GOS 2136010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_776
Annotathon code: GOS_2136010
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : Algarve 2011
Username : aacosta
Annotated on : 2011-07-12 17:26:14
  • Costa Ângela Maria Araújo da

Synopsis

  • Taxonomy: Proteobacteria (NCBI info)
    Rank: phylum - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 1224
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: - Order:
    Bacteria; Proteobacteria;

Genomic Sequence

>JCVI_READ_776 GOS_2136010 Genomic DNA
TTGTATTGGACAAGCTATGGGAAGAGTATCAAAATGAACTTCCTGGATACAGAGGTCATCATGAACAAAATATGGCACTAACAGGTATTGCATATGCTCG
TGCCAAAAGAAGACAACAAATATTTGTTGCAACTTCATCTGTTGGACCTGGTTCTACTAATATGGTAACTGCTGCTGCAGTTGCTTTAAGTAATAGACTT
CCAATTTTACTTTTACCAGGCGATACATTTTCTAGTCGTTTTCCAGATCCAGTTTTACAACAAGTAGAACATTTTAATTCTCCTTCAGAAACTCAAAATG
ATTCATTTAAATCTGTATCAAGATATTTTGATCGAATTACTAGACCTGAACAAATTTTAACATCTTTACCGCAAGCAATTAATGTAATGCTTGATCCTGC
AGACTGTGGCCCAGCAGTAATTTCTATGTCTCAAGATGTTCAAGGTGAAGCTTATGATTATCCTGAAATTTTTTTTGAAGAAAAAATTCATGAAATTAGA
AGAATTCACCCTGATCCAAATCAAATACAAAAGGCTGCAGATAAATTAAAACAATCTAAACAACCTATTATTATCTCAGGTGGAGGTGTTTTATATTCAG
AAGCAGAAGAAGAAATTTCCGCTTTTGCAAAAAAACATAATATTCCTGTAACAGCAACTGTAATGGGTATTGGATGTATGAATAAAGATGATCCCTATTA
TATAAGTGCAATTGGATGCTTGGGAGAAGGCTCATCTAATAATCTTGCTACTGATACAGATTTAGCATTAGCAGTTGGAACAAAATTAGGAGACTTTACA
ACTGGTTCTTGGACTAATTTTGAAAATGAAAATTTTCAACTTGTATCAAT

Translation

[3 - 848/850]   direct strand
>GOS_2136010 Translation [3-848   direct strand]
VLDKLWEEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVALSNRLPILLLPGDTFSSRFPDPVLQQVEHFNSPSETQND
SFKSVSRYFDRITRPEQILTSLPQAINVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADKLKQSKQPIIISGGGVLYSE
AEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLGEGSSNNLATDTDLALAVGTKLGDFTTGSWTNFENENFQLVS

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

The annotation of this metagenomic sequence allowed to conclude that the longest ORF (ORF number 1 in reading frame 3 on the direct strand), even though is incomplete in both ends, correspond to a coding ORF.


Its putative function is disclosed by the identification of conserved protein domains that acts as coenzyme and catalyse several biochemical reactions[1] in acquiescence by several homologs from Blast results, both analyses with e-values next to 0. These too tools point to the Acetolactate synthase enzyme, which is specifically involved in the chemical reaction involving the conversion of two pyruvate molecules to an acetolactate molecule and carbon dioxide. The reaction is assisted by thyamine pyrophosphate in order to link the two pyruvate molecules[2].

Like this it is possible to conclude that the function of this enzyme is catalytic activity or more specifically transferase activity - GO:0016740.

It is also possible to predict the biological process based on the analysis of the probable enzyme, which is amino acid and derivative metabolic process[2, 3].


[1] Arjunan P, Umland T, Dyda F, Swaminathan S, Furey W, Sax M, Farrenkopf B, Gao Y, Zhang D, Jordan F. 1996. Crystal structure of the thiamin diphosphate-dependent enzyme pyruvate decarboxylase from the yeast Saccharomyces cerevisiae at 2.3 A resolution. J. Mol. Biol. 256: 590-600

[2] Chang, Y; Cronan, J JR. 1988. Common Ancestry of Escherichia coli Pyruvate Oxidase and the Acetohydroxy Acid Synthases of the Branched-Chain Amino Acid Biosynthetic Pathway. J. Bacteriol. 170 (9): 3937-3945.

[3] Dailey FE, Cronan JE. 1986. Acetohydroxy acid synthase I, a required enzyme for isoleucine and valine biosynthesis in Escherichia coli K-12 during growth on acetate as the sole carbon source". J. Bacteriol. 165 (2): 453–60.


According to this results and the consesus of several homologs, it seems that this query sequence correspond to the gene ioLD.


Also, ORF number 1 in reading frame 1 on the reverse strand exhibits one hit on NCBI BLAST, but no more homologs were found with this hypothetic protein, which could suggest that there is currently no known homologs but because the longest ORF is a true ORF, I conclude that this is a false positive ORF.


Albeit with some precision was able identifying the protein and its function, the fact that more that 300 a.a. of the protein sequence are missing (data showed by multiple alignment), the taxonomic group that was possible to approach was the phylum due to the strong similarity between the all query sequence and the homologs of the classes of phylum to which indubitably this metagenomics sequence belongs - Proteobacteria.


ORF finding

PROTOCOL


a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code



RESULTS ANALYSIS



In this sequence there are one ORF on the direct strand and two ORFs on the reverse strand.


The longest ORF was chosen, it extends from base 3 to base 848 on the direct strand. Is a coding sequence comproved with clearly homology to known proteins with catalytic activity, showed by good scores and e-values under e-20 and conserved proteins domains also with e-values under e-24.

This metagenomic sequence is incomplete at both ends, this means that this ORF does not have both START and STOP codons, easily observed in the multiple alignment where the length of the homologs have approximately 600 aa and the metagenomic sequence has only 282 aa.

With other bioinformatics tools (EBI ORF finder and NCBI ORF finder) similar results were found and support the ones generated by SMS tool.


Beyond the chosen ORF, also ORF number 1 in reading frame 1 on the reverse strand exhibits one hit with e-value of 0.002 with algorithm blastp versus NR, even though in InterProScan tool no hits were found. Alignment of the two sequences using tools as Lalign, EMBL-EBI – Align and PRSS (local alignment), showed significant similarity between the two sequences. PRSS results revealed a score of 208 and e-value ~ e-12.


The other ORF, ORF number 1 in reading frame 3 on the reverse strand does not has results on BLASTp but was found an unintegrated domain of a signal-peptide.

RAW RESULTS


a) forward strand


No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the direct strand extends from base 3 to base 848.
GTATTGGACAAGCTATGGGAAGAGTATCAAAATGAACTTCCTGGATACAGAGGTCATCAT
GAACAAAATATGGCACTAACAGGTATTGCATATGCTCGTGCCAAAAGAAGACAACAAATA
TTTGTTGCAACTTCATCTGTTGGACCTGGTTCTACTAATATGGTAACTGCTGCTGCAGTT
GCTTTAAGTAATAGACTTCCAATTTTACTTTTACCAGGCGATACATTTTCTAGTCGTTTT
CCAGATCCAGTTTTACAACAAGTAGAACATTTTAATTCTCCTTCAGAAACTCAAAATGAT
TCATTTAAATCTGTATCAAGATATTTTGATCGAATTACTAGACCTGAACAAATTTTAACA
TCTTTACCGCAAGCAATTAATGTAATGCTTGATCCTGCAGACTGTGGCCCAGCAGTAATT
TCTATGTCTCAAGATGTTCAAGGTGAAGCTTATGATTATCCTGAAATTTTTTTTGAAGAA
AAAATTCATGAAATTAGAAGAATTCACCCTGATCCAAATCAAATACAAAAGGCTGCAGAT
AAATTAAAACAATCTAAACAACCTATTATTATCTCAGGTGGAGGTGTTTTATATTCAGAA
GCAGAAGAAGAAATTTCCGCTTTTGCAAAAAAACATAATATTCCTGTAACAGCAACTGTA
ATGGGTATTGGATGTATGAATAAAGATGATCCCTATTATATAAGTGCAATTGGATGCTTG
GGAGAAGGCTCATCTAATAATCTTGCTACTGATACAGATTTAGCATTAGCAGTTGGAACA
AAATTAGGAGACTTTACAACTGGTTCTTGGACTAATTTTGAAAATGAAAATTTTCAACTT
GTATCA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
VLDKLWEEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAV
ALSNRLPILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILT
SLPQAINVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAAD
KLKQSKQPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCL
GEGSSNNLATDTDLALAVGTKLGDFTTGSWTNFENENFQLVS

---------------------------------------------------------------------------------------------------

b) reverse strand


>ORF number 1 in reading frame 1 on the reverse strand extends from base 559 to base 792.
GTTTCTGAAGGAGAATTAAAATGTTCTACTTGTTGTAAAACTGGATCTGGAAAACGACTA
GAAAATGTATCGCCTGGTAAAAGTAAAATTGGAAGTCTATTACTTAAAGCAACTGCAGCA
GCAGTTACCATATTAGTAGAACCAGGTCCAACAGATGAAGTTGCAACAAATATTTGTTGT
CTTCTTTTGGCACGAGCATATGCAATACCTGTTAGTGCCATATTTTGTTCATGA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
VSEGELKCSTCCKTGSGKRLENVSPGKSKIGSLLLKATAAAVTILVEPGPTDEVATNICC
LLLARAYAIPVSAIFCS*

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 306 to base 485.
TTTATCTGCAGCCTTTTGTATTTGATTTGGATCAGGGTGAATTCTTCTAATTTCATGAAT
TTTTTCTTCAAAAAAAATTTCAGGATAATCATAAGCTTCACCTTGAACATCTTGAGACAT
AGAAATTACTGCTGGGCCACAGTCTGCAGGATCAAGCATTACATTAATTGCTTGCGGTAA


>Translation of ORF number 1 in reading frame 3 on the reverse strand.
FICSLLYLIWIRVNSSNFMNFFFKKNFRIIISFTLNILRHRNYCWATVCRIKHYINCLR*

Multiple Alignement

PROTOCOL



1) Phylogeny.fr | Muscle Alingment| default parameters | Clustal Format

2) Phylogeny.fr | Muscle Alingment| Gblocks 0.91b | default parameters




RESULTS ANALYSIS


Analysing the results of multiple alignment with both approaches easily allow seeing that the sequence is incomplete at 5'end and 3'end. This metagenomic sequence corresponds a small part of the whole protein, which has according to this results more than 600 aa.


The GOS sequence aligned have good similarity (mainly between the sequences of ingroup), showing conserved positions ~ 36%.


RAW RESULTS


1) Phylogeny.fr | Muscle Alingment| default parameters | Clustal Format                                             
 

MUSCLE (3.7) multiple sequence alignment


out_gi|255      ----------------------------MTKRLTVAQATIMFLKNQYIER-DGV-EEPYF
out_gi|302      ---------------------------MKTVRLTVGQAIVRFLDNQYIST-DGK-EEKYV
out_gi|325      --------------------------MNKTVRMTTAQAIVRFLDQQYVCM-DGV-ETKFV
out_gi|320      --MTYGNFNDKLYEKNKAIELFSIFWEEIMARMTVGQAIVKFLDNQWISQ-DGK-KIKFV
out_gi|521      ---------------------------MQTVRMTTAQALVKFLNQQYVEF-DGK-QQKFI
out_gi|310      -------------------------MTLKTIKLTTAQALVKFLDNQYVEF-NGK-QEKFI
gi|2607789      ---------------------------MKTIRLTVAEALAQYLAAQKIEV-DGK-VEQLF
gi|5430214      --------------------------MMKTVRLTVAEAFANYLAAQKIEI-DGK-VEQLF
gi|2077231      ------------------------MSRQATVRLTMAQALVRHLAALRVAEEDGT-LVPYV
gi|3003117      --------------------MNAQVNVRPTLRLTMAQALVRYLDALRIQTPQGV--LPLF
gi|1706958      MNQRMMDHKREQEHEHGHAASVGGAVREGTIRLTTAQALVRYLAAQRVATEDGLGTEPLF
gi|3267941      ---------------------------MKTIKLTMAQALVRYLMAQKVQTNDGV--QPMF
gi|3075468      ---------------------------MNTIRLTMAQALVKYLAAQRIEC-EGR-EVALF
gi|1637960      -------------------MAEERERGMGVIRLTAAQAVVRYLAAQMTSL-DGT-QVPLF
GOS_213601      ------------------------------------------------------------
gi|1826797      ---------------------------MAMVRCTMAQALVRYLCNQFTIV-NGQ-RVPLF
gi|2220842      -------------------------MTRKTVRLTMAQALVRYLCNQFTDI-EGE-RVPLF
gi|3251130      -------------------------MSERTVRLTMAQALVRWLTHQYTEI-DGE-RVPLF
                                                                            

out_gi|255      GGCFGIFGHGNVAGLGQALQENPD-FRYYQCRNEQSMVHTAVAYAKVKNRLGAFVCTTSI
out_gi|302      NGVFGIFGHGCVVGLGEALQEPNHGLKFYQGHNEQGMTHAAIAYAKQNNRRKIMAVTSSI
out_gi|325      EGFFTIFGHGIAVGLGEALDSNPGSLRVMQGRNEQGMCHTAIAFAKQNNRRKIIPCASSV
out_gi|320      EGIFTLFGHGNVCGLGEALDENPGALRVYQGRNEQGMCHAAIGFAKQHNRKKIIACTSSI
out_gi|521      KGIFTIFGHGNVVGLGQALEEDAGELEVYQGRNEQGMANAAMAFAKQKHRKQIMACTSSV
out_gi|310      KGFFTIFGHGNVVGLGQALEEYEGDMIIHQGRNEQGMAQAAIGFAKQTHRKQIYACTSSV
gi|2607789      GCAFAIFGHGNVTCFGQQLKNIEDKIPTWRGQNEQSMATAAIAYAKANQRRRIGIATSSI
gi|5430214      GAAFAIFGHGNVTCFGQQLKNIEDKIPTWRGQNEQSMAIAAIAYAKANQRRRIGIATSSI
gi|2077231      GGVWAIFGHGNVAGLGEALAQTRDALPVYRAHNEQAMAHAAIAYGKAHFRRRIMAATSSI
gi|3003117      GGVFSIFGHGNVAGMGEALYQYRATLPTYRAHNEQAMAHSAIAYAKAHLRQRMMAVTTSI
gi|1706958      GGVFAIFGHGNVAGMGEALYQHRDELPTLRAHNEQAMAHSAIAYAKVHFRRRMMAVTTSI
gi|3267941      AGVWGIFGHGNVAGLGEALHEVKETLPTYRAHNEQGMAHAAIAYAKAHNRRQMMACTTSI
gi|3075468      EGVFGIFGHGNVAGLGEALYHAREELPTYRAHNEQTMAHAAIAFAKANGRRRMMAATSSI
gi|1637960      AGVWAIFGHGNVAGLGEALWHAREALPTFRAHNEQAMTLAAIAYAKASNRRRMMACTTSI
GOS_213601      -------------VLDKLWEEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSV
gi|1826797      PGVFAIFGHGNVTCLAEALEAVQDKLPTWRGQNEQSMALAAIGFAKAVRRRQIMVATSSI
gi|2220842      AGVFAIFGHGNVTCLSEALETVQDRLPTWRGQNEQSMALAAIGFAKAKRRRQIMVAASSI
gi|3251130      AGLFGIFGHGNVTCLSEALEQVQDQLPTYRGQNEQSMALAAIGYAKAKRRRQIMIAATSI
                              : :        :   . .:** *  :.:.:..   *      ::*:

out_gi|255      GPGATNMITGAALATINRLPVLLLPGDIFATREPNPVLQQLESAASQDISVNDCFKPVSK
out_gi|302      GPGALNMVTAAALASVNRIPVLLMPGDAFACRQPDPVLQQVEQFHDYTVTANDAFKAVCR
out_gi|325      GPGAANMVTACATATVNNIPLLVFPADTFASRQPDPVLQQLEQSSSLATTTNDAFKPVCK
out_gi|320      GPGAANMVTAAALATANNLPLLVFTGDTFATRQPDPVLQQIEQPSNLSITTSDAFKPVTR
out_gi|521      GPGSANMITSAATASANNIPVLLLPGDVFATRQPDPVLQQIEQTHDLSISTNDAFRAVSK
out_gi|310      GPGAANMVTAAATATANRIPVLLLPGDTFATRQPDPVLQQVEQSSDLSITTNDAFKAVSK
gi|2607789      GPGATNMVTAAGIAHTNRLPVLLISGDAYVSRLPDPVLQQPENFYDPSITCNDAFKPLTR
gi|5430214      GPGATNMITAAGIAHTNRLPLLLISGDAYISRLPDPVLQQPENFHNPSITCNDAFKPLTR
gi|2077231      GPGATNMVTAAALAHAGRLPVLLLPGDTFASRAPDPVLQQLESFAEGDATANDAFRPVSR
gi|3003117      GPGATNLLTAAALAHVNRLPVLLLPGDVFVSRRPDPVLQQLEDFNDPGLSVNDAFRPLSR
gi|1706958      GPGATNLLTAAALAHVNRLPVLLLPGDIFVSRAPDPVLQQVEDFHDGGVSANDAFKPVSR
gi|3267941      GPGAANMVTAAALAHVNRLPVLFLPGDTFANRTPDPVLQQVESFGDPTISTNDCFRPVSR
gi|3075468      GPGATNMVTAAALAHANRLPILLLPGDTFASRDPDPVLQQVEHFGDPTITVNDCFRPVSR
gi|1637960      GPGALNMVTAAAVAHVNRLPVLLLPGDTFAGRLPDPVLQQVEHFGDPTVTANDCFRPVSR
GOS_213601      GPGSTNMVTAAAVALSNRLPILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSR
gi|1826797      GPGALNMVTAAGVAHTNRLPVLLLAGDTFVNRRPDPVMQQVEHFGNPTITVNDAFKAVTR
gi|2220842      GPGALNMVTAAGVAMANRLPVLLLAGDTYASRLPDPVLQQVEHFGDPTITANDAFKSVVR
gi|3251130      GPGASNMVTAAGTAMANRLPVLLLAGDTFANRLPDPVLQQVEHFGNPTITVNDTFKPVVR
                ***: *::*... *  ..:*:*.:..* :  * *:**:** *   .   : .* *..: .

out_gi|255      YWDRINRPEQLIYSLPEVMRVLTSQAEMGAVTLSMPQDVQTHAYDFPESLFQKRVWHVGR
out_gi|302      YWDRVSRPEQLMTALMNAFRVLTDPAQTGAVCLALPQDVQAEAWDYPESFFRKRVHYIER
out_gi|325      YWDRITRPEMIMTALINAMRVLTDPAETGACCIGLCQDVEGESFDFPEYFFKKRVHRITR
out_gi|320      YWDRVYRPEQLMTALLSAMRVLTDPAETGGVCISLPQDVQGESYDFLDYFFAERVHSIRR
out_gi|521      YWDRINRPEQLMTAMIQAMRVLTNPADTGAVTICLPQDVQGEAWDFPSYFFQKRVHRIER
out_gi|310      YWDRINRPEQLMTAAINAIRVLVDPADTGAVTLSLPQDVQGEAYEYPESFFQKRVHRIER
gi|2607789      YWDRIVSPSQLIHTLPQAIDTMLDPETCGPAFLSLPQDIQGVAYDFPEVFFEEKIHRIRR
gi|5430214      YWDRIVSPAQIIQSLPHALNTLLDPETCGPVFIGLPQDVQGMAYDFPESFFADKVHRIRR
gi|2077231      YFDRIVRPEQILTALPRAIQVLTDPAQCGPVTLALPQDVQTLAFDCPEDFLQPEPIRIRR
gi|3003117      MFDRICYPEQLLTALPRAIQVLTDPAQCGPVTLALPQDVQTMAYDYPLDFFSPRVIVPRA
gi|1706958      YFDRIVHPAQLLSALPRALRVLTDAASCGPVTLALPQDVQAQAWDFPAGFFAPRVVTFYA
gi|3267941      YFDRITRPEQIITSLPQAMRVLTDSVDCGPVTLCLSQDVQAEAYDFPESFFDEKVHRVRR
gi|3075468      YFDRITRPEQLLTSLPQAIATLLDPEHCGPATLALPQDVQTFAYDYPESFFAPRVHRIRR
gi|1637960      WFDRITRPEQLLTSLPRALQVLTDPAECGPVTLCLSQDVQAEAYDYPDAFFAETLRQTRR
GOS_213601      YFDRITRPEQILTSLPQAINVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRR
gi|1826797      YWDRIVHPEQVISSLPQAVAAMLDPADCGPAFIALPQDVQEMAWDYPEAFFAETVHNIPR
gi|2220842      YWDRIVLPEQILQSLPQAVATMLDPADCGPAFIGLAQDTQEVAFDYPEVFFEPKVWKIPR
gi|3251130      YWDRISLPEQIITSLPQAVATMLDPADCGPAFIGLAQDTQEKAFDYPAVFFEPKVWHIPR
                 :**:  *  :: :   .. .: .    *   : : ** :  :::    ::         

out_gi|255      PRPDLVTLQKAAEWIKTAQKPVIVAGGGAIYSGATDVLHDFATKTGIPVGETFAGKGAVR
out_gi|302      RTLSPEALDRAAKIIAGKKKPLAICGGGVRYSEAGKALADFCSRLGIPFGETQAGKSAVV
out_gi|325      PAAVEEELDDIAGIIANAEKPLVIVGGGVRYSEAGGTVEQFCEEFRIPFGESQAGKSACR
out_gi|320      QEPDSELLEKAAELIAKSKKPLVICGGGVRYSNAGNELRKFCEQYTIPFAETQAGKGVIP
out_gi|521      RLPTKASLADAVEMIKRKKKPVMICGGGVRYAEAAEELKQFAETFHIPFGETQAGKSAIE
out_gi|310      TPATAEMLKDAVELMKDKKKPLLIAGGGVRYSEAAAVLKDFAEKFEIPYAETQAGKSGNT
gi|2607789      PEPELADLEDAKAALMKAEKPLIISGGGVHYSLATDELKAFAEKHNIPVVETIAGRATML
gi|5430214      PEPEMVVIEEAKEILLNAERPLIISGGGVHYSLATDELADFAEKHNIPVVETIAGRATML
gi|2077231      PQPDPVELARAIDALRRARRPLIVAGGGVLYSLAGPTLADFAERHGVPVAESQAGKGALS
gi|3003117      QAPAAQELEDAVALLRQARQPLLIAGGGVLYGNACEHLRRFAEQHGVPVAETQAGKSALP
gi|1706958      PAPRVDEIERAIERLRRAQRPLIVAGGGVLYGRATDALQRFAAAHGIPVAETQAGKGSLA
gi|3267941      QGADTFELDEAIATLKAAKNPIIISGGGVHYSEAYSELHEFAEKHGIPVAETQAGKGSIA
gi|3075468      PQPDPRELEAAIVALARSERPLIIAGGGVHYAGACERLSEFARTHGVPVAETQAGKGALP
gi|1637960      QAADPDELARAVDLLRKAERPLLVAGGGVLYSDAADTLRNFAERHRIPVAETQAGKGALP
GOS_213601      IHPDPNQIQKAADKLKQSKQPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMN
gi|1826797      PRPDRGRLDEAASLLKNAQRPLIISGGGVRYSGAEDALAAFAAKHGVPLCETIAGKGSVS
gi|2220842      PRPDRDTVIAAAELLKTAKRPLIISGGGVRYSLAEEKVAEFAAKRGIPVVETIAGKGALT
gi|3251130      PRPDRDAVAKAVELLKSAKKPMIIAGGGVRYSLAEDIVAEFAAKHGIPVVETIAGKGGLT
                       :      :    .*: : ***. *. *   :  *.    :*   :  * .   

out_gi|255      YDAPYSIGGLGATGTKYAIDVANQADLVIGIGTRYSDFTTASKSIFKNPDVRFININISE
out_gi|302      WDHEMNLGGIGATGGLAANQLAPQADLIIAVGTRLSDFTTSSKWLFKNPDAEFLSLNVNS
out_gi|325      SSHPYCLGGIGVTGTYASNVIARDADVVIAIGSRLSDFTTSSKWLFKNEEAQFVTINNCR
out_gi|320      SSTALNLGGLGVTGNLAANIIAKDADLVIGVGTRFTDFTTASKFLFQNKAVQFLSVNVSA
out_gi|521      SSHPYNLGGIGVTGNIAANTIAKEADLVIGIGTRFTDFTTASKQLFQNEEVEFVNINISE
out_gi|310      WDDKYNLGTIGVTGTESANVIAQNCDLIIGVGTKFNDFVTGSKWLF--ADKEILQININC
gi|2607789      QDNPLNAGPIGVTGSDSANYMAAHADVVLAIGTRLQDFTTGSWSVFRNPDMKLIAMNVAR
gi|5430214      QDNPLNAGPIGVTGSNSANYMAAHADVVLAIGTRLQDFTTGSWSVFRNPDMKLISINVAK
gi|2077231      WQHPLNLGAIGVTGSPAANAAAAQADLIVGVGTRLQDFTTGSHSLF--GQARLLSINVQP
gi|3003117      WSHALQMGAIGVTGSPAANALAQEADVVIAVGTRLQDFTTGSHTLF--AQARLLNLNVNA
gi|1706958      WDDPLNVGALGVTGSPAANALARDADCVLALGTRLQDFTTGSNTLF--TQADVIGINANA
gi|3267941      WNHPNYVGAIGVTGSNAANQLAQKADVVLAVGTRLQDFTTASRTLFGNPEATLIQLNVAA
gi|3075468      DTHPCAVGAIGVTGSEAANHLAREADLILAVGTRLQDFTTGSRALFERDDLTLVALNVGR
gi|1637960      WNHPQNVGAVGVTGTEAANILARDADVILAVGTRLQDFTTGSRALLP-GEAQLIQLNVAA
GOS_213601      KDDPYYISAIGCLGEGSSNNLATDTDLALAVGTKLGDFTTGSWTNF--------------
gi|1826797      HDHPVHVGPIGIVGSTSANAMAAEADVILAVGTRLMDFTTGSWSSFR-QDAKFITVNTAR
gi|2220842      HDHPVHAGPIGIVGSTSANALAKDADVILAIGTRLQDFTTGSWTAFS-QDAQFISINAAR
gi|3251130      HDHPVHAGPIGIVGSTSANALAAEADVILAVGTRLQDFTTGSWTAFA-REAQFISVNAAR
                       . :*  *   :   *   *  :.:*:.  **.*.*.  :              

out_gi|255      FDAFKHAALPVIGDAKAVLEELGGL------LGNHEVAADYRRHIAEINKAWDDEVTQIY
out_gi|302      FDALKMDAHAFICDAREGLTALEGS------LAKKGYHADWGSAVADAKAAWKTEVDKLY
out_gi|325      FHAYKMDAVKAVGDAKATVEALAEK------LRAKGYVSSYNGEIEEAKRIWDEEMVRLA
out_gi|320      YHALKMDSTGIIADALVCIKKLQKL------LKKIGYKSAYKKEITEAKHLWDAEMQRLA
out_gi|521      FHANKLDALKVIADAKEALLTLIDE------LQVIDYRSSYTVEIADAKEAWETELSRLH
out_gi|310      YDAYKLDAVKVVADAKAGLGALSTE------LEKIGYKSGYTSEVDEVKEKWETEWQRLA
gi|2607789      FDAIKHRALAVKCDAQRGMAQLSQL------LGDWRSSDDWASTAKAQADEWKAVVQRRT
gi|5430214      FDAIKHMSHPVLGDAKACMTKLSGV------LGDWRSAQAWADTAKVQADEWKVEVYRRT
gi|2077231      FDAHKRGGQALVADARDALDRLGAA------LADWRADAGWTGQARTLAREWNARVGTLT
gi|3003117      MDAHKWRGLALQADAGLGLEALSHA------LEGWRSAPEWHARAHTLAQDWRERVAQIT
gi|1706958      FDGLKHRAQVVEADARLALDALDALDGPGSRLQDWHADRAWTARAQQLAASWRDTVHTLT
gi|3267941      FDAIKHNAQSLVVDAKLGLQALSSG------LESWSAQSGWLAEGQDAIATWNQYYDKVT
gi|3075468      FDSQKHHALPLTGDAFDGLEALDTG------LADWRLSAAWQERADNLKREWAEVVARVT
gi|1637960      FDAGKHSSAPLVGDARRTLQDLSDV------LGDHTAPLAWQNRTAEVIAGWNAVVDRVT
GOS_213601      ------------------------------------------------------------
gi|1826797      WDATKHRALAVVGDALETVKELDQN------LDGWTADTAWTEQGKIEFAKWNVALDGFQ
gi|2220842      FDAVKHRSLSVVGDALEAVAELDVA------LGDYKAAAGLMPRAKALFAEWDKLLDEHQ
gi|3251130      FDAVKHRALSVVGDARETMTEMDTA------LGDWVAPDERLKVAKDLFSEWNRILDEHQ
                                                                            

out_gi|255      AEGNG----------------------TVPPIDQAVVIGTLNSFMDD---RDVMINASGS
out_gi|302      AAELP-----------------------GNSYSQLRALGLLNEELLDD--DAIVVGASGS
out_gi|325      GIEYTGDDFEPMIQARDPRTVPEFVRLTNGKITQTAALAAIRRVIDQ---DATIITAGGS
out_gi|320      AIRYS-NTMEPLVKARTKSSLEDFVKATGGTITQTSAIALIRKTIEP---NAVIVGASGS
out_gi|521      NIRFTGQDFTPEVEGHFDGNLNEYVDALGSQLTQTAVIGQINTLLDE---DAIIVGAAGS
out_gi|310      TVKYCPEGFVAENPGQLDHVLKEVAEQTGSCLTVTEVLGTLNDILAD---DAIVVAAAGS
gi|2607789      NPQEG--------------------DLLPGMSSYAEVIGKLNKSMQP---GDTVLTAAGG
gi|5430214      HPKKG--------------------ELLPGTSSYAEVIGKLNTQMEK---GDTVLTAAGG
gi|2077231      TAAPE------------------------GLPYDAHVIGAVRDSAADSPGGDIVVCAAGT
gi|3003117      GQTDT----------------------GGRLPYDGEVIGAIQRSVADSPSQDIVVCAAGT
gi|1706958      HAPQR----------------------DAVLPYEGDVIGAVQRSSANSPANDIVVCAAGT
gi|3267941      AAEGV--------------------ETRTGLPSDAQVLGAVKRHVNP---NDVVVCAAGG
gi|3075468      ADEGA------------------------ELPTDAQVIGAVNRQAGE---DGTVVCAAGG
gi|1637960      AASNA------------------------DLPSDAQVLGAVNRQAQA---EDVVVCAAGG
GOS_213601      ------------------------------------------------------------
gi|1826797      KPTND------------------------PIPTYAQVIGVVNAKAGE---YDLLITAAGG
gi|2220842      FLTNA------------------------PVPSYAQVVGVLNKVARP---EDTLIAAAGG
gi|3251130      APTNS------------------------PVPSYAQVIGVMNKVARP---NDTLIGAAGG
                                                                            

out_gi|255      APGDLHKLWRATDPKNFHLEYGFSCMGYEIAAGLGAKMADP-----SREVYVICGDGGYL
out_gi|302      LPGDLQRVWRPKKRETYHMEYGFSCMGYEVSGSFGVKLAAP-----EREVYAMTGDGSFV
out_gi|325      LPSCMQRMWTTDKRGGYHAEYGYSCMGYEVAATLGVKFAEP-----DNEVYCVVGDSSFQ
out_gi|320      LPGDLQRMWTTDSVDSYNVEYGYSCMGYEIAAAFGTKLAKP-----DLPVYSMVGDGAFI
out_gi|521      LPGDLQRMWASRKPNTYHMEYGYSCMGYEVAGALGAKIAEP-----SKEVYAMVGDGSYQ
out_gi|310      LPADLGRMWKCKTPNVYNMEYGYSCMGYEVPAALGAKLAAP-----EQEVYAMVGDGSYM
gi|2607789      LPAELAMNWQNYQIGKFDIEFGFSCMGYEIAGGWGAKVANP-----DNDVVVLVGDGSYL
gi|5430214      LPAELSMNWQNYQIGKFDIDFGFSCMGYEIAGGWGAKIANP-----DNDVVVLVGDGSYL
gi|2077231      LPAELHKLWRSGRPGNYHMDYGYSCMGYEIAGGLGVKLARP-----EREVIVMVGDGSYL
gi|3003117      LPAELHKLWRAGRPGAYHVEYGYSCMGYEVAGGLGVKLAQP-----QREVIVIVGDGSYL
gi|1706958      LPAELHKLWRAATPGAYHVEYGYSCMGYEIAGGLGAKLARP-----EREVIVMVGDGSYL
gi|3267941      LPGDLHKLWRTDQAKGYHVEYGYSCMGYEIAGGLGVKMANP-----DNDVIVVVGDGSYM
gi|3075468      LPGELHKLWRCAGPGSYHVEYGYSCMGYEIAGGLGVKMARP-----DREVFVMVGDGSYL
gi|1637960      LPGELHKLWRAPGPGSYHLEYGFSCMGYEIAGGLGVRMARP-----GGEVFVLVGDGSYL
GOS_213601      ------------------------------------------------------------
gi|1826797      LPGEVMKNWRVKAPNTFDCEFGFSCMGYEIPAGWGAAMADP-----TRTPIVMIGDGTYM
gi|2220842      TPGEVVKGWRVKNPNTFDCEFGFSCMGYEIPAGWGCAMAQEGPGGTGGTPIVMIGDGTYM
gi|3251130      TPGEITKNWRVKDPNTFDCEFGFSCMGYEIPAGWGHAMAQKGPGGLGGTPMVMLGDGTYL
                                                                            

out_gi|255      MNNHEIVTAIQEGVRFTILLLNNNGYASIGGLSESIGSERFGTMYKYRDNATGQLA--GN
out_gi|302      MLHSELLTSIQEGQKINVLLFDNNGFGCIDNLQRSQGIPKFGCELKFRNPETGRLDEGGK
out_gi|325      MLHSEIMTIMQEQKKVNILIFDNCGFGCINNLEMNHGIGSLATEFRYTDGRKPC----GD
out_gi|320      MLHSELVTARQEGAKIIILLFDNCGFGCINNLQMSQGMASLATEFRFRNEASGKQD--GA
out_gi|521      MLHSELVTSLQENKKINVLLFDNSGFGCINNLQMGNGMGSFGTEFRYRNQETRKLD--GA
out_gi|310      MLHSELPTAIQEGKKINVIMFDNMAFGCINNLQMGAGMGSFGTEFRRRNPKTGKLD--GS
gi|2607789      IQNSDIYSSVLTGHKMIVVVCDNGGFAVINKLQTNTGNQSFNNLLEDCRRPD------GE
gi|5430214      IQNSDIYSSVLTGQKMILVVCDNGGFAVINKLQNNTGNESFNNLLEDCRRPD------GE
gi|2077231      MMNSEIATAVMLGRKLIIVVLDNRGFGCINRLQRACGGENYNNLLEHCVPEG------GE
gi|3003117      MMNSELATSVMLGAKLIVVVLDNRGYGCINRLQQACGGAPFNNMLADCLQAG------PG
gi|1706958      MMNSEIATSVMLGAKLIVVVLDNRGYGCINRLQQACGGAPFNNLLDDCKQGP------LG
gi|3267941      MMNSELATSVMMGHKLIVVVLDNRGYGCINRLQNATGGAPFNNLLEDCVTIE------GG
gi|3075468      MHNSELATSVMLGQKLVVVVLDNRGFGCINRLQRGTGGAGFNNLLDDCLTIE------GG
gi|1637960      MLNSEVATSVMLGRKLVIVVLDNGGFGCINRLQQACGGAPFNNLFDHVDHR-------VD
GOS_213601      ---------------------ENENFQLVS------------------------------
gi|1826797      MMNSDIYSSVLSGHKIILIVCDNGGYAVINRLQNAKGGASFNNLLKDCRV--------KE
gi|2220842      MMNSDIYSAALTGHRLIVVVCDNGGFAVINRLQQAKGVPGFNNLLTDSRVQNR-----EN
gi|3251130      MMNSDIYSAVLTGDRMIVVVCDNGGFAVINRLQQFKGVPGFNNLLKDCRIANP-----EN
                                     :*  :  :.                              

out_gi|255      FLPVDLAANAESLGANVIRATDRQSLENALAQSKTADRTTVIYIETSLYRTV--KGYHAW
out_gi|302      PVPVDYAKIAEGYGCKVWTVHNSEELRKAMSEAKKSTVSTLIDIKVDFDSMS--GDYESW
out_gi|325      LIPVDYAKIGEGYGLKTYTCRTIGELEKALEDAKKQDIACLFDLKVIPKTMT--DGYESW
out_gi|320      LIPIDYAMIAKGYGLSSYTAKTYEELEDALKKAKKDTQSVLIDIKVLPKTMT--DGYEAW
out_gi|521      IMKIDFAASAAGYGVKTYHVTSLEQLREALIDAKKQTVSTLIDIKVLPKTMT--NGYESW
out_gi|310      LVPVDFAMNARSYGAVGYTVKNLDELKAAVEDSKKQTVSTLIDIKVLPKTMT--HHYETF
gi|2607789      LARVDFAKHAEAQGAISEKLTDITEFDAAFQRAKEADRTYVIVVDIDPISPATWSKCDCW
gi|5430214      LARVDFAKHAESQGAISEKLTSIDQFDAAFIRAKEADRTYVIVVDIDPVSPAAWSKCDCW
gi|2077231      PVRIDFAAHAASLGADAVHVDGLNGLRAAMLRARAGRRASVIVIDTTPEQTT--PDGGWW
gi|3003117      APAIDFAAHARSLGALGENVKTITELEAALQRARAADRSYLVCIDTDASRTT--DDGGCW
gi|1706958      APRIDFAAHARALGAHAEHAANVAELEAALQRARAADRTYVISIDTDPARTT--TDGGWW
gi|3267941      APKLDFAAHAAAMGATSEKVGSIAELEQAMARAKAADSTYVVTLDTDPYLTA---DGGFW
gi|3075468      APKTDFAAHARALGCEAESVRGIQALEDALVRARQADTTYVIALDTDPLPST--SEGGAW
gi|1637960      TAGVDFAAHARSLGATAEKIAGIADLEAALKRARASAGTYAIVIDTDPLVST--SEGGAW
GOS_213601      ------------------------------------------------------------
gi|1826797      PFAVDFNKHAEAMGALTRRVESLADLGQAVEWAKTTDRTTVITIVSDAFTWT--P-GDAW
gi|2220842      PLHVDFVKHAEAMGAKARKAESLADLEDAMKWAQGNDGVTVISIVSDAWKWV--P-GDAD
gi|3251130      PPHVDFAKHAEAMGAAARHVESLADLEEALKWAQGNDGPTVISIVSDAYAWV--P-GDAD
                                                                            

out_gi|255      WEVPVAEVSTSPTVQKAFETYKENKKTQRIFL--------------------
out_gi|302      WRVGTPEVSLKQSVLDAHERLIKEIAKARQF---------------------
out_gi|325      WNVGIATTSEKESVRKACEGVLEGRNAARNY---------------------
out_gi|320      WHVGIAETSNSKSVQNAYKNRITHLDSARKY---------------------
out_gi|521      WHVGVAEVSKSQSVQAAYESKVSNLQQARSY---------------------
out_gi|310      WSFGCAEVAKKKEVEETAKGLKETLKKARQY---------------------
gi|2607789      WEVGLPEVTRSEETASIVAEWEEGRVNQRRGV--------------------
gi|5430214      WEVGLPEVTRNEGTEKKVADWQEGKNLQRRGV--------------------
gi|2077231      WEVAVPEVSPRADVGAAYQAYRQNKTLQRV----------------------
gi|3003117      WEVAVPEVSPRSQVQQARSQYEQARQAQSV----------------------
gi|1706958      WEVAVPEVSSRASVRDARANYDAQIAARGKPSGVAEHSSETDNDVNDRGSLA
gi|3267941      WDVAVPEVSVRTEVNTARENYVDAKKKQPY----------------------
gi|3075468      WEVAVPEVSAREPVNEAYASYREAKRRQHR----------------------
gi|1637960      WDVAVPEVSERAQVRQAHAKYIKAFAHRKLV---------------------
GOS_213601      ----------------------------------------------------
gi|1826797      WDVGVPQVSVRAEVSNAAQQQQEGRTRQRVGV--------------------
gi|2220842      WDVGVPAVSTFETVRAARAAQEKIREAQRLGV--------------------
gi|3251130      WDVGVPEVSNFKAVTEARKAQDAIRAKQRVGV--------------------
                                                                    
-------------------------------------------------------------------------------------------------------------

2) Phylogeny.fr | Muscle Alingment| Gblocks 0.91b | default parameters


Gblocks 0.91b Results

Processed file: input.fasta
Number of sequences: 18
Alignment assumed to be: Protein
New number of positions: 261 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
out_gi|25503942  ----------------------------MTKRLTVAQATIMFLKNQYIER-DGV-EEPYF
out_gi|30233947  ---------------------------MKTVRLTVGQAIVRFLDNQYIST-DGK-EEKYV
out_gi|32526321  --------------------------MNKTVRMTTAQAIVRFLDQQYVCM-DGV-ETKFV
out_gi|32053720  --MTYGNFNDKLYEKNKAIELFSIFWEEIMARMTVGQAIVKFLDNQWISQ-DGK-KIKFV
out_gi|52142985  ---------------------------MQTVRMTTAQALVKFLNQQYVEF-DGK-QQKFI
out_gi|31077990  -------------------------MTLKTIKLTTAQALVKFLDNQYVEF-NGK-QEKFI
gi|260778968|re  ---------------------------MKTIRLTVAEALAQYLAAQKIEV-DGK-VEQLF
gi|54302142|ref  --------------------------MMKTVRLTVAEAFANYLAAQKIEI-DGK-VEQLF
gi|207723195|re  ------------------------MSRQATVRLTMAQALVRHLAALRVAEEDGT-LVPYV
gi|300311743|re  --------------------MNAQVNVRPTLRLTMAQALVRYLDALRIQTPQGV--LPLF
gi|170695877|re  MNQRMMDHKREQEHEHGHAASVGGAVREGTIRLTTAQALVRYLAAQRVATEDGLGTEPLF
gi|326794113|re  ---------------------------MKTIKLTMAQALVRYLMAQKVQTNDGV--QPMF
gi|307546822|re  ---------------------------MNTIRLTMAQALVKYLAAQRIEC-EGR-EVALF
gi|163796023|re  -------------------MAEERERGMGVIRLTAAQAVVRYLAAQMTSL-DGT-QVPLF
GOS_2136010      ------------------------------------------------------------
gi|182679746|re  ---------------------------MAMVRCTMAQALVRYLCNQFTIV-NGQ-RVPLF
gi|222084277|re  -------------------------MTRKTVRLTMAQALVRYLCNQFTDI-EGE-RVPLF
gi|325113090|re  -------------------------MSERTVRLTMAQALVRWLTHQYTEI-DGE-RVPLF
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
out_gi|25503942  GGCFGIFGHGNVAGLGQALQENPD-FRYYQCRNEQSMVHTAVAYAKVKNRLGAFVCTTSI
out_gi|30233947  NGVFGIFGHGCVVGLGEALQEPNHGLKFYQGHNEQGMTHAAIAYAKQNNRRKIMAVTSSI
out_gi|32526321  EGFFTIFGHGIAVGLGEALDSNPGSLRVMQGRNEQGMCHTAIAFAKQNNRRKIIPCASSV
out_gi|32053720  EGIFTLFGHGNVCGLGEALDENPGALRVYQGRNEQGMCHAAIGFAKQHNRKKIIACTSSI
out_gi|52142985  KGIFTIFGHGNVVGLGQALEEDAGELEVYQGRNEQGMANAAMAFAKQKHRKQIMACTSSV
out_gi|31077990  KGFFTIFGHGNVVGLGQALEEYEGDMIIHQGRNEQGMAQAAIGFAKQTHRKQIYACTSSV
gi|260778968|re  GCAFAIFGHGNVTCFGQQLKNIEDKIPTWRGQNEQSMATAAIAYAKANQRRRIGIATSSI
gi|54302142|ref  GAAFAIFGHGNVTCFGQQLKNIEDKIPTWRGQNEQSMAIAAIAYAKANQRRRIGIATSSI
gi|207723195|re  GGVWAIFGHGNVAGLGEALAQTRDALPVYRAHNEQAMAHAAIAYGKAHFRRRIMAATSSI
gi|300311743|re  GGVFSIFGHGNVAGMGEALYQYRATLPTYRAHNEQAMAHSAIAYAKAHLRQRMMAVTTSI
gi|170695877|re  GGVFAIFGHGNVAGMGEALYQHRDELPTLRAHNEQAMAHSAIAYAKVHFRRRMMAVTTSI
gi|326794113|re  AGVWGIFGHGNVAGLGEALHEVKETLPTYRAHNEQGMAHAAIAYAKAHNRRQMMACTTSI
gi|307546822|re  EGVFGIFGHGNVAGLGEALYHAREELPTYRAHNEQTMAHAAIAFAKANGRRRMMAATSSI
gi|163796023|re  AGVWAIFGHGNVAGLGEALWHAREALPTFRAHNEQAMTLAAIAYAKASNRRRMMACTTSI
GOS_2136010      -------------VLDKLWEEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSV
gi|182679746|re  PGVFAIFGHGNVTCLAEALEAVQDKLPTWRGQNEQSMALAAIGFAKAVRRRQIMVATSSI
gi|222084277|re  AGVFAIFGHGNVTCLSEALETVQDRLPTWRGQNEQSMALAAIGFAKAKRRRQIMVAASSI
gi|325113090|re  AGLFGIFGHGNVTCLSEALEQVQDQLPTYRGQNEQSMALAAIGYAKAKRRRQIMIAATSI
                                          ###################################


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
out_gi|25503942  GPGATNMITGAALATINRLPVLLLPGDIFATREPNPVLQQLESAASQDISVNDCFKPVSK
out_gi|30233947  GPGALNMVTAAALASVNRIPVLLMPGDAFACRQPDPVLQQVEQFHDYTVTANDAFKAVCR
out_gi|32526321  GPGAANMVTACATATVNNIPLLVFPADTFASRQPDPVLQQLEQSSSLATTTNDAFKPVCK
out_gi|32053720  GPGAANMVTAAALATANNLPLLVFTGDTFATRQPDPVLQQIEQPSNLSITTSDAFKPVTR
out_gi|52142985  GPGSANMITSAATASANNIPVLLLPGDVFATRQPDPVLQQIEQTHDLSISTNDAFRAVSK
out_gi|31077990  GPGAANMVTAAATATANRIPVLLLPGDTFATRQPDPVLQQVEQSSDLSITTNDAFKAVSK
gi|260778968|re  GPGATNMVTAAGIAHTNRLPVLLISGDAYVSRLPDPVLQQPENFYDPSITCNDAFKPLTR
gi|54302142|ref  GPGATNMITAAGIAHTNRLPLLLISGDAYISRLPDPVLQQPENFHNPSITCNDAFKPLTR
gi|207723195|re  GPGATNMVTAAALAHAGRLPVLLLPGDTFASRAPDPVLQQLESFAEGDATANDAFRPVSR
gi|300311743|re  GPGATNLLTAAALAHVNRLPVLLLPGDVFVSRRPDPVLQQLEDFNDPGLSVNDAFRPLSR
gi|170695877|re  GPGATNLLTAAALAHVNRLPVLLLPGDIFVSRAPDPVLQQVEDFHDGGVSANDAFKPVSR
gi|326794113|re  GPGAANMVTAAALAHVNRLPVLFLPGDTFANRTPDPVLQQVESFGDPTISTNDCFRPVSR
gi|307546822|re  GPGATNMVTAAALAHANRLPILLLPGDTFASRDPDPVLQQVEHFGDPTITVNDCFRPVSR
gi|163796023|re  GPGALNMVTAAAVAHVNRLPVLLLPGDTFAGRLPDPVLQQVEHFGDPTVTANDCFRPVSR
GOS_2136010      GPGSTNMVTAAAVALSNRLPILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSR
gi|182679746|re  GPGALNMVTAAGVAHTNRLPVLLLAGDTFVNRRPDPVMQQVEHFGNPTITVNDAFKAVTR
gi|222084277|re  GPGALNMVTAAGVAMANRLPVLLLAGDTYASRLPDPVLQQVEHFGDPTITANDAFKSVVR
gi|325113090|re  GPGASNMVTAAGTAMANRLPVLLLAGDTFANRLPDPVLQQVEHFGNPTITVNDTFKPVVR
                 ############################################################


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
out_gi|25503942  YWDRINRPEQLIYSLPEVMRVLTSQAEMGAVTLSMPQDVQTHAYDFPESLFQKRVWHVGR
out_gi|30233947  YWDRVSRPEQLMTALMNAFRVLTDPAQTGAVCLALPQDVQAEAWDYPESFFRKRVHYIER
out_gi|32526321  YWDRITRPEMIMTALINAMRVLTDPAETGACCIGLCQDVEGESFDFPEYFFKKRVHRITR
out_gi|32053720  YWDRVYRPEQLMTALLSAMRVLTDPAETGGVCISLPQDVQGESYDFLDYFFAERVHSIRR
out_gi|52142985  YWDRINRPEQLMTAMIQAMRVLTNPADTGAVTICLPQDVQGEAWDFPSYFFQKRVHRIER
out_gi|31077990  YWDRINRPEQLMTAAINAIRVLVDPADTGAVTLSLPQDVQGEAYEYPESFFQKRVHRIER
gi|260778968|re  YWDRIVSPSQLIHTLPQAIDTMLDPETCGPAFLSLPQDIQGVAYDFPEVFFEEKIHRIRR
gi|54302142|ref  YWDRIVSPAQIIQSLPHALNTLLDPETCGPVFIGLPQDVQGMAYDFPESFFADKVHRIRR
gi|207723195|re  YFDRIVRPEQILTALPRAIQVLTDPAQCGPVTLALPQDVQTLAFDCPEDFLQPEPIRIRR
gi|300311743|re  MFDRICYPEQLLTALPRAIQVLTDPAQCGPVTLALPQDVQTMAYDYPLDFFSPRVIVPRA
gi|170695877|re  YFDRIVHPAQLLSALPRALRVLTDAASCGPVTLALPQDVQAQAWDFPAGFFAPRVVTFYA
gi|326794113|re  YFDRITRPEQIITSLPQAMRVLTDSVDCGPVTLCLSQDVQAEAYDFPESFFDEKVHRVRR
gi|307546822|re  YFDRITRPEQLLTSLPQAIATLLDPEHCGPATLALPQDVQTFAYDYPESFFAPRVHRIRR
gi|163796023|re  WFDRITRPEQLLTSLPRALQVLTDPAECGPVTLCLSQDVQAEAYDYPDAFFAETLRQTRR
GOS_2136010      YFDRITRPEQILTSLPQAINVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRR
gi|182679746|re  YWDRIVHPEQVISSLPQAVAAMLDPADCGPAFIALPQDVQEMAWDYPEAFFAETVHNIPR
gi|222084277|re  YWDRIVLPEQILQSLPQAVATMLDPADCGPAFIGLAQDTQEVAFDYPEVFFEPKVWKIPR
gi|325113090|re  YWDRISLPEQIITSLPQAVATMLDPADCGPAFIGLAQDTQEKAFDYPAVFFEPKVWHIPR
                 ############################################################


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
out_gi|25503942  PRPDLVTLQKAAEWIKTAQKPVIVAGGGAIYSGATDVLHDFATKTGIPVGETFAGKGAVR
out_gi|30233947  RTLSPEALDRAAKIIAGKKKPLAICGGGVRYSEAGKALADFCSRLGIPFGETQAGKSAVV
out_gi|32526321  PAAVEEELDDIAGIIANAEKPLVIVGGGVRYSEAGGTVEQFCEEFRIPFGESQAGKSACR
out_gi|32053720  QEPDSELLEKAAELIAKSKKPLVICGGGVRYSNAGNELRKFCEQYTIPFAETQAGKGVIP
out_gi|52142985  RLPTKASLADAVEMIKRKKKPVMICGGGVRYAEAAEELKQFAETFHIPFGETQAGKSAIE
out_gi|31077990  TPATAEMLKDAVELMKDKKKPLLIAGGGVRYSEAAAVLKDFAEKFEIPYAETQAGKSGNT
gi|260778968|re  PEPELADLEDAKAALMKAEKPLIISGGGVHYSLATDELKAFAEKHNIPVVETIAGRATML
gi|54302142|ref  PEPEMVVIEEAKEILLNAERPLIISGGGVHYSLATDELADFAEKHNIPVVETIAGRATML
gi|207723195|re  PQPDPVELARAIDALRRARRPLIVAGGGVLYSLAGPTLADFAERHGVPVAESQAGKGALS
gi|300311743|re  QAPAAQELEDAVALLRQARQPLLIAGGGVLYGNACEHLRRFAEQHGVPVAETQAGKSALP
gi|170695877|re  PAPRVDEIERAIERLRRAQRPLIVAGGGVLYGRATDALQRFAAAHGIPVAETQAGKGSLA
gi|326794113|re  QGADTFELDEAIATLKAAKNPIIISGGGVHYSEAYSELHEFAEKHGIPVAETQAGKGSIA
gi|307546822|re  PQPDPRELEAAIVALARSERPLIIAGGGVHYAGACERLSEFARTHGVPVAETQAGKGALP
gi|163796023|re  QAADPDELARAVDLLRKAERPLLVAGGGVLYSDAADTLRNFAERHRIPVAETQAGKGALP
GOS_2136010      IHPDPNQIQKAADKLKQSKQPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMN
gi|182679746|re  PRPDRGRLDEAASLLKNAQRPLIISGGGVRYSGAEDALAAFAAKHGVPLCETIAGKGSVS
gi|222084277|re  PRPDRDTVIAAAELLKTAKRPLIISGGGVRYSLAEEKVAEFAAKRGIPVVETIAGKGALT
gi|325113090|re  PRPDRDAVAKAVELLKSAKKPMIIAGGGVRYSLAEDIVAEFAAKHGIPVVETIAGKGGLT
                 ############################################################


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
out_gi|25503942  YDAPYSIGGLGATGTKYAIDVANQADLVIGIGTRYSDFTTASKSIFKNPDVRFININISE
out_gi|30233947  WDHEMNLGGIGATGGLAANQLAPQADLIIAVGTRLSDFTTSSKWLFKNPDAEFLSLNVNS
out_gi|32526321  SSHPYCLGGIGVTGTYASNVIARDADVVIAIGSRLSDFTTSSKWLFKNEEAQFVTINNCR
out_gi|32053720  SSTALNLGGLGVTGNLAANIIAKDADLVIGVGTRFTDFTTASKFLFQNKAVQFLSVNVSA
out_gi|52142985  SSHPYNLGGIGVTGNIAANTIAKEADLVIGIGTRFTDFTTASKQLFQNEEVEFVNINISE
out_gi|31077990  WDDKYNLGTIGVTGTESANVIAQNCDLIIGVGTKFNDFVTGSKWLF--ADKEILQININC
gi|260778968|re  QDNPLNAGPIGVTGSDSANYMAAHADVVLAIGTRLQDFTTGSWSVFRNPDMKLIAMNVAR
gi|54302142|ref  QDNPLNAGPIGVTGSNSANYMAAHADVVLAIGTRLQDFTTGSWSVFRNPDMKLISINVAK
gi|207723195|re  WQHPLNLGAIGVTGSPAANAAAAQADLIVGVGTRLQDFTTGSHSLF--GQARLLSINVQP
gi|300311743|re  WSHALQMGAIGVTGSPAANALAQEADVVIAVGTRLQDFTTGSHTLF--AQARLLNLNVNA
gi|170695877|re  WDDPLNVGALGVTGSPAANALARDADCVLALGTRLQDFTTGSNTLF--TQADVIGINANA
gi|326794113|re  WNHPNYVGAIGVTGSNAANQLAQKADVVLAVGTRLQDFTTASRTLFGNPEATLIQLNVAA
gi|307546822|re  DTHPCAVGAIGVTGSEAANHLAREADLILAVGTRLQDFTTGSRALFERDDLTLVALNVGR
gi|163796023|re  WNHPQNVGAVGVTGTEAANILARDADVILAVGTRLQDFTTGSRALLP-GEAQLIQLNVAA
GOS_2136010      KDDPYYISAIGCLGEGSSNNLATDTDLALAVGTKLGDFTTGSWTNF--------------
gi|182679746|re  HDHPVHVGPIGIVGSTSANAMAAEADVILAVGTRLMDFTTGSWSSFR-QDAKFITVNTAR
gi|222084277|re  HDHPVHAGPIGIVGSTSANALAKDADVILAIGTRLQDFTTGSWTAFS-QDAQFISINAAR
gi|325113090|re  HDHPVHAGPIGIVGSTSANALAAEADVILAVGTRLQDFTTGSWTAFA-REAQFISVNAAR
                 ##############################################              


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
out_gi|25503942  FDAFKHAALPVIGDAKAVLEELGGL------LGNHEVAADYRRHIAEINKAWDDEVTQIY
out_gi|30233947  FDALKMDAHAFICDAREGLTALEGS------LAKKGYHADWGSAVADAKAAWKTEVDKLY
out_gi|32526321  FHAYKMDAVKAVGDAKATVEALAEK------LRAKGYVSSYNGEIEEAKRIWDEEMVRLA
out_gi|32053720  YHALKMDSTGIIADALVCIKKLQKL------LKKIGYKSAYKKEITEAKHLWDAEMQRLA
out_gi|52142985  FHANKLDALKVIADAKEALLTLIDE------LQVIDYRSSYTVEIADAKEAWETELSRLH
out_gi|31077990  YDAYKLDAVKVVADAKAGLGALSTE------LEKIGYKSGYTSEVDEVKEKWETEWQRLA
gi|260778968|re  FDAIKHRALAVKCDAQRGMAQLSQL------LGDWRSSDDWASTAKAQADEWKAVVQRRT
gi|54302142|ref  FDAIKHMSHPVLGDAKACMTKLSGV------LGDWRSAQAWADTAKVQADEWKVEVYRRT
gi|207723195|re  FDAHKRGGQALVADARDALDRLGAA------LADWRADAGWTGQARTLAREWNARVGTLT
gi|300311743|re  MDAHKWRGLALQADAGLGLEALSHA------LEGWRSAPEWHARAHTLAQDWRERVAQIT
gi|170695877|re  FDGLKHRAQVVEADARLALDALDALDGPGSRLQDWHADRAWTARAQQLAASWRDTVHTLT
gi|326794113|re  FDAIKHNAQSLVVDAKLGLQALSSG------LESWSAQSGWLAEGQDAIATWNQYYDKVT
gi|307546822|re  FDSQKHHALPLTGDAFDGLEALDTG------LADWRLSAAWQERADNLKREWAEVVARVT
gi|163796023|re  FDAGKHSSAPLVGDARRTLQDLSDV------LGDHTAPLAWQNRTAEVIAGWNAVVDRVT
GOS_2136010      ------------------------------------------------------------
gi|182679746|re  WDATKHRALAVVGDALETVKELDQN------LDGWTADTAWTEQGKIEFAKWNVALDGFQ
gi|222084277|re  FDAVKHRSLSVVGDALEAVAELDVA------LGDYKAAAGLMPRAKALFAEWDKLLDEHQ
gi|325113090|re  FDAVKHRALSVVGDARETMTEMDTA------LGDWVAPDERLKVAKDLFSEWNRILDEHQ
                                                                             


                        430       440       450       460       470       480
                 =========+=========+=========+=========+=========+=========+
out_gi|25503942  AEGNG----------------------TVPPIDQAVVIGTLNSFMDD---RDVMINASGS
out_gi|30233947  AAELP-----------------------GNSYSQLRALGLLNEELLDD--DAIVVGASGS
out_gi|32526321  GIEYTGDDFEPMIQARDPRTVPEFVRLTNGKITQTAALAAIRRVIDQ---DATIITAGGS
out_gi|32053720  AIRYS-NTMEPLVKARTKSSLEDFVKATGGTITQTSAIALIRKTIEP---NAVIVGASGS
out_gi|52142985  NIRFTGQDFTPEVEGHFDGNLNEYVDALGSQLTQTAVIGQINTLLDE---DAIIVGAAGS
out_gi|31077990  TVKYCPEGFVAENPGQLDHVLKEVAEQTGSCLTVTEVLGTLNDILAD---DAIVVAAAGS
gi|260778968|re  NPQEG--------------------DLLPGMSSYAEVIGKLNKSMQP---GDTVLTAAGG
gi|54302142|ref  HPKKG--------------------ELLPGTSSYAEVIGKLNTQMEK---GDTVLTAAGG
gi|207723195|re  TAAPE------------------------GLPYDAHVIGAVRDSAADSPGGDIVVCAAGT
gi|300311743|re  GQTDT----------------------GGRLPYDGEVIGAIQRSVADSPSQDIVVCAAGT
gi|170695877|re  HAPQR----------------------DAVLPYEGDVIGAVQRSSANSPANDIVVCAAGT
gi|326794113|re  AAEGV--------------------ETRTGLPSDAQVLGAVKRHVNP---NDVVVCAAGG
gi|307546822|re  ADEGA------------------------ELPTDAQVIGAVNRQAGE---DGTVVCAAGG
gi|163796023|re  AASNA------------------------DLPSDAQVLGAVNRQAQA---EDVVVCAAGG
GOS_2136010      ------------------------------------------------------------
gi|182679746|re  KPTND------------------------PIPTYAQVIGVVNAKAGE---YDLLITAAGG
gi|222084277|re  FLTNA------------------------PVPSYAQVVGVLNKVARP---EDTLIAAAGG
gi|325113090|re  APTNS------------------------PVPSYAQVIGVMNKVARP---NDTLIGAAGG
                                                                             


                        490       500       510       520       530       540
                 =========+=========+=========+=========+=========+=========+
out_gi|25503942  APGDLHKLWRATDPKNFHLEYGFSCMGYEIAAGLGAKMADP-----SREVYVICGDGGYL
out_gi|30233947  LPGDLQRVWRPKKRETYHMEYGFSCMGYEVSGSFGVKLAAP-----EREVYAMTGDGSFV
out_gi|32526321  LPSCMQRMWTTDKRGGYHAEYGYSCMGYEVAATLGVKFAEP-----DNEVYCVVGDSSFQ
out_gi|32053720  LPGDLQRMWTTDSVDSYNVEYGYSCMGYEIAAAFGTKLAKP-----DLPVYSMVGDGAFI
out_gi|52142985  LPGDLQRMWASRKPNTYHMEYGYSCMGYEVAGALGAKIAEP-----SKEVYAMVGDGSYQ
out_gi|31077990  LPADLGRMWKCKTPNVYNMEYGYSCMGYEVPAALGAKLAAP-----EQEVYAMVGDGSYM
gi|260778968|re  LPAELAMNWQNYQIGKFDIEFGFSCMGYEIAGGWGAKVANP-----DNDVVVLVGDGSYL
gi|54302142|ref  LPAELSMNWQNYQIGKFDIDFGFSCMGYEIAGGWGAKIANP-----DNDVVVLVGDGSYL
gi|207723195|re  LPAELHKLWRSGRPGNYHMDYGYSCMGYEIAGGLGVKLARP-----EREVIVMVGDGSYL
gi|300311743|re  LPAELHKLWRAGRPGAYHVEYGYSCMGYEVAGGLGVKLAQP-----QREVIVIVGDGSYL
gi|170695877|re  LPAELHKLWRAATPGAYHVEYGYSCMGYEIAGGLGAKLARP-----EREVIVMVGDGSYL
gi|326794113|re  LPGDLHKLWRTDQAKGYHVEYGYSCMGYEIAGGLGVKMANP-----DNDVIVVVGDGSYM
gi|307546822|re  LPGELHKLWRCAGPGSYHVEYGYSCMGYEIAGGLGVKMARP-----DREVFVMVGDGSYL
gi|163796023|re  LPGELHKLWRAPGPGSYHLEYGFSCMGYEIAGGLGVRMARP-----GGEVFVLVGDGSYL
GOS_2136010      ------------------------------------------------------------
gi|182679746|re  LPGEVMKNWRVKAPNTFDCEFGFSCMGYEIPAGWGAAMADP-----TRTPIVMIGDGTYM
gi|222084277|re  TPGEVVKGWRVKNPNTFDCEFGFSCMGYEIPAGWGCAMAQEGPGGTGGTPIVMIGDGTYM
gi|325113090|re  TPGEITKNWRVKDPNTFDCEFGFSCMGYEIPAGWGHAMAQKGPGGLGGTPMVMLGDGTYL
                                                                             


                        550       560       570       580       590       600
                 =========+=========+=========+=========+=========+=========+
out_gi|25503942  MNNHEIVTAIQEGVRFTILLLNNNGYASIGGLSESIGSERFGTMYKYRDNATGQLA--GN
out_gi|30233947  MLHSELLTSIQEGQKINVLLFDNNGFGCIDNLQRSQGIPKFGCELKFRNPETGRLDEGGK
out_gi|32526321  MLHSEIMTIMQEQKKVNILIFDNCGFGCINNLEMNHGIGSLATEFRYTDGRKPC----GD
out_gi|32053720  MLHSELVTARQEGAKIIILLFDNCGFGCINNLQMSQGMASLATEFRFRNEASGKQD--GA
out_gi|52142985  MLHSELVTSLQENKKINVLLFDNSGFGCINNLQMGNGMGSFGTEFRYRNQETRKLD--GA
out_gi|31077990  MLHSELPTAIQEGKKINVIMFDNMAFGCINNLQMGAGMGSFGTEFRRRNPKTGKLD--GS
gi|260778968|re  IQNSDIYSSVLTGHKMIVVVCDNGGFAVINKLQTNTGNQSFNNLLEDCRRPD------GE
gi|54302142|ref  IQNSDIYSSVLTGQKMILVVCDNGGFAVINKLQNNTGNESFNNLLEDCRRPD------GE
gi|207723195|re  MMNSEIATAVMLGRKLIIVVLDNRGFGCINRLQRACGGENYNNLLEHCVPEG------GE
gi|300311743|re  MMNSELATSVMLGAKLIVVVLDNRGYGCINRLQQACGGAPFNNMLADCLQAG------PG
gi|170695877|re  MMNSEIATSVMLGAKLIVVVLDNRGYGCINRLQQACGGAPFNNLLDDCKQGP------LG
gi|326794113|re  MMNSELATSVMMGHKLIVVVLDNRGYGCINRLQNATGGAPFNNLLEDCVTIE------GG
gi|307546822|re  MHNSELATSVMLGQKLVVVVLDNRGFGCINRLQRGTGGAGFNNLLDDCLTIE------GG
gi|163796023|re  MLNSEVATSVMLGRKLVIVVLDNGGFGCINRLQQACGGAPFNNLFDHVDHR-------VD
GOS_2136010      ---------------------ENENFQLVS------------------------------
gi|182679746|re  MMNSDIYSSVLSGHKIILIVCDNGGYAVINRLQNAKGGASFNNLLKDCRV--------KE
gi|222084277|re  MMNSDIYSAALTGHRLIVVVCDNGGFAVINRLQQAKGVPGFNNLLTDSRVQNR-----EN
gi|325113090|re  MMNSDIYSAVLTGDRMIVVVCDNGGFAVINRLQQFKGVPGFNNLLKDCRIANP-----EN
                                                                             


                        610       620       630       640       650       660
                 =========+=========+=========+=========+=========+=========+
out_gi|25503942  FLPVDLAANAESLGANVIRATDRQSLENALAQSKTADRTTVIYIETSLYRTV--KGYHAW
out_gi|30233947  PVPVDYAKIAEGYGCKVWTVHNSEELRKAMSEAKKSTVSTLIDIKVDFDSMS--GDYESW
out_gi|32526321  LIPVDYAKIGEGYGLKTYTCRTIGELEKALEDAKKQDIACLFDLKVIPKTMT--DGYESW
out_gi|32053720  LIPIDYAMIAKGYGLSSYTAKTYEELEDALKKAKKDTQSVLIDIKVLPKTMT--DGYEAW
out_gi|52142985  IMKIDFAASAAGYGVKTYHVTSLEQLREALIDAKKQTVSTLIDIKVLPKTMT--NGYESW
out_gi|31077990  LVPVDFAMNARSYGAVGYTVKNLDELKAAVEDSKKQTVSTLIDIKVLPKTMT--HHYETF
gi|260778968|re  LARVDFAKHAEAQGAISEKLTDITEFDAAFQRAKEADRTYVIVVDIDPISPATWSKCDCW
gi|54302142|ref  LARVDFAKHAESQGAISEKLTSIDQFDAAFIRAKEADRTYVIVVDIDPVSPAAWSKCDCW
gi|207723195|re  PVRIDFAAHAASLGADAVHVDGLNGLRAAMLRARAGRRASVIVIDTTPEQTT--PDGGWW
gi|300311743|re  APAIDFAAHARSLGALGENVKTITELEAALQRARAADRSYLVCIDTDASRTT--DDGGCW
gi|170695877|re  APRIDFAAHARALGAHAEHAANVAELEAALQRARAADRTYVISIDTDPARTT--TDGGWW
gi|326794113|re  APKLDFAAHAAAMGATSEKVGSIAELEQAMARAKAADSTYVVTLDTDPYLTA---DGGFW
gi|307546822|re  APKTDFAAHARALGCEAESVRGIQALEDALVRARQADTTYVIALDTDPLPST--SEGGAW
gi|163796023|re  TAGVDFAAHARSLGATAEKIAGIADLEAALKRARASAGTYAIVIDTDPLVST--SEGGAW
GOS_2136010      ------------------------------------------------------------
gi|182679746|re  PFAVDFNKHAEAMGALTRRVESLADLGQAVEWAKTTDRTTVITIVSDAFTWT--P-GDAW
gi|222084277|re  PLHVDFVKHAEAMGAKARKAESLADLEDAMKWAQGNDGVTVISIVSDAWKWV--P-GDAD
gi|325113090|re  PPHVDFAKHAEAMGAAARHVESLADLEEALKWAQGNDGPTVISIVSDAYAWV--P-GDAD
                                                                             


                        670       680       690       700       710
                 =========+=========+=========+=========+=========+==
out_gi|25503942  WEVPVAEVSTSPTVQKAFETYKENKKTQRIFL--------------------
out_gi|30233947  WRVGTPEVSLKQSVLDAHERLIKEIAKARQF---------------------
out_gi|32526321  WNVGIATTSEKESVRKACEGVLEGRNAARNY---------------------
out_gi|32053720  WHVGIAETSNSKSVQNAYKNRITHLDSARKY---------------------
out_gi|52142985  WHVGVAEVSKSQSVQAAYESKVSNLQQARSY---------------------
out_gi|31077990  WSFGCAEVAKKKEVEETAKGLKETLKKARQY---------------------
gi|260778968|re  WEVGLPEVTRSEETASIVAEWEEGRVNQRRGV--------------------
gi|54302142|ref  WEVGLPEVTRNEGTEKKVADWQEGKNLQRRGV--------------------
gi|207723195|re  WEVAVPEVSPRADVGAAYQAYRQNKTLQRV----------------------
gi|300311743|re  WEVAVPEVSPRSQVQQARSQYEQARQAQSV----------------------
gi|170695877|re  WEVAVPEVSSRASVRDARANYDAQIAARGKPSGVAEHSSETDNDVNDRGSLA
gi|326794113|re  WDVAVPEVSVRTEVNTARENYVDAKKKQPY----------------------
gi|307546822|re  WEVAVPEVSAREPVNEAYASYREAKRRQHR----------------------
gi|163796023|re  WDVAVPEVSERAQVRQAHAKYIKAFAHRKLV---------------------
GOS_2136010      ----------------------------------------------------
gi|182679746|re  WDVGVPQVSVRAEVSNAAQQQQEGRTRQRVGV--------------------
gi|222084277|re  WDVGVPAVSTFETVRAARAAQEKIREAQRLGV--------------------
gi|325113090|re  WDVGVPEVSNFKAVTEARKAQDAIRAKQRVGV--------------------
                                                                     

Parameters used
Minimum Number Of Sequences For A Conserved Position: 10
Minimum Number Of Sequences For A Flanking Position: 15
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes


Flank positions of the 1 selected block(s)
Flanks: [86  346]  

New number of positions in input.fasta-gb:  261  (36% of the original 712 positions)




Protein Domains

PROTOCOL


1) InterProScan; default parameters at EBI



RESULTS ANALYSIS


Through the use of the tool InterProScan was identified eight protein domains but six of them were tagged as unintegrated so were ignored.


The others two proteins domains are conserved domains corroborated with NBCI Blast:

1 – Accession IPR012000, Thiamine pyrophosphate enzyme, central domain - TPP_enzyme_M with e-value of 1.4E-24

2 – Accession IPR012001, Thiamine pyrophosphate enzyme, N-terminal - TPP-binding domain with e-value of 2.1E-30, and this one has a children corresponding to the accession IPR022502, that represents the alpha subunit, or the N-terminal region, of sulfopyruvate decarboxylase, an enzyme of coenzyme M biosynthesis.


This results suggests that this query sequence may correspond to the Acetolactate synthase enzyme.









RAW RESULTS

Sequence_1	C7D28AC4CBB46C80	282	HMMPfam	PF02776	TPP_enzyme_N	8	154	2.1e-30	T	27-Apr-2011	IPR012001	Thiamine pyrophosphate enzyme, N-terminal TPP-binding domain	Molecular Function: thiamine pyrophosphate binding (GO:0030976)
Sequence_1	C7D28AC4CBB46C80	282	HMMPfam	PF00205	TPP_enzyme_M	175	281	1.4e-24	T	27-Apr-2011	IPR012000	Thiamine pyrophosphate enzyme, central domain	Molecular Function: magnesium ion binding (GO:0000287), Molecular Function: thiamine pyrophosphate binding (GO:0030976)
Sequence_1	C7D28AC4CBB46C80	282	HMMPanther	PTHR18968:SF9	MALONIC SEMIALDEHYDE OXIDATIVE DECARBOXYLASE	9	274	1.9e-86	T	27-Apr-2011	NULL	NULL	
Sequence_1	C7D28AC4CBB46C80	282	HMMPanther	PTHR18968	FAMILY NOT NAMED	9	274	1.9e-86	T	27-Apr-2011	NULL	NULL	
Sequence_1	C7D28AC4CBB46C80	282	superfamily	SSF52467	DHS-like NAD/FAD-binding domain	164	273	1e-31	T	27-Apr-2011	NULL	NULL	
Sequence_1	C7D28AC4CBB46C80	282	superfamily	SSF52518	Thiamin diphosphate-binding fold (THDP-binding)	12	168	9.5e-25	T	27-Apr-2011	NULL	NULL	
Sequence_1	C7D28AC4CBB46C80	282	Gene3D	G3DSA:3.40.50.970	no description	9	167	1.2e-35	T	27-Apr-2011	NULL	NULL	
Sequence_1	C7D28AC4CBB46C80	282	Gene3D	G3DSA:3.40.50.1220	no description	168	275	2.8e-32	T	27-Apr-2011	NULL	NULL	

Phylogeny

PROTOCOL


1) Phylogeny.fr / PhyML method / no bootstrap / default substitution model / outgroup: Spirochaetes; Firmicutes; Tenericutes; Fusobacteria; Bacteroidetes


2) Phylogeny.fr / BioNJ method / 1000 bootstrap / default substitution model / outgroup: Spirochaetes; Firmicutes; Tenericutes; Fusobacteria; Bacteroidetes




RESULTS ANALYSIS



The resultant trees are in agreement and also are coherent with the reference phylogeny of the species. In both trees, ingroups are separated from the outgroups, with branch sport value higher than 70%.


The observation of the phylogenetic tree allowed inferring which taxonomic group belongs this metagenomic sequence, and with both approaches is integrated in the Proteobacteria cluster group, which means that was only possible define the phylum.


RAW RESULTS

1) Phylogeny.fr / PhyML method / no bootstrap / default substitution model / outgroup: Spirochaetes; Firmicutes; Tenericutes; Fusobacteria; Bacteroidetes

                                                                                                           -----0.1---
 
      +--------------------------------------------------------------Dyadobacter_fermentans_DSM_18053_gi_255039428             (Bacteroidetes)
      |
 +----+                    +------------------------------Spirochaeta_smaragdinae_DSM_11293_gi_302339477                       (Spirochaetes)
 |    |                    |
 |    +--------------------+--------------------------------Ilyobacter_polytropus_DSM_2926_gi_310779903                        (Fusobacteria)
 |                         |
 |                         |
 |                         |              +------------------Bacillus_cereus_E33L_gi_52142985                                  (Firmicutes)
 |                         +--------------+
 |                                        |         +-----------------------------Clostridium_sp._D5_gi_325263213              (Firmicutes)
 |                                        +---------+
 |                                                  +-----------------------Treponema_phagedenis_F0421_gi_320537200            (Spirochaetes)
 |
 |    +------------------------Marinomonas_mediterranea_MMB-1_gi_326794113                                                     (g-proteobacteria)            
 |    |
 +----+------------------------------------------------Ralstonia_solanacearum_MolK2_gi_207723195                               (b-proteobacteria)
      |
      |-------------------------------------------------------Herbaspirillum_seropedicae_SmR1_gi_300311743                     (b-proteobacteria)
      |
      |
      |-------------------------------------------------------------Burkholderia_graminis_C4D1M_gi_170695877                   (b-proteobacteria)
      |
      |-------------------------------------Halomonas_elongata_DSM_2581_gi_307546822                                           (g-proteobacteria)
      |
      |---------------------------------alpha_proteobacterium_BAL199_gi_163796023                                              (a-proteobacteria)
      |
      |                            +------------------------------------Vibrio_coralliilyticus_ATCC_BAA-450_gi_260778968       (g-proteobacteria)
      |                            |
      |                 +----------+----------------------------------Photobacterium_profundum_SS9_gi_54302142                 (g-proteobacteria)
      |                 |          |
      |                 |          |-------------------------Beijerinckia_indica_subsp._indica_ATCC_9039_gi_182679746          (a-proteobacteria)
      |                 |          |
      |                 |          |
      +-----------------+          |---------------------------Agrobacterium_radiobacter_K84_gi_222084277                      (a-proteobacteria)
                        |          |
                        |          +-----------------------------Acidiphilium_multivorum_AIU301_gi_325113090                   (a-proteobacteria)
                        |
                        +-------------------------------------------GOS_2136010

                                                                                            


-------------------------------------------------------------------------------------------------------------------------------------------------

2) Phylogeny.fr / BioNJ method / 1000 bootstrap / default substitution model


                                                                                                   -------0.1------
 
     +---------------------------------------------------------------------Dyadobacter_fermentans_DSM_18053_gi_255039428      (Bacteroidetes)
     |
 +---+-------------------------------------------------------Spirochaeta_smaragdinae_DSM_11293_gi_302339477                   (Spirochaetes)
 |   |
 |   |                                  +-----------------------------------------Clostridium_sp._D5_gi_325263213             (Firmicutes)
 |   |----------------------------------+
 |   |                                  |
 |   |                                  +--------------------------Treponema_phagedenis_F0421_gi_320537200                    (Spirochaetes)
 |   |
 |   |                                +-----------------------------Bacillus_cereus_E33L_gi_52142985                          (Firmicutes)
 |   +--------------------------------+
 |                                    +----------------------------Ilyobacter_polytropus_DSM_2926_gi_310779903                (Fusobacteria)
 |
 |   +----------------------------Marinomonas_mediterranea_MMB-1_gi_326794113                                                 (g-proteobacteria)
 |   | 
 +---+-------------------------------Halomonas_elongata_DSM_2581_gi_307546822                                                 (g-proteobacteria)
     |
     |-----------------------------------alpha_proteobacterium_BAL199_gi_163796023                                            (a-proteobacteria)
     |
     |
     |-------------------------------------------------Burkholderia_graminis_C4D1M_gi_170695877                               (b-proteobacteria)
     |
     |-----------------------------------------------Herbaspirillum_seropedicae_SmR1_gi_300311743                             (b-proteobacteria)
     |
     |-----------------------------------------Ralstonia_solanacearum_MolK2_gi_207723195                                      (b-proteobacteria)
     |
     |                 +---------------------------------------Vibrio_coralliilyticus_ATCC_BAA-450_gi_260778968               (g-proteobacteria)
     |                 |
     |            +----+--------------------------------------Photobacterium_profundum_SS9_gi_54302142                        (g-proteobacteria)
     |            |    |
     |            |    |--------------------------------Beijerinckia_indica_subsp._indica_ATCC_9039_gi_182679746              (a-proteobacteria)
     |            |    |
     |            |    |
     +------------+    |                       +-----------Agrobacterium_radiobacter_K84_gi_222084277                         (a-proteobacteria)
                  |    +-----------------------+
                  |                            +----------Acidiphilium_multivorum_AIU301_gi_325113090                         (a-proteobacteria)
                  |
                  +-------------------------------------------------------GOS_2136010

Taxonomy report

PROTOCOL



1) BLASTp versus NR, NCBI default parameters apart from "Max target sequences _ 1000"

2) BLASTp versus SwissProt, NCBI default parameters



RESULTS ANALYSIS


The two lineage report pasted on raw results are different because of the dimension of the database Swissprot.

To define the ingroup and outgroup was chosen based on lineage report, considering the E-values of the sequences in BLASTp vs NR and the variability of organisms chosen. For ingroup was chosen the proteobacteria phylum and for the outgroup other bacterial phyla (firmicutes, fusobacteria, spirochetes, Bacteroidetes):


Ingroup: proteobacteria


ref|YP_002542806.1| Agrobacterium radiobacter K84 1e-92 (a-proteobacteria)

ref|YP_004277036.1| Acidiphilium multivorum AIU301 7e-92 (a-proteobacteria)

ref|YP_001833892.1| Beijerinckia indica subsp. indica 5e-86 (a-proteobacteria)

ref|ZP_02189986.1| alpha proteobacterium BAL199 4e-85 (a-proteobacteria)

ref|YP_003899301.1| Halomonas elongata DSM 2581 1e-84 (g-proteobacteria)

ref|YP_004311933.1| Marinomonas mediterranea MMB-1 1e-81 (g-proteobacteria)

ref|ZP_05887860.1| Vibrio coralliilyticus ATCC BAA-450 5e-81 (g-proteobacteria)

ref|YP_132135.1| Photobacterium profundum SS9 7e-79 (g-proteobacteria)

ref|YP_002253594.1| Ralstonia solanacearum MolK2 5e-75 (b-proteobacteria)

ref|YP_003775835.1| Herbaspirillum seropedicae SmR1 3e-73 (b-proteobacteria)

ref|ZP_02887017.1| Burkholderia graminis C4D1M 9e-73 (b-proteobacteria)



Outgroup: other bacteria (_non proteobacteria: firmicutes, fusobacteria, spirochetes, Bacteroidetes)


ref|YP_083844.1| Bacillus cereus E33L 7e-71 (firmicutes)

ref|YP_003968235.1| Ilyobacter polytropus DSM 2926 6e-67 (fusobacteria)

ref|YP_003804683.1| Spirochaeta smaragdinae DSM 11293 1e-66 (spirochetes)

ref|YP_003090049.1| Dyadobacter fermentans DSM 18053 6e-65 (Bacteroidetes)

ref|ZP_08037167.1| Treponema phagedenis F0421 3e-62 (spirochetes)

ref|ZP_08129948.1| Clostridium sp. D5 2e-62 (firmicutes)




RAW RESULTS

1) BLASTp versus NR

root
. uncultured marine microorganism HF4000_009A22 --------------------------------  423 1 hit  [unclassified]        putative Thiamine pyrophosphate enzyme, central domain prot
. Agrobacterium radiobacter K84 ................................................  343 4 hits [a-proteobacteria]    myo-inositol catabolism [Agrobacterium radiobacter K84] >gi
. Acidiphilium multivorum AIU301 ...............................................  341 6 hits [a-proteobacteria]    3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase IolD [
. Sagittula stellata E-37 ......................................................  326 4 hits [a-proteobacteria]    hypothetical acetolactate synthase, iolD [Sagittula stellat
. Beijerinckia indica subsp. indica ATCC 9039 ..................................  322 2 hits [a-proteobacteria]    thiamine pyrophosphate protein central region [Beijerinckia
. Pantoea sp. At-9b ............................................................  319 4 hits [enterobacteria]      thiamine pyrophosphate protein central region [Pantoea sp. 
. alpha proteobacterium BAL199 .................................................  318 2 hits [a-proteobacteria]    Acetolactate synthase [alpha proteobacterium BAL199] >gi|15
. Halomonas elongata DSM 2581 ..................................................  317 2 hits [g-proteobacteria]    K03336 myo-inositol catabolism protein IolD [Halomonas elon
. Methylobacterium nodulans ORS 2060 ...........................................  310 2 hits [a-proteobacteria]    thiamine pyrophosphate protein central region [Methylobacte
. Burkholderia multivorans CGD2M ...............................................  308 4 hits [b-proteobacteria]    probable malonic semialdehyde oxidative decarboxylase [Burk
. Burkholderia multivorans CGD2 ................................................  308 4 hits [b-proteobacteria]    probable malonic semialdehyde oxidative decarboxylase [Burk
. Silicibacter lacuscaerulensis ITI-1157 .......................................  308 2 hits [a-proteobacteria]    probable malonic semialdehyde oxidative decarboxylase [Sili
. Vibrio harveyi 1DA3 ..........................................................  307 2 hits [g-proteobacteria]    conserved hypothetical protein [Vibrio harveyi 1DA3] >gi|26
. Marinomonas mediterranea MMB-1 ...............................................  307 2 hits [g-proteobacteria]    Acetolactate synthase [Marinomonas mediterranea MMB-1] >gi|
. Ruegeria sp. R11 .............................................................  307 4 hits [a-proteobacteria]    TPP-requiring enzyme IolD [Ruegeria sp. R11] >gi|214030473|
. Labrenzia alexandrii DFL-11 ..................................................  305 2 hits [a-proteobacteria]    Thiamine pyrophosphate enzyme, central domain family [Labre
. Oceanicola granulosus HTCC2516 ...............................................  305 2 hits [a-proteobacteria]    Acetolactate synthase [Oceanicola granulosus HTCC2516] >gi|
. Asticcacaulis biprosthecum C19 ...............................................  305 1 hit  [a-proteobacteria]    3D-3,5/4-trihydroxycyclohexane-1,2-dione hydrolase [Asticca
. Vibrio coralliilyticus ATCC BAA-450 ..........................................  305 4 hits [g-proteobacteria]    epi-inositol hydrolase [Vibrio coralliilyticus ATCC BAA-450
. Acidiphilium cryptum JF-5 ....................................................  305 2 hits [a-proteobacteria]    thiamine pyrophosphate enzyme, central region [Acidiphilium
. Roseibium sp. TrichSKD4 ......................................................  305 2 hits [a-proteobacteria]    3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Rosei
. Phaeobacter gallaeciensis 2.10 ...............................................  303 2 hits [a-proteobacteria]    thiamine pyrophosphate enzyme protein [Phaeobacter gallaeci
. Octadecabacter antarcticus 307 ...............................................  303 4 hits [a-proteobacteria]    Thiamine pyrophosphate enzyme, central domain family [Octad
. Vibrio shilonii AK1 ..........................................................  303 2 hits [g-proteobacteria]    hypothetical acetolactate synthase, iolD [Vibrio shilonii A
. Sinorhizobium fredii NGR234 ..................................................  303 7 hits [a-proteobacteria]    thiamine pyrophosphate domain protein, TPP binding region [
. Loktanella vestfoldensis SKA53 ...............................................  302 4 hits [a-proteobacteria]    iold protein [Loktanella vestfoldensis SKA53] >gi|84510738|
. Silicibacter sp. TrichCH4B ...................................................  302 2 hits [a-proteobacteria]    probable malonic semialdehyde oxidative decarboxylase [Sili
. Phaeobacter gallaeciensis BS107 ..............................................  302 2 hits [a-proteobacteria]    thiamine pyrophosphate enzyme, central region [Phaeobacter 
. Ochrobactrum intermedium LMG 3301 ............................................  302 2 hits [a-proteobacteria]    thiamine pyrophosphate protein central region [Ochrobactrum
. Sinorhizobium meliloti 1021 ..................................................  301 2 hits [a-proteobacteria]    putative malonic semialdehyde oxidative decarboxylase prote
. Sinorhizobium meliloti BL225C ................................................  301 2 hits [a-proteobacteria]    putative malonic semialdehyde oxidative decarboxylase prote
. Sinorhizobium meliloti AK83 ..................................................  301 2 hits [a-proteobacteria]    putative malonic semialdehyde oxidative decarboxylase prote
. Labrenzia aggregata IAM 12614 ................................................  301 2 hits [a-proteobacteria]    Acetolactate synthase [Stappia aggregata IAM 12614] >gi|118
. Roseobacter litoralis Och 149 ................................................  300 2 hits [a-proteobacteria]    acetolactate synthase [Roseobacter litoralis Och 149] >gi|1
. Roseobacter denitrificans OCh 114 ............................................  300 2 hits [a-proteobacteria]    acetolactate synthase [Roseobacter denitrificans OCh 114] >
. uncultured alpha proteobacterium HF0070_34E11 ................................  300 1 hit  [a-proteobacteria]    acetolactate synthase [uncultured alpha proteobacterium HF0
. Octadecabacter antarcticus 238 ...............................................  298 2 hits [a-proteobacteria]    thiamine pyrophosphate enzyme protein [Octadecabacter antar
. Roseobacter sp. MED193 .......................................................  298 2 hits [a-proteobacteria]    iold protein [Roseobacter sp. MED193] >gi|85827573|gb|EAQ47
. Photobacterium profundum 3TCK ................................................  298 4 hits [g-proteobacteria]    hypothetical acetolactate synthase, iolD [Photobacterium pr
. Rhizobium leguminosarum bv. viciae 3841 ......................................  297 2 hits [a-proteobacteria]    malonate semialdehyde dehydrogenase [Rhizobium leguminosaru
. Rhizobium etli CFN 42 ........................................................  296 2 hits [a-proteobacteria]    myo-inositol catabolism, acetolactate synthase protein [Rhi
. Thalassiobium sp. R2A62 ......................................................  296 2 hits [a-proteobacteria]    probable malonic semialdehyde oxidative decarboxylase [Thal
. Rhizobium leguminosarum ......................................................  296 1 hit  [a-proteobacteria]    acetolactate synthase [Rhizobium leguminosarum]
. Photobacterium profundum SS9 .................................................  296 4 hits [g-proteobacteria]    acetolactate synthase IolD [Photobacterium profundum SS9] >
. Brucella sp. 83/13 ...........................................................  295 3 hits [a-proteobacteria]    thiamine pyrophosphate protein [Brucella sp. 83/13] >gi|265
. Brucella sp. NF 2653 .........................................................  295 2 hits [a-proteobacteria]    thiamine pyrophosphate protein [Brucella sp. 83/13] >gi|265
. Rhizobium leguminosarum bv. trifolii WSM1325 .................................  295 2 hits [a-proteobacteria]    thiamine pyrophosphate protein central region [Rhizobium le
. Ochrobactrum anthropi ATCC 49188 .............................................  295 2 hits [a-proteobacteria]    thiamine pyrophosphate protein central region [Ochrobactrum
. Leptothrix cholodnii SP-6 ....................................................  294 2 hits [b-proteobacteria]    thiamine pyrophosphate protein central region [Leptothrix c
. Hoeflea phototrophica DFL-43 .................................................  294 2 hits [a-proteobacteria]    thiamine pyrophosphate enzyme, central region [Hoeflea phot
. Brucella sp. BO2 .............................................................  294 2 hits [a-proteobacteria]    thiamine pyrophosphate protein [Brucella sp. BO2] >gi|30684
. Brucella sp. BO1 .............................................................  294 2 hits [a-proteobacteria]    thiamine pyrophosphate protein [Brucella sp. BO2] >gi|30684
. Rhizobium leguminosarum bv. trifolii WSM2304 .................................  293 2 hits [a-proteobacteria]    thiamine pyrophosphatase [Rhizobium leguminosarum bv. trifo
. Sinorhizobium medicae WSM419 .................................................  293 2 hits [a-proteobacteria]    thiamine pyrophosphate protein central region [Sinorhizobiu
. Asticcacaulis excentricus CB 48 ..............................................  293 2 hits [a-proteobacteria]    thiamine pyrophosphate TPP-binding domain-containing protei
. Dinoroseobacter shibae DFL 12 ................................................  293 2 hits [a-proteobacteria]    thiamine pyrophosphate protein central region [Dinoroseobac
. Hahella chejuensis KCTC 2396 .................................................  293 2 hits [g-proteobacteria]    acetolactate synthase [Hahella chejuensis KCTC 2396] >gi|83
. Aurantimonas manganoxydans SI85-9A1 ..........................................  293 2 hits [a-proteobacteria]    acetolactate synthase IolD protein [Aurantimonas manganoxyd
. Rhodobacteraceae bacterium HTCC2150 ..........................................  292 2 hits [a-proteobacteria]    thiamine pyrophosphate enzyme protein [Rhodobacterales bact
. Brucella melitensis ATCC 23457 ...............................................  291 2 hits [a-proteobacteria]    thiamine pyrophosphate protein [Brucella melitensis ATCC 23
. Brucella abortus bv. 3 str. Tulya ............................................  291 3 hits [a-proteobacteria]    thiamine pyrophosphate protein [Brucella melitensis ATCC 23
. Brucella melitensis bv. 1 str. Rev.1 .........................................  291 3 hits [a-proteobacteria]    thiamine pyrophosphate protein [Brucella melitensis ATCC 23
. Brucella melitensis bv. 2 str. 63/9 ..........................................  291 2 hits [a-proteobacteria]    thiamine pyrophosphate protein [Brucella melitensis ATCC 23
. Brucella melitensis bv. 1 str. 16M ...........................................  291 4 hits [a-proteobacteria]    thiamine pyrophosphate protein [Brucella melitensis ATCC 23
. Brucella melitensis M28 ......................................................  291 1 hit  [a-proteobacteria]    thiamine pyrophosphate protein [Brucella melitensis ATCC 23
. Brucella melitensis M5-90 ....................................................  291 1 hit  [a-proteobacteria]    thiamine pyrophosphate protein [Brucella melitensis ATCC 23
. Brucella pinnipedialis M292/94/1 .............................................  291 2 hits [a-proteobacteria]    thiamine pyrophosphate enzyme [Brucella pinnipedialis M292/
. Brucella melitensis bv. 3 str. Ether .........................................  291 3 hits [a-proteobacteria]    thiamine pyrophosphate protein [Brucella melitensis bv. 3 s
. Brucella ovis ATCC 25840 .....................................................  291 2 hits [a-proteobacteria]    TPP-requiring enzyme IolD [Brucella ovis ATCC 25840] >gi|14
. Brucella abortus bv. 1 str. 9-941 ............................................  291 2 hits [a-proteobacteria]    TPP-requiring prtoein IolD [Brucella abortus bv. 1 str. 9-9
. Brucella melitensis biovar Abortus 2308 ......................................  291 2 hits [a-proteobacteria]    TPP-requiring prtoein IolD [Brucella abortus bv. 1 str. 9-9
. Brucella abortus S19 .........................................................  291 2 hits [a-proteobacteria]    TPP-requiring prtoein IolD [Brucella abortus bv. 1 str. 9-9
. Brucella abortus bv. 6 str. 870 ..............................................  291 3 hits [a-proteobacteria]    TPP-requiring prtoein IolD [Brucella abortus bv. 1 str. 9-9
. Brucella abortus bv. 2 str. 86/8/59 ..........................................  291 3 hits [a-proteobacteria]    TPP-requiring prtoein IolD [Brucella abortus bv. 1 str. 9-9
. Brucella abortus bv. 4 str. 292 ..............................................  291 3 hits [a-proteobacteria]    TPP-requiring prtoein IolD [Brucella abortus bv. 1 str. 9-9
. Brucella abortus bv. 9 str. C68 ..............................................  291 3 hits [a-proteobacteria]    TPP-requiring prtoein IolD [Brucella abortus bv. 1 str. 9-9
. Brucella abortus NCTC 8038 ...................................................  291 2 hits [a-proteobacteria]    TPP-requiring prtoein IolD [Brucella abortus bv. 1 str. 9-9
. Brucella abortus bv. 5 str. B3196 ............................................  291 2 hits [a-proteobacteria]    TPP-requiring prtoein IolD [Brucella abortus bv. 1 str. 9-9
. Pseudovibrio sp. JE062 .......................................................  291 2 hits [a-proteobacteria]    iold protein [Pseudovibrio sp. JE062] >gi|211959289|gb|EEA9
. Marinomonas sp. MWYL1 ........................................................  291 2 hits [g-proteobacteria]    thiamine pyrophosphate protein central region [Marinomonas 
. Brucella pinnipedialis M163/99/10 ............................................  291 3 hits [a-proteobacteria]    thiamine pyrophosphate protein [Brucella pinnipedialis M163
. Brucella pinnipedialis B2/94 .................................................  291 3 hits [a-proteobacteria]    thiamine pyrophosphate protein [Brucella pinnipedialis M163
. Brucella microti CCM 4915 ....................................................  291 2 hits [a-proteobacteria]    thiamine pyrophosphate protein [Brucella pinnipedialis M163
. Mesorhizobium opportunistum WSM2075 ..........................................  291 2 hits [a-proteobacteria]    thiamine pyrophosphate protein central region [Mesorhizobiu
. Brucella abortus str. 2308 A .................................................  291 2 hits [a-proteobacteria]    acetolactate synthase IolD [Brucella abortus str. 2308 A] >
. Brucella suis 1330 ...........................................................  291 2 hits [a-proteobacteria]    TPP-requiring enzyme IolD [Brucella suis 1330] >gi|16162077
. Brucella canis ATCC 23365 ....................................................  291 2 hits [a-proteobacteria]    TPP-requiring enzyme IolD [Brucella suis 1330] >gi|16162077
. Brucella suis bv. 3 str. 686 .................................................  291 3 hits [a-proteobacteria]    TPP-requiring enzyme IolD [Brucella suis 1330] >gi|16162077
. Brucella suis bv. 4 str. 40 ..................................................  291 2 hits [a-proteobacteria]    TPP-requiring enzyme IolD [Brucella suis 1330] >gi|16162077
. Brucella ceti M490/95/1 ......................................................  291 3 hits [a-proteobacteria]    thiamine pyrophosphate protein [Brucella ceti M490/95/1] >g
. Brucella ceti B1/94 ..........................................................  291 3 hits [a-proteobacteria]    thiamine pyrophosphate protein [Brucella ceti M490/95/1] >g
. Brucella sp. F5/99 ...........................................................  291 3 hits [a-proteobacteria]    thiamine pyrophosphate protein [Brucella ceti M490/95/1] >g
. Brucella neotomae 5K33 .......................................................  290 3 hits [a-proteobacteria]    thiamine pyrophosphate protein [Brucella neotomae 5K33] >gi
. Brucella ceti str. Cudo ......................................................  290 2 hits [a-proteobacteria]    acetolactate synthase IolD [Brucella ceti str. Cudo] >gi|22
. Rhizobium etli CIAT 652 ......................................................  290 2 hits [a-proteobacteria]    acetolactate synthase protein (myo-inositol catabolism) [Rh
. Brucella suis bv. 5 str. 513 .................................................  290 3 hits [a-proteobacteria]    TPP-requiring enzyme IolD [Brucella suis bv. 5 str. 513] >g
. Rhizobium etli CNPAF512 ......................................................  290 1 hit  [a-proteobacteria]    acetolactate synthase protein (myo-inositol catabolism) [Rh
. Ralstonia solanacearum PSI07 .................................................  289 2 hits [b-proteobacteria]    acetolactate synthase protein [Ralstonia solanacearum PSI07
. Agrobacterium sp. H13-3 ......................................................  289 1 hit  [a-proteobacteria]    Acetolactate synthase [Agrobacterium sp. H13-3]
. Mesorhizobium loti MAFF303099 ................................................  288 2 hits [a-proteobacteria]    acetolactate synthase, iolD [Mesorhizobium loti MAFF303099]
. Ruegeria sp. TM1040 ..........................................................  288 2 hits [a-proteobacteria]    thiamine pyrophosphate enzyme, central region [Ruegeria sp.
. Paracoccus denitrificans PD1222 ..............................................  288 2 hits [a-proteobacteria]    thiamine pyrophosphate binding domain-containing protein [P
. Rhodobacter sphaeroides ATCC 17029 ...........................................  288 2 hits [a-proteobacteria]    thiamine pyrophosphate enzyme, central region [Rhodobacter 
. Rhodobacteraceae bacterium HTCC2083 ..........................................  288 2 hits [a-proteobacteria]    thiamine pyrophosphate-dependent enzyme IolD [Rhodobacteral
. Rhodobacterales bacterium HTCC2255 ...........................................  287 2 hits [a-proteobacteria]    hypothetical acetolactate synthase, iolD [alpha proteobacte
. Bradyrhizobium sp. BTAi1 .....................................................  287 2 hits [a-proteobacteria]    putative malonic semialdehyde oxidative decarboxylase [Brad
. Rhodobacteraceae bacterium KLH11 .............................................  286 2 hits [a-proteobacteria]    thiamine pyrophosphate enzyme, central region [Rhodobactera
. Jannaschia sp. CCS1 ..........................................................  286 2 hits [a-proteobacteria]    thiamine pyrophosphate enzyme protein [Jannaschia sp. CCS1]
. Candidatus Puniceispirillum marinum IMCC1322 .................................  286 2 hits [a-proteobacteria]    acetolactate synthase, iolD [Candidatus Puniceispirillum ma
. Agrobacterium vitis S4 .......................................................  286 2 hits [a-proteobacteria]    acetolactate synthase [Agrobacterium vitis S4] >gi|22173406
. Ralstonia solanacearum MolK2 .................................................  285 2 hits [b-proteobacteria]    acetolactate synthase protein [Ralstonia solanacearum MolK2
. Rhodobacter sphaeroides 2.4.1 ................................................  285 2 hits [a-proteobacteria]    acetolactate synthase [Rhodobacter sphaeroides 2.4.1] >gi|7
. Ralstonia solanacearum CFBP2957 ..............................................  285 2 hits [b-proteobacteria]    acetolactate synthase protein (iold) [Ralstonia solanacearu
. Nematostella vectensis .......................................................  285 2 hits [sea anemones]        hypothetical protein NEMVEDRAFT_v1g225949 [Nematostella vec
. Ralstonia solanacearum UW551 .................................................  284 2 hits [b-proteobacteria]    IolD PROTEIN [Ralstonia solanacearum UW551] >gi|207743407|r
. Ralstonia solanacearum IPO1609 ...............................................  284 2 hits [b-proteobacteria]    IolD PROTEIN [Ralstonia solanacearum UW551] >gi|207743407|r
. Ralstonia solanacearum CMR15 .................................................  284 2 hits [b-proteobacteria]    putative acetolactate synthase (ilvB) [Ralstonia solanacear
. Geobacillus kaustophilus HTA426 ..............................................  283 2 hits [firmicutes]          myo-inositol catabolism protein [Geobacillus kaustophilus H
. Geobacillus kaustophilus .....................................................  283 1 hit  [firmicutes]          myo-inositol catabolism protein [Geobacillus kaustophilus H
. Rhodobacter sphaeroides KD131 ................................................  283 2 hits [a-proteobacteria]    Thiamine pyrophosphate enzyme, central region [Rhodobacter 
. Amycolatopsis mediterranei U32 ...............................................  282 2 hits [high GC Gram+]       3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Amyco
. Gluconacetobacter diazotrophicus PAl 5 .......................................  280 4 hits [a-proteobacteria]    xylose isomerase domain-containing protein [Gluconacetobact
. Thermobaculum terrenum ATCC BAA-798 ..........................................  279 2 hits [bacteria]            thiamine pyrophosphate protein central region [Thermobaculu
. Herbaspirillum seropedicae SmR1 ..............................................  279 2 hits [b-proteobacteria]    acetolactate synthase [Herbaspirillum seropedicae SmR1] >gi
. Burkholderia graminis C4D1M ..................................................  278 2 hits [b-proteobacteria]    thiamine pyrophosphate protein central region [Burkholderia
. Agrobacterium tumefaciens str. C58 ...........................................  277 2 hits [a-proteobacteria]    acetolactate synthase [Agrobacterium tumefaciens str. C58] 
. Burkholderia sp. CCGE1002 ....................................................  277 2 hits [b-proteobacteria]    thiamine pyrophosphate protein central region [Burkholderia
. Mesorhizobium ciceri biovar biserrulae WSM1271 ...............................  277 2 hits [a-proteobacteria]    thiamine pyrophosphate central domain-containing protein [M
. Caulobacter crescentus CB15 ..................................................  276 2 hits [a-proteobacteria]    iolD protein [Caulobacter crescentus CB15] >gi|221234294|re
. Caulobacter crescentus NA1000 ................................................  276 2 hits [a-proteobacteria]    iolD protein [Caulobacter crescentus CB15] >gi|221234294|re
. Burkholderia xenovorans LB400 ................................................  276 2 hits [b-proteobacteria]    putative myo-inositol catabolism LolD protein [Burkholderia
. Burkholderia phymatum STM815 .................................................  276 2 hits [b-proteobacteria]    thiamine pyrophosphate protein central region [Burkholderia
. Burkholderia sp. CCGE1001 ....................................................  275 2 hits [b-proteobacteria]    thiamine pyrophosphate TPP-binding domain-containing protei
. Burkholderia sp. Ch1-1 .......................................................  274 2 hits [b-proteobacteria]    thiamine pyrophosphate protein central region [Burkholderia
. Bacillus cereus E33L .........................................................  273 6 hits [firmicutes]          myo-inositol catabolism protein, malonic semialdehyde oxida
. Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1 .....................  273 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Bacil
. Meiothermus ruber DSM 1279 ...................................................  273 2 hits [bacteria]            thiamine pyrophosphate protein central region [Meiothermus 
. Bacillus cereus AH820 ........................................................  273 3 hits [firmicutes]          putative iolD protein [Bacillus cereus AH820] >gi|301054049
. Bacillus cereus biovar anthracis str. CI .....................................  273 2 hits [firmicutes]          putative iolD protein [Bacillus cereus AH820] >gi|301054049
. Bacillus thuringiensis serovar konkukian str. 97-27 ..........................  273 2 hits [firmicutes]          malonic semialdehyde oxidative decarboxylase [Bacillus thur
. Bacillus thuringiensis serovar konkukian .....................................  273 1 hit  [firmicutes]          malonic semialdehyde oxidative decarboxylase [Bacillus thur
. Bacillus anthracis str. Ames .................................................  273 2 hits [firmicutes]          iolD protein, putative [Bacillus anthracis str. Ames] >gi|4
. Bacillus anthracis str. 'Ames Ancestor' ......................................  273 2 hits [firmicutes]          iolD protein, putative [Bacillus anthracis str. Ames] >gi|4
. Bacillus anthracis str. Sterne ...............................................  273 2 hits [firmicutes]          iolD protein, putative [Bacillus anthracis str. Ames] >gi|4
. Bacillus anthracis str. A2012 ................................................  273 1 hit  [firmicutes]          iolD protein, putative [Bacillus anthracis str. Ames] >gi|4
. Bacillus anthracis str. A0488 ................................................  273 2 hits [firmicutes]          iolD protein, putative [Bacillus anthracis str. Ames] >gi|4
. Bacillus anthracis str. A0442 ................................................  273 2 hits [firmicutes]          iolD protein, putative [Bacillus anthracis str. Ames] >gi|4
. Bacillus anthracis str. A0193 ................................................  273 2 hits [firmicutes]          iolD protein, putative [Bacillus anthracis str. Ames] >gi|4
. Bacillus anthracis str. A0465 ................................................  273 2 hits [firmicutes]          iolD protein, putative [Bacillus anthracis str. Ames] >gi|4
. Bacillus anthracis str. A0389 ................................................  273 2 hits [firmicutes]          iolD protein, putative [Bacillus anthracis str. Ames] >gi|4
. Bacillus anthracis str. A0174 ................................................  273 2 hits [firmicutes]          iolD protein, putative [Bacillus anthracis str. Ames] >gi|4
. Bacillus anthracis Tsiankovskii-I ............................................  273 2 hits [firmicutes]          iolD protein, putative [Bacillus anthracis str. Ames] >gi|4
. Bacillus anthracis str. CDC 684 ..............................................  273 3 hits [firmicutes]          iolD protein, putative [Bacillus anthracis str. Ames] >gi|4
. Bacillus thuringiensis serovar andalousiensis BGSC 4AW1 ......................  273 2 hits [firmicutes]          iolD protein, putative [Bacillus anthracis str. Ames] >gi|4
. Bacillus anthracis str. A0248 ................................................  273 3 hits [firmicutes]          iolD protein, putative [Bacillus anthracis str. Ames] >gi|4
. Bacillus anthracis str. CNEVA-9066 ...........................................  273 1 hit  [firmicutes]          iolD protein, putative [Bacillus anthracis str. Ames] >gi|4
. Bacillus anthracis str. A1055 ................................................  273 1 hit  [firmicutes]          iolD protein, putative [Bacillus anthracis str. Ames] >gi|4
. Bacillus anthracis str. Western North America USA6153 ........................  273 1 hit  [firmicutes]          iolD protein, putative [Bacillus anthracis str. Ames] >gi|4
. Bacillus anthracis str. Kruger B .............................................  273 1 hit  [firmicutes]          iolD protein, putative [Bacillus anthracis str. Ames] >gi|4
. Bacillus anthracis str. Vollum ...............................................  273 1 hit  [firmicutes]          iolD protein, putative [Bacillus anthracis str. Ames] >gi|4
. Bacillus anthracis str. Australia 94 .........................................  273 1 hit  [firmicutes]          iolD protein, putative [Bacillus anthracis str. Ames] >gi|4
. Bacillus anthracis (anthrax) .................................................  273 1 hit  [firmicutes]          iolD protein, putative [Bacillus anthracis str. Ames] >gi|4
. Bacillus cereus W ............................................................  273 2 hits [firmicutes]          putative iolD protein [Bacillus cereus W] >gi|195993367|gb|
. Bacillus thuringiensis serovar monterrey BGSC 4AJ1 ...........................  273 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Bacil
. Bacillus cereus NVH0597-99 ...................................................  272 2 hits [firmicutes]          putative iolD protein [Bacillus cereus NVH0597-99] >gi|1960
. Bacillus cereus AH603 ........................................................  272 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Bacil
. Burkholderia phytofirmans PsJN ...............................................  272 2 hits [b-proteobacteria]    thiamine pyrophosphate protein central region [Burkholderia
. Bacillus cereus Rock3-42 .....................................................  272 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Bacil
. Kosmotoga olearia TBF 19.5.1 .................................................  271 2 hits [thermotogales]       thiamine pyrophosphate protein central region [Kosmotoga ol
. Roseobacter sp. CCS2 .........................................................  271 2 hits [a-proteobacteria]    thiamine pyrophosphate enzyme, central region [Roseobacter 
. Bacillus cereus AH621 ........................................................  271 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Bacil
. Azospirillum sp. B510 ........................................................  271 2 hits [a-proteobacteria]    myo-inositol catabolism protein [Azospirillum sp. B510] >gi
. Bacillus cereus ATCC 4342 ....................................................  271 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Bacil
. Bacillus thuringiensis serovar tochigiensis BGSC 4Y1 .........................  270 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Bacil
. Brucella ceti M13/05/1 .......................................................  270 2 hits [a-proteobacteria]    acetolactate synthase [Brucella ceti M13/05/1] >gi|26132019
. Brucella ceti M644/93/1 ......................................................  270 2 hits [a-proteobacteria]    acetolactate synthase [Brucella ceti M13/05/1] >gi|26132019
. Bacillus thuringiensis str. Al Hakam .........................................  270 3 hits [firmicutes]          malonic semialdehyde oxidative decarboxylase [Bacillus thur
. Bacillus cereus 03BB108 ......................................................  270 2 hits [firmicutes]          malonic semialdehyde oxidative decarboxylase [Bacillus thur
. Bacillus cereus 03BB102 ......................................................  270 3 hits [firmicutes]          malonic semialdehyde oxidative decarboxylase [Bacillus thur
. Bacillus cereus BGSC 6E1 .....................................................  270 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Bacil
. Bacillus cereus R309803 ......................................................  270 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Bacil
. Bacillus thuringiensis serovar pulsiensis BGSC 4CC1 ..........................  270 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Bacil
. Ahrensia sp. R2A130 ..........................................................  269 2 hits [a-proteobacteria]    3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Ahren
. Burkholderia sp. H160 ........................................................  268 2 hits [b-proteobacteria]    thiamine pyrophosphate protein central region [Burkholderia
. Ralstonia solanacearum GMI1000 ...............................................  268 2 hits [b-proteobacteria]    putative acetolactate synthase protein [Ralstonia solanacea
. Marinithermus hydrothermalis DSM 14884 .......................................  267 1 hit  [bacteria]            Acetolactate synthase [Marinithermus hydrothermalis DSM 148
. Geobacillus thermodenitrificans NG80-2 .......................................  266 3 hits [firmicutes]          IolD protein [Geobacillus thermodenitrificans NG80-2] >gi|1
. Geobacillus sp. G11MC16 ......................................................  266 2 hits [firmicutes]          IolD protein [Geobacillus thermodenitrificans NG80-2] >gi|1
. Rhodococcus opacus B4 ........................................................  266 4 hits [high GC Gram+]       3D-(3,5/4)-trihydroxycyclohexane-1,2- dione hydrolase [Rhod
. Bacillus cereus Rock1-3 ......................................................  266 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Bacil
. Geobacillus sp. Y4.1MC1 ......................................................  265 2 hits [firmicutes]          thiamine pyrophosphate central domain-containing protein [G
. Bacillus megaterium DSM 319 ..................................................  265 4 hits [firmicutes]          myo-inositol catabolism protein IolD [Bacillus megaterium D
. Hyphomonas neptunium ATCC 15444 ..............................................  265 2 hits [a-proteobacteria]    thiamine pyrophosphate-dependent enzyme IolD [Hyphomonas ne
. Actinosynnema mirum DSM 43827 ................................................  265 2 hits [high GC Gram+]       thiamine pyrophosphate protein central region [Actinosynnem
. Bacillus megaterium QM B1551 .................................................  264 4 hits [firmicutes]          myo-inositol catabolism protein IolD [Bacillus megaterium Q
. Bacillus cereus Rock3-29 .....................................................  264 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Bacil
. Burkholderia oklahomensis EO147 ..............................................  264 1 hit  [b-proteobacteria]    iolD protein [Burkholderia oklahomensis EO147]
. Bacillus cereus 95/8201 ......................................................  264 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Bacil
. Xenorhabdus nematophila ATCC 19061 ...........................................  263 2 hits [enterobacteria]      putative malonic semialdehyde oxidative decarboxylase [Xeno
. Burkholderia oklahomensis C6786 ..............................................  263 1 hit  [b-proteobacteria]    iolD protein [Burkholderia oklahomensis C6786]
. Listeria monocytogenes serotype 4b str. H7858 ................................  263 2 hits [firmicutes]          thiamine-pyrophosphate-requiring enzyme [Listeria monocytog
. Listeria monocytogenes FSL J1-194 ............................................  263 2 hits [firmicutes]          thiamine-pyrophosphate-requiring enzyme [Listeria monocytog
. Listeria monocytogenes FSL J1-175 ............................................  263 1 hit  [firmicutes]          thiamine-pyrophosphate-requiring enzyme [Listeria monocytog
. Listeria monocytogenes serotype 4b str. F2365 ................................  263 3 hits [firmicutes]          RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. Listeria monocytogenes HPB2262 ...............................................  263 2 hits [firmicutes]          thiamine-pyrophosphate-requiring enzyme [Listeria monocytog
. Listeria monocytogenes 220 ...................................................  263 1 hit  [firmicutes]          thiamine-pyrophosphate-requiring enzyme [Listeria monocytog
. Burkholderia pseudomallei 91 .................................................  263 1 hit  [b-proteobacteria]    iolD protein [Burkholderia pseudomallei 91]
. Listeria seeligeri serovar 1/2b str. SLCC3954 ................................  263 2 hits [firmicutes]          IolD protein [Listeria seeligeri serovar 1/2b str. SLCC3954
. Listeria monocytogenes FSL R2-503 ............................................  263 2 hits [firmicutes]          thiamine-pyrophosphate-requiring enzyme [Listeria monocytog
. Listeria monocytogenes FSL N1-017 ............................................  263 2 hits [firmicutes]          thiamine-pyrophosphate-requiring enzyme [Listeria monocytog
. Burkholderia pseudomallei DM98 ...............................................  262 1 hit  [b-proteobacteria]    iolD protein [Burkholderia pseudomallei DM98]
. Burkholderia pseudomallei 668 ................................................  262 2 hits [b-proteobacteria]    iolD protein [Burkholderia pseudomallei 668] >gi|126218633|
. Burkholderia thailandensis TXDOH .............................................  262 1 hit  [b-proteobacteria]    iolD protein [Burkholderia thailandensis TXDOH]
. Bradyrhizobium sp. ORS278 ....................................................  261 2 hits [a-proteobacteria]    putative malonic semialdehyde oxidative decarboxylase [Brad
. Listeria monocytogenes FSL J2-071 ............................................  261 2 hits [firmicutes]          thiamine-pyrophosphate-requiring enzyme [Listeria monocytog
. Burkholderia pseudomallei 576 ................................................  261 2 hits [b-proteobacteria]    iolD protein [Burkholderia pseudomallei 576] >gi|217393451|
. Listeria monocytogenes HCC23 .................................................  261 2 hits [firmicutes]          probable malonic semialdehyde oxidative decarboxylase [List
. Listeria monocytogenes L99 ...................................................  261 1 hit  [firmicutes]          probable malonic semialdehyde oxidative decarboxylase [List
. Burkholderia pseudomallei 1655 ...............................................  261 2 hits [b-proteobacteria]    iolD protein [Burkholderia pseudomallei 1655] >gi|184210594
. Burkholderia mallei ATCC 23344 ...............................................  261 2 hits [b-proteobacteria]    iolD protein [Burkholderia mallei ATCC 23344] >gi|238561768
. Burkholderia mallei GB8 horse 4 ..............................................  261 2 hits [b-proteobacteria]    iolD protein [Burkholderia mallei ATCC 23344] >gi|238561768
. Propionibacterium acnes HL082PA2 .............................................  261 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Burkholderia mallei PRL-20 ...................................................  261 2 hits [b-proteobacteria]    iolD protein [Burkholderia mallei PRL-20] >gi|243062673|gb|
. Burkholderia pseudomallei S13 ................................................  261 2 hits [b-proteobacteria]    iolD protein [Burkholderia pseudomallei S13] >gi|169654255|
. Burkholderia mallei SAVP1 ....................................................  261 2 hits [b-proteobacteria]    iolD protein [Burkholderia mallei SAVP1] >gi|124383379|ref|
. Burkholderia mallei NCTC 10229 ...............................................  261 2 hits [b-proteobacteria]    iolD protein [Burkholderia mallei SAVP1] >gi|124383379|ref|
. Burkholderia mallei NCTC 10247 ...............................................  261 2 hits [b-proteobacteria]    iolD protein [Burkholderia mallei SAVP1] >gi|124383379|ref|
. Burkholderia mallei ATCC 10399 ...............................................  261 2 hits [b-proteobacteria]    iolD protein [Burkholderia mallei SAVP1] >gi|124383379|ref|
. Burkholderia mallei FMH ......................................................  261 2 hits [b-proteobacteria]    iolD protein [Burkholderia mallei SAVP1] >gi|124383379|ref|
. Burkholderia mallei JHU ......................................................  261 2 hits [b-proteobacteria]    iolD protein [Burkholderia mallei SAVP1] >gi|124383379|ref|
. Burkholderia mallei 2002721280 ...............................................  261 2 hits [b-proteobacteria]    iolD protein [Burkholderia mallei SAVP1] >gi|124383379|ref|
. Burkholderia pseudomallei K96243 .............................................  261 2 hits [b-proteobacteria]    putative TPP-binding acetolactate synthase [Burkholderia ps
. Burkholderia pseudomallei 1710b ..............................................  261 2 hits [b-proteobacteria]    putative TPP-binding acetolactate synthase [Burkholderia ps
. Burkholderia pseudomallei 1106b ..............................................  261 2 hits [b-proteobacteria]    putative TPP-binding acetolactate synthase [Burkholderia ps
. Burkholderia pseudomallei 1710a ..............................................  261 2 hits [b-proteobacteria]    putative TPP-binding acetolactate synthase [Burkholderia ps
. Burkholderia pseudomallei 406e ...............................................  261 2 hits [b-proteobacteria]    putative TPP-binding acetolactate synthase [Burkholderia ps
. Burkholderia pseudomallei 1106a ..............................................  261 2 hits [b-proteobacteria]    iolD protein [Burkholderia pseudomallei 1106a] >gi|16791928
. Burkholderia pseudomallei BCC215 .............................................  261 1 hit  [b-proteobacteria]    iolD protein [Burkholderia pseudomallei 1106a] >gi|16791928
. Burkholderia pseudomallei Pakistan 9 .........................................  261 2 hits [b-proteobacteria]    iolD protein [Burkholderia pseudomallei 1106a] >gi|16791928
. Burkholderia pseudomallei Pasteur 52237 ......................................  261 2 hits [b-proteobacteria]    iolD protein [Burkholderia pseudomallei 1106a] >gi|16791928
. Listeria monocytogenes serotype 4b str. CLIP 80459 ...........................  261 2 hits [firmicutes]          IolD protein, to acetolactate synthase [Listeria monocytoge
. Propionibacterium acnes HL110PA4 .............................................  261 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL050PA2 .............................................  261 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Enterococcus faecium .........................................................  261 1 hit  [firmicutes]          pyruvate decarboxylase [Enterococcus faecium]
. Propionibacterium acnes HL110PA3 .............................................  261 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL060PA1 .............................................  261 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL001PA1 .............................................  261 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Burkholderia pseudomallei MSHR346 ............................................  261 2 hits [b-proteobacteria]    IolD protein [Burkholderia pseudomallei MSHR346] >gi|237506
. Enterococcus faecium DO ......................................................  261 3 hits [firmicutes]          Pyruvate decarboxylase [Enterococcus faecium DO] >gi|258616
. Stigmatella aurantiaca DW4/3-1 ...............................................  261 4 hits [d-proteobacteria]    myo-inositol catabolism protein [Stigmatella aurantiaca DW4
. Burkholderia pseudomallei 305 ................................................  261 2 hits [b-proteobacteria]    iolD protein [Burkholderia pseudomallei 305] >gi|134245876|
. Burkholderia thailandensis E264 ..............................................  261 3 hits [b-proteobacteria]    iolD protein [Burkholderia thailandensis E264] >gi|83654431
. Listeria seeligeri FSL S4-171 ................................................  260 1 hit  [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Liste
. Anaerococcus tetradius ATCC 35098 ............................................  260 2 hits [firmicutes]          acetolactate synthase [Anaerococcus tetradius ATCC 35098] >
. Burkholderia ambifaria MC40-6 ................................................  260 2 hits [b-proteobacteria]    thiamine pyrophosphate protein central region [Burkholderia
. Clostridium perfringens str. 13 ..............................................  259 2 hits [firmicutes]          myo-inositol catabolism protein [Clostridium perfringens st
. Clostridium perfringens CPE str. F4969 .......................................  259 2 hits [firmicutes]          myo-inositol catabolism protein [Clostridium perfringens st
. Clostridium perfringens ......................................................  259 1 hit  [firmicutes]          myo-inositol catabolism protein [Clostridium perfringens st
. Burkholderia sp. CCGE1003 ....................................................  259 2 hits [b-proteobacteria]    thiamine pyrophosphate central domain-containing protein [B
. Streptosporangium roseum DSM 43021 ...........................................  259 2 hits [high GC Gram+]       thiamine pyrophosphate binding domain-containing protein [S
. Listeria monocytogenes EGD-e .................................................  259 2 hits [firmicutes]          hypothetical protein lmo0386 [Listeria monocytogenes EGD-e]
. Listeria monocytogenes .......................................................  259 1 hit  [firmicutes]          hypothetical protein lmo0386 [Listeria monocytogenes EGD-e]
. Erwinia billingiae Eb661 .....................................................  259 2 hits [enterobacteria]      Myo-inositol catabolism protein, malonic semialdehyde oxida
. Bacillus cereus BDRD-ST196 ...................................................  259 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Bacil
. Propionibacterium acnes J139 .................................................  258 2 hits [high GC Gram+]       thiamine pyrophosphate enzyme, C-terminal TPP binding domai
. Propionibacterium acnes HL037PA2 .............................................  258 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL037PA3 .............................................  258 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL044PA1 .............................................  258 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Ilyobacter polytropus DSM 2926 ...............................................  258 2 hits [fusobacteria]        3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Ilyob
. Listeria monocytogenes FSL R2-561 ............................................  258 1 hit  [firmicutes]          hypothetical protein LmonFR_07334 [Listeria monocytogenes F
. Propionibacterium acnes HL103PA1 .............................................  258 1 hit  [high GC Gram+]       3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Propi
. Clostridium perfringens D str. JGS1721 .......................................  258 2 hits [firmicutes]          myo-inositol catabolism protein IolD [Clostridium perfringe
. Clostridium perfringens ATCC 13124 ...........................................  258 3 hits [firmicutes]          myo-inositol catabolism protein IolD [Clostridium perfringe
. Clostridium perfringens B str. ATCC 3626 .....................................  258 2 hits [firmicutes]          myo-inositol catabolism protein IolD [Clostridium perfringe
. Rhodococcus jostii RHA1 ......................................................  257 2 hits [high GC Gram+]       acetolactate synthase [Rhodococcus jostii RHA1] >gi|1108178
. Spirochaeta smaragdinae DSM 11293 ............................................  257 2 hits [spirochetes]         thiamine pyrophosphate protein domain protein TPP-binding p
. Clostridium perfringens NCTC 8239 ............................................  257 2 hits [firmicutes]          myo-inositol catabolism protein IolD [Clostridium perfringe
. Listeria marthii FSL S4-120 ..................................................  257 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Liste
. Listeria monocytogenes FSL J2-003 ............................................  257 1 hit  [firmicutes]          hypothetical protein LmonocytFSL_01864 [Listeria monocytoge
. Candidatus Solibacter usitatus Ellin6076 .....................................  257 2 hits [bacteria]            thiamine pyrophosphate binding domain-containing protein [C
. Listeria monocytogenes 08-5578 ...............................................  257 2 hits [firmicutes]          hypothetical protein LM5578_0420 [Listeria monocytogenes 08
. Listeria monocytogenes 08-5923 ...............................................  257 2 hits [firmicutes]          hypothetical protein LM5578_0420 [Listeria monocytogenes 08
. Listeria monocytogenes Finland 1988 ..........................................  256 1 hit  [firmicutes]          hypothetical protein LmonF1_10274 [Listeria monocytogenes F
. Clostridiales genomosp. BVAB3 str. UPII9-5 ...................................  256 2 hits [firmicutes]          putative 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrola
. Streptomyces viridochromogenes DSM 40736 .....................................  256 4 hits [high GC Gram+]       acetolactate synthase [Streptomyces viridochromogenes DSM 4
. Listeria monocytogenes J0161 .................................................  256 1 hit  [firmicutes]          hypothetical protein LmonJ_12664 [Listeria monocytogenes J0
. Listeria monocytogenes J2818 .................................................  256 2 hits [firmicutes]          hypothetical protein LmonJ_12664 [Listeria monocytogenes J0
. Listeria monocytogenes F6900 .................................................  256 2 hits [firmicutes]          hypothetical protein LmonJ_12664 [Listeria monocytogenes J0
. Listeria monocytogenes serotype 1/2a str. F6854 ..............................  256 2 hits [firmicutes]          thiamine-pyrophosphate-requiring enzyme [Listeria monocytog
. Erwinia tasmaniensis Et1/99 ..................................................  256 2 hits [enterobacteria]      Myo-inositol catabolism protein, malonic semialdehyde oxida
. Leadbetterella byssophila DSM 17132 ..........................................  256 2 hits [CFB group bacteria]  3d-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Leadb
. Clostridium perfringens E str. JGS1987 .......................................  256 2 hits [firmicutes]          myo-inositol catabolism protein IolD [Clostridium perfringe
. Clostridium tetani ...........................................................  256 1 hit  [firmicutes]          RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. Frankia sp. EAN1pec ..........................................................  256 2 hits [high GC Gram+]       thiamine pyrophosphate protein central region [Frankia sp. 
. Clostridium tetani E88 .......................................................  256 2 hits [firmicutes]          myo-inositol catabolism protein iolD [Clostridium tetani E8
. Listeria monocytogenes 10403S ................................................  256 1 hit  [firmicutes]          hypothetical protein Lmon1_10530 [Listeria monocytogenes 10
. Erwinia sp. Ejp617 ...........................................................  256 1 hit  [enterobacteria]      Myo-inositol catabolism protein, malonic semialdehyde oxida
. Listeria monocytogenes FSL N3-165 ............................................  256 2 hits [firmicutes]          thiamine-pyrophosphate-requiring enzyme [Listeria monocytog
. Ktedonobacter racemifer DSM 44963 ............................................  255 2 hits [GNS bacteria]        thiamine pyrophosphate protein central region [Ktedonobacte
. Anaerostipes sp. 3_2_56FAA ...................................................  255 2 hits [firmicutes]          thiamine pyrophosphate enzyme [Anaerostipes sp. 3_2_56FAA] 
. Clostridium botulinum E1 str. 'BoNT E Beluga' ................................  255 2 hits [firmicutes]          probable malonic semialdehyde oxidative decarboxylase [Clos
. Clostridium sp. SS2/1 ........................................................  255 2 hits [firmicutes]          hypothetical protein CLOSS21_00355 [Clostridium sp. SS2/1] 
. Lachnospiraceae bacterium 5_1_63FAA ..........................................  255 2 hits [firmicutes]          hypothetical protein CLOSS21_00355 [Clostridium sp. SS2/1] 
. butyrate-producing bacterium SSC/2 ...........................................  255 1 hit  [firmicutes]          hypothetical protein CLOSS21_00355 [Clostridium sp. SS2/1] 
. Erwinia amylovora ATCC BAA-2158 ..............................................  254 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Erwinia amylo
. Erwinia amylovora CFBP1430 ...................................................  254 2 hits [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Erwinia amylo
. Erwinia amylovora ATCC 49946 .................................................  254 2 hits [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Erwinia amylo
. Sebaldella termitidis ATCC 33386 .............................................  254 2 hits [fusobacteria]        thiamine pyrophosphate protein central region [Sebaldella t
. Clostridium perfringens C str. JGS1495 .......................................  254 2 hits [firmicutes]          myo-inositol catabolism protein IolD [Clostridium perfringe
. Clostridium saccharolyticum WM1 ..............................................  254 2 hits [firmicutes]          thiamine pyrophosphate protein central region [Clostridium 
. Bacillus clausii KSM-K16 .....................................................  254 3 hits [firmicutes]          myo-inositol catabolism protein IolD [Bacillus clausii KSM-
. Bacillus sp. BT1B_CT2 ........................................................  254 2 hits [firmicutes]          IolD protein [Bacillus sp. BT1B_CT2] >gi|317389486|gb|EFV70
. Propionibacterium acnes HL027PA2 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Bacillus subtilis BSn5 .......................................................  253 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Bacil
. Bacillus licheniformis ATCC 14580 ............................................  253 5 hits [firmicutes]          IolD [Bacillus licheniformis ATCC 14580] >gi|52787925|ref|Y
. Bacillus subtilis subsp. subtilis str. 168 ...................................  253 3 hits [firmicutes]          IolD [Bacillus subtilis subsp. subtilis str. 168] >gi|22131
. Bacillus subtilis subsp. subtilis str. NCIB 3610 .............................  253 1 hit  [firmicutes]          IolD [Bacillus subtilis subsp. subtilis str. 168] >gi|22131
. Bacillus subtilis subsp. subtilis str. JH642 .................................  253 1 hit  [firmicutes]          IolD [Bacillus subtilis subsp. subtilis str. 168] >gi|22131
. Bacillus subtilis subsp. subtilis str. SMY ...................................  253 1 hit  [firmicutes]          IolD [Bacillus subtilis subsp. subtilis str. 168] >gi|22131
. Bacillus subtilis ............................................................  253 2 hits [firmicutes]          IolD [Bacillus subtilis subsp. subtilis str. 168] >gi|22131
. Propionibacterium acnes HL036PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL036PA3 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL005PA2 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL013PA2 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL020PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes SK137 ................................................  253 2 hits [high GC Gram+]       Epi-inositol hydrolase [Propionibacterium acnes SK137] >gi|
. Propionibacterium acnes HL056PA1 .............................................  253 1 hit  [high GC Gram+]       Epi-inositol hydrolase [Propionibacterium acnes SK137] >gi|
. Propionibacterium acnes HL053PA1 .............................................  253 1 hit  [high GC Gram+]       Epi-inositol hydrolase [Propionibacterium acnes SK137] >gi|
. Propionibacterium acnes HL005PA1 .............................................  253 1 hit  [high GC Gram+]       Epi-inositol hydrolase [Propionibacterium acnes SK137] >gi|
. Propionibacterium acnes HL038PA1 .............................................  253 1 hit  [high GC Gram+]       Epi-inositol hydrolase [Propionibacterium acnes SK137] >gi|
. Propionibacterium acnes HL043PA1 .............................................  253 1 hit  [high GC Gram+]       Epi-inositol hydrolase [Propionibacterium acnes SK137] >gi|
. Propionibacterium acnes HL025PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes KPA171202 ............................................  253 2 hits [high GC Gram+]       thiamine pyrophosphate-requiring enzyme, putative acetolact
. Propionibacterium acnes HL013PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate-requiring enzyme, putative acetolact
. Propionibacterium acnes HL067PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate-requiring enzyme, putative acetolact
. Propionibacterium acnes HL037PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate-requiring enzyme, putative acetolact
. Propionibacterium acnes HL059PA2 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate-requiring enzyme, putative acetolact
. Propionibacterium acnes HL030PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate-requiring enzyme, putative acetolact
. Propionibacterium acnes HL030PA2 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate-requiring enzyme, putative acetolact
. Propionibacterium acnes HL074PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL083PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL007PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL086PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL045PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL096PA2 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL043PA2 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL099PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Bacillus subtilis subsp. natto BEST195 .......................................  253 1 hit  [firmicutes]          inositol utilization protein D [Bacillus subtilis subsp. na
. Propionibacterium acnes SK187 ................................................  253 2 hits [high GC Gram+]       thiamine pyrophosphate enzyme, C-terminal TPP binding domai
. Propionibacterium acnes HL110PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, C-terminal TPP binding domai
. Propionibacterium acnes HL082PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, C-terminal TPP binding domai
. Propionibacterium acnes HL092PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, C-terminal TPP binding domai
. Propionibacterium acnes HL087PA2 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL036PA2 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL005PA3 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL059PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL063PA2 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL005PA4 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL050PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL050PA3 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL027PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL002PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL046PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL087PA3 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL083PA2 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL087PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL110PA2 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL053PA2 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL046PA2 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL002PA2 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL002PA3 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes J165 .................................................  253 2 hits [high GC Gram+]       thiamine pyrophosphate enzyme, C-terminal TPP binding domai
. Propionibacterium acnes HL072PA2 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, C-terminal TPP binding domai
. Propionibacterium acnes HL063PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL072PA1 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Propionibacterium acnes HL096PA3 .............................................  253 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Delftia acidovorans SPH-1 ....................................................  253 2 hits [b-proteobacteria]    thiamine pyrophosphate protein central region [Delftia acid
. Anaerostipes caccae DSM 14662 ................................................  253 2 hits [firmicutes]          hypothetical protein ANACAC_03486 [Anaerostipes caccae DSM 
. Pseudomonas syringae pv. phaseolicola 1448A ..................................  253 2 hits [g-proteobacteria]    iolD protein [Pseudomonas syringae pv. phaseolicola 1448A] 
. Propionibacterium acnes HL097PA1 .............................................  253 1 hit  [high GC Gram+]       3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Propi
. Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1 ..................  252 2 hits [high GC Gram+]       iolD (Myo-inositol catabolism iolD protein) (acetolactate s
. Paenibacillus sp. JDR-2 ......................................................  252 2 hits [firmicutes]          thiamine pyrophosphate protein central region [Paenibacillu
. Dyadobacter fermentans DSM 18053 .............................................  251 2 hits [CFB group bacteria]  thiamine pyrophosphate protein central region [Dyadobacter 
. Epulopiscium sp. 'N.t. morphotype B' .........................................  251 1 hit  [firmicutes]          IolD protein [Epulopiscium sp. 'N.t. morphotype B']
. Erwinia pyrifoliae Ep1/96 ....................................................  251 2 hits [enterobacteria]      Myo-inositol catabolism protein, malonic semialdehyde oxida
. Erwinia pyrifoliae DSM 12163 .................................................  251 1 hit  [enterobacteria]      Myo-inositol catabolism protein, malonic semialdehyde oxida
. Listeria innocua FSL S4-378 ..................................................  251 1 hit  [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Liste
. Kribbella flavida DSM 17836 ..................................................  251 2 hits [high GC Gram+]       thiamine pyrophosphate protein central region [Kribbella fl
. Actinomyces sp. oral taxon 171 str. F0337 ....................................  251 2 hits [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Mycoplasma hyopneumoniae J ...................................................  250 2 hits [mycoplasmas]         myo-inositol catabolism protein [Mycoplasma hyopneumoniae J
. Mycoplasma hyopneumoniae 232 .................................................  250 2 hits [mycoplasmas]         myo-inositol catabolism protein [Mycoplasma hyopneumoniae 2
. Rhodococcus erythropolis PR4 .................................................  250 2 hits [high GC Gram+]       3D-(3,5/4)-trihydroxycyclohexane-1,2- dione hydrolase [Rhod
. Mycoplasma hyopneumoniae 168 .................................................  250 1 hit  [mycoplasmas]         Myo-inositol catabolism [Mycoplasma hyopneumoniae 168]
. Bacillus subtilis subsp. spizizenii ATCC 6633 ................................  250 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Bacil
. Bacillus subtilis subsp. spizizenii str. W23 .................................  250 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Bacil
. Conexibacter woesei DSM 14684 ................................................  250 2 hits [high GC Gram+]       thiamine pyrophosphate protein central region [Conexibacter
. Actinomyces sp. oral taxon 170 str. F0386 ....................................  250 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, central domain protein [Acti
. Mycoplasma hyopneumoniae 7448 ................................................  250 2 hits [mycoplasmas]         myo-inositol catabolism protein [Mycoplasma hyopneumoniae 7
. Listeria innocua Clip11262 ...................................................  250 2 hits [firmicutes]          hypothetical protein lin0404 [Listeria innocua Clip11262] >
. Listeria innocua .............................................................  250 1 hit  [firmicutes]          hypothetical protein lin0404 [Listeria innocua Clip11262] >
. Rhodococcus erythropolis SK121 ...............................................  249 2 hits [high GC Gram+]       putative malonic semialdehyde oxidative decarboxylase [Rhod
. Pseudomonas syringae pv. glycinea str. B076 ..................................  249 1 hit  [g-proteobacteria]    iolD protein [Pseudomonas syringae pv. glycinea str. B076] 
. Pseudomonas syringae pv. glycinea str. race 4 ................................  249 1 hit  [g-proteobacteria]    iolD protein [Pseudomonas syringae pv. glycinea str. B076] 
. Pseudomonas syringae pv. aesculi str. NCPPB3681 ..............................  249 1 hit  [g-proteobacteria]    iolD protein [Pseudomonas syringae pv. aesculi str. NCPPB36
. Pseudomonas syringae pv. aesculi str. 2250 ...................................  249 1 hit  [g-proteobacteria]    iolD protein [Pseudomonas syringae pv. aesculi str. NCPPB36
. Propionibacterium acnes HL025PA2 .............................................  249 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Bacillus cereus Rock4-2 ......................................................  249 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Bacil
. Pseudomonas savastanoi pv. savastanoi NCPPB 3335 .............................  249 2 hits [g-proteobacteria]    Epi-inositol hydrolase [Pseudomonas savastanoi pv. savastan
. Pseudomonas syringae pv. syringae B728a ......................................  249 2 hits [g-proteobacteria]    pyruvate decarboxylase:pyruvate decarboxylase [Pseudomonas 
. Pseudomonas syringae pv. tomato T1 ...........................................  249 2 hits [g-proteobacteria]    iolD protein [Pseudomonas syringae pv. tomato T1] >gi|30138
. Pseudomonas syringae pv. tomato Max13 ........................................  249 1 hit  [g-proteobacteria]    iolD protein [Pseudomonas syringae pv. tomato T1] >gi|30138
. Pseudomonas syringae pv. tomato K40 ..........................................  249 1 hit  [g-proteobacteria]    iolD protein [Pseudomonas syringae pv. tomato T1] >gi|30138
. Pseudomonas syringae pv. tomato NCPPB 1108 ...................................  249 1 hit  [g-proteobacteria]    iolD protein [Pseudomonas syringae pv. tomato T1] >gi|30138
. Actinomyces oris K20 .........................................................  249 1 hit  [high GC Gram+]       iolD (Myo-inositol catabolism iolD protein) (acetolactate s
. Pseudomonas syringae pv. tomato str. DC3000 ..................................  249 2 hits [g-proteobacteria]    iolD protein [Pseudomonas syringae pv. tomato str. DC3000] 
. Mycobacterium gilvum PYR-GCK .................................................  249 2 hits [high GC Gram+]       thiamine pyrophosphate enzyme, central region [Mycobacteriu
. Mycobacterium sp. Spyr1 ......................................................  249 2 hits [high GC Gram+]       thiamine pyrophosphate enzyme, central region [Mycobacteriu
. Enterococcus faecalis TX1346 .................................................  249 1 hit  [firmicutes]          thiamine pyrophosphate enzyme, TPP binding domain protein [
. Lactobacillus rhamnosus GG ...................................................  249 3 hits [firmicutes]          myo-inositol catabolism protein IolD [Lactobacillus rhamnos
. Dorea longicatena DSM 13814 ..................................................  249 2 hits [firmicutes]          hypothetical protein DORLON_00389 [Dorea longicatena DSM 13
. Lactobacillus rhamnosus HN001 ................................................  249 2 hits [firmicutes]          hypothetical protein LRH_12529 [Lactobacillus rhamnosus HN0
. Actinomyces viscosus C505 ....................................................  249 2 hits [high GC Gram+]       3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Actin
. Streptomyces avermitilis MA-4680 .............................................  248 4 hits [high GC Gram+]       IolD protein [Streptomyces avermitilis MA-4680] >gi|2961081
. Streptomyces ghanaensis ATCC 14672 ...........................................  248 3 hits [high GC Gram+]       acetolactate synthase [Streptomyces ghanaensis ATCC 14672] 
. Rubrobacter xylanophilus DSM 9941 ............................................  248 2 hits [high GC Gram+]       thiamine pyrophosphate enzyme, central region [Rubrobacter 
. Streptomyces griseoflavus Tu4000 .............................................  248 2 hits [high GC Gram+]       3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Strep
. Pseudomonas syringae pv. syringae 642 ........................................  248 1 hit  [g-proteobacteria]    pyruvate decarboxylase:pyruvate decarboxylase [Pseudomonas 
. Streptomyces ambofaciens ATCC 23877 ..........................................  248 1 hit  [high GC Gram+]       putative acetolactate synthase [Streptomyces ambofaciens AT
. Streptomyces clavuligerus ATCC 27064 .........................................  248 5 hits [high GC Gram+]       putative IolD protein [Streptomyces clavuligerus ATCC 27064
. Lactobacillus rhamnosus MTCC 5462 ............................................  248 1 hit  [firmicutes]          myo-inositol catabolism protein IolD [Lactobacillus rhamnos
. Lactobacillus paracasei subsp. paracasei 8700:2 ..............................  248 2 hits [firmicutes]          conserved hypothetical protein [Lactobacillus paracasei sub
. Lactobacillus casei str. Zhang ...............................................  248 2 hits [firmicutes]          conserved hypothetical protein [Lactobacillus paracasei sub
. Lactobacillus casei ..........................................................  248 5 hits [firmicutes]          conserved hypothetical protein [Lactobacillus paracasei sub
. Lactobacillus casei BL23 .....................................................  248 3 hits [firmicutes]          IolD [Lactobacillus casei BL23] >gi|145309088|gb|ABP57765.1
. Lactobacillus casei LC2W .....................................................  248 1 hit  [firmicutes]          IolD [Lactobacillus casei BL23] >gi|145309088|gb|ABP57765.1
. Lactobacillus casei BD-II ....................................................  248 1 hit  [firmicutes]          IolD [Lactobacillus casei BL23] >gi|145309088|gb|ABP57765.1
. Streptomyces coelicolor A3(2) ................................................  248 2 hits [high GC Gram+]       acetolactate synthase [Streptomyces coelicolor A3(2)] >gi|2
. Paenibacillus sp. Y412MC10 ...................................................  248 2 hits [firmicutes]          thiamine pyrophosphate protein central region [Paenibacillu
. Yersinia pestis biovar Orientalis str. MG05-1020 .............................  247 2 hits [enterobacteria]      thiamine pyrophosphate-dependent enzyme [Yersinia pestis bi
. Streptomyces cf. griseus XylebKG-1 ...........................................  247 2 hits [high GC Gram+]       Acetolactate synthase [Streptomyces cf. griseus XylebKG-1] 
. Streptomyces griseus subsp. griseus NBRC 13350 ...............................  247 2 hits [high GC Gram+]       putative IolD protein [Streptomyces griseus subsp. griseus 
. Lactobacillus rhamnosus Lc 705 ...............................................  247 2 hits [firmicutes]          myo-inositol catabolism protein IolD [Lactobacillus rhamnos
. Enterococcus faecalis DS5 ....................................................  247 2 hits [firmicutes]          malonic semialdehyde oxidative decarboxylase [Enterococcus 
. Enterococcus faecalis TUSoD Ef11 .............................................  247 2 hits [firmicutes]          malonic semialdehyde oxidative decarboxylase [Enterococcus 
. Enterococcus faecalis TX0027 .................................................  247 1 hit  [firmicutes]          malonic semialdehyde oxidative decarboxylase [Enterococcus 
. Enterococcus faecalis T3 .....................................................  247 2 hits [firmicutes]          thiamine-pyrophosphate-requiring enzyme [Enterococcus faeca
. Lactobacillus rhamnosus LMS2-1 ...............................................  247 2 hits [firmicutes]          acetolactate synthase [Lactobacillus rhamnosus LMS2-1] >gi|
. Enterococcus faecalis T8 .....................................................  247 2 hits [firmicutes]          myo-inositol catabolism protein IolD [Enterococcus faecalis
. Enterococcus faecalis TX0411 .................................................  247 2 hits [firmicutes]          myo-inositol catabolism protein IolD [Enterococcus faecalis
. Enterococcus faecalis TX4000 .................................................  247 1 hit  [firmicutes]          myo-inositol catabolism protein IolD [Enterococcus faecalis
. Streptomyces roseosporus NRRL 15998 ..........................................  247 3 hits [high GC Gram+]       putative IolD protein [Streptomyces roseosporus NRRL 15998]
. Streptomyces roseosporus NRRL 11379 ..........................................  247 1 hit  [high GC Gram+]       putative IolD protein [Streptomyces roseosporus NRRL 15998]
. Enterococcus faecalis HIP11704 ...............................................  247 2 hits [firmicutes]          thiamine-pyrophosphate-requiring enzyme [Enterococcus faeca
. Enterococcus faecalis TX0855 .................................................  247 2 hits [firmicutes]          thiamine-pyrophosphate-requiring enzyme [Enterococcus faeca
. Enterococcus faecalis T11 ....................................................  247 2 hits [firmicutes]          thiamine-pyrophosphate-requiring enzyme [Enterococcus faeca
. Enterococcus faecalis JH1 ....................................................  246 2 hits [firmicutes]          thiamine-pyrophosphate-requiring enzyme [Enterococcus faeca
. Enterococcus faecalis PC1.1 ..................................................  246 2 hits [firmicutes]          thiamine-pyrophosphate-requiring enzyme [Enterococcus faeca
. Enterococcus faecalis TX4248 .................................................  246 2 hits [firmicutes]          thiamine-pyrophosphate-requiring enzyme [Enterococcus faeca
. Enterococcus faecalis TX1342 .................................................  246 1 hit  [firmicutes]          thiamine pyrophosphate enzyme, TPP binding domain protein [
. Streptomyces sviceus ATCC 29083 ..............................................  246 4 hits [high GC Gram+]       acetolactate synthase [Streptomyces sviceus ATCC 29083] >gi
. Burkholderia cenocepacia J2315 ...............................................  246 2 hits [b-proteobacteria]    putative TPP-binding acetolactate synthase [Burkholderia ce
. Burkholderia gladioli BSR3 ...................................................  246 1 hit  [b-proteobacteria]    IolD protein [Burkholderia gladioli BSR3]
. Enterococcus faecalis TX0109 .................................................  246 2 hits [firmicutes]          thiamine pyrophosphate enzyme, TPP binding domain protein [
. Enterococcus faecalis TX1302 .................................................  246 1 hit  [firmicutes]          thiamine pyrophosphate enzyme, TPP binding domain protein [
. Enterococcus faecalis ATCC 29200 .............................................  246 2 hits [firmicutes]          acetolactate synthase [Enterococcus faecalis ATCC 29200] >g
. Enterococcus faecalis T1 .....................................................  246 2 hits [firmicutes]          acetolactate synthase [Enterococcus faecalis ATCC 29200] >g
. Enterococcus faecalis D6 .....................................................  246 2 hits [firmicutes]          acetolactate synthase [Enterococcus faecalis ATCC 29200] >g
. Enterococcus faecalis TX0102 .................................................  246 2 hits [firmicutes]          acetolactate synthase [Enterococcus faecalis ATCC 29200] >g
. Enterococcus faecalis TX2137 .................................................  246 1 hit  [firmicutes]          acetolactate synthase [Enterococcus faecalis ATCC 29200] >g
. Enterococcus faecalis TX4244 .................................................  246 1 hit  [firmicutes]          acetolactate synthase [Enterococcus faecalis ATCC 29200] >g
. Enterococcus faecalis TX0031 .................................................  246 1 hit  [firmicutes]          acetolactate synthase [Enterococcus faecalis ATCC 29200] >g
. Enterococcus faecalis TX0312 .................................................  246 1 hit  [firmicutes]          acetolactate synthase [Enterococcus faecalis ATCC 29200] >g
. Burkholderia sp. 383 .........................................................  246 2 hits [b-proteobacteria]    acetolactate synthase [Burkholderia sp. 383] >gi|77966782|g
. Enterococcus faecalis TX1322 .................................................  246 2 hits [firmicutes]          acetolactate synthase [Enterococcus faecalis TX1322] >gi|22
. Enterococcus faecalis OG1RF ..................................................  246 2 hits [firmicutes]          myo-inositol catabolism protein IolD [Enterococcus faecalis
. Enterococcus faecalis ARO1/DG ................................................  246 2 hits [firmicutes]          malonic semialdehyde oxidative decarboxylase [Enterococcus 
. Burkholderia sp. TJI49 .......................................................  246 1 hit  [b-proteobacteria]    thiamine pyrophosphate protein central region [Burkholderia
. Enterococcus faecalis CH188 ..................................................  246 2 hits [firmicutes]          malonic semialdehyde oxidative decarboxylase [Enterococcus 
. Enterococcus faecalis TX0635 .................................................  246 2 hits [firmicutes]          malonic semialdehyde oxidative decarboxylase [Enterococcus 
. Enterococcus faecalis TX0630 .................................................  246 1 hit  [firmicutes]          malonic semialdehyde oxidative decarboxylase [Enterococcus 
. Streptomyces bingchenggensis BCW-1 ...........................................  246 2 hits [high GC Gram+]       thiamine pyrophosphate protein central region [Streptomyces
. Pseudomonas syringae pv. syringae FF5 ........................................  246 1 hit  [g-proteobacteria]    pyruvate decarboxylase:pyruvate decarboxylase [Pseudomonas 
. Ruminococcus sp. SR1/5 .......................................................  245 1 hit  [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Rumin
. Clostridium botulinum D str. 1873 ............................................  245 2 hits [firmicutes]          probable malonic semialdehyde oxidative decarboxylase [Clos
. Burkholderia cenocepacia AU 1054 .............................................  245 2 hits [b-proteobacteria]    thiamine pyrophosphate enzyme-like TPP-binding [Burkholderi
. Burkholderia cenocepacia HI2424 ..............................................  245 2 hits [b-proteobacteria]    thiamine pyrophosphate enzyme-like TPP-binding [Burkholderi
. Photorhabdus luminescens subsp. laumondii TTO1 ...............................  245 2 hits [enterobacteria]      hypothetical protein plu1805 [Photorhabdus luminescens subs
. Gordonia bronchialis DSM 43247 ...............................................  245 2 hits [high GC Gram+]       thiamine pyrophosphate protein central region [Gordonia bro
. Bacillus amyloliquefaciens FZB42 .............................................  245 3 hits [firmicutes]          IolD [Bacillus amyloliquefaciens FZB42] >gi|209572908|sp|A7
. Yersinia pseudotuberculosis YPIII ............................................  245 2 hits [enterobacteria]      thiamine pyrophosphate binding domain-containing protein [Y
. Truepera radiovictrix DSM 17093 ..............................................  244 2 hits [bacteria]            thiamine pyrophosphate protein central region [Truepera rad
. Yersinia pestis biovar Microtus str. 91001 ...................................  244 2 hits [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Yersinia pseudotuberculosis IP 32953 .........................................  244 2 hits [enterobacteria]      thiamine pyrophosphate-dependent protein [Yersinia pseudotu
. Yersinia pseudotuberculosis PB1/+ ............................................  244 2 hits [enterobacteria]      thiamine pyrophosphate-dependent protein [Yersinia pseudotu
. Yersinia pseudotuberculosis IP 31758 .........................................  244 2 hits [enterobacteria]      thiamine pyrophosphate-dependent enzyme [Yersinia pseudotub
. Yersinia pestis Antiqua ......................................................  244 2 hits [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Yersinia pestis Nepal516 .....................................................  244 4 hits [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Yersinia pestis CA88-4125 ....................................................  244 2 hits [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Yersinia pestis Angola .......................................................  244 2 hits [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Yersinia pestis biovar Orientalis str. F1991016 ..............................  244 2 hits [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Yersinia pestis biovar Orientalis str. IP275 .................................  244 2 hits [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Yersinia pestis biovar Antiqua str. E1979001 .................................  244 2 hits [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Yersinia pestis biovar Antiqua str. B42003004 ................................  244 2 hits [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Yersinia pestis biovar Mediaevalis str. K1973002 .............................  244 2 hits [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Yersinia pestis FV-1 .........................................................  244 1 hit  [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Yersinia pestis CO92 .........................................................  244 2 hits [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Yersinia pestis biovar Orientalis str. PEXU2 .................................  244 2 hits [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Yersinia pestis Pestoides A ..................................................  244 2 hits [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Yersinia pestis biovar Orientalis str. India 195 .............................  244 2 hits [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Yersinia pestis KIM D27 ......................................................  244 2 hits [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Yersinia pestis Z176003 ......................................................  244 2 hits [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Yersinia pestis D106004 ......................................................  244 1 hit  [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Yersinia pestis D182038 ......................................................  244 1 hit  [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Yersinia pestis biovar Antiqua str. UG05-0454 ................................  244 2 hits [enterobacteria]      thiamine pyrophosphate-dependent enzyme [Yersinia pestis bi
. Yersinia pestis Pestoides F ..................................................  244 2 hits [enterobacteria]      aldehyde dehydrogenase [Yersinia pestis Pestoides F] >gi|14
. Oribacterium sp. oral taxon 078 str. F0262 ...................................  244 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Oriba
. Yersinia pestis biovar Medievalis str. Harbin 35 .............................  244 1 hit  [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Yersinia pestis KIM 10 .......................................................  244 2 hits [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Yersinia pest
. Actinomyces urogenitalis DSM 15434 ...........................................  244 2 hits [high GC Gram+]       acetolactate synthase [Actinomyces urogenitalis DSM 15434] 
. Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 .......................  244 1 hit  [enterobacteria]      hypothetical protein PAU_02710 [Photorhabdus asymbiotica su
. Photorhabdus asymbiotica .....................................................  244 1 hit  [enterobacteria]      hypothetical protein PAU_02710 [Photorhabdus asymbiotica su
. Clostridium beijerinckii NCIMB 8052 ..........................................  244 2 hits [firmicutes]          thiamine pyrophosphate protein, central region [Clostridium
. Burkholderia ambifaria AMMD ..................................................  244 2 hits [b-proteobacteria]    thiamine pyrophosphate binding domain-containing protein [B
. Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ............................  244 2 hits [enterobacteria]      putative acetolactate synthase large subunit [Klebsiella pn
. Klebsiella pneumoniae 342 ....................................................  244 2 hits [enterobacteria]      putative acetolactate synthase large subunit [Klebsiella pn
. Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 ...........................  244 2 hits [enterobacteria]      putative acetolactate synthase large subunit [Klebsiella pn
. Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 .....................  244 2 hits [enterobacteria]      putative acetolactate synthase large subunit [Klebsiella pn
. Klebsiella sp. MS 92-3 .......................................................  244 1 hit  [enterobacteria]      putative acetolactate synthase large subunit [Klebsiella pn
. Bacillus halodurans C-125 ....................................................  244 2 hits [firmicutes]          malonic semialdehyde oxidative decarboxylase [Bacillus halo
. Bacillus halodurans ..........................................................  244 1 hit  [firmicutes]          malonic semialdehyde oxidative decarboxylase [Bacillus halo
. Klebsiella variicola At-22 ...................................................  244 2 hits [enterobacteria]      thiamine pyrophosphate protein central region [Klebsiella v
. Klebsiella sp. 1_1_55 ........................................................  244 2 hits [enterobacteria]      thiamine pyrophosphate protein central region [Klebsiella v
. Burkholderia cenocepacia MC0-3 ...............................................  244 2 hits [b-proteobacteria]    thiamine pyrophosphate protein central region [Burkholderia
. Enterococcus faecalis E1Sol ..................................................  244 2 hits [firmicutes]          thiamine-pyrophosphate-requiring enzyme [Enterococcus faeca
. Geodermatophilus obscurus DSM 43160 ..........................................  244 2 hits [high GC Gram+]       thiamine pyrophosphate protein central region [Geodermatoph
. Acidothermus cellulolyticus 11B ..............................................  244 2 hits [high GC Gram+]       thiamine pyrophosphate binding domain-containing protein [A
. Haemophilus somnus 2336 ......................................................  244 2 hits [g-proteobacteria]    thiamine pyrophosphate protein central region [Haemophilus 
. Legionella pneumophila str. Lens .............................................  244 2 hits [g-proteobacteria]    hypothetical protein lpl1616 [Legionella pneumophila str. L
. Streptomyces scabiei 87.22 ...................................................  243 4 hits [high GC Gram+]       amino acid synthase [Streptomyces scabiei 87.22] >gi|260645
. Enterococcus faecium 1,231,502 ...............................................  243 2 hits [firmicutes]          thiamine-pyrophosphate enzyme [Enterococcus faecium 1,231,5
. Burkholderia ambifaria MEX-5 .................................................  243 2 hits [b-proteobacteria]    thiamine pyrophosphate protein central region [Burkholderia
. Legionella pneumophila str. Paris ............................................  243 2 hits [g-proteobacteria]    hypothetical protein lpp1621 [Legionella pneumophila str. P
. Legionella pneumophila str. Corby ............................................  243 2 hits [g-proteobacteria]    myo-inositol catabolism protein IolD [Legionella pneumophil
. Legionella pneumophila 2300/99 Alcoy .........................................  243 2 hits [g-proteobacteria]    myo-inositol catabolism protein IolD [Legionella pneumophil
. Alicyclobacillus acidocaldarius LAA1 .........................................  243 2 hits [firmicutes]          thiamine pyrophosphate protein domain protein TPP-binding [
. Streptomyces sp. AA4 .........................................................  243 2 hits [high GC Gram+]       glyoxylate carboligase [Streptomyces sp. AA4] >gi|302435369
. Clostridium sp. D5 ...........................................................  243 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Clost
. Mobiluncus mulieris ATCC 35243 ...............................................  243 2 hits [high GC Gram+]       acetolactate synthase [Mobiluncus mulieris ATCC 35243] >gi|
. Mobiluncus mulieris 28-1 .....................................................  243 2 hits [high GC Gram+]       acetolactate synthase [Mobiluncus mulieris ATCC 35243] >gi|
. Mobiluncus mulieris FB024-16 .................................................  243 2 hits [high GC Gram+]       putative 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrola
. Legionella pneumophila 130b ..................................................  243 1 hit  [g-proteobacteria]    hypothetical protein LPW_16771 [Legionella pneumophila 130b]
. Pectobacterium atrosepticum SCRI1043 .........................................  243 2 hits [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Pectobac
. Burkholderia ambifaria IOP40-10 ..............................................  243 2 hits [b-proteobacteria]    thiamine pyrophosphate protein central region [Burkholderia
. Arthrobacter chlorophenolicus A6 .............................................  243 4 hits [high GC Gram+]       thiamine pyrophosphate protein central region [Arthrobacter
. Xenopus (Silurana) tropicalis ................................................  243 1 hit  [frogs & toads]       PREDICTED: 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydro
. Bacillus amyloliquefaciens TA208 .............................................  243 1 hit  [firmicutes]          IolD [Bacillus amyloliquefaciens TA208]
. Pectobacterium carotovorum subsp. brasiliensis PBR1692 .......................  243 1 hit  [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Pectobac
. Legionella pneumophila subsp. pneumophila str. Philadelphia 1 ................  243 2 hits [g-proteobacteria]    myo-inositol catabolism protein IolD [Legionella pneumophil
. Treponema phagedenis F0421 ...................................................  243 2 hits [spirochetes]         thiamine pyrophosphate enzyme, TPP binding domain protein [
. Paenibacillus sp. oral taxon 786 str. D14 ....................................  243 2 hits [firmicutes]          pyruvate decarboxylase:pyruvate decarboxylase [Paenibacillu
. Arthrobacter aurescens TC1 ...................................................  242 2 hits [high GC Gram+]       putative acetolactate synthase [Arthrobacter aurescens TC1]
. Mobiluncus mulieris ATCC 35239 ...............................................  242 2 hits [high GC Gram+]       3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Mobil
. Streptomyces lividans TK24 ...................................................  242 3 hits [high GC Gram+]       acetolactate synthase [Streptomyces lividans TK24] >gi|2897
. Burkholderia dolosa AUO158 ...................................................  242 2 hits [b-proteobacteria]    Acetolactate synthase [Burkholderia dolosa AUO158] >gi|1248
. Haemophilus somnus 129PT .....................................................  242 2 hits [g-proteobacteria]    myo-inositol catabolism protein [Haemophilus somnus 129PT] 
. Arcanobacterium haemolyticum DSM 20595 .......................................  242 2 hits [high GC Gram+]       thiamine pyrophosphate protein central region [Arcanobacter
. Saccharopolyspora erythraea NRRL 2338 ........................................  242 3 hits [high GC Gram+]       thiamine pyrophosphate-requiring enzyme [Saccharopolyspora 
. Streptomyces pristinaespiralis ATCC 25486 ....................................  242 2 hits [high GC Gram+]       IolD protein [Streptomyces pristinaespiralis ATCC 25486] >g
. Dickeya dadantii 3937 ........................................................  241 2 hits [enterobacteria]      Epi-inositol hydrolase [Dickeya dadantii 3937] >gi|30652704
. Pectobacterium wasabiae WPP163 ...............................................  241 2 hits [enterobacteria]      thiamine pyrophosphate protein domain protein TPP-binding p
. Clostridium botulinum C str. Eklund ..........................................  241 2 hits [firmicutes]          probable malonic semialdehyde oxidative decarboxylase [Clos
. Citrobacter koseri ATCC BAA-895 ..............................................  241 2 hits [enterobacteria]      hypothetical protein CKO_03993 [Citrobacter koseri ATCC BAA
. Mycobacterium smegmatis str. MC2 155 .........................................  241 2 hits [high GC Gram+]       IolD protein [Mycobacterium smegmatis str. MC2 155] >gi|118
. Burkholderia multivorans ATCC 17616 ..........................................  241 4 hits [b-proteobacteria]    myo-inositol catabolism protein [Burkholderia multivorans A
. Burkholderia glumae BGR1 .....................................................  241 2 hits [b-proteobacteria]    IolD protein [Burkholderia glumae BGR1] >gi|237876975|gb|AC
. Lysinibacillus fusiformis ZC1 ................................................  240 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Lysin
. Clostridium botulinum E3 str. Alaska E43 .....................................  240 3 hits [firmicutes]          probable malonic semialdehyde oxidative decarboxylase [Clos
. Bacillus atrophaeus 1942 .....................................................  240 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Bacil
. Escherichia coli ED1a ........................................................  240 2 hits [enterobacteria]      putative malonic semialdehyde oxidative decarboxylase (iolD
. Salmonella enterica subsp. enterica serovar Virchow str. SL491 ...............  240 2 hits [enterobacteria]      probable malonic semialdehyde oxidative decarboxylase [Salm
. Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29 ............  240 2 hits [enterobacteria]      probable malonic semialdehyde oxidative decarboxylase [Salm
. Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066 .............  240 2 hits [enterobacteria]      probable malonic semialdehyde oxidative decarboxylase [Salm
. Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23 ............  240 2 hits [enterobacteria]      probable malonic semialdehyde oxidative decarboxylase [Salm
. Salmonella enterica subsp. enterica serovar Typhimurium str. D23580 ..........  240 1 hit  [enterobacteria]      probable malonic semialdehyde oxidative decarboxylase [Salm
. Salmonella enterica subsp. enterica serovar Typhimurium str. T000240 .........  240 1 hit  [enterobacteria]      probable malonic semialdehyde oxidative decarboxylase [Salm
. Salmonella enterica subsp. enterica serovar Typhimurium str. TN061786 ........  240 1 hit  [enterobacteria]      probable malonic semialdehyde oxidative decarboxylase [Salm
. Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191 ........  240 1 hit  [enterobacteria]      probable malonic semialdehyde oxidative decarboxylase [Salm
. Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1 ..  240 1 hit  [enterobacteria]      probable malonic semialdehyde oxidative decarboxylase [Salm
. Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701 .......  240 2 hits [enterobacteria]      probable malonic semialdehyde oxidative decarboxylase [Salm
. Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 ..........  240 1 hit  [enterobacteria]      probable malonic semialdehyde oxidative decarboxylase [Salm
. Salmonella enterica subsp. enterica serovar Typhimurium str. 4/74 ............  240 1 hit  [enterobacteria]      probable malonic semialdehyde oxidative decarboxylase [Salm
. Salmonella enterica subsp. enterica serovar Montevideo str. 315996572 ........  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. 495297-1 .........  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. 495297-3 .........  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. 495297-4 .........  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. 515920-1 .........  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. 515920-2 .........  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. NC_MB110209-0054 .  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. OH_2009072675 ....  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. CASC_09SCPH15965 .  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. 19N ..............  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. 81038-01 .........  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. MD_MDA09249507 ...  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. 414877 ...........  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. 366867 ...........  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. 413180 ...........  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. 446600 ...........  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. 609458-1 .........  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. 556150-1 .........  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. 609460 ...........  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. 507440-20 ........  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. 556152 ...........  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. MB101509-0077 ....  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. MB102109-0047 ....  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. MB110209-0055 ....  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. MB111609-0052 ....  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. 2009083312 .......  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. 2009085258 .......  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. 315731156 ........  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. IA_2009159199 ....  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008282 ....  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008283 ....  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008284 ....  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008285 ....  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008287 ....  240 1 hit  [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Salmonella en
. Salmonella enterica subsp. enterica serovar Agona str. SL483 .................  240 2 hits [enterobacteria]      putative malonic semialdehyde oxidative decarboxylase [Salm
. Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537 ......  240 2 hits [enterobacteria]      probable malonic semialdehyde oxidative decarboxylase [Salm
. Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 .............  239 1 hit  [enterobacteria]      putative thiamine pyrophosphate-requiring enzyme [Salmonell
. Enterococcus faecium E1679 ...................................................  239 2 hits [firmicutes]          probable malonic semialdehyde oxidative decarboxylase [Ente
. Providencia stuartii ATCC 25827 ..............................................  239 2 hits [enterobacteria]      hypothetical protein PROSTU_03485 [Providencia stuartii ATC
. Streptomyces sp. ACTE ........................................................  239 2 hits [high GC Gram+]       thiamine pyrophosphate protein domain protein TPP-binding [
. Propionibacterium acnes HL078PA1 .............................................  239 1 hit  [high GC Gram+]       thiamine pyrophosphate enzyme, TPP binding domain protein [
. Stackebrandtia nassauensis DSM 44728 .........................................  239 2 hits [high GC Gram+]       thiamine pyrophosphate protein central region [Stackebrandt
. Burkholderia ubonensis Bu ....................................................  238 1 hit  [b-proteobacteria]    thiamine pyrophosphate enzyme domain protein TPP-binding [B
. Mitsuokella multacida DSM 20544 ..............................................  238 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Mitsu
. Verminephrobacter eiseniae EF01-2 ............................................  238 2 hits [b-proteobacteria]    thiamine pyrophosphate-binding domain-containing protein [V
. Pectobacterium carotovorum subsp. carotovorum PC1 ............................  238 2 hits [enterobacteria]      thiamine pyrophosphate protein domain protein TPP-binding [
. Actinomyces odontolyticus ATCC 17982 .........................................  238 2 hits [high GC Gram+]       hypothetical protein ACTODO_02072 [Actinomyces odontolyticu
. Burkholderia multivorans CGD1 ................................................  238 2 hits [b-proteobacteria]    probable malonic semialdehyde oxidative decarboxylase [Burk
. Citrobacter youngae ATCC 29220 ...............................................  238 2 hits [enterobacteria]      3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Citro
. Burkholderia vietnamiensis G4 ................................................  238 2 hits [b-proteobacteria]    thiamine pyrophosphate enzyme, central region [Burkholderia
. Yersinia enterocolitica subsp. enterocolitica 8081 ...........................  238 2 hits [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Cronobacter turicensis z3032 .................................................  238 2 hits [enterobacteria]      3D-(3,5/4)-trihydroxycyclohexane-1,2-dionehydrolase [Cronob
. Pantoea ananatis LMG 20103 ...................................................  237 2 hits [enterobacteria]      IolD [Pantoea ananatis LMG 20103] >gi|291154318|gb|ADD78902
. Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ............  237 2 hits [enterobacteria]      hypothetical protein SPAB_05579 [Salmonella enterica subsp.
. Dickeya zeae Ech1591 .........................................................  237 2 hits [enterobacteria]      thiamine pyrophosphate protein domain-containing protein TP
. Citrobacter sp. 30_2 .........................................................  237 2 hits [enterobacteria]      thiamine pyrophosphate-dependent enzyme [Citrobacter sp. 30
. Dickeya dadantii Ech586 ......................................................  237 2 hits [enterobacteria]      thiamine pyrophosphate protein domain-containing protein TP
. Yersinia enterocolitica subsp. palearctica 105.5R(r) .........................  237 1 hit  [enterobacteria]      putative thiamine pyrophosphate-dependent protein [Yersinia
. Yersinia enterocolitica subsp. palearctica Y11 ...............................  237 1 hit  [enterobacteria]      epi-inositol hydrolase [Yersinia enterocolitica subsp. pale
. Kineococcus radiotolerans SRS30216 ...........................................  236 2 hits [high GC Gram+]       thiamine pyrophosphate protein central region [Kineococcus 
. Thermobispora bispora DSM 43833 ..............................................  236 2 hits [high GC Gram+]       thiamine pyrophosphate protein central region [Thermobispor
. Legionella longbeachae D-4968 ................................................  236 2 hits [g-proteobacteria]    myo-inositol catabolism protein IolD [Legionella longbeacha
. Legionella longbeachae NSW150 ................................................  236 2 hits [g-proteobacteria]    myo-inositol catabolism protein IolD [Legionella longbeacha
. Bacillus amyloliquefaciens DSM 7 .............................................  236 2 hits [firmicutes]          IolD [Bacillus amyloliquefaciens DSM 7] >gi|307608540|emb|C
. Serratia odorifera DSM 4582 ..................................................  236 2 hits [enterobacteria]      3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Serra
. Aggregatibacter actinomycetemcomitans D7S-1 ..................................  236 2 hits [g-proteobacteria]    probable malonic semialdehyde oxidative decarboxylase [Aggr
. Yersinia kristensenii ATCC 33638 .............................................  236 4 hits [enterobacteria]      3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Yersi
. Yersinia frederiksenii ATCC 33641 ............................................  236 2 hits [enterobacteria]      3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Yersi
. Clavibacter michiganensis subsp. michiganensis NCPPB 382 .....................  236 2 hits [high GC Gram+]       putative acetolactate synthase [Clavibacter michiganensis s
. Streptomyces sp. SPB78 .......................................................  235 2 hits [high GC Gram+]       IolD protein [Streptomyces sp. SPB78] >gi|302428083|gb|EFK9
. Streptomyces sp. SA3_actG ....................................................  235 1 hit  [high GC Gram+]       putative IolD protein [Streptomyces sp. SA3_actG] >gi|31807
. Streptomyces sp. SA3_actF ....................................................  235 1 hit  [high GC Gram+]       putative IolD protein [Streptomyces sp. SA3_actG] >gi|31807
. Haemophilus parainfluenzae T3T1 ..............................................  235 1 hit  [g-proteobacteria]    unnamed protein product [Haemophilus parainfluenzae T3T1]
. Catenulispora acidiphila DSM 44928 ...........................................  235 2 hits [high GC Gram+]       thiamine pyrophosphate protein central region [Catenulispor
. Yersinia rohdei ATCC 43380 ...................................................  235 2 hits [enterobacteria]      3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Yersi
. Pantoea sp. aB ...............................................................  235 2 hits [enterobacteria]      thiamine pyrophosphate protein domain protein TPP-binding [
. Escherichia coli MS 182-1 ....................................................  235 2 hits [enterobacteria]      thiamine pyrophosphate enzyme, TPP binding domain protein [
. Aggregatibacter aphrophilus NJ8700 ...........................................  235 2 hits [g-proteobacteria]    putative malonic semialdehyde oxidative decarboxylase [Aggr
. Escherichia coli MS 84-1 .....................................................  234 2 hits [enterobacteria]      thiamine pyrophosphate enzyme, TPP binding domain protein [
. Escherichia coli MS 124-1 ....................................................  234 2 hits [enterobacteria]      thiamine pyrophosphate enzyme, TPP binding domain protein [
. Escherichia coli MS 85-1 .....................................................  234 1 hit  [enterobacteria]      thiamine pyrophosphate enzyme, TPP binding domain protein [
. Paenibacillus larvae subsp. larvae B-3650 ....................................  234 2 hits [firmicutes]          3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase-like p
. Escherichia coli TA271 .......................................................  234 1 hit  [enterobacteria]      3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Esche
. Pantoea vagans C9-1 ..........................................................  234 2 hits [enterobacteria]      malonic semialdehyde oxidative decarboxylase [Pantoea vagan
. Actinomyces odontolyticus F0309 ..............................................  234 2 hits [high GC Gram+]       3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Actin
. Paenibacillus larvae subsp. larvae BRL-230010 ................................  234 1 hit  [firmicutes]          myo-inositol catabolism protein (thiamine pyrophosphate-req
. Nakamurella multipartita DSM 44233 ...........................................  234 2 hits [high GC Gram+]       thiamine pyrophosphate protein central region [Nakamurella 
. Yersinia mollaretii ATCC 43969 ...............................................  234 2 hits [enterobacteria]      3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Yersi
. Corynebacterium ammoniagenes DSM 20306 .......................................  234 2 hits [high GC Gram+]       thiamine pyrophosphate-dependent enzyme IolD [Corynebacteri
. Streptomyces sp. SPB74 .......................................................  233 2 hits [high GC Gram+]       3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Strep
. Yersinia intermedia ATCC 29909 ...............................................  233 2 hits [enterobacteria]      3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Yersi
. Clostridium botulinum B str. Eklund 17B ......................................  233 3 hits [firmicutes]          probable malonic semialdehyde oxidative decarboxylase [Clos
. Streptomyces albus J1074 .....................................................  233 3 hits [high GC Gram+]       putative IolD protein [Streptomyces albus J1074] >gi|291451
. Rhizobium etli IE4771 ........................................................  233 1 hit  [a-proteobacteria]    acetolactate synthase protein (myo-inositol catabolism) [Rh
. Edwardsiella ictaluri 93-146 .................................................  231 2 hits [enterobacteria]      putative malonic semialdehyde oxidative decarboxylase [Edwa
. Streptomyces himastatinicus ATCC 53653 .......................................  231 2 hits [high GC Gram+]       3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Strep
. Beutenbergia cavernae DSM 12333 ..............................................  231 2 hits [high GC Gram+]       thiamine pyrophosphate protein central region [Beutenbergia
. Serratia proteamaculans 568 ..................................................  231 2 hits [enterobacteria]      thiamine pyrophosphate protein central region [Serratia pro
. Corynebacterium glutamicum ATCC 13032 ........................................  231 4 hits [high GC Gram+]       Thiamine pyrophosphate-requiring enzymes [acetolactate synt
. Corynebacterium glutamicum R .................................................  231 2 hits [high GC Gram+]       hypothetical protein cgR_0241 [Corynebacterium glutamicum R
. Yersinia aldovae ATCC 35236 ..................................................  231 2 hits [enterobacteria]      3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Yersi
. Janibacter sp. HTCC2649 ......................................................  230 2 hits [high GC Gram+]       putative IolD protein [Janibacter sp. HTCC2649] >gi|8438216
. Burkholderia pseudomallei 7894 ...............................................  229 1 hit  [b-proteobacteria]    iolD protein [Burkholderia pseudomallei 7894]
. Enterobacter cloacae SCF1 ....................................................  229 2 hits [enterobacteria]      thiamine pyrophosphate central domain-containing protein [E
. Actinomyces sp. oral taxon 178 str. F0338 ....................................  229 2 hits [high GC Gram+]       acetolactate synthase [Actinomyces sp. oral taxon 178 str. 
. Mycobacterium vanbaalenii PYR-1 ..............................................  229 2 hits [high GC Gram+]       thiamine pyrophosphate binding domain-containing protein [M
. Pseudomonas fluorescens Pf-5 .................................................  229 2 hits [g-proteobacteria]    iolD protein [Pseudomonas fluorescens Pf-5] >gi|68344257|gb
. Enterobacter cloacae subsp. cloacae ATCC 13047 ...............................  229 2 hits [enterobacteria]      3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [Enter
. Azotobacter vinelandii DJ ....................................................  228 2 hits [g-proteobacteria]    myo-inositol catabolism protein IolD [Azotobacter vinelandi
. Arthrobacter phenanthrenivorans Sphe3 ........................................  228 2 hits [high GC Gram+]       acetolactate synthase [Arthrobacter phenanthrenivorans Sphe

------------------------------------------------------------------------------------------------------------------------

2) BLASTp versus SwissProt

cellular organisms
. Bacteria           [bacteria]
. . Firmicutes         [firmicutes]
. . . Bacilli            [firmicutes]
. . . . Bacillales         [firmicutes]
. . . . . Bacillaceae        [firmicutes]
. . . . . . Geobacillus        [firmicutes]
. . . . . . . Geobacillus kaustophilus ----------------------  283 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . . . . . Geobacillus thermodenitrificans NG80-2 ........  266 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . . . . Bacillus cereus E33L ----------------------------  273 2 hits [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . . . . Bacillus cereus AH820 ...........................  273 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . . . . Bacillus thuringiensis serovar konkukian ........  273 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . . . . Bacillus anthracis (anthrax) ....................  273 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . . . . Bacillus anthracis str. A0248 ...................  273 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . . . . Bacillus anthracis str. CDC 684 .................  273 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . . . . Bacillus thuringiensis str. Al Hakam ............  270 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . . . . Bacillus cereus 03BB102 .........................  270 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . . . . Bacillus clausii KSM-K16 ........................  254 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . . . . Bacillus licheniformis ATCC 14580 ...............  253 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . . . . Bacillus subtilis ...............................  253 4 hits [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . . . . Bacillus amyloliquefaciens FZB42 ................  245 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . . . . Bacillus halodurans .............................  244 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . . . Listeria monocytogenes serotype 4b str. F2365 -----  263 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . . . Listeria monocytogenes ............................  259 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . . . Listeria innocua ..................................  250 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . . Lactobacillus casei ---------------------------------  248 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . . Lactococcus lactis subsp. lactis ....................   70 1 hit  [firmicutes]            RecName: Full=Acetolactate synthase large subunit; Short=AH
. . . . Streptococcus pneumoniae ............................   51 1 hit  [firmicutes]            RecName: Full=Pyruvate oxidase; AltName: Full=Pyruvic oxida
. . . . Lactobacillus plantarum .............................   41 1 hit  [firmicutes]            RecName: Full=Pyruvate oxidase; AltName: Full=Pyruvic oxida
. . . Clostridium perfringens -------------------------------  259 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . Clostridium perfringens ATCC 13124 ....................  258 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . Clostridium tetani ....................................  256 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . Clostridium botulinum E3 str. Alaska E43 ..............  240 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . Clostridium botulinum B str. Eklund 17B ...............  233 1 hit  [firmicutes]            RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy
. . . Desulfonispora thiosulfatigenes .......................   73 1 hit  [firmicutes]            RecName: Full=Sulfoacetaldehyde acetyltransferase
. . Escherichia coli K-12 -----------------------------------  107 6 hits [enterobacteria]        RecName: Full=Acetolactate synthase isozyme 2 large subunit
. . Haemophilus influenzae Rd KW20 ..........................  105 2 hits [g-proteobacteria]      RecName: Full=Acetolactate synthase large subunit; Short=AH
. . Buchnera aphidicola (Schlechtendalia chinensis) .........  104 1 hit  [enterobacteria]        RecName: Full=Acetolactate synthase large subunit; Short=AH
. . Buchnera aphidicola (Schizaphis graminum) ...............  101 1 hit  [enterobacteria]        RecName: Full=Acetolactate synthase large subunit; Short=AH
. . Arthrospira platensis ...................................  100 1 hit  [cyanobacteria]         RecName: Full=Acetolactate synthase; AltName: Full=ALS; Alt
. . Corynebacterium glutamicum ..............................   95 1 hit  [high GC Gram+]         RecName: Full=Acetolactate synthase large subunit; Short=AH
. . Buchnera aphidicola (Acyrthosiphon pisum) ...............   92 1 hit  [enterobacteria]        RecName: Full=Acetolactate synthase large subunit; Short=AH
. . Synechococcus sp. WH 8102 ...............................   89 1 hit  [cyanobacteria]         RecName: Full=Acetolactate synthase large subunit; Short=AH
. . Buchnera aphidicola str. Bp (Baizongia pistaciae) .......   83 1 hit  [enterobacteria]        RecName: Full=Acetolactate synthase large subunit; Short=AH
. . Castellaniella defragrans ...............................   83 1 hit  [b-proteobacteria]      RecName: Full=Sulfoacetaldehyde acetyltransferase
. . Escherichia coli O157:H7 ................................   79 2 hits [enterobacteria]        RecName: Full=Glyoxylate carboligase; AltName: Full=Tartron
. . Achromobacter xylosoxidans ..............................   78 1 hit  [b-proteobacteria]      RecName: Full=Sulfoacetaldehyde acetyltransferase
. . Mycobacterium tuberculosis ..............................   77 3 hits [high GC Gram+]         RecName: Full=Putative acetolactate synthase large subunit 
. . Salmonella enterica subsp. enterica serovar Typhimurium .   76 1 hit  [enterobacteria]        RecName: Full=Acetolactate synthase isozyme 3 large subunit
. . Sinorhizobium meliloti ..................................   75 1 hit  [a-proteobacteria]      RecName: Full=Probable sulfoacetaldehyde acetyltransferase
. . Mycobacterium avium .....................................   74 1 hit  [high GC Gram+]         RecName: Full=Acetolactate synthase; AltName: Full=ALS; Alt
. . Mycobacterium bovis .....................................   72 2 hits [high GC Gram+]         RecName: Full=Acetolactate synthase large subunit IlvB1; Sh
. . Mycobacterium leprae ....................................   70 1 hit  [high GC Gram+]         RecName: Full=Acetolactate synthase; AltName: Full=ALS; Alt
. . Azoarcus sp. ............................................   67 1 hit  [b-proteobacteria]      RecName: Full=Cyclohexane-1,2-dione hydrolase
. . Oxalobacter formigenes ..................................   52 1 hit  [b-proteobacteria]      RecName: Full=Oxalyl-CoA decarboxylase
. . Klebsiella pneumoniae ...................................   50 1 hit  [enterobacteria]        RecName: Full=Acetolactate synthase, catabolic; Short=ALS
. . Pseudomonas fluorescens .................................   45 1 hit  [g-proteobacteria]      RecName: Full=Benzaldehyde lyase; AltName: Full=Benzoin ald
. . Pseudomonas amyloderamosa ...............................   43 1 hit  [proteobacteria]        RecName: Full=Uncharacterized 42.6 kDa protein in isoamylas
. . Azospirillum brasilense .................................   42 1 hit  [a-proteobacteria]      RecName: Full=Indole-3-pyruvate decarboxylase; Short=Indole
. Methanocaldococcus jannaschii -----------------------------  116 1 hit  [euryarchaeotes]        RecName: Full=Probable acetolactate synthase large subunit;
. Cyanidium caldarium .......................................  105 1 hit  [red algae]             RecName: Full=Acetolactate synthase large subunit; Short=AH
. Methanococcus aeolicus ....................................  102 1 hit  [euryarchaeotes]        RecName: Full=Probable acetolactate synthase large subunit;
. Porphyra purpurea .........................................   98 1 hit  [red algae]             RecName: Full=Acetolactate synthase large subunit; Short=AH
. Porphyra umbilicalis ......................................   98 1 hit  [red algae]             RecName: Full=Acetolactate synthase large subunit; Short=AH
. Guillardia theta ..........................................   98 1 hit  [cryptomonads]          RecName: Full=Acetolactate synthase large subunit; Short=AH
. Porphyra yezoensis ........................................   97 1 hit  [red algae]             RecName: Full=Acetolactate synthase large subunit; Short=AH
. Saccharomyces cerevisiae (yeast) ..........................   88 4 hits [ascomycetes]           RecName: Full=Acetolactate synthase catalytic subunit, mito
. Schizosaccharomyces pombe .................................   87 4 hits [ascomycetes]           RecName: Full=Acetolactate synthase, mitochondrial; AltName
. Oryza sativa Japonica Group (Japanese rice) ...............   85 2 hits [monocots]              RecName: Full=Acetolactate synthase 1, chloroplastic; AltNa
. Zea mays (maize) ..........................................   85 2 hits [monocots]              RecName: Full=Acetolactate synthase 2, chloroplastic; AltNa
. Nicotiana tabacum (tobacco) ...............................   81 2 hits [eudicots]              RecName: Full=Acetolactate synthase 2, chloroplastic; AltNa
. Cryptococcus neoformans var. grubii .......................   80 1 hit  [basidiomycetes]        RecName: Full=Acetolactate synthase, mitochondrial; AltName
. Cryptococcus neoformans ...................................   78 1 hit  [basidiomycetes]        RecName: Full=Acetolactate synthase, mitochondrial; AltName
. Arabidopsis thaliana (thale-cress) ........................   78 2 hits [eudicots]              RecName: Full=Acetolactate synthase, chloroplastic; AltName
. Brassica napus (rapeseeds) ................................   77 3 hits [eudicots]              RecName: Full=Acetolactate synthase 1, chloroplastic; AltNa
. Dictyostelium discoideum ..................................   57 1 hit  [cellular slime molds]  RecName: Full=Probable 2-hydroxyacyl-CoA lyase 1; AltName: 
. Homo sapiens (man) ........................................   51 2 hits [primates]              RecName: Full=2-hydroxyacyl-CoA lyase 1; AltName: Full=2-hy
. Caenorhabditis elegans (nematode) .........................   46 1 hit  [nematodes]             RecName: Full=Acetolactate synthase-like protein; AltName: 
. Rattus norvegicus (brown rat) .............................   46 1 hit  [rodents]               RecName: Full=2-hydroxyacyl-CoA lyase 1; AltName: Full=2-hy
. Mus musculus (mouse) ......................................   45 2 hits [rodents]               RecName: Full=2-hydroxyacyl-CoA lyase 1; AltName: Full=2-hy
. Kluyveromyces lactis ......................................   43 1 hit  [ascomycetes]           RecName: Full=Pyruvate decarboxylase
. Danio rerio (zebra fish) ..................................   39 1 hit  [bony fishes]           RecName: Full=Acetolactate synthase-like protein; AltName: 
. Candida glabrata ..........................................   39 1 hit  [ascomycetes]           RecName: Full=Pyruvate decarboxylase
. Kluyveromyces marxianus ...................................   39 1 hit  [ascomycetes]           RecName: Full=Pyruvate decarboxylase
. Methanosarcina thermophila ................................   38 1 hit  [euryarchaeotes]        RecName: Full=Acetyl-CoA decarbonylase/synthase complex sub
. Bos taurus (cow) ..........................................   37 1 hit  [even-toed ungulates]   RecName: Full=Acetolactate synthase-like protein; AltName: 
. Hanseniaspora uvarum ......................................   36 1 hit  [ascomycetes]           RecName: Full=Pyruvate decarboxylase



BLAST

PROTOCOL



A) ORF number 1 in reading frame 3 on the direct strand extends from base 3 to base 848.


1) BLASTp versus NR, NCBI default parameters apart from "Max target sequences _ 1000"

2) BLASTp versus SwissProt, NCBI default parameters



RESULTS ANALYSIS


The Blastp results with the two protein databases NR and Swissprot are coherent but the sequence of homologs is in different organization and the number of hits is very different since Swissprot is a very small database.

The results on the NR database are very significant, a high huge of hits, good scores and E-values under e-20.

Blast results also allowed to predict the potential protein and their function, and are in agreement with those of obtained when searching for protein domains, where the metagenomics sequence corresponds to the Acetolactate synthase enzyme that catalyzes the first step in the synthesis of the branched-chain amino acids.


To perform the local alignment all query sequence was used, high values of identity (> 45%) were obtained reveling a high scoring pair along of the sequence.

RAW RESULTS


A) ORF number 1 in reading frame 3 on the direct strand extends from base 3 to base 848.

1) BLASTp versus NR

                                                                  Score     E
Sequences producing significant alignments:                       (Bits)  Value

gb|ABZ06335.1|  putative Thiamine pyrophosphate enzyme, centra...   423    2e-116
ref|YP_002542806.1|  myo-inositol catabolism [Agrobacterium ra...   343    1e-92 
ref|YP_004277036.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dion...   341    7e-92 
ref|ZP_01743920.1|  hypothetical acetolactate synthase, iolD [...   326    3e-87 
ref|YP_001833892.1|  thiamine pyrophosphate protein central re...   322    5e-86 
ref|YP_004119074.1|  thiamine pyrophosphate protein central re...   319    2e-85 
ref|ZP_02189986.1|  Acetolactate synthase [alpha proteobacteri...   318    4e-85 
ref|YP_003899301.1|  K03336 myo-inositol catabolism protein Io...   317    1e-84 
ref|YP_002490002.1|  thiamine pyrophosphate protein central re...   310    1e-82 
ref|ZP_03569026.1|  probable malonic semialdehyde oxidative de...   308    5e-82 
ref|ZP_05785776.1|  probable malonic semialdehyde oxidative de...   308    6e-82 
ref|ZP_06175542.1|  conserved hypothetical protein [Vibrio har...   307    9e-82 
ref|YP_004311933.1|  Acetolactate synthase [Marinomonas medite...   307    1e-81 
ref|ZP_05089616.1|  TPP-requiring enzyme IolD [Ruegeria sp. R1...   307    1e-81 
ref|ZP_05116943.1|  Thiamine pyrophosphate enzyme, central dom...   305    3e-81 
ref|ZP_01156752.1|  Acetolactate synthase [Oceanicola granulos...   305    3e-81 
gb|EGF89390.1|  3D-3,5/4-trihydroxycyclohexane-1,2-dione hydro...   305    4e-81 
ref|ZP_05887860.1|  epi-inositol hydrolase [Vibrio coralliilyt...   305    5e-81 
ref|YP_001235427.1|  thiamine pyrophosphate enzyme, central re...   305    5e-81 
ref|YP_004277056.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dion...   305    5e-81 
ref|ZP_07657227.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   305    6e-81 
ref|ZP_02149495.1|  thiamine pyrophosphate enzyme protein [Pha...   303    1e-80 
ref|ZP_05052968.1|  Thiamine pyrophosphate enzyme, central dom...   303    1e-80 
ref|ZP_01867065.1|  hypothetical acetolactate synthase, iolD [...   303    2e-80 
ref|YP_002828176.1|  thiamine pyrophosphate domain protein, TP...   303    2e-80 
ref|ZP_01002817.1|  iold protein [Loktanella vestfoldensis SKA...   302    3e-80 
ref|ZP_05741281.1|  probable malonic semialdehyde oxidative de...   302    3e-80 
ref|ZP_02145898.1|  thiamine pyrophosphate enzyme, central reg...   302    4e-80 
ref|ZP_04682454.1|  thiamine pyrophosphate protein central reg...   302    4e-80 
ref|NP_384459.1|  putative malonic semialdehyde oxidative deca...   301    7e-80 
ref|ZP_01545639.1|  Acetolactate synthase [Stappia aggregata I...   301    9e-80 
ref|ZP_05052475.1|  Thiamine pyrophosphate enzyme, central dom...   301    9e-80 
ref|YP_002827107.1|  myo-inositol catabolism, acetolactate syn...   301    1e-79 
ref|ZP_02140719.1|  acetolactate synthase [Roseobacter litoral...   300    1e-79 
ref|YP_680636.1|  acetolactate synthase [Roseobacter denitrifi...   300    2e-79 
gb|ADI19129.1|  acetolactate synthase [uncultured alpha proteo...   300    2e-79 
ref|ZP_05068316.1|  thiamine pyrophosphate enzyme protein [Oct...   298    4e-79 
ref|ZP_01055278.1|  iold protein [Roseobacter sp. MED193] >gb|...   298    6e-79 
ref|ZP_01220442.1|  hypothetical acetolactate synthase, iolD [...   298    7e-79 
ref|ZP_05887874.1|  epi-inositol hydrolase [Vibrio coralliilyt...   298    7e-79 
ref|ZP_05090552.1|  thiamine pyrophosphate enzyme, central reg...   297    9e-79 
ref|YP_767098.1|  malonate semialdehyde dehydrogenase [Rhizobi...   297    1e-78 
ref|YP_468874.1|  myo-inositol catabolism, acetolactate syntha...   296    2e-78 
ref|ZP_05342040.1|  probable malonic semialdehyde oxidative de...   296    2e-78 
emb|CAB76950.1|  acetolactate synthase [Rhizobium leguminosarum]    296    2e-78 
ref|YP_132135.1|  acetolactate synthase IolD [Photobacterium p...   296    2e-78 
ref|ZP_05182123.1|  thiamine pyrophosphate protein [Brucella s...   295    6e-78 
ref|YP_002974968.1|  thiamine pyrophosphate protein central re...   295    6e-78 
ref|YP_001372373.1|  thiamine pyrophosphate protein central re...   295    7e-78 
ref|YP_002543896.1|  myo-inositol catabolism [Agrobacterium ra...   294    7e-78 
ref|YP_001792338.1|  thiamine pyrophosphate protein central re...   294    1e-77 
ref|ZP_02166753.1|  thiamine pyrophosphate enzyme, central reg...   294    1e-77 
ref|ZP_07473431.1|  thiamine pyrophosphate protein [Brucella s...   294    1e-77 
ref|YP_002280501.1|  thiamine pyrophosphatase [Rhizobium legum...   293    1e-77 
ref|YP_001329211.1|  thiamine pyrophosphate protein central re...   293    1e-77 
ref|YP_004089354.1|  thiamine pyrophosphate TPP-binding domain...   293    2e-77 
ref|YP_001532612.1|  thiamine pyrophosphate protein central re...   293    2e-77 
ref|YP_432461.1|  acetolactate synthase [Hahella chejuensis KC...   293    2e-77 
ref|ZP_01226451.1|  acetolactate synthase IolD protein [Aurant...   293    2e-77 
ref|ZP_01742905.1|  thiamine pyrophosphate enzyme protein [Rho...   292    4e-77 
ref|YP_002734459.1|  thiamine pyrophosphate protein [Brucella ...   291    5e-77 
ref|ZP_06098974.1|  thiamine pyrophosphate enzyme [Brucella pi...   291    5e-77 
ref|NP_541549.1|  acetolactate synthase IolD [Brucella meliten...   291    6e-77 
ref|ZP_05452394.1|  thiamine pyrophosphate protein [Brucella m...   291    6e-77 
ref|YP_001257673.1|  TPP-requiring enzyme IolD [Brucella ovis ...   291    6e-77 
ref|YP_223296.1|  TPP-requiring prtoein IolD [Brucella abortus...   291    6e-77 
ref|ZP_05085488.1|  iold protein [Pseudovibrio sp. JE062] >gb|...   291    6e-77 
ref|YP_001340458.1|  thiamine pyrophosphate protein central re...   291    6e-77 
ref|ZP_05167628.1|  thiamine pyrophosphate protein [Brucella p...   291    6e-77 
ref|ZP_01746942.1|  iold protein [Sagittula stellata E-37] >gb...   291    6e-77 
ref|ZP_05809249.1|  thiamine pyrophosphate protein central reg...   291    7e-77 
ref|ZP_04595987.1|  acetolactate synthase IolD [Brucella abort...   291    7e-77 
ref|NP_699893.1|  TPP-requiring enzyme IolD [Brucella suis 133...   291    7e-77 
ref|ZP_05455524.1|  thiamine pyrophosphate protein [Brucella c...   291    9e-77 
ref|ZP_05449311.1|  thiamine pyrophosphate protein [Brucella n...   290    1e-76 
ref|ZP_03787225.1|  acetolactate synthase IolD [Brucella ceti ...   290    1e-76 
ref|YP_001977598.1|  acetolactate synthase protein (myo-inosit...   290    1e-76 
ref|ZP_05161764.1|  TPP-requiring enzyme IolD [Brucella suis b...   290    1e-76 
gb|EGE58797.1|  acetolactate synthase protein (myo-inositol ca...   290    1e-76 
ref|YP_003752760.1|  acetolactate synthase protein [Ralstonia ...   289    3e-76 
gb|ADY67549.1|  Acetolactate synthase [Agrobacterium sp. H13-3]     289    4e-76 
ref|NP_105727.1|  acetolactate synthase, iolD [Mesorhizobium l...   288    5e-76 
ref|YP_611582.1|  thiamine pyrophosphate enzyme, central regio...   288    7e-76 
ref|YP_915468.1|  thiamine pyrophosphate binding domain-contai...   288    7e-76 
ref|YP_001045866.1|  thiamine pyrophosphate enzyme, central re...   288    8e-76 
ref|ZP_05074445.1|  thiamine pyrophosphate-dependent enzyme Io...   288    8e-76 
ref|ZP_01447508.1|  hypothetical acetolactate synthase, iolD [...   287    1e-75 
ref|YP_001236678.1|  putative malonic semialdehyde oxidative d...   287    1e-75 
ref|ZP_05123326.1|  thiamine pyrophosphate enzyme, central reg...   286    2e-75 
ref|YP_509362.1|  thiamine pyrophosphate enzyme protein [Janna...   286    2e-75 
ref|YP_003550601.1|  acetolactate synthase, iolD [Candidatus P...   286    2e-75 
ref|YP_002548034.1|  acetolactate synthase [Agrobacterium viti...   286    3e-75 
ref|YP_002253594.1|  acetolactate synthase protein [Ralstonia ...   285    5e-75 
ref|YP_354792.1|  acetolactate synthase [Rhodobacter sphaeroid...   285    6e-75 
ref|YP_003745983.1|  acetolactate synthase protein (iold) [Ral...   285    7e-75 
ref|XP_001617603.1|  hypothetical protein NEMVEDRAFT_v1g225949...   285    7e-75 
ref|ZP_00945013.1|  IolD PROTEIN [Ralstonia solanacearum UW551...   284    8e-75 
emb|CBJ37042.1|  putative acetolactate synthase (ilvB) [Ralsto...   284    9e-75 
ref|YP_147744.1|  myo-inositol catabolism protein [Geobacillus...   283    2e-74 
ref|YP_002520392.1|  Thiamine pyrophosphate enzyme, central re...   283    2e-74 
ref|YP_003764093.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dion...   282    4e-74 
ref|ZP_01220426.1|  putative acetolactate synthase [Photobacte...   281    6e-74 
ref|YP_132149.1|  putative acetolactate synthase [Photobacteri...   280    1e-73 
ref|YP_002276779.1|  xylose isomerase domain-containing protei...   280    2e-73 
ref|YP_003323252.1|  thiamine pyrophosphate protein central re...   279    3e-73 
ref|YP_003775835.1|  acetolactate synthase [Herbaspirillum ser...   279    3e-73 
ref|YP_001600649.1|  putative acetolactate synthase large subu...   279    3e-73 
ref|ZP_02887017.1|  thiamine pyrophosphate protein central reg...   278    9e-73 
ref|NP_356146.1|  acetolactate synthase [Agrobacterium tumefac...   277    1e-72 
ref|YP_003605618.1|  thiamine pyrophosphate protein central re...   277    1e-72 
ref|YP_004139726.1|  thiamine pyrophosphate central domain-con...   277    1e-72 
ref|NP_420112.1|  iolD protein [Caulobacter crescentus CB15] >...   276    2e-72 
ref|YP_559680.1|  putative myo-inositol catabolism LolD protei...   276    2e-72 
ref|YP_001857829.1|  thiamine pyrophosphate protein central re...   276    3e-72 
ref|YP_004228932.1|  thiamine pyrophosphate TPP-binding domain...   275    7e-72 
ref|ZP_06840977.1|  thiamine pyrophosphate protein central reg...   274    8e-72 
ref|YP_083844.1|  myo-inositol catabolism protein, malonic sem...   273    1e-71 
ref|ZP_04090625.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   273    2e-71 
ref|YP_003507476.1|  thiamine pyrophosphate protein central re...   273    2e-71 
ref|YP_002451480.1|  putative iolD protein [Bacillus cereus AH...   273    2e-71 
ref|YP_036624.1|  malonic semialdehyde oxidative decarboxylase...   273    2e-71 
ref|NP_844886.1|  iolD protein, putative [Bacillus anthracis s...   273    2e-71 
ref|ZP_03101098.1|  putative iolD protein [Bacillus cereus W] ...   273    2e-71 
ref|ZP_04111787.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   273    2e-71 
ref|ZP_03107708.1|  putative iolD protein [Bacillus cereus NVH...   272    3e-71 
ref|ZP_04197529.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   272    3e-71 
ref|YP_001896428.1|  thiamine pyrophosphate protein central re...   272    4e-71 
ref|ZP_04222709.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   272    5e-71 
ref|YP_002940701.1|  thiamine pyrophosphate protein central re...   271    6e-71 
ref|YP_245790.1|  myo-inositol catabolism protein [Bacillus ce...   271    7e-71 
ref|ZP_01752265.1|  thiamine pyrophosphate enzyme, central reg...   271    7e-71 
ref|ZP_04298026.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   271    8e-71 
ref|YP_003451312.1|  myo-inositol catabolism protein [Azospiri...   271    8e-71 
ref|ZP_04284190.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   271    1e-70 
ref|ZP_04145751.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   270    1e-70 
ref|ZP_05931602.1|  acetolactate synthase [Brucella ceti M13/0...   270    1e-70 
ref|YP_895066.1|  malonic semialdehyde oxidative decarboxylase...   270    2e-70 
ref|ZP_04311938.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   270    2e-70 
ref|ZP_04288941.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   270    2e-70 
ref|ZP_04078697.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   270    2e-70 
ref|ZP_07374365.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   269    3e-70 
ref|ZP_03268088.1|  thiamine pyrophosphate protein central reg...   268    5e-70 
ref|ZP_01004057.1|  hypothetical acetolactate synthase, iolD [...   268    7e-70 
ref|NP_519360.1|  putative acetolactate synthase protein [Rals...   268    9e-70 
gb|AEB11692.1|  Acetolactate synthase [Marinithermus hydrother...   267    1e-69 
ref|YP_001125915.1|  IolD protein [Geobacillus thermodenitrifi...   266    2e-69 
ref|YP_002777701.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2- dio...   266    2e-69 
ref|ZP_04245382.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   266    2e-69 
ref|YP_003989522.1|  thiamine pyrophosphate central domain-con...   265    4e-69 
ref|YP_003595730.1|  myo-inositol catabolism protein IolD [Bac...   265    4e-69 
ref|YP_760879.1|  thiamine pyrophosphate-dependent enzyme IolD...   265    6e-69 
emb|CBJ38488.1|  putative acetolactate synthase protein (iolD)...   265    6e-69 
ref|YP_003104488.1|  thiamine pyrophosphate protein central re...   265    7e-69 
ref|YP_003560982.1|  myo-inositol catabolism protein IolD [Bac...   264    8e-69 
ref|YP_003563927.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dion...   264    9e-69 
ref|ZP_04228007.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   264    1e-68 
ref|ZP_02355940.1|  iolD protein [Burkholderia oklahomensis EO...   264    1e-68 
ref|ZP_04251271.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   264    1e-68 
ref|YP_003713161.1|  putative malonic semialdehyde oxidative d...   263    2e-68 
ref|ZP_02363087.1|  iolD protein [Burkholderia oklahomensis C6...   263    2e-68 
ref|ZP_00229318.1|  thiamine-pyrophosphate-requiring enzyme [L...   263    2e-68 
ref|ZP_05230808.1|  thiamine-pyrophosphate-requiring enzyme [L...   263    2e-68 
sp|Q723S8.2|IOLD_LISMF  RecName: Full=3D-(3,5/4)-trihydroxycyc...   263    3e-68 
ref|ZP_05266039.1|  thiamine-pyrophosphate-requiring enzyme [L...   263    3e-68 
ref|ZP_02447818.1|  iolD protein [Burkholderia pseudomallei 91]     263    3e-68 
ref|YP_003463571.1|  IolD protein [Listeria seeligeri serovar ...   263    3e-68 
ref|ZP_05243452.1|  thiamine-pyrophosphate-requiring enzyme [L...   263    3e-68 
ref|YP_013006.1|  thiamine-pyrophosphate-requiring enzyme [Lis...   263    3e-68 
ref|ZP_02403154.1|  iolD protein [Burkholderia pseudomallei DM98]   262    4e-68 
ref|YP_001058695.1|  iolD protein [Burkholderia pseudomallei 6...   262    4e-68 
ref|ZP_02375050.1|  iolD protein [Burkholderia thailandensis T...   262    5e-68 
ref|YP_001204317.1|  putative malonic semialdehyde oxidative d...   261    5e-68 
ref|ZP_06555452.1|  thiamine-pyrophosphate-requiring enzyme [L...   261    5e-68 
ref|ZP_03455094.1|  iolD protein [Burkholderia pseudomallei 57...   261    5e-68 
ref|YP_002351202.1|  probable malonic semialdehyde oxidative d...   261    6e-68 
ref|ZP_04886653.1|  iolD protein [Burkholderia pseudomallei 16...   261    6e-68 
ref|YP_102640.1|  iolD protein [Burkholderia mallei ATCC 23344...   261    6e-68 
gb|EFT09264.1|  thiamine pyrophosphate enzyme, TPP binding dom...   261    6e-68 
ref|ZP_02267362.2|  iolD protein [Burkholderia mallei PRL-20] ...   261    6e-68 
ref|ZP_04903936.1|  iolD protein [Burkholderia pseudomallei S1...   261    6e-68 
ref|YP_992774.1|  iolD protein [Burkholderia mallei SAVP1] >re...   261    7e-68 
ref|YP_108593.1|  putative TPP-binding acetolactate synthase [...   261    7e-68 
ref|YP_001065947.1|  iolD protein [Burkholderia pseudomallei 1...   261    7e-68 
ref|YP_002757118.1|  IolD protein, to acetolactate synthase [L...   261    8e-68 
gb|EFT64636.1|  thiamine pyrophosphate enzyme, TPP binding dom...   261    8e-68 
gb|ADO66836.1|  pyruvate decarboxylase [Enterococcus faecium]       261    8e-68 
gb|EFT26392.1|  thiamine pyrophosphate enzyme, TPP binding dom...   261    8e-68 
gb|EFS85908.1|  thiamine pyrophosphate enzyme, TPP binding dom...   261    8e-68 
ref|YP_002896410.1|  IolD protein [Burkholderia pseudomallei M...   261    9e-68 
ref|ZP_00602564.1|  Pyruvate decarboxylase [Enterococcus faeci...   261    1e-67 
ref|ZP_01459141.1|  myo-inositol catabolism protein [Stigmatel...   261    1e-67 
ref|ZP_01769493.1|  iolD protein [Burkholderia pseudomallei 30...   261    1e-67 
ref|YP_443163.1|  iolD protein [Burkholderia thailandensis E26...   261    1e-67 
gb|EFS04373.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hyd...   260    1e-67 
ref|ZP_03930414.1|  acetolactate synthase [Anaerococcus tetrad...   260    1e-67 
ref|ZP_05587655.1|  iolD protein [Burkholderia thailandensis E...   260    1e-67 
ref|YP_001808045.1|  thiamine pyrophosphate protein central re...   260    2e-67 
ref|NP_561005.1|  myo-inositol catabolism protein [Clostridium...   259    2e-67 
ref|YP_003907669.1|  thiamine pyrophosphate central domain-con...   259    2e-67 
ref|YP_003341061.1|  thiamine pyrophosphate binding domain-con...   259    3e-67 
ref|NP_463916.1|  hypothetical protein lmo0386 [Listeria monoc...   259    4e-67 
ref|YP_003743643.1|  Myo-inositol catabolism protein, malonic ...   259    4e-67 
ref|ZP_04262183.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   259    4e-67 
ref|ZP_06262867.1|  thiamine pyrophosphate enzyme, C-terminal ...   258    5e-67 
gb|EFS73193.1|  thiamine pyrophosphate enzyme, TPP binding dom...   258    5e-67 
gb|EFS92477.1|  thiamine pyrophosphate enzyme, TPP binding dom...   258    5e-67 
ref|YP_003968235.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dion...   258    6e-67 
ref|ZP_03670627.1|  hypothetical protein LmonFR_07334 [Listeri...   258    6e-67 
gb|EGE71213.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hyd...   258    7e-67 
ref|ZP_02953746.1|  myo-inositol catabolism protein IolD [Clos...   258    9e-67 
ref|YP_694548.1|  myo-inositol catabolism protein IolD [Clostr...   258    1e-66 
ref|YP_701335.1|  acetolactate synthase [Rhodococcus jostii RH...   257    1e-66 
ref|YP_003804683.1|  thiamine pyrophosphate protein domain pro...   257    1e-66 
ref|ZP_02643801.1|  myo-inositol catabolism protein IolD [Clos...   257    1e-66 
ref|ZP_07869661.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   257    1e-66 
ref|ZP_05297354.1|  hypothetical protein LmonocytFSL_01864 [Li...   257    1e-66 
ref|YP_822760.1|  thiamine pyrophosphate binding domain-contai...   257    1e-66 
ref|YP_003412538.1|  hypothetical protein LM5578_0420 [Listeri...   257    1e-66 
ref|ZP_03668377.1|  hypothetical protein LmonF1_10274 [Listeri...   256    2e-66 
ref|YP_003474380.1|  putative 3D-(3,5/4)-trihydroxycyclohexane...   256    2e-66 
ref|ZP_07307935.1|  acetolactate synthase [Streptomyces virido...   256    2e-66 
ref|ZP_05260591.1|  hypothetical protein LmonJ_12664 [Listeria...   256    2e-66 
ref|ZP_00234165.1|  thiamine-pyrophosphate-requiring enzyme [L...   256    2e-66 
ref|YP_001909196.1|  Myo-inositol catabolism protein, malonic ...   256    2e-66 
ref|YP_003996164.1|  3d-(3,5/4)-trihydroxycyclohexane-1,2-dion...   256    3e-66 
ref|ZP_02633727.1|  myo-inositol catabolism protein IolD [Clos...   256    3e-66 
sp|Q898E8.2|IOLD_CLOTE  RecName: Full=3D-(3,5/4)-trihydroxycyc...   256    3e-66 
ref|YP_001507438.1|  thiamine pyrophosphate protein central re...   256    3e-66 
ref|NP_781196.1|  myo-inositol catabolism protein iolD [Clostr...   256    3e-66 
ref|ZP_05236436.1|  hypothetical protein Lmon1_10530 [Listeria...   256    3e-66 
gb|ADP10661.1|  Myo-inositol catabolism protein, malonic semia...   256    3e-66 
ref|ZP_05233668.1|  thiamine-pyrophosphate-requiring enzyme [L...   256    3e-66 
ref|ZP_06970644.1|  thiamine pyrophosphate protein central reg...   255    4e-66 
ref|ZP_07929837.1|  thiamine pyrophosphate enzyme [Anaerostipe...   255    5e-66 
ref|ZP_04820632.1|  probable malonic semialdehyde oxidative de...   255    6e-66 
ref|ZP_02437917.1|  hypothetical protein CLOSS21_00355 [Clostr...   255    6e-66 
emb|CBX82410.1|  malonic semialdehyde oxidative decarboxylase ...   254    7e-66 
ref|YP_003532861.1|  malonic semialdehyde oxidative decarboxyl...   254    7e-66 
ref|YP_002778261.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dion...   254    7e-66 
ref|YP_003310778.1|  thiamine pyrophosphate protein central re...   254    7e-66 
ref|ZP_02863317.1|  myo-inositol catabolism protein IolD [Clos...   254    7e-66 
ref|YP_003824098.1|  thiamine pyrophosphate protein central re...   254    8e-66 
ref|YP_173928.1|  myo-inositol catabolism protein IolD [Bacill...   254    8e-66 
ref|YP_002822666.1|  myo-inositol catabolism protein IolD [Sin...   254    1e-65 
ref|ZP_08002623.1|  IolD protein [Bacillus sp. BT1B_CT2] >gb|E...   254    1e-65 
gb|EFT54548.1|  thiamine pyrophosphate enzyme, TPP binding dom...   253    2e-65 
ref|YP_004205825.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dion...   253    2e-65 
ref|YP_081320.1|  IolD [Bacillus licheniformis ATCC 14580] >re...   253    2e-65 
ref|ZP_03593792.1|  IolD [Bacillus subtilis subsp. subtilis st...   253    2e-65 
gb|EFS59506.1|  thiamine pyrophosphate enzyme, TPP binding dom...   253    2e-65 
ref|YP_003580679.1|  Epi-inositol hydrolase [Propionibacterium...   253    2e-65 
gb|EFS52067.1|  thiamine pyrophosphate enzyme, TPP binding dom...   253    2e-65 
ref|YP_055169.1|  thiamine pyrophosphate-requiring enzyme, put...   253    2e-65 
gb|EFS38540.1|  thiamine pyrophosphate enzyme, TPP binding dom...   253    2e-65 
dbj|BAI87671.1|  inositol utilization protein D [Bacillus subt...   253    2e-65 
ref|ZP_06426550.1|  thiamine pyrophosphate enzyme, C-terminal ...   253    2e-65 
gb|EFS45106.1|  thiamine pyrophosphate enzyme, TPP binding dom...   253    2e-65 
gb|EFS52872.1|  thiamine pyrophosphate enzyme, TPP binding dom...   253    2e-65 
gb|EFS43809.1|  thiamine pyrophosphate enzyme, TPP binding dom...   253    2e-65 
gb|EFS55004.1|  thiamine pyrophosphate enzyme, TPP binding dom...   253    2e-65 
ref|ZP_06430155.1|  thiamine pyrophosphate enzyme, C-terminal ...   253    2e-65 
gb|EFS64391.1|  thiamine pyrophosphate enzyme, TPP binding dom...   253    2e-65 
ref|YP_001563954.1|  thiamine pyrophosphate protein central re...   253    3e-65 
ref|ZP_02420839.1|  hypothetical protein ANACAC_03486 [Anaeros...   253    3e-65 
ref|YP_275351.1|  iolD protein [Pseudomonas syringae pv. phase...   253    3e-65 
dbj|BAA03293.1|  hypothetical protein [Bacillus subtilis]           253    3e-65 
gb|EGE76758.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hyd...   253    3e-65 
ref|YP_003598656.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dion...   252    4e-65 
ref|YP_003688821.1|  iolD (Myo-inositol catabolism iolD protei...   252    5e-65 
ref|YP_003010691.1|  thiamine pyrophosphate protein central re...   252    5e-65 
ref|YP_003090049.1|  thiamine pyrophosphate protein central re...   251    6e-65 
ref|ZP_02692333.1|  IolD protein [Epulopiscium sp. 'N.t. morph...   251    8e-65 
ref|YP_002650481.1|  Myo-inositol catabolism protein, malonic ...   251    9e-65 
gb|EFR91939.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hyd...   251    9e-65 
ref|YP_003379583.1|  thiamine pyrophosphate protein central re...   251    9e-65 
ref|ZP_08032405.1|  thiamine pyrophosphate enzyme, TPP binding...   251    9e-65 
ref|YP_279025.1|  myo-inositol catabolism protein [Mycoplasma ...   250    1e-64 
ref|YP_115663.1|  myo-inositol catabolism protein [Mycoplasma ...   250    1e-64 
ref|YP_002765465.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2- dio...   250    1e-64 
gb|ADQ90459.1|  Myo-inositol catabolism [Mycoplasma hyopneumon...   250    1e-64 
ref|ZP_06872392.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   250    2e-64 
ref|YP_003397226.1|  thiamine pyrophosphate protein central re...   250    2e-64 
gb|EGF55260.1|  thiamine pyrophosphate enzyme, central domain ...   250    2e-64 
ref|YP_287626.1|  myo-inositol catabolism protein [Mycoplasma ...   250    2e-64 
ref|NP_469749.1|  hypothetical protein lin0404 [Listeria innoc...   250    2e-64 
ref|ZP_04383499.1|  putative malonic semialdehyde oxidative de...   249    2e-64 
gb|EFW79947.1|  iolD protein [Pseudomonas syringae pv. glycine...   249    2e-64 
ref|ZP_06458323.1|  iolD protein [Pseudomonas syringae pv. aes...   249    2e-64 
gb|EGF70187.1|  thiamine pyrophosphate enzyme, TPP binding dom...   249    3e-64 
ref|ZP_04215176.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   249    3e-64 
ref|ZP_07005665.1|  Epi-inositol hydrolase [Pseudomonas savast...   249    3e-64 
ref|YP_236339.1|  pyruvate decarboxylase:pyruvate decarboxylas...   249    3e-64 
ref|ZP_03397185.1|  iolD protein [Pseudomonas syringae pv. tom...   249    3e-64 
ref|ZP_08126810.1|  iolD (Myo-inositol catabolism iolD protein...   249    4e-64 
ref|NP_793275.1|  iolD protein [Pseudomonas syringae pv. tomat...   249    4e-64 
ref|YP_001133864.1|  thiamine pyrophosphate enzyme, central re...   249    4e-64 
gb|EFU17638.1|  thiamine pyrophosphate enzyme, TPP binding dom...   249    4e-64 
ref|YP_003170011.1|  myo-inositol catabolism protein IolD [Lac...   249    4e-64 
ref|ZP_01994404.1|  hypothetical protein DORLON_00389 [Dorea l...   249    4e-64 
ref|ZP_03211358.1|  hypothetical protein LRH_12529 [Lactobacil...   249    4e-64 
ref|ZP_08233346.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   249    4e-64 
ref|NP_828323.1|  IolD protein [Streptomyces avermitilis MA-46...   248    5e-64 
ref|ZP_04684364.1|  acetolactate synthase [Streptomyces ghanae...   248    5e-64 
ref|YP_644490.1|  thiamine pyrophosphate enzyme, central regio...   248    6e-64 
ref|ZP_07314470.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   248    6e-64 
ref|ZP_07263320.1|  pyruvate decarboxylase:pyruvate decarboxyl...   248    6e-64 
emb|CAJ88765.1|  putative acetolactate synthase [Streptomyces ...   248    6e-64 
ref|ZP_06771374.1|  putative IolD protein [Streptomyces clavul...   248    7e-64 
gb|EGF49085.1|  myo-inositol catabolism protein IolD [Lactobac...   248    8e-64 
ref|ZP_04674088.1|  conserved hypothetical protein [Lactobacil...   248    8e-64 
sp|A5YBJ6.2|IOLD_LACCA  RecName: Full=3D-(3,5/4)-trihydroxycyc...   248    8e-64 
ref|YP_001986210.1|  IolD [Lactobacillus casei BL23] >gb|ABP57...   248    8e-64 
gb|ADD13470.1|  acetolactate synthase-like protein [Lactobacil...   248    8e-64 
ref|NP_733719.1|  acetolactate synthase [Streptomyces coelicol...   248    8e-64 
ref|YP_003243718.1|  thiamine pyrophosphate protein central re...   248    9e-64 
ref|ZP_02314312.1|  thiamine pyrophosphate-dependent enzyme [Y...   247    1e-63 
ref|ZP_08238544.1|  Acetolactate synthase [Streptomyces cf. gr...   247    1e-63 
ref|YP_001826349.1|  putative IolD protein [Streptomyces grise...   247    1e-63 
ref|ZP_05005898.1|  IolD protein [Streptomyces clavuligerus AT...   247    1e-63 
ref|YP_003172946.1|  myo-inositol catabolism protein IolD [Lac...   247    1e-63 
ref|ZP_05560807.1|  malonic semialdehyde oxidative decarboxyla...   247    1e-63 
ref|ZP_05503629.1|  thiamine-pyrophosphate-requiring enzyme [E...   247    1e-63 
ref|ZP_04439566.1|  acetolactate synthase [Lactobacillus rhamn...   247    1e-63 
ref|ZP_05559062.1|  myo-inositol catabolism protein IolD [Ente...   247    1e-63 
ref|ZP_04693252.1|  putative IolD protein [Streptomyces roseos...   247    1e-63 
ref|ZP_05567695.1|  thiamine-pyrophosphate-requiring enzyme [E...   247    2e-63 
ref|ZP_05596794.1|  thiamine-pyrophosphate-requiring enzyme [E...   247    2e-63 
ref|ZP_05573923.1|  thiamine-pyrophosphate-requiring enzyme [E...   246    2e-63 
gb|EFU14363.1|  thiamine pyrophosphate enzyme, TPP binding dom...   246    2e-63 
ref|ZP_06921326.1|  acetolactate synthase [Streptomyces sviceu...   246    2e-63 
ref|YP_002230560.1|  putative TPP-binding acetolactate synthas...   246    2e-63 
gb|AEA60374.1|  IolD protein [Burkholderia gladioli BSR3]           246    2e-63 
ref|ZP_07567803.1|  thiamine pyrophosphate enzyme, TPP binding...   246    2e-63 
ref|ZP_04438197.1|  acetolactate synthase [Enterococcus faecal...   246    2e-63 
ref|YP_368806.1|  acetolactate synthase [Burkholderia sp. 383]...   246    2e-63 
ref|ZP_04433958.1|  acetolactate synthase [Enterococcus faecal...   246    2e-63 
ref|ZP_03056838.1|  myo-inositol catabolism protein IolD [Ente...   246    2e-63 
ref|ZP_05593555.1|  malonic semialdehyde oxidative decarboxyla...   246    3e-63 
gb|EGC99706.1|  thiamine pyrophosphate protein central region ...   246    3e-63 
ref|ZP_05584875.1|  malonic semialdehyde oxidative decarboxyla...   246    3e-63 
gb|ADD13509.1|  acetolactate synthase-like protein [Lactobacil...   246    4e-63 
gb|ADI03917.1|  thiamine pyrophosphate protein central region ...   246    4e-63 
ref|ZP_06499551.1|  pyruvate decarboxylase:pyruvate decarboxyl...   246    4e-63 
emb|CBL18506.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hy...   245    4e-63 
ref|ZP_04863634.1|  probable malonic semialdehyde oxidative de...   245    5e-63 
ref|YP_620822.1|  thiamine pyrophosphate enzyme-like TPP-bindi...   245    6e-63 
ref|NP_929083.1|  hypothetical protein plu1805 [Photorhabdus l...   245    6e-63 
ref|YP_003274690.1|  thiamine pyrophosphate protein central re...   245    6e-63 
ref|YP_001423235.1|  IolD [Bacillus amyloliquefaciens FZB42] >...   245    6e-63 
ref|YP_001721774.1|  thiamine pyrophosphate binding domain-con...   245    6e-63 
ref|YP_003704898.1|  thiamine pyrophosphate protein central re...   244    7e-63 
ref|NP_992504.1|  putative thiamine pyrophosphate-dependent pr...   244    7e-63 
ref|YP_069610.1|  thiamine pyrophosphate-dependent protein [Ye...   244    7e-63 
ref|YP_001401938.1|  thiamine pyrophosphate-dependent enzyme [...   244    7e-63 
ref|YP_652432.1|  putative thiamine pyrophosphate-dependent pr...   244    7e-63 
ref|ZP_02304986.1|  thiamine pyrophosphate-dependent enzyme [Y...   244    7e-63 
ref|YP_001164016.1|  aldehyde dehydrogenase [Yersinia pestis P...   244    8e-63 
ref|ZP_06599482.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   244    8e-63 
gb|ADV99788.1|  putative thiamine pyrophosphate-dependent prot...   244    8e-63 
ref|NP_668474.1|  malonic semialdehyde oxidative decarboxylase...   244    8e-63 
ref|ZP_03927513.1|  acetolactate synthase [Actinomyces urogeni...   244    8e-63 
ref|YP_003041544.1|  hypothetical protein PAU_02710 [Photorhab...   244    8e-63 
ref|YP_001311613.1|  thiamine pyrophosphate protein, central r...   244    8e-63 
gb|ADD13482.1|  acetolactate synthase-like protein [Lactobacil...   244    9e-63 
ref|YP_773194.1|  thiamine pyrophosphate binding domain-contai...   244    1e-62 
ref|YP_001338292.1|  putative acetolactate synthase large subu...   244    1e-62 
ref|NP_243184.1|  malonic semialdehyde oxidative decarboxylase...   244    1e-62 
ref|YP_003441484.1|  thiamine pyrophosphate protein central re...   244    1e-62 
ref|YP_001764697.1|  thiamine pyrophosphate protein central re...   244    1e-62 
ref|ZP_05576421.1|  thiamine-pyrophosphate-requiring enzyme [E...   244    1e-62 
ref|YP_003409748.1|  thiamine pyrophosphate protein central re...   244    1e-62 
ref|YP_873558.1|  thiamine pyrophosphate binding domain-contai...   244    1e-62 
ref|YP_001783782.1|  thiamine pyrophosphate protein central re...   244    1e-62 
ref|YP_126955.1|  hypothetical protein lpl1616 [Legionella pne...   244    1e-62 
ref|YP_003487594.1|  amino acid synthase [Streptomyces scabiei...   243    2e-62 
ref|ZP_05662076.1|  thiamine-pyrophosphate enzyme [Enterococcu...   243    2e-62 
ref|ZP_02908338.1|  thiamine pyrophosphate protein central reg...   243    2e-62 
ref|YP_123939.1|  hypothetical protein lpp1621 [Legionella pne...   243    2e-62 
ref|YP_001250393.1|  myo-inositol catabolism protein IolD [Leg...   243    2e-62 
ref|ZP_03495178.1|  thiamine pyrophosphate protein domain prot...   243    2e-62 
ref|ZP_07278816.1|  glyoxylate carboligase [Streptomyces sp. A...   243    2e-62 
ref|ZP_08129948.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   243    2e-62 
ref|ZP_03994749.1|  acetolactate synthase [Mobiluncus mulieris...   243    2e-62 
ref|ZP_07636989.1|  putative 3D-(3,5/4)-trihydroxycyclohexane-...   243    2e-62 
emb|CBW99920.1|  hypothetical protein LPW_16771 [Legionella pn...   243    2e-62 
ref|YP_049563.1|  putative thiamine pyrophosphate-dependent pr...   243    2e-62 
ref|ZP_02891925.1|  thiamine pyrophosphate protein central reg...   243    3e-62 
ref|YP_002486230.1|  thiamine pyrophosphate protein central re...   243    3e-62 
ref|XP_002944130.1|  PREDICTED: 3D-(3,5/4)-trihydroxycyclohexa...   243    3e-62 
gb|AEB26149.1|  IolD [Bacillus amyloliquefaciens TA208]             243    3e-62 
ref|ZP_03826830.1|  putative thiamine pyrophosphate-dependent ...   243    3e-62 
ref|YP_095677.1|  myo-inositol catabolism protein IolD [Legion...   243    3e-62 
ref|ZP_08037167.1|  thiamine pyrophosphate enzyme, TPP binding...   243    3e-62 
ref|ZP_04851949.1|  pyruvate decarboxylase:pyruvate decarboxyl...   243    3e-62 
ref|YP_947724.1|  putative acetolactate synthase [Arthrobacter...   242    3e-62 
ref|ZP_07451333.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   242    3e-62 
ref|ZP_05522156.1|  acetolactate synthase [Streptomyces livida...   242    4e-62 
ref|ZP_04945925.1|  Acetolactate synthase [Burkholderia dolosa...   242    4e-62 
ref|YP_719783.1|  myo-inositol catabolism protein [Haemophilus...   242    4e-62 
ref|YP_003696434.1|  thiamine pyrophosphate protein central re...   242    4e-62 
ref|YP_001107355.1|  thiamine pyrophosphate-requiring enzyme [...   242    5e-62 
ref|ZP_06911711.1|  IolD protein [Streptomyces pristinaespiral...   242    5e-62 
ref|YP_003881529.1|  Epi-inositol hydrolase [Dickeya dadantii ...   241    7e-62 
ref|ZP_06917204.1|  acetolactate synthase [Streptomyces sviceu...   241    7e-62 
ref|YP_003260355.1|  thiamine pyrophosphate protein domain pro...   241    8e-62 
ref|ZP_02621105.1|  probable malonic semialdehyde oxidative de...   241    8e-62 
ref|YP_001455501.1|  hypothetical protein CKO_03993 [Citrobact...   241    8e-62 
ref|YP_888927.1|  IolD protein [Mycobacterium smegmatis str. M...   241    1e-61 
ref|YP_001945820.1|  myo-inositol catabolism protein [Burkhold...   241    1e-61 
ref|YP_002912012.1|  IolD protein [Burkholderia glumae BGR1] >...   241    1e-61 
ref|YP_001580077.1|  thiamine pyrophosphate protein central re...   241    1e-61 
ref|ZP_07051673.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   240    1e-61 
ref|YP_004117566.1|  thiamine pyrophosphate protein domain-con...   240    1e-61 
ref|YP_001920649.1|  probable malonic semialdehyde oxidative d...   240    1e-61 
ref|YP_003975423.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dion...   240    2e-61 
ref|YP_002396372.1|  putative malonic semialdehyde oxidative d...   240    2e-61 
ref|ZP_03215232.1|  probable malonic semialdehyde oxidative de...   240    2e-61 
ref|ZP_02345075.1|  probable malonic semialdehyde oxidative de...   240    2e-61 
ref|ZP_04654425.1|  probable malonic semialdehyde oxidative de...   240    2e-61 
ref|ZP_03223794.1|  probable malonic semialdehyde oxidative de...   240    2e-61 
gb|EFY12514.1|  malonic semialdehyde oxidative decarboxylase [...   240    2e-61 
ref|YP_002149349.1|  putative malonic semialdehyde oxidative d...   240    2e-61 
ref|ZP_03224447.1|  probable malonic semialdehyde oxidative de...   240    2e-61 
gb|AAL23251.1|  putative thiamine pyrophosphate-requiring enzy...   239    2e-61 
ref|ZP_06699698.1|  probable malonic semialdehyde oxidative de...   239    2e-61 
ref|ZP_02961456.1|  hypothetical protein PROSTU_03485 [Provide...   239    4e-61 
ref|ZP_06274944.1|  thiamine pyrophosphate protein domain prot...   239    4e-61 
gb|EFT53907.1|  thiamine pyrophosphate enzyme, TPP binding dom...   239    4e-61 
ref|YP_003509465.1|  thiamine pyrophosphate protein central re...   239    5e-61 
ref|ZP_02382481.1|  thiamine pyrophosphate enzyme domain prote...   238    5e-61 
ref|ZP_05404363.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   238    5e-61 
ref|YP_994877.1|  thiamine pyrophosphate-binding domain-contai...   238    6e-61 
ref|YP_003016918.1|  thiamine pyrophosphate protein domain pro...   238    6e-61 
ref|YP_002487023.1|  thiamine pyrophosphate protein central re...   238    6e-61 
ref|ZP_02045182.1|  hypothetical protein ACTODO_02072 [Actinom...   238    7e-61 
ref|ZP_03587923.1|  probable malonic semialdehyde oxidative de...   238    8e-61 
ref|ZP_03570729.1|  probable malonic semialdehyde oxidative de...   238    8e-61 
ref|ZP_06355381.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   238    8e-61 
ref|YP_001119229.1|  thiamine pyrophosphate enzyme, central re...   238    8e-61 
ref|YP_001008170.1|  putative thiamine pyrophosphate-dependent...   238    9e-61 
ref|YP_003209260.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dion...   238    1e-60 
ref|YP_003522030.1|  IolD [Pantoea ananatis LMG 20103] >gb|ADD...   237    1e-60 
ref|YP_001591682.1|  hypothetical protein SPAB_05579 [Salmonel...   237    1e-60 
ref|YP_003005639.1|  thiamine pyrophosphate protein domain-con...   237    1e-60 
ref|ZP_04560054.1|  thiamine pyrophosphate-dependent enzyme [C...   237    1e-60 
ref|YP_003332305.1|  thiamine pyrophosphate protein domain-con...   237    1e-60 
gb|ADZ44240.1|  putative thiamine pyrophosphate-dependent prot...   237    1e-60 
emb|CBY29360.1|  epi-inositol hydrolase [Yersinia enterocoliti...   237    2e-60 
ref|YP_001363783.1|  thiamine pyrophosphate protein central re...   236    2e-60 
ref|YP_003653663.1|  thiamine pyrophosphate protein central re...   236    2e-60 
ref|ZP_06188311.1|  myo-inositol catabolism protein IolD [Legi...   236    2e-60 
ref|YP_003922381.1|  IolD [Bacillus amyloliquefaciens DSM 7] >...   236    3e-60 
ref|ZP_06637739.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   236    3e-60 
ref|ZP_06634817.1|  probable malonic semialdehyde oxidative de...   236    3e-60 
ref|ZP_04622246.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   236    4e-60 
ref|ZP_04631479.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   236    4e-60 
ref|YP_001221518.1|  putative acetolactate synthase [Clavibact...   236    4e-60 
ref|ZP_07271530.1|  IolD protein [Streptomyces sp. SPB78] >gb|...   235    4e-60 
ref|ZP_07977261.1|  putative IolD protein [Streptomyces sp. SA...   235    5e-60 
emb|CBW15058.1|  unnamed protein product [Haemophilus parainfl...   235    5e-60 
ref|YP_003115195.1|  thiamine pyrophosphate protein central re...   235    5e-60 
ref|ZP_04612678.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   235    5e-60 
ref|ZP_07379767.1|  thiamine pyrophosphate protein domain prot...   235    6e-60 
ref|ZP_07138238.1|  thiamine pyrophosphate enzyme, TPP binding...   235    6e-60 
ref|YP_003007764.1|  putative malonic semialdehyde oxidative d...   235    6e-60 
ref|ZP_07120652.1|  thiamine pyrophosphate enzyme, TPP binding...   234    7e-60 
ref|ZP_08055558.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   234    7e-60 
ref|ZP_07525040.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   234    7e-60 
ref|YP_003932621.1|  malonic semialdehyde oxidative decarboxyl...   234    8e-60 
ref|ZP_06607929.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   234    8e-60 
ref|ZP_02327567.1|  myo-inositol catabolism protein (thiamine ...   234    8e-60 
ref|YP_003203807.1|  thiamine pyrophosphate protein central re...   234    9e-60 
ref|ZP_04640533.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   234    1e-59 
ref|ZP_06838563.1|  thiamine pyrophosphate-dependent enzyme Io...   234    1e-59 
ref|ZP_06825728.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   233    2e-59 
ref|ZP_04636923.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   233    2e-59 
ref|YP_001885502.1|  probable malonic semialdehyde oxidative d...   233    2e-59 
ref|ZP_04702062.1|  putative IolD protein [Streptomyces albus ...   233    3e-59 
ref|ZP_03514243.1|  acetolactate synthase protein (myo-inosito...   233    3e-59 
ref|NP_826518.1|  IolD protein [Streptomyces avermitilis MA-46...   232    4e-59 
ref|YP_002933547.1|  putative malonic semialdehyde oxidative d...   231    6e-59 
ref|ZP_07297641.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   231    8e-59 
ref|YP_002880751.1|  thiamine pyrophosphate protein central re...   231    1e-58 
ref|YP_001480880.1|  thiamine pyrophosphate protein central re...   231    1e-58 
dbj|BAB97555.1|  Thiamine pyrophosphate-requiring enzymes [ace...   231    1e-58 
ref|NP_599414.1|  thiamine pyrophosphate-requiring enzyme [Cor...   231    1e-58 
ref|YP_001137106.1|  hypothetical protein cgR_0241 [Corynebact...   231    1e-58 
ref|ZP_04618595.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   231    1e-58 
ref|YP_003491452.1|  thiamine pyrophosphate-dependent protein ...   230    1e-58 
ref|ZP_00996097.1|  putative IolD protein [Janibacter sp. HTCC...   230    2e-58 
ref|ZP_02482019.1|  iolD protein [Burkholderia pseudomallei 7894]   229    2e-58 
ref|YP_003940808.1|  thiamine pyrophosphate central domain-con...   229    2e-58 
ref|ZP_08027447.1|  acetolactate synthase [Actinomyces sp. ora...   229    3e-58 
ref|YP_954802.1|  thiamine pyrophosphate binding domain-contai...   229    3e-58 
ref|YP_259697.1|  iolD protein [Pseudomonas fluorescens Pf-5] ...   229    4e-58 
ref|YP_003614291.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dion...   229    5e-58 
ref|ZP_07303886.1|  acetolactate synthase [Streptomyces virido...   228    5e-58 
ref|YP_002802075.1|  myo-inositol catabolism protein IolD [Azo...   228    6e-58 
gb|ADI10143.1|  putative amino acid synthase [Streptomyces bin...   228    6e-58 
ref|YP_004240190.1|  acetolactate synthase [Arthrobacter phena...   228    9e-58 
gb|AEA69670.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hyd...   227    1e-57 
ref|YP_830320.1|  thiamine pyrophosphate binding domain-contai...   227    2e-57 
ref|YP_001926856.1|  thiamine pyrophosphate protein central re...   225    4e-57 
ref|ZP_06192744.1|  thiamine pyrophosphate protein central reg...   225    4e-57 
ref|ZP_07775018.1|  acetolactate synthase, large subunit [Pseu...   224    9e-57 
ref|ZP_07286825.1|  IolD protein [Streptomyces sp. C] >gb|EFL1...   224    9e-57 
gb|ADW05596.1|  thiamine pyrophosphate central domain-containi...   224    9e-57 
ref|YP_002872166.1|  putative thiamine pyrophosphate-dependent...   224    9e-57 
ref|ZP_02463790.1|  iolD protein [Burkholderia thailandensis M...   224    9e-57 
ref|ZP_08039896.1|  putative acetolactate synthase I, large su...   224    1e-56 
ref|ZP_04978892.1|  acetolactate synthase [Mannheimia haemolyt...   224    1e-56 
ref|ZP_03992539.1|  possible acetolactate synthase [Oribacteri...   223    2e-56 
ref|ZP_08121981.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2- dion...   223    3e-56 
ref|ZP_05882651.1|  epi-inositol hydrolase [Vibrio metschnikov...   222    4e-56 
ref|ZP_02477562.1|  myo-inositol catabolism protein [Haemophil...   222    5e-56 
ref|ZP_05992093.1|  acetolactate synthase [Mannheimia haemolyt...   222    6e-56 
ref|ZP_07603700.1|  thiamine pyrophosphate protein central reg...   221    6e-56 
ref|ZP_02388963.1|  iolD protein [Burkholderia thailandensis Bt4]   221    6e-56 
ref|ZP_05000090.1|  IolD protein [Streptomyces sp. Mg1] >gb|ED...   219    3e-55 
ref|ZP_05638715.1|  iolD protein [Pseudomonas syringae pv. tab...   218    9e-55 
ref|ZP_02471553.1|  iolD protein [Burkholderia pseudomallei B7...   218    1e-54 
ref|ZP_02455981.1|  iolD protein [Burkholderia pseudomallei 9]      218    1e-54 
ref|ZP_02498350.1|  iolD protein [Burkholderia pseudomallei 112]    217    1e-54 
ref|ZP_02411691.1|  iolD protein [Burkholderia pseudomallei 14]     217    1e-54 
ref|ZP_03500453.1|  acetolactate synthase protein (myo-inosito...   215    5e-54 
ref|YP_003646336.1|  thiamine pyrophosphate protein central re...   215    7e-54 
dbj|BAK13039.1|  probable malonic semialdehyde oxidative decar...   213    3e-53 
ref|ZP_06574086.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   208    7e-52 
ref|ZP_03636699.1|  hypothetical protein HOLDEFILI_04022 [Hold...   205    5e-51 
ref|ZP_06711046.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione...   184    8e-45 
ref|YP_001623530.1|  IolD [Renibacterium salmoninarum ATCC 332...   181    1e-43 
gb|EFR85824.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hyd...   180    2e-43 
gb|AAX24115.1|  acetolactate synthase [Sinorhizobium fredii]        169    4e-40 
emb|CBL05712.1|  Acetolactate synthase [Megamonas hypermegale ...   169    5e-40 
ref|ZP_04587931.1|  iolD protein [Pseudomonas syringae pv. ory...   167    1e-39 
gb|EFS01305.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hyd...   157    1e-36 
ref|ZP_05301938.1|  hypothetical protein LmonL_14584 [Listeria...   155    4e-36 
gb|EFR95000.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hyd...   142    4e-32 
gb|EFR95019.1|  3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hyd...   136    4e-30 
ref|ZP_07331777.1|  acetolactate synthase, large subunit, bios...   134    2e-29 
ref|YP_002953560.1|  acetolactate synthase large subunit [Desu...   128    8e-28 
ref|ZP_05296785.1|  probable malonic semialdehyde oxidative de...   126    3e-27 
ref|ZP_06367917.1|  acetolactate synthase, large subunit, bios...   124    1e-26 
ref|YP_004237376.1|  acetolactate synthase, large subunit, bio...   124    1e-26 
ref|ZP_08117438.1|  acetolactate synthase, large subunit, bios...   124    2e-26 
ref|ZP_07080878.1|  acetolactate synthase large subunit [Sphin...   122    6e-26 
ref|ZP_05391046.1|  acetolactate synthase, large subunit, bios...   122    8e-26 
ref|NP_613816.1|  acetolactate synthase catalytic subunit [Met...   121    9e-26 
ref|YP_010595.1|  acetolactate synthase large subunit, biosynt...   121    1e-25 
emb|CBK73107.1|  acetolactate synthase, large subunit, biosynt...   121    1e-25 
ref|YP_004003618.1|  acetolactate synthase, large subunit [Met...   120    1e-25 
ref|ZP_03967659.1|  acetolactate synthase [Sphingobacterium sp...   120    2e-25 
ref|YP_967136.1|  acetolactate synthase, large subunit, biosyn...   119    4e-25 
ref|YP_842552.1|  acetolactate synthase 3 catalytic subunit [M...   119    4e-25 
ref|YP_002572401.1|  acetolactate synthase large subunit [Cald...   119    4e-25 
ref|YP_003726441.1|  acetolactate synthase large subunit, bios...   119    6e-25 
ref|ZP_02078625.1|  hypothetical protein CLOLEP_00060 [Clostri...   118    9e-25 
ref|ZP_05092286.1|  acetolactate synthase, large subunit, bios...   118    9e-25 
ref|YP_003238243.1|  acetolactate synthase, large subunit, bio...   118    1e-24 
ref|NP_621734.1|  acetolactate synthase large subunit [Thermoa...   118    1e-24 
ref|YP_003780206.1|  acetolactate synthaselarge subunit [Clost...   118    1e-24 
ref|ZP_07031560.1|  acetolactate synthase, large subunit, bios...   117    1e-24 
ref|NP_578664.1|  acetolactate synthase [Pyrococcus furiosus D...   117    1e-24 
ref|YP_003839762.1|  acetolactate synthase, large subunit, bio...   117    1e-24 
ref|YP_004166414.1|  acetolactate synthase, large subunit, bio...   117    2e-24 
ref|YP_476898.1|  acetolactate synthase 3 catalytic subunit [S...   117    2e-24 
ref|ZP_03990849.1|  acetolactate synthase [Oribacterium sinus ...   117    2e-24 
ref|YP_003021309.1|  acetolactate synthase, large subunit, bio...   117    2e-24 
ref|YP_001179941.1|  acetolactate synthase, large subunit, bio...   117    2e-24 
ref|NP_247250.1|  acetolactate synthase catalytic subunit [Met...   116    3e-24 
ref|ZP_05791596.2|  acetolactate synthase, large subunit [Buty...   116    3e-24 
ref|YP_002471968.1|  hypothetical protein CKR_1503 [Clostridiu...   116    3e-24 
emb|CBA71820.1|  acetolactate synthase 2 catalytic subunit [Ar...   116    4e-24 
ref|YP_001395008.1|  IlvI [Clostridium kluyveri DSM 555] >gb|E...   116    4e-24 
ref|ZP_08109647.1|  acetolactate synthase, large subunit, bios...   116    4e-24 
ref|ZP_01288118.1|  Acetolactate synthase, large subunit, bios...   115    5e-24 
ref|ZP_07546975.1|  acetolactate synthase, large subunit, bios...   115    5e-24 
ref|YP_271482.1|  acetolactate synthase 2 catalytic subunit [C...   115    5e-24 
ref|YP_002480477.1|  acetolactate synthase, large subunit, bio...   115    6e-24 
ref|ZP_07944123.1|  acetolactate synthase [Bilophila wadsworth...   115    7e-24 
ref|YP_003885359.1|  acetolactate synthase large subunit [Cyan...   115    7e-24 
ref|YP_004121533.1|  acetolactate synthase large subunit [Desu...   115    8e-24 
ref|ZP_08095819.1|  acetolactate synthase large subunit [Plano...   115    8e-24 
ref|YP_002139546.1|  acetolactate synthase, large subunit, bio...   115    9e-24 
ref|YP_475476.1|  acetolactate synthase 3 catalytic subunit [S...   115    1e-23 
ref|YP_001232446.1|  acetolactate synthase, large subunit, bio...   115    1e-23 
ref|YP_003850701.1|  acetolactate synthase, large subunit, bio...   115    1e-23 
ref|YP_004199339.1|  acetolactate synthase large subunit [Geob...   115    1e-23 
ref|YP_002991993.1|  acetolactate synthase, large subunit, bio...   115    1e-23 
ref|YP_002250909.1|  acetolactate synthase, large subunit, bio...   114    1e-23 
ref|YP_303782.1|  acetolactate synthase 3 catalytic subunit [M...   114    1e-23 
ref|ZP_07358170.1|  acetolactate synthase, large subunit, bios...   114    1e-23 
ref|ZP_01166487.1|  acetolactate synthase large subunit [Ocean...   114    2e-23 
ref|YP_003127480.1|  acetolactate synthase, large subunit, bio...   114    2e-23 
ref|ZP_01060690.1|  putative acetolactate synthase large subun...   114    2e-23 
ref|YP_704498.1|  acetolactate synthase large subunit [Rhodoco...   114    2e-23 
ref|YP_002434582.1|  acetolactate synthase, large subunit, bio...   114    2e-23 
ref|YP_003494365.1|  acetolactate synthase large subunit [Stre...   114    2e-23 
ref|YP_002781660.1|  acetolactate synthase large subunit [Rhod...   114    2e-23 
ref|YP_001179646.1|  acetolactate synthase, large subunit, bio...   114    2e-23 
ref|ZP_08107697.1|  acetolactate synthase [Clostridium symbios...   114    2e-23 
ref|ZP_08089294.1|  acetolactate synthase [Clostridium symbios...   114    2e-23 
ref|YP_001699011.1|  acetolactate synthase large subunit [Lysi...   114    2e-23 
ref|YP_004281319.1|  acetolactate synthase, large subunit, bio...   114    2e-23 
ref|YP_003993245.1|  acetolactate synthase, large subunit, bio...   114    2e-23 
ref|ZP_07944740.1|  acetolactate synthase [Bilophila wadsworth...   114    2e-23 
ref|YP_001394471.1|  IlvB1 [Clostridium kluyveri DSM 555] >ref...   114    2e-23 
ref|YP_004094393.1|  acetolactate synthase, large subunit, bio...   114    2e-23 
ref|NP_952960.1|  acetolactate synthase large subunit, biosynt...   114    2e-23 
ref|YP_001303425.1|  acetolactate synthase large subunit [Para...   113    2e-23 
ref|YP_003457695.1|  acetolactate synthase, large subunit, bio...   113    2e-23 
ref|YP_004024805.1|  acetolactate synthase, large subunit, bio...   113    2e-23 
ref|ZP_08211904.1|  acetolactate synthase, large subunit, bios...   113    2e-23 
ref|YP_384221.1|  acetolactate synthase, large subunit [Geobac...   113    3e-23 
gb|ADI84749.1|  acetolactate synthase, large subunit, biosynth...   113    3e-23 
emb|CBL15386.1|  acetolactate synthase, large subunit [Ruminoc...   113    3e-23 
ref|YP_388660.1|  acetolactate synthase large subunit [Desulfo...   113    3e-23 
ref|ZP_01050444.1|  acetolactate synthase large subunit [Dokdo...   113    3e-23 
ref|YP_004024623.1|  acetolactate synthase, large subunit, bio...   113    3e-23 
ref|ZP_07217424.1|  acetolactate synthase, large subunit, bios...   113    3e-23 
ref|ZP_07737864.1|  acetolactate synthase, large subunit, bios...   113    3e-23 
ref|YP_004026628.1|  acetolactate synthase, large subunit, bio...   113    3e-23 
ref|ZP_05492314.1|  acetolactate synthase, large subunit, bios...   113    3e-23 
ref|YP_359378.1|  acetolactate synthase large subunit [Carboxy...   113    3e-23 
ref|YP_003675835.1|  acetolactate synthase, large subunit, bio...   113    4e-23 
ref|ZP_01053663.1|  acetolactate synthase large subunit [Polar...   112    4e-23 
ref|YP_066505.1|  acetolactate synthase isozyme III, large sub...   112    4e-23 
ref|YP_003156950.1|  acetolactate synthase, large subunit, bio...   112    4e-23 
ref|YP_003885036.1|  acetolactate synthase large subunit [Dick...   112    5e-23 
ref|YP_003475911.1|  acetolactate synthase, large subunit, bio...   112    5e-23 
ref|ZP_07015521.1|  acetolactate synthase, large subunit, bios...   112    5e-23 
ref|YP_003588829.1|  acetolactate synthase, large subunit, bio...   112    5e-23 
ref|YP_176141.1|  acetolactate synthase large subunit [Bacillu...   112    5e-23 
ref|ZP_01386649.1|  acetolactate synthase, large subunit, bios...   112    6e-23 
ref|YP_003190137.1|  acetolactate synthase, large subunit, bio...   112    6e-23 
ref|YP_003700595.1|  acetolactate synthase large subunit [Baci...   112    6e-23 
ref|NP_632694.1|  acetolactate synthase 3 catalytic subunit [M...   112    6e-23 
ref|YP_004026920.1|  acetolactate synthase, large subunit, bio...   112    7e-23 
ref|YP_002353080.1|  acetolactate synthase, large subunit, bio...   112    7e-23 
ref|YP_001664029.1|  acetolactate synthase, large subunit, bio...   112    7e-23 
ref|YP_003780502.1|  acetolactate synthaselarge subunit [Clost...   112    7e-23 
ref|ZP_07737558.1|  acetolactate synthase, large subunit, bios...   112    8e-23 
ref|YP_001404604.1|  acetolactate synthase, large subunit, bio...   112    8e-23 
ref|ZP_06076699.1|  acetolactate synthase, large subunit, bios...   112    8e-23 
ref|YP_003198524.1|  acetolactate synthase, large subunit, bio...   112    8e-23 
ref|ZP_06985972.1|  acetolactate synthase, large subunit, bios...   112    8e-23 
ref|ZP_06598311.1|  acetolactate synthase, large subunit [Orib...   112    9e-23 
ref|ZP_02233975.1|  hypothetical protein DORFOR_00831 [Dorea f...   111    9e-23 
ref|ZP_01116331.1|  acetolactate synthase III large subunit [R...   111    1e-22 
ref|YP_004181953.1|  acetolactate synthase large subunit [Terr...   111    1e-22 
ref|YP_754808.1|  acetolactate synthase large subunit [Syntrop...   111    1e-22 
ref|YP_003002510.1|  acetolactate synthase 2 catalytic subunit...   111    1e-22 
ref|ZP_01690811.1|  acetolactate synthase, large subunit, bios...   111    1e-22 
ref|YP_003826821.1|  acetolactate synthase, large subunit [Ace...   111    1e-22 
ref|YP_003839926.1|  acetolactate synthase, large subunit, bio...   111    1e-22 
ref|ZP_01725507.1|  acetolactate synthase large subunit [Bacil...   111    1e-22 
ref|NP_488653.1|  acetolactate synthase 3 catalytic subunit [N...   111    1e-22 
ref|ZP_08048623.1|  acetolactate synthase, large subunit, bios...   111    1e-22 
ref|YP_003901132.1|  acetolactate synthase large subunit, bios...   111    1e-22 
ref|YP_323265.1|  acetolactate synthase 3 catalytic subunit [A...   111    1e-22 
ref|YP_001952737.1|  acetolactate synthase, large subunit, bio...   111    1e-22 
ref|YP_003335454.1|  acetolactate synthase large subunit [Dick...   111    1e-22 
ref|ZP_04107848.1|  hypothetical protein bthur0007_16580 [Baci...   110    1e-22 
ref|YP_001906138.1|  acetolactate synthase 2 catalytic subunit...   110    1e-22 
ref|ZP_04244732.1|  hypothetical protein bcere0017_16190 [Baci...   110    2e-22 
ref|YP_002536969.1|  acetolactate synthase, large subunit, bio...   110    2e-22 
ref|ZP_07828949.1|  acetolactate synthase, large subunit, bios...   110    2e-22 
ref|YP_680322.1|  acetolactate synthase large subunit [Cytopha...   110    2e-22 
ref|ZP_04096028.1|  hypothetical protein bthur0009_16380 [Baci...   110    2e-22 
ref|YP_001661679.1|  acetolactate synthase, large subunit, bio...   110    2e-22 
ref|ZP_06050913.1|  acetolactate synthase large subunit [Grimo...   110    2e-22 
ref|ZP_03100840.1|  acetolactate synthase, large subunit, bios...   110    2e-22 
ref|NP_895067.1|  acetolactate synthase 3 catalytic subunit [P...   110    2e-22 
ref|NP_844268.1|  acetolactate synthase 3 catalytic subunit [B...   110    2e-22 
ref|ZP_05392511.1|  acetolactate synthase, large subunit, bios...   110    2e-22 
ref|ZP_06112028.1|  acetolactate synthase, large subunit [Clos...   110    2e-22 
ref|YP_001560439.1|  acetolactate synthase, large subunit, bio...   110    2e-22 
ref|YP_002572563.1|  acetolactate synthase large subunit [Cald...   110    2e-22 
ref|ZP_02155928.1|  acetolactate synthase II large subunit [Sh...   110    2e-22 
ref|ZP_03734581.1|  acetolactate synthase, large subunit, bios...   110    2e-22 
ref|YP_579789.1|  acetolactate synthase 3 catalytic subunit [P...   110    2e-22 
ref|YP_502706.1|  acetolactate synthase, large subunit, biosyn...   110    2e-22 
ref|YP_004195962.1|  acetolactate synthase large subunit [Desu...   110    2e-22 
ref|ZP_03707685.1|  hypothetical protein CLOSTMETH_02440 [Clos...   110    2e-22 
ref|YP_001321205.1|  acetolactate synthase, large subunit, bio...   110    2e-22 
ref|ZP_04150826.1|  hypothetical protein bpmyx0001_16230 [Baci...   110    2e-22 
ref|ZP_03305064.1|  hypothetical protein ANHYDRO_01499 [Anaero...   110    2e-22 
ref|YP_004172960.1|  acetolactate synthase, large subunit [Ana...   110    2e-22 
ref|YP_565425.1|  acetolactate synthase 3 catalytic subunit [M...   110    2e-22 
ref|YP_002756461.1|  acetolactate synthase, large subunit, bio...   110    3e-22 
ref|YP_002950557.1|  acetolactate synthase catalytic subunit [...   110    3e-22 
ref|YP_001500208.1|  acetolactate synthase 2 catalytic subunit...   110    3e-22 
ref|YP_447088.1|  IlvB1 [Methanosphaera stadtmanae DSM 3091] >...   110    3e-22 
ref|ZP_04855394.1|  conserved hypothetical protein [Ruminococc...   110    3e-22 
ref|ZP_04822345.1|  acetolactate synthase, large subunit, bios...   110    3e-22 
ref|YP_003247730.1|  acetolactate synthase, large subunit, bio...   110    3e-22 
ref|ZP_04078088.1|  hypothetical protein bthur0012_17080 [Baci...   110    3e-22 
ref|YP_263824.1|  acetolactate synthase 3 catalytic subunit [P...   110    3e-22 
ref|ZP_05026603.1|  acetolactate synthase, large subunit, bios...   110    3e-22 
ref|ZP_01253275.1|  putative acetolactate synthase large subun...   110    3e-22 
ref|ZP_01857674.1|  acetolactate synthase III (Precursor) [Pla...   109    3e-22 
ref|YP_001884928.1|  acetolactate synthase, large subunit, bio...   109    3e-22 
ref|ZP_03108556.1|  acetolactate synthase, large subunit, bios...   109    3e-22 
ref|ZP_05898428.1|  acetolactate synthase, large subunit [Sele...   109    3e-22 
ref|YP_003690048.1|  acetolactate synthase, large subunit, bio...   109    3e-22 
ref|YP_003960730.1|  acetolactate synthase [Eubacterium limosu...   109    3e-22 
ref|ZP_07051179.1|  acetolactate synthase large subunit [Lysin...   109    4e-22 
ref|YP_894460.1|  acetolactate synthase 3 catalytic subunit [B...   109    4e-22 
ref|NP_874919.1|  acetolactate synthase 3 catalytic subunit [P...   109    4e-22 
ref|ZP_07519740.1|  acetolactate synthase 2 catalytic subunit ...   109    4e-22 
ref|YP_003848954.1|  acetolactate synthase, large subunit [Met...   109    4e-22 
ref|YP_002414925.1|  acetolactate synthase 2 catalytic subunit...   109    4e-22 
ref|NP_276558.1|  acetolactate synthase catalytic subunit [Met...   109    4e-22 
ref|ZP_08075754.1|  acetolactate synthase, large subunit, bios...   109    4e-22 
ref|ZP_07449345.1|  acetolactate synthase 2 catalytic subunit ...   109    4e-22 
ref|YP_004001925.1|  acetolactate synthase, large subunit, bio...   109    4e-22 
ref|YP_002018988.1|  acetolactate synthase, large subunit, bio...   109    4e-22 
ref|ZP_05403307.1|  acetolactate synthase, large subunit [Mits...   109    5e-22 
ref|YP_002366569.1|  acetolactate synthase 3 catalytic subunit...   109    5e-22 
ref|YP_003537252.1|  acetolactate synthase isozyme II large su...   109    5e-22 
ref|YP_003993068.1|  acetolactate synthase, large subunit, bio...   109    5e-22 
ref|YP_001475897.1|  acetolactate synthase 2 catalytic subunit...   109    5e-22 
ref|ZP_05629184.1|  acetolactate synthase 3 catalytic subunit ...   109    5e-22 
ref|ZP_04278314.1|  hypothetical protein bcere0011_16470 [Baci...   109    5e-22 
ref|ZP_06391968.1|  thiamine pyrophosphate protein TPP binding...   109    5e-22 
ref|ZP_05849999.1|  acetolactate synthase, large subunit, bios...   109    5e-22 
ref|YP_001644574.1|  acetolactate synthase 3 catalytic subunit...   109    5e-22 
ref|ZP_04101600.1|  hypothetical protein bthur0008_16630 [Baci...   109    5e-22 
ref|ZP_04322847.1|  hypothetical protein bcere0001_16570 [Baci...   109    5e-22 
gb|AEA85283.1|  acetolactate synthase 3 catalytic subunit [Pse...   109    5e-22 
ref|YP_003961236.1|  acetolactate synthase [Eubacterium limosu...   109    5e-22 
ref|YP_003529516.1|  acetolactate synthase large subunit [Erwi...   109    5e-22 
ref|ZP_04119901.1|  hypothetical protein bthur0005_16800 [Baci...   109    5e-22 
ref|YP_003615922.1|  acetolactate synthase, large subunit, bio...   109    5e-22 
ref|YP_002603361.1|  IlvG [Desulfobacterium autotrophicum HRM2...   109    5e-22 
ref|ZP_07707757.1|  acetolactate synthase catalytic subunit [B...   109    6e-22 
ref|YP_001173731.1|  acetolactate synthase 3 catalytic subunit...   109    6e-22 
ref|YP_003399915.1|  acetolactate synthase, large subunit, bio...   109    6e-22 
ref|YP_003284166.1|  acetolactate synthase large subunit [Blat...   108    6e-22 
ref|ZP_07621210.1|  acetolactate synthase 2 catalytic subunit ...   108    6e-22 
ref|ZP_07504676.1|  acetolactate synthase 2 catalytic subunit ...   108    6e-22 
ref|ZP_03758441.1|  hypothetical protein CLOSTASPAR_02453 [Clo...   108    6e-22 
ref|ZP_02233750.1|  hypothetical protein DORFOR_00602 [Dorea f...   108    6e-22 
gb|EGB69479.1|  acetolactate synthase [Escherichia coli TW10509]    108    6e-22 
ref|ZP_04222087.1|  hypothetical protein bcere0021_16800 [Baci...   108    6e-22 
ref|YP_002295326.1|  acetolactate synthase 2 catalytic subunit...   108    7e-22 
ref|ZP_03051988.1|  acetolactate synthase, large subunit, isoz...   108    7e-22 
gb|EFW73124.1|  Acetolactate synthase large subunit [Escherich...   108    7e-22 
ref|YP_036023.1|  acetolactate synthase 3 catalytic subunit [B...   108    7e-22 
ref|ZP_05620563.1|  acetolactate synthase, large subunit, bios...   108    7e-22 
ref|ZP_03931109.1|  acetolactate synthase [Anaerococcus tetrad...   108    7e-22 
gb|AEB51876.1|  acetolactate synthase 2 catalytic subunit [Aer...   108    7e-22 
ref|NP_127022.1|  acetolactate synthase, large subunit [Pyroco...   108    7e-22 
ref|YP_004317513.1|  acetolactate synthase, large subunit, bio...   108    7e-22 
ref|YP_001016784.1|  acetolactate synthase 3 catalytic subunit...   108    7e-22 
ref|ZP_04207833.1|  hypothetical protein bcere0024_16250 [Baci...   108    8e-22 
ref|ZP_07098969.1|  acetolactate synthase, large subunit [Esch...   108    8e-22 
ref|YP_004001744.1|  acetolactate synthase, large subunit, bio...   108    8e-22 
ref|YP_003565137.1|  acetolactate synthase, large subunit, bio...   108    8e-22 
ref|YP_002507705.1|  acetolactate synthase, large subunit, bio...   108    8e-22 
ref|ZP_04168380.1|  hypothetical protein bmyco0001_16390 [Baci...   108    8e-22 
ref|ZP_05105662.1|  acetolactate synthase, large subunit, bios...   108    8e-22 
ref|YP_543276.1|  acetolactate synthase 2 catalytic subunit [E...   108    8e-22 
ref|ZP_07514659.1|  acetolactate synthase 2 catalytic subunit ...   108    8e-22 
ref|YP_002991370.1|  acetolactate synthase, large subunit, bio...   108    8e-22 
ref|ZP_07903476.1|  acetolactate synthase large subunit [Eubac...   108    9e-22 
gb|EGC97117.1|  acetolactate synthase 2 catalytic subunit [Esc...   108    9e-22 
ref|YP_003496879.1|  acetolactate synthase large subunit [Defe...   108    9e-22 
ref|ZP_02685181.1|  acetolactate synthase, large subunit, isoz...   108    9e-22 
ref|NP_756548.1|  acetolactate synthase 2 catalytic subunit [E...   108    9e-22 
ref|ZP_04753960.1|  acetolactate synthase 3 catalytic subunit ...   108    9e-22 
ref|YP_004245227.1|  acetolactate synthase, large subunit, bio...   108    9e-22 
ref|YP_001878250.1|  acetolactate synthase, large subunit, bio...   108    9e-22 
gb|AEB28693.1|  Acetolactate synthase large subunit [Francisel...   108    1e-21 
ref|ZP_01117621.1|  putative acetolactate synthase large subun...   108    1e-21 
ref|YP_002408947.1|  acetolactate synthase 2 catalytic subunit...   108    1e-21 
ref|ZP_07833170.1|  acetolactate synthase, large subunit, bios...   108    1e-21 
ref|ZP_03221174.1|  acetolactate synthase, large subunit, isoz...   108    1e-21 
ref|YP_083261.1|  acetolactate synthase 3 catalytic subunit [B...   108    1e-21 
ref|YP_004289317.1|  acetolactate synthase, large subunit, bio...   108    1e-21 
ref|ZP_07185464.1|  acetolactate synthase, large subunit [Esch...   108    1e-21 
emb|CBX29494.1|  Acetolactate synthase large subunit [uncultur...   108    1e-21 
emb|CAP78217.1|  acetolactate synthase isozyme II large subuni...   108    1e-21 
ref|YP_002331529.1|  acetolactate synthase 2 catalytic subunit...   108    1e-21 
ref|YP_001243976.1|  acetolactate synthase, large subunit, bio...   108    1e-21 
ref|ZP_05705539.1|  biosynthetic family acetolactate synthase,...   108    1e-21 
ref|ZP_08169064.1|  acetolactate synthase, large subunit, bios...   108    1e-21 
gb|EFU60059.1|  acetolactate synthase, large subunit [Escheric...   108    1e-21 
ref|ZP_07088842.1|  acetolactate synthase large subunit [Chrys...   108    1e-21 
ref|ZP_07154641.1|  acetolactate synthase, large subunit [Esch...   108    1e-21 
ref|YP_003639147.1|  acetolactate synthase, large subunit, bio...   108    1e-21 
ref|ZP_03461770.1|  hypothetical protein BACPEC_00827 [Bactero...   108    1e-21 
ref|ZP_06354281.1|  acetolactate synthase, large subunit [Citr...   108    1e-21 
ref|ZP_07626343.1|  acetolactate synthase 2 catalytic subunit ...   108    1e-21 
ref|ZP_03800125.1|  hypothetical protein COPCOM_02391 [Coproco...   108    1e-21 
ref|ZP_04989930.1|  acetolactate synthase large subunit [Franc...   108    1e-21 
ref|ZP_04227342.1|  hypothetical protein bcere0020_16180 [Baci...   108    1e-21 
ref|ZP_06655876.1|  acetolactate synthase [Escherichia coli B3...   108    1e-21 
ref|ZP_06659859.1|  acetolactate synthase [Escherichia coli B1...   108    1e-21 
ref|YP_001614370.1|  acetolactate synthase [Sorangium cellulos...   107    1e-21 
ref|NP_618663.1|  acetolactate synthase 3 catalytic subunit [M...   107    1e-21 
ref|ZP_08005882.1|  acetolactate synthase large subunit [Bacil...   107    1e-21 
ref|YP_003125738.1|  acetolactate synthase, large subunit, bio...   107    1e-21 
ref|YP_003121618.1|  acetolactate synthase, large subunit, bio...   107    1e-21 
ref|ZP_03062295.1|  acetolactate synthase, large subunit, isoz...   107    1e-21 
ref|ZP_04755916.1|  acetolactate synthase large subunit [Franc...   107    1e-21 
ref|YP_898683.1|  acetolactate synthase large subunit [Francis...   107    1e-21 
ref|YP_001465249.1|  acetolactate synthase 2 catalytic subunit...   107    1e-21 
ref|ZP_03717932.1|  hypothetical protein EUBHAL_03019 [Eubacte...   107    1e-21 
ref|ZP_08060450.1|  acetolactate synthase large subunit [Strep...   107    1e-21 
ref|YP_001460561.1|  acetolactate synthase 2 catalytic subunit...   107    1e-21 
ref|ZP_03027927.1|  acetolactate synthase, large subunit, isoz...   107    1e-21 
ref|YP_003231716.1|  acetolactate synthase II large subunit Il...   107    1e-21 
ref|YP_410070.1|  acetolactate synthase 2 catalytic subunit [S...   107    1e-21 
ref|NP_709573.1|  acetolactate synthase 2 catalytic subunit [S...   107    1e-21 
ref|NP_290399.1|  acetolactate synthase 2 catalytic subunit [E...   107    1e-21 
ref|ZP_07653501.1|  acetolactate synthase, large subunit, bios...   107    1e-21 
ref|ZP_04455414.1|  hypothetical protein GCWU000342_01432 [Shu...   107    1e-21 
gb|EFZ59015.1|  acetolactate synthase, large subunit, biosynth...   107    1e-21 
ref|YP_002389245.1|  acetolactate synthase 2 catalytic subunit...   107    1e-21 
ref|YP_002749131.1|  acetolactate synthase, large subunit, bio...   107    2e-21 
ref|ZP_02084769.1|  hypothetical protein CLOBOL_02299 [Clostri...   107    2e-21 
emb|CBK79450.1|  acetolactate synthase, large subunit [Coproco...   107    2e-21 
ref|ZP_02904269.1|  acetolactate synthase, large subunit, isoz...   107    2e-21 
ref|YP_286275.1|  acetolactate synthase, large subunit [Dechlo...   107    2e-21 
ref|ZP_04174088.1|  hypothetical protein bcere0030_17370 [Baci...   107    2e-21 
ref|YP_001422128.1|  acetolactate synthase catalytic subunit [...   107    2e-21 
ref|YP_001746089.1|  acetolactate synthase 2 catalytic subunit...   107    2e-21 
ref|YP_142202.1|  acetolactate synthase catalytic subunit [Str...   107    2e-21 
emb|CBL14941.1|  acetolactate synthase, large subunit [Ruminoc...   107    2e-21 
ref|YP_140287.1|  acetolactate synthase catalytic subunit [Str...   107    2e-21 
gb|EGC04984.1|  acetolactate synthase [Escherichia fergusonii ...   107    2e-21 
emb|CBK77030.1|  acetolactate synthase, large subunit, biosynt...   107    2e-21 
ref|YP_875552.1|  thiamine pyrophosphate-requiring enzyme [Cen...   107    2e-21 
ref|ZP_08030841.1|  acetolactate synthase, large subunit [Sele...   107    2e-21 
ref|YP_002429734.1|  acetolactate synthase, large subunit, bio...   107    2e-21 
ref|YP_001676143.1|  acetolactate synthase 2 catalytic subunit...   107    2e-21 
sp|P00892.3|ILVG_ECOLI  RecName: Full=Acetolactate synthase is...   107    2e-21 
ref|ZP_05439981.1|  acetolactate synthase 2 catalytic subunit ...   107    2e-21 
ref|YP_436992.1|  acetolactate synthase 3 catalytic subunit [H...   107    2e-21 
ref|ZP_03070680.1|  acetolactate synthase, large subunit, isoz...   107    2e-21 
ref|ZP_07990300.1|  acetolactate synthase 1 catalytic subunit ...   107    2e-21 
ref|YP_004111419.1|  acetolactate synthase large subunit [Desu...   107    2e-21 
ref|ZP_05126795.1|  acetolactate synthase, large subunit, bios...   107    2e-21 
ref|ZP_04857606.1|  conserved hypothetical protein [Ruminococc...   107    2e-21 
gb|ACI75111.1|  acetolactate synthase II small subunit [Escher...   107    2e-21 
ref|YP_003195872.1|  putative acetolactate synthase large subu...   107    2e-21 
ref|YP_002445231.1|  acetolactate synthase, large subunit, bio...   107    2e-21 
ref|ZP_04873032.1|  acetolactate synthase II [Escherichia sp. ...   107    2e-21 
ref|ZP_00740942.1|  Acetolactate synthase large subunit [Bacil...   107    2e-21 
ref|ZP_01793476.1|  acetolactate synthase 3 catalytic subunit ...   107    2e-21 
gb|AAA67571.1|  acetohydroxy acid synthase II, large subunit [...   107    2e-21 
ref|YP_821171.1|  acetolactate synthase catalytic subunit [Str...   107    2e-21 
dbj|BAJ45504.1|  acetolactate synthase II [Escherichia coli DH1]    107    2e-21 
gb|AAA24608.1|  acetolactate synthase II [Escherichia coli]         107    2e-21 
ref|NP_228358.1|  acetolactate synthase, large subunit [Thermo...   107    2e-21 
ref|ZP_04671373.1|  conserved hypothetical protein [Clostridia...   107    2e-21 
ref|ZP_03754463.1|  hypothetical protein ROSEINA2194_02888 [Ro...   107    2e-21 
ref|ZP_04125982.1|  hypothetical protein bthur0004_17210 [Baci...   107    2e-21 
ref|ZP_01890127.1|  putative acetolactate synthase large subun...   107    2e-21 
ref|YP_001942801.1|  acetolactate synthase, large subunit, bio...   107    2e-21 
emb|CAA23558.1|  ilvG [Escherichia coli]                            107    2e-21 
ref|ZP_05993201.1|  acetolactate synthase [Mannheimia haemolyt...   107    2e-21 
ref|YP_004151074.1|  acetolactate synthase, large subunit, bio...   107    2e-21 
ref|YP_691060.1|  acetolactate synthase 2 catalytic subunit [S...   107    2e-21 
ref|ZP_07137870.1|  acetolactate synthase, large subunit [Esch...   107    2e-21 
ref|YP_911328.1|  acetolactate synthase, large subunit [Chloro...   107    2e-21 
ref|YP_002148829.1|  acetolactate synthase 2 catalytic subunit...   107    3e-21 
ref|YP_003671052.1|  thiamine pyrophosphate protein central re...   107    3e-21 
gb|ADI22552.1|  thiamine pyrophosphate-requiring enzymes [uncu...   107    3e-21 
gb|AAF13795.1|AF129503_2  acetohydroxy acid synthase large sub...   107    3e-21 
ref|ZP_04641215.1|  Acetolactate synthase large subunit [Yersi...   107    3e-21 
ref|ZP_04978911.1|  acetolactate synthase [Mannheimia haemolyt...   107    3e-21 
dbj|BAI86322.1|  acetolactate synthase catalytic subunit [Baci...   106    3e-21 
ref|NP_390709.1|  acetolactate synthase catalytic subunit [Bac...   106    3e-21 
ref|ZP_05988636.1|  acetolactate synthase [Mannheimia haemolyt...   106    3e-21 
ref|YP_003345845.1|  acetolactate synthase, large subunit, bio...   106    3e-21 
ref|YP_001550414.1|  acetolactate synthase 3 catalytic subunit...   106    3e-21 
ref|ZP_04083939.1|  hypothetical protein bthur0011_16090 [Baci...   106    3e-21 
ref|ZP_03056159.1|  acetolactate synthase [Bacillus pumilus AT...   106    3e-21 
ref|YP_001738428.1|  acetolactate synthase, large subunit, bio...   106    3e-21 
ref|YP_003893624.1|  acetolactate synthase large subunit, bios...   106    3e-21 
ref|YP_003011641.1|  acetolactate synthase large subunit, bios...   106    3e-21 
ref|ZP_02039834.1|  hypothetical protein RUMGNA_00588 [Ruminoc...   106    3e-21 
ref|YP_001678275.1|  acetolactate synthase large subunit [Fran...   106    4e-21 
ref|YP_359375.1|  acetolactate synthase large subunit [Carboxy...   106    4e-21 
ref|YP_002639522.1|  acetolactate synthase 2 catalytic subunit...   106    4e-21 
gb|AEB24941.1|  acetolactate synthase catalytic subunit [Bacil...   106    4e-21 
ref|YP_312701.1|  acetolactate synthase 2 catalytic subunit [S...   106    4e-21 
ref|YP_003823800.1|  acetolactate synthase, large subunit, bio...   106    4e-21 
ref|YP_003585318.1|  acetolactate synthase large subunit [Zuno...   106    4e-21 
ref|YP_003256862.1|  putative acetolactate synthase large subu...   106    4e-21 
ref|ZP_04305661.1|  hypothetical protein bcere0005_16530 [Baci...   106    4e-21 
ref|ZP_04202725.1|  hypothetical protein bcere0025_16410 [Baci...   106    4e-21 
ref|ZP_04114357.1|  hypothetical protein bthur0006_16750 [Baci...   106    4e-21 
ref|NP_462792.1|  acetolactate synthase 2 catalytic subunit [S...   106    4e-21 
ref|ZP_08067532.1|  acetolactate synthase large subunit [Actin...   106    4e-21 
ref|YP_003960677.1|  putative acetolactate synthase large subu...   106    4e-21 
ref|YP_002474682.1|  acetolactate synthase 3 catalytic subunit...   106    4e-21 
ref|ZP_03289204.1|  hypothetical protein CLONEX_01404 [Clostri...   106    4e-21 
ref|ZP_01786788.1|  acetolactate synthase 3 catalytic subunit ...   106    4e-21 
ref|YP_003921234.1|  acetolactate synthase large subunit [Baci...   106    4e-21 
emb|CBL26543.1|  acetolactate synthase, large subunit, biosynt...   106    4e-21 
ref|ZP_01628200.1|  acetolactate synthase III large subunit [N...   106    4e-21 
ref|YP_152835.1|  acetolactate synthase 2 catalytic subunit [S...   106    4e-21 
ref|YP_002647207.1|  acetolactate synthase 2 catalytic subunit...   106    4e-21 
ref|ZP_06874091.1|  acetolactate synthase catalytic subunit [B...   106    4e-21 
ref|ZP_02033764.1|  hypothetical protein PARMER_03799 [Parabac...   106    4e-21 
emb|CBL20198.1|  acetolactate synthase, large subunit, biosynt...   106    4e-21 
gb|ADO81060.1|  Acetolactate synthase III large subunit [Haemo...   106    4e-21 
ref|ZP_02663413.1|  acetolactate synthase, large subunit, isoz...   106    4e-21 
ref|ZP_03066874.1|  acetolactate synthase, large subunit, isoz...   106    4e-21 
ref|YP_004339736.1|  acetolactate synthase large subunit [Hipp...   106    5e-21 
ref|YP_002217840.1|  acetolactate synthase 2 catalytic subunit...   106    5e-21 
ref|ZP_02669884.1|  acetolactate synthase, large subunit, isoz...   106    5e-21 
ref|ZP_02834955.1|  acetolactate synthase, large subunit, isoz...   105    5e-21 
ref|NP_045101.1|  acetohydroxyacid synthase large subunit [Cya...   105    5e-21 
ref|ZP_02478424.1|  acetolactate synthase 3 catalytic subunit ...   105    5e-21 
ref|ZP_04316993.1|  hypothetical protein bcere0002_16590 [Baci...   105    5e-21 
ref|ZP_02701520.1|  acetolactate synthase, large subunit, isoz...   105    5e-21 
ref|ZP_01783510.1|  acetolactate synthase III large subunit [H...   105    5e-21 
ref|YP_001529918.1|  acetolactate synthase, large subunit, bio...   105    5e-21 
gb|EGB59507.1|  acetolactate synthase [Escherichia coli M863] ...   105    5e-21 
ref|ZP_03476745.1|  hypothetical protein PRABACTJOHN_02419 [Pa...   105    5e-21 
ref|ZP_07751596.1|  acetolactate synthase, large subunit, bios...   105    5e-21 
ref|YP_002384796.1|  acetolactate synthase 2 catalytic subunit...   105    5e-21 
ref|YP_405399.1|  acetolactate synthase 2 catalytic subunit [S...   105    5e-21 
ref|ZP_03369833.1|  acetolactate synthase 2 catalytic subunit ...   105    5e-21 
emb|CBL21324.1|  acetolactate synthase, large subunit, biosynt...   105    5e-21 
ref|ZP_00514506.1|  Acetolactate synthase, large subunit, bios...   105    5e-21 
ref|YP_004342138.1|  acetolactate synthase large subunit, bios...   105    6e-21 
ref|ZP_03166871.1|  hypothetical protein RUMLAC_00527 [Ruminoc...   105    6e-21 
ref|ZP_03161821.1|  acetolactate synthase, large subunit, isoz...   105    6e-21 
ref|ZP_03214043.1|  acetolactate synthase, large subunit, isoz...   105    6e-21 
ref|YP_326753.1|  acetolactate synthase large subunit [Natrono...   105    6e-21 
dbj|BAI90040.1|  acetolactate synthase [Arthrospira platensis ...   105    6e-21 
ref|ZP_04569328.1|  acetolactate synthase [Fusobacterium sp. 2...   105    6e-21 
ref|YP_862144.1|  acetolactate synthase large subunit [Gramell...   105    6e-21 
ref|NP_457847.1|  acetolactate synthase 2 catalytic subunit [S...   105    6e-21 
ref|YP_001290857.1|  acetolactate synthase 3 catalytic subunit...   105    6e-21 
ref|NP_978250.1|  acetolactate synthase 3 catalytic subunit [B...   105    6e-21 
ref|YP_004138967.1|  acetolactate synthase large subunit [Haem...   105    6e-21 
ref|ZP_03376748.1|  acetolactate synthase 2 catalytic subunit ...   105    6e-21 
ref|ZP_03716718.1|  hypothetical protein EUBHAL_01782 [Eubacte...   105    6e-21 
ref|ZP_04196520.1|  hypothetical protein bcere0026_12440 [Baci...   105    6e-21 
ref|YP_047618.1|  acetolactate synthase 3 catalytic subunit [A...   105    6e-21 
ref|YP_003803325.1|  acetolactate synthase, large subunit, bio...   105    6e-21 
ref|ZP_04467204.1|  acetolactate synthase 3 catalytic subunit ...   105    6e-21 
ref|NP_439730.1|  acetolactate synthase 3 catalytic subunit [H...   105    6e-21 
gb|EFY09933.1|  acetolactate synthase 2 catalytic subunit [Sal...   105    7e-21 
ref|ZP_05044392.1|  acetolactate synthase, large subunit, bios...   105    7e-21 
gb|AAA24021.1|  ilvG [Escherichia coli]                             105    7e-21 
ref|YP_001010906.1|  acetolactate synthase 3 catalytic subunit...   105    7e-21 
ref|ZP_07330116.1|  acetolactate synthase, large subunit, bios...   105    7e-21 
ref|ZP_03275274.1|  acetolactate synthase, large subunit, bios...   105    7e-21 
ref|YP_003526222.1|  acetolactate synthase, large subunit, bio...   105    7e-21 
ref|NP_790820.1|  acetolactate synthase, large subunit, biosyn...   105    7e-21 
ref|YP_001644194.1|  acetolactate synthase catalytic subunit [...   105    7e-21 
ref|ZP_06541125.1|  acetolactate synthase 2 catalytic subunit ...   105    7e-21 
ref|ZP_07960235.1|  acetolactate synthase [Lachnospiraceae bac...   105    7e-21 
ref|ZP_07229712.1|  acetolactate synthase 3 catalytic subunit ...   105    7e-21 
ref|ZP_03601309.1|  acetolactate synthase catalytic subunit [B...   105    7e-21 
ref|ZP_03231724.1|  acetolactate synthase, large subunit, bios...   105    7e-21 
ref|YP_003994933.1|  acetolactate synthase, large subunit, bio...   105    8e-21 
ref|ZP_08160649.1|  acetolactate synthase, large subunit, bios...   105    8e-21 
ref|ZP_06345135.1|  acetolactate synthase, large subunit [Clos...   105    8e-21 
ref|ZP_02347081.1|  acetolactate synthase, large subunit, isoz...   105    8e-21 
ref|ZP_04590550.1|  acetolactate synthase 3 catalytic subunit ...   105    8e-21 
ref|ZP_04452327.1|  hypothetical protein GCWU000182_01630 [Abi...   105    8e-21 
ref|ZP_04958014.1|  acetolactate synthase, large subunit, bios...   105    8e-21 
ref|ZP_03362018.1|  acetolactate synthase 2 catalytic subunit ...   105    8e-21 
ref|YP_002309780.1|  acetolactate synthase 2 catalytic subunit...   105    8e-21 
ref|NP_245807.1|  acetolactate synthase 3 catalytic subunit [P...   105    8e-21 
ref|YP_003706906.1|  acetolactate synthase, large subunit, bio...   105    8e-21 
gb|ABZ07988.1|  putative Thiamine pyrophosphate enzyme, N-term...   105    8e-21 
ref|ZP_04238939.1|  hypothetical protein bcere0018_16120 [Baci...   105    8e-21 
ref|YP_003722686.1|  acetolactate synthase large subunit ['Nos...   105    8e-21 
ref|YP_003664179.1|  acetolactate synthase 3 catalytic subunit...   105    8e-21 
ref|YP_001451717.1|  acetolactate synthase 2 catalytic subunit...   105    8e-21 
ref|NP_831551.1|  acetolactate synthase 3 catalytic subunit [B...   105    8e-21 
gb|EFR56974.1|  acetolactate synthase, large subunit, biosynth...   105    8e-21 
ref|ZP_02659278.1|  acetolactate synthase, large subunit, isoz...   105    8e-21 
emb|CBK63385.1|  acetolactate synthase, large subunit [Alistip...   105    9e-21 
ref|ZP_07462066.1|  acetolactate synthase large subunit [Strep...   105    9e-21 
ref|YP_003390675.1|  acetolactate synthase, large subunit, bio...   105    9e-21 
ref|ZP_03342439.1|  acetolactate synthase 2 catalytic subunit ...   105    9e-21 
ref|YP_001337906.1|  acetolactate synthase 2 catalytic subunit...   105    9e-21 
ref|YP_001590983.1|  acetolactate synthase 2 catalytic subunit...   105    9e-21 
ref|YP_002917105.1|  acetolactate synthase 2 catalytic subunit...   105    9e-21 
ref|YP_273153.1|  acetolactate synthase 3 catalytic subunit [P...   105    9e-21 
ref|ZP_05920800.1|  acetolactate synthase [Pasteurella dagmati...   105    1e-20 
gb|EFW86255.1|  acetolactate synthase 3 catalytic subunit [Pse...   105    1e-20 
ref|ZP_07719528.1|  acetolactate synthase, large subunit, bios...   105    1e-20 
ref|YP_004218567.1|  acetolactate synthase, large subunit, bio...   105    1e-20 
ref|ZP_04167998.1|  hypothetical protein bmyco0001_12560 [Baci...   105    1e-20 
ref|ZP_01868734.1|  acetolactate synthase II large subunit [Vi...   105    1e-20 
ref|ZP_08193783.1|  acetolactate synthase, large subunit, bios...   104    1e-20 
ref|YP_001395486.1|  IlvB2 [Clostridium kluyveri DSM 555] >ref...   104    1e-20 
ref|ZP_04294095.1|  hypothetical protein bcere0007_13110 [Baci...   104    1e-20 
ref|ZP_06058748.1|  thiamine pyrophosphate-requiring enzyme [A...   104    1e-20


>gb|ABZ06335.1| putative Thiamine pyrophosphate enzyme, central domain protein 
[uncultured marine microorganism HF4000_009A22]
Length=614

 Score =  423 bits (1087),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 193/282 (68%), Positives = 232/282 (82%), Gaps = 0/282 (0%)

Query  1    VLDKLWEEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAV  60
             L +  +E Q ELP +RGHHEQNMALT +AYARAKRR+QIFVATSSVGPGSTNMVTAA V
Sbjct  45   CLGQALQENQKELPTWRGHHEQNMALTAVAYARAKRRRQIFVATSSVGPGSTNMVTAAGV  104

Query  61   ALSNRLPILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILT  120
            A+SNRLPIL LPGD +++R PDP LQQVEHFN+P  TQND+FK V+RYFDRITRPEQIL 
Sbjct  105  AMSNRLPILFLPGDAYANRMPDPALQQVEHFNNPGITQNDAFKPVTRYFDRITRPEQILQ  164

Query  121  SLPQAINVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAAD  180
            +LPQAI +MLDPADCGPA +S+ QD QGE +DYPE FF+E++H IRR  PD  QI++AA+
Sbjct  165  TLPQAIQIMLDPADCGPACLSLCQDTQGEIFDYPEEFFKERVHTIRRSRPDDFQIKQAAE  224

Query  181  KLKQSKQPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCL  240
            K+K+SK PIIISGGG+ YS+A  E+  FA KHNIPVT TVMG   M +D PY++  IG L
Sbjct  225  KIKKSKYPIIISGGGIFYSDAMNELGDFATKHNIPVTQTVMGYSTMKRDHPYFVGPIGGL  284

Query  241  GEGSSNNLATDTDLALAVGTKLGDFTTGSWTNFENENFQLVS  282
            G  ++N+LA  TD+A+A+GTKLGDFTTGSW NFEN +FQLV+
Sbjct  285  GGRAANSLAKQTDMAIAIGTKLGDFTTGSWANFENTDFQLVA  326


>ref|YP_002542806.1| myo-inositol catabolism [Agrobacterium radiobacter K84]
 gb|ACM24881.1| myo-inositol catabolism [Agrobacterium radiobacter K84]
Length=623

 Score =  343 bits (880),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 162/281 (58%), Positives = 208/281 (74%), Gaps = 1/281 (0%)

Query  2    LDKLWEEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVA  61
            L +  E  Q+ LP +RG +EQ+MAL  I +A+AKRR+QI VA SS+GPG+ NMVTAA VA
Sbjct  48   LSEALETVQDRLPTWRGQNEQSMALAAIGFAKAKRRRQIMVAASSIGPGALNMVTAAGVA  107

Query  62   LSNRLPILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTS  121
            ++NRLP+LLL GDT++SR PDPVLQQVEHF  P+ T ND+FKSV RY+DRI  PEQIL S
Sbjct  108  MANRLPVLLLAGDTYASRLPDPVLQQVEHFGDPTITANDAFKSVVRYWDRIVLPEQILQS  167

Query  122  LPQAINVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADK  181
            LPQA+  MLDPADCGPA I ++QD Q  A+DYPE+FFE K+ +I R  PD + +  AA+ 
Sbjct  168  LPQAVATMLDPADCGPAFIGLAQDTQEVAFDYPEVFFEPKVWKIPRPRPDRDTVIAAAEL  227

Query  182  LKQSKQPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLG  241
            LK +K+P+IISGGGV YS AEE+++ FA K  IPV  T+ G G +  D P +   IG +G
Sbjct  228  LKTAKRPLIISGGGVRYSLAEEKVAEFAAKRGIPVVETIAGKGALTHDHPVHAGPIGIVG  287

Query  242  EGSSNNLATDTDLALAVGTKLGDFTTGSWTNFENENFQLVS  282
              S+N LA D D+ LA+GT+L DFTTGSWT F +++ Q +S
Sbjct  288  STSANALAKDADVILAIGTRLQDFTTGSWTAF-SQDAQFIS  327


>ref|YP_004277036.1| 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase IolD [Acidiphilium 
multivorum AIU301]
 dbj|BAJ82894.1| 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase IolD [Acidiphilium 
multivorum AIU301]
Length=623

 Score =  341 bits (874),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 157/275 (57%), Positives = 206/275 (75%), Gaps = 0/275 (0%)

Query  2    LDKLWEEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVA  61
            L +  E+ Q++LP YRG +EQ+MAL  I YA+AKRR+QI +A +S+GPG++NMVTAA  A
Sbjct  48   LSEALEQVQDQLPTYRGQNEQSMALAAIGYAKAKRRRQIMIAATSIGPGASNMVTAAGTA  107

Query  62   LSNRLPILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTS  121
            ++NRLP+LLL GDTF++R PDPVLQQVEHF +P+ T ND+FK V RY+DRI+ PEQI+TS
Sbjct  108  MANRLPVLLLAGDTFANRLPDPVLQQVEHFGNPTITVNDTFKPVVRYWDRISLPEQIITS  167

Query  122  LPQAINVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADK  181
            LPQA+  MLDPADCGPA I ++QD Q +A+DYP +FFE K+  I R  PD + + KA + 
Sbjct  168  LPQAVATMLDPADCGPAFIGLAQDTQEKAFDYPAVFFEPKVWHIPRPRPDRDAVAKAVEL  227

Query  182  LKQSKQPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLG  241
            LK +K+P+II+GGGV YS AE+ ++ FA KH IPV  T+ G G +  D P +   IG +G
Sbjct  228  LKSAKKPMIIAGGGVRYSLAEDIVAEFAAKHGIPVVETIAGKGGLTHDHPVHAGPIGIVG  287

Query  242  EGSSNNLATDTDLALAVGTKLGDFTTGSWTNFENE  276
              S+N LA + D+ LAVGT+L DFTTGSWT F  E
Sbjct  288  STSANALAAEADVILAVGTRLQDFTTGSWTAFARE  322


>ref|ZP_01743920.1| hypothetical acetolactate synthase, iolD [Sagittula stellata 
E-37]
 gb|EBA10119.1| hypothetical acetolactate synthase, iolD [Sagittula stellata 
E-37]
Length=618

 Score =  326 bits (835),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 153/272 (56%), Positives = 197/272 (72%), Gaps = 0/272 (0%)

Query  2    LDKLWEEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVA  61
            L +  E+ Q+ LP +RG +EQ+MAL  + +A+AKRR+QI VATSSVGPG+TNM+TAA VA
Sbjct  47   LSEALEQVQDRLPTWRGQNEQSMALAAVGFAKAKRRRQIMVATSSVGPGATNMITAAGVA  106

Query  62   LSNRLPILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTS  121
             +NRLP+LLL GDTF +R PDPVLQQVEH+ SPS T ND F++VSR++DRI  P QIL+S
Sbjct  107  HANRLPVLLLSGDTFVNRLPDPVLQQVEHYGSPSTTVNDGFRAVSRFWDRIVHPAQILSS  166

Query  122  LPQAINVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADK  181
            LPQA+  MLDPADCGPA I + QD+Q  AYDYPE FF EK+  I R  P  +++  A   
Sbjct  167  LPQAVTTMLDPADCGPAFIGLPQDIQEIAYDYPEAFFAEKVWTIPRPRPARSEVAAAVAL  226

Query  182  LKQSKQPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLG  241
            LK +K+P+IISGGGV YS A E ++ FA +  IP+T T+ G G +  D P Y  A+G  G
Sbjct  227  LKSAKRPLIISGGGVRYSGAGEALADFAVRRGIPMTETIAGKGAVVHDHPAYTGAMGIEG  286

Query  242  EGSSNNLATDTDLALAVGTKLGDFTTGSWTNF  273
              +S  LA   D+ +A+GT++ DFTTGSWT F
Sbjct  287  TDASKELAETADVVIAIGTRMQDFTTGSWTTF  318


>ref|YP_001833892.1| thiamine pyrophosphate protein central region [Beijerinckia indica 
subsp. indica ATCC 9039]
 gb|ACB96403.1| thiamine pyrophosphate protein central region [Beijerinckia indica 
subsp. indica ATCC 9039]
Length=613

 Score =  322 bits (824),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 152/270 (56%), Positives = 206/270 (76%), Gaps = 0/270 (0%)

Query  7    EEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVALSNRL  66
            E  Q++LP +RG +EQ+MAL  I +A+A RR+QI VATSS+GPG+ NMVTAA VA +NRL
Sbjct  51   EAVQDKLPTWRGQNEQSMALAAIGFAKAVRRRQIMVATSSIGPGALNMVTAAGVAHTNRL  110

Query  67   PILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTSLPQAI  126
            P+LLL GDTF +R PDPV+QQVEHF +P+ T ND+FK+V+RY+DRI  PEQ+++SLPQA+
Sbjct  111  PVLLLAGDTFVNRRPDPVMQQVEHFGNPTITVNDAFKAVTRYWDRIVHPEQVISSLPQAV  170

Query  127  NVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADKLKQSK  186
              MLDPADCGPA I++ QDVQ  A+DYPE FF E +H I R  PD  ++ +AA  LK ++
Sbjct  171  AAMLDPADCGPAFIALPQDVQEMAWDYPEAFFAETVHNIPRPRPDRGRLDEAASLLKNAQ  230

Query  187  QPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLGEGSSN  246
            +P+IISGGGV YS AE+ ++AFA KH +P+  T+ G G ++ D P ++  IG +G  S+N
Sbjct  231  RPLIISGGGVRYSGAEDALAAFAAKHGVPLCETIAGKGSVSHDHPVHVGPIGIVGSTSAN  290

Query  247  NLATDTDLALAVGTKLGDFTTGSWTNFENE  276
             +A + D+ LAVGT+L DFTTGSW++F  +
Sbjct  291  AMAAEADVILAVGTRLMDFTTGSWSSFRQD  320


>ref|YP_004119074.1| thiamine pyrophosphate protein central region [Pantoea sp. At-9b]
 gb|ADU72518.1| thiamine pyrophosphate protein central region [Pantoea sp. At-9b]
Length=614

 Score =  319 bits (818),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/275 (52%), Positives = 200/275 (73%), Gaps = 0/275 (0%)

Query  1    VLDKLWEEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAV  60
             L +  E  Q+ LP +RG +EQ+MA   + +A+A  R+QI V T+S+GPG+TN++TAA V
Sbjct  45   CLGEALEAAQDVLPTWRGQNEQSMAFAAVGFAKAMVRRQIMVVTASIGPGTTNLLTAAGV  104

Query  61   ALSNRLPILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILT  120
            A ++RLP+L++ GD+F+ R PDPV+QQVEHFN P++T ND+FK+VSRY+DRIT PEQI++
Sbjct  105  AHTSRLPVLMICGDSFARRIPDPVMQQVEHFNDPTQTVNDAFKAVSRYWDRITWPEQIMS  164

Query  121  SLPQAINVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAAD  180
            SLPQA+  +LDP DCGPA I + QDVQ  AYDYPE FF  ++H + R  PD   +++A  
Sbjct  165  SLPQAVATLLDPGDCGPAFIGVCQDVQEMAYDYPEEFFSPRLHTMPRPRPDRRLLEQAVQ  224

Query  181  KLKQSKQPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCL  240
             LK +K+P+IISGGGV YS+AE  + AFA +H IPV  T+ G G    D P ++  +G L
Sbjct  225  LLKTAKRPLIISGGGVRYSQAEATLEAFATEHGIPVVETIAGKGAFTHDHPMHMGPVGIL  284

Query  241  GEGSSNNLATDTDLALAVGTKLGDFTTGSWTNFEN  275
            G  S+N LA + D+ +A+GT+L DF TGSWT F++
Sbjct  285  GSTSANELAANADVIIAIGTRLMDFVTGSWTLFDH  319


>ref|ZP_02189986.1| Acetolactate synthase [alpha proteobacterium BAL199]
 gb|EDP63316.1| Acetolactate synthase [alpha proteobacterium BAL199]
Length=622

 Score =  318 bits (816),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 144/267 (54%), Positives = 196/267 (73%), Gaps = 1/267 (0%)

Query  3    DKLWEEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVAL  62
            + LW   +  LP +R H+EQ M L  IAYA+A  R+++   T+S+GPG+ NMVTAAAVA 
Sbjct  56   EALWHA-REALPTFRAHNEQAMTLAAIAYAKASNRRRMMACTTSIGPGALNMVTAAAVAH  114

Query  63   SNRLPILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTSL  122
             NRLP+LLLPGDTF+ R PDPVLQQVEHF  P+ T ND F+ VSR+FDRITRPEQ+LTSL
Sbjct  115  VNRLPVLLLPGDTFAGRLPDPVLQQVEHFGDPTVTANDCFRPVSRWFDRITRPEQLLTSL  174

Query  123  PQAINVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADKL  182
            P+A+ V+ DPA+CGP  + +SQDVQ EAYDYP+ FF E + + RR   DP+++ +A D L
Sbjct  175  PRALQVLTDPAECGPVTLCLSQDVQAEAYDYPDAFFAETLRQTRRQAADPDELARAVDLL  234

Query  183  KQSKQPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLGE  242
            +++++P++++GGGVLYS+A + +  FA++H IPV  T  G G +  + P  + A+G  G 
Sbjct  235  RKAERPLLVAGGGVLYSDAADTLRNFAERHRIPVAETQAGKGALPWNHPQNVGAVGVTGT  294

Query  243  GSSNNLATDTDLALAVGTKLGDFTTGS  269
             ++N LA D D+ LAVGT+L DFTTGS
Sbjct  295  EAANILARDADVILAVGTRLQDFTTGS  321


>ref|YP_003899301.1| K03336 myo-inositol catabolism protein IolD [Halomonas elongata 
DSM 2581]
 emb|CBV44116.1| K03336 myo-inositol catabolism protein IolD [Halomonas elongata 
DSM 2581]
Length=615

 Score =  317 bits (811),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 157/273 (58%), Positives = 200/273 (73%), Gaps = 0/273 (0%)

Query  10   QNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVALSNRLPIL  69
            + ELP YR H+EQ MA   IA+A+A  R+++  ATSS+GPG+TNMVTAAA+A +NRLPIL
Sbjct  54   REELPTYRAHNEQTMAHAAIAFAKANGRRRMMAATSSIGPGATNMVTAAALAHANRLPIL  113

Query  70   LLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTSLPQAINVM  129
            LLPGDTF+SR PDPVLQQVEHF  P+ T ND F+ VSRYFDRITRPEQ+LTSLPQAI  +
Sbjct  114  LLPGDTFASRDPDPVLQQVEHFGDPTITVNDCFRPVSRYFDRITRPEQLLTSLPQAIATL  173

Query  130  LDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADKLKQSKQPI  189
            LDP  CGPA +++ QDVQ  AYDYPE FF  ++H IRR  PDP +++ A   L +S++P+
Sbjct  174  LDPEHCGPATLALPQDVQTFAYDYPESFFAPRVHRIRRPQPDPRELEAAIVALARSERPL  233

Query  190  IISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLGEGSSNNLA  249
            II+GGGV Y+ A E +S FA+ H +PV  T  G G +    P  + AIG  G  ++N+LA
Sbjct  234  IIAGGGVHYAGACERLSEFARTHGVPVAETQAGKGALPDTHPCAVGAIGVTGSEAANHLA  293

Query  250  TDTDLALAVGTKLGDFTTGSWTNFENENFQLVS  282
             + DL LAVGT+L DFTTGS   FE ++  LV+
Sbjct  294  READLILAVGTRLQDFTTGSRALFERDDLTLVA  326


>ref|YP_002490002.1| thiamine pyrophosphate protein central region [Methylobacterium 
nodulans ORS 2060]
 gb|ACL62835.1| thiamine pyrophosphate protein central region [Methylobacterium 
nodulans ORS 2060]
Length=612

 Score =  310 bits (794),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/276 (51%), Positives = 192/276 (70%), Gaps = 0/276 (0%)

Query  7    EEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVALSNRL  66
            E+  + LP +RG +EQ MA   IAYA+ KRR++    TSS+GPG+TNMVTAAA+A  NRL
Sbjct  49   EKIGDALPTWRGQNEQTMAHAAIAYAKTKRRRKAMAVTSSIGPGATNMVTAAALAHVNRL  108

Query  67   PILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTSLPQAI  126
            P+LL+PGD F++R PDPVLQQ+E F+  + + ND F+ VSRYFDRITRPE +LT+LP+A+
Sbjct  109  PVLLIPGDVFANRRPDPVLQQIEDFDDGTVSANDCFRPVSRYFDRITRPEHLLTALPRAL  168

Query  127  NVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADKLKQSK  186
             VM DPA CGP  ++  QDVQ EAYD+PE FF  K+  IRR  PD  ++    + ++ ++
Sbjct  169  QVMTDPAQCGPVTLAFCQDVQAEAYDWPEAFFAPKVWHIRRPEPDRRELAAVIEMIRAAQ  228

Query  187  QPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLGEGSSN  246
            +P+I+SGGGVLYS A+++++AFA+KHNIPV  T  G G ++   P    + G  G   +N
Sbjct  229  KPVIVSGGGVLYSGADQDLAAFAEKHNIPVVETQAGKGALDWQHPLNFGSPGVTGSDCAN  288

Query  247  NLATDTDLALAVGTKLGDFTTGSWTNFENENFQLVS  282
             +  + DL +  GT+  DFTTGSW  F N   +LVS
Sbjct  289  RICAEADLIIGAGTRFQDFTTGSWAAFRNPQRKLVS  324


>ref|ZP_03569026.1| probable malonic semialdehyde oxidative decarboxylase [Burkholderia 
multivorans CGD2M]
 ref|ZP_03575671.1| probable malonic semialdehyde oxidative decarboxylase [Burkholderia 
multivorans CGD2]
 gb|EEE09014.1| probable malonic semialdehyde oxidative decarboxylase [Burkholderia 
multivorans CGD2]
 gb|EEE14933.1| probable malonic semialdehyde oxidative decarboxylase [Burkholderia 
multivorans CGD2M]
Length=613

 Score =  308 bits (789),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 153/267 (57%), Positives = 201/267 (75%), Gaps = 0/267 (0%)

Query  7    EEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVALSNRL  66
            E  + ELP +RG +EQ+MAL  IA+A+A+RR+QI VATSS+GPG+TN VTAA +A +NRL
Sbjct  51   ESVKEELPTWRGQNEQSMALAAIAFAKARRRKQIMVATSSIGPGATNFVTAAGLAHANRL  110

Query  67   PILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTSLPQAI  126
            PIL + GD F+SR  DPVLQQVEHFN P+ T NDSFK+V+RY+DRIT PEQI++SLPQA+
Sbjct  111  PILFISGDVFASRRNDPVLQQVEHFNDPTLTVNDSFKAVTRYWDRITHPEQIISSLPQAV  170

Query  127  NVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADKLKQSK  186
             VMLDPADCGPA I + QD+Q  A+DYPE FF   +H   R  PD N++ +AA  L +++
Sbjct  171  AVMLDPADCGPAFIGLCQDIQEVAFDYPEAFFAPTVHASPRPRPDLNRLAQAAALLAKAE  230

Query  187  QPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLGEGSSN  246
            +P+II+GGGV YSEAE  +  FA++  IPV  T+ G GC+  D P ++  +G +G  S+N
Sbjct  231  RPLIIAGGGVRYSEAEAAVIKFAEERRIPVVETIAGKGCVTHDHPVHVGPLGIVGSTSAN  290

Query  247  NLATDTDLALAVGTKLGDFTTGSWTNF  273
             LA D D+ +A+GT+L DFTTGSWT F
Sbjct  291  ALAADADVIVAIGTRLQDFTTGSWTCF  317


>ref|ZP_05785776.1| probable malonic semialdehyde oxidative decarboxylase [Silicibacter 
lacuscaerulensis ITI-1157]
 gb|EEX08892.1| probable malonic semialdehyde oxidative decarboxylase [Silicibacter 
lacuscaerulensis ITI-1157]
Length=611

 Score =  308 bits (789),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 143/272 (53%), Positives = 185/272 (68%), Gaps = 0/272 (0%)

Query  10   QNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVALSNRLPIL  69
            ++ LP YRGH+EQ MA   IAYA+  RR +    TSS+GPG+TNMVTAAA+A  NRLP+L
Sbjct  53   RDSLPTYRGHNEQTMAHCAIAYAKQMRRSRAMAVTSSIGPGATNMVTAAALAHVNRLPVL  112

Query  70   LLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTSLPQAINVM  129
            LLPGD F+SR PDPVLQQ+E F   + + ND F+ VSRYFDRITRPE +LT+LP+A   M
Sbjct  113  LLPGDVFASRGPDPVLQQIEDFTDGTVSANDCFRPVSRYFDRITRPEHLLTALPRAFRTM  172

Query  130  LDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADKLKQSKQPI  189
             DPADCGP  +   QDVQ EAYDYP  FFE +I   RRI PD  ++ +AA+ ++ +K+PI
Sbjct  173  TDPADCGPVTLGFCQDVQAEAYDYPLSFFEPRIWHQRRIRPDEGELARAAEAIRSAKRPI  232

Query  190  IISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLGEGSSNNLA  249
            I++GGGV YS A + + AFA+ HNIPV  T  G   +  D P  +  +G  G   +N + 
Sbjct  233  IVAGGGVHYSGATDALQAFAETHNIPVAETQAGKSALAWDHPLNLGPVGVTGGEPANTVC  292

Query  250  TDTDLALAVGTKLGDFTTGSWTNFENENFQLV  281
             + DL L +GT+  DFTTGSW  F N   ++V
Sbjct  293  AEADLILGIGTRFQDFTTGSWGLFSNPERKMV  324


>ref|ZP_06175542.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gb|EEZ88216.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
Length=623

 Score =  307 bits (787),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 149/273 (55%), Positives = 202/273 (74%), Gaps = 0/273 (0%)

Query  10   QNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVALSNRLPIL  69
            ++++P +RG +EQ+MA   IAYA+A  R++I +ATSS+GPG+TNMVTAA +A +NRLP+L
Sbjct  54   EDKIPTWRGQNEQSMATAAIAYAKANLRRRIGIATSSIGPGATNMVTAAGIAHTNRLPVL  113

Query  70   LLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTSLPQAINVM  129
            L+ GD + SR PDPVLQQ E+F  PS T ND+FK ++RY+DRI  P Q++ SLPQAI+ M
Sbjct  114  LISGDAYVSRLPDPVLQQPENFYDPSITCNDAFKPLTRYWDRIISPTQLMHSLPQAIDTM  173

Query  130  LDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADKLKQSKQPI  189
            LDP  CGPA I + QD+QG AYD+PE+FF+EK+H IRR  P+   ++ A   L  +KQP+
Sbjct  174  LDPETCGPAFIGLPQDIQGVAYDFPEVFFQEKVHRIRRPEPEVADLEDAKAALLSAKQPL  233

Query  190  IISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLGEGSSNNLA  249
            +ISGGGV YS A +E++AFAKKHNIPV  T+ G   M +D+P     IG  G  S+N +A
Sbjct  234  VISGGGVHYSLATDELAAFAKKHNIPVVETIAGRATMLQDNPLNAGPIGVTGSDSANYMA  293

Query  250  TDTDLALAVGTKLGDFTTGSWTNFENENFQLVS  282
               D+ LAVGT+L DFTTGSW+ F+N + +LV+
Sbjct  294  AHADVVLAVGTRLQDFTTGSWSVFKNPDMKLVT  326


------------------------------------------------------------------------------

2) BLASTp versus SwissProt, NCBI default parameters 

Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q5KYR0.1|IOLD_GEOKA  RecName: Full=3D-(3,5/4)-trihydroxycyc...   283    7e-76
sp|Q63B73.1|IOLD1_BACCZ  RecName: Full=3D-(3,5/4)-trihydroxycy...   273    6e-73
sp|B7JPM3.1|IOLD_BACC0  RecName: Full=3D-(3,5/4)-trihydroxycyc...   273    1e-72
sp|Q6HIK2.1|IOLD_BACHK  RecName: Full=3D-(3,5/4)-trihydroxycyc...   273    1e-72
sp|Q81QB5.1|IOLD_BACAN  RecName: Full=3D-(3,5/4)-trihydroxycyc...   273    1e-72
sp|Q4V1F5.1|IOLD2_BACCZ  RecName: Full=3D-(3,5/4)-trihydroxycy...   271    3e-72
sp|A0REB6.1|IOLD_BACAH  RecName: Full=3D-(3,5/4)-trihydroxycyc...   270    7e-72
sp|A4IPB6.1|IOLD_GEOTN  RecName: Full=3D-(3,5/4)-trihydroxycyc...   266    8e-71
sp|Q723S8.2|IOLD_LISMF  RecName: Full=3D-(3,5/4)-trihydroxycyc...   263    1e-69
sp|Q8XP76.1|IOLD_CLOPE  RecName: Full=3D-(3,5/4)-trihydroxycyc...   259    1e-68
sp|Q8Y9Y1.1|IOLD_LISMO  RecName: Full=3D-(3,5/4)-trihydroxycyc...   259    2e-68
sp|Q0TUZ2.1|IOLD_CLOP1  RecName: Full=3D-(3,5/4)-trihydroxycyc...   258    4e-68
sp|Q898E8.2|IOLD_CLOTE  RecName: Full=3D-(3,5/4)-trihydroxycyc...   256    1e-67
sp|Q5WKY8.1|IOLD_BACSK  RecName: Full=3D-(3,5/4)-trihydroxycyc...   254    4e-67
sp|Q65D03.1|IOLD_BACLD  RecName: Full=3D-(3,5/4)-trihydroxycyc...   253    8e-67
sp|P42415.2|IOLD_BACSU  RecName: Full=3D-(3,5/4)-trihydroxycyc...   253    8e-67
sp|Q92EQ4.1|IOLD_LISIN  RecName: Full=3D-(3,5/4)-trihydroxycyc...   250    9e-66
sp|A5YBJ6.2|IOLD_LACCA  RecName: Full=3D-(3,5/4)-trihydroxycyc...   248    4e-65
sp|A7ZAH8.1|IOLD_BACA2  RecName: Full=3D-(3,5/4)-trihydroxycyc...   245    3e-64
sp|Q9KAG9.1|IOLD_BACHD  RecName: Full=3D-(3,5/4)-trihydroxycyc...   244    5e-64
sp|B2V4K0.1|IOLD_CLOBA  RecName: Full=3D-(3,5/4)-trihydroxycyc...   240    6e-63
sp|B2TJ86.1|IOLD_CLOBB  RecName: Full=3D-(3,5/4)-trihydroxycyc...   233    8e-61
sp|Q57725.1|ILVB_METJA  RecName: Full=Probable acetolactate sy...   116    1e-25
sp|P00892.3|ILVG_ECOLI  RecName: Full=Acetolactate synthase is...   107    9e-23
sp|P37251.4|ILVB_BACSU  RecName: Full=Acetolactate synthase la...   106    1e-22
sp|O19929.1|ILVB_CYACA  RecName: Full=Acetolactate synthase la...   105    2e-22
sp|P45261.1|ILVI_HAEIN  RecName: Full=Acetolactate synthase la...   105    3e-22
sp|Q9RQ65.1|ILVI_BUCSC  RecName: Full=Acetolactate synthase la...   104    8e-22
sp|O08353.1|ILVB_METAO  RecName: Full=Probable acetolactate sy...   102    3e-21
sp|O85293.1|ILVI_BUCAP  RecName: Full=Acetolactate synthase la...   101    7e-21
sp|P27868.1|ILVB_SPIPL  RecName: Full=Acetolactate synthase; A...   100    9e-21
sp|P69683.1|ILVB_PORPU  RecName: Full=Acetolactate synthase la...  98.6    4e-20
sp|O78518.1|ILVB_GUITH  RecName: Full=Acetolactate synthase la...  98.2    5e-20
sp|Q1XDF6.1|ILVB_PORYE  RecName: Full=Acetolactate synthase la...  97.4    1e-19
sp|P42463.1|ILVB_CORGL  RecName: Full=Acetolactate synthase la...  95.9    2e-19
sp|P57321.1|ILVI_BUCAI  RecName: Full=Acetolactate synthase la...  92.8    2e-18
sp|Q7U5G1.1|ILVB_SYNPX  RecName: Full=Acetolactate synthase la...  89.4    3e-17
sp|P07342.1|ILVB_YEAST  RecName: Full=Acetolactate synthase ca...  89.0    4e-17
sp|P36620.2|ILVB_SCHPO  RecName: Full=Acetolactate synthase, m...  87.8    7e-17
sp|Q6K2E8.1|ILVB1_ORYSJ  RecName: Full=Acetolactate synthase 1...  85.1    5e-16
sp|Q41769.1|ILVB2_MAIZE  RecName: Full=Acetolactate synthase 2...  85.1    5e-16
sp|Q89AP7.1|ILVI_BUCBP  RecName: Full=Acetolactate synthase la...  84.0    1e-15
sp|Q41768.1|ILVB1_MAIZE  RecName: Full=Acetolactate synthase 1...  83.2    2e-15
sp|Q84H44.3|XSC_ALCDF  RecName: Full=Sulfoacetaldehyde acetylt...  83.2    2e-15
sp|Q7XKQ8.2|ILVB2_ORYSJ  RecName: Full=Probable acetolactate s...  82.8    2e-15
sp|P09114.1|ILVB2_TOBAC  RecName: Full=Acetolactate synthase 2...  81.3    6e-15
sp|P09342.1|ILVB1_TOBAC  RecName: Full=Acetolactate synthase 1...  80.5    1e-14
sp|Q6SSJ3.1|ILVB_CRYNV  RecName: Full=Acetolactate synthase, m...  80.1    1e-14
sp|P0AEP8.2|GCL_ECO57  RecName: Full=Glyoxylate carboligase; A...  79.3    2e-14
sp|P00893.2|ILVI_ECOLI  RecName: Full=Acetolactate synthase is...  79.0    3e-14
sp|Q5KPJ5.1|ILVB_CRYNE  RecName: Full=Acetolactate synthase, m...  78.6    4e-14
sp|P17597.1|ILVB_ARATH  RecName: Full=Acetolactate synthase, c...  78.6    5e-14
sp|Q84H41.3|XSC_ALCXX  RecName: Full=Sulfoacetaldehyde acetylt...  78.6    5e-14
sp|P27818.1|ILVB1_BRANA  RecName: Full=Acetolactate synthase 1...  77.8    8e-14
sp|P27819.1|ILVB3_BRANA  RecName: Full=Acetolactate synthase 3...  77.4    9e-14
sp|O06335.1|ILVB2_MYCTU  RecName: Full=Putative acetolactate s...  77.4    1e-13
sp|P40811.3|ILVI_SALTY  RecName: Full=Acetolactate synthase is...  76.3    2e-13
sp|P08142.1|ILVB_ECOLI  RecName: Full=Acetolactate synthase is...  76.3    2e-13
sp|Q92UW6.1|XSC_RHIME  RecName: Full=Probable sulfoacetaldehyd...  75.1    5e-13
sp|P14874.1|ILVB2_BRANA  RecName: Full=Acetolactate synthase 2...  74.7    7e-13
sp|Q59498.1|ILVB_MYCAV  RecName: Full=Acetolactate synthase; A...  74.3    8e-13
sp|Q93PS3.1|XSC_DESTI  RecName: Full=Sulfoacetaldehyde acetylt...  73.9    9e-13
sp|P0A622.1|ILVB1_MYCTU  RecName: Full=Acetolactate synthase l...  72.0    4e-12
sp|Q02137.2|ILVB_LACLA  RecName: Full=Acetolactate synthase la...  70.9    9e-12
sp|O33112.1|ILVB_MYCLE  RecName: Full=Acetolactate synthase; A...  70.1    1e-11
sp|P0CH62.1|CHDH_AZOSP  RecName: Full=Cyclohexane-1,2-dione hy...  67.8    8e-11
sp|P96591.1|YDAP_BACSU  RecName: Full=Putative thiamine pyroph...  62.0    4e-09
sp|P66947.1|ILVG_MYCBO  RecName: Full=Probable acetolactate sy...  59.3    3e-08
sp|Q54DA9.1|HACL1_DICDI  RecName: Full=Probable 2-hydroxyacyl-...  57.4    1e-07
sp|P07003.1|POXB_ECOLI  RecName: Full=Pyruvate dehydrogenase [...  57.0    1e-07
sp|Q9Y7M1.1|YGK4_SCHPO  RecName: Full=Putative 2-hydroxyacyl-C...  55.5    3e-07
sp|Q9LF46.1|HACL_ARATH  RecName: Full=2-hydroxyacyl-CoA lyase;...  55.5    4e-07
sp|P40149.1|OXC_OXAFO  RecName: Full=Oxalyl-CoA decarboxylase      52.8    2e-06
sp|Q54970.2|POXB_STRPN  RecName: Full=Pyruvate oxidase; AltNam...  51.2    7e-06
sp|Q9UJ83.2|HACL1_HUMAN  RecName: Full=2-hydroxyacyl-CoA lyase...  51.2    8e-06
sp|P0AFI1.1|OXC_ECO57  RecName: Full=Probable oxalyl-CoA decar...  50.8    9e-06
sp|P27696.1|ILVB_KLEPN  RecName: Full=Acetolactate synthase, c...  50.1    2e-05
sp|O42873.1|PDC4_SCHPO  RecName: Full=Putative pyruvate decarb...  49.7    2e-05
sp|Q04789.3|ILVX_BACSU  RecName: Full=Acetolactate synthase; A...  48.9    4e-05
sp|O61856.2|ILVBL_CAEEL  RecName: Full=Acetolactate synthase-l...  46.6    2e-04
sp|Q8CHM7.1|HACL1_RAT  RecName: Full=2-hydroxyacyl-CoA lyase 1...  46.6    2e-04
sp|Q9QXE0.2|HACL1_MOUSE  RecName: Full=2-hydroxyacyl-CoA lyase...  45.8    3e-04
sp|P51853.1|BZNB_PSEFL  RecName: Full=Benzaldehyde lyase; AltN...  45.1    6e-04
sp|P16467.4|PDC5_YEAST  RecName: Full=Pyruvate decarboxylase i...  44.3    0.001
sp|Q12629.2|PDC1_KLULA  RecName: Full=Pyruvate decarboxylase       43.9    0.001
sp|P10343.1|YI42_PSEAY  RecName: Full=Uncharacterized 42.6 kDa...  43.5    0.002
sp|P51852.1|DCIP_AZOBR  RecName: Full=Indole-3-pyruvate decarb...  42.7    0.002
sp|P37063.3|POXB_LACPL  RecName: Full=Pyruvate oxidase; AltNam...  42.0    0.004
sp|O05031.1|Y737_HAEIN  RecName: Full=Putative uncharacterized...  41.6    0.006
sp|A1L0T0.2|ILVBL_HUMAN  RecName: Full=Acetolactate synthase-l...  41.2    0.007
sp|P26263.3|PDC6_YEAST  RecName: Full=Pyruvate decarboxylase i...  41.2    0.007
sp|Q8BU33.1|ILVBL_MOUSE  RecName: Full=Acetolactate synthase-l...  40.8    0.009
sp|P06169.7|PDC1_YEAST  RecName: Full=Pyruvate decarboxylase i...  40.8    0.010
sp|Q6NV04.1|ILVBL_DANRE  RecName: Full=Acetolactate synthase-l...  39.7    0.020
sp|Q6FJA3.1|PDC1_CANGA  RecName: Full=Pyruvate decarboxylase       39.7    0.023
sp|P33149.1|PDC1_KLUMA  RecName: Full=Pyruvate decarboxylase       39.7    0.024
sp|P72020.3|ACDE1_METTE  RecName: Full=Acetyl-CoA decarbonylas...  38.9    0.039
sp|Q09737.2|PDC1_SCHPO  RecName: Full=Putative pyruvate decarb...  38.1    0.066
sp|A6QQT9.2|ILVBL_BOVIN  RecName: Full=Acetolactate synthase-l...  37.7    0.075
sp|P34734.1|PDC_HANUV  RecName: Full=Pyruvate decarboxylase        37.0    0.16 


>sp|Q5KYR0.1|IOLD_GEOKA RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase; 
Short=THcHDO hydrolase
Length=644

 Score =  283 bits (725),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 134/281 (48%), Positives = 194/281 (69%), Gaps = 0/281 (0%)

Query  2    LDKLWEEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVA  61
            L +  EE   EL  Y+G +EQ MA   IA+A+ K R+QI   TSSVGPG+ NMVTAAA A
Sbjct  46   LGQALEEDPGELEVYQGRNEQGMAHAAIAFAKQKHRRQIMACTSSVGPGAANMVTAAATA  105

Query  62   LSNRLPILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTS  121
             +N +P+LLLPGDTF++R PDPVLQQ+EH++  + + ND+F++VS+Y+DRI+RPEQ++++
Sbjct  106  SANHIPVLLLPGDTFATRQPDPVLQQIEHWHDLTVSTNDAFRAVSKYWDRISRPEQLMSA  165

Query  122  LPQAINVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADK  181
            + QA+ V+ DPA+ G   I++ QDVQGEAYD+PE FF+++IH I R  P    I +A + 
Sbjct  166  MIQAMRVLTDPANTGAVTIALPQDVQGEAYDFPESFFQKRIHRIERRVPAKAAIHEAVEL  225

Query  182  LKQSKQPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLG  241
            +++ K+PIII GGGV YSEA EE+  FA+K +IP   T  G   +    PY +  IG  G
Sbjct  226  IRRKKKPIIICGGGVRYSEAAEELKQFAEKFHIPYGETQAGKSAVESAHPYNLGGIGVTG  285

Query  242  EGSSNNLATDTDLALAVGTKLGDFTTGSWTNFENENFQLVS  282
              ++N +A + DL + +GT+  DFTTGS   F++   + ++
Sbjct  286  NLAANIIAKEADLVIGIGTRYTDFTTGSKQLFQHPEVEFLT  326


>sp|Q63B73.1|IOLD1_BACCZ RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase 
1; Short=THcHDO hydrolase 1
Length=644

 Score =  273 bits (699),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 186/281 (66%), Gaps = 0/281 (0%)

Query  2    LDKLWEEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVA  61
            L +  EE   EL  Y+G +EQ MA   +A+A+ K R+QI   TSSVGPGS NM+T+AA A
Sbjct  46   LGQALEEDAGELEVYQGRNEQGMANAAMAFAKQKHRKQIMACTSSVGPGSANMITSAATA  105

Query  62   LSNRLPILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTS  121
             +N +P+LLLPGD F++R PDPVLQQ+E  +  S + ND+F++VS+Y+DRI RPEQ++T+
Sbjct  106  SANNIPVLLLPGDVFATRQPDPVLQQIEQTHDLSISTNDAFRAVSKYWDRINRPEQLMTA  165

Query  122  LPQAINVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADK  181
            + QA+ V+ +PAD G   I + QDVQGEA+D+P  FF++++H I R  P    +  A + 
Sbjct  166  MIQAMRVLTNPADTGAVTICLPQDVQGEAWDFPSYFFQKRVHRIERRLPTKASLADAVEM  225

Query  182  LKQSKQPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLG  241
            +K+ K+P++I GGGV Y+EA EE+  FA+  +IP   T  G   +    PY +  IG  G
Sbjct  226  IKRKKKPVMICGGGVRYAEAAEELKQFAETFHIPFGETQAGKSAIESSHPYNLGGIGVTG  285

Query  242  EGSSNNLATDTDLALAVGTKLGDFTTGSWTNFENENFQLVS  282
              ++N +A + DL + +GT+  DFTT S   F+NE  + V+
Sbjct  286  NIAANTIAKEADLVIGIGTRFTDFTTASKQLFQNEEVEFVN  326


>sp|B7JPM3.1|IOLD_BACC0 RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase; 
Short=THcHDO hydrolase
Length=644

 Score =  273 bits (698),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/281 (45%), Positives = 186/281 (66%), Gaps = 0/281 (0%)

Query  2    LDKLWEEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVA  61
            L +  EE   EL  Y+G +EQ MA   +A+A+ K R+QI   TSSVGPGS NM+T+AA A
Sbjct  46   LGQALEEDAGELEVYQGRNEQGMANAAMAFAKQKHRKQIMACTSSVGPGSANMITSAATA  105

Query  62   LSNRLPILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTS  121
             +N +P+LLLPGD F++R PDPVLQQ+E  +  S + ND+F++VS+Y+DRI RPEQ++T+
Sbjct  106  SANNIPVLLLPGDVFATRQPDPVLQQIEQTHDLSISTNDAFRAVSKYWDRINRPEQLMTA  165

Query  122  LPQAINVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADK  181
            + QA+ V+ +PAD G   I + QDVQGEA+D+P  FF++++H I R  P    +  A + 
Sbjct  166  MIQAMRVLTNPADTGAVTICLPQDVQGEAWDFPSYFFQKRVHRIERRLPTKASLADAVEM  225

Query  182  LKQSKQPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLG  241
            +K+ K+P++I GGGV Y+EA EE+  FA+  +IP   T  G   +    PY +  IG  G
Sbjct  226  IKRKKKPVMICGGGVRYAEAAEELKQFAETFHIPFGETQAGKSAIESSHPYNLGGIGVTG  285

Query  242  EGSSNNLATDTDLALAVGTKLGDFTTGSWTNFENENFQLVS  282
              ++N +A + DL + +GT+  DFTT S   F+NE  + ++
Sbjct  286  NVAANTIAKEADLVIGIGTRFTDFTTASKQLFQNEEVEFLN  326


>sp|Q6HIK2.1|IOLD_BACHK RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase; 
Short=THcHDO hydrolase
Length=644

 Score =  273 bits (698),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/281 (45%), Positives = 186/281 (66%), Gaps = 0/281 (0%)

Query  2    LDKLWEEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVA  61
            L +  EE   EL  Y+G +EQ MA   +A+A+ K R+QI   TSSVGPGS NM+T+AA A
Sbjct  46   LGQALEEDAGELEVYQGRNEQGMANAAMAFAKQKHRKQIMACTSSVGPGSANMITSAATA  105

Query  62   LSNRLPILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTS  121
             +N +P+LLLPGD F++R PDPVLQQ+E  +  S + ND+F++VS+Y+DRI RPEQ++T+
Sbjct  106  SANNIPVLLLPGDVFATRQPDPVLQQIEQTHDLSISTNDAFRAVSKYWDRINRPEQLMTA  165

Query  122  LPQAINVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADK  181
            + QA+ V+ +PAD G   I + QDVQGEA+D+P  FF++++H I R  P    +  A + 
Sbjct  166  MIQAMRVLTNPADTGAVTICLPQDVQGEAWDFPSYFFQKRVHRIERRLPTKASLADAVEM  225

Query  182  LKQSKQPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLG  241
            +K+ K+P++I GGGV Y+EA EE+  FA+  +IP   T  G   +    PY +  IG  G
Sbjct  226  IKRKKKPVMICGGGVRYAEAAEELKQFAETFHIPFGETQAGKSAIESSHPYNLGGIGVTG  285

Query  242  EGSSNNLATDTDLALAVGTKLGDFTTGSWTNFENENFQLVS  282
              ++N +A + DL + +GT+  DFTT S   F+NE  + ++
Sbjct  286  NVAANTIAKEADLVIGIGTRFTDFTTASKQLFQNEEVEFLN  326


>sp|Q81QB5.1|IOLD_BACAN RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase; 
Short=THcHDO hydrolase
 sp|C3PAZ3.1|IOLD_BACAA RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase; 
Short=THcHDO hydrolase
 sp|C3LHY1.1|IOLD_BACAC RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase; 
Short=THcHDO hydrolase
Length=644

 Score =  273 bits (697),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/281 (45%), Positives = 186/281 (66%), Gaps = 0/281 (0%)

Query  2    LDKLWEEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVA  61
            L +  EE   EL  Y+G +EQ MA   +A+A+ K R+QI   TSSVGPGS NM+T+AA A
Sbjct  46   LGQALEEDAGELEVYQGRNEQGMANAAMAFAKQKHRKQIMACTSSVGPGSANMITSAATA  105

Query  62   LSNRLPILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTS  121
             +N +P+LLLPGD F++R PDPVLQQ+E  +  S + ND+F++VS+Y+DRI RPEQ++T+
Sbjct  106  SANNIPVLLLPGDVFATRQPDPVLQQIEQTHDLSISTNDAFRAVSKYWDRINRPEQLMTA  165

Query  122  LPQAINVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADK  181
            + QA+ V+ +PAD G   I + QDVQGEA+D+P  FF++++H I R  P    +  A + 
Sbjct  166  MIQAMRVLTNPADTGAVTICLPQDVQGEAWDFPSYFFQKRVHRIERRLPTKASLADAVEM  225

Query  182  LKQSKQPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLG  241
            +K+ K+P++I GGGV Y+EA EE+  FA+  +IP   T  G   +    PY +  IG  G
Sbjct  226  IKRKKKPVMICGGGVRYAEAAEELKQFAETFHIPFGETQAGKSAIESSHPYNLGGIGVTG  285

Query  242  EGSSNNLATDTDLALAVGTKLGDFTTGSWTNFENENFQLVS  282
              ++N +A + DL + +GT+  DFTT S   F+NE  + ++
Sbjct  286  NVAANTIAKEADLVIGIGTRFTDFTTASKQLFQNEEVEFLN  326


>sp|Q4V1F5.1|IOLD2_BACCZ RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase 
2; Short=THcHDO hydrolase 2
Length=644

 Score =  271 bits (693),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 184/281 (65%), Gaps = 0/281 (0%)

Query  2    LDKLWEEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVA  61
            L +  EE   EL  Y+G +EQ MA   +A+A+ K R+QI   TSSVGPGS NM+T+AA A
Sbjct  46   LGQALEEDAGELEVYQGRNEQGMANAAMAFAKQKHRKQIMACTSSVGPGSANMITSAATA  105

Query  62   LSNRLPILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTS  121
             +N +P+LLLPGD F++R PDPVLQQ+E  +  S + ND+F++VS+Y+DRI RPEQ++T+
Sbjct  106  SANNIPVLLLPGDVFATRQPDPVLQQIEQTHDLSISTNDAFRAVSKYWDRINRPEQLMTA  165

Query  122  LPQAINVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADK  181
            + QA+ V+ +PAD G   I + QDVQGEA+D+P  FF++ +H I R  P    +  A + 
Sbjct  166  MIQAMRVLTNPADTGAVTICLPQDVQGEAWDFPSYFFQKCVHRIERRLPTRASLADAVEM  225

Query  182  LKQSKQPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLG  241
            +K+ K+P++I GGGV Y+EA EE+  FA+   IP   T  G   +    PY +  IG  G
Sbjct  226  IKRKKKPVMICGGGVRYAEAAEELKQFAEAFRIPFGETQAGKSAIESSHPYNLGGIGVTG  285

Query  242  EGSSNNLATDTDLALAVGTKLGDFTTGSWTNFENENFQLVS  282
              ++N +A + DL + +GT+  DFTT S   F+NE  + V+
Sbjct  286  NLAANTIAKEADLVIGIGTRFTDFTTASKQLFQNEEVEFVN  326


>sp|A0REB6.1|IOLD_BACAH RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase; 
Short=THcHDO hydrolase
 sp|C1EVJ3.1|IOLD_BACC3 RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase; 
Short=THcHDO hydrolase
Length=644

 Score =  270 bits (690),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 125/281 (44%), Positives = 186/281 (66%), Gaps = 0/281 (0%)

Query  2    LDKLWEEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVA  61
            L +  EE   EL  Y+G +EQ MA   +A+A+ K R+QI   TSSVGPGS NM+T+AA A
Sbjct  46   LGQALEEDAGELEVYQGRNEQGMANAAMAFAKQKHRKQIMACTSSVGPGSANMITSAATA  105

Query  62   LSNRLPILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTS  121
             +N +P+LLLPGD F++R  DPVLQQ+E  +  S + ND+F++VS+Y+DRI RPEQ++T+
Sbjct  106  SANNIPVLLLPGDVFATRQSDPVLQQIEQTHDLSISTNDAFRAVSKYWDRINRPEQLMTA  165

Query  122  LPQAINVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADK  181
            + QA+ V+ +PAD G   I + QDVQGEA+D+P+ FF++++H I R  P    +  A + 
Sbjct  166  MIQAMRVLTNPADTGAVTICLPQDVQGEAWDFPDYFFQKRVHRIERRLPTKASLADAVEM  225

Query  182  LKQSKQPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLG  241
            +K+ K+P++I GGGV Y+EA EE+  FA+  +IP   T  G   +    PY +  IG  G
Sbjct  226  IKRKKKPVMICGGGVRYAEAAEELKQFAETFHIPFGETQAGKSAIESSHPYNLGGIGVTG  285

Query  242  EGSSNNLATDTDLALAVGTKLGDFTTGSWTNFENENFQLVS  282
              ++N +A + DL + +GT+  DFTT S   F+NE  + ++
Sbjct  286  NIAANTIAKEADLVIGIGTRFTDFTTASKQLFQNEEVEFLN  326


>sp|A4IPB6.1|IOLD_GEOTN RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase; 
Short=THcHDO hydrolase
Length=639

 Score =  266 bits (681),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 178/268 (66%), Gaps = 0/268 (0%)

Query  2    LDKLWEEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVA  61
            L +  EE   EL  Y+G +EQ MA   IA+A+ K R+QI  ATSSVGPG+ NMVT+AA A
Sbjct  46   LGQALEEDPGELEVYQGRNEQGMANAAIAFAKQKNRKQIMAATSSVGPGAANMVTSAATA  105

Query  62   LSNRLPILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTS  121
             +N +P+LLLPGD F++R PDPVLQQ+EH +  S + ND+F++VS+Y+DR+ RPEQ++++
Sbjct  106  TANNIPVLLLPGDVFATRQPDPVLQQIEHTHDLSISTNDAFRAVSKYWDRVCRPEQLMSA  165

Query  122  LPQAINVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADK  181
            +  A+ V+ +PAD G   I++ QDVQGEA+D+PE FF +++H I R  P    ++ A   
Sbjct  166  MLNAMRVLTNPADTGAVTIALPQDVQGEAWDFPESFFAKRVHRIERRQPSLESVRDAVKL  225

Query  182  LKQSKQPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLG  241
            ++  K+P+++ GGGV YSEA +    FA+K NIP   T  G G +    P  +  IG  G
Sbjct  226  IRSKKKPLLVLGGGVRYSEAADAFVKFAEKFNIPFAETQAGKGTIESSHPLNLGGIGVTG  285

Query  242  EGSSNNLATDTDLALAVGTKLGDFTTGS  269
              ++N +A   DL + VGT+  DFTT S
Sbjct  286  NLAANTIAKQADLIIGVGTRFTDFTTAS  313


>sp|Q723S8.2|IOLD_LISMF RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase; 
Short=THcHDO hydrolase
Length=638

 Score =  263 bits (671),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/268 (47%), Positives = 177/268 (66%), Gaps = 0/268 (0%)

Query  7    EEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVALSNRL  66
            EE    L  Y+G +EQ MA   IAYA+ K RQ+I+  ++S GPGS N++TAA  AL+N L
Sbjct  53   EEAPGHLKVYQGKNEQGMAHAAIAYAKQKNRQRIYACSTSAGPGSANLITAAGTALANNL  112

Query  67   PILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTSLPQAI  126
            P+L LP DTF++R PDPVLQQ+EH +S + T ND F++VSRYFDR+ RPEQ++++L +A 
Sbjct  113  PVLFLPADTFATRQPDPVLQQLEHESSTAITTNDGFQAVSRYFDRVQRPEQLMSALIRAF  172

Query  127  NVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADKLKQSK  186
             VM +PA  GPA I ++QD +GEA+DYP  FF+++IH + R  P   ++ +AA  +K SK
Sbjct  173  EVMTNPASAGPATICIAQDTEGEAFDYPVEFFQKRIHYLNRQIPTKRELTEAARLIKASK  232

Query  187  QPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLGEGSSN  246
             P+II GGG  YS A EE+ A +++ NIP+  T  G   +  D    +   G LG  ++N
Sbjct  233  TPVIIVGGGARYSRAREELIALSEQTNIPLVETHAGKSTLEFDFKNNLGGTGILGTLAAN  292

Query  247  NLATDTDLALAVGTKLGDFTTGSWTNFE  274
                D DL + +GT+  DFTT S T F+
Sbjct  293  KAIRDADLVIGIGTRYTDFTTSSKTAFD  320


>sp|Q8XP76.1|IOLD_CLOPE RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase; 
Short=THcHDO hydrolase
Length=639

 Score =  259 bits (663),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 126/276 (46%), Positives = 180/276 (65%), Gaps = 2/276 (1%)

Query  9    YQN--ELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVALSNRL  66
            Y+N  EL  Y+G +EQ MA    A+A+   R++I   +SSVGPG+ NMVTAAA A  N +
Sbjct  48   YENPGELKVYQGRNEQGMAHVSTAFAKQNNRRKIIACSSSVGPGAANMVTAAATATVNNI  107

Query  67   PILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTSLPQAI  126
            P+LLLPGD+F++R PDPVLQQ+E   +   T ND+FK V +Y+DRI RPEQ+++++  A+
Sbjct  108  PLLLLPGDSFATRQPDPVLQQIEQSYNLGITTNDAFKPVCKYWDRINRPEQLMSAMINAM  167

Query  127  NVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADKLKQSK  186
             V+ DPA+ G   I++ QDVQGEAYD+PE FF++++H I R      + ++A D +   K
Sbjct  168  RVLTDPAETGAVCIALPQDVQGEAYDFPEYFFKKRVHRITRPLAVQEEFEEALDIIMNKK  227

Query  187  QPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLGEGSSN  246
            +PIII GGGV YSEA E +  FA++ NIP+  T  G   +    P  +  IG  G  ++N
Sbjct  228  KPIIICGGGVRYSEAGEALVDFAEEFNIPICETQAGKSAIKSSHPLNLGGIGVTGNLAAN  287

Query  247  NLATDTDLALAVGTKLGDFTTGSWTNFENENFQLVS  282
             +A DTDL + VGT+  DFTT S + F+N     ++
Sbjct  288  MIAKDTDLVIGVGTRFSDFTTSSKSLFKNPEVDFIT  323


>sp|Q8Y9Y1.1|IOLD_LISMO RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase; 
Short=THcHDO hydrolase
Length=638

 Score =  259 bits (661),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/267 (46%), Positives = 178/267 (67%), Gaps = 0/267 (0%)

Query  7    EEYQNELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVALSNRL  66
            EE    L  Y+G +EQ MA   IAYA+ K R++I+  ++S GPGS N++TAA+ AL+N L
Sbjct  53   EEDPGHLNVYQGKNEQGMAHAAIAYAKQKNRKRIYACSASAGPGSANLITAASTALANNL  112

Query  67   PILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTSLPQAI  126
            P+L LP DTF++R PDPVLQQ+EH +S + T ND F++VSRYFDR+ RPEQ++++L +A 
Sbjct  113  PVLFLPADTFATRQPDPVLQQLEHESSAAITTNDGFQAVSRYFDRVQRPEQLMSALIRAF  172

Query  127  NVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADKLKQSK  186
             VM +PA  GPA I ++QD +GEA+DYP  FF+++IH + R  P   ++ +AA  ++ SK
Sbjct  173  EVMTNPASAGPATICIAQDTEGEAFDYPVEFFQKRIHYLNRQIPTKRELTEAARLIQASK  232

Query  187  QPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLGEGSSN  246
             P+II GGG  YS+A EE+ A +++ NIP+  T  G   +  D    +   G LG  ++N
Sbjct  233  TPVIIVGGGARYSDAREELIALSEQSNIPLVETHAGKSTVEFDFKNNLGGTGILGTLAAN  292

Query  247  NLATDTDLALAVGTKLGDFTTGSWTNF  273
                D DL + +GT+  DFTT S T F
Sbjct  293  KAIRDADLVIGIGTRYTDFTTSSKTAF  319


>sp|Q0TUZ2.1|IOLD_CLOP1 RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase; 
Short=THcHDO hydrolase
Length=639

 Score =  258 bits (658),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 179/276 (65%), Gaps = 2/276 (1%)

Query  9    YQN--ELPGYRGHHEQNMALTGIAYARAKRRQQIFVATSSVGPGSTNMVTAAAVALSNRL  66
            Y+N  EL  Y+G +EQ MA    A+A+   R++I   +SSVGPG+ NMVTAAA A  N +
Sbjct  48   YENPGELKVYQGRNEQGMAHVSTAFAKQNNRRKIIACSSSVGPGAANMVTAAATATVNNI  107

Query  67   PILLLPGDTFSSRFPDPVLQQVEHFNSPSETQNDSFKSVSRYFDRITRPEQILTSLPQAI  126
            P+LLLPGD+F++R PDPVLQQ+E   +   T ND+FK V +Y+DRI RPEQ+++++  A+
Sbjct  108  PLLLLPGDSFATRQPDPVLQQIEQSYNLGITTNDAFKPVCKYWDRINRPEQLMSAMINAM  167

Query  127  NVMLDPADCGPAVISMSQDVQGEAYDYPEIFFEEKIHEIRRIHPDPNQIQKAADKLKQSK  186
             V+ DPA+ G   I++ QDVQGEAYD+PE FF++++H I R      + ++A D +   K
Sbjct  168  RVLTDPAETGAVCIALPQDVQGEAYDFPEYFFKKRVHRITRPLAVQEEFEEALDIIMNKK  227

Query  187  QPIIISGGGVLYSEAEEEISAFAKKHNIPVTATVMGIGCMNKDDPYYISAIGCLGEGSSN  246
            +PIII GGGV YSEA E +  FA++ NIP+  T  G   +    P  +  IG  G  ++N
Sbjct  228  KPIIICGGGVRYSEAGEALVDFAEEFNIPICETQAGKSAIKSSHPLNLGGIGVTGNLAAN  287

Query  247  NLATDTDLALAVGTKLGDFTTGSWTNFENENFQLVS  282
             +A D DL + VGT+  DFTT S + F+N     ++
Sbjct  288  MIAKDADLVIGVGTRFSDFTTSSKSLFKNPEVDFIT  323