrio...  37.0    4.6  
ref|YP_003482425.1|  flagellin [Aciduliprofundum boonei T469] ...  37.0    4.6  
ref|ZP_04087705.1|  Chitin-binding domain 3 protein [Bacillus ...  37.0    4.6  
ref|ZP_04115822.1|  Chitin-binding domain 3 protein [Bacillus ...  37.0    4.6  
ref|ZP_04290032.1|  Chitin-binding domain 3 protein [Bacillus ...  37.0    4.6  
ref|YP_003323411.1|  serine/threonine protein kinase [Thermoba...  37.0    4.6  
ref|YP_002533312.1|  Chitin binding protein [Bacillus cereus Q...  37.0    4.6  
ref|YP_002352348.1|  Fibronectin type III domain protein [Dict...  37.0    4.6  
ref|ZP_04875927.1|  hypothetical protein ABOONEI_32 [Acidulipr...  37.0    4.6  
ref|ZP_01878851.1|  hypothetical protein RTM1035_05035 [Roseov...  37.0    4.6  
ref|YP_001967179.1|  chitin-binding domain protein [Bacillus c...  37.0    4.6  
ref|YP_245766.1|  chitin-binding protein [Bacillus cereus E33L...  37.0    4.6  
ref|YP_004341622.1|  Subtilisin [Archaeoglobus veneficus SNP6]...  36.6    6.0  
ref|YP_004267263.1|  cell wall binding repeat 2-containing pro...  36.6    6.0  
gb|EFR92899.1|  chitin-binding protein/carbohydrate-binding pr...  36.6    6.0  
ref|ZP_05909176.2|  Ig domain protein [Vibrio parahaemolyticus...  36.6    6.0  
gb|ADO03956.1|  hypothetical protein HPCU_03980 [Helicobacter ...  36.6    6.0  
ref|YP_003914290.1|  Dystroglycan-type cadherin domain protein...  36.6    6.0  
gb|EFN85387.1|  Protein dopey-1-like protein [Harpegnathos sal...  36.6    6.0  
ref|YP_004310278.1|  RHS repeat-associated core domain protein...  36.6    6.0  
ref|YP_003569994.1|  Conserved hypothetical protein, secreted ...  36.6    6.0  
ref|ZP_05776284.1|  Ig domain protein [Vibrio parahaemolyticus...  36.6    6.0  
ref|ZP_04197570.1|  Chitin-binding domain 3 protein [Bacillus ...  36.6    6.0  
ref|ZP_04262459.1|  Chitin-binding domain 3 protein [Bacillus ...  36.6    6.0  
ref|ZP_03132348.1|  Carbohydrate binding family 6 [Chthoniobac...  36.6    6.0  
ref|YP_001672389.1|  GLUG domain-containing protein [Shewanell...  36.6    6.0  
ref|ZP_01874087.1|  GTP-binding protein [Lentisphaera araneosa...  36.6    6.0  
ref|NP_798012.1|  putative RTX toxin [Vibrio parahaemolyticus ...  36.6    6.0  
ref|YP_001645189.1|  chitin-binding domain-containing protein ...  36.6    6.0  
ref|ZP_08144225.1|  trans-hexaprenyltranstransferase [Enteroco...  36.2    7.8  
ref|YP_004160145.1|  TonB-dependent receptor plug [Bacteroides...  36.2    7.8  
ref|YP_003945289.1|  exoglucanase a [Paenibacillus polymyxa SC...  36.2    7.8  
ref|ZP_05655619.1|  polyprenyl synthetase [Enterococcus cassel...  36.2    7.8  
ref|ZP_05646006.1|  polyprenyl synthetase [Enterococcus cassel...  36.2    7.8  
ref|ZP_04169231.1|  Chitin-binding domain 3 protein [Bacillus ...  36.2    7.8  
ref|ZP_03626643.1|  Carbohydrate binding family 6 [bacterium E...  36.2    7.8  

ALIGNMENTS
>ref|ZP_07325212.1| PKD domain containing protein [Acetivibrio cellulolyticus CD2]
 gb|EFL63513.1| PKD domain containing protein [Acetivibrio cellulolyticus CD2]
Length=4244

 Score = 53.5 bits (127),  Expect = 5e-05
 Identities = 52/192 (27%), Positives = 79/192 (41%), Gaps = 20/192 (10%)
 Frame = +1

Query  460   KPVITSVEDVPNDQ-GGRVYVSFNASYFDNGEPSGQS----YSL--FRWDDFDNDSSGWV  618
             KP I SVE V     GG     F+  + ++   +G      YS+    W DF +   G  
Sbjct  2230  KPQILSVEPVAGTTVGGNTSRWFHVYFANSNNLAGTKGKFEYSVDGITWSDFGSTVYGPY  2289

Query  619   ALSSVGAIGEPAYTFEATTLMDSTSEESNGWTNFKIVASMEGGIFDDHEEGYSVDNIAPG  798
                     G  AY +     +D TS  S+G    +   + E G FD  E  Y +D  +P 
Sbjct  2290  TS------GSSAYLY---CRLDFTSL-SSGTYKVRYTVTDEEGSFDKIEAAYQLDRTSPN  2339

Query  799   VPNGLMAMVLEDGIELTWSPSLDEDFQYFLLEKSTNESF---SSPTAYELVDTTFMDVEY  969
              P  L A  +   I+L+W   ++ D  ++++ +S   S    S  T     +  + D   
Sbjct  2340  APGSLNASGVAGKIDLSWDIPVNNDVHHYVVYRSLTSSGTYNSIATINGAANNYYSDSNV  2399

Query  970   EMNQTYYYRVTA  1005
                 TYYY+VTA
Sbjct  2400  TNGTTYYYKVTA  2411


 Score = 36.6 bits (83),  Expect = 6.0
 Identities = 20/79 (25%), Positives = 37/79 (47%), Gaps = 1/79 (1%)
 Frame = +1

Query  772   YSVDNIAPGVPNGLMAMVLEDGIELTWSPSLDEDFQYFLLEKSTN-ESFSSPTAYELVDT  948
             Y VD+  P  P+G+        I L W  + + D + + + +S N       TA ++   
Sbjct  2726  YVVDHTGPAAPSGIYVEPEAGLITLKWQENTETDLKSYKVYRSENVVGPFEMTAQDIDSL  2785

Query  949   TFMDVEYEMNQTYYYRVTA  1005
              + D   +  +TYYY+++A
Sbjct  2786  GYRDRSVDQTKTYYYQISA  2804


>ref|ZP_04854074.1| predicted protein [Paenibacillus sp. oral taxon 786 str. D14]
 gb|EES71801.1| predicted protein [Paenibacillus sp. oral taxon 786 str. D14]
Length=1810

 Score = 51.6 bits (122),  Expect = 2e-04
 Identities = 52/176 (30%), Positives = 77/176 (44%), Gaps = 36/176 (20%)
 Frame = +1

Query  553   PSGQSYSLFRWDDFDNDSS-GWVALSSVGAIGEPAYTFEATTLMDSTSEESNGW-TNFKI  726
             P G   S   W D +     G V ++S+    +  Y F        TS+   GW T +  
Sbjct  722   PQGALLSFKHWYDLEEGYDIGTVYIASL----DTDYAFVPVAEFTGTSD---GWKTQYLD  774

Query  727   VASMEG-------GIFDD---HEEGYSVDNI--------APGVPNGLMAMVLEDG-IELT  849
             +    G       G+  D   H+ G+ +D++        AP  P  L   V   G  EL+
Sbjct  775   LRDYAGEQVYLQFGLTSDGSVHKAGWYLDDLSLQVPDATAPEAPADLTGSVNFAGSAELS  834

Query  850   WSPSLDEDFQYFLLEKSTNESFSSPTAYELVDTT----FMDVEYEMNQTYYYRVTA  1005
             WSPS DED + + + +ST    +S + YE++ T+    F D   E + TYYY VTA
Sbjct  835   WSPSADEDVKLYTVYRST----TSGSGYEVIGTSGQTEFTDTTTETDHTYYYAVTA  886


>ref|YP_001306678.1| fibronectin, type III domain-containing protein [Thermosipho 
melanesiensis BI429]
 gb|ABR31293.1| Fibronectin, type III domain protein [Thermosipho melanesiensis 
BI429]
Length=1089

 Score = 50.8 bits (120),  Expect = 3e-04
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 0/75 (0%)
 Frame = +1

Query  781   DNIAPGVPNGLMAMVLEDGIELTWSPSLDEDFQYFLLEKSTNESFSSPTAYELVDTTFMD  960
             D + P VP GL    L   I + W+P+ ++DF +++L+  T   FS+     L  T+ + 
Sbjct  637   DEVPPAVPTGLTPTGLFQTIMVKWNPNTEDDFDHYVLQYDTKSDFSTAKEIVLNATSAVI  696

Query  961   VEYEMNQTYYYRVTA  1005
              +  +N TYY R+ A
Sbjct  697   KDLAVNTTYYLRIKA  711


>ref|YP_001983759.1| glucan exo-1,3-beta glucosidase glu5A [Cellvibrio japonicus Ueda107]
 gb|ACE82980.1| glucan exo-1,3-beta glucosidase, putative, glu5A [Cellvibrio 
japonicus Ueda107]
Length=876

 Score = 46.2 bits (108),  Expect = 0.008
 Identities = 24/86 (28%), Positives = 40/86 (47%), Gaps = 4/86 (5%)
 Frame = +1

Query  748   IFDDHEEGYSVDNIAPGVPNGLMAMVLEDGIELTWSPSLDEDFQYFLLEKSTNESFSSPT  927
             + D+H + +      P  P  L      + + L+WSP+  +   Y +   +T  +   P 
Sbjct  649   VTDEHNDVFDY----PPRPTNLQLTESGNSVSLSWSPANGDTVSYSVYRATTPGAKGEPI  704

Query  928   AYELVDTTFMDVEYEMNQTYYYRVTA  1005
             A EL   T+ D   + +QTY+Y VTA
Sbjct  705   AEELTQNTYSDTRPDADQTYFYTVTA  730


>ref|YP_004182898.1| coagulation factor 5/8 type domain-containing protein [Terriglobus 
saanensis SP1PR4]
 gb|ADV82904.1| coagulation factor 5/8 type domain protein [Terriglobus saanensis 
SP1PR4]
Length=1935

 Score = 44.7 bits (104),  Expect = 0.022
 Identities = 23/73 (32%), Positives = 33/73 (45%), Gaps = 0/73 (0%)
 Frame = +1

Query  787   IAPGVPNGLMAMVLEDGIELTWSPSLDEDFQYFLLEKSTNESFSSPTAYELVDTTFMDVE  966
             + P  P GL A+  +  + LTW+ S        L   +     ++P A  L  TTF D  
Sbjct  1429  VVPSAPTGLTAIAGDSTVSLTWNASTGATSYNVLRGTTAGGENAAPIASNLTSTTFTDTT  1488

Query  967   YEMNQTYYYRVTA  1005
                  TY+Y+VTA
Sbjct  1489  ATNGTTYFYKVTA  1501


>ref|YP_001489931.1| fibronectin type III domain-containing protein [Arcobacter butzleri 
RM4018]
 gb|ABV67262.1| fibronectin type III domain protein [Arcobacter butzleri RM4018]
Length=420

 Score = 44.7 bits (104),  Expect = 0.022
 Identities = 44/157 (28%), Positives = 68/157 (43%), Gaps = 14/157 (9%)
 Frame = +1

Query  550   EPSGQSYSLFRWDDFDNDSSGWVALSSVGAIGEPAYTFEATTLMDSTSEESNGWTNFKIV  729
             +P    Y+ +R D      SG   L  + AI E  YT   T  +D   E    +  ++I 
Sbjct  65    DPRVVGYNFYRTDL----QSGEKTLKLIRAI-ESRYT---THYVDKELEPKTKYA-YQIS  115

Query  730   ASMEGGIFDDHEEGYSVDNIAPGVP-NGLMAMV-LEDGIELTWSPSLDEDFQYFLLEK--  897
             + +  G      + Y  + +   VP NG  A+  L   I+L W P  D+  QY+ +EK  
Sbjct  116   SRLNDGSESVTTDAYVAETLPRIVPVNGAQAISNLPKKIKLLWQPHPDQRIQYYRVEKYN  175

Query  898   -STNESFSSPTAYELVDTTFMDVEYEMNQTYYYRVTA  1005
              + NE     T  + +   ++D   E N TY YR+ A
Sbjct  176   TTLNEWIHLATVNQRLSAEYLDTGLENNTTYQYRIKA  212


 Score = 36.2 bits (82),  Expect = 7.8
 Identities = 39/156 (25%), Positives = 64/156 (41%), Gaps = 20/156 (13%)
 Frame = +1

Query  562   QSYSLFRWDDFDNDSSGWVALSSVGAIGEPAYTFEATTLMDSTSEESNGWTNFKIVASME  741
             Q    +R + ++   + W+ L++V       Y          T  E+N    ++I A   
Sbjct  164   QRIQYYRVEKYNTTLNEWIHLATVNQRLSAEYL--------DTGLENNTTYQYRIKAFT-  214

Query  742   GGIFDDHEEG-----YSVDNIAPGVPNGLMAMV-LEDGIELTWSPSLDEDFQYFLLEKST  903
                F+D E        +    AP  P  + A   +   I LTWSPS ++D   + + +S+
Sbjct  215   ---FEDVESAPTKTLSAKTKPAPKSPTNVKASNNIPKKIFLTWSPSQNQDIIGYDIYRSS  271

Query  904   NES--FSSPTAYELVDTTFMDVEYEMNQTYYYRVTA  1005
               S  FS  T      T + D   +  +TYYYR+ A
Sbjct  272   YSSFGFSKVTNVNSTTTEYTDSVDDDGRTYYYRIIA  307


>ref|YP_002505875.1| cellulosome anchoring protein cohesin region [Clostridium cellulolyticum 
H10]
 gb|ACL75895.1| cellulosome anchoring protein cohesin region [Clostridium cellulolyticum 
H10]
Length=782

 Score = 44.7 bits (104),  Expect = 0.022
 Identities = 33/114 (29%), Positives = 52/114 (46%), Gaps = 5/114 (4%)
 Frame = +1

Query  667   ATTLMDSTSEESNGWTNFKIVASMEGGIFDDHEEGYSVDNIAPG-VPNGLMAMVLEDGIE  843
             +TT  D+T   +NG T + +V ++  G   ++    S   IAP   P  L+A      ++
Sbjct  454   STTYTDTTV--ANGTTYYYVVTAVNAGGESENSNEVSAKPIAPAKAPINLVAKANNAKVD  511

Query  844   LTWSPSLDEDFQYFLLEKSTNESFSSPTAYELVDTTFMDVEYEMNQTYYYRVTA  1005
             L WS S  +    + +++ST       T  +   TT+ D       TYYY VTA
Sbjct  512   LVWSAS--QSATSYNIKRSTTAGGPYTTIGQSTSTTYTDTTVANGTTYYYVVTA  563


 Score = 43.1 bits (100),  Expect = 0.064
 Identities = 32/114 (28%), Positives = 52/114 (46%), Gaps = 5/114 (4%)
 Frame = +1

Query  667   ATTLMDSTSEESNGWTNFKIVASMEGGIFDDHEEGYSVDNIAPG-VPNGLMAMVLEDGIE  843
             +TT  D+T   +NG T + +V ++  G   ++    S   IAP   P  L+A      ++
Sbjct  365   STTYTDTTV--ANGTTYYYVVTAVNAGGESENSNEVSARPIAPAKAPINLVAKANNAKVD  422

Query  844   LTWSPSLDEDFQYFLLEKSTNESFSSPTAYELVDTTFMDVEYEMNQTYYYRVTA  1005
             L WS S  +    + ++++T       T  +   TT+ D       TYYY VTA
Sbjct  423   LVWSAS--QSATSYNIKRATTAGGPYTTIGQSTSTTYTDTTVANGTTYYYVVTA  474


 Score = 42.7 bits (99),  Expect = 0.084
 Identities = 32/114 (28%), Positives = 52/114 (46%), Gaps = 5/114 (4%)
 Frame = +1

Query  667   ATTLMDSTSEESNGWTNFKIVASMEGGIFDDHEEGYSVDNIAPG-VPNGLMAMVLEDGIE  843
             +TT  D+T   +NG T + +V ++  G   ++    S   IAP   P  L+A      ++
Sbjct  276   STTYTDTTV--ANGTTYYYVVTAVNTGGESENSNEVSAKPIAPAKAPINLVAKANNAKVD  333

Query  844   LTWSPSLDEDFQYFLLEKSTNESFSSPTAYELVDTTFMDVEYEMNQTYYYRVTA  1005
             L WS S  +    + ++++T       T  +   TT+ D       TYYY VTA
Sbjct  334   LVWSAS--QSATSYNIKRATTAGGPYTTIGQSTSTTYTDTTVANGTTYYYVVTA  385


>ref|YP_003703131.1| Fibronectin type III domain protein [Syntrophothermus lipocalidus 
DSM 12680]
 gb|ADI02566.1| Fibronectin type III domain protein [Syntrophothermus lipocalidus 
DSM 12680]
Length=1073

 Score = 43.9 bits (102),  Expect = 0.038
 Identities = 38/135 (28%), Positives = 60/135 (44%), Gaps = 14/135 (10%)
 Frame = +1

Query  601   DSSGWVALSSVGAIGEPAYTFEATTLMDSTSEESNGWTNFKIVASMEGGIFDDHEEGYSV  780
             D+  W +L++V           AT+  D  ++ +   T +  V S  G          +V
Sbjct  452   DNITWSSLANVS---------NATSYTDEVTDPNT--TYYYRVRSDGGNGQLSEPSNTAV  500

Query  781   DNIAPGVPNGLMAMVLEDGIELTWSPSLDEDFQYFLLEKSTNESFSSPTAYELVDTTFMD  960
                 P  P GL A      I LTWS S       +++++ST+ +  S  A E+  T+++D
Sbjct  501   ITTPPAAPTGLTATAAGRNISLTWSGSAGA--ASYVIQRSTDGASFSQIA-EVTVTSYLD  557

Query  961   VEYEMNQTYYYRVTA  1005
                + N TYYYRV A
Sbjct  558   SALDWNTTYYYRVFA  572


 Score = 39.3 bits (90),  Expect = 0.93
 Identities = 40/149 (27%), Positives = 63/149 (42%), Gaps = 6/149 (4%)
 Frame = +1

Query  556  SGQSYSLFRWDDFDNDSSGWVALSSVGAIGEP-AYTFEATTLMDSTSEESNGWTNFKIVA  732
            +G+S +L  W    N +S  V  S+ G++ E  A   E  T    T+       N++++A
Sbjct  777  NGKSVTL-SWTGSAN-ASYIVERSTDGSVWEQVAEVPETETTYQDTAPRWETTYNYRVLA  834

Query  733  SMEGGIFDDHEEGYSVDNIAPGVPNGLMAMVLEDGIELTWSPSLDEDFQYFLLEKSTNES  912
               GG+  +  E       A  VP  L A V  + I + W  ++    QY +       S
Sbjct  835  KNSGGMISEPSESVQATTSAIPVPQNLKASVSGNAITVKWD-AVAGIGQYKVERSVDGAS  893

Query  913  FSSPTAYELVDTTFMDVEYEMNQTYYYRV  999
            +   T  +  +  F D + E   TYYYRV
Sbjct  894  WREVTLTD--ENYFTDNDLEWETTYYYRV  920


>ref|YP_001997480.1| peptidase S8/S53 subtilisin kexin sedolisin [Chloroherpeton thalassium 
ATCC 35110]
 gb|ACF15033.1| peptidase S8 and S53 subtilisin kexin sedolisin [Chloroherpeton 
thalassium ATCC 35110]
Length=1628

 Score = 43.9 bits (102),  Expect = 0.038
 Identities = 46/163 (28%), Positives = 67/163 (41%), Gaps = 18/163 (11%)
 Frame = +1

Query  556   SGQSYSLFRWDDFDNDSSGWVALSSVGAIGEPAYTFEATTLMDSTSE-----ESNGWTNF  720
             S    +L   D+ DN+    +  S          TF+     D TS      E+N    F
Sbjct  559   SSSQVNLSWQDNSDNEMGFIIHWSKYANFSTYDSTFQGR---DRTSHPLSGLEANTTYYF  615

Query  721   KIVASMEGG---IFDDHEEGYSVDNIAPGVPNGLMAMVL-EDGIELTWSPSLDEDFQYFL  888
             ++ AS   G     +   E    +   P  P GL A  + E  I L W  + + +  ++L
Sbjct  616   RVYASSLAGNSAFSNTVSETTQPEGSIPQPPTGLQATAISEKRIRLNWIDNANNELGFYL  675

Query  889   LEKSTNESFSS----PTAYELVDTTFMDVEYEMNQTYYYRVTA  1005
               +S   +FS+    P  YE  DT + D   E N TYYYR+TA
Sbjct  676   -HRSKTSNFSAYTEIPAGYEN-DTEYNDNNLEPNTTYYYRLTA  716


>gb|ADU74089.1| PKD domain containing protein [Clostridium thermocellum DSM 1313]
Length=7955

 Score = 43.1 bits (100),  Expect = 0.064
 Identities = 38/168 (23%), Positives = 64/168 (38%), Gaps = 6/168 (4%)
 Frame = +1

Query  517   VSFNASYFDNGEPSGQSYSLFRWDDFDND--SSGWVALSSVGAIGEPAYTFEATTLMDST  690
             V+  A   DN E +  S+     D+  N      W  ++ V   G+     +  TL    
Sbjct  2239  VTLTAYAKDNLEVNMYSFQFRPLDENGNPIGDGEWTPIADVQNPGKNEVQVKWDTLATGP  2298

Query  691   SEES---NGWTNFKIVASMEGGIFDDHEEGYSVDNIAPGVPNGLMAMVLEDGIELTWSPS  861
               E    +G+   +++ S   G F      Y + N  P  P  L     E  + ++WSP 
Sbjct  2299  EGEELYPDGYYQVRVMVSDAAGNFSQKIHTYLLANDPPSPPEHLYVQAGEWQLVVSWSPV  2358

Query  862   LDEDFQYFLL-EKSTNESFSSPTAYELVDTTFMDVEYEMNQTYYYRVT  1002
             L  DF+Y++L  K   E              ++D   +  + Y+Y V+
Sbjct  2359  LRPDFRYYVLYRKEGREGTWEKIVSNTTSNVYIDTMRDPQKEYFYAVS  2406


 Score = 38.9 bits (89),  Expect = 1.2
 Identities = 22/80 (28%), Positives = 38/80 (48%), Gaps = 2/80 (3%)
 Frame = +1

Query  772   YSVDNIAPGVPNGLMAMVLEDG--IELTWSPSLDEDFQYFLLEKSTNESFSSPTAYELVD  945
             Y VD  AP  P+GL  +  + G  ++L+W  S  +D  ++++ ++T    +         
Sbjct  2570  YIVDREAPQTPSGLKVVDPKVGGELQLSWERSKSDDVDHYVVYRATESGGNFKAVTRTKS  2629

Query  946   TTFMDVEYEMNQTYYYRVTA  1005
               + D   E  + YYY VTA
Sbjct  2630  LVYTDKGLEDGKIYYYVVTA  2649


 Score = 37.7 bits (86),  Expect = 2.7
 Identities = 32/112 (29%), Positives = 51/112 (46%), Gaps = 8/112 (7%)
 Frame = +1

Query  685   STSEESNGWTNFKIVASMEGGIFDDHEEGYSVDNIAPGVPNGLMAMVLEDGIELTWSPSL  864
             +T E  +G    K+V S       +    Y+VDN  P  P  L A   E  + L W  S+
Sbjct  2089  NTKELVDGLYYVKVVVSDTSDNISEFISEYTVDNTPPAAP-VLKASSSELRVLLEWELSV  2147

Query  865   D-EDFQYFLLEKSTNESFSSPTAYELVDTT----FMDVEYEMNQTYYYRVTA  1005
               EDF +F + +ST     +   +EL++ T    + D    ++   +Y+VTA
Sbjct  2148  KAEDFDHFRVYRSTEG--GAEDTFELIENTMDFSYADTAAPLDVDSFYKVTA  2197


>ref|ZP_05430708.1| PKD domain containing protein [Clostridium thermocellum DSM 2360]
 gb|EEU00416.1| PKD domain containing protein [Clostridium thermocellum DSM 2360]
Length=6806

 Score = 43.1 bits (100),  Expect = 0.064
 Identities = 38/168 (23%), Positives = 64/168 (38%), Gaps = 6/168 (4%)
 Frame = +1

Query  517   VSFNASYFDNGEPSGQSYSLFRWDDFDND--SSGWVALSSVGAIGEPAYTFEATTLMDST  690
             V+  A   DN E +  S+     D+  N      W  ++ V   G+     +  TL    
Sbjct  1090  VTLTAYAKDNLEVNMYSFQFRPLDENGNPIGDGEWTPIADVQNPGKNEVQVKWDTLATGP  1149

Query  691   SEES---NGWTNFKIVASMEGGIFDDHEEGYSVDNIAPGVPNGLMAMVLEDGIELTWSPS  861
               E    +G+   +++ S   G F      Y + N  P  P  L     E  + ++WSP 
Sbjct  1150  EGEELYPDGYYQVRVMVSDAAGNFSQKIHTYLLANDPPSPPEHLYVQAGEWQLVVSWSPV  1209

Query  862   LDEDFQYFLL-EKSTNESFSSPTAYELVDTTFMDVEYEMNQTYYYRVT  1002
             L  DF+Y++L  K   E              ++D   +  + Y+Y V+
Sbjct  1210  LRPDFRYYVLYRKEGREGTWEKIVSNTTSNVYIDTMRDPQKEYFYAVS  1257


 Score = 38.9 bits (89),  Expect = 1.2
 Identities = 22/80 (28%), Positives = 38/80 (48%), Gaps = 2/80 (3%)
 Frame = +1

Query  772   YSVDNIAPGVPNGLMAMVLEDG--IELTWSPSLDEDFQYFLLEKSTNESFSSPTAYELVD  945
             Y VD  AP  P+GL  +  + G  ++L+W  S  +D  ++++ ++T    +         
Sbjct  1421  YIVDREAPQTPSGLKVVDPKVGGELQLSWERSKSDDVDHYVVYRATESGGNFKAVTRTKS  1480

Query  946   TTFMDVEYEMNQTYYYRVTA  1005
               + D   E  + YYY VTA
Sbjct  1481  LVYTDKGLEDGKIYYYVVTA  1500


 Score = 37.7 bits (86),  Expect = 2.7
 Identities = 32/112 (29%), Positives = 51/112 (46%), Gaps = 8/112 (7%)
 Frame = +1

Query  685   STSEESNGWTNFKIVASMEGGIFDDHEEGYSVDNIAPGVPNGLMAMVLEDGIELTWSPSL  864
             +T E  +G    K+V S       +    Y+VDN  P  P  L A   E  + L W  S+
Sbjct  940   NTKELVDGLYYVKVVVSDTSDNISEFISEYTVDNTPPAAP-VLKASSSELRVLLEWELSV  998

Query  865   D-EDFQYFLLEKSTNESFSSPTAYELVDTT----FMDVEYEMNQTYYYRVTA  1005
               EDF +F + +ST     +   +EL++ T    + D    ++   +Y+VTA
Sbjct  999   KAEDFDHFRVYRSTEG--GAEDTFELIENTMDFSYADTAAPLDVDSFYKVTA  1048


>ref|YP_001037660.1| cellulose 1,4-beta-cellobiosidase [Clostridium thermocellum ATCC 
27405]
 gb|ABN52467.1| Cellulose 1,4-beta-cellobiosidase [Clostridium thermocellum ATCC 
27405]
Length=6885

 Score = 43.1 bits (100),  Expect = 0.064
 Identities = 38/168 (23%), Positives = 64/168 (38%), Gaps = 6/168 (4%)
 Frame = +1

Query  517   VSFNASYFDNGEPSGQSYSLFRWDDFDND--SSGWVALSSVGAIGEPAYTFEATTLMDST  690
             V+  A   DN E +  S+     D+  N      W  ++ V   G+     +  TL    
Sbjct  1169  VTLTAYAKDNLEVNMYSFQFRPLDENGNPIGDGEWTPIADVQNPGKNEVQVKWDTLATGP  1228

Query  691   SEES---NGWTNFKIVASMEGGIFDDHEEGYSVDNIAPGVPNGLMAMVLEDGIELTWSPS  861
               E    +G+   +++ S   G F      Y + N  P  P  L     E  + ++WSP 
Sbjct  1229  EGEELYPDGYYQVRVMVSDAAGNFSQKIHTYLLANDPPSPPEHLYVQAGEWQLVVSWSPV  1288

Query  862   LDEDFQYFLL-EKSTNESFSSPTAYELVDTTFMDVEYEMNQTYYYRVT  1002
             L  DF+Y++L  K   E              ++D   +  + Y+Y V+
Sbjct  1289  LRPDFRYYVLYRKEGREGTWEKIVSNTTSNVYIDTMRDPQKEYFYAVS  1336


 Score = 38.9 bits (89),  Expect = 1.2
 Identities = 22/80 (28%), Positives = 38/80 (48%), Gaps = 2/80 (3%)
 Frame = +1

Query  772   YSVDNIAPGVPNGLMAMVLEDG--IELTWSPSLDEDFQYFLLEKSTNESFSSPTAYELVD  945
             Y VD  AP  P+GL  +  + G  ++L+W  S  +D  ++++ ++T    +         
Sbjct  1500  YIVDREAPQTPSGLKVVDPKVGGELQLSWERSKSDDVDHYVVYRATESGGNFKAVTRTKS  1559

Query  946   TTFMDVEYEMNQTYYYRVTA  1005
               + D   E  + YYY VTA
Sbjct  1560  LVYTDKGLEDGKIYYYVVTA  1579


 Score = 37.7 bits (86),  Expect = 2.7
 Identities = 32/112 (29%), Positives = 51/112 (46%), Gaps = 8/112 (7%)
 Frame = +1

Query  685   STSEESNGWTNFKIVASMEGGIFDDHEEGYSVDNIAPGVPNGLMAMVLEDGIELTWSPSL  864
             +T E  +G    K+V S       +    Y+VDN  P  P  L A   E  + L W  S+
Sbjct  1019  NTKELVDGLYYVKVVVSDTSDNISEFISEYTVDNTPPAAP-VLKASSSELRVLLEWELSV  1077

Query  865   D-EDFQYFLLEKSTNESFSSPTAYELVDTT----FMDVEYEMNQTYYYRVTA  1005
               EDF +F + +ST     +   +EL++ T    + D    ++   +Y+VTA
Sbjct  1078  KAEDFDHFRVYRSTEG--GAEDTFELIENTMDFSYADTAAPLDVDSFYKVTA  1127


>ref|YP_003641596.1| cytochrome C family protein [Thermincola sp. JR]
 gb|ADG83695.1| cytochrome C family protein [Thermincola potens JR]
Length=3091

 Score = 42.7 bits (99),  Expect = 0.084
 Identities = 30/89 (34%), Positives = 41/89 (46%), Gaps = 12/89 (13%)
 Frame = +1

Query  775   SVDNIAPGVPNGLMAMV------LEDGIELTWSPSLD--EDFQYFLLEKSTNESFSSPTA  930
             S D   P +P  + A +          I L WSPS D  E  +Y +   ++  +   P A
Sbjct  1679  SADTTKPDIPLNVTASLPLKEEMQSTSIVLNWSPSSDNYEVRRYNIYRTASASAKDDPGA  1738

Query  931   YELV----DTTFMDVEYEMNQTYYYRVTA  1005
             Y LV     T+F+D     N TYYYR+TA
Sbjct  1739  YTLVGSTGSTSFVDGSLSENTTYYYRITA  1767