GOS 2035030

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1093025574928
Annotathon code: GOS_2035030
Sample :
  • GPS :8°24'54s; 124°14'23w
  • Tropical South Pacific: 600 miles from F. Polynesia - International
  • Open Ocean (-2m, 27.6°C, 0.1-0.8 microns)
Authors
Team : Biochimie 2011
Username : BrothTeam
Annotated on : 2011-06-19 10:14:45
  • GILLET Rémi
  • PESENTI Yoann

Synopsis

  • Taxonomy: Cyanobacteria (NCBI info)
    Rank: phylum - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 1117
    Kingdom: Bacteria - Phylum: Cyanobacteria - Class: - Order:
    Bacteria; Cyanobacteria;

Genomic Sequence

>JCVI_READ_1093025574928 GOS_2035030 Genomic DNA
CATCAAAGATATATACAAGACCGGAAGAGGATCACTAACCATTAGAGGAGTTATACATCAGGAAGAAATTAATAATGGGAAAGGTAAGCATAAAAGGAAT
GCCCTTGTTGTTACAGAACTTCCTTACCAAATCAACAAAGCAGCTTGGATTGAAAAGTTAGCTGATCTTGTAAACACAGGAAAAATAAATGGTATTTCTG
ACATACGCGACGAAAGCGATAGAGACGGTATGAGAATAACAATAGAACTCAAAAAAAACGTAAATAGCGATTTAGTTATATCTGATCTATACAAGAAAAC
ATCATTACAAACTAATTTTGGAGCTATATTTTTAGCTTTAATCGATGGAAAACCAGTTCAGCTCTCTTTAAAAGAATATTTAAAACAATTTTTAGAATTC
AGAGAGATAACTGTTTTAAAAAGAACAAAACATTTTTTAGAATTAACAGAAGAAAAATTAGAGATTCTACAAGGTTTTGCTTTAGCAGTTAAAAATATAA
AAAGAATCATTGAAATAGTTCAAAACTCTGAAAATACTATTGAAGCTAAATCATCATTAGAACAAAAACTTAACTTAACGAGTAAACAAAGTAATGCAGT
CCTCAGTATGCCTATAAAAAAATTAACCAACCTAGAAAGAATCCAAATAGATCAAAATATTATAGATTTAAAAGTTAAAAAAGAATCACTAAGTAAAATA
TTAAATGAAAGAACAGTTTTATTAAATATTTTAGAGGAAGAATTAAAAAGCTTAAAAGATAAATATAATACAAAAAGATCTACAAAAATAGTTAAAAATA
TTAATATAGATGATGAAAATAAAGTTATTAATAAACAAATTCTTAACGAATTAATTAATAATAAAGCGAAAATTTCAATTGATAACAAATTTAATATAAA
AAATTTGTTAATTAATAATTATAAAAAATTAATTGAGAATGATAATAAATTAATT

Translation

[2 - 955/955]   direct strand
>GOS_2035030 Translation [2-955   direct strand]
IKDIYKTGRGSLTIRGVIHQEEINNGKGKHKRNALVVTELPYQINKAAWIEKLADLVNTGKINGISDIRDESDRDGMRITIELKKNVNSDLVISDLYKKT
SLQTNFGAIFLALIDGKPVQLSLKEYLKQFLEFREITVLKRTKHFLELTEEKLEILQGFALAVKNIKRIIEIVQNSENTIEAKSSLEQKLNLTSKQSNAV
LSMPIKKLTNLERIQIDQNIIDLKVKKESLSKILNERTVLLNILEEELKSLKDKYNTKRSTKIVKNINIDDENKVINKQILNELINNKAKISIDNKFNIK
NLLINNYKKLIENDNKLI

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

Analyse du fragment d'ADN GOS_2035030, long de 955 pb, pêché en 2004 à 2m de profondeur en plein Pacifique Sud Tropical à environ 1000 Km de la Polynésie.



Parmi les 2 ORFs candidates proposées par ORFfinder, nous avons retenu la plus longue, de coordonnées [2 - 955] (any codon). Nous avons utilisé le paramètre "any codon" car le BLASTp nous a montré que notre ORF était incomplète en 5' (et en 3' également car il n'y a pas de codon stop dans la séquence. L'étape du BLAST nous a permis d'estimer la proportion de séquence manquante à notre ORF à environ 70%.



Concernant la fonction de la protéine codée par notre ORF, les résultats de cette analyse concordent bien:


- Interproscan y a reconnu notamment un domaine Topoisomérase IV aux coordonnées [1 309] de l'ORF, avec une bonne e-value de 1.8e-63, que nous avons sélectionné pour les raisons énumérées dans la rubrique concernée.

-Le BLASTp contre NR (et celui contre SwissProtun peu aussi) a montré un très grand nombre d'homologues avec de bon scores codant ici aussi pour la sous unité A de la DNA Topoisomérase IV

Nous avons pour la Gene Ontology choisi DNA metabolic process et DNA binding car effectivement et comme nous l'avons vu, la DNA Topoisomérase IV se fixe à l'ADN afin de le compacter en le surenroulant négativement.


Pour le champ "symbole du gène", nous avons retrouvé dans la fiche SwissProt du meilleur des hits le symbole officiel de la sous-unité A de la Topoisomérase IV: "parC".



Achevons cette conclusion avec l'appartenance taxonomique de notre séquence, il n'y a pas eu de contradiction en croisant les différentes étapes de l'analyse:


- Les résultats d'Interpro nous ont indiqué que ce domaine était très majoritairement retrouvé chez les bactéries, sans plus de précisions

- Les BLASTp contre NR et Swissprot on apporté plus de précision, et nous ont orienté vers l'hypothèse (nous insistons sur le caractère hypothétique de cette remarque) selon laquelle notre ORF pourrait provenir d'une Cyanobactérie, étant donné les bons résultats (qualitativement et quantitativement) d'homologues provenant pour la majorité et pour les meilleurs de cyanobactéries.

- C'est à l'étape des arbres phylogénétiques que l'origine taxonomique de notre séquence a pu être plus précisément supposée. En effet, les deux arbres (PhyML et BioNJ),très cohérents l'un par rapport à l'autre ainsi que par rapport à la phylogénie de référence, ont tous les deux placés notre ORF dans un taxon monophylétique exclusivement composé de Topoisomérases de Prochlorococcus Marinus (une cyanobactérie), avec comme homologue le plus proche celle provenant de "Prochlorococcus marinus str. MIT 9515". Il est donc probable que notre séquence provienne d'un tel organisme, et ce que l'on sait, c'est qu'elle provient clairement d'une cyanobactériecar elle est placée au coeur d'un taxon monophylétique composé de cyanobactéries exclusivement.






ORF finding

PROTOCOLE:


SMS ORF finder / at least 60 codons long / pour chaque brin: recherche sur les 3 cadres de lecture avec les codons usuels, puis quelconques.



ANALYSE DES RÉSULTATS:


- Dans la rubrique protocole, nous vous demandons uniquement de fournir les paramètres utilisés pour réaliser votre recherche. Il n'est donc pas nécessaire de dire où vous avez cliqué.


- Vous devez décrire plus précisément vos résultats. Il faut par exemple lister tous les ORFs que vous avez détectés (éventuellement sous forme d'un tableau pour être synthétique).


- Vous devez justifier pourquoi vous pensez que votre ORF est complet.


PROTOCOLE:


Avec NCBI ORFinder

A) NCBI ORFinder / initiation 'ATG initiation codon' /

B) NCBI ORFinder / initiation 'Alternative initiations codons /


Avec SMS ORFinder, réalisation de la recherche en quatre étapes (qui diffèrent par le choix des paramètres):

C) SMS ORFinder / sens direct / cadres 1, 2 & 3 / min 60 AA / initiation 'usuals codons' / code génétique 'universel'

D) SMS ORFinder / sens indirect / cadres 1, 2 & 3 / min 60 AA / initiation 'usuals codons' / code génétique 'universel'

E) SMS ORFinder / sens direct / cadres 1, 2 & 3 / min 60 AA / initiation 'any codon' / code génétique 'universel'

F) SMS ORFinder / sens indirect / cadres 1, 2 & 3 / min 60 AA / initiation 'any codon' / code génétique 'universel'





ANALYSE DES RÉSULTATS:


Finder détecte deux ORF's potentielles dans notre séquence de 955 pdb, localisées dans les cadres de lecture (CDL) +2 et -2.

Celle du CDL +2 est bien plus longue (726 bases contre 153 bases pour le CDL -2). Elle est donc meilleure candidate pour être une vraie ORF.

On ne voit pas de codon STOP après notre ORF. Elle est donc incomplète en 3'.

Les résultats de SMS ORF finder en any codon montrent une ORF sur le CDL +2 allant de la base 2 à la base 955, ce début potentiel à la base 2 montre que toute la séquence d'ADN ne contient aucun codon STOP dans ce cadre de lecture, et donc que la séquence entre les bases 2 et 230 peut faire partie intégrante d'une vraie ORF. Par ailleurs, on voit que toute cette portion (2->230) ne code pour aucune méthionine, cela signifie que si cette portion fait partie de l'ORF, alors notre ORF est incomplète en 5'.

Afin de repérer tout de suite le début de notre ORF, nous avons décidé de faire un blastp contre NR à partir de la séquence (2->955) traduite par SMS . On a alors vu que pour les 8 meilleurs alignements, l'acide aminé (aa) n°1 de notre séquence query s'aligne en face de l'aa n° 228 des séquences subject, ce qui signifie que 227 aa faisaient défaut en 5' de notre ORF.

Nous prenons donc comme ORF cette séquence protéique. L'ORF est incomplète en 5' et en 3' donc il est absolument inutile de calculer le poids moléculaire de la portion de protéine pour laquelle elle code.










RÉSULTATS BRUTS:


* SMS orf finder (at least 60 codons long) on the direct strand, frames 1, 2 and 3 (with usual codons):


No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 230 to base 955.
ATGAGAATAACAATAGAACTCAAAAAAAACGTAAATAGCGATTTAGTTATATCTGATCTA
TACAAGAAAACATCATTACAAACTAATTTTGGAGCTATATTTTTAGCTTTAATCGATGGA
AAACCAGTTCAGCTCTCTTTAAAAGAATATTTAAAACAATTTTTAGAATTCAGAGAGATA
ACTGTTTTAAAAAGAACAAAACATTTTTTAGAATTAACAGAAGAAAAATTAGAGATTCTA
CAAGGTTTTGCTTTAGCAGTTAAAAATATAAAAAGAATCATTGAAATAGTTCAAAACTCT
GAAAATACTATTGAAGCTAAATCATCATTAGAACAAAAACTTAACTTAACGAGTAAACAA
AGTAATGCAGTCCTCAGTATGCCTATAAAAAAATTAACCAACCTAGAAAGAATCCAAATA
GATCAAAATATTATAGATTTAAAAGTTAAAAAAGAATCACTAAGTAAAATATTAAATGAA
AGAACAGTTTTATTAAATATTTTAGAGGAAGAATTAAAAAGCTTAAAAGATAAATATAAT
ACAAAAAGATCTACAAAAATAGTTAAAAATATTAATATAGATGATGAAAATAAAGTTATT
AATAAACAAATTCTTAACGAATTAATTAATAATAAAGCGAAAATTTCAATTGATAACAAA
TTTAATATAAAAAATTTGTTAATTAATAATTATAAAAAATTAATTGAGAATGATAATAAA
TTAATT

>Translation of ORF number 1 in reading frame 2 on the direct strand.
MRITIELKKNVNSDLVISDLYKKTSLQTNFGAIFLALIDGKPVQLSLKEYLKQFLEFREI
TVLKRTKHFLELTEEKLEILQGFALAVKNIKRIIEIVQNSENTIEAKSSLEQKLNLTSKQ
SNAVLSMPIKKLTNLERIQIDQNIIDLKVKKESLSKILNERTVLLNILEEELKSLKDKYN
TKRSTKIVKNINIDDENKVINKQILNELINNKAKISIDNKFNIKNLLINNYKKLIENDNK
LI


No ORFs were found in reading frame 3.


* SMS orf finder (at least 60 codons long) on the direct strand, frames 1, 2 and 3 (with any codon):


No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 2 to base 955.
ATCAAAGATATATACAAGACCGGAAGAGGATCACTAACCATTAGAGGAGTTATACATCAG
GAAGAAATTAATAATGGGAAAGGTAAGCATAAAAGGAATGCCCTTGTTGTTACAGAACTT
CCTTACCAAATCAACAAAGCAGCTTGGATTGAAAAGTTAGCTGATCTTGTAAACACAGGA
AAAATAAATGGTATTTCTGACATACGCGACGAAAGCGATAGAGACGGTATGAGAATAACA
ATAGAACTCAAAAAAAACGTAAATAGCGATTTAGTTATATCTGATCTATACAAGAAAACA
TCATTACAAACTAATTTTGGAGCTATATTTTTAGCTTTAATCGATGGAAAACCAGTTCAG
CTCTCTTTAAAAGAATATTTAAAACAATTTTTAGAATTCAGAGAGATAACTGTTTTAAAA
AGAACAAAACATTTTTTAGAATTAACAGAAGAAAAATTAGAGATTCTACAAGGTTTTGCT
TTAGCAGTTAAAAATATAAAAAGAATCATTGAAATAGTTCAAAACTCTGAAAATACTATT
GAAGCTAAATCATCATTAGAACAAAAACTTAACTTAACGAGTAAACAAAGTAATGCAGTC
CTCAGTATGCCTATAAAAAAATTAACCAACCTAGAAAGAATCCAAATAGATCAAAATATT
ATAGATTTAAAAGTTAAAAAAGAATCACTAAGTAAAATATTAAATGAAAGAACAGTTTTA
TTAAATATTTTAGAGGAAGAATTAAAAAGCTTAAAAGATAAATATAATACAAAAAGATCT
ACAAAAATAGTTAAAAATATTAATATAGATGATGAAAATAAAGTTATTAATAAACAAATT
CTTAACGAATTAATTAATAATAAAGCGAAAATTTCAATTGATAACAAATTTAATATAAAA
AATTTGTTAATTAATAATTATAAAAAATTAATTGAGAATGATAATAAATTAATT

>Translation of ORF number 1 in reading frame 2 on the direct strand.
IKDIYKTGRGSLTIRGVIHQEEINNGKGKHKRNALVVTELPYQINKAAWIEKLADLVNTG
KINGISDIRDESDRDGMRITIELKKNVNSDLVISDLYKKTSLQTNFGAIFLALIDGKPVQ
LSLKEYLKQFLEFREITVLKRTKHFLELTEEKLEILQGFALAVKNIKRIIEIVQNSENTI
EAKSSLEQKLNLTSKQSNAVLSMPIKKLTNLERIQIDQNIIDLKVKKESLSKILNERTVL
LNILEEELKSLKDKYNTKRSTKIVKNINIDDENKVINKQILNELINNKAKISIDNKFNIK
NLLINNYKKLIENDNKLI

No ORFs were found in reading frame 3.



* SMS orf finder (at least 60 codons long) on the reverse strand, frames 1, 2 and 3 (with usual codons):


No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 68 to base 304.
TTGTTATCAATTGAAATTTTCGCTTTATTATTAATTAATTCGTTAAGAATTTGTTTATTA
ATAACTTTATTTTCATCATCTATATTAATATTTTTAACTATTTTTGTAGATCTTTTTGTA
TTATATTTATCTTTTAAGCTTTTTAATTCTTCCTCTAAAATATTTAATAAAACTGTTCTT
TCATTTAATATTTTACTTAGTGATTCTTTTTTAACTTTTAAATCTATAATATTTTGA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
LLSIEIFALLLINSLRICLLITLFSSSILIFLTIFVDLFVLYLSFKLFNSSSKIFNKTVL
SFNILLSDSFLTFKSIIF*

No ORFs were found in reading frame 3.



* SMS orf finder (at least 60 codons long) on the reverse strand, frames 1, 2 and 3 (with any codon):


No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 38 to base 304.
TTATTAATTAACAAATTTTTTATATTAAATTTGTTATCAATTGAAATTTTCGCTTTATTA
TTAATTAATTCGTTAAGAATTTGTTTATTAATAACTTTATTTTCATCATCTATATTAATA
TTTTTAACTATTTTTGTAGATCTTTTTGTATTATATTTATCTTTTAAGCTTTTTAATTCT
TCCTCTAAAATATTTAATAAAACTGTTCTTTCATTTAATATTTTACTTAGTGATTCTTTT
TTAACTTTTAAATCTATAATATTTTGA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
LLINKFFILNLLSIEIFALLLINSLRICLLITLFSSSILIFLTIFVDLFVLYLSFKLFNS
SSKIFNKTVLSFNILLSDSFLTFKSIIF*

>ORF number 2 in reading frame 2 on the reverse strand extends from base 599 to base 832.
ACTGGTTTTCCATCGATTAAAGCTAAAAATATAGCTCCAAAATTAGTTTGTAATGATGTT
TTCTTGTATAGATCAGATATAACTAAATCGCTATTTACGTTTTTTTTGAGTTCTATTGTT
ATTCTCATACCGTCTCTATCGCTTTCGTCGCGTATGTCAGAAATACCATTTATTTTTCCT
GTGTTTACAAGATCAGCTAACTTTTCAATCCAAGCTGCTTTGTTGATTTGGTAA

>Translation of ORF number 2 in reading frame 2 on the reverse strand.
TGFPSIKAKNIAPKLVCNDVFLYRSDITKSLFTFFLSSIVILIPSLSLSSRMSEIPFIFP
VFTRSANFSIQAALLIW*

No ORFs were found in reading frame 3.


Multiple Alignement

PROTOCOLE:


Phylogeny.fr / Multiple alignment : muscle / alignment curation : Gblock



ANALYSE DES RÉSULTATS:


Nous avons un alignement d'une taille de 1059 positions, on voit tout de suite que notre ORF traduite ne couvre qu'une petite partie centrale de ses homologues; elleva de la position 254 de l'alignement multiple à la position 625, sur 1059. Cela corrobore les conclusions issues de l'analyse par BLAST: notre ORF serait alors bien incomplète en 5' et en 3', et sa traduction correspond certainement à moins de 40% de la longueur du peptide codé par ce gène.


L'alignement montre 236 positions retenues pour la construction des arbres phylogénétiques, c'est un assez bon résultat, nous pouvons donc nous attendre a un arbre significatif.


Recoupons à présent les résultats de cet alignement multiple avec ceux de la recherche Interpro. Les blocs de similarité entre les séquences ont les coordonnées suivantes sur l'alignement multiple:

[254 274] [290 325] [333 441] [472 541].

D'après nos calculs, le domaine que nous avons retenu à l'étape d'Interpro (PTHR10169:SF4 1->309) correspond sur cet alignement aux coordonnées [254 616]. On voit donc que plusieurs parties de ce domaine (les 4 blocs de similarité de cet alignement multiple) sont reconnues dans chacune des séquences. Cela confirme que le domaine fonctionnel détecté par Interpro (Topoisomérase IV) serait également présent chez tous les homologues de notre ORF, il s'agirait d'un domaine conservé, soumis à une pression de sélection.


Globalement il apparait que les homologues de notre séquences aient des alignements cohérents. On voit qu'ils présentent de façon générale (et notamment pour les meilleurs alignements, cf: BLAST) 227 acides aminés supplémentaires du coté N-terminal par rapport à notre ORF.

Coté C-terminal, la fin des séquences s'aligne un peu moins parfaitement qu'en N-ter, mais quoi qu'il en soit ces différences de longueur d'alignement sont négligeables puisqu'elles n'excèdent pas 12 acides aminés d'écart.

Les séquences se montrent donc relativement peu divergentes.


Pour conclure, on discerne grâce à cet alignement multiple une région conservée dans la partie centrale de ce dernier, entre les positions 254 et 541, ce qui est cohérent avec les résultats d'interpro, qui montraient au niveau de cette région une fonction Topoisomérase IV, d'où la conservation de ces séquences là.

Le nombre de positions retenues nous prépare à priori à des arbres phylogénétiques fiables.









Gblocks 0.91b Results

Processed file: input.fasta
Number of sequences: 24
Alignment assumed to be: Protein
New number of positions: 236 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
CYANOTHECE_gi|1  MIQQERKLMAKQL-------KLVGTGEITPTALHAEMQRSYLEYAMSVIVGRALPDVRDG
ACARYOMA_gi|158  --------MTFSS--------DPAQDRIILTDLRDEMSRSYLEYAMSVIVGRALPDARDG
LYNGBYA_gi|1194  --------MARQL-------NLLS-GQVIATPLHTEMQQSYLEYAMSVIVGRALPDVRDG
TRICHOERY_gi|11  --------MAKKL-------NLLS-GKVITTSLHTEMQQSYLEYAMSVIVGRALPDVRDG
OSCILLATOR_gi|3  --------MAKQL-------NLFS-GQVISTALHTEMQQSYLEYAMSVIVGRALPDVRDG
CROCOWAT_gi|679  --------MAKQL-------RLVGSGEIIPTALHAEMQRSYLEYAMSVIVGRALPDVRDG
CYAN-UCYNA_gi|2  --------MAQQL-------KFTKTGKIISTSLHTEMRHSYLEYAMSVIVGRALPDARDG
ANABAENA_gi|759  --------MAKQL-------NLLSTGQVITTALHTEMQRSYLEYAMSVIVGRALPDVRDG
NODULASPUMI_gi|  --------MAKQL-------NLLPTGQVITTALHTEMQRSYLEYAMSVIVGRALPDVRDG
NOSTOCAZOLL_gi|  --------MAKQL-------NLLSTGQVITTALHTEMQRSYLEYAMSVIVGRALPDVRDG
CYLINDRORACI_gi  --------MAEQL-------NLLNTGQVVSTALHTEMQRSYLEYAMSVIVGRALPDVRDG
RAPHIBROOKI_gi|  --------MAEQL-------NLLNTGQVVPTALHTEMQQSYLEYAMSVIVGRALPDVRDG
CYANOBIUM_gi|25  --------MAEERGNERNGGDPGGDGRIQPIALHQEMQRSYLEYAMSVIVGRALPDARDG
ORF---GOS_20350  ------------------------------------------------------------
ext_-_Streprose  MADENTPETPESVTLEEEVTVPGVGMRVEPVQLETEMQRSYLDYAMSVIVSRALPDVRDG
GLOVIOLACEUS_gi  --------MTT----------------IIPTNLRNEMQRSYLEYAMSVIVGRALPDARDG
ext_-_Lactcasei  --------MDDRQ-----------ESRITNVNLGETMRKSFLEYAMSVIVARALPDVRDG
ext_-_Verrucoba  --------MENIS-----------NERISSTSITDIMQTAYIDYSMSVIVSRALPDARDG
SYNECHO-COCC_gi  --------MADER--------------IVSISLHQEMQRSYLEYAMSVIVGRALPDVRDG
PCM_gi|12396523  --------MTKEK--------------FTSISLQEEMQRSYLEYAMSVIVGRALPDARDG
PCMPASTORI_gi|3  --------MTKEK--------------FTSISLQEEMQRSYLEYAMSVIIGRALPDARDG
ext_-_Candisumu  --------MKEKE-------------KIITINIEDEMKSSYRDYSMSVIVSRALPDVRDG
THERMOSYNECHOel  --------MSFAA----------DSSRIIPTELREEISRSYLEYAMSVIVGRALPDARDG
ext_-_Oritsutsu  --------MSEQE---------YKESNINIISIKEEMQRSYLDYAMSVIVSRALPDVRDG
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
CYANOTHECE_gi|1  LKPVHRRILYAMHELGLTPDRPFRKCARVVGDVLGKYHPHGDQAVYDALVRMVQDFSSRY
ACARYOMA_gi|158  LKPVHRRILYAMYELGLTPDRPFRKCARVVGEVLGKYHPHGDTAVYDALVRMAQDFSMRM
LYNGBYA_gi|1194  LKPVHRRILYAMHELGLTPDRPYRKCARVVGDVLGKYHPHGDQSVYDALVRLVQEFSSRY
TRICHOERY_gi|11  QKPVHRRIIYAMHELGLTPDRPFRKCARVVGDVLGKYHPHGDQAVYDAMVRMIQNFSSRY
OSCILLATOR_gi|3  LKPVHRRILYAMHELGLTPDRPYRKCARVVGDVLGKYHPHGDQSVYDALVRMVQEFSSRY
CROCOWAT_gi|679  LKPVHRRILYAMHELGLTPDRPFRKCARVVGDVLGKYHPHGDQAVYDALVRMVQDFSSRY
CYAN-UCYNA_gi|2  LKPVHRRILYAMYELGLTPERPFRKCARVVGDVLGKYHPHGDQAVYDALVRMAQDFSSRY
ANABAENA_gi|759  LKPVHRRILYAMHELGLTPDRPYRKCARVVGDVLGKYHPHGDQAVYDALVRLVQDFSSRY
NODULASPUMI_gi|  LKPVHRRILYAMHELGLTPDRPYRKCARVVGDVLGKYHPHGDQSVYDALVRLVQEFSCRY
NOSTOCAZOLL_gi|  LKPVHRRILYAMHELGLTPDRPYRKCARVVGDVLGKYHPHGDQSVYDALVRLVQEFSSRY
CYLINDRORACI_gi  LKPVHRRILYAMHELGLTPDRPYRKCARVVGDVLGKYHPHGDQAVYDALVRLVQDFSSRY
RAPHIBROOKI_gi|  LKPVHRRILYAMHELGLTPDRPYRKCARVVGDVLGKYHPHGDQAVYDALVRLVQDFSSRY
CYANOBIUM_gi|25  LKPVQRRILFAMHELGLTPDRPYRKCARVVGDVLGKYHPHGDQAVYDALVRLVQTFASRH
ORF---GOS_20350  ------------------------------------------------------------
ext_-_Streprose  LKPVHRRVLYAMYDGGYRPEKGFYKCARVVGDVMGTYHPHGDSSIYDALVRLAQPWSMRM
GLOVIOLACEUS_gi  LKPVHRRILFAMHELGLGPDRPYRKCARVVGDVLGKYHPHGDSAVYDALVRLAQDFSTRY
ext_-_Lactcasei  LKPVQRRILYGMNELGVTPDKPYKKSARIVGDVMGKYHPHGDSSIYEGLVRMAQDFSYRY
ext_-_Verrucoba  LKPVQRRILYAMLREGLLHNRAFDKCAGVVGEVLKNYHPHGDSSVYDTLVRMAQKWVMRY
SYNECHO-COCC_gi  LKPVQRRILFAMHELGLTPDRPYRKCARVVGDVLGKYHPHGDQAVYDALVRLVQTFGCRN
PCM_gi|12396523  LKPVQRRILFAMHELGLTPDRPFRKCARVVGDVLGKYHPHGDQAVYEALVRLVQDFSTKY
PCMPASTORI_gi|3  LKPVQRRILFAMHELGLTPDRPFRKCARVVGDVLGKYHPHGDQAVYEALVRLVQDFSTKY
ext_-_Candisumu  LKPVHRRVLYGMYEQGALFSKNYRKSARIVGNVLGKYHPHGDSSVYDAIVRMAQSWSLRY
THERMOSYNECHOel  LKPVHRRILYAMYELGLTSDRPFRKCARVVGEVLGKYHPHGDSAVYDALVRMAQDFSMRH
ext_-_Oritsutsu  LKPVHRRVLYAMYESGYHYNKQYRKSARVVGDVIGKYHPHGELAVYDSLVRMAQDFSLRL
                                                                             


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
CYANOTHECE_gi|1  PLLAGHGNFGSVDNDPPAAMRYTETRLSPIADQAMLTEISEAIVDFSSNFDNSQQEPVVL
ACARYOMA_gi|158  PLINGHGNFGSIDNDPPAAMRYTECRLQALSTDSLLPDIEQETVDFGDNFDGSQQEPLVL
LYNGBYA_gi|1194  PLLAGHGNFGSVDNDPPAAMRYTETRLASIGNEGLLTQVGEATVDFISNFDNSQQEPTVL
TRICHOERY_gi|11  PLLDGHGNFGSIDNDPAAAMRYTESRLASIGNEGLLTQISEAIVDFTNNFDGSQQEPKVL
OSCILLATOR_gi|3  PLLAGHGNFGSVDNDPPAAMRYTETRLASICHEAMLTQVGEATVDFSDNFDSSQQEPTVL
CROCOWAT_gi|679  PLLAGHGNFGSVDNDPPAAMRYTETRLSPIADQSMLTEISEAIVDFSSNFDNSQQEPVVL
CYAN-UCYNA_gi|2  PLLSGHGNFGSIDNDPPAAMRYTETRLSSIANEGILGEIGENIIDFNNNFDNSQQEPIVL
ANABAENA_gi|759  PLLGGHGNFGSVDNDPPAAMRYTETRLAPISHEGMLTEIGEETVEFVGNFDNSQQEPTVL
NODULASPUMI_gi|  PLLSGHGNFGSVDNDPPAAMRYTETRLAPISYEGMLAEIADETVEFIGNFDNSQQEPTVL
NOSTOCAZOLL_gi|  PLLAGHGNFGSVDNDPPAAMRYTETRLAPVGHEGMLTEIGEETVEFIGNFDNSQQEPTVL
CYLINDRORACI_gi  PLLGGHGNFGSVDNDPPAAMRYTETRLAPIGHEAMLREIGEETVEFVGNFDNSQQEPTVL
RAPHIBROOKI_gi|  PLLGGHGNFGSVDNDPPAAMRYTETRLAPIGHEAMLREIGEETVEFVGNFDNSQQEPTVL
CYANOBIUM_gi|25  PLLDGHGNFGSVDDDPPAAMRYTETRLAPIAHEGLLDEIGNDTVDFAPNFDGSQQEPTVL
ORF---GOS_20350  ------------------------------------------------------------
ext_-_Streprose  PLVDSNGNFGSPGNDPAAAMRYTECKMMPLSME-MVRDIDEETVDFQDNYDGRNQEPTVL
GLOVIOLACEUS_gi  LLIDGHGNFGSVDNDPPAAMRYTECRLTPLTRDTLLADLEAETVDFSDNFDGSQQEPTVL
ext_-_Lactcasei  MLVDGHGNFGSVDGDGAAAMRYTEARMSKIAVE-MLRDINKDTIDFQDNYDGTEKEPVVL
ext_-_Verrucoba  PLIDPQGNFGSVDGDSPAAYRYTEARLTAIAED-LLRNIDEDTVDFVANYKESTTEPSVL
SYNECHO-COCC_gi  PLLDGHGNFGSVDDDPPAAMRYTETRLAPVSHQALLEEIGSDTVDFAPNFDGSQQEPTVL
PCM_gi|12396523  PTLDGHGNFGSVDNDPPAAMRYTETRLAPIAHECFLQEIETDTVSYSNNFDGSQKEPDIL
PCMPASTORI_gi|3  PTLDGHGNFGSVDNDPPAAMRYTETRLAPIAHECFLQEIGSETVSYSNNFDGSQQEPDIL
ext_-_Candisumu  LLIDGQGNFGSIDNDPPAAMRYTEIKLKKISEE-MLLDLEKETVDMKLNFDDSCKEPIVL
THERMOSYNECHOel  PLIEGHGNFGSIDNDPPAAMRYTECRLQALATEALLQDIEQETVDFVDNFDGSQQEPLVL
ext_-_Oritsutsu  PLVDGQGNFGSMDGDAAAAMRYTEVRLKKVAHS-LLEDINKDTVDFQANYDGLEQEPKVL
                                                                             


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
CYANOTHECE_gi|1  PAQLPNLLLNGCTGIAVGMATNIPPHNLGELVDGLIALIDNPELSDEK----LWKIIPGP
ACARYOMA_gi|158  PARIPQLLINGSSGIAVGMATNIPPHNLGEVIDGLVALIHNPEITDLE----LMKIIPGP
LYNGBYA_gi|1194  PAQLPFLLLNGSSGIAVGMATNVPPHNLGEVVDGLIALIDNSDLSDER----LRSIIPAP
TRICHOERY_gi|11  PAQLPFLLLNGSSGIAVGMATNVPPHNLGEVVDGLIALIDNPNISDQK----LFELIPGP
OSCILLATOR_gi|3  PAELPFLLLNGCSGIAVGMATNIPPHNLNEVVDGLIALIDTPDLSDEK----LLALIPGP
CROCOWAT_gi|679  PAQLPNLLLNGCTGIAVGMATNIPPHNLGEVVDGLIGLIDNPELSDEK----LWKIIPGP
CYAN-UCYNA_gi|2  PVKIPNLLVNGCTGIAVGMATNIPPHNLGELIDGLIALLEKPELSNEK----LWKIIPGP
ANABAENA_gi|759  PAQLPFLLLNGCSGIAVGMATNIPPHNLGEIVDGLIALIDQPDLADEK----LLELIPGP
NODULASPUMI_gi|  PAQLPFLLLNGCSGIAVGMATNIPPHNLGELVDGLIALIDQPDLSDQK----LWEIIPGP
NOSTOCAZOLL_gi|  PAQLPFLLLNGCAGIAVGMATNIPPHNLGEVVDGLIVLIDNPDLTDEK----LFEIIPGP
CYLINDRORACI_gi  PAQLPFLLINGCAGIAVGMATNIPPHNLGEIVDGLIALIDHPDLTEEK----LLELIPGP
RAPHIBROOKI_gi|  PAQLPFLLINGCAGIAVGMATNIPPHNLGEIVDGLIALIDHPDLTEEK----LLELIPGP
CYANOBIUM_gi|25  PAQLPFLLLNGCTGIAVGMATNIPPHNLGEVVDAMIALIRKPDLSDEK----LFALVPGP
ORF---GOS_20350  ------------------------------------------------------------
ext_-_Streprose  PARFPNLLVNGSAGIAVGMATNIPPHNLREVAAGAQWYLEHPEASHEELQDALIERIKGP
GLOVIOLACEUS_gi  PSRLPQLLLNGSAGIAVGMATNIPPHQLGELVDGVTALLANPNLGIPE----LMRYIPGP
ext_-_Lactcasei  PARFPNLLVNGATGIAVGMTTNIPPHNLSETISALHVLMDNPDATTAD----LMQALPGP
ext_-_Verrucoba  PAGLPNLLMNGSTGIAVGMATNIPPHNLDELIDGVCAQIDNPNITIAE----LGELIQGP
SYNECHO-COCC_gi  PAQLPFLLLNGCTGIAVGMATSIPPHNLGEVVDALVALIRNPNLSDEK----LLQLVPGP
PCM_gi|12396523  PAQLPFLLLNGSSGIAVGMATNIPPHNLGEIIDGLIALIRDKDISDSK----LSKIILGP
PCMPASTORI_gi|3  PAQLPFLLLNGSSGIAVGMATNIPPHNLGEIVDGLIALINDKEISDLR----LSKIILGP
ext_-_Candisumu  PTCIPNLLINGSSGIAVGMATNMPPHNIVESIEAICSYIDKKKISIEE----LMKYIKAP
THERMOSYNECHOel  PARIPQLLLNGASGIAVGMATNIPPHNLGELVDGLVALIHHPQMSDRE----LMRYIPGP
ext_-_Oritsutsu  PAGFPNLLVNGTGGIAVGMATNIPPHNLCEVVDACCAYIDNNNITIIE----LMELVKGP
                                                                             


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
CYANOTHECE_gi|1  DFPTGGEIIPTQGIEDAYRHGKGIISVRGVVRIERMDVGKKRRKERTAIIVTELPYQVTK
ACARYOMA_gi|158  DFPTGGRILGTAGIREAYTTGRGSITMRGVAEIETLEQS-GRP-DREAIIITELPFQTNK
LYNGBYA_gi|1194  DFPTGGEIVSTDGIAEAYTQGRGSIVMRGVAKIEQVPTAQRRR-TKTAIVVTELPFQVNK
TRICHOERY_gi|11  DFPTGGEIVSTDGIIDTYTKGRGSIPMRGVATIEQVPTGRGRR-TKTAIVVTELPFQVNK
OSCILLATOR_gi|3  DFPTGGEIISTEGITDAYTKGKGSIAVRGVTRMEEIPAARRTR-SKMAIVVTEFPFQVNK
CROCOWAT_gi|679  DFPTGGEIINSQGIEEAYRHGKGIIPVRGVVKIQRMDVGKKRRKERTAIIVTELPYQVNK
CYAN-UCYNA_gi|2  DFPTGGEIIQTEGIKDAYRDGKGIIRVRGVVSIEKINVGKKRRQERTALIITELPYQVNK
ANABAENA_gi|759  DFPTGGEIVGETGIREAYITGKGGIVLRGVATVEEIPGGRGSK-RRMAIIVTELPYQVNK
NODULASPUMI_gi|  DFPTGGEIVGDSGIREAYTSGKGSIVLRGVAKTEEIAPTKGSK-RRTAIIITELPYQVNK
NOSTOCAZOLL_gi|  DFPTGGEIVGNSGIREAYTTGKGGIVLRGVATLEEMLPTKGSK-RRTAIIITELPYQVNK
CYLINDRORACI_gi  DFPTGGQIVGSGGIKEAYNTGKGGIILRGVVSLEDIVSTRGGR-RRTAIIVTELPYQVNK
RAPHIBROOKI_gi|  DFPTGGQIVGSGGIKEAYNTGKGGIILRGVVSLEDILSTRGGR-RRTAIIVTELPYQVNK
CYANOBIUM_gi|25  DFPTGGEVLLSSGVRDTYRLGRGSIPMRGVAHIEEVQPGKGRH-RRSAVVITELPYQLSK
ORF---GOS_20350  -------------IKDIYKTGRGSLTIRGVIHQEEINNGKGKH-KRNALVVTELPYQINK
ext_-_Streprose  DFPTGALVVGRKGIEEAYRTGRGSITMRAVVAVEEIQ-------GRQCLVVTELPYQTNP
GLOVIOLACEUS_gi  DFPTGGTILGQSGIREAYTTGRGSITMRGVAAIETIQV-RGRP-DREAIVITELPYQVCK
ext_-_Lactcasei  DFPTGGVVMGKSGIRHAYETGRGTIVLRGKVDVQTEKSGRER------IVITEIPYMVNK
ext_-_Verrucoba  DFPTGGRIIGRKGIDEYMNTGRGIVRMRGTVTSEPMEGG-----DRERIIISTIPYNVNR
SYNECHO-COCC_gi  DFPTGGVVLTGSGLRDTYLHGRGSIPMRGVAHIEEVQPGKGRH-KRNAVVITELPYQLSK
PCM_gi|12396523  DFPTGGELLYNNGIKNVYLEGRGSITIRGVIKSEEINLGKGKH-KRNALIISELPYQISK
PCMPASTORI_gi|3  DFPTGGELICNSAMNEVYLQGRGSVTVRGVIKNEEINLGKGRH-KKNALIISELPYQISK
ext_-_Candisumu  DFPTGGIIYGYEGVKKYFLTGRGKILLRSKVHFEEIN-------NRICLIVDEIPYQINK
THERMOSYNECHOel  DFPTGGHILGQGGIEEAYTTGRGSMTLRAVATIETLEAP-GRQ-PREAIIITELPYQTNK
ext_-_Oritsutsu  DFPTGGQIIGTFGIKSAYNTGRGKIIVRGKTDIESDS-------LKHAIIITEIPFMVNK
                              #####################               ###########


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
CYANOTHECE_gi|1  STWIEKIADLVNGGRLEGIADIRDE-SDRSGMRVVIELKRDAVAKTVLRELYKKTALQQN
ACARYOMA_gi|158  AALIERIAENVNDKRLEGISDIRDE-SDRDGMRIVIELKRDAYPQVVLNNLYKQTPIQTN
LYNGBYA_gi|1194  ASWIEKTASLVNAGRLEGISDIRDE-SDRDGIRVVIELKREASPQVVLHHLYQQTDLMSK
TRICHOERY_gi|11  AGWIEKTADLVNAGKIEGIADLRDE-SDRSGIRVVIELKREADPSVVLHHLYRNTDLLSK
OSCILLATOR_gi|3  AGWIEKVAELVNQGRIEGISDLRDE-SDREGIRVVIEIKREFSPQTVLSRLYHQTDLQCN
CROCOWAT_gi|679  SAWIEKIADLVNNGRLDGIADIRDE-SDRTGMRVVIELKRDAVAKTVLKELYKKTALQQN
CYAN-UCYNA_gi|2  AAWIEKIADLVNCGRLEGIADIRDE-SDRTGMRVVIELKRDAVTKLVLKELYKKTALEHN
ANABAENA_gi|759  AGWIEKVAELVNQGRLQGISDLRDE-SDREGMRVVIELKRDTNPQEVLQHLYHQTALQTN
NODULASPUMI_gi|  AGWIEKVADLVNHGRLHGISDLRDE-SDREGMRVVIELKRDTNPQEVLQHLYHQTALQSN
NOSTOCAZOLL_gi|  AGWIEKVADLVNQGRLQGISDLRDE-SDREGMRVVIELKRDTNPQEILQHLYHQTALQTT
CYLINDRORACI_gi  AGWIEKVADLVNQGRLHGISDLRDE-SDRQGMRVVIELKRDANPEEVIGQLYHQTALQTT
RAPHIBROOKI_gi|  AGWIEKVADLVNQGRLHGISDLRDE-SDRQGMRVVIELKRDANPEEVIGQLYQQTALQTT
CYANOBIUM_gi|25  AGWIEKLAEQVNDGKIGGIADIRDE-SDREGMRVVVELRRDANADTVLAELQRRTALQSN
ORF---GOS_20350  AAWIEKLADLVNTGKINGISDIRDE-SDRDGMRITIELKKNVNSDLVISDLYKKTSLQTN
ext_-_Streprose  DNLAQKIADLVKDGKVGGIADVRDETSSRTGQRLVVVLKRDAVAKVVLNNLYKHTDLQTN
GLOVIOLACEUS_gi  AALIEKIAELVNDKRIDGISDIRDE-SDRDGLRAVIELKRDAYPRVVLNNLFKLTPLQTN
ext_-_Lactcasei  AKMVERIADLVHEKKIDGIVTLRDE-SDRDGMRIVIDVRRDASASVILNNLYKLTPLQTG
ext_-_Verrucoba  ATLVTKIAELVSTKEVEGISDLRDE-SDENT-RIVIELKRGEFPEVIISKLYKKTALEAS
SYNECHO-COCC_gi  AGWIEKLAEQVNDGKVAGIADIRDE-SDRDGMRVVVELRRDANPEQVLAQLHKRTALQNN
PCM_gi|12396523  AGWIEKLAELVNIGKIDGISDIRDE-SDRDGMRIVIELKKDSNPEIVISNLYKKTTLQSN
PCMPASTORI_gi|3  AGWIEKLAELVNLGKIDGISDIRDE-SDRDGMRVVIELKKDSNSEIVVSNLFKKTALQSN
ext_-_Candisumu  EELINKTLKLVKEGKLEGLSNIRDE-SDRNGMRIVYNIKQNVDKQRLLNNLFKETSLETS
THERMOSYNECHOel  AALMEKIAELVNEKKIEGIADLRDE-SDRDGIRVVIELKRDAHPRVVLNNLYKQTPLQVN
ext_-_Oritsutsu  ASLVEKIAELVNDKRIEGISAIRDE-SNKSGIRVVIELKKHANTDLILNQLYSYTSLQTT
                 #########################       ############################


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
CYANOTHECE_gi|1  FGAIMLALVDNQPRQLSLRQLLEEFLKFREHTLTRQYNYELEECRNRLHLLEGLLIALNN
ACARYOMA_gi|158  FGANMLALVGGDPQLLTLRQFLSVFLEFREDAILRRTRFQLRKAQERDHLLQGLLIALDN
LYNGBYA_gi|1194  FGAIFLALVDSQPRQLTLKQILQEFLNFREQTLIRQYTHELEAALRRGHIVEGLLNALAN
TRICHOERY_gi|11  FGAIMLALVNGQPQQLSLRTLLQEFLNFREETLTRHYTHELQIAQARSHIVAGLLTALKE
OSCILLATOR_gi|3  FGAILLALVNGQPRQLTLRQMLQEFLNFREVTLTRRYNHELQVAVRRCHIVEGLLLVLGN
CROCOWAT_gi|679  FGAIMLALLDNQPCQLSLRQLLEEFLKFREDTLTRQYNNELQECQNRLHLLQGLLISLND
CYAN-UCYNA_gi|2  FGAIMLALVDNQPQQLSLRSLLEEFLSFREKTLNRQYSNELKNCQDQSDILKGLLIALAN
ANABAENA_gi|759  FGAILLAIVEGQPRQLSLRQLLQEFLNFREHTLNRRYSYELGKAASRLNTVEGLLKALSN
NODULASPUMI_gi|  FGAILLALVDGQPRQLSLRQMLQEFLKFREQTLNRRYSYELGKADSRLHIVSGLLKALSQ
NOSTOCAZOLL_gi|  FGAILLALVEGQPRQLSLRQTLQEFLNFREHTLNRRYSYELGKAENRVNLVAGLLKALSK
CYLINDRORACI_gi  FGAILLALVEGQPRQLSLRQMLQEFLRFREDTLNRRYSYELGKAENRASIVAGLLKALFA
RAPHIBROOKI_gi|  FGAILLALVEGQPRQLSLRQMLQEFLRFREDTLNRRYSYELGKAENRASIVAGLLKALSA
CYANOBIUM_gi|25  FGAILLALVNGQPVQLSLRRLLQEFLDYRELTLIRRTRHALRRCEDRLEVVEGLIKALDA
ORF---GOS_20350  FGAIFLALIDGKPVQLSLKEYLKQFLEFREITVLKRTKHFLELTEEKLEILQGFALAVKN
ext_-_Streprose  FGANMLALVDGVPRTLSIDAFIRHWVTHQIEVIVRRTKFRLRKAEERAHILRGLLKALNA
GLOVIOLACEUS_gi  FGCNMLALVNGEPRLLNLKEFLQTFIDFRAEVITRRTHYELRKARERDHILMGMLVALAN
ext_-_Lactcasei  FSFNMVAIVNGAPKVLSLKQILQYYLDHQENVIRRRTQFDLRKAKAREHILEGLRIALDH
ext_-_Verrucoba  FGVNMLALDNKRPKQMNMKEMINCYIDHRREVIYRRTAFRLKKAEDRAHILEGYKIALDN
SYNECHO-COCC_gi  FGAILLALVNGQPIQLSLRQMLQQFLEYRELTMMRRTRYALRRCEERLEVVEGLIKALDD
PCM_gi|12396523  FGAILLALVNGKPVQLTLRKYLNYFLEFREETIRKRTKYFLKIASEKLEILEGFSIATKN
PCMPASTORI_gi|3  FGAIFLALVDGKPIQLTLRKYLNYFLEFREETIRKRTKYFLRIASEKFEILEGFSIATKN
ext_-_Candisumu  FHVNNIALVNGKPTILNLKDLIKHFVNHRHDVIIRRTKYDLNQAKNRAHIIEGFYIVLNN
THERMOSYNECHOel  FGANMLAIVNGEPQLLTLKRSLEVFLRFREEAIARRTRYALRKAEERDHLLQGLLVALAN
ext_-_Oritsutsu  FNVMMLALDQGIPKTMTLKDIIVAFTNFREEVITKRTIFLLNKARDKAHILVGIIIAVSN
                 ############################################################


                        430       440       450       460       470       480
                 =========+=========+=========+=========+=========+=========+
CYANOTHECE_gi|1  LDRIIDILRNAADGTTAKTQFQQEL-------------------------NLSEAQANGI
ACARYOMA_gi|158  LDAVIQLIRQAADSAVARQELMDGF-------------------------GLSDTQADAI
LYNGBYA_gi|1194  LDAVIEILRNAPDGGTAKISLESDL-------------------------QMSEAQADAI
TRICHOERY_gi|11  LDRVIDILRNAPDGNTAKVSFQESL-------------------------GLSENQADAI
OSCILLATOR_gi|3  LDAAIDILRNAPDGSTAKQGLQSRL-------------------------NFSESQADAI
CROCOWAT_gi|679  LDRTIDILRHAADGTTAKVQFQRDL-------------------------NLSEAQANAI
CYAN-UCYNA_gi|2  LDKVINILCNSVDSTIAKEQFQKEL-------------------------GLNEKQANGI
ANABAENA_gi|759  LDEVIEILRQAPDGSTAKVTLCSQL-------------------------DLSEDQADAI
NODULASPUMI_gi|  LDQLIEILRSAADGTTAKMSLCSRL-------------------------DLSESQGDAI
NOSTOCAZOLL_gi|  LDEVIAILRQAADGSTAKMNLCRQL-------------------------DLSEVQADAI
CYLINDRORACI_gi  VDEVITILRQSPDGSTAKMVLCQQL-------------------------DLTETQADAI
RAPHIBROOKI_gi|  VDEVITILRQSPDGSTAKMVLCQQL-------------------------ELTETQADAI
CYANOBIUM_gi|25  LQEVIAMITAAADAASARASLQVRL-------------------------DLSERQADAV
ORF---GOS_20350  IKRIIEIVQNSENTIEAKSSLEQKL-------------------------NLTSKQSNAV
ext_-_Streprose  IDEVIALIRRSNTVEIAREGLMGLL-------------------------EIDELQANAI
GLOVIOLACEUS_gi  LESVIALIRAADDTASARAELVNRF-------------------------ELSEAQAEAI
ext_-_Lactcasei  IDEIITIIRSSETGDKAKVILMDKF-------------------------KLSDKQSQAI
ext_-_Verrucoba  LDDFIKIIRSSANRDEAKVRLQEKY-------------------------PLSDRQVTAI
SYNECHO-COCC_gi  LAKVIQMIQDARDAASAKASLQVHL-------------------------DISERQADAV
PCM_gi|12396523  IKNIIEIIQNSENVSEAKSILIPKL-------------------------DLSNKQADAV
PCMPASTORI_gi|3  IKDIIEVIQNSENATEAKSILIVKL-------------------------SLSEKQADAV
ext_-_Candisumu  LETVIELIKSSKDRNDAKKKILIKY-------------------------NLSEIQVKSI
THERMOSYNECHOel  LDAVIQLIRSASDTALARQQLMQTY-------------------------ALSEAQADAI
ext_-_Oritsutsu  IDEVIKIIRSSANSEEAKSRLMARMWNVSDVYDLVKLVDDRAILKEDGQCFLTEQQTKSI
                 #####################                              #########


                        490       500       510       520       530       540
                 =========+=========+=========+=========+=========+=========+
CYANOTHECE_gi|1  LAMPMRRLTGLERQKLQAEYDELQGRINELENLLNNRPEFLKVLKKELRSLKRKYGDERR
ACARYOMA_gi|158  LQMQLRRLTALEAEKIEREHQDLQERIADLEDILARRERVLEIIETEVTELKTKFASPRR
LYNGBYA_gi|1194  LAMPMRRLTGLERQKLQEEFEELSEQIRQLRRLIDDRSELMKSLKKELRSLKRQYGDPRR
TRICHOERY_gi|11  LAMPMRRLTGLEKQKLEEEHEQLMGKIQELENLLGDRHQLLKALKKELRTLKRKYNDPRR
OSCILLATOR_gi|3  LAMPMRRLTGLERQNLQAEFDELMATIQELQRLLGDRRELLKALKKELRSLKRKYGDPRR
CROCOWAT_gi|679  LAMPMRRLTGLERQKLQAESDELEGKINELETLLNNRPEFLKVLKKELRSLKRKYGDTRR
CYAN-UCYNA_gi|2  LAMPMRRLTGLERKKIETEYEELQIKVNKLEILLKNRKEFLAELKKELRSLKKKYGDKRR
ANABAENA_gi|759  LSMPLRRLTSLEQQNLQREFGELSEQITLLDRLLSDRKELLKALKKDLRSLKRKYGDPRR
NODULASPUMI_gi|  LAMPLRRLTSLEQRNLQQEFEQLSEQIGSLQILLSDRKELLKTLKKDLRSLKRKYNNPRR
NOSTOCAZOLL_gi|  LSMPLRRLTSLEQQNLQQEFDSLNEQITSLRRLLEDRRELLKALKKDLRSLKRKYSDPRR
CYLINDRORACI_gi  LAMPLRRLTSLERQNLQEEFDQLNEQITSLRRLLEDRRELLKSLKKDLRTIKRKYGDTRR
RAPHIBROOKI_gi|  LAMPLRRLTSLEQQNLQEEFHQLSDQITSLRRLLEDRRELLKSLKKDLRTLKRKYGDTRR
CYANOBIUM_gi|25  LAMPLRRLTGLEQESLRQESEELRTERTRLRHLLDDRDSLLEAMVAEFRALKKRYGTPRR
ORF---GOS_20350  LSMPIKKLTNLERIQIDQNIIDLKVKKESLSKILNERTVLLNILEEELKSLKDKYNTKRS
ext_-_Streprose  LEMQLRRLAALEHQKITAEHDELQAKINEYNEILASPAKQRGIVSEELAAIVEKFGDDRR
GLOVIOLACEUS_gi  LQMQLRRLTGMEAGRIEAEHRELIAKIADLSDVLERRERIDQIIRDELLTAKQRLNDPRR
ext_-_Lactcasei  LDMRLVRLTGLEREKVESEYKDVEAAIADYTDILARPERVHQIIYNELLDIQKKFGDKRR
ext_-_Verrucoba  LDLRLYQLTGMERGKIEEEYAELLKLIEELRSILENEYKLLSIIKEELSELKEKYTSPRK
SYNECHO-COCC_gi  LSMPLRRLTGLEQESLRQELEELRQEQSRLRHLLDDRKSLLDTLVSELKHLRKRYATPRR
PCM_gi|12396523  LSMPLKKLTNLEKKQVENEINQLFEKKKYLSTLLNNRSLLLETLIKELIELKKKFNVKRK
PCMPASTORI_gi|3  LSMPLKKLTTLERKQIEIDMKELLEKKKYLNNLLNNRRLLLDTLIEELKSLKKKFNVKRK
ext_-_Candisumu  LELKLNSLTKLENKKIKEEYIHIRKKIYFLKKIISNKFLQKKIIKKELNIVKTKYGDLRR
THERMOSYNECHOel  LQMQLRRLTALEAEKIEREHAELQRQIADYRDILAHRQRVLEIIEKEVTELKAKFATPRR
ext_-_Oritsutsu  LELRLQRLTNTERGKVEDELNNLVKEIKAYLEILGSRDKLLETMKFELNQIKEQFSTARL
                 ############################################################


                        550       560       570       580       590       600
                 =========+=========+=========+=========+=========+=========+
CYANOTHECE_gi|1  TRIVQPTAQKSQSKATQTAKKQSSDQNKTTSISNREPDTT---------SQPFSLFTPQT
ACARYOMA_gi|158  TLIEANLADLDD-------------------------------------IDLIAN-----
LYNGBYA_gi|1194  TRIIVQDPKAQPEQSSSRIRSGKPKSKGSQTTAILQ-------------PVAPAE-----
TRICHOERY_gi|11  TRIIDQIKLKNADDFASISQQKKYLEAGNKEIDIKTKGRVIKSKNITVKSPILTLEAAPP
OSCILLATOR_gi|3  TRLVTVEQGSGGAPEQGSRGAREQGSGGAEGRGSRGAGEQRGGEGKKKATQLPVTSVSTE
CROCOWAT_gi|679  TRIVQATAQKSSSTTTSTSQRKSTNKDKVESKSNQQTETV---------TQPFNLFTPQT
CYAN-UCYNA_gi|2  TRIIGKDTTKINNIETQKLDVPKQPILQSKKKISHT-------------PKQLNL----N
ANABAENA_gi|759  TKLGAKSLEELPKNKKADKHNSSAKTDEDT-------------------ENLSPL----E
NODULASPUMI_gi|  TKLLARSSEEFAKVKGVEKLQITAAAIDS--------------------PNSPDA----E
NOSTOCAZOLL_gi|  TKILAINETPIKSEKGTTETEDNP-------------------------KSKLQTPKSEQ
CYLINDRORACI_gi  TKLIPGQIAVKADKVNNQPSSPGEKEK----------------------SKISQE---EQ
RAPHIBROOKI_gi|  TKLIPGQIAVKPDKVNNQPSSPGEKEK----------------------SKISPE---EQ
CYANOBIUM_gi|25  TRLVEGGDDLVAQRAAAARPNAELQRQQALEALASD-------------SRVLIQ-----
ORF---GOS_20350  TKIVKNINIDDENKVINKQIL----------------------------NELINN-----
ext_-_Streprose  SKLVPFEGDMSI-------------------------------------EDLIAE-----
GLOVIOLACEUS_gi  TIIEKAEGEIDD-------------------------------------ADLIAN-----
ext_-_Lactcasei  TELLVGEVLSLED------------------------------------EDLIEQ-----
ext_-_Verrucoba  CEIVPYEGDISK-------------------------------------ADMTPK-----
SYNECHO-COCC_gi  TALQEGGDELVAQRTAAQRPNTEMLRKQALANVSSD-------------QQLLWQ-----
PCM_gi|12396523  TKILKDINQSEELDTINNQIL----------------------------EDLIIK-----
PCMPASTORI_gi|3  TKILKDINQEKEIDTINNQIL----------------------------EDLINK-----
ext_-_Candisumu  TEINYLGLE----------------------------------------NEVYNN-----
THERMOSYNECHOel  SRIVQADGEISD-------------------------------------IDLIAN-----
ext_-_Oritsutsu  TTIENQEFEQDI-------------------------------------EDLIPE-----
                 #                                                           


                        610       620       630       640       650       660
                 =========+=========+=========+=========+=========+=========+
CYANOTHECE_gi|1  PPKNAILEMTYQGTICWRSPDTKVP---------------DNHVPIYSEPI-QEREQFIV
ACARYOMA_gi|158  --DQAVILVTEQGYVKRMPVDTFNAQSRATRGRA-GAKIKEDDAVEHFFGC-CDHDSVLF
LYNGBYA_gi|1194  --EETFLEFTHRGYVRRLSAKTGDSKSRSKADKSEIIVEDSDDFNVGSYLT-NTGQNLAI
TRICHOERY_gi|11  PTEKVVIEFSHRGYVRRIPAKGFEKYKIDKKSH--ITMENSEDFTTNIIEA-TTDKTLVL
OSCILLATOR_gi|3  PSEATVLEFTHKQYVRRLASAESSRGKNHDKSA--QSRGGESDFSVNTIQA-RTNENLAI
CROCOWAT_gi|679  PPKNAILEMTYQGTICWRSPDDKIP---------------DNHLPIYSEPI-QEREQFVV
CYAN-UCYNA_gi|2  LSKDSILEMTYQGEVAWRKPEDRGF---------------ENKLLIYSEII-GEREQIIV
ANABAENA_gi|759  PAEEAILEITHRGYLRRIQPGKKSKV---------ENGLLEHDFIIQTNIT-DTHKELLV
NODULASPUMI_gi|  PPEEVILDFSHRGYVRRLQPSGKKSKA--------ENGLPDHDFIIQSDLT-ATDKELLV
NOSTOCAZOLL_gi|  PPEEAILEFTQRGYVRRLSPTGKKPKA--------ENGLHENDFIIQTELT-DTEKDLLI
CYLINDRORACI_gi  PPEPAILEFTHRGYVRRLAPGSKKAKA--------ETIMGDNDFLIQTEIT-NTHQDLLI
RAPHIBROOKI_gi|  PPEPAILEFTQRGYVRRLAPGSKKAKA--------ETITGDNDFLIQTEIT-NTHQDLLI
CYANOBIUM_gi|25  --ADRAVKIVTPQVLGRLHLEEPAP-------------LGEHPAPAQLLLTVASQPQVLA
ORF---GOS_20350  ---KAKISIDNKFNIKNLLINNYKK-----------------------------------
ext_-_Streprose  --EDIVVTISRSGYVKRTKTDDYRSQKRGGKGVR-GTKLREDDIVDHFFVS-TTHHWLLF
GLOVIOLACEUS_gi  --QEMVVLVTEQGYIKRLPVDTFDRQRRATRGKS-GARMREDDAVEHFITC-CNHDTVLF
ext_-_Lactcasei  --EDVVITLSHNGYVKRLATSEFKAQNRGGRGIQ-GMNVHDDDFVERLIST-STHDVLLF
ext_-_Verrucoba  --EGCFITISHKGFIKRVSDSEFRTQKRGGKGVQ-GGNTYEDDFVEHIFTA-NTHDTIMF
SYNECHO-COCC_gi  --SDGILRLVTPQVLGRLHLLDDLD-------------FGDHGCSAKLLLPVQPEPQLLA
PCM_gi|12396523  ---DAKISIDNRFYFKKLIYYNYKKLLDQ------ENKFIENKNVQKFICNIKKSLRIIG
PCMPASTORI_gi|3  ---ETKISVDNRFYFKKIIYNNYKKILDH------ENKFIDNKNVQKFICRIDKSLKIIG
ext_-_Candisumu  ---KFVITITNTGYIKKNYLNKYKI----------GVTYKCKKNNLEKIIIAKNYQDILF
THERMOSYNECHOel  --DKSVILVTQQGYIKRMPVDTFEAQSRDGRGRK-GAEIKEDDAVEHFFSC-NDHDRILF
ext_-_Oritsutsu  --EEVVVTVTLAGYIKRVPLSTYRAQKRGGKGRV-GSSVQNEDVITHLFIE-NTHTSILF
                                                                             


                        670       680       690       700       710       720
                 =========+=========+=========+=========+=========+=========+
CYANOTHECE_gi|1  ITDIGKAYPVNVADVPPIE--I------QPIPLLSLLPKSAQRD-----SKKVVSLFFLS
ACARYOMA_gi|158  FSDRGVVYCLRAYQIPVSSRTA------RGVPLVQLLPIPREEK--------ITSVIPVS
LYNGBYA_gi|1194  ITRTGKAYPLNVGDIPTTSNRS------RGTPLITLLPSSVTKDPPMSLQELILAHFIVA
TRICHOERY_gi|11  LTRTGKAYPLKVNNIPSASNRSTIRNENKGVPLVTLLPPSATKEITDARKEIIIGQFILN
OSCILLATOR_gi|3  LTRTGKAYPLKISDIPTVGNRD------RGTPIISLLSPSATKDVAPGNLPEIVAGMFVL
CROCOWAT_gi|679  ITDIGKAYPVNVADVPPID--I------QPISLLSLLPKSAQRD-----SKKVISAFFVL
CYAN-UCYNA_gi|2  ITDNGKAYPIKILDIPYIDV--------QSTFLISLLPENAQKD-----TKSVISIFFLT
ANABAENA_gi|759  LTNGGKLYPVKVGDIPLTTGRSP-----RGTPLITMLTTTAQGN-----QEPVVSRLLLP
NODULASPUMI_gi|  ITSSGKVYPVNVGDIRPTTGRSP-----RGTPLITMLSSTAQGA-----QEAVVSRLILP
NOSTOCAZOLL_gi|  LNTGGKVYPVKVGDIPAITGRSP-----RGTPLITMLTSTAQGN-----VEGVVNRFVLP
CYLINDRORACI_gi  LNTSGKVYPAKVGDISPISPRSP-----RGIPLITLLTNTAQGN-----VEGILGRFTLP
RAPHIBROOKI_gi|  LNTSGKVYPVKVGDISPISARSP-----RGMPLITLLTNTAQGN-----VEGILGRFILP
CYANOBIUM_gi|25  FTTDGRVAVLRWEFAGQ-----------QPGPLERFLPDSLEGA-----S--VMQVLPLQ
ORF---GOS_20350  ------------------------------------------------------------
ext_-_Streprose  FTNKGRVYRAKAYELPDAGRDA------RGQHVANLLAFQPDEK--------IAQILAIR
GLOVIOLACEUS_gi  FTNRGVVYALRGYQIPAGSRTA------KGTPVVQLLPIPIEEK--------VTSIVPVQ
ext_-_Lactcasei  FTNKGKVYRSKGYEIPEYGRTA------KGIPIINLLGVGAGEK--------IQTVINVH
ext_-_Verrucoba  FMNNGRVYVEKVYELPEGSRTS------KGRSINNVLQLQKEEQ--------IAAMICVK
SYNECHO-COCC_gi  FTSGGRVAALRWEFAAQ-----------QPGPLERFLPDSVDGQ-----AEQVVDVLVVP
PCM_gi|12396523  VTSSGKVLQINWKSIINNVYKL------DNKILGNINPKE------------IINFHDLD
PCMPASTORI_gi|3  ITSSGKIIQIDWKSNITSEFKM------DKKVLGNIDPKE------------IINFHYLD
ext_-_Candisumu  FYENGKYFLLKVFKIPEVLKKS------KGQAIQNLIKINKKEK--------ICSSILIE
THERMOSYNECHOel  FSDRGLVYALAAYQIPSGSRQA------RGTPIVQLLPIPREEK--------ITSVIAVQ
ext_-_Oritsutsu  FSNIGQVYNLKVYKLPLGTPQS------KGRPIINLISIKENET--------ITNIMPMP
                                                                             


                        730       740       750       760       770       780
                 =========+=========+=========+=========+=========+=========+
CYANOTHECE_gi|1  ----D-NTENKDLLLLTNQGKIKRIQLSELAGLTNRGLVLIKLKD-----QDGLESVSIT
ACARYOMA_gi|158  ----E-FSEDEYLVMMTAGGFIKKTALAAFSNIRANGLIAISLEE-----GDLLRWVRLT
LYNGBYA_gi|1194  ----Q-HSDKTDLILVTQQGKIKRLSLTELMDLTNRGITIIKLKD-----QDELGYASLT
TRICHOERY_gi|11  ----E-AKENKDLIMLTQNGKIKRLCLSDLSDMRNRGVTVIKLKE-----DDELRYVSLG
OSCILLATOR_gi|3  ----SENADATDLVTLTQQGKIKRLPLSELSDITNRGVTAVKLKD-----DDELRYAMLS
CROCOWAT_gi|679  ----E-NKENHDLLLLTNQGKIKRIQLSELDGLTNRGLVLIKLKD-----NDYLEFISPT
CYAN-UCYNA_gi|2  ----K-NVENRNLLLLTNQGKIKRIQLSELNSLTNRGLSLMKLKN-----DDFLKYISFV
ANABAENA_gi|759  ----E-NLAAQQLILLTKQGRIKRLSLEELTNLTRRGVTILKLKD-----DDELLLTQFS
NODULASPUMI_gi|  ----E-NLETRQMVLLTKEGRIKRLTLGELTNLTRRGITILKLKE-----DDELLFTQLT
NOSTOCAZOLL_gi|  ----E-TPERSQMLLLTKQGRIKRLSMEEFANLSRRGITILKLKD-----DDELSFTQFT
CYLINDRORACI_gi  ----E-TKDTHDMVIVTKQGRIKRISLEELTNVSKRGITILKVKD-----DDQLCFAQLT
RAPHIBROOKI_gi|  ----E-TKDTHDMVIVTKQGRIKRLSLEELTNVSKRGITILKLKD-----DDQLCFAQLT
CYANOBIUM_gi|25  ----EGSDPHLSIGLLSSDGRFKRLPLDDLQDLSGRAATVLKLKE-----GVTLQRVVPC
ORF---GOS_20350  ------------------------------------------------------------
ext_-_Streprose  ----D-YEAVPYLILATKGGLVKKTALKDYDSPRSGGVIAINLREMPDGGDDELIGAELV
GLOVIOLACEUS_gi  ----E-FASDEFLVMLTRTGFIKKTALAAFANLRANGLIAIGLEE-----GDELRWVRRA
ext_-_Lactcasei  ----EGENDDRYLFFVTQKGVVKRTPVKEFANIRSNGLIALNLKD-----EDELNNVILT
ext_-_Verrucoba  ----E-ITEDFNLVMCTKHGTVKKTNLAAYKNFRKGGIIGINIDE-----GDSLITVKLT
SYNECHO-COCC_gi  ----P-ADQDFSVGLLSSDGRFKRLAGQDLRELSGRATTVLKLKD-----GVQLQRVVMC
PCM_gi|12396523  ------SNLENYICIICSDGKFKKVLLDKDMIRSTRIFSITKLKN-----STKIIDSFIY
PCMPASTORI_gi|3  ------SKLKNYLCILSSDGRFKKVLFDEDMIKSNRIFSITKLKN-----STSIIDSFIL
ext_-_Candisumu  KNNDKKYLNKNYVILITKNGIIKKTTLIQYYKNPKNLIKIIN--------KDYIIYAKLT
THERMOSYNECHOel  ----E-FSEDEYLVMLTRKGFIKKTPLAAFSHIRSNGLIAISLEE-----GDQLRWVRRT
ext_-_Oritsutsu  -AESENDSEKKYIIFATKHGNIRRNDLSDFKHIASNGKIAIRLDE-----GDSLISVKSC
                                                                             


                        790       800       810       820       830       840
                 =========+=========+=========+=========+=========+=========+
CYANOTHECE_gi|1  KEGEEVAIAMSSGRVLRFPVVDEVIPIMGRNAQGNQALKLRYGETIIGCVTL--------
ACARYOMA_gi|158  RAEDSIVIGSRRGMSIHFRADHQQLRPLGRATRGVRAMRLREGDEFIGMDILSSA-----
LYNGBYA_gi|1194  RPGEQMILATSGGRVLRLPVNDEQLPPMGRTAQGSQVTRLRKQERLVSCLTV--------
TRICHOERY_gi|11  KTGEQVVLATSGGRLLRLQIDDEKLPLMGRAAQGSQATRLRKQEELVGCVTL--------
OSCILLATOR_gi|3  KPGEQVVLATSGGRLLRFELNDEQLPPMGRAAQGSQATRLRKQEQLVGCITL--------
CROCOWAT_gi|679  KEGEEVAIAMSSGRVLRFPVVDEVIHIMGRNAQGNQALKLRYGENIISCVTL--------
CYAN-UCYNA_gi|2  KEEDEIVIAITSGRLLRFQMKNEEIPVMNRNTQGEQAFRLRSKEEIVGCINM--------
ANABAENA_gi|759  KAGQHLILASSGGRLLRFSANDEQLPIMGRTAMGLQAFRLLRNQCMVGCVNA--------
NODULASPUMI_gi|  TPKENLILASSGGRLLKFAADDQQLPVMGRTAMGLQALRLLKHQQMVGCVTA--------
NOSTOCAZOLL_gi|  TTGQHLILASSSGRLLRFAVNEEQLPIMGRAAMGLQAFRLLKNQQMVGCATV--------
CYLINDRORACI_gi  NPNHNLILASSGGRCLRFAINDDQLPVMGRGAMGLQSFRILKSQQIIGCVAI--------
RAPHIBROOKI_gi|  NPNHNLILGSSGGRCLRFAINDDQLPVMGRAAMGLQSFRILKSQQIISCVTI--------
CYANOBIUM_gi|25  RSGAELVVASSTGRMLRLEANEEQVPLMGRTAQGPVLMRLLPDEQIVGAACV--------
ORF---GOS_20350  ------------------------------------------------------------
ext_-_Streprose  SAEDDLLLISKKAQSIRFTATDDALRPMGRATSGVKGMSFREGDELLSMNVV--------
GLOVIOLACEUS_gi  RAEDDILVGSRAGMAIRFRADEEQLRPLGRTARGVKSMELRKGDELVSMDIL--------
ext_-_Lactcasei  SGQDNILIGTHLGYSVTF--KEQDVRSMGRSATGVRGIRLREHDYVVGSDIL--------
ext_-_Verrucoba  NRDSELVIVTHLGKSIRF--HESDLREQGRATRGVRGVKLSEKDYAQAMEVV--------
SYNECHO-COCC_gi  RPGDDLAVASSTGRMLRLPVDDSTIPVMGRTAQGPVLMRLLPGESIVGAAAV--------
PCM_gi|12396523  SQEENIIILTSIGRIFKFNLSNEYLKPSSKQSQGILLVNLLPKEQIVSCCKS--------
PCMPASTORI_gi|3  NKQQQLVILTSIGRLFKFDLSDKNLNPSTKQSLGLLLVNLLPTEQIVSCCKS--------
ext_-_Candisumu  NENSEIFIAEKSGKIIKF--DESTIKKIA-----------LKNDLYIICIND--------
THERMOSYNECHOel  REQDTIIIGSRQGMAIHFRASHDQLRPLGRATRGVKSMNLRPGDELVGMDIL--------
ext_-_Oritsutsu  DEENHVLLATQNGKAIRFPVKDLRV-FKSRTSDGVKAIKLAGNDAVISMTILKGINCSLE
                                                                             


                        850       860       870       880       890       900
                 =========+=========+=========+=========+=========+=========+
CYANOTHECE_gi|1  ------------------------------------------DDNKIVLLVSKLGYGK--
ACARYOMA_gi|158  ------VVETLGNATDADDEETDDPDVLVEDDGNEEESETVEQPGPWVLVITTNGFGK--
LYNGBYA_gi|1194  ------------------------------------------PPKASLLLVSELGFAK--
TRICHOERY_gi|11  ------------------------------------------DIGSNLLLVSQHSYGK--
OSCILLATOR_gi|3  ------------------------------------------AADGSLLLVSELGWAK--
CROCOWAT_gi|679  ------------------------------------------DENKTVLLVSKLGYAK--
CYAN-UCYNA_gi|2  ------------------------------------------NKKDDILLVSKLGYGK--
ANABAENA_gi|759  ------------------------------------------AQAEYLLLVTEEGYAK--
NODULASPUMI_gi|  ------------------------------------------AGEDNLLLVTEEGYAK--
NOSTOCAZOLL_gi|  ------------------------------------------GKDDQLLLVTQEGYAK--
CYLINDRORACI_gi  ------------------------------------------GQEENLLLVTQEGYAK--
RAPHIBROOKI_gi|  ------------------------------------------EQEENLLLVTQEGYAK--
CYANOBIUM_gi|25  ------------------------------------------PASGSVLLASRQGQVK--
ORF---GOS_20350  ------------------------------------------------------------
ext_-_Streprose  ------------------------------------------RPGTFVFTATDGGYAK--
GLOVIOLACEUS_gi  ------------------------------SCEQRERAEANGECGPWVLVVTADGFGK--
ext_-_Lactcasei  ------------------------------------------KPDSEVFVISEKGYGK--
ext_-_Verrucoba  ------------------------------------------DNESALLICGINGQGK--
SYNECHO-COCC_gi  ------------------------------------------AAGGDVLLISQLGQLK--
PCM_gi|12396523  ------------------------------------------KEKDLLYLISNKGKFF--
PCMPASTORI_gi|3  ------------------------------------------KDKEILYLVSKKGKFF--
ext_-_Candisumu  ------------------------------------------LKKEYILVVSEKGFVKIS
THERMOSYNECHOel  --------------PAAIANRFATPSEDDSGEIEDSEETVAHSEGPWVLVITTNGYGK--
ext_-_Oritsutsu  VRENYLNLPVSNRLLIAKNKLLHPSIDLSKYNLTEDEMLTMASNEEFILTVSENGYGK--
                                                                             


                        910       920       930       940       950       960
                 =========+=========+=========+=========+=========+=========+
CYANOTHECE_gi|1  -RLNVTGLRMTKLGDIGTQALQFTHKN--DSLLGMIRASDSKDITLLTNQKKTLNIVAKD
ACARYOMA_gi|158  -RVPVAQFRLQNRAGKGVTATKFKKLKTPDQLAALRIVNAEDELMLVTSRGIVIRQAVTD
LYNGBYA_gi|1194  -RISLDRVRSTTRGAIGTQLFQFKGQK--DALAGMVSVNSHQEAYLITSESRIVRFAVDE
TRICHOERY_gi|11  -QIPVTALRVANRGGIGQNVFQFTRQD--DILAGIVASSSNVLVQVLTTDGRVFGMIADR
OSCILLATOR_gi|3  -RMPVGSVRLTGRGEIGTQAFHFAEPK--DALVGIVAALPRKELKLLTNNGRLLRVGVEK
CROCOWAT_gi|679  -RLNITGLRMTKLGDIGTQALQFAQKT--DSLLGMIKASDDRNVTLLTNQNNTVNIVAKK
CYAN-UCYNA_gi|2  -RLNVLDLRITKLGDIGTQALKFIHQA--DSLLGIKVSSDIRNINILTNKNRVITTEITE
ANABAENA_gi|759  -RLPVNQIKSANRGDLGTQSMKFVNKT--DNLAAMVGANTSSEVALLTNRERVVRISTDT
NODULASPUMI_gi|  -RLPVSNLKRADRGNIGTQSLKFASKT--DNLAAMVQAIASAEVALVTNKDRVVRIPVDT
NOSTOCAZOLL_gi|  -RIPASNLRAANRGDLGIQMLKFHNKT--DNLAGMVRATPGVEVALVSNKERVVRIPVDT
CYLINDRORACI_gi  -KISSSSLRAGNRGDLGTQMLKFHNKT--DNLVAITRTNSSQEVALVTNKDRVIKTSIES
RAPHIBROOKI_gi|  -RISSGSLRAGNRGDLGIQMLKFHNKT--DNLVAITRTNTSQKVVLVTNKERMVKTSVQS
CYANOBIUM_gi|25  -KLAVESLRRCERGDLGLIGIRFSQRG--DALVALSSGEHPL-VAVLAGENRSARLSSGS
ORF---GOS_20350  ---------------------------------------------LIENDNKLI------
ext_-_Streprose  -RTPVDEYRVQGRGGLGIKAAKIVEDR--GSLVGALVVEETDEILAITLGGGVIRTRVNE
GLOVIOLACEUS_gi  -RVPFSEFRAQNRGGMGVIATKFRDQG--DELAALRVVSCEDELMIVTARGVIIRQQSEE
ext_-_Lactcasei  -RTAAKEYPIKGRGGKGIKTANITAKN--GPLAGVTTVDGTEDILVMTDSGVMIRFNIQS
ext_-_Verrucoba  -RTTFDEFPLQKRGGSGVIAAKT------AGVAGALAVRESDEIMMLTKNGQAVRTSVKD
SYNECHO-COCC_gi  -RLGIDHLRRCQRGAIGEIGLRFEQRN--DALTDLRSTTARLSVETQAG---SLRLASDS
PCM_gi|12396523  -ELKINEVYNSYNSKLGYINEKIQLNN--DHFIKVLTNNQYIDFE--TNKNKSARINLTK
PCMPASTORI_gi|3  -KLKIDDIYNSYNSKLGYVNEKMQLKD--DHFITVLSSNQYIDIE--TNKNKSARLNLNK
ext_-_Candisumu  NSIGIKTINVTKKTGFLVAMKNVINKN--DIIIINKYGLTFRIPIFLIGRGRRGRRGRRG
THERMOSYNECHOel  -RVPVQQFRLQNRAGMGITATKFKAKSNEDQLAALRIVNAGDELMIVTSRGIIIRQKVMD
ext_-_Oritsutsu  -FSSAYEYRVTKRGGKGVANMNVSSKT--GKVVSVLPACQDNELMLITSSGKLIRCQLNS
                                                                             


                        970       980       990      1000      1010      1020
                 =========+=========+=========+=========+=========+=========+
CYANOTHECE_gi|1  VKIW-GKDGQ----GDRLVKLSNQE---VIDYVM--------------------------
ACARYOMA_gi|158  ISSQ-SRAAT----GVRVQRLDEDDYIAAVALVPPEDLSDEEGETELE------------
LYNGBYA_gi|1194  VKLQ-NEEAT----GNRLFKLNTGE---TIIGVRDPLLLHHP------------------
TRICHOERY_gi|11  VKVD-QQDDH----GHRLLKLGAKE---KIIKVVGY------------------------
OSCILLATOR_gi|3  IAFW-GKDAP----GDRAVNLNPSE---KIVKVVSC------------------------
CROCOWAT_gi|679  VRIW-GKDGQ----GDRLIKLSNQE---VIDYLI--------------------------
CYAN-UCYNA_gi|2  VEN-----------NKPIVELFDTE---IIIHIN--------------------------
ANABAENA_gi|759  VPIL-PRDGK----GETILQLNRDE---KVIAVVEVR-----------------------
NODULASPUMI_gi|  VPIL-ARDGK----GESILDLNRDE---RIISVMEVQS----------------------
NOSTOCAZOLL_gi|  VPIL-DRDAK----GESVLQLNRDE---KIITVVEVGV----------------------
CYLINDRORACI_gi  IPIL-DRDAR----GENILPMTRDEIITSVVLVLETGR----------------------
RAPHIBROOKI_gi|  IPIL-DRDAR----GENIFPMTRDEVITSVVVVLETES----------------------
CYANOBIUM_gi|25  LALE-DANGS----GLTL-ELRPGESLRDLVPLLT-------------------------
ORF---GOS_20350  ------------------------------------------------------------
ext_-_Streprose  VRET-GRDTM----GVQLINLGKRDAVVGIARNAEAGREAEEVDGTDDAEGETAAAHAVG
GLOVIOLACEUS_gi  ISQQ-SRAAT----GVRVQRLDEDDTIVGVAVVPESAEDGGSAFAAEEEEEAEA------
ext_-_Lactcasei  VSQT-GRATL----GVRLIRVDDDAKVATMAKVEPESDDPDDGSKPDQPTSPTDGSAAPT
ext_-_Verrucoba  INLI-GRITK----GVRCINLNKGDVLLGIARIVEDESESEDDAEEAAPSEE--------
SYNECHO-COCC_gi  LPVQ-DGRGT----GQQL-KLPKGQTVQRLLPLIDG------------------------
PCM_gi|12396523  FSSKPNKNIL----NVDFLNLEKDEFLENCSSLDNLLN----------------------
PCMPASTORI_gi|3  LDNNSGKNML----KIDFLNLEKDEYLDNCYRLEKYIN----------------------
ext_-_Candisumu  RRGRRGRRGRRGTKGIKLINLKYDD---KITYVAKVEYDNSLNIFN--------------
THERMOSYNECHOel  ISSQ-SRSAT----GVRLQRLDEDDAIVTAAVLPPGSMEAAAD-----------------
ext_-_Oritsutsu  VRII-GRSTS----GVILFKTSKDEKVVSIDTIKDTDYSDDCSDDESNNNNI--------
                                                                             


                       1030      1040      1050
                 =========+=========+=========+=========
CYANOTHECE_gi|1  ---------------------------------------
ACARYOMA_gi|158  ---------------------------------------
LYNGBYA_gi|1194  ---------------------------------------
TRICHOERY_gi|11  ---------------------------------------
OSCILLATOR_gi|3  ---------------------------------------
CROCOWAT_gi|679  ---------------------------------------
CYAN-UCYNA_gi|2  ---------------------------------------
ANABAENA_gi|759  ---------------------------------------
NODULASPUMI_gi|  ---------------------------------------
NOSTOCAZOLL_gi|  ---------------------------------------
CYLINDRORACI_gi  ---------------------------------------
RAPHIBROOKI_gi|  ---------------------------------------
CYANOBIUM_gi|25  ---------------------------------------
ORF---GOS_20350  ---------------------------------------
ext_-_Streprose  TAEGIVEGTEPSTGEHEE---------------------
GLOVIOLACEUS_gi  ---------------------------------------
ext_-_Lactcasei  SQQPADGSYAGDADQQVSQLLDRAEADQPEQHDTGDQPE
ext_-_Verrucoba  ---------------------------------------
SYNECHO-COCC_gi  ---------------------------------------
PCM_gi|12396523  ---------------------------------------
PCMPASTORI_gi|3  ---------------------------------------
ext_-_Candisumu  ---------------------------------------
THERMOSYNECHOel  ---------------------------------------
ext_-_Oritsutsu  ---------------------------------------
                                                        






Parameters used
Minimum Number Of Sequences For A Conserved Position: 13
Minimum Number Of Sequences For A Flanking Position: 20
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes


Flank positions of the 4 selected block(s)
Flanks: [254  274]  [290  325]  [333  441]  [472  541]  

New number of positions in input.fasta-gb:  236  (22% of the original 1059 positions)



Protein Domains

PROTOCOLE:


INTERPROSCAN/ORF traduite/"TOOL Output"/"Table view".



ANALYSE DES RÉSULTATS:


On obtient 7 domaines conservés dont les deux premiers et les deux derniers sont redondants (donc 5 domaines en réalité).

Mis à part le domaine IPR020899, tous codent pour une DNA topoisomérase type IIA (cf: interprétation de l'analyse), et principalement la sous unité A pour 3/4 des cas.

En regardant ces résultats de plus près, on s'aperçoit que le domaine PTHR10169:SF4 possède la plus petite e-value de tous (_ 1,8e-63) et contient tous les autres domaines qui correspondent à des sous-unités A de DNA Topoiomérase IV (avec de bonnes e-values n'excédant pas 1,4e-12). Ce domaine correspond d'ailleurs lui aussi à une sous unité A de DNA Gyrase, c'est à dire à une DNA Topoisomérase IV.

Il y a donc de fortes chances pour que notre ORF code pour une DNA Topoisomérase IV (souc-unité A).


Le domaine IPR020899 (qui correspond à un répresseur de l'arginine) est affiché comme étant "superposé" à IPR013760, IPR002205 et PTHR10169:SF4. Son e-value est de 1.6e-34. Le fait que le début de notre ORF traduite ressemble à un domaine codant pour un répresseur de la synthèse d'arginine est assez surprenant au premier coup d'oeil (car ça n'a fonctionnellement rien à voir avec l'activité d'une topoisomérase), d'autant plus que l'e-value de cet alignement est assez petite (_ 1.6e-34). Cependant cet alignement ne correspond qu'à la partie C-terminale du répresseur de l'arginine, dont le point commun avec la DNA Topoisomérase est de se fixer à l'ADN. Peut-être que cela peut expliquer cette ressemblance entre les deux séquences protéiques.


On remarque que le domaine PTHR10169:SF4 (que nous avons sélectionné comme domaine le plus parlant) est identifié dès le premièr acide aminé de notre séquence query. Cela laisse imaginer une grande probabilité pour que le début de ce domaine conservé soit manquant sur notre séquence query, sans que l'on puisse pour autant en être certains. D'autre part cela soutiendrait l'hypothèse selon laquelle le début de notre ORF serait manquant (cf Blast rapide lors de la recherche d'ORF).


Les "Gene Ontologies" que l'on obtient pour tous les domaines identifiés avec les meilleures e-values sont:


  • GO:0003677 DNA binding
  • GO:0003918 DNA topoisomerase (ATP-hydrolyzing) activity
  • GO:0005524 ATP binding
  • GO:0005694 chromosome
  • GO:0006265 DNA topological change


Explicitons le rôle de la topoisomérase de type IIA.

Une topoisomérase est une enzyme qui contrôle l'état plus ou moins surenroulé de l'ADN. Elle est donc impliquée dans divers processus cellulaires qui nécessitent de "dénouer" l'ADN; tels que la transcription, la réplication, ou encore parfois la recombinaison (une décaténation est parfois nécessaire si ces deux derniers processus se déroulent simultanément).

Quant au terme "type IIA", voici les explications; les DNA topoisomérases de type II (par opposition à celles de type I) sont des gyrases (enzymes ATP dépendantes). Les gyrases sont des enzymes qui surenroulent négativement l'ADN, c'est à dire qu'elles augmentent le nombre de supertours dans le sens opposé à celui de la double hélice d'ADN, ce qui a pour conséquence de réduire l'espace occupé par l'ADN.

Dans notre cas, nous avons obtenu des domaines DNA topoisomérase de type IIA, type qui englobe les enzymes TopII et TopIV.


Les "Gene Ontologies" correspondant aux meilleures identifications de domaines dans notre ORF sont donc tout à fait cohérentes, puisque cette enzyme est une topoisomérase qui fixe l'ADN notamment chromosomique pour y effectuer des changements topologiques (surenroulement négatif).


Parlons maintenant du type d'organisme chez qui ces différents domaines sont retrouvés. Les résultats taxonomiques affichés par Interpro nous indiquent pour chacun des domaines identifiés qu'ils sont très majoritairement retrouvés chez les bactéries, puis en seconde position chez les eucaryotes. Cela dit l'hypothèse eucaryote est à prendre avec beaucoup de précautions car deux arguments font qu'elle est largement moins probable que l'hypothèse bactérienne:


- Premièrement les résultats de la table Interpro nous montrent que chacun des domaines reconnus dans notre séquence sont significativement plus souvent retrouvées chez les bactéries que chez les eucaryotes.


- Deuxièmement cette séquence a été prélevée dans la mer grâce à un filtre qui ne sélectionne que les organismes dont la taille est comprise entre 0,1 µm et 0,8 µm. Cette procédure élimine ainsi la plupart des virus et des eucaryotes.


CONCLUSION


Nous retenons le domaine PTHR10169:SF4.


Par rapport au domaine IPR020899, codant pour le répresseur de l'arginine, ce bon alignement avec notre ORF traduite n'est pas si surprenant si l'on comprend que le point commun entre un régulateur de la transcription et une DNA Topoisomérase est de devoir reconnaitre l'ADN, et que par conséquent un domaine de liaison à l'ADN doit également être présent sur la protéine codée par notre ORF, d'où la petite e-value. D'autre part, en nous documentant, nous nous sommes aperçus que la régultation de la transcription pouvait se faire par changements topologiques de l'ADN, par conséquent, peut-être que notre enzyme est impliquée dans la régulation de la transcription de divers gènes, mais nous n'en sommes pas assez convaincus, donc nous n'irons pas plus loin dans cette hypothèse, d'autant plus que cette fonction ne serait que secondaire car la compaction de l'ADN a bien d'autres intérêts que la régulation de la transcription.


L'hypothèse résultant de cette recherche de domaines protéiques conservés est que l'on aurait dans notre ORF une région codant pour une enzyme capable de compacter de l'ADN (surenroulement négatif), et que cet ORF (et donc notre séquence) proviendrait d'une bactérie (ou bien moins probablement d'une cellule eucaryote).


Le BLAST, en plus d'avoir confirmé l'incomplétude bilatérale de notre ORF, nous a confirmé l'aspect fonctionnel de la protéine, à savoir sa fonction topoisomérase IV.







RÉSULTATS BRUTS:

GOS_2035030	C1ACC38A0A2200A2	318	HMMPanther	PTHR10169:SF4	DNA GYRASE SUBUNIT A	        1	309	1.8e-63	T	03-Mar-2011	NULL	NULL	
GOS_2035030	C1ACC38A0A2200A2	318	HMMPanther	PTHR10169	DNA TOPOISOMERASE/GYRASE	1	309	1.8e-63	T	03-Mar-2011	NULL	NULL	
GOS_2035030	C1ACC38A0A2200A2	318	HMMSmart	SM00434   	no description	                1	241	1.4e-12	T	03-Mar-2011	IPR002205	DNA topoisomerase, type IIA, subunit A/C-terminal	Molecular Function: DNA binding (GO:0003677), Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918), Molecular Function: ATP binding (GO:0005524), Cellular Component: chromosome (GO:0005694), Biological Process: DNA topological change (GO:0006265)
GOS_2035030	C1ACC38A0A2200A2	318	HMMPfam	        PF00521	        DNA_topoisoIV	                2	248	2.4e-47	T	03-Mar-2011	IPR002205	DNA topoisomerase, type IIA, subunit A/C-terminal	Molecular Function: DNA binding (GO:0003677), Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918), Molecular Function: ATP binding (GO:0005524), Cellular Component: chromosome (GO:0005694), Biological Process: DNA topological change (GO:0006265)
GOS_2035030	C1ACC38A0A2200A2	318	Gene3D	G3DSA:3.30.1360.40	no description           	8	107	1.6e-34	T	03-Mar-2011	IPR020899	Arginine repressor, C-terminal	Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700), Biological Process: regulation of transcription, DNA-dependent (GO:0006355)
GOS_2035030	C1ACC38A0A2200A2	318	Gene3D	G3DSA:1.10.268.10	no description	              140	235	1.2e-15	T	03-Mar-2011	IPR013757	DNA topoisomerase, type IIA, subunit A, alpha-helical	Molecular Function: DNA binding (GO:0003677), Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918), Molecular Function: ATP binding (GO:0005524), Cellular Component: chromosome (GO:0005694), Biological Process: DNA metabolic process (GO:0006259), Biological Process: DNA topological change (GO:0006265)
GOS_2035030	C1ACC38A0A2200A2	318	superfamily	SSF56719	Type II DNA topoisomerase	4	265	1.7e-57	T	03-Mar-2011	IPR013760	DNA topoisomerase, type IIA, central	Molecular Function: DNA binding (GO:0003677), Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918), Molecular Function: ATP binding (GO:0005524), Cellular Component: chromosome (GO:0005694), Biological Process: DNA topological change (GO:0006265)






Phylogeny

PROTOCOLE:


1) Phylogeny.fr / PhyML

2) Phylogeny.fr / BioNJ



ANALYSE DES RÉSULTATS:


Les deux arbres basés sur le maximum de vraisemblance comme sur la distance paraissent plutôt cohérents.


- En effet on constate que les regroupements de séquences sont les mêmes, sans exception, et que seuls diffèrent d'un arbre à l'autre les relations de parenté entre les séquences de chaque regroupement, et encore, ça n'est pas toujours le cas (par exemple CYANOTHECE, CROCOWAT et CYAN-UCYNA, ou également celui dans lequel ce trouve notre ORF).


- Ces deux arbres racinés se sont effectivement accordés pour considérer notre ORF comme étant la plus proche de la séquence PCM et PCMPASTORI, appartenant aux Prochlorales (Prochlorococcus marinus)


La phylogénie décrite par ces arbres ne montre pas de contradiction par rapport à la phylogénie de référence, et les séquences du groupe externe ont bien été réunies en un clade dans les deux cas.


On en conclut que l'homologue le plus proche de notre ORF est est PCMPASTORI, que notre séquence appartient aux cyanobactéries et que l'on peut se fier à ces résultats.








RÉSULTATS BRUTS:

* PhyML:
                                                                                                        -----0.2---
 
                                +---CYANOTHECE_gi_172039454_ref_YP_001805955.1_DNA_gyrase_subunit_A          [Cyanobacteria]
                              +-+
                              | +-----CROCOWAT_gi_67921390_ref_ZP_00514908.1_DNA_topoisomerase_ATP-hyd       [Cyanobacteria]
                   +----------+
                   |          +------------CYAN-UCYNA_gi_284928878_ref_YP_003421400.1_DNA_topoisomerase_IV   [Cyanobacteria]
                   |
                   |          +----NODULASPUMI_gi_119512306_ref_ZP_01631392.1_DNA_topoisomerase_cha          [Cyanobacteria]
                   |          |
              +----+   +------+
              |    |   |      | +---ANABAENA_gi_75909066_ref_YP_323362.1_DNA_topoisomerase_IV_subuni         [Cyanobacteria]
              |    |   |      +-+
              |    |   |        | +--NOSTOCAZOLL_gi_298491612_ref_YP_003721789.1_DNA_gyrase_subunit_A        [Cyanobacteria]
              |    |   |        +-+
              |    |   |          |      +CYLINDRORACI_gi_282901150_ref_ZP_06309081.1_DNA_gyrase_subunit_A   [Cyanobacteria]
              |    +---+          +------+
              |        |                 +RAPHIBROOKI_gi_282896473_ref_ZP_06304493.1_DNA_topoisomerase_4_s   [Cyanobacteria]
              |        |
              |        |      +---------LYNGBYA_gi_119489753_ref_ZP_01622511.1_DNA_topoisomerase_chain_A     [Cyanobacteria]
  +-----------+        |    +-+
  |           |        |    | +----------TRICHOERY_gi_113475568_ref_YP_721629.1_DNA_topoisomerase_IV_subu    [Cyanobacteria]
  |           |        +----+
  |           |             +-------OSCILLATOR_gi_300863985_ref_ZP_07108894.1_DNA_topoisomerase_IV_s         [Cyanobacteria]
  |           |
  |           |                            +-----PCM_gi_123965239_ref_YP_001010320.1_DNA_gyrase/topoisomerase_IV   [Cyanobacteria]
  |           |                       +----+
  |           |                       |    |
  |           |     +-----------------+    +-----PCMPASTORI_gi_33860565_ref_NP_892126.1_DNA_gyrase/topoisomerase   [Cyanobacteria]
 ++           |     |                 |
 ||           +-----+                 +-----------------ORF---GOS_2035030_Traduction_2-955_sens_direct
 ||                 |
 ||                 |              +-------CYANOBIUM_gi_254432446_ref_ZP_05046149.1_DNA_gyrase/topoisomeras [Cyanobacteria]
 ||                 +--------------+
 ||                                +----SYNECHO-COCC_gi_148241104_ref_YP_001226261.1_DNA_gyrase/topoisom    [Cyanobacteria]
 ||
 ||   +-------------GLOVIOLACEUS_gi_37522651_ref_NP_926028.1_DNA_gyrase_subunit_A_Gl                        [Cyanobacteria]
 ||   |
 |+---+    +-----ACARYOMA_gi_158336251_ref_YP_001517425.1_DNA_gyrase_subunit_A_Ac                           [Cyanobacteria]
 |    +----+
 |         +--------THERMOSYNECHOel_gi_22298912_ref_NP_682159.1_DNA_gyrase_subunit_A                        [Cyanobacteria]
 |
 |                 +----------------------ext_-_Verrucoba_gi_254444720_ref_ZP_05058196.1_DNA_gyrase_A_subu  [Chlamidiae Verrucomicrobiagroup]
 |                 |
 |            +----+
 |       +----+    +------------------------------------ext_-_Candisumu_gi_307128512_ref_YP_003880542.1_DNA_gyrase_A_sub   [BacteroidettesChlorobigroup]
 |       |    |
 |   +---+    +------------------------ext_-_Oritsutsu_gi_148284134_ref_YP_001248224.1_DNA_gyrase_subun     [Proteobacteria]
 |   |   |
 +---+   +------------------------ext_-_Lactcasei_gi_191636830_ref_YP_001985996.1_DNA_gyrase_A_sub          [Firmicutes]
     |
     +----------------------------ext_-_Streprose_gi_239942664_ref_ZP_04694601.1_DNA_gyrase_subuni          [Actinobacteria]





* BioNJ:

                                                                                                   -------0.2------
 
                             +-------------LYNGBYA_gi_119489753_ref_ZP_01622511.1_DNA_topoisomerase_chain_A       [Cyanobacteria]
                             |
                             |--------------TRICHOERY_gi_113475568_ref_YP_721629.1_DNA_topoisomerase_IV_subu      [Cyanobacteria]
                          +--+
                          |  +------------OSCILLATOR_gi_300863985_ref_ZP_07108894.1_DNA_topoisomerase_IV_s        [Cyanobacteria]
                          |
                        +-+       +-------NODULASPUMI_gi_119512306_ref_ZP_01631392.1_DNA_topoisomerase_cha        [Cyanobacteria]
                        | |       |
                        | +-------+
                        |         | +-----ANABAENA_gi_75909066_ref_YP_323362.1_DNA_topoisomerase_IV_subuni        [Cyanobacteria]
                        |         +-+
                        |           |+-----NOSTOCAZOLL_gi_298491612_ref_YP_003721789.1_DNA_gyrase_subunit_A       [Cyanobacteria]
                        |           ++
                +-------+            |       +-CYLINDRORACI_gi_282901150_ref_ZP_06309081.1_DNA_gyrase_subunit_A   [Cyanobacteria]
                |       |            +-------+
                |       |                    +-RAPHIBROOKI_gi_282896473_ref_ZP_06304493.1_DNA_topoisomerase_4_s   [Cyanobacteria]
                |       |
                |       |             +----CYANOTHECE_gi_172039454_ref_YP_001805955.1_DNA_gyrase_subunit_A        [Cyanobacteria]
                |       |         +---+
                |       |         |   +------CROCOWAT_gi_67921390_ref_ZP_00514908.1_DNA_topoisomerase_ATP-hyd     [Cyanobacteria]
    +-----------+       +---------+
    |           |                 +--------------CYAN-UCYNA_gi_284928878_ref_YP_003421400.1_DNA_topoisomerase_IV  [Cyanobacteria]
    |           |
    |           |                 +--------CYANOBIUM_gi_254432446_ref_ZP_05046149.1_DNA_gyrase/topoisomeras       [Cyanobacteria]
    |           |  +--------------+
    |           |  |              |
    |           |  |              +---------SYNECHO-COCC_gi_148241104_ref_YP_001226261.1_DNA_gyrase/topoisom      [Cyanobacteria]
    |           +--+
 +--+              |                    +---------------------ORF---GOS_2035030_Traduction_2-955_sens_direct       
 |  |              +--------------------+
 |  |                                   |       +------PCM_gi_123965239_ref_YP_001010320.1_DNA_gyrase/topoisomerase_IV        [Cyanobacteria]
 |  |                                   +-------+
 |  |                                           +-------PCMPASTORI_gi_33860565_ref_NP_892126.1_DNA_gyrase/topoisomerase        [Cyanobacteria]
 |  |
 |  |   +------------------GLOVIOLACEUS_gi_37522651_ref_NP_926028.1_DNA_gyrase_subunit_A_Gl     [Cyanobacteria]
 |  |   |
 |  +---+    +----------ACARYOMA_gi_158336251_ref_YP_001517425.1_DNA_gyrase_subunit_A_Ac        [Cyanobacteria]
 |      +----+
 |           +----------THERMOSYNECHOel_gi_22298912_ref_NP_682159.1_DNA_gyrase_subunit_A        [Cyanobacteria]
 |
 |     +-------------------------------ext_-_Streprose_gi_239942664_ref_ZP_04694601.1_DNA_gyrase_subuni        [Actinobacteria]
 |     |
 |  +--+
 |  |  +---------------------------------ext_-_Lactcasei_gi_191636830_ref_YP_001985996.1_DNA_gyrase_A_sub      [Firmicutes]
 +--+
    |      +---------------------------------ext_-_Verrucoba_gi_254444720_ref_ZP_05058196.1_DNA_gyrase_A_subu  [Chlamidiae Verrucomicrobiagroup]
    |   +--+
    +---+  +-----------------------------ext_-_Oritsutsu_gi_148284134_ref_YP_001248224.1_DNA_gyrase_subun      [Proteobacteria]
        |
        +-----------------------------------------------ext_-_Candisumu_gi_307128512_ref_YP_003880542.1_DNA_gyrase_A_sub   [BacteroidettesChlorobigroup]

Taxonomy report

PROTOCOLE:


Taxonomy Report / Lineage Report



ANALYSE DES RÉSULTATS:


On observe pour l'alignement face à chacune des deux banques de données que les meilleurs scores correspondent à des séquences cyanobactériennes diverses et variées, et que ce ne sont que de très bons scores.

Le rapport taxonomique de NR nous sera beaucoup plus utile car il est vraiment plus complet. Nous ne prendrons donc que ce dernier en compte à partir de maintenant.

Les cyanobactéries constituent donc le groupe taxonomique dont les sous-unité A des DNA Topoisomérases IV sont les plus similaires à celle pour laquelle code notre ORF. Nous prendrons par conséquent les cyanobactéries comme groupe d'étude.


On observe que les alpha-protéobactéries, firmicutes, CFB group bacteria, verrucomicrobia et les high GC Gram+ constituent un groupe actuel, à la fois proche et différent de celui des cyanobactéries, et dont les scores sont globalement assez inférieurs à ceux des cyanobactéries. Ainsi, ces clades remplissent toutes les conditions pour former un groupe externe adapté.



Nous choisissons les cyanobactéries comme groupe d'étude, et l'ensemble [alpha-protéobactéries, firmicutes, CFB group bacteria, verrucomicrobia et high GC Gram+] comme groupe externe.




GROUPE D'ETUDE ET GROUPE EXTERNE



Voici le groupe d'étude INITIALEMENT choisi:


(Les quatre séquences du groupe d'étude marquées d'une croix (MICRO-CHTONO, SYNECHO-CYST, ARTHROMAX et MICRO-AERU) ont présenté des différences induisant de longs gaps dans toutes les autres séquences au moment de l'alignement multiple, nous les avons donc supprimées juste avant l'étape "curation")



GROUPE D'ETUDE (Cyanobactéries)


NUMERO D'ACESSION NOM DE CODE E-VALUE ESPECE G.A.T.


ref|NP_892126.1| PCMPASTORI 2e-104 [Prochl. marinus subsp. pastoris str. CCMP1986] [cyanobacteria]

ref|YP_001010320.1| PCM 9e-103 [Prochl. marinus str. MIT 9515] [cyanobacteria]

ref|YP_001226261.1| SYNECHO-COCC 2e-78 [Synechococcus sp. RCC307] [cyanobacteria]

ref|ZP_05046149.1| CYANOBIUM 1e-74 [Cyanobium sp. PCC 7001] [cyanobacteria]

ref|YP_001805955.1| CYANOTHECE 3e-67 [Cyanothece sp. ATCC 51142] [cyanobacteria]

ref|ZP_00514908.1| CROCOWAT 1e-64 [Crocosphaera watsonii WH 8501] [cyanobacteria]

X -->ref|ZP_05031045.1| MICRO-CHTONO 8e-68 [Microcoleus chthonoplastes PCC 7420] [cyanobacteria]

ref|ZP_07108894.1| OSCILLATOR 6e-65 [Oscillatoria sp. PCC 6506] [cyanobacteria]

X --> sp|P73077.2| SYNECHO-CYST 5e-64 [Synechocystis sp. PCC 6803] [cyanobacteria]

X -->ref|ZP_03272202.1| ARTHROMAX 6e-65 [Arthrospira maxima CS-328] [cyanobacteria]

X --> ref|YP_001661003.1| MICRO-AERU 6e-64 [Microcystis aeruginosa NIES-843] [cyanobacteria]

ref|ZP_01631392.1| NODULASPUMI 7e-67 [Nodularia spumigena CCY9414] [cyanobacteria]

ref|YP_721629.1| TRICHOERY 8e-65 [Trichodesmium erythraeum IMS101] [cyanobacteria]

ref|YP_003421400.1| CYAN-UCYNA 8e-65 [cyanobacterium UCYN-A] [cyanobacteria]

ref|ZP_06304493.1| RAPHIBROOKI 1e-64 [Raphidiopsis brookii D9] [cyanobacteria]

ref|ZP_06309081.1| CYLINDRORACI 2e-64 [Cylindrospermopsis raciborskii CS-505] [cyanobacteria]

ref|ZP_01622511.1| LYNGBYA 6e-63 [Lyngbya sp. PCC 8106] [cyanobacteria]

ref|YP_323362.1| ANABAENA 4e-64 [Anabaena variabilis ATCC 29413] [cyanobacteria]

ref|YP_001517425.1| ACARYOMA 1e-57 [Acaryochloris marina MBIC11017] [cyanobacteria]

ref|YP_003721789.1| NOSTOCAZOLL 2e-62 ['Nostoc azollae' 0708] [cyanobacteria]

ref|NP_682159.1| THERMOSYNECHOel 7e-57 [Thermosynechococcus elongatus BP-1] [cyanobacteria]

ref|NP_926028.1| GLOVIOLACEUS 7e-55 [Gloeobacter violaceus PCC 7421] [cyanobacteria]





GROUPE EXTERNE (alpha-protéobactéries, firmicutes, CFB group bacteria, verrucomicrobia, high GC Gram+)



NUMERO D'ACESSION NOM DE CODE E-VALUE ESPECE G.A.T.


ref|ZP_04694601.1| Streprose 2e-42 [Streptomyces roseosporus NRRL 15998] [high GC Gram+]

ref|ZP_05058196.1| Verrucoba 3e-42 [Verrucomicrobiae bacterium DG1235] [verrucomicrobia]

ref|YP_003880542.1| Candisumu 3e-42 [Candidatus Sulcia muelleri CARI] [CFB group bacteria]

ref|YP_001985996.1| Lactcasei 3e-42 [Lactobacillus casei BL23] [firmicutes]

ref|YP_001248224.1| Oritsutsu 3e-42 [Orientia tsutsugamushi str. Boryong] [a-proteobacteria]



















RÉSULTATS BRUTS

---------------------------------------- LINEAGE REPORT -------------------------------------------------------------

cellular organisms
. Bacteria                [bacteria]
. . Cyanobacteria           [cyanobacteria]
. . . Prochlorococcus marinus [cyanobacteria]
. . . . Prochlorococcus marinus subsp. pastoris str. CCMP1986 --------  383  4 hits [cyanobacteria]          DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus mar
. . . . Prochlorococcus marinus str. MIT 9515 ........................  377  4 hits [cyanobacteria]          DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus mar
. . . . Prochlorococcus marinus str. MIT 9301 ........................  361  4 hits [cyanobacteria]          DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus mar
. . . . Prochlorococcus marinus str. MIT 9312 ........................  359  4 hits [cyanobacteria]          DNA topoisomerase IV subunit A [Prochlorococcus marinus str
. . . . Prochlorococcus marinus str. MIT 9202 ........................  356  4 hits [cyanobacteria]          DNA gyrase/topoisomerase IV, A subunit domain protein [Proc
. . . . Prochlorococcus marinus str. AS9601 ..........................  348  4 hits [cyanobacteria]          DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus mar
. . . . Prochlorococcus marinus str. MIT 9215 ........................  346  4 hits [cyanobacteria]          DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus mar
. . . . Prochlorococcus marinus str. MIT 9211 ........................  285  4 hits [cyanobacteria]          DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus mar
. . . . Prochlorococcus marinus str. MIT 9313 ........................  284  4 hits [cyanobacteria]          DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus mar
. . . . Prochlorococcus marinus str. MIT 9303 ........................  281  4 hits [cyanobacteria]          DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus mar
. . . . Prochlorococcus marinus str. NATL1A ..........................  278  4 hits [cyanobacteria]          DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus mar
. . . . Prochlorococcus marinus subsp. marinus str. CCMP1375 .........  277  4 hits [cyanobacteria]          Type IIA topoisomerase, A subunit, ParC [Prochlorococcus ma
. . . . Prochlorococcus marinus str. NATL2A ..........................  275  4 hits [cyanobacteria]          DNA topoisomerase IV subunit A [Prochlorococcus marinus str
. . . Synechococcus sp. RCC307 ---------------------------------------  297  4 hits [cyanobacteria]          DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. R
. . . Synechococcus sp. CB0205 .......................................  296  2 hits [cyanobacteria]          DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. C
. . . Synechococcus sp. WH 7803 ......................................  289  4 hits [cyanobacteria]          DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. W
. . . Synechococcus sp. CB0101 .......................................  287  2 hits [cyanobacteria]          DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. C
. . . Synechococcus sp. WH 8102 ......................................  285  4 hits [cyanobacteria]          putative DNA topoisomerase chain A [Synechococcus sp. WH 81
. . . Cyanobium sp. PCC 7001 .........................................  284  4 hits [cyanobacteria]          DNA gyrase/topoisomerase IV, A subunit domain protein [Cyan
. . . Synechococcus sp. WH 5701 ......................................  281  4 hits [cyanobacteria]          DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. W
. . . Synechococcus sp. CC9605 .......................................  279  4 hits [cyanobacteria]          DNA topoisomerase IV subunit A [Synechococcus sp. CC9605] >
. . . Synechococcus sp. WH 8109 ......................................  277  4 hits [cyanobacteria]          DNA gyrase subunit A [Synechococcus sp. WH 8109] >gi|260413
. . . Synechococcus sp. CC9311 .......................................  277  4 hits [cyanobacteria]          DNA gyrase subunit A [Synechococcus sp. CC9311] >gi|1138812
. . . Synechococcus elongatus PCC 7942 ...............................  275  4 hits [cyanobacteria]          DNA topoisomerase IV subunit A [Synechococcus elongatus PCC
. . . Synechococcus sp. BL107 ........................................  274  4 hits [cyanobacteria]          DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. B
. . . Synechococcus elongatus PCC 6301 ...............................  273  4 hits [cyanobacteria]          DNA gyrase A subunit [Synechococcus elongatus PCC 6301] >gi
. . . Synechococcus sp. CC9902 .......................................  272  4 hits [cyanobacteria]          DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. C
. . . Synechococcus sp. WH 7805 ......................................  270  4 hits [cyanobacteria]          DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. W
. . . Synechococcus sp. PCC 7335 .....................................  263  4 hits [cyanobacteria]          DNA gyrase/topoisomerase IV, A subunit domain protein [Syne
. . . Synechococcus sp. JA-2-3B'a(2-13) ..............................  263  4 hits [cyanobacteria]          type II DNA topoisomerase, A subunit [Synechococcus sp. JA-
. . . Microcoleus chthonoplastes PCC 7420 ............................  261  4 hits [cyanobacteria]          DNA gyrase/topoisomerase IV, A subunit domain protein [Micr
. . . Cyanothece sp. PCC 8801 ........................................  261  4 hits [cyanobacteria]          DNA topoisomerase [Cyanothece sp. PCC 8801] >gi|218166684|g
. . . Cyanothece sp. ATCC 51142 ......................................  259  4 hits [cyanobacteria]          DNA gyrase subunit A [Cyanothece sp. ATCC 51142] >gi|171700
. . . Cyanothece sp. PCC 8802 ........................................  259  4 hits [cyanobacteria]          DNA topoisomerase (ATP-hydrolyzing) [Cyanothece sp. PCC 880
. . . Nodularia spumigena CCY9414 ....................................  258  4 hits [cyanobacteria]          DNA topoisomerase chain A [Nodularia spumigena CCY9414] >gi
. . . Synechococcus sp. RS9917 .......................................  258  4 hits [cyanobacteria]          putative DNA topoisomerase chain A [Synechococcus sp. RS991
. . . Synechococcus sp. RS9916 .......................................  258  4 hits [cyanobacteria]          putative DNA topoisomerase chain A [Synechococcus sp. RS991
. . . Synechococcus sp. JA-3-3Ab .....................................  258  4 hits [cyanobacteria]          type II DNA topoisomerase, A subunit [Synechococcus sp. JA-
. . . Cyanothece sp. CCY0110 .........................................  256  4 hits [cyanobacteria]          DNA gyrase, subunit A [Cyanothece sp. CCY0110] >gi|12661889
. . . Cyanothece sp. PCC 7425 ........................................  255  4 hits [cyanobacteria]          DNA gyrase subunit A [Cyanothece sp. PCC 7425] >gi|21986340
. . . Synechococcus sp. PCC 7002 .....................................  255  4 hits [cyanobacteria]          DNA topoisomerase chain A [Synechococcus sp. PCC 7002] >gi|
. . . Cyanothece sp. PCC 7822 ........................................  253  4 hits [cyanobacteria]          DNA topoisomerase (ATP-hydrolyzing) [Cyanothece sp. PCC 782
. . . Arthrospira platensis NIES-39 ..................................  253  2 hits [cyanobacteria]          DNA gyrase A subunit [Arthrospira platensis NIES-39]
. . . Cyanothece sp. PCC 7424 ........................................  252  4 hits [cyanobacteria]          DNA topoisomerase (ATP-hydrolyzing) [Cyanothece sp. PCC 742
. . . Oscillatoria sp. PCC 6506 ......................................  252  4 hits [cyanobacteria]          DNA topoisomerase IV subunit A [Oscillatoria sp. PCC 6506] 
. . . Arthrospira maxima CS-328 ......................................  252  4 hits [cyanobacteria]          DNA topoisomerase (ATP-hydrolyzing) [Arthrospira maxima CS-
. . . Trichodesmium erythraeum IMS101 ................................  251  4 hits [cyanobacteria]          DNA topoisomerase IV subunit A [Trichodesmium erythraeum IM
. . . cyanobacterium UCYN-A ..........................................  251  4 hits [cyanobacteria]          DNA topoisomerase IV subunit A [cyanobacterium UCYN-A] >gi|
. . . Crocosphaera watsonii WH 8501 ..................................  251  4 hits [cyanobacteria]          DNA topoisomerase (ATP-hydrolyzing) [Crocosphaera watsonii 
. . . Raphidiopsis brookii D9 ........................................  251  4 hits [cyanobacteria]          DNA topoisomerase 4 subunit A [Raphidiopsis brookii D9] >gi
. . . Cylindrospermopsis raciborskii CS-505 ..........................  250  4 hits [cyanobacteria]          DNA gyrase, subunit A [Cylindrospermopsis raciborskii CS-50
. . . Synechocystis sp. PCC 6803 .....................................  249  6 hits [cyanobacteria]          DNA gyrase A subunit [Synechocystis sp. PCC 6803] >gi|16521
. . . Anabaena variabilis ATCC 29413 .................................  249  4 hits [cyanobacteria]          DNA topoisomerase IV subunit A [Anabaena variabilis ATCC 29
. . . Microcystis aeruginosa PCC 7806 ................................  248  2 hits [cyanobacteria]          unnamed protein product [Microcystis aeruginosa PCC 7806]
. . . Microcystis aeruginosa NIES-843 ................................  248  4 hits [cyanobacteria]          DNA gyrase subunit A [Microcystis aeruginosa NIES-843] >gi|
. . . Nostoc sp. PCC 7120 ............................................  246  4 hits [cyanobacteria]          DNA topoisomerase chain A [Nostoc sp. PCC 7120] >gi|1712978
. . . Lyngbya sp. PCC 8106 ...........................................  245  4 hits [cyanobacteria]          DNA topoisomerase chain A [Lyngbya sp. PCC 8106] >gi|119454
. . . Nostoc punctiforme PCC 73102 ...................................  244  4 hits [cyanobacteria]          DNA gyrase, A subunit [Nostoc punctiforme PCC 73102] >gi|18
. . . Acaryochloris marina MBIC11017 .................................  244  4 hits [cyanobacteria]          DNA gyrase, A subunit [Acaryochloris marina MBIC11017] >gi|
. . . 'Nostoc azollae' 0708 ..........................................  243  4 hits [cyanobacteria]          DNA gyrase subunit A ['Nostoc azollae' 0708] >gi|298233530|
. . . Thermosynechococcus elongatus BP-1 .............................  236  4 hits [cyanobacteria]          DNA gyrase A subunit [Thermosynechococcus elongatus BP-1] >
. . . Arthrospira platensis str. Paraca ..............................  235  2 hits [cyanobacteria]          DNA topoisomerase IV subunit A [Arthrospira platensis str. 
. . . Gloeobacter violaceus PCC 7421 .................................  218  4 hits [cyanobacteria]          DNA gyrase subunit A [Gloeobacter violaceus PCC 7421] >gi|3
. . Carboxydothermus hydrogenoformans Z-2901 -------------------------  223  2 hits [firmicutes]             DNA gyrase subunit A [Carboxydothermus hydrogenoformans Z-2
. . Natranaerobius thermophilus JW/NM-WN-LF ..........................  221  2 hits [firmicutes]             DNA gyrase subunit A [Natranaerobius thermophilus JW/NM-WN-
. . Clostridium botulinum C str. Eklund ..............................  219  2 hits [firmicutes]             DNA gyrase, A subunit [Clostridium botulinum C str. Eklund]
. . Clostridium novyi NT .............................................  217  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium novyi NT] >gi|118135630|g
. . Bacillus licheniformis ATCC 14580 ................................  216  4 hits [firmicutes]             DNA gyrase subunit A [Bacillus licheniformis ATCC 14580] >g
. . Bacillus sp. BT1B_CT2 ............................................  216  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus licheniformis ATCC 14580] >g
. . Bacillus coahuilensis m4-4 .......................................  216  1 hit  [firmicutes]             DNA gyrase subunit A [Bacillus coahuilensis m4-4]
. . Bacillus amyloliquefaciens FZB42 .................................  216  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus amyloliquefaciens FZB42] >gi
. . Clostridium botulinum A3 str. Loch Maree .........................  215  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium botulinum A3 str. Loch Ma
. . Clostridium botulinum A str. ATCC 19397 ..........................  215  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium botulinum A str. ATCC 193
. . Clostridium botulinum A str. Hall ................................  215  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium botulinum A str. ATCC 193
. . Clostridium botulinum A str. ATCC 3502 ...........................  215  2 hits [firmicutes]             DNA gyrase, A subunit [Clostridium botulinum A str. ATCC 35
. . Clostridium botulinum H04402 065 .................................  215  1 hit  [firmicutes]             DNA gyrase subunit A [Clostridium botulinum H04402 065]
. . Clostridium botulinum F str. Langeland ...........................  215  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium botulinum F str. Langelan
. . Clostridium botulinum F str. 230613 ..............................  215  1 hit  [firmicutes]             DNA gyrase, A subunit [Clostridium botulinum F str. 230613]
. . Clostridium botulinum B1 str. Okra ...............................  215  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium botulinum B1 str. Okra] >
. . Clostridium botulinum NCTC 2916 ..................................  215  2 hits [firmicutes]             DNA gyrase, A subunit [Clostridium botulinum NCTC 2916] >gi
. . Clostridium botulinum A2 str. Kyoto ..............................  215  2 hits [firmicutes]             DNA gyrase, A subunit [Clostridium botulinum A2 str. Kyoto]
. . Coprococcus eutactus ATCC 27759 ..................................  215  2 hits [firmicutes]             hypothetical protein COPEUT_01135 [Coprococcus eutactus ATC
. . Geobacillus sp. WCH70 ............................................  214  2 hits [firmicutes]             DNA gyrase, A subunit [Geobacillus sp. WCH70] >gi|239805883
. . Coprococcus sp. ART55/1 ..........................................  214  1 hit  [firmicutes]             DNA gyrase subunit A [Coprococcus sp. ART55/1]
. . Bacillus amyloliquefaciens DSM 7 .................................  214  2 hits [firmicutes]             DNA gyrase (subunit A) [Bacillus amyloliquefaciens DSM 7] >
. . Bacillus tusciae DSM 2912 ........................................  214  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus tusciae DSM 2912] >gi|29541
. . Clostridium cellulovorans 743B ...................................  214  3 hits [firmicutes]             DNA gyrase, A subunit [Clostridium cellulovorans 743B] >gi|
. . Halothermothrix orenii H 168 .....................................  213  4 hits [firmicutes]             DNA gyrase, A subunit [Halothermothrix orenii H 168] >gi|21
. . Clostridium botulinum D str. 1873 ................................  213  2 hits [firmicutes]             DNA gyrase, A subunit [Clostridium botulinum D str. 1873] >
. . Bacillus subtilis ................................................  213 53 hits [firmicutes]             DNA gyrase subunit A [Bacillus subtilis]
. . Geobacillus kaustophilus HTA426 ..................................  213  2 hits [firmicutes]             DNA gyrase subunit A [Geobacillus kaustophilus HTA426] >gi|
. . Geobacillus sp. Y412MC61 .........................................  213  2 hits [firmicutes]             DNA gyrase subunit A [Geobacillus kaustophilus HTA426] >gi|
. . Geobacillus sp. C56-T3 ...........................................  213  2 hits [firmicutes]             DNA gyrase subunit A [Geobacillus kaustophilus HTA426] >gi|
. . Geobacillus sp. Y412MC52 .........................................  213  2 hits [firmicutes]             DNA gyrase subunit A [Geobacillus kaustophilus HTA426] >gi|
. . Roseburia inulinivorans DSM 16841 ................................  213  2 hits [firmicutes]             hypothetical protein ROSEINA2194_03240 [Roseburia inulinivo
. . Bacillus sp. 2_A_57_CT2 ..........................................  213  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus sp. 2_A_57_CT2] >gi|31739727
. . Clostridium botulinum Ba4 str. 657 ...............................  213  2 hits [firmicutes]             DNA gyrase, A subunit [Clostridium botulinum Ba4 str. 657] 
. . Clostridium botulinum Bf .........................................  213  2 hits [firmicutes]             DNA gyrase, A subunit [Clostridium botulinum Bf] >gi|182673
. . Clostridium sporogenes ATCC 15579 ................................  212  2 hits [firmicutes]             hypothetical protein CLOSPO_00917 [Clostridium sporogenes A
. . Anoxybacillus flavithermus WK1 ...................................  211  2 hits [firmicutes]             DNA gyrase subunit A [Anoxybacillus flavithermus WK1] >gi|2
. . Roseburia intestinalis L1-82 .....................................  211  2 hits [firmicutes]             DNA gyrase, A subunit [Roseburia intestinalis L1-82] >gi|25
. . Roseburia intestinalis M50/1 .....................................  211  1 hit  [firmicutes]             DNA gyrase, A subunit [Roseburia intestinalis L1-82] >gi|25
. . Roseburia intestinalis XB6B4 .....................................  211  1 hit  [firmicutes]             DNA gyrase, A subunit [Roseburia intestinalis L1-82] >gi|25
. . Bacillus subtilis subsp. spizizenii ATCC 6633 ....................  211  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus subtilis subsp. spizizenii A
. . Bacillus subtilis subsp. spizizenii str. W23 .....................  211  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus subtilis subsp. spizizenii A
. . Paenibacillus larvae subsp. larvae B-3650 ........................  211  2 hits [firmicutes]             DNA gyrase subunit A-like protein [Paenibacillus larvae sub
. . Geobacillus sp. G11MC16 ..........................................  211  2 hits [firmicutes]             DNA gyrase, A subunit [Geobacillus sp. G11MC16] >gi|1962107
. . Bacillus subtilis BSn5 ...........................................  211  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus subtilis BSn5] >gi|320019948
. . Paenibacillus larvae subsp. larvae BRL-230010 ....................  211  1 hit  [firmicutes]             DNA gyrase subunit A [Paenibacillus larvae subsp. larvae BR
. . Geobacillus thermodenitrificans NG80-2 ...........................  211  2 hits [firmicutes]             DNA gyrase subunit A [Geobacillus thermodenitrificans NG80-
. . Eubacterium eligens ATCC 27750 ...................................  211  2 hits [firmicutes]             DNA gyrase subunit A [Eubacterium eligens ATCC 27750] >gi|2
. . Bacillus subtilis subsp. subtilis str. 168 .......................  211  4 hits [firmicutes]             DNA gyrase subunit A [Bacillus subtilis subsp. subtilis str
. . Bacillus subtilis subsp. subtilis str. NCIB 3610 .................  211  1 hit  [firmicutes]             DNA gyrase subunit A [Bacillus subtilis subsp. subtilis str
. . Bacillus subtilis subsp. subtilis str. JH642 .....................  211  1 hit  [firmicutes]             DNA gyrase subunit A [Bacillus subtilis subsp. subtilis str
. . Bacillus subtilis subsp. subtilis str. SMY .......................  211  1 hit  [firmicutes]             DNA gyrase subunit A [Bacillus subtilis subsp. subtilis str
. . Bacillus subtilis subsp. natto BEST195 ...........................  211  1 hit  [firmicutes]             DNA gyrase subunit A [Bacillus subtilis subsp. subtilis str
. . Oceanobacillus iheyensis HTE831 ..................................  210  2 hits [firmicutes]             DNA gyrase subunit A [Oceanobacillus iheyensis HTE831] >gi|
. . Denitrovibrio acetiphilus DSM 12809 ..............................  210  2 hits [bacteria]               DNA gyrase, A subunit [Denitrovibrio acetiphilus DSM 12809]
. . Bacillus pseudomycoides DSM 12442 ................................  210  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus pseudomycoides DSM 12442] >g
. . Bacillus mycoides Rock3-17 .......................................  210  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus mycoides Rock3-17] >gi|22900
. . Bacillus mycoides Rock1-4 ........................................  210  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus mycoides Rock3-17] >gi|22900
. . Thermaerobacter marianensis DSM 12885 ............................  210  2 hits [firmicutes]             DNA gyrase subunit A [Thermaerobacter marianensis DSM 12885
. . Bacillus cereus AH820 ............................................  210  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus AH820] >gi|228930500
. . Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1 .........  210  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus AH820] >gi|228930500
. . Bacillus thuringiensis serovar andalousiensis BGSC 4AW1 ..........  210  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus AH820] >gi|228930500
. . Bacillus thuringiensis serovar tochigiensis BGSC 4Y1 .............  210  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus AH820] >gi|228930500
. . Bacillus cereus 95/8201 ..........................................  210  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus AH820] >gi|228930500
. . Clostridium carboxidivorans P7 ...................................  209  4 hits [firmicutes]             DNA gyrase, A subunit [Clostridium carboxidivorans P7] >gi|
. . Bacillus atrophaeus 1942 .........................................  209  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus atrophaeus 1942] >gi|3108711
. . Geobacillus thermoglucosidasius C56-YS93 .........................  209  2 hits [firmicutes]             DNA gyrase, A subunit [Geobacillus thermoglucosidasius C56-
. . Bacillus thuringiensis serovar monterrey BGSC 4AJ1 ...............  209  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus thuringiensis serovar monter
. . Clostridium butyricum 5521 .......................................  209  2 hits [firmicutes]             DNA gyrase, A subunit [Clostridium butyricum 5521] >gi|1823
. . Bacillus anthracis str. A0442 ....................................  209  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus anthracis str. A0442] >gi|2
. . Bacillus anthracis str. Kruger B .................................  209  1 hit  [firmicutes]             DNA gyrase, A subunit [Bacillus anthracis str. A0442] >gi|2
. . Clostridium butyricum E4 str. BoNT E BL5262 ......................  209  2 hits [firmicutes]             DNA gyrase, A subunit [Clostridium butyricum E4 str. BoNT E
. . Bacillus anthracis str. Ames .....................................  209  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus cereus ATCC 10987 .......................................  209  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus anthracis str. 'Ames Ancestor' ..........................  209  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus anthracis str. Sterne ...................................  209  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus thuringiensis serovar konkukian str. 97-27 ..............  209  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus anthracis str. A2012 ....................................  209  1 hit  [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus anthracis str. A0488 ....................................  209  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus anthracis str. A0193 ....................................  209  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus anthracis str. A0465 ....................................  209  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus anthracis str. A0389 ....................................  209  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus anthracis str. A0174 ....................................  209  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus anthracis Tsiankovskii-I ................................  209  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus cereus NVH0597-99 .......................................  209  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus cereus 03BB108 ..........................................  209  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus anthracis str. CDC 684 ..................................  209  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus thuringiensis serovar pulsiensis BGSC 4CC1 ..............  209  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus cereus BGSC 6E1 .........................................  209  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus cereus m1293 ............................................  209  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus anthracis str. A0248 ....................................  209  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus anthracis str. CNEVA-9066 ...............................  209  1 hit  [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus anthracis str. A1055 ....................................  209  1 hit  [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus anthracis str. Western North America USA6153 ............  209  1 hit  [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus anthracis str. Vollum ...................................  209  1 hit  [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus anthracis str. Australia 94 .............................  209  1 hit  [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus cereus biovar anthracis str. CI .........................  209  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus anthracis str. Ames] >gi|427
. . Bacillus cereus H3081.97 .........................................  208  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus H3081.97] >gi|217957
. . Bacillus cereus AH187 ............................................  208  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus H3081.97] >gi|217957
. . Bacillus cereus Q1 ...............................................  208  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus H3081.97] >gi|217957
. . Bacillus cereus BDRD-ST26 ........................................  208  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus H3081.97] >gi|217957
. . Bacillus thuringiensis str. Al Hakam .............................  208  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus thuringiensis str. Al Hakam]
. . Bacillus cereus MM3 ..............................................  208  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus cereus MM3] >gi|228607329|gb
. . Bacillus cellulosilyticus DSM 2522 ...............................  208  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cellulosilyticus DSM 2522] 
. . Bacillus anthracis (anthrax) .....................................  208  1 hit  [firmicutes]             DNA gyrase subunit A [Bacillus anthracis] >gi|31323279|gb|A
. . Bacillus cereus ..................................................  208  1 hit  [firmicutes]             DNA gyrase subunit A [Bacillus anthracis] >gi|31323279|gb|A
. . Bacillus cereus R309803 ..........................................  208  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus cereus R309803] >gi|22861905
. . Alkaliphilus metalliredigens QYMF ................................  208  2 hits [firmicutes]             DNA gyrase, A subunit [Alkaliphilus metalliredigens QYMF] >
. . Bacillus thuringiensis serovar berliner ATCC 10792 ...............  207  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus thuringiensis serovar berlin
. . Bacillus thuringiensis serovar thuringiensis str. T01001 .........  207  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus thuringiensis serovar berlin
. . Bacillus thuringiensis Bt407 .....................................  207  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus thuringiensis serovar berlin
. . Clostridium hathewayi DSM 13479 ..................................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Clostridium hathewayi DSM 13479] >gi
. . Bacillus cereus ATCC 14579 .......................................  207  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus cereus ATCC 14579] >gi|29893
. . Geobacillus sp. Y4.1MC1 ..........................................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Geobacillus sp. Y4.1MC1] >gi|3112142
. . Clostridium kluyveri NBRC 12016 ..................................  207  2 hits [firmicutes]             DNA gyrase A subunit [Clostridium kluyveri NBRC 12016] >gi|
. . Bacillus cereus Rock3-28 .........................................  207  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus cereus Rock3-28] >gi|2286826
. . Bacillus cereus Rock3-29 .........................................  207  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus cereus Rock3-29] >gi|2291189
. . Bacillus cereus Rock1-3 ..........................................  207  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus cereus Rock3-29] >gi|2291189
. . Bacillus cereus AH1134 ...........................................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus AH1134] >gi|21823133
. . Bacillus cereus B4264 ............................................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus AH1134] >gi|21823133
. . Bacillus thuringiensis serovar huazhongensis BGSC 4BD1 ...........  207  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus AH1134] >gi|21823133
. . Bacillus thuringiensis serovar kurstaki str. T03a001 .............  207  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus AH1134] >gi|21823133
. . Bacillus thuringiensis serovar pakistani str. T13001 .............  207  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus AH1134] >gi|21823133
. . Bacillus cereus AH676 ............................................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus AH1134] >gi|21823133
. . Bacillus cereus F65185 ...........................................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus AH1134] >gi|21823133
. . Bacillus cereus Rock4-2 ..........................................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus AH1134] >gi|21823133
. . Bacillus cereus Rock1-15 .........................................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus AH1134] >gi|21823133
. . Bacillus cereus BDRD-Cer4 ........................................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus AH1134] >gi|21823133
. . Bacillus cereus BDRD-ST24 ........................................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus AH1134] >gi|21823133
. . Bacillus cereus m1550 ............................................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus AH1134] >gi|21823133
. . Bacillus cereus 172560W ..........................................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus AH1134] >gi|21823133
. . Bacillus cereus ATCC 10876 .......................................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus AH1134] >gi|21823133
. . Bacillus thuringiensis BMB171 ....................................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus AH1134] >gi|21823133
. . Clostridium kluyveri DSM 555 .....................................  207  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium kluyveri DSM 555] >gi|146
. . Bacillus cereus Rock3-42 .........................................  207  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus cereus Rock3-42] >gi|3001188
. . Bacillus cereus SJ1 ..............................................  207  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus cereus Rock3-42] >gi|3001188
. . Clostridium tetani E88 ...........................................  207  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium tetani E88] >gi|28202297|
. . Exiguobacterium sibiricum 255-15 .................................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Exiguobacterium sibiricum 255-15] >g
. . Dethiobacter alkaliphilus AHT 1 ..................................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Dethiobacter alkaliphilus AHT 1] >gi
. . Bacillus cereus G9842 ............................................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus G9842] >gi|228905438
. . Bacillus thuringiensis IBL 4222 ..................................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus G9842] >gi|228905438
. . Bacillus thuringiensis serovar sotto str. T04001 .................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus G9842] >gi|228905438
. . Desulfohalobium retbaense DSM 5692 ...............................  207  2 hits [d-proteobacteria]       DNA gyrase, A subunit [Desulfohalobium retbaense DSM 5692] 
. . Bacillus cereus W ................................................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus W] >gi|195991290|gb|
. . Alkaliphilus oremlandii OhILAs ...................................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Alkaliphilus oremlandii OhILAs] >gi|
. . Bacillus cereus AH1271 ...........................................  207  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus cereus AH1271] >gi|228728218
. . Deferribacter desulfuricans SSM1 .................................  207  2 hits [bacteria]               DNA gyrase subunit A [Deferribacter desulfuricans SSM1] >gi
. . Leptospirillum rubarum ...........................................  207  1 hit  [bacteria]               DNA gyrase, A subunit [Leptospirillum rubarum] >gi|20660340
. . Leptospirillum sp. Group II '5-way CG' ...........................  207  2 hits [bacteria]               DNA gyrase, A subunit [Leptospirillum rubarum] >gi|20660340
. . Atopobium parvulum DSM 20469 .....................................  207  2 hits [high GC Gram+]          DNA gyrase, A subunit [Atopobium parvulum DSM 20469] >gi|25
. . Bacillus cereus 03BB102 ..........................................  207  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus cereus 03BB102] >gi|2257902
. . Eubacterium ventriosum ATCC 27560 ................................  207  2 hits [firmicutes]             hypothetical protein EUBVEN_01634 [Eubacterium ventriosum A
. . Bacillus cereus ATCC 4342 ........................................  206  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus cereus ATCC 4342] >gi|228624
. . Bacillus cereus E33L .............................................  206  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus cereus E33L] >gi|51978672|gb
. . Bacillus halodurans C-125 ........................................  206  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus halodurans C-125] >gi|403339
. . Bacillus halodurans ..............................................  206  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus halodurans C-125] >gi|403339
. . Bacillus sp. .....................................................  206  1 hit  [firmicutes]             DNA gyrase subunit A [Bacillus halodurans C-125] >gi|403339
. . Bacillus cereus Rock3-44 .........................................  206  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus cereus Rock3-44] >gi|2286999
. . Bacillus thuringiensis IBL 200 ...................................  206  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus thuringiensis IBL 200] >gi|2
. . Bacillus coagulans 36D1 ..........................................  206  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus coagulans 36D1] >gi|2293267
. . Bacillus weihenstephanensis KBAB4 ................................  206  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus weihenstephanensis KBAB4] >g
. . Bacillus cereus AH603 ............................................  206  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus weihenstephanensis KBAB4] >g
. . Bacillus cereus BDRD-ST196 .......................................  206  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus weihenstephanensis KBAB4] >g
. . Thermaerobacter subterraneus DSM 13965 ...........................  206  2 hits [firmicutes]             DNA gyrase subunit A [Thermaerobacter subterraneus DSM 1396
. . Coprococcus catus GD/7 ...........................................  206  1 hit  [firmicutes]             DNA gyrase subunit A [Coprococcus catus GD/7]
. . Bacillus mycoides DSM 2048 .......................................  205  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus mycoides DSM 2048] >gi|22917
. . Bacillus cereus AH621 ............................................  205  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus mycoides DSM 2048] >gi|22917
. . Sebaldella termitidis ATCC 33386 .................................  205  2 hits [fusobacteria]           DNA gyrase, A subunit [Sebaldella termitidis ATCC 33386] >g
. . Clostridium beijerinckii NCIMB 8052 ..............................  205  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium beijerinckii NCIMB 8052] 
. . Butyrivibrio proteoclasticus B316 ................................  205  2 hits [firmicutes]             DNA gyrase subunit A GyrA [Butyrivibrio proteoclasticus B31
. . Bacillus cytotoxicus NVH 391-98 ..................................  205  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus cereus subsp. cytotoxis NVH 
. . Bacillus cereus AH1273 ...........................................  205  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus cereus AH1273] >gi|229026935
. . Bacillus cereus AH1272 ...........................................  205  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus cereus AH1273] >gi|229026935
. . Staphylococcus lugdunensis HKU09-01 ..............................  205  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus lugdunensis HKU09-01] 
. . Staphylococcus lugdunensis M23590 ................................  204  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) subunit A [Staphylococc
. . Fusobacterium varium ATCC 27725 ..................................  204  2 hits [fusobacteria]           DNA topoisomerase [Fusobacterium varium ATCC 27725] >gi|251
. . Bacillus sp. SG-1 ................................................  204  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus sp. SG-1] >gi|148849976|gb|E
. . Bacillus megaterium DSM 319 ......................................  204  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus megaterium DSM 319] >gi|2947
. . Ruminococcus torques L2-14 .......................................  204  1 hit  [firmicutes]             DNA gyrase subunit A [Ruminococcus torques L2-14]
. . Clostridium sp. 7_2_43FAA ........................................  204  2 hits [firmicutes]             subunit A [Clostridium sp. 7_2_43FAA] >gi|226914439|gb|EEH9
. . Bacillus megaterium QM B1551 .....................................  204  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus megaterium QM B1551] >gi|294
. . Thermincola potens JR ............................................  204  2 hits [firmicutes]             DNA gyrase, A subunit [Thermincola sp. JR] >gi|296030137|gb
. . Pelotomaculum thermopropionicum SI ...............................  204  2 hits [firmicutes]             type IIA topoisomerase, A subunit [Pelotomaculum thermoprop
. . Gemella moribillum M424 ..........................................  204  2 hits [firmicutes]             DNA gyrase, subunit A [Gemella moribillum M424] >gi|3169148
. . Bacillus pseudofirmus OF4 ........................................  204  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus pseudofirmus OF4] >gi|288545
. . Selenomonas flueggei ATCC 43531 ..................................  204  2 hits [firmicutes]             DNA gyrase subunit A [Selenomonas flueggei ATCC 43531] >gi|
. . Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 ....  204  2 hits [firmicutes]             DNA gyrase, A subunit [Alicyclobacillus acidocaldarius subs
. . Thermomicrobium roseum DSM 5159 ..................................  204  2 hits [GNS bacteria]           DNA gyrase, A subunit [Thermomicrobium roseum DSM 5159] >gi
. . Dialister invisus DSM 15470 ......................................  204  2 hits [firmicutes]             DNA gyrase, A subunit [Dialister invisus DSM 15470] >gi|260
. . Clostridium sticklandii DSM 519 ..................................  204  1 hit  [firmicutes]             DNA gyrase (type ii topoisomerase), subunit a [Clostridium 
. . Clostridium sticklandii ..........................................  204  1 hit  [firmicutes]             DNA gyrase (type ii topoisomerase), subunit a [Clostridium 
. . Desulfovibrio sp. FW1012B ........................................  204  2 hits [d-proteobacteria]       DNA gyrase, A subunit [Desulfovibrio sp. FW1012B] >gi|28357
. . Thermoanaerobacterium xylanolyticum LX-11 ........................  204  1 hit  [firmicutes]             DNA gyrase, A subunit [Thermoanaerobacterium xylanolyticum 
. . Clostridium botulinum E3 str. Alaska E43 .........................  204  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium botulinum E3 str. Alaska 
. . Bacillus sp. m3-13 ...............................................  204  1 hit  [firmicutes]             DNA gyrase subunit A [Bacillus sp. m3-13]
. . Thermosediminibacter oceani DSM 16646 ............................  204  2 hits [firmicutes]             DNA gyrase subunit A [Thermosediminibacter oceani DSM 16646
. . Bacillus pumilus SAFR-032 ........................................  204  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus pumilus SAFR-032] >gi|157679
. . Thermovibrio ammonificans HB-1 ...................................  204  2 hits [aquificales]            DNA gyrase, A subunit [Thermovibrio ammonificans HB-1] >gi|
. . Clostridium botulinum E1 str. 'BoNT E Beluga' ....................  203  2 hits [firmicutes]             DNA gyrase, A subunit [Clostridium botulinum E1 str. 'BoNT 
. . Planococcus donghaensis MPA1U2 ...................................  203  2 hits [firmicutes]             DNA gyrase subunit A [Planococcus donghaensis MPA1U2] >gi|3
. . Thermobaculum terrenum ATCC BAA-798 ..............................  203  2 hits [bacteria]               DNA gyrase, A subunit [Thermobaculum terrenum ATCC BAA-798]
. . Desulfovibrio fructosovorans JJ ..................................  203  2 hits [d-proteobacteria]       DNA gyrase, A subunit [Desulfovibrio fructosovorans JJ] >gi
. . Bacillus sp. NRRL B-14911 ........................................  203  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus sp. NRRL B-14911] >gi|890841
. . Selenomonas sp. oral taxon 149 str. 67H29BP ......................  203  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) subunit A [Selenomonas 
. . Fusobacterium mortiferum ATCC 9817 ...............................  203  2 hits [fusobacteria]           DNA gyrase subunit A [Fusobacterium mortiferum ATCC 9817] >
. . Selenomonas artemidis F0399 ......................................  203  2 hits [firmicutes]             DNA gyrase, A subunit [Selenomonas artemidis F0399] >gi|320
. . Erysipelotrichaceae bacterium 5_2_54FAA ..........................  203  2 hits [firmicutes]             DNA gyrase, A subunit [Erysipelotrichaceae bacterium 5_2_54
. . Selenomonas sp. oral taxon 137 str. F0430 ........................  202  2 hits [firmicutes]             DNA gyrase, A subunit [Selenomonas sp. oral taxon 137 str. 
. . Candidatus Desulforudis audaxviator MP104C .......................  202  2 hits [firmicutes]             DNA gyrase, A subunit [Candidatus Desulforudis audaxviator 
. . Thermodesulfovibrio yellowstonii DSM 11347 .......................  202  2 hits [bacteria]               DNA gyrase, A subunit [Thermodesulfovibrio yellowstonii DSM
. . Ruminococcus torques ATCC 27756 ..................................  202  2 hits [firmicutes]             hypothetical protein RUMTOR_01664 [Ruminococcus torques ATC
. . Fulvimarina pelagi HTCC2506 ......................................  202  2 hits [a-proteobacteria]       DNA gyrase subunit A [Fulvimarina pelagi HTCC2506] >gi|1145
. . Pedobacter saltans DSM 12145 .....................................  202  2 hits [CFB group bacteria]     DNA gyrase subunit A [Pedobacter saltans DSM 12145] >gi|313
. . Lachnospiraceae bacterium 8_1_57FAA ..............................  202  2 hits [firmicutes]             DNA gyrase, subunit A [Lachnospiraceae bacterium 8_1_57FAA]
. . Halanaerobium sp. 'sapolanicus' ..................................  202  4 hits [firmicutes]             DNA gyrase, A subunit [Halanaerobium sp. 'sapolanicus'] >gi
. . Clostridium botulinum B str. Eklund 17B ..........................  202  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium botulinum B str. Eklund 1
. . Clostridium sp. SS2/1 ............................................  202  2 hits [firmicutes]             hypothetical protein CLOSS21_01376 [Clostridium sp. SS2/1] 
. . butyrate-producing bacterium SSC/2 ...............................  202  1 hit  [firmicutes]             hypothetical protein CLOSS21_01376 [Clostridium sp. SS2/1] 
. . Abiotrophia defectiva ATCC 49176 .................................  202  2 hits [firmicutes]             hypothetical protein GCWU000182_02242 [Abiotrophia defectiv
. . Butyrivibrio fibrisolvens 16/4 ...................................  202  1 hit  [firmicutes]             DNA gyrase subunit A [Butyrivibrio fibrisolvens 16/4]
. . Brevibacillus brevis NBRC 100599 .................................  202  2 hits [firmicutes]             DNA gyrase subunit A [Brevibacillus brevis NBRC 100599] >gi
. . Clostridium hiranonis DSM 13275 ..................................  202  2 hits [firmicutes]             hypothetical protein CLOHIR_02100 [Clostridium hiranonis DS
. . Leptotrichia hofstadii F0254 .....................................  202  2 hits [fusobacteria]           DNA gyrase, A subunit [Leptotrichia hofstadii F0254] >gi|26
. . Lachnospiraceae bacterium 5_1_63FAA ..............................  201  2 hits [firmicutes]             hypothetical protein HMPREF0996_02557 [Lachnospiraceae bact
. . Desulfovibrio magneticus RS-1 ....................................  201  2 hits [d-proteobacteria]       DNA gyrase subunit A [Desulfovibrio magneticus RS-1] >gi|23
. . Alicyclobacillus acidocaldarius LAA1 .............................  201  2 hits [firmicutes]             DNA gyrase, A subunit [Alicyclobacillus acidocaldarius LAA1
. . Leptotrichia buccalis C-1013-b ...................................  201  2 hits [fusobacteria]           DNA gyrase, A subunit [Leptotrichia buccalis DSM 1135] >gi|
. . Heliobacterium modesticaldum Ice1 ................................  201  2 hits [firmicutes]             DNA gyrase, a subunit [Heliobacterium modesticaldum Ice1] >
. . Atopobium rimae ATCC 49626 .......................................  201  2 hits [high GC Gram+]          DNA gyrase, A subunit [Atopobium rimae ATCC 49626] >gi|2211
. . Clostridium hylemonae DSM 15053 ..................................  201  2 hits [firmicutes]             hypothetical protein CLOHYLEM_06427 [Clostridium hylemonae 
. . Lysinibacillus sphaericus C3-41 ..................................  201  2 hits [firmicutes]             DNA gyrase subunit A [Lysinibacillus sphaericus C3-41] >gi|
. . Clostridium ljungdahlii DSM 13528 ................................  201  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium ljungdahlii DSM 13528] >g
. . Thermoanaerobacterium thermosaccharolyticum DSM 571 ..............  200  2 hits [firmicutes]             DNA gyrase, A subunit [Thermoanaerobacterium thermosaccharo
. . uncultured Termite group 1 bacterium phylotype Rs-D17 ............  200  2 hits [bacteria]               DNA gyrase subunit A [uncultured Termite group 1 bacterium 
. . Coprococcus comes ATCC 27758 .....................................  200  2 hits [firmicutes]             hypothetical protein COPCOM_03970 [Coprococcus comes ATCC 2
. . Clostridium symbiosum WAL-14163 ..................................  200  2 hits [firmicutes]             hypothetical protein HMPREF9474_03814 [Clostridium symbiosu
. . Clostridium symbiosum WAL-14673 ..................................  200  1 hit  [firmicutes]             hypothetical protein HMPREF9474_03814 [Clostridium symbiosu
. . Desulfovibrio salexigens DSM 2638 ................................  200  2 hits [d-proteobacteria]       DNA gyrase, A subunit [Desulfovibrio salexigens DSM 2638] >
. . Ruminococcus gnavus ATCC 29149 ...................................  200  2 hits [firmicutes]             hypothetical protein RUMGNA_00866 [Ruminococcus gnavus ATCC
. . Fusobacterium ulcerans ATCC 49185 ................................  199  3 hits [fusobacteria]           DNA gyrase subunit A [Fusobacterium ulcerans ATCC 49185] >g
. . Anaerostipes caccae DSM 14662 ....................................  199  2 hits [firmicutes]             hypothetical protein ANACAC_02786 [Anaerostipes caccae DSM 
. . Anaerostipes sp. 3_2_56FAA .......................................  199  2 hits [firmicutes]             hypothetical protein ANACAC_02786 [Anaerostipes caccae DSM 
. . Eubacterium hallii DSM 3353 ......................................  199  2 hits [firmicutes]             hypothetical protein EUBHAL_03120 [Eubacterium hallii DSM 3
. . Agrobacterium radiobacter K84 ....................................  199  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Agrobacterium radiobacter K84] >gi|2
. . Holdemania filiformis DSM 12042 ..................................  199  2 hits [firmicutes]             hypothetical protein HOLDEFILI_00967 [Holdemania filiformis
. . Dorea longicatena DSM 13814 ......................................  199  2 hits [firmicutes]             hypothetical protein DORLON_01543 [Dorea longicatena DSM 13
. . Bacillus sp. B14905 ..............................................  199  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus sp. B14905] >gi|126591269|gb
. . Thermosinus carboxydivorans Nor1 .................................  199  2 hits [firmicutes]             DNA gyrase, A subunit [Thermosinus carboxydivorans Nor1] >g
. . Clostridiales bacterium 1_7_47FAA ................................  199  2 hits [firmicutes]             conserved hypothetical protein [Clostridiales bacterium 1_7
. . Clostridium septicum .............................................  199  1 hit  [firmicutes]             putative gyrase subunit A [Clostridium septicum]
. . Clostridium nexile DSM 1787 ......................................  199  2 hits [firmicutes]             hypothetical protein CLONEX_02386 [Clostridium nexile DSM 1
. . Clostridium acetobutylicum ATCC 824 ..............................  199  3 hits [firmicutes]             DNA gyrase subunit A [Clostridium acetobutylicum ATCC 824] 
. . Clostridium acetobutylicum .......................................  199  1 hit  [firmicutes]             DNA gyrase subunit A [Clostridium acetobutylicum ATCC 824] 
. . Megasphaera micronuciformis F0359 ................................  199  2 hits [firmicutes]             DNA gyrase, A subunit [Megasphaera micronuciformis F0359] >
. . Bacteriovorax marinus SJ .........................................  199  1 hit  [d-proteobacteria]       DNA gyrase subunit A [Bacteriovorax marinus SJ]
. . Clostridium difficile NAP08 ......................................  199  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) subunit A [Clostridium 
. . Clostridium scindens ATCC 35704 ..................................  199  2 hits [firmicutes]             hypothetical protein CLOSCI_01940 [Clostridium scindens ATC
. . Exiguobacterium sp. AT1b .........................................  199  2 hits [firmicutes]             DNA gyrase, A subunit [Exiguobacterium sp. AT1b] >gi|229468
. . Clostridium difficile QCD-23m63 ..................................  198  1 hit  [firmicutes]             DNA gyrase subunit A [Clostridium difficile QCD-23m63] >gi|
. . Clostridium difficile NAP07 ......................................  198  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium difficile QCD-23m63] >gi|
. . Atopobium vaginae PB189-T1-4 .....................................  198  2 hits [high GC Gram+]          DNA gyrase, A subunit [Atopobium vaginae PB189-T1-4] >gi|30
. . Peptostreptococcus anaerobius 653-L ..............................  198  2 hits [firmicutes]             DNA gyrase, A subunit [Peptostreptococcus anaerobius 653-L]
. . Clostridium bolteae ATCC BAA-613 .................................  198  2 hits [firmicutes]             hypothetical protein CLOBOL_06347 [Clostridium bolteae ATCC
. . Selenomonas noxia ATCC 43541 .....................................  198  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) subunit A [Selenomonas 
. . Dialister microaerophilus UPII 345-E .............................  198  2 hits [firmicutes]             DNA gyrase, A subunit [Dialister microaerophilus UPII 345-E
. . Dethiosulfovibrio peptidovorans DSM 11002 ........................  198  2 hits [bacteria]               DNA gyrase, A subunit [Dethiosulfovibrio peptidovorans DSM 
. . Bilophila wadsworthia 3_1_6 ......................................  198  2 hits [d-proteobacteria]       DNA gyrase, A subunit [Bilophila wadsworthia 3_1_6] >gi|316
. . Dorea formicigenerans ATCC 27755 .................................  198  2 hits [firmicutes]             hypothetical protein DORFOR_02606 [Dorea formicigenerans AT
. . Paenibacillus vortex V453 ........................................  198  2 hits [firmicutes]             DNA gyrase, A subunit [Paenibacillus vortex V453] >gi|31528
. . Aurantimonas manganoxydans SI85-9A1 ..............................  197  2 hits [a-proteobacteria]       DNA gyrase/topo II, topoisomerase IV, A subunit [Aurantimon
. . Croceibacter atlanticus HTCC2559 .................................  197  2 hits [CFB group bacteria]     DNA gyrase A subunit [Croceibacter atlanticus HTCC2559] >gi
. . Anaerolinea thermophila UNI-1 ....................................  197  4 hits [GNS bacteria]           DNA gyrase subunit A [Anaerolinea thermophila UNI-1] >gi|31
. . Mycoplasma fermentans JER ........................................  197  2 hits [mycoplasmas]            DNA gyrase subunit A [Mycoplasma fermentans JER] >gi|319777
. . Mycoplasma fermentans M64 ........................................  197  2 hits [mycoplasmas]            DNA gyrase subunit A [Mycoplasma fermentans JER] >gi|319777
. . Thermoanaerobacter italicus Ab9 ..................................  197  2 hits [firmicutes]             DNA gyrase, A subunit [Thermoanaerobacter italicus Ab9] >gi
. . Thermoanaerobacter mathranii subsp. mathranii str. A3 ............  197  2 hits [firmicutes]             DNA gyrase, A subunit [Thermoanaerobacter mathranii subsp. 
. . Acetohalobium arabaticum DSM 5501 ................................  197  4 hits [firmicutes]             DNA gyrase, A subunit [Acetohalobium arabaticum DSM 5501] >
. . Lysinibacillus fusiformis ZC1 ....................................  197  2 hits [firmicutes]             DNA gyrase subunit A [Lysinibacillus fusiformis ZC1] >gi|29
. . Mycoplasma fermentans PG18 .......................................  197  1 hit  [mycoplasmas]            hypothetical protein [Mycoplasma fermentans PG18]
. . Bartonella tribocorum CIP 105476 .................................  197  2 hits [a-proteobacteria]       DNA gyrase subunit A [Bartonella tribocorum CIP 105476] >gi
. . Thermoanaerobacter sp. X514 ......................................  197  2 hits [firmicutes]             DNA gyrase, A subunit [Thermoanaerobacter sp. X514] >gi|300
. . Thermoanaerobacter sp. X561 ......................................  197  2 hits [firmicutes]             DNA gyrase, A subunit [Thermoanaerobacter sp. X514] >gi|300
. . Thermoanaerobacter sp. X513 ......................................  197  2 hits [firmicutes]             DNA gyrase, A subunit [Thermoanaerobacter sp. X514] >gi|300
. . Thermoanaerobacter pseudethanolicus ATCC 33223 ...................  197  2 hits [firmicutes]             DNA gyrase, A subunit [Thermoanaerobacter pseudethanolicus 
. . Thermoanaerobacter ethanolicus CCSD1 .............................  197  2 hits [firmicutes]             DNA gyrase, A subunit [Thermoanaerobacter pseudethanolicus 
. . Thermoanaerobacter brockii subsp. finnii Ako-1 ...................  197  2 hits [firmicutes]             DNA gyrase, A subunit [Thermoanaerobacter pseudethanolicus 
. . Desulfitobacterium hafniense DCB-2 ...............................  197  2 hits [firmicutes]             DNA gyrase, A subunit [Desulfitobacterium hafniense DCB-2] 
. . Eubacterium rectale ATCC 33656 ...................................  197  2 hits [firmicutes]             DNA gyrase, A subunit [Eubacterium rectale ATCC 33656] >gi|
. . Thermoanaerobacter wiegelii Rt8.B1 ...............................  197  2 hits [firmicutes]             DNA gyrase, A subunit [Thermoanaerobacter wiegelii Rt8.B1] 
. . Bacillus mojavensis ..............................................  197  3 hits [firmicutes]             DNA gyrase subunit A [Bacillus mojavensis]
. . Sinorhizobium fredii NGR234 ......................................  197  2 hits [a-proteobacteria]       DNA gyrase subunit A [Sinorhizobium fredii NGR234] >gi|2273
. . Desulfitobacterium hafniense Y51 .................................  197  2 hits [firmicutes]             DNA gyrase subunit A [Desulfitobacterium hafniense Y51] >gi
. . Brachyspira hyodysenteriae WA1 ...................................  197  2 hits [spirochetes]            DNA gyrase subunit A [Brachyspira hyodysenteriae WA1] >gi|2
. . Atopobium vaginae DSM 15829 ......................................  197  3 hits [high GC Gram+]          DNA topoisomerase (ATP-hydrolyzing) [Atopobium vaginae DSM 
. . Desulfotomaculum acetoxidans DSM 771 .............................  197  2 hits [firmicutes]             DNA gyrase, A subunit [Desulfotomaculum acetoxidans DSM 771
. . Clostridium sp. L2-50 ............................................  196  2 hits [firmicutes]             hypothetical protein CLOL250_00955 [Clostridium sp. L2-50] 
. . Bartonella grahamii as4aup .......................................  196  2 hits [a-proteobacteria]       DNA gyrase subunit A [Bartonella grahamii as4aup] >gi|24026
. . Clostridium perfringens SM101 ....................................  196  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium perfringens SM101] >gi|11
. . Sphaerobacter thermophilus DSM 20745 .............................  196  2 hits [GNS bacteria]           DNA gyrase, A subunit [Sphaerobacter thermophilus DSM 20745
. . Clostridium perfringens E str. JGS1987 ...........................  196  2 hits [firmicutes]             DNA gyrase, A subunit [Clostridium perfringens E str. JGS19
. . Clostridium perfringens C str. JGS1495 ...........................  196  2 hits [firmicutes]             DNA gyrase, A subunit [Clostridium perfringens E str. JGS19
. . Syntrophus aciditrophicus SB .....................................  196  2 hits [d-proteobacteria]       DNA gyrase subunit A [Syntrophus aciditrophicus SB] >gi|857
. . Bartonella quintana str. Toulouse ................................  196  2 hits [a-proteobacteria]       DNA gyrase subunit A [Bartonella quintana str. Toulouse] >g
. . candidate division TM7 single-cell isolate TM7a ..................  196  2 hits [bacteria]               DNA gyrase subunit A [candidate division TM7 single-cell is
. . Desulfotalea psychrophila LSv54 ..................................  196  2 hits [d-proteobacteria]       DNA gyrase, subunit A [Desulfotalea psychrophila LSv54] >gi
. . Fusobacterium periodonticum ATCC 33693 ...........................  196  2 hits [fusobacteria]           DNA gyrase, A subunit [Fusobacterium periodonticum ATCC 336
. . Clostridium perfringens B str. ATCC 3626 .........................  196  2 hits [firmicutes]             DNA gyrase, A subunit [Clostridium perfringens B str. ATCC 
. . Clostridium perfringens D str. JGS1721 ...........................  196  2 hits [firmicutes]             DNA gyrase, A subunit [Clostridium perfringens D str. JGS17
. . Candidatus Nitrospira defluvii ...................................  196  2 hits [bacteria]               DNA gyrase subunit A [Candidatus Nitrospira defluvii] >gi|3
. . Clostridium difficile QCD-63q42 ..................................  196  1 hit  [firmicutes]             DNA gyrase subunit A [Clostridium difficile QCD-63q42]
. . Collinsella intestinalis DSM 13280 ...............................  196  2 hits [high GC Gram+]          hypothetical protein COLINT_03281 [Collinsella intestinalis
. . Clostridium perfringens NCTC 8239 ................................  196  2 hits [firmicutes]             DNA gyrase, A subunit [Clostridium perfringens NCTC 8239] >
. . Bartonella rochalimae ATCC BAA-1498 ..............................  196  1 hit  [a-proteobacteria]       DNA gyrase subunit A [Bartonella rochalimae ATCC BAA-1498]
. . Veillonella dispar ATCC 17748 ....................................  196  2 hits [firmicutes]             hypothetical protein VEIDISOL_00077 [Veillonella dispar ATC
. . Clostridium difficile 630 ........................................  196  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium difficile 630] >gi|255308
. . Clostridium difficile ATCC 43255 .................................  196  1 hit  [firmicutes]             DNA gyrase subunit A [Clostridium difficile 630] >gi|255308
. . Paenibacillus sp. Y412MC10 .......................................  196  2 hits [firmicutes]             DNA gyrase subunit A [Paenibacillus sp. Y412MC10] >gi|26128
. . Eggerthella lenta DSM 2243 .......................................  196  2 hits [high GC Gram+]          DNA gyrase, A subunit [Eggerthella lenta DSM 2243] >gi|2574
. . Anaerococcus prevotii DSM 20548 ..................................  196  2 hits [firmicutes]             DNA gyrase, A subunit [Anaerococcus prevotii DSM 20548] >gi
. . Clostridium perfringens str. 13 ..................................  196  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium perfringens str. 13] >gi|
. . Staphylococcus xylosus ...........................................  196  1 hit  [firmicutes]             DNA gyrase subunit A [Staphylococcus xylosus]
. . Ruminococcus lactaris ATCC 29176 .................................  196  2 hits [firmicutes]             hypothetical protein RUMLAC_01001 [Ruminococcus lactaris AT
. . NC10 bacterium 'Dutch sediment' ..................................  196  1 hit  [bacteria]               DNA gyrase, subunit A, type II topoisomerase [NC10 bacteriu
. . Clostridium perfringens ATCC 13124 ...............................  196  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium perfringens ATCC 13124] >
. . Clostridium perfringens CPE str. F4969 ...........................  196  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium perfringens ATCC 13124] >
. . Bartonella clarridgeiae 73 .......................................  196  2 hits [a-proteobacteria]       DNA gyrase subunit A [Bartonella clarridgeiae 73] >gi|31940
. . Desulfovibrio sp. ND132 ..........................................  195  1 hit  [d-proteobacteria]       DNA gyrase, A subunit [Desulfovibrio sp. ND132]
. . Ammonifex degensii KC4 ...........................................  195  2 hits [firmicutes]             DNA gyrase, A subunit [Ammonifex degensii KC4] >gi|26086407
. . Desulfovibrio aespoeensis Aspo-2 .................................  195  2 hits [d-proteobacteria]       DNA gyrase subunit A [Desulfovibrio aespoeensis Aspo-2] >gi
. . Moorella thermoacetica ATCC 39073 ................................  195  2 hits [firmicutes]             DNA gyrase, A subunit [Moorella thermoacetica ATCC 39073] >
. . Caldicellulosiruptor owensensis OL ...............................  195  2 hits [firmicutes]             DNA gyrase, a subunit [Caldicellulosiruptor owensensis OL] 
. . Veillonella parvula DSM 2008 .....................................  195  2 hits [firmicutes]             DNA gyrase, A subunit [Veillonella parvula DSM 2008] >gi|26
. . Ilyobacter polytropus DSM 2926 ...................................  195  2 hits [fusobacteria]           DNA gyrase subunit A [Ilyobacter polytropus DSM 2926] >gi|3
. . Halanaerobium praevalens DSM 2228 ................................  195  1 hit  [firmicutes]             DNA gyrase subunit A [Halanaerobium praevalens DSM 2228]
. . Methylobacterium nodulans ORS 2060 ...............................  195  2 hits [a-proteobacteria]       DNA gyrase subunit A [Methylobacterium nodulans ORS 2060] >
. . Veillonella atypica ACS-134-V-Col7a ..............................  195  2 hits [firmicutes]             DNA gyrase, A subunit [Veillonella atypica ACS-134-V-Col7a]
. . Marivirga tractuosa DSM 4126 .....................................  195  2 hits [CFB group bacteria]     DNA gyrase subunit a [Marivirga tractuosa DSM 4126] >gi|312
. . Clostridium difficile QCD-66c26 ..................................  195  1 hit  [firmicutes]             DNA gyrase subunit A [Clostridium difficile QCD-66c26] >gi|
. . Clostridium difficile QCD-37x79 ..................................  195  1 hit  [firmicutes]             DNA gyrase subunit A [Clostridium difficile QCD-66c26] >gi|
. . Clostridium difficile QCD-32g58 ..................................  195  1 hit  [firmicutes]             DNA gyrase subunit A [Clostridium difficile QCD-66c26] >gi|
. . Clostridium difficile CIP 107932 .................................  195  1 hit  [firmicutes]             DNA gyrase subunit A [Clostridium difficile CIP 107932] >gi
. . Clostridium difficile QCD-76w55 ..................................  195  1 hit  [firmicutes]             DNA gyrase subunit A [Clostridium difficile CIP 107932] >gi
. . Clostridium difficile QCD-97b34 ..................................  195  1 hit  [firmicutes]             DNA gyrase subunit A [Clostridium difficile CIP 107932] >gi
. . Clostridium difficile CD196 ......................................  195  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium difficile CIP 107932] >gi
. . Caldicellulosiruptor obsidiansis OB47 ............................  195  2 hits [firmicutes]             DNA gyrase, A subunit [Caldicellulosiruptor obsidiansis OB4
. . Collinsella aerofaciens ATCC 25986 ...............................  195  2 hits [high GC Gram+]          Hypothetical protein COLAER_02250 [Collinsella aerofaciens 
. . Syntrophobacter fumaroxidans MPOB ................................  194  2 hits [d-proteobacteria]       DNA gyrase, A subunit [Syntrophobacter fumaroxidans MPOB] >
. . Bacillus selenitireducens MLS10 ..................................  194  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus selenitireducens MLS10] >gi|
. . Prosthecochloris aestuarii DSM 271 ...............................  194  2 hits [green sulfur bacteria]  DNA gyrase subunit A [Prosthecochloris aestuarii DSM 271] >
. . Erysipelotrichaceae bacterium 3_1_53 .............................  194  2 hits [firmicutes]             DNA gyrase, A subunit [Erysipelotrichaceae bacterium 3_1_53
. . Collinsella stercoris DSM 13279 ..................................  194  2 hits [high GC Gram+]          hypothetical protein COLSTE_02200 [Collinsella stercoris DS
. . Sinorhizobium meliloti 1021 ......................................  194  2 hits [a-proteobacteria]       DNA gyrase subunit A [Sinorhizobium meliloti 1021] >gi|1507
. . Sinorhizobium meliloti BL225C ....................................  194  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Sinorhizobium meliloti BL225C] >gi|3
. . Bartonella sp. 1-1C ..............................................  194  1 hit  [a-proteobacteria]       DNA gyrase subunit A [Bartonella sp. 1-1C]
. . Veillonella sp. 6_1_27 ...........................................  194  2 hits [firmicutes]             DNA gyrase, A subunit [Veillonella sp. 6_1_27] >gi|29445632
. . Veillonella parvula ATCC 17745 ...................................  194  2 hits [firmicutes]             DNA gyrase, A subunit [Veillonella parvula ATCC 17745] >gi|
. . Bartonella bacilliformis KC583 ...................................  194  2 hits [a-proteobacteria]       DNA gyrase subunit A [Bartonella bacilliformis KC583] >gi|1
. . Bartonella bacilliformis .........................................  194  1 hit  [a-proteobacteria]       DNA gyrase subunit A [Bartonella bacilliformis KC583] >gi|1
. . Sinorhizobium meliloti AK83 ......................................  194  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Sinorhizobium meliloti AK83] >gi|306
. . Brachyspira murdochii DSM 12563 ..................................  194  2 hits [spirochetes]            DNA gyrase, A subunit [Brachyspira murdochii DSM 12563] >gi
. . Sinorhizobium medicae WSM419 .....................................  194  2 hits [a-proteobacteria]       DNA gyrase subunit A [Sinorhizobium medicae WSM419] >gi|150
. . Bartonella henselae str. Houston-1 ...............................  194  2 hits [a-proteobacteria]       DNA gyrase subunit A [Bartonella henselae str. Houston-1] >
. . Rubrobacter xylanophilus DSM 9941 ................................  194  2 hits [high GC Gram+]          DNA gyrase subunit A [Rubrobacter xylanophilus DSM 9941] >g
. . Chlorobium phaeobacteroides DSM 266 ..............................  194  2 hits [green sulfur bacteria]  DNA gyrase subunit A [Chlorobium phaeobacteroides DSM 266] 
. . Geobacter uraniireducens Rf4 .....................................  194  2 hits [d-proteobacteria]       DNA gyrase, A subunit [Geobacter uraniireducens Rf4] >gi|14
. . Veillonella sp. 3_1_44 ...........................................  194  2 hits [firmicutes]             DNA gyrase, A subunit [Veillonella sp. 3_1_44] >gi|29445456
. . Caldicellulosiruptor hydrothermalis 108 ..........................  194  2 hits [firmicutes]             DNA gyrase, a subunit [Caldicellulosiruptor hydrothermalis 
. . Desulfurivibrio alkaliphilus AHT2 ................................  194  2 hits [d-proteobacteria]       DNA gyrase, A subunit [Desulfurivibrio alkaliphilus AHT2] >
. . Anaerotruncus colihominis DSM 17241 ..............................  194  2 hits [firmicutes]             hypothetical protein ANACOL_02199 [Anaerotruncus colihomini
. . Veillonella sp. oral taxon 158 str. F0412 ........................  194  2 hits [firmicutes]             DNA gyrase, A subunit [Veillonella sp. oral taxon 158 str. 
. . Listeria grayi DSM 20601 .........................................  194  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) subunit A [Listeria gra
. . Syntrophothermus lipocalidus DSM 12680 ...........................  194  2 hits [firmicutes]             DNA gyrase, A subunit [Syntrophothermus lipocalidus DSM 126
. . Rhizobium etli GR56 ..............................................  194  1 hit  [a-proteobacteria]       DNA gyrase subunit A [Rhizobium etli GR56]
. . Caldicellulosiruptor bescii DSM 6725 .............................  193  2 hits [firmicutes]             DNA gyrase, A subunit [Caldicellulosiruptor bescii DSM 6725
. . Clostridium leptum DSM 753 .......................................  193  2 hits [firmicutes]             hypothetical protein CLOLEP_01250 [Clostridium leptum DSM 7
. . Aminomonas paucivorans DSM 12260 .................................  193  2 hits [bacteria]               DNA gyrase subunit A [Aminomonas paucivorans DSM 12260] >gi
. . Clostridium asparagiforme DSM 15981 ..............................  193  2 hits [firmicutes]             hypothetical protein CLOSTASPAR_00092 [Clostridium asparagi
. . Agrobacterium tumefaciens str. C58 ...............................  193  2 hits [a-proteobacteria]       DNA gyrase subunit A [Agrobacterium tumefaciens str. C58] >
. . Rhizobium etli CIAT 652 ..........................................  193  2 hits [a-proteobacteria]       DNA gyrase protein, A subunit [Rhizobium etli CIAT 652] >gi
. . Agrobacterium vitis S4 ...........................................  193  2 hits [a-proteobacteria]       DNA gyrase subunit A [Agrobacterium vitis S4] >gi|221735736
. . Spirochaeta smaragdinae DSM 11293 ................................  193  2 hits [spirochetes]            DNA gyrase, A subunit [Spirochaeta smaragdinae DSM 11293] >
. . Finegoldia magna ATCC 53516 ......................................  193  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) subunit A [Finegoldia m
. . Veillonella atypica ACS-049-V-Sch6 ...............................  193  2 hits [firmicutes]             DNA gyrase, A subunit [Veillonella atypica ACS-049-V-Sch6] 
. . Caminibacter mediatlanticus TB-2 .................................  193  2 hits [e-proteobacteria]       DNA gyrase subunit A [Caminibacter mediatlanticus TB-2] >gi
. . Caldicellulosiruptor kristjanssonii 177R1B .......................  193  2 hits [firmicutes]             DNA gyrase, a subunit [Caldicellulosiruptor kristjanssonii 
. . Chelativorans sp. BNC1 ...........................................  193  2 hits [a-proteobacteria]       DNA gyrase subunit A [Mesorhizobium sp. BNC1] >gi|110284737
. . Caldicellulosiruptor saccharolyticus DSM 8903 ....................  193  2 hits [firmicutes]             DNA gyrase, A subunit [Caldicellulosiruptor saccharolyticus
. . Caldicellulosiruptor kronotskyensis 2002 .........................  193  2 hits [firmicutes]             DNA gyrase, a subunit [Caldicellulosiruptor kronotskyensis 
. . Sphingobacterium spiritivorum ATCC 33300 .........................  193  2 hits [CFB group bacteria]     DNA topoisomerase [Sphingobacterium spiritivorum ATCC 33300
. . Sphingobacterium spiritivorum ATCC 33861 .........................  193  2 hits [CFB group bacteria]     DNA topoisomerase (ATP-hydrolyzing) subunit A [Sphingobacte
. . Rhizobium etli 8C-3 ..............................................  193  1 hit  [a-proteobacteria]       DNA gyrase subunit A [Rhizobium etli 8C-3]
. . Mariprofundus ferrooxydans PV-1 ..................................  192  2 hits [proteobacteria]         DNA gyrase, A subunit [Mariprofundus ferrooxydans PV-1] >gi
. . Desulfotomaculum nigrificans DSM 574 .............................  192  1 hit  [firmicutes]             DNA gyrase, A subunit [Desulfotomaculum nigrificans DSM 574]
. . Eubacterium saburreum DSM 3986 ...................................  192  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) subunit A [Eubacterium 
. . Rhizobium etli CFN 42 ............................................  192  2 hits [a-proteobacteria]       DNA gyrase subunit A protein [Rhizobium etli CFN 42]
. . Bartonella sp. AR 15-3 ...........................................  192  1 hit  [a-proteobacteria]       DNA gyrase subunit A [Bartonella sp. AR 15-3]
. . Staphylococcus warneri L37603 ....................................  192  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus warneri L37603] >gi|2
. . Campylobacter concisus 13826 .....................................  192  2 hits [e-proteobacteria]       DNA gyrase subunit A [Campylobacter concisus 13826] >gi|112
. . Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 .....  192  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus saprophyticus subsp. s
. . Blautia hydrogenotrophica DSM 10507 ..............................  192  2 hits [firmicutes]             hypothetical protein RUMHYD_03812 [Blautia hydrogenotrophic
. . Rhizobium leguminosarum bv. trifolii WSM1325 .....................  192  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rhizobium leguminosarum bv. trifolii 
. . Eggerthella sp. 1_3_56FAA ........................................  192  2 hits [high GC Gram+]          DNA gyrase, subunit A [Eggerthella sp. 1_3_56FAA] >gi|31691
. . Bartonella schoenbuchensis R1 ....................................  192  1 hit  [a-proteobacteria]       DNA gyrase subunit A [Bartonella schoenbuchensis R1]
. . Bacillus clausii KSM-K16 .........................................  192  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus clausii KSM-K16] >gi|5690802
. . Thermoanaerobacter tengcongensis MB4 .............................  192  2 hits [firmicutes]             DNA gyrase (topoisomerase II) A subunit [Thermoanaerobacter
. . Carboxydibrachium pacificum DSM 12653 ............................  192  2 hits [firmicutes]             DNA gyrase, A subunit [Carboxydibrachium pacificum DSM 1265
. . Clostridium spiroforme DSM 1552 ..................................  192  2 hits [firmicutes]             hypothetical protein CLOSPI_02408 [Clostridium spiroforme D
. . Bacillus thuringiensis serovar israelensis ATCC 35646 ............  192  2 hits [firmicutes]             DNA gyrase subunit A [Bacillus thuringiensis serovar israel
. . Brucella suis ATCC 23445 .........................................  192  2 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella suis ATCC 23445] >gi|1636740
. . Brucella suis 1330 ...............................................  192  2 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella suis 1330] >gi|261755064|ref
. . Brucella suis bv. 3 str. 686 .....................................  192  3 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella suis 1330] >gi|261755064|ref
. . Staphylococcus intermedius .......................................  191  1 hit  [firmicutes]             topoisomerase II subunit A [Staphylococcus intermedius]
. . Aminobacterium colombiense DSM 12261 .............................  191  2 hits [bacteria]               DNA gyrase, A subunit [Aminobacterium colombiense DSM 12261
. . Brucella sp. F5/99 ...............................................  191  3 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella sp. F5/99] >gi|261758289|ref
. . Paenibacillus sp. oral taxon 786 str. D14 ........................  191  2 hits [firmicutes]             DNA gyrase, A subunit [Paenibacillus sp. oral taxon 786 str
. . Brucella canis ATCC 23365 ........................................  191  2 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella canis ATCC 23365] >gi|260566
. . Brucella suis bv. 4 str. 40 ......................................  191  2 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella canis ATCC 23365] >gi|260566
. . Brucella abortus bv. 1 str. 9-941 ................................  191  2 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella abortus bv. 1 str. 9-941] >g
. . Brucella melitensis biovar Abortus 2308 ..........................  191  2 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella abortus bv. 1 str. 9-941] >g
. . Brucella melitensis ATCC 23457 ...................................  191  2 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella abortus bv. 1 str. 9-941] >g
. . Brucella abortus bv. 6 str. 870 ..................................  191  3 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella abortus bv. 1 str. 9-941] >g
. . Brucella ceti M13/05/1 ...........................................  191  3 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella abortus bv. 1 str. 9-941] >g
. . Brucella melitensis bv. 2 str. 63/9 ..............................  191  2 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella abortus bv. 1 str. 9-941] >g
. . Brucella abortus NCTC 8038 .......................................  191  2 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella abortus bv. 1 str. 9-941] >g
. . Brucella abortus bv. 4 str. 292 ..................................  191  3 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella abortus bv. 1 str. 9-941] >g
. . Brucella abortus bv. 2 str. 86/8/59 ..............................  191  3 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella abortus bv. 1 str. 9-941] >g
. . Brucella pinnipedialis M163/99/10 ................................  191  3 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella abortus bv. 1 str. 9-941] >g
. . Brucella pinnipedialis B2/94 .....................................  191  3 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella abortus bv. 1 str. 9-941] >g
. . Brucella ceti M644/93/1 ..........................................  191  3 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella abortus bv. 1 str. 9-941] >g
. . Brucella pinnipedialis M292/94/1 .................................  191  3 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella abortus bv. 1 str. 9-941] >g
. . Brucella melitensis bv. 3 str. Ether .............................  191  3 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella abortus bv. 1 str. 9-941] >g
. . Brucella ceti M490/95/1 ..........................................  191  3 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella abortus bv. 1 str. 9-941] >g
. . Brucella sp. NVSL 07-0026 ........................................  191  2 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella abortus bv. 1 str. 9-941] >g
. . Clostridium bartlettii DSM 16795 .................................  191  2 hits [firmicutes]             hypothetical protein CLOBAR_00006 [Clostridium bartlettii D
. . Brucella melitensis bv. 1 str. Rev.1 .............................  191  3 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella melitensis bv. 1 str. Rev.1]
. . Brucella sp. 83/13 ...............................................  191  3 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella sp. 83/13] >gi|306838155|ref
. . Brucella sp. NF 2653 .............................................  191  2 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella sp. 83/13] >gi|306838155|ref
. . Clostridium saccharolyticum WM1 ..................................  191  2 hits [firmicutes]             DNA gyrase, A subunit [Clostridium saccharolyticum WM1] >gi
. . Brucella ceti B1/94 ..............................................  191  3 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella ceti B1/94]
. . Brucella suis bv. 5 str. 513 .....................................  191  3 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella suis bv. 5 str. 513] >gi|261
. . Brucella abortus S19 .............................................  191  2 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella abortus S19] >gi|237815520|r
. . Brucella abortus str. 2308 A .....................................  191  2 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella abortus S19] >gi|237815520|r
. . Brucella sp. BO2 .................................................  191  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Brucella sp. BO2] >gi|306288106|gb|E
. . Pelobacter carbinolicus DSM 2380 .................................  191  2 hits [d-proteobacteria]       DNA gyrase, A subunit [Pelobacter carbinolicus DSM 2380] >g
. . Brucella melitensis bv. 1 str. 16M ...............................  191  4 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella melitensis bv. 1 str. 16M] >
. . Brucella ceti str. Cudo ..........................................  191  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Brucella ceti str. Cudo] >gi|2256175





. . Brucella abortus bv. 3 str. Tulya ................................  191  3 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella abortus bv. 3 str. Tulya] >g
. . Brucella abortus bv. 9 str. C68 ..................................  191  3 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella abortus bv. 9 str. C68] >gi|
. . Brucella abortus bv. 5 str. B3196 ................................  191  2 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella abortus bv. 9 str. C68] >gi|
. . Brucella microti CCM 4915 ........................................  191  2 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella microti CCM 4915] >gi|255999
. . Desulfovibrio piger ATCC 29098 ...................................  191  2 hits [d-proteobacteria]       hypothetical protein DESPIG_01805 [Desulfovibrio piger ATCC
. . Brachyspira pilosicoli 95/1000 ...................................  191  2 hits [spirochetes]            DNA gyrase subunit A [Brachyspira pilosicoli 95/1000] >gi|3
. . Thermanaerovibrio acidaminovorans DSM 6589 .......................  191  2 hits [bacteria]               DNA gyrase, A subunit [Thermanaerovibrio acidaminovorans DS
. . Chlorobium chlorochromatii CaD3 ..................................  191  2 hits [green sulfur bacteria]  DNA gyrase, subunit A [Chlorobium chlorochromatii CaD3] >gi
. . Hoeflea phototrophica DFL-43 .....................................  191  2 hits [a-proteobacteria]       DNA gyrase subunit A [Hoeflea phototrophica DFL-43] >gi|162
. . Haliangium ochraceum DSM 14365 ...................................  191  2 hits [d-proteobacteria]       DNA gyrase, A subunit [Haliangium ochraceum DSM 14365] >gi|
. . Kordia algicida OT-1 .............................................  191  2 hits [CFB group bacteria]     DNA topoisomerase, ATP-hydrolyzing (DNA gyrase) (DNA topois
. . Candidatus Liberibacter solanacearum CLso-ZC1 ....................  191  2 hits [a-proteobacteria]       DNA gyrase subunit A [Candidatus Liberibacter solanacearum 
. . Rhodopseudomonas palustris DX-1 ..................................  191  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rhodopseudomonas palustris DX-1] >gi|
. . Rhodothermus marinus DSM 4252 ....................................  191  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Rhodothermus marinus DSM 4252] >gi|2
. . Ruminococcus obeum ATCC 29174 ....................................  191  2 hits [firmicutes]             hypothetical protein RUMOBE_02418 [Ruminococcus obeum ATCC 
. . Ruminococcus obeum A2-162 ........................................  191  1 hit  [firmicutes]             DNA gyrase subunit A [Ruminococcus obeum A2-162]
. . Parvularcula bermudensis HTCC2503 ................................  191  2 hits [a-proteobacteria]       DNA gyrase subunit A [Parvularcula bermudensis HTCC2503] >g
. . Brucella neotomae 5K33 ...........................................  191  3 hits [a-proteobacteria]       conserved hypothetical protein [Brucella neotomae 5K33] >gi
. . Geobacter bemidjiensis Bem .......................................  191  2 hits [d-proteobacteria]       DNA gyrase subunit A [Geobacter bemidjiensis Bem] >gi|19708
. . Ruminococcus bromii L2-63 ........................................  191  1 hit  [firmicutes]             DNA gyrase subunit A [Ruminococcus bromii L2-63]
. . Gemella haemolysans ATCC 10379 ...................................  191  2 hits [firmicutes]             DNA gyrase, A subunit [Gemella haemolysans ATCC 10379] >gi|
. . Desulfovibrio desulfuricans subsp. desulfuricans str. G20 ........  191  2 hits [d-proteobacteria]       DNA gyrase subunit A [Desulfovibrio desulfuricans subsp. de
. . Marvinbryantia formatexigens DSM 14469 ...........................  191  2 hits [firmicutes]             DNA gyrase, A subunit [Bryantella formatexigens DSM 14469] 
. . Geobacter sp. M21 ................................................  191  2 hits [d-proteobacteria]       DNA gyrase, A subunit [Geobacter sp. M21] >gi|251773511|gb|
. . Desulfobacterium autotrophicum HRM2 ..............................  191  2 hits [d-proteobacteria]       GyrA [Desulfobacterium autotrophicum HRM2] >gi|223693435|gb
. . Staphylococcus pseudintermedius ..................................  191  2 hits [firmicutes]             topoisomerase II subunit A [Staphylococcus pseudintermedius]
. . Finegoldia magna ACS-171-V-Col3 ..................................  191  2 hits [firmicutes]             DNA gyrase, A subunit [Finegoldia magna ACS-171-V-Col3] >gi
. . Corynebacterium urealyticum ......................................  191  1 hit  [high GC Gram+]          topoisomerase II subunit A [Corynebacterium urealyticum]
. . Staphylococcus pseudintermedius ED99 .............................  191  1 hit  [firmicutes]             DNA gyrase, A subunit [Staphylococcus pseudintermedius ED99]
. . Rhodopseudomonas palustris BisA53 ................................  191  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rhodopseudomonas palustris BisA53] >g
. . Staphylococcus pseudintermedius HKU10-03 .........................  191  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus pseudintermedius HKU10
. . Macrococcus caseolyticus JCSC5402 ................................  191  2 hits [firmicutes]             DNA gyrase subunit A [Macrococcus caseolyticus JCSC5402] >g
. . Paenibacillus sp. JDR-2 ..........................................  190  2 hits [firmicutes]             DNA gyrase, A subunit [Paenibacillus sp. JDR-2] >gi|2475416
. . Staphylococcus aureus subsp. aureus COL ..........................  190  3 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus subsp. aureus USA300_TCH1516 ...............  190  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus A5948 ......................................  190  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus subsp. aureus CGS01 ........................  190  1 hit  [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus subsp. aureus MRSA131 ......................  190  1 hit  [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus subsp. aureus MRSA177 ......................  190  1 hit  [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Desulfonatronospira thiodismutans ASO3-1 .........................  190  2 hits [d-proteobacteria]       DNA gyrase, A subunit [Desulfonatronospira thiodismutans AS
. . Bacillus pumilus ATCC 7061 .......................................  190  2 hits [firmicutes]             DNA gyrase, A subunit [Bacillus pumilus ATCC 7061] >gi|1940
. . Finegoldia magna BVS033A4 ........................................  190  2 hits [firmicutes]             DNA gyrase, A subunit [Finegoldia magna BVS033A4] >gi|30249
. . Dehalococcoides ethenogenes 195 ..................................  190  2 hits [GNS bacteria]           DNA gyrase, A subunit [Dehalococcoides ethenogenes 195] >gi
. . Staphylococcus aureus subsp. aureus USA300_FPR3757 ...............  190  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus A9765 ......................................  190  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus subsp. aureus 132 ..........................  190  1 hit  [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus A9754 ......................................  190  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus subsp. aureus USA300 .......................  190  1 hit  [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus subsp. aureus str. Newman ..................  190  2 hits [firmicutes]             DNA gyrase A subunit [Staphylococcus aureus subsp. aureus s
. . Staphylococcus aureus subsp. aureus M809 .........................  190  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Fusobacterium sp. 1_1_41FAA ......................................  190  2 hits [fusobacteria]           DNA gyrase, A subunit [Fusobacterium sp. 1_1_41FAA] >gi|294
. . Chloroherpeton thalassium ATCC 35110 .............................  190  2 hits [green sulfur bacteria]  DNA gyrase subunit A [Chloroherpeton thalassium ATCC 35110]
. . Finegoldia magna ATCC 29328 ......................................  190  2 hits [firmicutes]             DNA gyrase A subunit [Finegoldia magna ATCC 29328] >gi|1678
. . Staphylococcus aureus subsp. aureus 55/2053 ......................  190  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus 5
. . Staphylococcus aureus subsp. aureus 65-1322 ......................  190  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus 5
. . Staphylococcus aureus subsp. aureus 68-397 .......................  190  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus 5
. . Staphylococcus aureus subsp. aureus E1410 ........................  190  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus 5
. . Staphylococcus aureus subsp. aureus M876 .........................  190  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus 5
. . Staphylococcus aureus subsp. aureus Btn1260 ......................  190  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus 5
. . Staphylococcus aureus subsp. aureus WW2703/97 ....................  190  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus 5
. . Staphylococcus aureus subsp. aureus WBG10049 .....................  190  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus 5
. . Staphylococcus aureus subsp. aureus M899 .........................  190  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus 5
. . Staphylococcus aureus subsp. aureus C101 .........................  190  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus 5
. . Staphylococcus aureus subsp. aureus A017934/97 ...................  190  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus 5
. . Staphylococcus aureus subsp. aureus 58-424 .......................  190  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus 5
. . Staphylococcus aureus subsp. aureus M1015 ........................  190  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus 5
. . Staphylococcus aureus subsp. aureus MN8 ..........................  190  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus 5
. . Staphylococcus aureus subsp. aureus TCH60 ........................  190  1 hit  [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus 5
. . Staphylococcus aureus subsp. aureus CGS00 ........................  190  1 hit  [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus 5
. . Rhizobium leguminosarum bv. viciae 3841 ..........................  190  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rhizobium leguminosarum bv. viciae 38
. . Rhizobium leguminosarum bv. trifolii WSM2304 .....................  190  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rhizobium leguminosarum bv. trifolii 
. . Staphylococcus aureus A9635 ......................................  190  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus A9635] >gi|2578
. . Staphylococcus aureus subsp. aureus ATCC BAA-39 ..................  190  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) subunit A [Staphylococc
. . Fusobacterium sp. 3_1_5R .........................................  190  3 hits [fusobacteria]           DNA gyrase subunit A [Fusobacterium sp. 3_1_5R] >gi|3170595
. . Clostridium sp. HGF2 .............................................  190  2 hits [firmicutes]             DNA gyrase, A subunit [Clostridium sp. HGF2] >gi|312954409|
. . Staphylococcus aureus subsp. aureus EMRSA16 ......................  190  2 hits [firmicutes]             hypothetical protein SIAG_01513 [Staphylococcus aureus subs
. . Staphylococcus aureus subsp. aureus MRSA252 ......................  190  3 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus M
. . Staphylococcus aureus subsp. aureus str. JKD6009 .................  190  1 hit  [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus M
. . Staphylococcus aureus subsp. aureus TW20 .........................  190  1 hit  [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus M
. . Staphylococcus aureus subsp. aureus str. JKD6008 .................  190  1 hit  [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus M
. . Peptoniphilus harei ACS-146-V-Sch2b ..............................  190  2 hits [firmicutes]             DNA gyrase, A subunit [Peptoniphilus harei ACS-146-V-Sch2b]
. . Clostridium sp. M62/1 ............................................  190  2 hits [firmicutes]             DNA gyrase, A subunit [Clostridium sp. M62/1] >gi|291075138
. . Methylobacterium sp. 4-46 ........................................  190  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Methylobacterium sp. 4-46] >gi|16819
. . Paenibacillus polymyxa E681 ......................................  190  2 hits [firmicutes]             DNA gyrase subunit A [Paenibacillus polymyxa E681] >gi|3058
. . Clostridium methylpentosum DSM 5476 ..............................  190  2 hits [firmicutes]             hypothetical protein CLOSTMETH_00663 [Clostridium methylpen
. . Candidatus Liberibacter asiaticus str. psy62 .....................  190  2 hits [a-proteobacteria]       DNA gyrase subunit A [Candidatus Liberibacter asiaticus str
. . Xanthobacter autotrophicus Py2 ...................................  190  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Xanthobacter autotrophicus Py2] >gi|
. . Listeria monocytogenes HCC23 .....................................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Listeria monocytogenes HCC23] >gi|25
. . Listeria monocytogenes FSL J1-208 ................................  189  1 hit  [firmicutes]             DNA gyrase, A subunit [Listeria monocytogenes HCC23] >gi|25
. . Listeria monocytogenes FSL J2-071 ................................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Listeria monocytogenes HCC23] >gi|25
. . Listeria monocytogenes L99 .......................................  189  1 hit  [firmicutes]             DNA gyrase, A subunit [Listeria monocytogenes HCC23] >gi|25
. . Eubacterium cellulosolvens 6 .....................................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Eubacterium cellulosolvens 6] >gi|31
. . Listeria innocua Clip11262 .......................................  189  2 hits [firmicutes]             DNA gyrase subunit A [Listeria innocua Clip11262] >gi|16412
. . Staphylococcus caprae C87 ........................................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus caprae C87] >gi|31365
. . Candidatus Chloracidobacterium thermophilum ......................  189  1 hit  [bacteria]               DNA gyrase A subunit [Candidatus Chloracidobacterium thermo
. . Listeria monocytogenes FSL J2-064 ................................  189  1 hit  [firmicutes]             DNA gyrase subunit A [Listeria monocytogenes FSL J2-064]
. . Listeria monocytogenes serotype 4b str. F2365 ....................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Listeria monocytogenes str. 4b F2365
. . Listeria monocytogenes serotype 4b str. H7858 ....................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Listeria monocytogenes str. 4b F2365
. . Listeria monocytogenes serotype 4b str. CLIP 80459 ...............  189  2 hits [firmicutes]             DNA gyrase, A subunit [Listeria monocytogenes str. 4b F2365
. . Listeria monocytogenes FSL J1-194 ................................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Listeria monocytogenes str. 4b F2365
. . Listeria monocytogenes FSL R2-503 ................................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Listeria monocytogenes str. 4b F2365
. . Listeria monocytogenes HPB2262 ...................................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Listeria monocytogenes str. 4b F2365
. . Listeria monocytogenes FSL N1-017 ................................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Listeria monocytogenes str. 4b F2365
. . butyrate-producing bacterium SS3/4 ...............................  189  1 hit  [firmicutes]             DNA gyrase subunit A [butyrate-producing bacterium SS3/4]
. . Parabacteroides johnsonii DSM 18315 ..............................  189  2 hits [CFB group bacteria]     hypothetical protein PRABACTJOHN_01389 [Parabacteroides joh
. . Rhodopseudomonas palustris BisB18 ................................  189  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rhodopseudomonas palustris BisB18] >g
. . Staphylococcus capitis SK14 ......................................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus capitis SK14] >gi|222
. . Staphylococcus aureus subsp. aureus C160 .........................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus subsp. aureus D139 .........................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus subsp. aureus C427 .........................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus subsp. aureus H19 ..........................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus subsp. aureus ED133 ........................  189  1 hit  [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus O11 ........................................  189  1 hit  [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus O11] >gi|323443
. . Staphylococcus aureus O46 ........................................  189  1 hit  [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus O11] >gi|323443
. . Streptomyces ghanaensis ATCC 14672 ...............................  189  3 hits [high GC Gram+]          DNA gyrase subunit A [Streptomyces ghanaensis ATCC 14672] >
. . Anaerococcus hydrogenalis DSM 7454 ...............................  189  2 hits [firmicutes]             hypothetical protein ANHYDRO_01953 [Anaerococcus hydrogenal
. . Roseibium sp. TrichSKD4 ..........................................  189  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Roseibium sp. TrichSKD4] >gi|3077707
. . Geobacter sp. M18 ................................................  189  2 hits [d-proteobacteria]       DNA gyrase subunit A [Geobacter sp. M18] >gi|320123937|gb|A
. . Fusobacterium gonidiaformans ATCC 25563 ..........................  189  3 hits [fusobacteria]           DNA gyrase subunit A [Fusobacterium gonidiaformans ATCC 255
. . Dehalococcoides sp. VS ...........................................  189  2 hits [GNS bacteria]           DNA gyrase, A subunit [Dehalococcoides sp. VS] >gi|27015477
. . Brucella ovis ATCC 25840 .........................................  189  2 hits [a-proteobacteria]       DNA gyrase subunit A [Brucella ovis ATCC 25840] >gi|1483718
. . Staphylococcus aureus subsp. aureus USA300_TCH959 ................  189  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus U
. . Bradyrhizobium sp. BTAi1 .........................................  189  2 hits [a-proteobacteria]       DNA gyrase subunit A [Bradyrhizobium sp. BTAi1] >gi|1464079
. . Peptostreptococcus stomatis DSM 17678 ............................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Peptostreptococcus stomatis DSM 1767
. . Mitsuokella multacida DSM 20544 ..................................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Mitsuokella multacida DSM 20544] >gi
. . Anaerofustis stercorihominis DSM 17244 ...........................  189  2 hits [firmicutes]             hypothetical protein ANASTE_01999 [Anaerofustis stercorihom
. . Rhodopseudomonas palustris HaA2 ..................................  189  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rhodopseudomonas palustris HaA2] >gi|
. . Staphylococcus aureus ............................................  189  8 hits [firmicutes]             RecName: Full=DNA gyrase subunit A
. . Staphylococcus aureus subsp. aureus ST398 ........................  189  1 hit  [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Shuttleworthia satelles DSM 14600 ................................  189  2 hits [firmicutes]             hypothetical protein GCWU000342_01615 [Shuttleworthia satel
. . Ruminococcus sp. SR1/5 ...........................................  189  1 hit  [firmicutes]             DNA gyrase subunit A [Ruminococcus sp. SR1/5]
. . Staphylococcus epidermidis M23864:W1 .............................  189  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus epidermidis M23864:W1]
. . Clostridium phytofermentans ISDg .................................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Clostridium phytofermentans ISDg] >g
. . Chlorobium tepidum TLS ...........................................  189  2 hits [green sulfur bacteria]  DNA gyrase subunit A [Chlorobium tepidum TLS] >gi|21646043|
. . Listeria welshimeri serovar 6b str. SLCC5334 .....................  189  2 hits [firmicutes]             DNA gyrase subunit A [Listeria welshimeri serovar 6b str. S
. . Arcobacter butzleri ..............................................  189 11 hits [e-proteobacteria]       DNA gyrase subunit A [Arcobacter butzleri]
. . Staphylococcus aureus subsp. aureus TCH130 .......................  189  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus T
. . Staphylococcus carnosus subsp. carnosus TM300 ....................  189  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus carnosus subsp. carnos
. . Listeria seeligeri FSL S4-171 ....................................  189  1 hit  [firmicutes]             DNA gyrase, A subunit [Listeria seeligeri FSL S4-171]
. . uncultured Desulfobacterium sp. ..................................  189  1 hit  [d-proteobacteria]       DNA gyrase subunit A [uncultured Desulfobacterium sp.]
. . Listeria seeligeri serovar 1/2b str. SLCC3954 ....................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Listeria seeligeri serovar 1/2b str.
. . Staphylococcus aureus subsp. aureus JH9 ..........................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus subsp. aureus JH1 ..........................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus subsp. aureus str. CF-Marseille ............  189  1 hit  [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus A9781 ......................................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus A9763 ......................................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus A9719 ......................................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus A6300 ......................................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus A6224 ......................................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus A5937 ......................................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus A10102 .....................................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus A8796 ......................................  189  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus 04-02981 ...................................  189  1 hit  [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus subsp. aureus ECT-R 2 ......................  189  1 hit  [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Staphylococcus aureus subsp. aureus CGS03 ........................  189  1 hit  [firmicutes]             DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 
. . Listeria monocytogenes EGD-e .....................................  189  2 hits [firmicutes]             DNA gyrase subunit A [Listeria monocytogenes EGD-e] >gi|470
. . Listeria monocytogenes serotype 1/2a str. F6854 ..................  189  2 hits [firmicutes]             DNA gyrase subunit A [Listeria monocytogenes EGD-e] >gi|470
. . Listeria monocytogenes Finland 1988 ..............................  189  1 hit  [firmicutes]             DNA gyrase subunit A [Listeria monocytogenes EGD-e] >gi|470
. . Listeria monocytogenes FSL R2-561 ................................  189  1 hit  [firmicutes]             DNA gyrase subunit A [Listeria monocytogenes EGD-e] >gi|470
. . Listeria monocytogenes FSL N3-165 ................................  189  2 hits [firmicutes]             DNA gyrase subunit A [Listeria monocytogenes EGD-e] >gi|470
. . Listeria monocytogenes 10403S ....................................  189  1 hit  [firmicutes]             DNA gyrase subunit A [Listeria monocytogenes EGD-e] >gi|470
. . Listeria monocytogenes J0161 .....................................  189  1 hit  [firmicutes]             DNA gyrase subunit A [Listeria monocytogenes EGD-e] >gi|470
. . Listeria monocytogenes J2818 .....................................  189  2 hits [firmicutes]             DNA gyrase subunit A [Listeria monocytogenes EGD-e] >gi|470
. . Listeria monocytogenes F6900 .....................................  189  2 hits [firmicutes]             DNA gyrase subunit A [Listeria monocytogenes EGD-e] >gi|470
. . Listeria monocytogenes FSL J2-003 ................................  189  1 hit  [firmicutes]             DNA gyrase subunit A [Listeria monocytogenes EGD-e] >gi|470
. . Listeria monocytogenes 08-5578 ...................................  189  2 hits [firmicutes]             DNA gyrase subunit A [Listeria monocytogenes EGD-e] >gi|470
. . Listeria monocytogenes 08-5923 ...................................  189  2 hits [firmicutes]             DNA gyrase subunit A [Listeria monocytogenes EGD-e] >gi|470
. . Listeria monocytogenes ...........................................  189  1 hit  [firmicutes]             DNA gyrase subunit A [Listeria monocytogenes EGD-e] >gi|470
. . Staphylococcus aureus subsp. aureus JKD6159 ......................  189  1 hit  [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) subunit A, GyrA [Staphy
. . Staphylococcus aureus subsp. aureus MW2 ..........................  189  3 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus M
. . Staphylococcus aureus subsp. aureus MSSA476 ......................  189  3 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus M
. . Staphylococcus aureus subsp. aureus NCTC 8325 ....................  189  3 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus M
. . Staphylococcus aureus subsp. aureus ATCC 51811 ...................  189  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus M
. . Staphylococcus aureus subsp. aureus TCH70 ........................  189  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus M
. . Roseomonas cervicalis ATCC 49957 .................................  189  2 hits [a-proteobacteria]       DNA topoisomerase (ATP-hydrolyzing) subunit A [Roseomonas c
. . Rickettsia bellii OSU 85-389 .....................................  189  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rickettsia bellii OSU 85-389] >gi|157
. . Listeria seeligeri FSL N1-067 ....................................  189  1 hit  [firmicutes]             DNA gyrase, A subunit [Listeria seeligeri FSL N1-067]
. . Rickettsia bellii RML369-C .......................................  189  3 hits [a-proteobacteria]       DNA gyrase subunit A [Rickettsia bellii RML369-C] >gi|12308
. . Gluconobacter oxydans 621H .......................................  189  2 hits [a-proteobacteria]       DNA gyrase subunit A [Gluconobacter oxydans 621H]
. . Rickettsia typhi str. Wilmington .................................  189  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rickettsia typhi str. Wilmington] >gi
. . Rickettsia typhi .................................................  189  1 hit  [a-proteobacteria]       DNA gyrase subunit A [Rickettsia typhi str. Wilmington] >gi
. . Staphylococcus aureus subsp. aureus N315 .........................  189 11 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus N
. . Staphylococcus aureus A9299 ......................................  189  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus N
. . Staphylococcus aureus A8115 ......................................  189  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus N
. . Staphylococcus aureus subsp. aureus ED98 .........................  189  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus N
. . Staphylococcus aureus A8117 ......................................  189  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus N
. . Staphylococcus aureus subsp. aureus MR1 ..........................  189  1 hit  [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus N
. . Staphylococcus aureus A8819 ......................................  189  2 hits [firmicutes]             hypothetical protein SMAG_02043 [Staphylococcus aureus A881
. . Staphylococcus epidermidis W23144 ................................  188  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus epidermidis W23144] >g
. . Staphylococcus epidermidis FRI909 ................................  188  1 hit  [firmicutes]             DNA gyrase, A subunit [Staphylococcus epidermidis FRI909]
. . Clostridium lentocellum DSM 5427 .................................  188  2 hits [firmicutes]             DNA gyrase, A subunit [Clostridium lentocellum DSM 5427] >g
. . Staphylococcus epidermidis ATCC 12228 ............................  188  3 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus epidermidis ATCC 12228
. . Staphylococcus epidermidis BCM-HMP0060 ...........................  188  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus epidermidis ATCC 12228
. . Staphylococcus epidermidis SK135 .................................  188  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus epidermidis ATCC 12228
. . Staphylococcus epidermidis M23864:W2(grey) .......................  188  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus epidermidis ATCC 12228
. . Campylobacter lari RM2100 ........................................  188  2 hits [e-proteobacteria]       DNA gyrase, subunit A [Campylobacter lari RM2100] >gi|22253
. . Arcobacter butzleri JV22 .........................................  188  2 hits [e-proteobacteria]       DNA topoisomerase (ATP-hydrolyzing) subunit A [Arcobacter b
. . Staphylococcus aureus subsp. aureus Mu50 .........................  188  3 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus M
. . Staphylococcus aureus subsp. aureus Mu3 ..........................  188  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus M
. . Staphylococcus aureus subsp. aureus Mu50-omega ...................  188  1 hit  [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus subsp. aureus M
. . Erysipelothrix rhusiopathiae ATCC 19414 ..........................  188  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) subunit A [Erysipelothr
. . Conexibacter woesei DSM 14684 ....................................  188  2 hits [high GC Gram+]          DNA gyrase, A subunit [Conexibacter woesei DSM 14684] >gi|2
. . Arcobacter cryaerophilus .........................................  188  1 hit  [e-proteobacteria]       DNA gyrase subunit A [Arcobacter cryaerophilus]
. . Arcobacter butzleri RM4018 .......................................  188  2 hits [e-proteobacteria]       DNA gyrase subunit A [Arcobacter butzleri RM4018] >gi|11857
. . Leptotrichia goodfellowii F0264 ..................................  188  2 hits [fusobacteria]           DNA gyrase, A subunit [Leptotrichia goodfellowii F0264] >gi
. . Listeria monocytogenes FSL J1-175 ................................  188  1 hit  [firmicutes]             DNA gyrase subunit A [Listeria monocytogenes FSL J1-175]
. . Clostridium cf. saccharolyticum K10 ..............................  188  1 hit  [firmicutes]             DNA gyrase subunit A [Clostridium cf. saccharolyticum K10]
. . Dictyoglomus thermophilum H-6-12 .................................  188  2 hits [bacteria]               DNA gyrase, A subunit [Dictyoglomus thermophilum H-6-12] >g
. . Rickettsia rickettsii str. 'Sheila Smith' ........................  188  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rickettsia rickettsii str. 'Sheila Sm
. . Rickettsia rickettsii str. Iowa ..................................  188  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rickettsia rickettsii str. 'Sheila Sm
. . Desulfuromonas acetoxidans DSM 684 ...............................  188  2 hits [d-proteobacteria]       DNA gyrase, A subunit [Desulfuromonas acetoxidans DSM 684] 
. . Azorhizobium caulinodans ORS 571 .................................  188  2 hits [a-proteobacteria]       DNA gyrase subunit A [Azorhizobium caulinodans ORS 571] >gi
. . Phenylobacterium zucineum HLK1 ...................................  188  2 hits [a-proteobacteria]       DNA gyrase subunit A [Phenylobacterium zucineum HLK1] >gi|1
. . Dictyoglomus turgidum DSM 6724 ...................................  187  2 hits [bacteria]               DNA gyrase, A subunit [Dictyoglomus turgidum DSM 6724] >gi|
. . Chlorobium phaeobacteroides BS1 ..................................  187  2 hits [green sulfur bacteria]  DNA gyrase, A subunit [Chlorobium phaeobacteroides BS1] >gi
. . Streptomyces viridochromogenes DSM 40736 .........................  187  2 hits [high GC Gram+]          LOW QUALITY PROTEIN: DNA gyrase, A subunit [Streptomyces vi
. . Desulfovibrio vulgaris str. 'Miyazaki F' .........................  187  2 hits [d-proteobacteria]       DNA gyrase, A subunit [Desulfovibrio vulgaris str. 'Miyazak
. . Solobacterium moorei F0204 .......................................  187  2 hits [firmicutes]             DNA gyrase, A subunit [Solobacterium moorei F0204] >gi|3201
. . Pelodictyon phaeoclathratiforme BU-1 .............................  187  2 hits [green sulfur bacteria]  DNA gyrase, A subunit [Pelodictyon phaeoclathratiforme BU-1
. . Staphylococcus aureus RF122 ......................................  187  2 hits [firmicutes]             DNA gyrase subunit A [Staphylococcus aureus RF122] >gi|8265
. . Clostridium ramosum DSM 1402 .....................................  187  2 hits [firmicutes]             hypothetical protein CLORAM_00665 [Clostridium ramosum DSM 
. . Coprobacillus sp. D7 .............................................  187  2 hits [firmicutes]             hypothetical protein CLORAM_00665 [Clostridium ramosum DSM 
. . Ruminococcus albus 7 .............................................  187  2 hits [firmicutes]             DNA gyrase subunit A [Ruminococcus albus 7] >gi|315447011|g
. . Campylobacter curvus 525.92 ......................................  187  2 hits [e-proteobacteria]       DNA gyrase subunit A [Campylobacter curvus 525.92] >gi|1128
. . Desulfotomaculum reducens MI-1 ...................................  187  2 hits [firmicutes]             DNA gyrase, A subunit [Desulfotomaculum reducens MI-1] >gi|
. . Arcobacter skirrowii .............................................  187  1 hit  [e-proteobacteria]       DNA gyrase subunit A [Arcobacter skirrowii]
. . Brucella sp. BO1 .................................................  187  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Brucella sp. BO1] >gi|306275720|gb|E
. . Ochrobactrum intermedium LMG 3301 ................................  187  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Ochrobactrum intermedium LMG 3301] >
. . Asticcacaulis excentricus CB 48 ..................................  187  2 hits [a-proteobacteria]       DNA gyrase, a subunit [Asticcacaulis excentricus CB 48] >gi
. . Chlorobium ferrooxidans DSM 13031 ................................  187  2 hits [green sulfur bacteria]  DNA gyrase, A subunit [Chlorobium ferrooxidans DSM 13031] >
. . Labrenzia alexandrii DFL-11 ......................................  187  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Labrenzia alexandrii DFL-11] >gi|222
. . Dehalococcoides sp. CBDB1 ........................................  187  2 hits [GNS bacteria]           DNA gyrase, A subunit [Dehalococcoides sp. CBDB1] >gi|14767
. . Dehalococcoides sp. BAV1 .........................................  187  2 hits [GNS bacteria]           DNA gyrase, A subunit [Dehalococcoides sp. CBDB1] >gi|14767
. . Dehalococcoides sp. GT ...........................................  187  2 hits [GNS bacteria]           DNA gyrase, A subunit [Dehalococcoides sp. CBDB1] >gi|14767
. . Caulobacter crescentus CB15 ......................................  187  2 hits [a-proteobacteria]       DNA gyrase subunit A [Caulobacter crescentus CB15] >gi|2212
. . Caulobacter crescentus NA1000 ....................................  187  2 hits [a-proteobacteria]       DNA gyrase subunit A [Caulobacter crescentus CB15] >gi|2212
. . Nitratifractor salsuginis DSM 16511 ..............................  187  2 hits [e-proteobacteria]       DNA gyrase subunit a [Nitratifractor salsuginis DSM 16511] 
. . Campylobacter showae RM3277 ......................................  187  2 hits [e-proteobacteria]       DNA gyrase, A subunit [Campylobacter showae RM3277] >gi|255
. . Paenibacillus polymyxa SC2 .......................................  187  2 hits [firmicutes]             DNA gyrase, a subunit [Paenibacillus polymyxa SC2] >gi|3092
. . Streptomyces sp. e14 .............................................  187  2 hits [high GC Gram+]          LOW QUALITY PROTEIN: DNA gyrase, A subunit [Streptomyces sp
. . Arcobacter cibarius ..............................................  187  1 hit  [e-proteobacteria]       DNA gyrase subunit A [Arcobacter cibarius]
. . Campylobacter hominis ATCC BAA-381 ...............................  186  2 hits [e-proteobacteria]       DNA gyrase subunit A [Campylobacter hominis ATCC BAA-381] >
. . Campylobacter rectus RM3267 ......................................  186  2 hits [e-proteobacteria]       DNA gyrase, A subunit [Campylobacter rectus RM3267] >gi|222
. . Ochrobactrum anthropi ATCC 49188 .................................  186  2 hits [a-proteobacteria]       DNA gyrase subunit A [Ochrobactrum anthropi ATCC 49188] >gi
. . Rickettsia peacockii str. Rustic .................................  186  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rickettsia peacockii str. Rustic] >gi
. . Flavobacteria bacterium BAL38 ....................................  186  2 hits [CFB group bacteria]     DNA gyrase A subunit [Flavobacteria bacterium BAL38] >gi|12
. . Bradyrhizobium sp. ORS278 ........................................  186  2 hits [a-proteobacteria]       DNA gyrase subunit A [Bradyrhizobium sp. ORS278] >gi|146193
. . Rhodopseudomonas palustris BisB5 .................................  186  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rhodopseudomonas palustris BisB5] >gi
. . Chlorobium limicola DSM 245 ......................................  186  2 hits [green sulfur bacteria]  DNA gyrase, A subunit [Chlorobium limicola DSM 245] >gi|189
. . Caulobacter segnis ATCC 21756 ....................................  186  2 hits [a-proteobacteria]       DNA gyrase, subunit A [Caulobacter segnis ATCC 21756] >gi|2
. . Rickettsia africae ESF-5 .........................................  186  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rickettsia africae ESF-5] >gi|2280214
. . Rhodopseudomonas palustris CGA009 ................................  186  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rhodopseudomonas palustris CGA009]
. . Anaerococcus vaginalis ATCC 51170 ................................  186  2 hits [firmicutes]             DNA gyrase, A subunit [Anaerococcus vaginalis ATCC 51170] >
. . Pseudovibrio sp. JE062 ...........................................  186  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Pseudovibrio sp. JE062] >gi|21196167
. . Eubacterium dolichum DSM 3991 ....................................  186  2 hits [firmicutes]             hypothetical protein EUBDOL_00825 [Eubacterium dolichum DSM
. . Hydrogenivirga sp. 128-5-R1-1 ....................................  186  2 hits [aquificales]            DNA gyrase A subunit [Hydrogenivirga sp. 128-5-R1-1] >gi|15
. . Staphylococcus haemolyticus ......................................  186  1 hit  [firmicutes]             DNA gyrase subunit A [Staphylococcus haemolyticus]
. . Anaerobaculum hydrogeniformans ATCC BAA-1850 .....................  186  2 hits [bacteria]               DNA gyrase, A subunit [Anaerobaculum hydrogeniformans ATCC 
. . Staphylococcus hominis SK119 .....................................  186  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus hominis SK119] >gi|31
. . Staphylococcus hominis subsp. hominis C80 ........................  186  2 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus hominis SK119] >gi|31
. . Rickettsia conorii str. Malish 7 .................................  186  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rickettsia conorii str. Malish 7] >gi
. . Rickettsia conorii ...............................................  186  1 hit  [a-proteobacteria]       DNA gyrase subunit A [Rickettsia conorii str. Malish 7] >gi
. . Rhodopseudomonas palustris TIE-1 .................................  186  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Rhodopseudomonas palustris TIE-1] >g
. . Kytococcus sedentarius DSM 20547 .................................  186  2 hits [high GC Gram+]          DNA gyrase subunit A [Kytococcus sedentarius DSM 20547] >gi
. . Pedobacter sp. BAL39 .............................................  186  2 hits [CFB group bacteria]     DNA topoisomerase, ATP-hydrolyzing (DNA gyrase) (DNA topois
. . Rickettsia sibirica 246 ..........................................  186  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rickettsia sibirica 246] >gi|28262169
. . Pseudoramibacter alactolyticus ATCC 23263 ........................  186  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) subunit A [Pseudoramiba
. . Meiothermus ruber DSM 1279 .......................................  186  2 hits [bacteria]               DNA gyrase A subunit [Meiothermus ruber DSM 1279] >gi|29046
. . Rickettsia akari str. Hartford ...................................  186  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rickettsia akari str. Hartford] >gi|1
. . Mesorhizobium loti MAFF303099 ....................................  186  2 hits [a-proteobacteria]       DNA gyrase subunit A [Mesorhizobium loti MAFF303099]
. . Arcobacter nitrofigilis DSM 7299 .................................  186  3 hits [e-proteobacteria]       DNA gyrase subunit A [Arcobacter nitrofigilis DSM 7299]
. . Staphylococcus haemolyticus JCSC1435 .............................  186  2 hits [firmicutes]             DNA gyrase (topoisomerase II) subunit A [Staphylococcus hae
. . Saccharomonospora viridis DSM 43017 ..............................  186  2 hits [high GC Gram+]          DNA gyrase subunit A [Saccharomonospora viridis DSM 43017] 
. . Campylobacter coli RM2228 ........................................  186  2 hits [e-proteobacteria]       DNA gyrase, A subunit [Campylobacter coli RM2228] >gi|30543
. . Campylobacter coli JV20 ..........................................  186  2 hits [e-proteobacteria]       DNA gyrase, A subunit [Campylobacter coli RM2228] >gi|30543
. . Afipia sp. 1NLS2 .................................................  186  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Afipia sp. 1NLS2] >gi|298591811|gb|E
. . Rickettsia endosymbiont of Ixodes scapularis .....................  186  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Rickettsia endosymbiont of Ixodes sc
. . Flavobacteriales bacterium ALC-1 .................................  186  2 hits [CFB group bacteria]     DNA topoisomerase, ATP-hydrolyzing (DNA gyrase) (DNA topois
. . Rickettsia felis URRWXCal2 .......................................  186  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rickettsia felis URRWXCal2] >gi|75536
. . Rickettsia felis .................................................  186  1 hit  [a-proteobacteria]       DNA gyrase subunit A [Rickettsia felis URRWXCal2] >gi|75536
. . Blautia hansenii DSM 20583 .......................................  186  2 hits [firmicutes]             DNA gyrase, A subunit [Blautia hansenii DSM 20583] >gi|2605
. . Staphylococcus epidermidis RP62A .................................  186  3 hits [firmicutes]             DNA gyrase, A subunit [Staphylococcus epidermidis RP62A] >g
. . Streptomyces avermitilis MA-4680 .................................  186  2 hits [high GC Gram+]          DNA gyrase subunit A [Streptomyces avermitilis MA-4680] >gi
. . Clostridium thermocellum ATCC 27405 ..............................  186  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium thermocellum ATCC 27405] 
. . Clostridium thermocellum DSM 2360 ................................  186  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium thermocellum ATCC 27405] 
. . Clostridium thermocellum JW20 ....................................  186  2 hits [firmicutes]             DNA gyrase subunit A [Clostridium thermocellum ATCC 27405] 
. . Clostridium thermocellum DSM 1313 ................................  186  1 hit  [firmicutes]             DNA gyrase subunit A [Clostridium thermocellum ATCC 27405] 
. . Rickettsia massiliae MTU5 ........................................  185  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rickettsia massiliae MTU5] >gi|157844
. . Sulfurospirillum deleyianum DSM 6946 .............................  185  2 hits [e-proteobacteria]       DNA gyrase, A subunit [Sulfurospirillum deleyianum DSM 6946
. . Fusobacterium nucleatum subsp. nucleatum ATCC 25586 ..............  185  2 hits [fusobacteria]           DNA gyrase subunit A [Fusobacterium nucleatum subsp. nuclea
. . Fusobacterium nucleatum subsp. nucleatum ATCC 23726 ..............  185  2 hits [fusobacteria]           DNA gyrase subunit A [Fusobacterium nucleatum subsp. nuclea
. . Prevotella buccae D17 ............................................  185  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Prevotella buccae D17] >gi|288336241
. . Prevotella buccae ATCC 33574 .....................................  185  2 hits [CFB group bacteria]     DNA topoisomerase (ATP-hydrolyzing) subunit A [Prevotella b
. . Ruminococcus sp. 5_1_39BFAA ......................................  185  2 hits [firmicutes]             conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FA
. . Candidatus Amoebophilus asiaticus 5a2 ............................  185  2 hits [CFB group bacteria]     hypothetical protein Aasi_0828 [Candidatus Amoebophilus asi
. . Methylobacterium populi BJ001 ....................................  185  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Methylobacterium populi BJ001] >gi|1
. . Streptomyces sp. ACTE ............................................  185  2 hits [high GC Gram+]          DNA gyrase, A subunit [Streptomyces sp. ACTE] >gi|282561649
. . Candidatus Kuenenia stuttgartiensis ..............................  185  1 hit  [planctomycetes]         strongly similar to DNA gyrase subunit A, type II topoisome
. . Chlorobaculum parvum NCIB 8327 ...................................  185  2 hits [green sulfur bacteria]  DNA gyrase subunit A [Chlorobaculum parvum NCIB 8327] >gi|1
. . Fusobacterium sp. 3_1_36A2 .......................................  185  2 hits [fusobacteria]           DNA gyrase, A subunit [Fusobacterium sp. 3_1_36A2] >gi|2947
. . Fusobacterium sp. 3_1_27 .........................................  185  2 hits [fusobacteria]           DNA gyrase, A subunit [Fusobacterium sp. 3_1_36A2] >gi|2947
. . Chlorobium phaeovibrioides DSM 265 ...............................  185  2 hits [green sulfur bacteria]  DNA gyrase subunit A [Prosthecochloris vibrioformis DSM 265
. . Fusobacterium sp. 4_1_13 .........................................  185  2 hits [fusobacteria]           DNA gyrase subunit A [Fusobacterium sp. 4_1_13] >gi|2294310
. . Flavobacteria bacterium MS024-3C .................................  185  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Flavobacteria bacterium MS024-3C] >g
. . Prevotella salivae DSM 15606 .....................................  185  2 hits [CFB group bacteria]     DNA topoisomerase (ATP-hydrolyzing) subunit A [Prevotella s
. . Nautilia profundicola AmH ........................................  185  2 hits [e-proteobacteria]       DNA gyrase subunit A [Nautilia profundicola AmH] >gi|223588
. . Labrenzia aggregata IAM 12614 ....................................  185  2 hits [a-proteobacteria]       DNA gyrase subunit A [Stappia aggregata IAM 12614] >gi|1184
. . Rickettsia prowazekii str. Madrid E ..............................  184  1 hit  [a-proteobacteria]       DNA gyrase subunit A [Rickettsia prowazekii str. Madrid E] 
. . Rickettsia prowazekii ............................................  184  4 hits [a-proteobacteria]       DNA gyrase subunit A [Rickettsia prowazekii str. Madrid E] 
. . Rickettsia prowazekii Rp22 .......................................  184  1 hit  [a-proteobacteria]       DNA gyrase subunit A [Rickettsia prowazekii str. Madrid E] 
. . Elusimicrobium minutum Pei191 ....................................  184  2 hits [bacteria]               DNA gyrase subunit A [Elusimicrobium minutum Pei191] >gi|18
. . Polaribacter sp. MED152 ..........................................  184  2 hits [CFB group bacteria]     DNA gyrase subunit A [Polaribacter sp. MED152] >gi|85820859
. . Olsenella uli DSM 7084 ...........................................  184  2 hits [high GC Gram+]          DNA gyrase subunit A [Olsenella uli DSM 7084] >gi|301320375
. . Parabacteroides merdae ATCC 43184 ................................  184  2 hits [CFB group bacteria]     hypothetical protein PARMER_01763 [Parabacteroides merdae A
. . Nitratiruptor sp. SB155-2 ........................................  184  2 hits [e-proteobacteria]       DNA gyrase subunit A [Nitratiruptor sp. SB155-2] >gi|151422
. . Flavobacterium psychrophilum JIP02/86 ............................  184  2 hits [CFB group bacteria]     DNA gyrase subunit A [Flavobacterium psychrophilum JIP02/86
. . Brevundimonas sp. BAL3 ...........................................  184  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Brevundimonas sp. BAL3] >gi|19618416
. . Symbiobacterium thermophilum IAM 14863 ...........................  184  2 hits [firmicutes]             DNA gyrase A subunit [Symbiobacterium thermophilum IAM 1486
. . Lactobacillus johnsonii ATCC 33200 ...............................  184  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus johnsoni
. . Desulfarculus baarsii DSM 2075 ...................................  184  2 hits [d-proteobacteria]       DNA gyrase, A subunit [Desulfarculus baarsii DSM 2075] >gi|
. . Oligotropha carboxidovorans OM5 ..................................  184  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Oligotropha carboxidovorans OM5] >gi
. . Desulfobulbus propionicus DSM 2032 ...............................  184  2 hits [d-proteobacteria]       DNA gyrase subunit A [Desulfobulbus propionicus DSM 2032] >
. . Lawsonia intracellularis PHE/MN1-00 ..............................  184  2 hits [d-proteobacteria]       Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase I
. . Paenibacillus curdlanolyticus YK9 ................................  184  2 hits [firmicutes]             DNA gyrase, A subunit [Paenibacillus curdlanolyticus YK9] >
. . Flavobacteria bacterium BBFL7 ....................................  184  2 hits [CFB group bacteria]     DNA gyrase (type IIA topoisomerase), subunit A [Flavobacter
. . Parvibaculum lavamentivorans DS-1 ................................  184  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Parvibaculum lavamentivorans DS-1] >
. . Flavobacterium johnsoniae UW101 ..................................  184  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Flavobacterium johnsoniae UW101] >gi
. . Rhodomicrobium vannielii ATCC 17100 ..............................  184  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Rhodomicrobium vannielii ATCC 17100]
. . Frankia sp. EuI1c ................................................  184  2 hits [high GC Gram+]          DNA gyrase, A subunit [Frankia sp. EuI1c] >gi|311225239|gb|
. . Desulfomicrobium baculatum DSM 4028 ..............................  184  2 hits [d-proteobacteria]       DNA gyrase, A subunit [Desulfomicrobium baculatum DSM 4028]
. . Calditerrivibrio nitroreducens DSM 19672 .........................  184  2 hits [bacteria]               DNA gyrase subunit a [Calditerrivibrio nitroreducens DSM 19
. . Desulfovibrio sp. 3_1_syn3 .......................................  184  2 hits [d-proteobacteria]       DNA gyrase, A subunit [Desulfovibrio sp. 3_1_syn3] >gi|3028
. . Arcobacter halophilus ............................................  184  1 hit  [e-proteobacteria]       DNA gyrase subunit A [Arcobacter halophilus]
. . Peptoniphilus sp. oral taxon 386 str. F0131 ......................  184  2 hits [firmicutes]             DNA gyrase, A subunit [Peptoniphilus sp. oral taxon 386 str
. . Streptomyces clavuligerus ATCC 27064 .............................  184  4 hits [high GC Gram+]          DNA gyrase subunit A [Streptomyces clavuligerus ATCC 27064]
. . Fusobacterium nucleatum subsp. vincentii ATCC 49256 ..............  183  2 hits [fusobacteria]           DNA gyrase subunit A [Fusobacterium nucleatum subsp. vincen
. . Selenomonas sputigena ATCC 35185 .................................  183  2 hits [firmicutes]             DNA gyrase, A subunit [Selenomonas sputigena ATCC 35185] >g
. . Candidatus Cloacamonas acidaminovorans ...........................  183  2 hits [bacteria]               DNA gyrase, A subunit [Candidatus Cloacamonas acidaminovora
. . Magnetococcus sp. MC-1 ...........................................  183  2 hits [proteobacteria]         DNA gyrase subunit A [Magnetococcus sp. MC-1] >gi|117608135
. . Hyphomonas neptunium ATCC 15444 ..................................  183  2 hits [a-proteobacteria]       DNA gyrase subunit A [Hyphomonas neptunium ATCC 15444] >gi|
. . Helicobacter canadensis MIT 98-5491 ..............................  183  5 hits [e-proteobacteria]       DNA gyrase subunit A [Helicobacter canadensis MIT 98-5491] 
. . Sagittula stellata E-37 ..........................................  183  2 hits [a-proteobacteria]       DNA gyrase subunit A [Sagittula stellata E-37] >gi|12670995
. . Prevotella bivia JCVIHMP010 ......................................  183  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Prevotella bivia JCVIHMP010] >gi|282
. . Streptomyces griseoflavus Tu4000 .................................  183  2 hits [high GC Gram+]          DNA gyrase, A subunit [Streptomyces griseoflavus Tu4000] >g
. . Methylobacterium radiotolerans JCM 2831 ..........................  183  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Methylobacterium radiotolerans JCM 2
. . Caulobacter sp. K31 ..............................................  183  2 hits [a-proteobacteria]       DNA gyrase subunit A [Caulobacter sp. K31] >gi|167349263|gb
. . Mycobacterium sp. MCS ............................................  183  2 hits [high GC Gram+]          DNA gyrase subunit A [Mycobacterium sp. MCS] >gi|119866072|
. . Mycobacterium sp. KMS ............................................  183  2 hits [high GC Gram+]          DNA gyrase subunit A [Mycobacterium sp. MCS] >gi|119866072|
. . Anaerococcus lactolyticus ATCC 51172 .............................  183  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) [Anaerococcus lactolyti
. . Fusobacterium sp. D11 ............................................  183  3 hits [fusobacteria]           DNA gyrase subunit A [Fusobacterium sp. D11] >gi|260495354|
. . Fusobacterium sp. 3_1_33 .........................................  183  2 hits [fusobacteria]           DNA gyrase subunit A [Fusobacterium sp. D11] >gi|260495354|
. . Actinomyces sp. oral taxon 171 str. F0337 ........................  183  2 hits [high GC Gram+]          DNA gyrase, A subunit [Actinomyces sp. oral taxon 171 str. 
. . Fusobacterium sp. 2_1_31 .........................................  183  2 hits [fusobacteria]           DNA gyrase subunit A [Fusobacterium sp. 2_1_31] >gi|2294240
. . Nitrobacter winogradskyi Nb-255 ..................................  183  2 hits [a-proteobacteria]       DNA gyrase subunit A [Nitrobacter winogradskyi Nb-255] >gi|
. . Streptomyces albus J1074 .........................................  183  3 hits [high GC Gram+]          DNA gyrase subunit A [Streptomyces albus J1074] >gi|2914526
. . Sulfuricurvum kujiense DSM 16994 .................................  183  2 hits [e-proteobacteria]       DNA gyrase subunit a [Sulfuricurvum kujiense DSM 16994] >gi
. . Rickettsia canadensis str. McKiel ................................  183  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rickettsia canadensis str. McKiel] >g
. . Prevotella ruminicola 23 .........................................  183  2 hits [CFB group bacteria]     DNA gyrase subunit A [Prevotella ruminicola 23] >gi|2944732
. . delta proteobacterium MLMS-1 .....................................  182  4 hits [d-proteobacteria]       DNA gyrase, subunit A [delta proteobacterium MLMS-1] >gi|93
. . Sulfurihydrogenibium sp. YO3AOP1 .................................  182  2 hits [aquificales]            DNA topoisomerase (ATP-hydrolyzing) [Sulfurihydrogenibium s
. . Streptomyces coelicolor A3(2) ....................................  182  3 hits [high GC Gram+]          DNA gyrase subunit A [Streptomyces coelicolor A3(2)] >gi|19
. . Streptomyces coelicolor ..........................................  182  3 hits [high GC Gram+]          DNA gyrase subunit A [Streptomyces coelicolor A3(2)] >gi|19
. . Mesorhizobium opportunistum WSM2075 ..............................  182  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Mesorhizobium opportunistum WSM2075]
. . Granulicatella adiacens ATCC 49175 ...............................  182  2 hits [firmicutes]             DNA gyrase, A subunit [Granulicatella adiacens ATCC 49175] 
. . Algoriphagus sp. PR1 .............................................  182  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Algoriphagus sp. PR1] >gi|126578969|
. . Lactobacillus johnsonii NCC 533 ..................................  182  2 hits [firmicutes]             DNA gyrase subunit A [Lactobacillus johnsonii NCC 533] >gi|
. . Slackia exigua ATCC 700122 .......................................  182  2 hits [high GC Gram+]          DNA gyrase, A subunit [Slackia exigua ATCC 700122] >gi|2691
. . Actinomyces viscosus C505 ........................................  182  1 hit  [high GC Gram+]          DNA gyrase subunit A [Actinomyces viscosus C505]
. . Prevotella oris F0302 ............................................  182  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Prevotella oris F0302] >gi|281401562
. . Helicobacter hepaticus ATCC 51449 ................................  182  2 hits [e-proteobacteria]       DNA gyrase subunit A [Helicobacter hepaticus ATCC 51449] >g
. . Lactobacillus rhamnosus GG .......................................  182  3 hits [firmicutes]             DNA gyrase subunit A [Lactobacillus rhamnosus GG] >gi|25714
. . Streptomyces sviceus ATCC 29083 ..................................  182  2 hits [high GC Gram+]          DNA gyrase, A subunit [Streptomyces sviceus ATCC 29083] >gi
. . Lactobacillus rhamnosus HN001 ....................................  182  2 hits [firmicutes]             DNA gyrase, A subunit [Lactobacillus rhamnosus HN001] >gi|1
. . Prevotella oris C735 .............................................  182  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Prevotella oris C735] >gi|298577934|
. . Psychroflexus torquis ATCC 700755 ................................  182  2 hits [CFB group bacteria]     DNA gyrase A subunit [Psychroflexus torquis ATCC 700755] >g
. . alpha proteobacterium BAL199 .....................................  182  2 hits [a-proteobacteria]       Type IIA topoisomerase , A subunit [alpha proteobacterium B
. . Ruminococcus albus 8 .............................................  182  2 hits [firmicutes]             DNA gyrase, A subunit [Ruminococcus albus 8] >gi|291502570|
. . Waddlia chondrophila WSU 86-1044 .................................  182  2 hits [chlamydias]             DNA gyrase subunit A [Waddlia chondrophila WSU 86-1044] >gi
. . Lactobacillus jensenii 27-2-CHN ..................................  182  2 hits [firmicutes]             DNA gyrase, A subunit [Lactobacillus jensenii 27-2-CHN] >gi
. . Lactobacillus jensenii 115-3-CHN .................................  182  2 hits [firmicutes]             DNA gyrase, A subunit [Lactobacillus jensenii 27-2-CHN] >gi
. . Lactobacillus jensenii 208-1 .....................................  182  4 hits [firmicutes]             DNA gyrase, A subunit [Lactobacillus jensenii 27-2-CHN] >gi
. . Lactobacillus jensenii JV-V16 ....................................  182  2 hits [firmicutes]             DNA gyrase, A subunit [Lactobacillus jensenii 27-2-CHN] >gi
. . Lactobacillus rhamnosus LMS2-1 ...................................  182  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus rhamnosu
. . Lactobacillus rhamnosus Lc 705 ...................................  182  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus rhamnosu
. . Streptomyces lividans TK24 .......................................  182  2 hits [high GC Gram+]          DNA topoisomerase subunit A [Streptomyces lividans TK24] >g
. . Gramella forsetii KT0803 .........................................  182  2 hits [CFB group bacteria]     DNA gyrase subunit A [Gramella forsetii KT0803] >gi|1175780
. . Anaerococcus tetradius ATCC 35098 ................................  182  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) [Anaerococcus tetradius
. . Prevotella amnii CRIS 21A-A ......................................  182  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Prevotella amnii CRIS 21A-A] >gi|307
. . Streptomyces sp. C ...............................................  182  2 hits [high GC Gram+]          DNA gyrase subunit A [Streptomyces sp. C] >gi|302444461|gb|
. . candidate division TM7 genomosp. GTL1 ............................  182  2 hits [bacteria]               DNA gyrase, A subunit [candidate division TM7 genomosp. GTL
. . Bacillus plakortidis .............................................  182  1 hit  [firmicutes]             DNA gyrase subunit A [Bacillus plakortidis]
. . Chlorobium luteolum DSM 273 ......................................  182  2 hits [green sulfur bacteria]  DNA gyrase, subunit A [Chlorobium luteolum DSM 273] >gi|781
. . Fusobacterium sp. D12 ............................................  182  3 hits [fusobacteria]           DNA gyrase subunit A [Fusobacterium sp. D12] >gi|317060118|
. . Streptomyces hygroscopicus ATCC 53653 ............................  182  2 hits [high GC Gram+]          DNA gyrase, A subunit [Streptomyces hygroscopicus ATCC 5365
. . Brevundimonas subvibrioides ATCC 15264 ...........................  182  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Brevundimonas subvibrioides ATCC 152
. . Streptomyces scabiei 87.22 .......................................  182  2 hits [high GC Gram+]          DNA gyrase subunit A [Streptomyces scabiei 87.22] >gi|26064
. . Streptomyces violaceusniger Tu 4113 ..............................  181  2 hits [high GC Gram+]          DNA gyrase, A subunit [Streptomyces violaceusniger Tu 4113]
. . Coprothermobacter proteolyticus DSM 5265 .........................  181  2 hits [firmicutes]             DNA gyrase, A subunit [Coprothermobacter proteolyticus DSM 
. . Mycoplasma pulmonis UAB CTIP .....................................  181  1 hit  [mycoplasmas]            DNA gyrase subunit A [Mycoplasma pulmonis UAB CTIP] >gi|140
. . Mycoplasma pulmonis ..............................................  181  1 hit  [mycoplasmas]            DNA gyrase subunit A [Mycoplasma pulmonis UAB CTIP] >gi|140
. . Mesorhizobium ciceri biovar biserrulae WSM1271 ...................  181  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Mesorhizobium ciceri biovar biserrul
. . Pedobacter heparinus DSM 2366 ....................................  181  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Pedobacter heparinus DSM 2366] >gi|2
. . Bacteroides finegoldii DSM 17565 .................................  181  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Bacteroides finegoldii DSM 17565] >g
. . Chitinophaga pinensis DSM 2588 ...................................  181  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Chitinophaga pinensis DSM 2588] >gi|
. . Streptomyces sp. Mg1 .............................................  181  2 hits [high GC Gram+]          DNA gyrase subunit A [Streptomyces sp. Mg1] >gi|194345916|g
. . Micromonospora aurantiaca ATCC 27029 .............................  181  2 hits [high GC Gram+]          DNA gyrase subunit A [Micromonospora aurantiaca ATCC 27029]
. . Acetivibrio cellulolyticus CD2 ...................................  181  2 hits [firmicutes]             DNA gyrase, A subunit [Acetivibrio cellulolyticus CD2] >gi|
. . Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 .  181  2 hits [d-proteobacteria]       DNA gyrase, A subunit [Desulfovibrio desulfuricans subsp. d
. . Prevotella buccalis ATCC 35310 ...................................  181  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Prevotella buccalis ATCC 35310] >gi|
. . Acidaminococcus fermentans DSM 20731 .............................  181  2 hits [firmicutes]             DNA gyrase, A subunit [Acidaminococcus fermentans DSM 20731
. . Hyphomicrobium denitrificans ATCC 51888 ..........................  181  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Hyphomicrobium denitrificans ATCC 51
. . Actinomyces urogenitalis DSM 15434 ...............................  181  2 hits [high GC Gram+]          DNA topoisomerase (ATP-hydrolyzing) [Actinomyces urogenital
. . Mycoplasma penetrans HF-2 ........................................  181  2 hits [mycoplasmas]            DNA gyrase subunit A [Mycoplasma penetrans HF-2] >gi|264534
. . Desulfovibrio vulgaris RCH1 ......................................  181  1 hit  [d-proteobacteria]       DNA gyrase, A subunit [Desulfovibrio vulgaris RCH1]
. . Desulfovibrio vulgaris str. Hildenborough ........................  181  2 hits [d-proteobacteria]       DNA gyrase subunit A [Desulfovibrio vulgaris str. Hildenbor
. . Desulfovibrio vulgaris DP4 .......................................  181  2 hits [d-proteobacteria]       DNA gyrase subunit A [Desulfovibrio vulgaris str. Hildenbor
. . Jonquetella anthropi E3_33 E1 ....................................  181  2 hits [bacteria]               DNA gyrase, A subunit [Jonquetella anthropi E3_33 E1] >gi|2
. . Maribacter sp. HTCC2170 ..........................................  181  2 hits [CFB group bacteria]     DNA gyrase subunit A [Maribacter sp. HTCC2170] >gi|88709632
. . Mycobacterium gilvum PYR-GCK .....................................  181  2 hits [high GC Gram+]          DNA gyrase, A subunit [Mycobacterium gilvum PYR-GCK] >gi|31
. . Mycobacterium sp. Spyr1 ..........................................  181  2 hits [high GC Gram+]          DNA gyrase, A subunit [Mycobacterium gilvum PYR-GCK] >gi|31
. . Bacteroides sp. 20_3 .............................................  181  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Bacteroides sp. 20_3] >gi|300831806|
. . Bacteroides sp. 3_1_19 ...........................................  181  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Bacteroides sp. 3_1_19] >gi|29826817
. . Parabacteroides distasonis ATCC 8503 .............................  181  2 hits [CFB group bacteria]     DNA gyrase A subunit [Parabacteroides distasonis ATCC 8503]
. . Bacteroides sp. 2_1_7 ............................................  181  1 hit  [CFB group bacteria]     DNA gyrase A subunit [Parabacteroides distasonis ATCC 8503]
. . Parabacteroides sp. D13 ..........................................  181  2 hits [CFB group bacteria]     DNA gyrase A subunit [Parabacteroides distasonis ATCC 8503]
. . Bacteroides sp. 2_1_33B ..........................................  181  2 hits [CFB group bacteria]     DNA gyrase A subunit [Parabacteroides distasonis ATCC 8503]
. . Lactobacillus amylolyticus DSM 11664 .............................  181  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillu
. . Campylobacter upsaliensis RM3195 .................................  181  2 hits [e-proteobacteria]       DNA gyrase, A subunit [Campylobacter upsaliensis RM3195] >g
. . Thermus thermophilus HB27 ........................................  181  2 hits [bacteria]               DNA gyrase subunit A [Thermus thermophilus HB27] >gi|461969
. . Thermus thermophilus HB8 .........................................  181  2 hits [bacteria]               DNA gyrase subunit A [Thermus thermophilus HB8] >gi|9622087
. . Thermus thermophilus .............................................  181  1 hit  [bacteria]               DNA gyrase subunit A [Thermus thermophilus HB8] >gi|9622087
. . Sulfurihydrogenibium yellowstonense SS-5 .........................  181  2 hits [aquificales]            DNA gyrase subunit A [Sulfurihydrogenibium yellowstonense S
. . Mycoplasma bovis PG45 ............................................  181  2 hits [mycoplasmas]            DNA gyrase subunit A [Mycoplasma bovis PG45] >gi|312950356|
. . Rhodospirillum rubrum ATCC 11170 .................................  181  2 hits [a-proteobacteria]       DNA gyrase subunit A [Rhodospirillum rubrum ATCC 11170] >gi
. . Lactobacillus jensenii 269-3 .....................................  181  2 hits [firmicutes]             DNA gyrase, A subunit [Lactobacillus jensenii 269-3] >gi|26
. . Lactobacillus jensenii SJ-7A-US ..................................  181  2 hits [firmicutes]             DNA gyrase, A subunit [Lactobacillus jensenii 269-3] >gi|26
. . Lactobacillus jensenii 1153 ......................................  181  2 hits [firmicutes]             DNA gyrase, A subunit [Lactobacillus jensenii 269-3] >gi|26
. . Mucilaginibacter paludis DSM 18603 ...............................  181  2 hits [CFB group bacteria]     DNA gyrase subunit A [Mucilaginibacter paludis DSM 18603] >
. . Prevotella marshii DSM 16973 .....................................  181  2 hits [CFB group bacteria]     DNA topoisomerase (ATP-hydrolyzing) subunit A [Prevotella m
. . Dokdonia donghaensis MED134 ......................................  181  2 hits [CFB group bacteria]     DNA gyrase subunit A [Dokdonia donghaensis MED134] >gi|8581
. . Cellulophaga algicola DSM 14237 ..................................  181  2 hits [CFB group bacteria]     DNA gyrase subunit a [Cellulophaga algicola DSM 14237] >gi|
. . Gluconacetobacter diazotrophicus PAl 5 ...........................  181  4 hits [a-proteobacteria]       DNA gyrase subunit A [Gluconacetobacter diazotrophicus PAl 
. . Mycoplasma agalactiae PG2 ........................................  181  2 hits [mycoplasmas]            DNA gyrase subunit A [Mycoplasma agalactiae PG2] >gi|148291
. . Microbacterium testaceum StLB037 .................................  181  2 hits [high GC Gram+]          type IIA topoisomerase (DNA gyrase/topo II, topoisomerase I
. . Rhodobacterales bacterium Y4I ....................................  181  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Rhodobacterales bacterium Y4I] >gi|2
. . Butyrivibrio crossotus DSM 2876 ..................................  181  2 hits [firmicutes]             DNA gyrase, A subunit [Butyrivibrio crossotus DSM 2876] >gi
. . Bradyrhizobium japonicum USDA 110 ................................  181  2 hits [a-proteobacteria]       DNA gyrase subunit A [Bradyrhizobium japonicum USDA 110]
. . Caldicellulosiruptor lactoaceticus 6A ............................  180  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) [Caldicellulosiruptor l
. . Lactobacillus johnsonii FI9785 ...................................  180  2 hits [firmicutes]             DNA gyrase, subunit A [Lactobacillus johnsonii FI9785] >gi|
. . Magnetospirillum gryphiswaldense MSR-1 ...........................  180  1 hit  [a-proteobacteria]       DNA gyrase, subunit A [Magnetospirillum gryphiswaldense MSR
. . Mycoplasma agalactiae ............................................  180  2 hits [mycoplasmas]            DNA gyrase subunit A [Mycoplasma agalactiae] >gi|290752858|
. . Magnetospirillum magneticum AMB-1 ................................  180  2 hits [a-proteobacteria]       Type IIA topoisomerase, A subunit [Magnetospirillum magneti
. . Bacteroides sp. D1 ...............................................  180  2 hits [CFB group bacteria]     subunit A [Bacteroides sp. D1] >gi|262408111|ref|ZP_0608465
. . Bacteroides sp. 2_1_22 ...........................................  180  2 hits [CFB group bacteria]     subunit A [Bacteroides sp. D1] >gi|262408111|ref|ZP_0608465
. . Bacteroides ovatus SD CC 2a ......................................  180  2 hits [CFB group bacteria]     subunit A [Bacteroides sp. D1] >gi|262408111|ref|ZP_0608465
. . Bacteroides xylanisolvens SD CC 1b ...............................  180  2 hits [CFB group bacteria]     subunit A [Bacteroides sp. D1] >gi|262408111|ref|ZP_0608465
. . Bacteroides sp. D22 ..............................................  180  2 hits [CFB group bacteria]     subunit A [Bacteroides sp. D1] >gi|262408111|ref|ZP_0608465
. . Lactobacillus gasseri ATCC 33323 .................................  180  2 hits [firmicutes]             DNA gyrase, A subunit [Lactobacillus gasseri ATCC 33323] >g
. . Lactobacillus gasseri 202-4 ......................................  180  2 hits [firmicutes]             DNA gyrase, A subunit [Lactobacillus gasseri ATCC 33323] >g
. . Maricaulis maris MCS10 ...........................................  180  2 hits [a-proteobacteria]       DNA gyrase subunit A [Maricaulis maris MCS10] >gi|114340885
. . Magnetospirillum magnetotacticum MS-1 ............................  180  1 hit  [a-proteobacteria]       COG0188: Type IIA topoisomerase (DNA gyrase/topo II, topois
. . Dyadobacter fermentans DSM 18053 .................................  180  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Dyadobacter fermentans DSM 18053] >g
. . Oscillochloris trichoides DG-6 ...................................  180  2 hits [GNS bacteria]           DNA gyrase, A subunit [Oscillochloris trichoides DG6] >gi|3
. . Fusobacterium nucleatum subsp. polymorphum ATCC 10953 ............  180  2 hits [fusobacteria]           DNA topoisomerase (ATP-hydrolyzing) [Fusobacterium nucleatu
. . Campylobacter upsaliensis JV21 ...................................  180  2 hits [e-proteobacteria]       DNA topoisomerase (ATP-hydrolyzing) subunit A [Campylobacte
. . Lactobacillus gasseri JV-V03 .....................................  180  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillu
. . Streptomyces bingchenggensis BCW-1 ...............................  180  1 hit  [high GC Gram+]          DNA gyrase subunit A [Streptomyces bingchenggensis BCW-1]
. . Mycobacterium kansasii ATCC 12478 ................................  180  1 hit  [high GC Gram+]          DNA gyrase subunit A [Mycobacterium kansasii ATCC 12478]
. . Mycobacterium leprae Br4923 ......................................  180  2 hits [high GC Gram+]          putative DNA gyrase subunit A [Mycobacterium leprae Br4923]
. . Syntrophomonas wolfei subsp. wolfei str. Goettingen ..............  180  2 hits [firmicutes]             DNA gyrase, A subunit [Syntrophomonas wolfei subsp. wolfei 
. . Leptospirillum ferrodiazotrophum .................................  180  1 hit  [bacteria]               DNA gyrase, A subunit [Leptospirillum ferrodiazotrophum]
. . Nitrobacter hamburgensis X14 .....................................  180  2 hits [a-proteobacteria]       DNA gyrase subunit A [Nitrobacter hamburgensis X14] >gi|918
. . Desulfatibacillum alkenivorans AK-01 .............................  179  2 hits [d-proteobacteria]       DNA gyrase, A subunit [Desulfatibacillum alkenivorans AK-01
. . Mycobacterium leprae TN ..........................................  179  1 hit  [high GC Gram+]          putative DNA gyrase subunit A [Mycobacterium leprae TN] >gi
. . Mycobacterium leprae .............................................  179  4 hits [high GC Gram+]          putative DNA gyrase subunit A [Mycobacterium leprae TN] >gi
. . Desulfococcus oleovorans Hxd3 ....................................  179  2 hits [d-proteobacteria]       DNA gyrase, A subunit [Desulfococcus oleovorans Hxd3] >gi|1
. . Granulicatella elegans ATCC 700633 ...............................  179  2 hits [firmicutes]             DNA gyrase, A subunit [Granulicatella elegans ATCC 700633] 
. . Rothia dentocariosa ATCC 17931 ...................................  179  2 hits [high GC Gram+]          DNA topoisomerase (ATP-hydrolyzing) subunit A [Rothia dento
. . Helicobacter cinaedi CCUG 18818 ..................................  179  3 hits [e-proteobacteria]       DNA gyrase subunit A [Helicobacter cinaedi CCUG 18818] >gi|
. . Geobacter lovleyi SZ .............................................  179  2 hits [d-proteobacteria]       DNA gyrase, A subunit [Geobacter lovleyi SZ] >gi|189419367|
. . Bacteroides xylanisolvens XB1A ...................................  179  1 hit  [CFB group bacteria]     DNA gyrase subunit A [Bacteroides xylanisolvens XB1A]
. . Nitrobacter sp. Nb-311A ..........................................  179  2 hits [a-proteobacteria]       DNA gyrase subunit A [Nitrobacter sp. Nb-311A] >gi|85696697
. . Actinomyces odontolyticus F0309 ..................................  179  2 hits [high GC Gram+]          DNA gyrase, A subunit [Actinomyces odontolyticus F0309] >gi
. . Rothia mucilaginosa DY-18 ........................................  179  2 hits [high GC Gram+]          type IIA topoisomerase, A subunit [Rothia mucilaginosa DY-1
. . Mycobacterium vanbaalenii PYR-1 ..................................  179  2 hits [high GC Gram+]          DNA gyrase, A subunit [Mycobacterium vanbaalenii PYR-1] >gi
. . Bacteroides sp. 3_1_23 ...........................................  179  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Bacteroides sp. 3_1_23] >gi|29851610
. . Rothia mucilaginosa ATCC 25296 ...................................  179  2 hits [high GC Gram+]          DNA gyrase, A subunit [Rothia mucilaginosa ATCC 25296] >gi|
. . Bacteroides ovatus ATCC 8483 .....................................  179  2 hits [CFB group bacteria]     hypothetical protein BACOVA_00722 [Bacteroides ovatus ATCC 
. . Bacteroides sp. 2_2_4 ............................................  179  2 hits [CFB group bacteria]     hypothetical protein BACOVA_00722 [Bacteroides ovatus ATCC 
. . Bacteroides ovatus SD CMC 3f .....................................  179  2 hits [CFB group bacteria]     hypothetical protein BACOVA_00722 [Bacteroides ovatus ATCC 
. . Ureaplasma parvum serovar 3 str. ATCC 700970 .....................  179  2 hits [mycoplasmas]            DNA gyrase subunit A [Ureaplasma parvum serovar 3 str. ATCC
. . Ureaplasma parvum serovar 3 str. ATCC 27815 ......................  179  2 hits [mycoplasmas]            DNA gyrase subunit A [Ureaplasma parvum serovar 3 str. ATCC
. . Ureaplasma parvum serovar 1 str. ATCC 27813 ......................  179  2 hits [mycoplasmas]            DNA gyrase subunit A [Ureaplasma parvum serovar 3 str. ATCC
. . Ureaplasma parvum serovar 14 str. ATCC 33697 .....................  179  2 hits [mycoplasmas]            DNA gyrase subunit A [Ureaplasma parvum serovar 3 str. ATCC
. . Ureaplasma parvum serovar 6 str. ATCC 27818 ......................  179  2 hits [mycoplasmas]            DNA gyrase subunit A [Ureaplasma parvum serovar 3 str. ATCC
. . Ureaplasma parvum ................................................  179  1 hit  [mycoplasmas]            DNA gyrase subunit A [Ureaplasma parvum serovar 3 str. ATCC
. . Ureaplasma urealyticum ...........................................  179  1 hit  [mycoplasmas]            DNA gyrase subunit A [Ureaplasma parvum serovar 3 str. ATCC
. . Bacteroides sp. D2 ...............................................  179  3 hits [CFB group bacteria]     DNA gyrase subunit A [Bacteroides sp. D2] >gi|315918594|ref
. . Thermocrinis albus DSM 14484 .....................................  179  2 hits [aquificales]            DNA topoisomerase (ATP-hydrolyzing) [Thermocrinis albus DSM
. . Bacteroides sp. 1_1_6 ............................................  179  2 hits [CFB group bacteria]     conserved hypothetical protein [Bacteroides sp. 1_1_6] >gi|
. . Bacteroides sp. 1_1_14 ...........................................  179  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Bacteroides sp. 1_1_14] >gi|29826180
. . Heliobacillus mobilis ............................................  179  1 hit  [firmicutes]             DNA gyrase subunit A [Heliobacillus mobilis]
. . Bacteroides thetaiotaomicron VPI-5482 ............................  179  2 hits [CFB group bacteria]     DNA gyrase subunit A [Bacteroides thetaiotaomicron VPI-5482
. . Phascolarctobacterium sp. YIT 12067 ..............................  179  2 hits [firmicutes]             DNA gyrase, A subunit [Phascolarctobacterium sp. YIT 12067]
. . Lactobacillus gasseri 224-1 ......................................  179  2 hits [firmicutes]             DNA gyrase, A subunit [Lactobacillus gasseri 224-1] >gi|282
. . Flavobacteria bacterium MS024-2A .................................  179  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Flavobacteria bacterium MS024-2A] >g
. . Acidaminococcus sp. D21 ..........................................  179  2 hits [firmicutes]             type IIA topoisomerase [Acidaminococcus sp. D21] >gi|226904
. . Rothia dentocariosa M567 .........................................  179  2 hits [high GC Gram+]          DNA gyrase, A subunit [Rothia dentocariosa M567] >gi|300381
. . Prevotella disiens FB035-09AN ....................................  179  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Prevotella disiens FB035-09AN] >gi|3
. . Chloroflexus aggregans DSM 9485 ..................................  179  2 hits [GNS bacteria]           DNA gyrase subunit A [Chloroflexus aggregans DSM 9485] >gi|
. . Lactobacillus amylovorus GRL 1112 ................................  179  2 hits [firmicutes]             DNA gyrase, A subunit [Lactobacillus amylovorus GRL 1112] >
. . Epulopiscium sp. 'N.t. morphotype B' .............................  179  1 hit  [firmicutes]             DNA gyrase subunit A [Epulopiscium sp. 'N.t. morphotype B']
. . Actinomyces odontolyticus ATCC 17982 .............................  178  2 hits [high GC Gram+]          hypothetical protein ACTODO_00741 [Actinomyces odontolyticu
. . Catenulispora acidiphila DSM 44928 ...............................  178  2 hits [high GC Gram+]          DNA gyrase, A subunit [Catenulispora acidiphila DSM 44928] 
. . Sorangium cellulosum 'So ce 56' ..................................  178  2 hits [d-proteobacteria]       DNA gyrase subunit A [Sorangium cellulosum 'So ce 56'] >gi|
. . Silicibacter lacuscaerulensis ITI-1157 ...........................  178  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Silicibacter lacuscaerulensis ITI-11
. . Eubacterium saphenum ATCC 49989 ..................................  178  2 hits [firmicutes]             DNA gyrase, A subunit [Eubacterium saphenum ATCC 49989] >gi
. . Aerococcus viridans ATCC 11563 ...................................  178  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) subunit A [Aerococcus v
. . Prevotella sp. oral taxon 299 str. F0039 .........................  178  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Prevotella sp. oral taxon 299 str. F
. . Mycobacterium intracellulare ATCC 13950 ..........................  178  1 hit  [high GC Gram+]          DNA gyrase, A subunit [Mycobacterium intracellulare ATCC 13
. . Candidatus Pelagibacter ubique HTCC1062 ..........................  178  2 hits [a-proteobacteria]       DNA gyrase subunit A [Candidatus Pelagibacter ubique HTCC10
. . Stackebrandtia nassauensis DSM 44728 .............................  178  2 hits [high GC Gram+]          DNA gyrase subunit A [Stackebrandtia nassauensis DSM 44728]
. . Candidatus Pelagibacter ubique HTCC1002 ..........................  178  2 hits [a-proteobacteria]       DNA gyrase subunit A [Candidatus Pelagibacter ubique HTCC10
. . Roseobacter sp. MED193 ...........................................  178  2 hits [a-proteobacteria]       DNA gyrase subunit A [Roseobacter sp. MED193] >gi|85824845|
. . Bacteroides plebeius DSM 17135 ...................................  178  2 hits [CFB group bacteria]     hypothetical protein BACPLE_00759 [Bacteroides plebeius DSM
. . Dermacoccus sp. Ellin185 .........................................  178  2 hits [high GC Gram+]          DNA gyrase, A subunit [Dermacoccus sp. Ellin185] >gi|308434
. . Helicobacter mustelae 12198 ......................................  178  2 hits [e-proteobacteria]       DNA gyrase subunit A [Helicobacter mustelae 12198] >gi|2909
. . Blattabacterium sp. (Periplaneta americana) str. BPLAN ...........  178  2 hits [CFB group bacteria]     DNA gyrase A subunit [Blattabacterium sp. (Periplaneta amer
. . Xylanimonas cellulosilytica DSM 15894 ............................  178  2 hits [high GC Gram+]          DNA gyrase subunit A [Xylanimonas cellulosilytica DSM 15894
. . Prevotella timonensis CRIS 5C-B1 .................................  177  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Prevotella timonensis CRIS 5C-B1] >g
. . Rhodobacter capsulatus SB 1003 ...................................  177  3 hits [a-proteobacteria]       DNA gyrase subunit a [Rhodobacter capsulatus SB 1003]
. . Phaeobacter gallaeciensis BS107 ..................................  177  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Phaeobacter gallaeciensis BS107] >gi
. . Oceanibulbus indolifex HEL-45 ....................................  177  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Oceanibulbus indolifex HEL-45] >gi|1
. . Campylobacter gracilis RM3268 ....................................  177  2 hits [e-proteobacteria]       DNA gyrase, A subunit [Campylobacter gracilis RM3268] >gi|2
. . Phaeobacter gallaeciensis 2.10 ...................................  177  2 hits [a-proteobacteria]       DNA gyrase subunit A [Phaeobacter gallaeciensis 2.10] >gi|1
. . Helicobacter pullorum NCTC 12824 .................................  177  1 hit  [e-proteobacteria]       DNA gyrase A subunit [Helicobacter pullorum NCTC 12824]
. . Lactobacillus crispatus JV-V01 ...................................  177  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus crispatu
. . Lactobacillus crispatus 125-2-CHN ................................  177  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus crispatu
. . Lactobacillus crispatus MV-1A-US .................................  177  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus crispatu
. . Lactobacillus crispatus MV-3A-US .................................  177  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus crispatu
. . Lactobacillus crispatus 214-1 ....................................  177  2 hits [firmicutes]             DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus crispatu
. . Proteus penneri ATCC 35198 .......................................  177  2 hits [enterobacteria]         hypothetical protein PROPEN_01728 [Proteus penneri ATCC 351
. . Helicobacter pullorum MIT 98-5489 ................................  177  2 hits [e-proteobacteria]       DNA gyrase subunit A [Helicobacter pullorum MIT 98-5489] >g
. . Actinomyces sp. oral taxon 178 str. F0338 ........................  177  2 hits [high GC Gram+]          DNA topoisomerase (ATP-hydrolyzing) subunit A [Actinomyces 
. . Leeuwenhoekiella blandensis MED217 ...............................  177  2 hits [CFB group bacteria]     DNA gyrase A subunit [Leeuwenhoekiella blandensis MED217] >
. . beta proteobacterium KB13 ........................................  177  2 hits [b-proteobacteria]       DNA gyrase, A subunit [beta proteobacterium KB13] >gi|20708
. . Acholeplasma laidlawii PG-8A .....................................  177  2 hits [mycoplasmas]            DNA gyrase subunit A [Acholeplasma laidlawii PG-8A] >gi|161
. . unidentified eubacterium SCB49 ...................................  177  2 hits [CFB group bacteria]     DNA gyrase A subunit [unidentified eubacterium SCB49] >gi|1
. . Orientia tsutsugamushi str. Ikeda ................................  177  2 hits [a-proteobacteria]       DNA gyrase subunit A [Orientia tsutsugamushi str. Ikeda] >g
. . Rhodobacteraceae bacterium KLH11 .................................  177  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Rhodobacteraceae bacterium KLH11] >g
. . Frankia symbiont of Datisca glomerata ............................  177  2 hits [high GC Gram+]          DNA gyrase, A subunit [Frankia symbiont of Datisca glomerat
. . Lactobacillus brevis ATCC 367 ....................................  177  2 hits [firmicutes]             DNA gyrase, A subunit [Lactobacillus brevis ATCC 367] >gi|1
. . Lactobacillus brevis .............................................  177  1 hit  [firmicutes]             DNA gyrase, A subunit [Lactobacillus brevis ATCC 367] >gi|1
. . Thiobacillus denitrificans ATCC 25259 ............................  177  2 hits [b-proteobacteria]       DNA gyrase subunit A [Thiobacillus denitrificans ATCC 25259
. . Frankia alni ACN14a ..............................................  177  2 hits [high GC Gram+]          DNA gyrase subunit A [Frankia alni ACN14a] >gi|111147045|em
. . Rhodobacterales bacterium HTCC2255 ...............................  177  2 hits [a-proteobacteria]       DNA gyrase subunit A [alpha proteobacterium HTCC2255] >gi|1
. . Ethanoligenens harbinense YUAN-3 .................................  177  2 hits [firmicutes]             DNA gyrase, A subunit [Ethanoligenens harbinense YUAN-3] >g
. . Turicibacter sanguinis PC909 .....................................  177  2 hits [firmicutes]             DNA gyrase, A subunit [Turicibacter sanguinis PC909] >gi|29
. . Methylocystis sp. ATCC 49242 .....................................  177  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Methylocystis sp. ATCC 49242] >gi|32
. . Roseiflexus sp. RS-1 .............................................  177  2 hits [GNS bacteria]           DNA gyrase subunit A [Roseiflexus sp. RS-1] >gi|148567000|g
. . Ahrensia sp. R2A130 ..............................................  177  2 hits [a-proteobacteria]       DNA gyrase, A subunit [Ahrensia sp. R2A130] >gi|303296002|g
. . Salinibacter ruber DSM 13855 .....................................  177  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Salinibacter ruber DSM 13855] >gi|83
. . Clavibacter michiganensis subsp. michiganensis NCPPB 382 .........  177  2 hits [high GC Gram+]          DNA gyrase subunit A [Clavibacter michiganensis subsp. mich
. . Streptomyces roseosporus NRRL 15998 ..............................  177  3 hits [high GC Gram+]          DNA gyrase subunit A [Streptomyces roseosporus NRRL 15998] 
. . Streptomyces roseosporus NRRL 11379 ..............................  177  1 hit  [high GC Gram+]          DNA gyrase subunit A [Streptomyces roseosporus NRRL 15998] 
. . Lactobacillus crispatus ST1 ......................................  177  2 hits [firmicutes]             DNA gyrase, a subunit [Lactobacillus crispatus ST1] >gi|295
. . Prevotella tannerae ATCC 51259 ...................................  177  2 hits [CFB group bacteria]     DNA gyrase, A subunit [Prevotella tannerae ATCC 51259] >gi|
. . Lactobacillus paracasei subsp. paracasei ATCC 25302 ..............  176  2 hits [firmicutes]             DNA gyrase, A subunit [Lactobacillus paracasei subsp. parac
. . Verrucomicrobiae bacterium DG1235 ................................  176  2 hits [verrucomicrobia]        DNA gyrase, A subunit [Verrucomicrobiae bacterium DG1235] >
. . Candidatus Sulcia muelleri CARI ..................................  176  2 hits [CFB group bacteria]     DNA gyrase A subunit [Candidatus Sulcia muelleri CARI] >gi|
. . Lactobacillus paracasei subsp. paracasei 8700:2 ..................  176  2 hits [firmicutes]             DNA gyrase subunit A [Lactobacillus paracasei subsp. paraca
. . Lactobacillus casei str. Zhang ...................................  176  2 hits [firmicutes]             DNA gyrase subunit A [Lactobacillus paracasei subsp. paraca
. . Lactobacillus casei BL23 .........................................  176  2 hits [firmicutes]             DNA gyrase, A subunit [Lactobacillus casei BL23] >gi|190711
. . Orientia tsutsugamushi str. Boryong ..............................  176  2 hits [a-proteobacteria]       DNA gyrase subunit A [Orientia tsutsugamushi str. Boryong] 
. Paulinella chromatophora -------------------------------------------  252  4 hits [cercozoans]             DNA gyrase/topoisomerase IV, subunit A [Paulinella chromato
. uncultured methanogenic archaeon RC-I ..............................  204  2 hits [euryarchaeotes]         type II DNA topoisomerase II (gyrase), subunit A [unculture
. Methanosarcina mazei Go1 ...........................................  204  2 hits [euryarchaeotes]         DNA gyrase, subunit A [Methanosarcina mazei Go1] >gi|209070
. Physcomitrella patens subsp. patens ................................  198  2 hits [mosses]                 predicted protein [Physcomitrella patens subsp. patens] >gi
. Methanococcoides burtonii DSM 6242 .................................  198  2 hits [euryarchaeotes]         DNA gyrase subunit A [Methanococcoides burtonii DSM 6242] >
. Methanosaeta thermophila PT ........................................  198  2 hits [euryarchaeotes]         DNA gyrase, A subunit [Methanosaeta thermophila PT] >gi|116
. Ectocarpus siliculosus .............................................  198  1 hit  [brown algae]            DNA gyrase subunit A [Ectocarpus siliculosus]
. Methanosarcina acetivorans C2A .....................................  197  2 hits [euryarchaeotes]         DNA topoisomerase (ATP-hydrolyzing), subunit A [Methanosarc
. Methanosarcina barkeri str. Fusaro .................................  195  2 hits [euryarchaeotes]         DNA gyrase subunit A [Methanosarcina barkeri str. Fusaro] >
. Methanohalobium evestigatum Z-7303 .................................  193  2 hits [euryarchaeotes]         DNA gyrase subunit A [Methanohalobium evestigatum Z-7303] >
. Methanoplanus petrolearius DSM 11571 ...............................  192  2 hits [euryarchaeotes]         DNA gyrase subunit A [Methanoplanus petrolearius DSM 11571]
. Micromonas sp. RCC299 ..............................................  191  2 hits [green algae]            predicted protein [Micromonas sp. RCC299] >gi|226521172|gb|
. Thalassiosira pseudonana CCMP1335 ..................................  189  2 hits [diatoms]                DNA topoisomerase IV, ATP/GTP binding site [Thalassiosira p
. Methanocella paludicola SANAE ......................................  189  2 hits [euryarchaeotes]         DNA gyrase subunit A [Methanocella paludicola SANAE] >gi|28
. Halorhabdus utahensis DSM 12940 ....................................  189  2 hits [euryarchaeotes]         DNA gyrase, A subunit [Halorhabdus utahensis DSM 12940] >gi
. Sorghum bicolor (milo) .............................................  188  2 hits [monocots]               hypothetical protein SORBIDRAFT_01g003750 [Sorghum bicolor]
. Ostreococcus lucimarinus CCE9901 ...................................  188  2 hits [green algae]            predicted protein [Ostreococcus lucimarinus CCE9901] >gi|14
. Halalkalicoccus jeotgali B3 ........................................  187  2 hits [euryarchaeotes]         DNA gyrase, A subunit [Halalkalicoccus jeotgali B3] >gi|299
. Arabidopsis thaliana (thale-cress) .................................  185  4 hits [eudicots]               DNA gyrase subunit A family protein [Arabidopsis thaliana] 
. Natrialba magadii ATCC 43099 .......................................  185  2 hits [euryarchaeotes]         DNA gyrase, A subunit [Natrialba magadii ATCC 43099] >gi|28
. Halobacterium sp. NRC-1 ............................................  185  2 hits [euryarchaeotes]         DNA gyrase subunit A [Halobacterium sp. NRC-1] >gi|16923574
. Halobacterium salinarum R1 .........................................  185  2 hits [euryarchaeotes]         DNA gyrase subunit A [Halobacterium sp. NRC-1] >gi|16923574
. Chlorella variabilis ...............................................  185  1 hit  [green algae]            hypothetical protein CHLNCDRAFT_56398 [Chlorella variabilis]
. Micromonas pusilla CCMP1545 ........................................  184  2 hits [green algae]            predicted protein [Micromonas pusilla CCMP1545] >gi|2264562
. Methanoculleus marisnigri JR1 ......................................  184  2 hits [euryarchaeotes]         DNA gyrase, A subunit [Methanoculleus marisnigri JR1] >gi|1
. uncultured archaeon ................................................  184  1 hit  [archaea]                DNA gyrase subunit A [uncultured archaeon]
. Methanohalophilus mahii DSM 5219 ...................................  184  2 hits [euryarchaeotes]         DNA gyrase subunit A [Methanohalophilus mahii DSM 5219] >gi
. Oryza sativa Japonica Group (Japanese rice) ........................  182  2 hits [monocots]               RecName: Full=Probable DNA gyrase subunit A, chloroplastic/
. Arabidopsis lyrata subsp. lyrata ...................................  182  2 hits [eudicots]               DNA gyrase subunit A family protein [Arabidopsis lyrata sub
. Selaginella moellendorffii .........................................  181  4 hits [club-mosses]            hypothetical protein SELMODRAFT_126010 [Selaginella moellen
. Vitis vinifera (wine grape) ........................................  180  2 hits [eudicots]               PREDICTED: similar to DNA gyrase subunit A, chloroplastic/m
. Methanospirillum hungatei JF-1 .....................................  180  2 hits [euryarchaeotes]         DNA gyrase, A subunit [Methanospirillum hungatei JF-1] >gi|
. Picrophilus torridus DSM 9790 ......................................  180  2 hits [euryarchaeotes]         DNA gyrase subunit A [Picrophilus torridus DSM 9790] >gi|48
. Phaeodactylum tricornutum CCAP 1055/1 ..............................  179  2 hits [diatoms]                predicted protein [Phaeodactylum tricornutum CCAP 1055/1] >
. Haloarcula marismortui ATCC 43049 ..................................  179  2 hits [euryarchaeotes]         DNA gyrase subunit A [Haloarcula marismortui ATCC 43049] >g
. Populus trichocarpa (black cottonwood) .............................  179  2 hits [eudicots]               predicted protein [Populus trichocarpa] >gi|222864442|gb|EE
. Haloterrigena turkmenica DSM 5511 ..................................  178  2 hits [euryarchaeotes]         DNA gyrase, A subunit [Haloterrigena turkmenica DSM 5511] >
. Aureococcus anophagefferens ........................................  177  1 hit  [pelagophytes]           hypothetical protein AURANDRAFT_53761 [Aureococcus anophage
. Halomicrobium mukohataei DSM 12286 .................................  177  2 hits [euryarchaeotes]         DNA gyrase, A subunit [Halomicrobium mukohataei DSM 12286] 
. Methanocorpusculum labreanum Z .....................................  177  2 hits [euryarchaeotes]         DNA gyrase subunit A [Methanocorpusculum labreanum Z] >gi|1

BLAST

PROTOCOLE:


ORF au format Fasta protéique dans BLASTp:


1) Parametres par défaut (NR)

2) "Max target sequences _ 5000" (NR)

3) Paramètres par défaut (SwissProt)


Nous avons sélectionné ce paramètre (2) pour NR car avec les paramètres par défauts nous obtenions 100 hits dont le dernier avait une e-value de 4e-30 (et toujours la même fonction que le permier (le meilleur) alignement) donc c'était encore un très bon alignement, et il y avait l'air d'y en avoir beaucoup d'autres encore qui soient clairement homologues, bien qu'ayant des e-values de moins en moins petites.


Choix d'une valeur seuil (e-value) pour NR et pour Swissprot (plus de détails dans la partie analytique ci-dessous).


NB: Nous avons choisi deux valeurs seuil, l'une pour la recherche sur NR, l'autre pour SwissProt, car l'échelle n'est pas la même dans les deux recherches.




ANALYSE DES RÉSULTATS:


I - DESCRIPTION


Contre la banque NR (nous ne parlerons bien entendu que de la recherche à 5000 alignements max, étant donné que c'est celle dont les résultats sont complets), nous avons obtenu près de 5000 hits avec des e-values allant de 2e-104 à 9.7.


La distribution des HSP est la suivante pour NR:


________________________________________________________________________________

| | | | | |

| <40 | 40-50 | 50-80 | 80-200 | >_200 |

_________________________|_______________|________________|_______________|_______________|_______________|

| | | | | | |

| Nombre de séquences | 81 | 130 | 100 | 4354 | 335 |

|_________________________|_______________|________________|_______________|_______________|_______________|

| | | | | | |

| Gamme de scores | 35.4 à 39.7 | 40 à 48.9 | 50.4 à 79.7 | 80.1 à 199 | 200 à 383 |

|_________________________|_______________|________________|_______________|_______________|_______________|

| | | | | | |

| Gamme des E-values | 9.7 à 0.5 | 0.44 à 0.001 | 4e-04 à 5e-13 | 4e-13 à 3e-49 |3e-49 à 2e-104 |

|_________________________|_______________|________________|_______________|_______________|_______________|


L'immense majorité de ces résultats correspond à la sous unité A de la DNA Topoisomérase IV (bactériennes pour la plupart, en particulier pour les séquences en tête de liste). Par ailleurs notons simplement que les meilleurs hits correspondent à des protéines provenant de différentes cyanobactéries.


Les 7 meilleures séquences subject ont une longueur de 813 acides aminés.

Pour les 7 meilleurs alignements, le premier acide aminé de notre query s'aligne en face du n°228 de la séquence subject, et l'acide aminé n°318 de notre query (le dernier) est en face de l'acide aminé n°545 de la séquence subject.



Quant à l'alignement face à SwissProt, on obtient un total de 92 hits, dont les e-values vont de 2.3e-65 à 7.5, et dont la majorité correspond à des sous unités A de gyrases, c'est à dire de Topoisomérases de type II (ce qui comprend Top II, top VI, et Top IV d'après le résumé d'Interpro entre autres). Certains hits, dont le meilleur, correspondent clairement à Top IV (sous unité A).


La distribution des HSP est la suivante pour SwissProt:

________________________________________________________________________________

| | | | | |

| <40 | 40-50 | 50-80 | 80-200 | >_200 |

_________________________|_______________|________________|_______________|_______________|_______________|

| | | | | | |

| Nombre de séquences | 3 | 1 | 0 | 84 | 4 |

|_________________________|_______________|________________|_______________|_______________|_______________|

| | | | | | |

| Gamme de scores | 31.6 à 37.4 | 40.8 | x | 85.9 à 199 | 206 à 249 |

|_________________________|_______________|________________|_______________|_______________|_______________|

| | | | | | |

| Gamme des E-values | 7.5 à 0.14 | 0.01 | x | 3e-16 à 2e-50 | 1e-52 à 2e-65 |

|_________________________|_______________|________________|_______________|_______________|_______________|


On observe un saut des scores entre 40.8 et 85.9, et les scores supérieurs à ce seuil correspondent à des sous-unités A de gyrases, alors qu'en dessous les protéines n'ont plus rien avoir avec les Topoisomérases.


II - INTERPRETATION


L'hypothèse selon laquelle notre ORF code pour une DNA topoisomérase IV est renforcée par les résultats des deux BLASTS, contre la banque NR plus particulièrement. En effet, toutes ces petites e-values correspondent à cette même enzyme.


Apparemment il manquerait encore une partie assez conséquente de notre ORF de part et d'autre de la séquence, hypothétiquement 227 acides aminés en 5', et 268 acides aminés (_ 813 - 545) en 3'.


Sur le plan taxonomique, cette recherche semble encore confirmer l'hypothèse obtenue via Interpro: les séquences sont principalement issues de bactéries.



III - CONCLUSION


Ici nous avons de quoi être pratiquement sûrs que notre ORF code pour une sous unité A de DNA Topoisomérase IV.

Du moins c'est le cas le la portion d'ORF qui se trouve dans notre séquence. En effet, on savait dès la recherche d'ORFs que la fin de notre ORF était manquante (pas de codon stop), et maintenant on vient d'apprendre que c'est aussi le cas du début de l'ORF.


L'appartenance taxonomique de la séquence reste à prouver, peut être à l'étape de l'arbre, nous ne pouvons pour le moment formuler que des hypothèses à ce sujet (bien qu'il ne soit pas improbable que la séquence provienne d'une cyanobactérie),ainsi qu'au sujet des longueurs manquantes en 5' et en 3' de notre ORF.


Nous formulons cependant l'hypothèse suivante: cette ORF potentielle serait incomplète en 5' de 303 acides aminés, et en 3' de 268 acides aminés. Dans ce cas nous aurions donc ici (242 * 100) / 813 _ moins d'un tiers de la séquence codant pour la sous unité A de la DNA Topoisomérase IV.


Il est interessant de souligner une particulière importance de la DNA Topoisomérase IV chez Prochlorococcus marinus; Prochlorococcus marinus etant une cyanobactérie ayant au cours de l'évolution diminué de taille (notamment pour mieux utiliser la lumière extérieure puisque c'est un organisme photosynthétique), elle a donc du trouver des méthodes pour réduire sa taille, à commencer par celle de son génome; diminution du nombre de gènes présents en plusieurs copies, voire même sacrifice de certains gênes qui ont alors totalement disparu. Or nous avons rappelé précédemment que la DNA Topoisomérase IV servait à surenrouler négativement l'ADN, ce qui a pour conséquence une diminution de l'espace occupé par celui-ci, c'est donc un outil très utile pour Prochlorococcus marinus.

Ça n'est cependant qu'une parenthèse car nous ne sommes pas encore sûrs du tout que notre séquence à nous provient de cette (cyano)bactérie.


Voila donc ou nous en sommes rendus: cette séquence coderait pour une partie la sous-unité A de la DNA Topoisomérase IV, d'une bactérie probablement.

Cela est cohérent avec les résultats issus d'Interpro.






























RÉSULTATS BRUTS:

PLAN:

1 - Liste complète des hits (NR)
2 - Liste complète des hits (SwissProt)

3 - Liste des meilleurs hits (NR)
4 - Liste des meilleurs hits (SwissProt)

***

Liste complète des hits obtenus par l'alignement avec BLASTp de notre ORF traduite, suivant le paramètre 
["Max target sequences" = 5000], contre NR:



Accession 	Description 	Max score 	Total score 	Query coverage 	E value 	Links
NP_892126.1 	
DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >emb|CAE18464.1| DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
	383 	383 	99% 	2e-104	Gene info linked to NP_892126.1
YP_001010320.1 	
DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. MIT 9515] >gb|ABM71213.1| DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. MIT 9515]
	377 	377 	100% 	9e-103	Gene info linked to YP_001010320.1
YP_001090228.1 	
DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. MIT 9301] >gb|ABO16627.1| DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. MIT 9301]
	361 	361 	100% 	7e-98	Gene info linked to YP_001090228.1
YP_396502.1 	
DNA topoisomerase IV subunit A [Prochlorococcus marinus str. MIT 9312] >gb|ABB49066.1| DNA topoisomerase IV subunit A [Prochlorococcus marinus str. MIT 9312]
	359 	359 	100% 	3e-97	Gene info linked to YP_396502.1
ZP_05137740.1 	
DNA gyrase/topoisomerase IV, A subunit domain protein [Prochlorococcus marinus str. MIT 9202] >gb|EEE39565.1| DNA gyrase/topoisomerase IV, A subunit domain protein [Prochlorococcus marinus str. MIT 9202]
	356 	356 	100% 	2e-96	
YP_001008399.1 	
DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. AS9601] >gb|ABM69292.1| DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. AS9601]
	348 	348 	100% 	8e-94	Gene info linked to YP_001008399.1
YP_001483209.1 	
DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. MIT 9215] >gb|ABV49623.1| DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. MIT 9215]
	346 	346 	100% 	2e-93	Gene info linked to YP_001483209.1
YP_001226261.1 	
DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. RCC307] >emb|CAK26908.1| DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. RCC307]
	297 	297 	82% 	2e-78	Gene info linked to YP_001226261.1
ZP_07969861.1 	
DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. CB0205]
	296 	296 	83% 	3e-78	
YP_001223728.1 	
DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. WH 7803] >emb|CAK22431.1| DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. WH 7803]
	289 	289 	83% 	4e-76	Gene info linked to YP_001223728.1
ZP_07974926.1 	
DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. CB0101]
	287 	287 	83% 	1e-75	
NP_896103.1 	
putative DNA topoisomerase chain A [Synechococcus sp. WH 8102] >emb|CAE06520.1| putative DNA topoisomerase chain A [Synechococcus sp. WH 8102]
	285 	285 	90% 	4e-75	Gene info linked to NP_896103.1
YP_001549889.1 	
DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. MIT 9211] >gb|ABX07935.1| DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. MIT 9211]
	285 	285 	83% 	5e-75	Gene info linked to YP_001549889.1
NP_893838.1 	
DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. MIT 9313] >emb|CAE20180.1| DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. MIT 9313]
	284 	284 	83% 	1e-74	Gene info linked to NP_893838.1
ZP_05046149.1 	
DNA gyrase/topoisomerase IV, A subunit domain protein [Cyanobium sp. PCC 7001] >gb|EDY39458.1| DNA gyrase/topoisomerase IV, A subunit domain protein [Cyanobium sp. PCC 7001]
	284 	284 	83% 	1e-74	
YP_001016026.1 	
DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. MIT 9303] >gb|ABM76761.1| DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. MIT 9303]
	281 	281 	83% 	8e-74	Gene info linked to YP_001016026.1
ZP_01084396.1 	
DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. WH 5701] >gb|EAQ75727.1| DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. WH 5701]
	281 	281 	83% 	1e-73	
YP_380342.1 	
DNA topoisomerase IV subunit A [Synechococcus sp. CC9605] >gb|ABB33787.1| DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. CC9605]
	279 	279 	94% 	4e-73	Gene info linked to YP_380342.1
YP_001013833.1 	
DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. NATL1A] >gb|ABM74568.1| DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. NATL1A]
	278 	278 	83% 	9e-73	Gene info linked to YP_001013833.1
ZP_05789792.1 	
DNA gyrase subunit A [Synechococcus sp. WH 8109] >gb|EEX06992.1| DNA gyrase subunit A [Synechococcus sp. WH 8109]
	277 	277 	94% 	1e-72	
YP_729244.1 	
DNA gyrase subunit A [Synechococcus sp. CC9311] >gb|ABI46187.1| DNA gyrase subunit A [Synechococcus sp. CC9311]
	277 	277 	83% 	1e-72	Gene info linked to YP_729244.1
NP_874399.1 	
Type IIA topoisomerase, A subunit, ParC [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gb|AAP99051.1| Type IIA topoisomerase, A subunit, ParC [Prochlorococcus marinus subsp. marinus str. CCMP1375]
	277 	277 	83% 	2e-72	Gene info linked to NP_874399.1
YP_400711.1 	
DNA topoisomerase IV subunit A [Synechococcus elongatus PCC 7942] >gb|ABB57724.1| DNA topoisomerase IV subunit A [Synechococcus elongatus PCC 7942]
	275 	275 	88% 	6e-72	Gene info linked to YP_400711.1
YP_292524.1 	
DNA topoisomerase IV subunit A [Prochlorococcus marinus str. NATL2A] >gb|AAZ58821.1| DNA topoisomerase IV subunit A [Prochlorococcus marinus str. NATL2A]
	275 	275 	83% 	8e-72	Gene info linked to YP_292524.1
ZP_01469071.1 	
DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. BL107] >gb|EAU71184.1| DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. BL107]
	274 	274 	92% 	1e-71	
YP_173106.1 	
DNA gyrase A subunit [Synechococcus elongatus PCC 6301] >dbj|BAD80586.1| DNA gyrase A subunit [Synechococcus elongatus PCC 6301]
	273 	273 	88% 	3e-71	Gene info linked to YP_173106.1
YP_376023.1 	
DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. CC9902] >gb|ABB24980.1| DNA topoisomerase IV subunit A [Synechococcus sp. CC9902]
	272 	272 	92% 	3e-71	Gene info linked to YP_376023.1
ZP_01124867.1 	
DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. WH 7805] >gb|EAR17737.1| DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. WH 7805]
	270 	270 	83% 	1e-70	
ZP_05035454.1 	
DNA gyrase/topoisomerase IV, A subunit domain protein [Synechococcus sp. PCC 7335] >gb|EDX84189.1| DNA gyrase/topoisomerase IV, A subunit domain protein [Synechococcus sp. PCC 7335]
	263 	263 	82% 	3e-68	
YP_476273.1 	
type II DNA topoisomerase, A subunit [Synechococcus sp. JA-2-3B'a(2-13)] >gb|ABD01010.1| type II DNA topoisomerase, A subunit [Synechococcus sp. JA-2-3B'a(2-13)]
	263 	263 	85% 	3e-68	Gene info linked to YP_476273.1
ZP_05031045.1 	
DNA gyrase/topoisomerase IV, A subunit domain protein [Microcoleus chthonoplastes PCC 7420] >gb|EDX70974.1| DNA gyrase/topoisomerase IV, A subunit domain protein [Microcoleus chthonoplastes PCC 7420]
	261 	261 	82% 	8e-68	
YP_002371577.1 	
DNA topoisomerase [Cyanothece sp. PCC 8801] >gb|ACK65421.1| DNA topoisomerase (ATP-hydrolyzing) [Cyanothece sp. PCC 8801]
	261 	261 	83% 	1e-67	Gene info linked to YP_002371577.1
YP_001805955.1 	
DNA gyrase subunit A [Cyanothece sp. ATCC 51142] >gb|ACB53889.1| DNA gyrase A subunit [Cyanothece sp. ATCC 51142]
	259 	259 	83% 	3e-67	Gene info linked to YP_001805955.1
YP_003137143.1 	
DNA topoisomerase (ATP-hydrolyzing) [Cyanothece sp. PCC 8802] >gb|ACV00308.1| DNA topoisomerase (ATP-hydrolyzing) [Cyanothece sp. PCC 8802]
	259 	259 	83% 	3e-67	Gene info linked to YP_003137143.1
ZP_01631392.1 	
DNA topoisomerase chain A [Nodularia spumigena CCY9414] >gb|EAW43970.1| DNA topoisomerase chain A [Nodularia spumigena CCY9414]
	258 	258 	83% 	7e-67	
ZP_01079195.1 	
putative DNA topoisomerase chain A [Synechococcus sp. RS9917] >gb|EAQ70320.1| putative DNA topoisomerase chain A [Synechococcus sp. RS9917]
	258 	258 	83% 	7e-67	
ZP_01471542.1 	
putative DNA topoisomerase chain A [Synechococcus sp. RS9916] >gb|EAU75337.1| putative DNA topoisomerase chain A [Synechococcus sp. RS9916]
	258 	258 	94% 	8e-67	
YP_473504.1 	
type II DNA topoisomerase, A subunit [Synechococcus sp. JA-3-3Ab] >gb|ABC98241.1| type II DNA topoisomerase, A subunit [Synechococcus sp. JA-3-3Ab]
	258 	258 	87% 	1e-66	Gene info linked to YP_473504.1
ZP_01730961.1 	
DNA gyrase, subunit A [Cyanothece sp. CCY0110] >gb|EAZ89635.1| DNA gyrase, subunit A [Cyanothece sp. CCY0110]
	256 	256 	83% 	4e-66	
YP_002482102.1 	
DNA gyrase subunit A [Cyanothece sp. PCC 7425] >gb|ACL43741.1| DNA gyrase, A subunit [Cyanothece sp. PCC 7425]
	255 	255 	82% 	6e-66	Gene info linked to YP_002482102.1
YP_001735181.1 	
DNA topoisomerase chain A [Synechococcus sp. PCC 7002] >gb|ACA99925.1| DNA topoisomerase chain A [Synechococcus sp. PCC 7002]
	255 	255 	82% 	7e-66	Gene info linked to YP_001735181.1
YP_003889786.1 	
DNA topoisomerase (ATP-hydrolyzing) [Cyanothece sp. PCC 7822] >gb|ADN16511.1| DNA topoisomerase (ATP-hydrolyzing) [Cyanothece sp. PCC 7822]
	253 	253 	82% 	2e-65	Gene info linked to YP_003889786.1
BAI92883.1 	
DNA gyrase A subunit [Arthrospira platensis NIES-39]
	253 	253 	82% 	3e-65	
YP_002376253.1 	
DNA topoisomerase (ATP-hydrolyzing) [Cyanothece sp. PCC 7424] >gb|ACK69385.1| DNA topoisomerase (ATP-hydrolyzing) [Cyanothece sp. PCC 7424]
	252 	252 	83% 	4e-65	Gene info linked to YP_002376253.1
YP_002049056.1 	
DNA gyrase/topoisomerase IV, subunit A [Paulinella chromatophora] >gb|ACB42846.1| DNA gyrase/topoisomerase IV, subunit A [Paulinella chromatophora]
	252 	252 	82% 	5e-65	Gene info linked to YP_002049056.1
ZP_07108894.1 	
DNA topoisomerase IV subunit A [Oscillatoria sp. PCC 6506] >emb|CBN54040.1| DNA topoisomerase IV subunit A [Oscillatoria sp. PCC 6506]
	252 	252 	83% 	6e-65	
ZP_03272202.1 	
DNA topoisomerase (ATP-hydrolyzing) [Arthrospira maxima CS-328] >gb|EDZ96354.1| DNA topoisomerase (ATP-hydrolyzing) [Arthrospira maxima CS-328]
	252 	252 	83% 	6e-65	
YP_721629.1 	
DNA topoisomerase IV subunit A [Trichodesmium erythraeum IMS101] >gb|ABG51156.1| DNA topoisomerase IV subunit A [Trichodesmium erythraeum IMS101]
	251 	251 	85% 	8e-65	Gene info linked to YP_721629.1
YP_003421400.1 	
DNA topoisomerase IV subunit A [cyanobacterium UCYN-A] >gb|ADB95042.1| DNA topoisomerase IV subunit A [cyanobacterium UCYN-A]
	251 	251 	83% 	8e-65	Gene info linked to YP_003421400.1
ZP_00514908.1 	
DNA topoisomerase (ATP-hydrolyzing) [Crocosphaera watsonii WH 8501] >gb|EAM51743.1| DNA topoisomerase (ATP-hydrolyzing) [Crocosphaera watsonii WH 8501]
	251 	251 	83% 	1e-64	
ZP_06304493.1 	
DNA topoisomerase 4 subunit A [Raphidiopsis brookii D9] >gb|EFA73460.1| DNA topoisomerase 4 subunit A [Raphidiopsis brookii D9]
	251 	251 	83% 	1e-64	
ZP_06309081.1 	
DNA gyrase, subunit A [Cylindrospermopsis raciborskii CS-505] >gb|EFA68948.1| DNA gyrase, subunit A [Cylindrospermopsis raciborskii CS-505]
	250 	250 	83% 	2e-64	
NP_440422.1 	
DNA gyrase A subunit [Synechocystis sp. PCC 6803] >dbj|BAA17102.1| DNA gyrase A subunit [Synechocystis sp. PCC 6803]
	249 	249 	87% 	4e-64	Gene info linked to NP_440422.1
YP_323362.1 	
DNA topoisomerase IV subunit A [Anabaena variabilis ATCC 29413] >gb|ABA22467.1| DNA topoisomerase IV subunit A [Anabaena variabilis ATCC 29413]
	249 	249 	82% 	4e-64	Gene info linked to YP_323362.1
P73077.2 	
RecName: Full=DNA topoisomerase 4 subunit A; AltName: Full=Topoisomerase IV subunit A
	249 	249 	87% 	5e-64	
CAO87714.1 	
unnamed protein product [Microcystis aeruginosa PCC 7806]
	248 	248 	82% 	6e-64	
YP_001661003.1 	
DNA gyrase subunit A [Microcystis aeruginosa NIES-843] >dbj|BAG05811.1| DNA gyrase subunit A [Microcystis aeruginosa NIES-843]
	248 	248 	82% 	6e-64	Gene info linked to YP_001661003.1
NP_484485.1 	
DNA topoisomerase chain A [Nostoc sp. PCC 7120] >dbj|BAB72399.1| DNA topoisomerase chain A [Nostoc sp. PCC 7120]
	246 	246 	87% 	4e-63	Gene info linked to NP_484485.1
ZP_01622511.1 	
DNA topoisomerase chain A [Lyngbya sp. PCC 8106] >gb|EAW35477.1| DNA topoisomerase chain A [Lyngbya sp. PCC 8106]
	245 	245 	83% 	6e-63	
YP_001869592.1 	
DNA gyrase, A subunit [Nostoc punctiforme PCC 73102] >gb|ACC84649.1| DNA gyrase, A subunit [Nostoc punctiforme PCC 73102]
	244 	244 	82% 	8e-63	Gene info linked to YP_001869592.1
YP_001520001.1 	
DNA gyrase, A subunit [Acaryochloris marina MBIC11017] >gb|ABW30682.1| DNA gyrase, A subunit [Acaryochloris marina MBIC11017]
	244 	244 	82% 	1e-62	Gene info linked to YP_001520001.1
YP_003721789.1 	
DNA gyrase subunit A ['Nostoc azollae' 0708] >gb|ADI64666.1| DNA gyrase, A subunit ['Nostoc azollae' 0708]
	243 	243 	83% 	2e-62	Gene info linked to YP_003721789.1
YP_003887256.1 	
DNA gyrase subunit A [Cyanothece sp. PCC 7822] >gb|ADN13981.1| DNA gyrase, A subunit [Cyanothece sp. PCC 7822]
	239 	239 	97% 	4e-61	Gene info linked to YP_003887256.1
NP_682407.1 	
DNA gyrase A subunit [Thermosynechococcus elongatus BP-1] >dbj|BAC09169.1| DNA gyrase A subunit [Thermosynechococcus elongatus BP-1]
	236 	236 	82% 	2e-60	Gene info linked to NP_682407.1
ZP_06380700.1 	
DNA topoisomerase IV subunit A [Arthrospira platensis str. Paraca]
	235 	235 	77% 	7e-60	
ZP_03275809.1 	
DNA gyrase, A subunit [Arthrospira maxima CS-328] >gb|EDZ92632.1| DNA gyrase, A subunit [Arthrospira maxima CS-328]
	233 	233 	96% 	3e-59	
YP_001805815.1 	
DNA gyrase subunit A [Cyanothece sp. ATCC 51142] >gb|ACB53749.1| DNA gyrase A subunit [Cyanothece sp. ATCC 51142]
	233 	233 	96% 	3e-59	Gene info linked to YP_001805815.1
YP_002379896.1 	
DNA gyrase subunit A [Cyanothece sp. PCC 7424] >gb|ACK73028.1| DNA gyrase, A subunit [Cyanothece sp. PCC 7424]
	231 	231 	97% 	1e-58	Gene info linked to YP_002379896.1
YP_001655459.1 	
DNA gyrase subunit A [Microcystis aeruginosa NIES-843] >dbj|BAG00267.1| DNA gyrase subunit A [Microcystis aeruginosa NIES-843]
	231 	231 	96% 	1e-58	Gene info linked to YP_001655459.1
ZP_06380061.1 	
DNA gyrase subunit A [Arthrospira platensis str. Paraca] >dbj|BAI91424.1| DNA gyrase A subunit [Arthrospira platensis NIES-39]
	230 	230 	96% 	2e-58	
ZP_05025901.1 	
DNA gyrase, A subunit [Microcoleus chthonoplastes PCC 7420] >gb|EDX76081.1| DNA gyrase, A subunit [Microcoleus chthonoplastes PCC 7420]
	230 	230 	96% 	2e-58	
ZP_01629896.1 	
DNA gyrase subunit A [Nodularia spumigena CCY9414] >gb|EAW45444.1| DNA gyrase subunit A [Nodularia spumigena CCY9414]
	229 	229 	96% 	4e-58	
CAO91224.1 	
gyrA [Microcystis aeruginosa PCC 7806]
	228 	228 	96% 	7e-58	
YP_001517425.1 	
DNA gyrase subunit A [Acaryochloris marina MBIC11017] >gb|ABW28109.1| DNA gyrase, A subunit [Acaryochloris marina MBIC11017]
	227 	227 	87% 	1e-57	Gene info linked to YP_001517425.1
NP_442310.1 	
DNA gyrase subunit A [Synechocystis sp. PCC 6803] >sp|Q55738.1|GYRA_SYNY3 RecName: Full=DNA gyrase subunit A >dbj|BAA10380.1| DNA gyrase A subunit [Synechocystis sp. PCC 6803]
	227 	227 	96% 	1e-57	Gene info linked to NP_442310.1
YP_171969.1 	
DNA gyrase subunit A [Synechococcus elongatus PCC 6301] >ref|YP_399273.1| DNA gyrase subunit A [Synechococcus elongatus PCC 7942] >dbj|BAD79449.1| DNA gyrase A subunit [Synechococcus elongatus PCC 6301] >gb|ABB56286.1| DNA gyrase subunit A [Synechococcus elongatus PCC 7942]
	227 	227 	96% 	2e-57	Gene info linked to YP_171969.1
YP_324957.1 	
DNA gyrase subunit A [Anabaena variabilis ATCC 29413] >gb|ABA24062.1| DNA gyrase subunit A [Anabaena variabilis ATCC 29413]
	226 	226 	96% 	3e-57	Gene info linked to YP_324957.1
YP_474847.1 	
DNA gyrase subunit A [Synechococcus sp. JA-3-3Ab] >gb|ABC99584.1| DNA gyrase, A subunit [Synechococcus sp. JA-3-3Ab]
	226 	226 	83% 	4e-57	Gene info linked to YP_474847.1
NP_484903.1 	
DNA gyrase subunit A [Nostoc sp. PCC 7120] >dbj|BAB72817.1| DNA gyrase A subunit [Nostoc sp. PCC 7120]
	226 	226 	96% 	4e-57	Gene info linked to NP_484903.1
YP_001226998.1 	
DNA gyrase subunit A [Synechococcus sp. RCC307] >emb|CAK27645.1| DNA gyrase/topoisomerase IV, subunit A [Synechococcus sp. RCC307]
	225 	225 	83% 	7e-57	Gene info linked to YP_001226998.1
NP_682159.1 	
DNA gyrase subunit A [Thermosynechococcus elongatus BP-1] >dbj|BAC08921.1| DNA gyrase A subunit [Thermosynechococcus elongatus BP-1]
	225 	225 	96% 	7e-57	Gene info linked to NP_682159.1
YP_477834.1 	
DNA gyrase subunit A [Synechococcus sp. JA-2-3B'a(2-13)] >gb|ABD02571.1| DNA gyrase, A subunit [Synechococcus sp. JA-2-3B'a(2-13)]
	224 	224 	83% 	1e-56	Gene info linked to YP_477834.1
YP_361486.1 	
DNA gyrase subunit A [Carboxydothermus hydrogenoformans Z-2901] >gb|ABB16016.1| DNA gyrase, A subunit [Carboxydothermus hydrogenoformans Z-2901]
	223 	223 	96% 	2e-56	Gene info linked to YP_361486.1
ZP_06304524.1 	
DNA gyrase, subunit A [Raphidiopsis brookii D9] >gb|EFA73491.1| DNA gyrase, subunit A [Raphidiopsis brookii D9]
	223 	223 	88% 	3e-56	
ZP_01727923.1 	
DNA gyrase subunit A [Cyanothece sp. CCY0110] >gb|EAZ92637.1| DNA gyrase subunit A [Cyanothece sp. CCY0110]
	223 	223 	96% 	4e-56	
ZP_07113806.1 	
DNA gyrase subunit A [Oscillatoria sp. PCC 6506] >emb|CBN59004.1| DNA gyrase subunit A [Oscillatoria sp. PCC 6506]
	222 	222 	88% 	4e-56	
YP_001734086.1 	
DNA gyrase subunit A [Synechococcus sp. PCC 7002] >gb|ACA98830.1| DNA gyrase, A subunit [Synechococcus sp. PCC 7002]
	222 	222 	96% 	4e-56	Gene info linked to YP_001734086.1
YP_002370808.1 	
DNA gyrase subunit A [Cyanothece sp. PCC 8801] >ref|YP_003136361.1| DNA gyrase, A subunit [Cyanothece sp. PCC 8802] >gb|ACK64652.1| DNA gyrase, A subunit [Cyanothece sp. PCC 8801] >gb|ACU99525.1| DNA gyrase, A subunit [Cyanothece sp. PCC 8802]
	221 	221 	96% 	8e-56	Gene info linked to YP_002370808.1
YP_003720163.1 	
DNA gyrase subunit A ['Nostoc azollae' 0708] >gb|ADI63040.1| DNA gyrase, A subunit ['Nostoc azollae' 0708]
	221 	221 	88% 	1e-55	Gene info linked to YP_003720163.1
ZP_07972247.1 	
DNA gyrase subunit A [Synechococcus sp. CB0101]
	221 	221 	83% 	1e-55	
YP_001916195.1 	
DNA gyrase subunit A [Natranaerobius thermophilus JW/NM-WN-LF] >gb|ACB83607.1| DNA gyrase subunit A [Natranaerobius thermophilus JW/NM-WN-LF]
	221 	221 	96% 	1e-55	Gene info linked to YP_001916195.1
ZP_01621207.1 	
DNA gyrase subunit A [Lyngbya sp. PCC 8106] >gb|EAW36902.1| DNA gyrase subunit A [Lyngbya sp. PCC 8106]
	220 	220 	96% 	2e-55	
YP_001863771.1 	
DNA gyrase subunit A [Nostoc punctiforme PCC 73102] >gb|ACC78828.1| DNA gyrase, A subunit [Nostoc punctiforme PCC 73102]
	219 	219 	96% 	3e-55	Gene info linked to YP_001863771.1
ZP_02621906.1 	
DNA gyrase, A subunit [Clostridium botulinum C str. Eklund] >gb|EDS76898.1| DNA gyrase, A subunit [Clostridium botulinum C str. Eklund]
	219 	219 	85% 	5e-55	
NP_924996.1 	
DNA gyrase subunit A [Gloeobacter violaceus PCC 7421] >dbj|BAC89991.1| DNA gyrase subunit A [Gloeobacter violaceus PCC 7421]
	218 	218 	85% 	6e-55	Gene info linked to NP_924996.1
NP_926028.1 	
DNA gyrase subunit A [Gloeobacter violaceus PCC 7421] >dbj|BAC91023.1| DNA gyrase subunit A [Gloeobacter violaceus PCC 7421]
	218 	218 	88% 	7e-55	Gene info linked to NP_926028.1
ZP_00516705.1 	
DNA gyrase, subunit A [Crocosphaera watsonii WH 8501] >gb|EAM50221.1| DNA gyrase, subunit A [Crocosphaera watsonii WH 8501]
	218 	218 	96% 	7e-55	
YP_002483494.1 	
DNA gyrase subunit A [Cyanothece sp. PCC 7425] >gb|ACL45133.1| DNA gyrase, A subunit [Cyanothece sp. PCC 7425]
	218 	218 	96% 	9e-55	Gene info linked to YP_002483494.1
ZP_07971836.1 	
DNA gyrase subunit A [Synechococcus sp. CB0205]
	218 	218 	83% 	1e-54	
ZP_06307443.1 	
DNA gyrase, subunit A [Cylindrospermopsis raciborskii CS-505] >gb|EFA70565.1| DNA gyrase, subunit A [Cylindrospermopsis raciborskii CS-505]
	218 	218 	88% 	1e-54	
YP_003421432.1 	
DNA gyrase subunit A [cyanobacterium UCYN-A] >gb|ADB95074.1| DNA gyrase subunit A [cyanobacterium UCYN-A]
	217 	217 	96% 	1e-54	Gene info linked to YP_003421432.1
YP_879292.1 	
DNA gyrase subunit A [Clostridium novyi NT] >gb|ABK62674.1| DNA gyrase, A subunit [Clostridium novyi NT]
	217 	217 	85% 	2e-54	Gene info linked to YP_879292.1
YP_077289.1 	
DNA gyrase subunit A [Bacillus licheniformis ATCC 14580] >ref|YP_089691.1| DNA gyrase subunit A [Bacillus licheniformis ATCC 14580] >ref|ZP_08002741.1| DNA gyrase subunit A [Bacillus sp. BT1B_CT2] >gb|AAU21651.1| DNA gyrase (subunit A) [Bacillus licheniformis ATCC 14580] >gb|AAU38998.1| GyrA [Bacillus licheniformis ATCC 14580] >gb|EFV70415.1| DNA gyrase subunit A [Bacillus sp. BT1B_CT2]
	216 	216 	90% 	3e-54	Gene info linked to YP_077289.1
ZP_03224725.1 	
DNA gyrase subunit A [Bacillus coahuilensis m4-4]
	216 	216 	90% 	4e-54	
YP_001419686.1 	
DNA gyrase subunit A [Bacillus amyloliquefaciens FZB42] >gb|ABS72455.1| GyrA [Bacillus amyloliquefaciens FZB42]
	216 	216 	90% 	5e-54	Gene info linked to YP_001419686.1
YP_001785342.1 	
DNA gyrase subunit A [Clostridium botulinum A3 str. Loch Maree] >gb|ACA53600.1| DNA gyrase, A subunit [Clostridium botulinum A3 str. Loch Maree]
	215 	215 	90% 	5e-54	Gene info linked to YP_001785342.1
YP_001382417.1 	
DNA gyrase subunit A [Clostridium botulinum A str. ATCC 19397] >ref|YP_001385969.1| DNA gyrase subunit A [Clostridium botulinum A str. Hall] >gb|ABS33745.1| DNA gyrase, A subunit [Clostridium botulinum A str. ATCC 19397] >gb|ABS37030.1| DNA gyrase, A subunit [Clostridium botulinum A str. Hall]
	215 	215 	85% 	7e-54	Gene info linked to YP_001382417.1
YP_001252559.1 	
DNA gyrase, A subunit [Clostridium botulinum A str. ATCC 3502] >emb|CAL81561.1| DNA gyrase subunit A [Clostridium botulinum A str. ATCC 3502]
	215 	215 	85% 	7e-54	Gene info linked to YP_001252559.1
CBZ01835.1 	
DNA gyrase subunit A [Clostridium botulinum H04402 065]
	215 	215 	85% 	7e-54	
YP_001389376.1 	
DNA gyrase subunit A [Clostridium botulinum F str. Langeland] >gb|ABS39653.1| DNA gyrase, A subunit [Clostridium botulinum F str. Langeland]
	215 	215 	85% 	7e-54	Gene info linked to YP_001389376.1
ADF97860.1 	
DNA gyrase, A subunit [Clostridium botulinum F str. 230613]
	215 	215 	85% 	7e-54	
YP_001779633.1 	
DNA gyrase subunit A [Clostridium botulinum B1 str. Okra] >gb|ACA45883.1| DNA gyrase, A subunit [Clostridium botulinum B1 str. Okra]
	215 	215 	85% 	7e-54	Gene info linked to YP_001779633.1
ZP_02615786.1 	
DNA gyrase, A subunit [Clostridium botulinum NCTC 2916] >gb|EDT80065.1| DNA gyrase, A subunit [Clostridium botulinum NCTC 2916]
	215 	215 	85% 	7e-54	
YP_002802320.1 	
DNA gyrase, A subunit [Clostridium botulinum A2 str. Kyoto] >gb|ACO83422.1| DNA gyrase, A subunit [Clostridium botulinum A2 str. Kyoto]
	215 	215 	85% 	8e-54	Gene info linked to YP_002802320.1
ZP_02206369.1 	
hypothetical protein COPEUT_01135 [Coprococcus eutactus ATCC 27759] >gb|EDP26660.1| hypothetical protein COPEUT_01135 [Coprococcus eutactus ATCC 27759]
	215 	215 	82% 	8e-54	
YP_002948214.1 	
DNA gyrase, A subunit [Geobacillus sp. WCH70] >gb|ACS22948.1| DNA gyrase, A subunit [Geobacillus sp. WCH70]
	214 	214 	96% 	9e-54	Gene info linked to YP_002948214.1
CBK83419.1 	
DNA gyrase subunit A [Coprococcus sp. ART55/1]
	214 	214 	82% 	1e-53	
YP_003918603.1 	
DNA gyrase (subunit A) [Bacillus amyloliquefaciens DSM 7] >emb|CBI41133.1| DNA gyrase (subunit A) [Bacillus amyloliquefaciens DSM 7]
	214 	214 	90% 	1e-53	Gene info linked to YP_003918603.1
YP_003587932.1 	
DNA gyrase, A subunit [Bacillus tusciae DSM 2912] >gb|ADG04788.1| DNA gyrase, A subunit [Bacillus tusciae DSM 2912]
	214 	214 	88% 	1e-53	Gene info linked to YP_003587932.1
YP_003841562.1 	
DNA gyrase, A subunit [Clostridium cellulovorans 743B] >ref|ZP_07630328.1| DNA gyrase subunit A [Clostridium cellulovorans 743B] >gb|ADL49798.1| DNA gyrase, A subunit [Clostridium cellulovorans 743B]
	214 	214 	86% 	1e-53	Gene info linked to YP_003841562.1
ZP_05035788.1 	
DNA gyrase, A subunit [Synechococcus sp. PCC 7335] >gb|EDX84523.1| DNA gyrase, A subunit [Synechococcus sp. PCC 7335]
	214 	214 	96% 	2e-53	
YP_723663.1 	
DNA gyrase subunit A [Trichodesmium erythraeum IMS101] >gb|ABG53190.1| DNA gyrase subunit A [Trichodesmium erythraeum IMS101]
	213 	213 	96% 	2e-53	Gene info linked to YP_723663.1
YP_002507765.1 	
DNA gyrase, A subunit [Halothermothrix orenii H 168] >gb|ACL68770.1| DNA gyrase, A subunit [Halothermothrix orenii H 168]
	213 	213 	96% 	3e-53	Gene info linked to YP_002507765.1
ZP_05138302.1 	
DNA gyrase, A subunit [Prochlorococcus marinus str. MIT 9202] >gb|EEE40127.1| DNA gyrase, A subunit [Prochlorococcus marinus str. MIT 9202]
	213 	213 	83% 	3e-53	
ZP_04862095.1 	
DNA gyrase, A subunit [Clostridium botulinum D str. 1873] >gb|EES91986.1| DNA gyrase, A subunit [Clostridium botulinum D str. 1873]
	213 	213 	85% 	3e-53	
ACN43201.1 	
DNA gyrase subunit A [Bacillus subtilis]
	213 	213 	83% 	3e-53	
YP_145859.1 	
DNA gyrase subunit A [Geobacillus kaustophilus HTA426] >ref|YP_003251188.1| DNA gyrase, A subunit [Geobacillus sp. Y412MC61] >ref|YP_003669657.1| DNA gyrase, A subunit [Geobacillus sp. C56-T3] >ref|YP_004130665.1| DNA gyrase, A subunit [Geobacillus sp. Y412MC52] >dbj|BAD74291.1| DNA gyrase subunit A [Geobacillus kaustophilus HTA426] >gb|ACX76706.1| DNA gyrase, A subunit [Geobacillus sp. Y412MC61] >gb|ADI25080.1| DNA gyrase, A subunit [Geobacillus sp. C56-T3] >gb|ADU92522.1| DNA gyrase, A subunit [Geobacillus sp. Y412MC52]
	213 	213 	96% 	3e-53	Gene info linked to YP_145859.1
ZP_03754811.1 	
hypothetical protein ROSEINA2194_03240 [Roseburia inulinivorans DSM 16841] >gb|EEG92920.1| hypothetical protein ROSEINA2194_03240 [Roseburia inulinivorans DSM 16841]
	213 	213 	94% 	4e-53	
ZP_08005239.1 	
DNA gyrase subunit A [Bacillus sp. 2_A_57_CT2] >gb|EFV77979.1| DNA gyrase subunit A [Bacillus sp. 2_A_57_CT2]
	213 	213 	96% 	4e-53	
YP_002860879.1 	
DNA gyrase, A subunit [Clostridium botulinum Ba4 str. 657] >gb|ACQ53857.1| DNA gyrase, A subunit [Clostridium botulinum Ba4 str. 657]
	213 	213 	85% 	4e-53	Gene info linked to YP_002860879.1
ZP_02618397.1 	
DNA gyrase, A subunit [Clostridium botulinum Bf] >gb|EDT85156.1| DNA gyrase, A subunit [Clostridium botulinum Bf]
	213 	213 	85% 	4e-53	
ZP_02993834.1 	
hypothetical protein CLOSPO_00917 [Clostridium sporogenes ATCC 15579] >gb|EDU38091.1| hypothetical protein CLOSPO_00917 [Clostridium sporogenes ATCC 15579]
	212 	212 	85% 	4e-53	
YP_397569.1 	
DNA gyrase subunit A [Prochlorococcus marinus str. MIT 9312] >gb|ABB50133.1| DNA gyrase subunit A [Prochlorococcus marinus str. MIT 9312]
	212 	212 	83% 	5e-53	Gene info linked to YP_397569.1
ACN43204.1 	
DNA gyrase subunit A [Bacillus subtilis]
	212 	212 	83% 	6e-53	
ACN43209.1 	
DNA gyrase subunit A [Bacillus subtilis]
	212 	212 	83% 	7e-53	
YP_002314375.1 	
DNA gyrase subunit A [Anoxybacillus flavithermus WK1] >gb|ACJ32390.1| DNA gyrase subunit A [Anoxybacillus flavithermus WK1]
	211 	211 	96% 	8e-53	Gene info linked to YP_002314375.1
YP_001091393.1 	
DNA gyrase subunit A [Prochlorococcus marinus str. MIT 9301] >gb|ABO17792.1| DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. MIT 9301]
	211 	211 	87% 	9e-53	Gene info linked to YP_001091393.1
ZP_04744338.1 	
DNA gyrase, A subunit [Roseburia intestinalis L1-82] >gb|EEV00438.1| DNA gyrase, A subunit [Roseburia intestinalis L1-82] >emb|CBL10097.1| DNA gyrase subunit A [Roseburia intestinalis M50/1] >emb|CBL12922.1| DNA gyrase subunit A [Roseburia intestinalis XB6B4]
	211 	211 	94% 	9e-53	
ZP_06872527.1 	
DNA gyrase subunit A [Bacillus subtilis subsp. spizizenii ATCC 6633] >ref|YP_003864376.1| DNA gyrase subunit A [Bacillus subtilis subsp. spizizenii str. W23] >gb|EFG93947.1| DNA gyrase subunit A [Bacillus subtilis subsp. spizizenii ATCC 6633] >gb|ADM36066.1| DNA gyrase subunit A [Bacillus subtilis subsp. spizizenii str. W23]
	211 	211 	90% 	9e-53	
ZP_08055381.1 	
DNA gyrase subunit A-like protein [Paenibacillus larvae subsp. larvae B-3650] >gb|EFX47225.1| DNA gyrase subunit A-like protein [Paenibacillus larvae subsp. larvae B-3650]
	211 	211 	96% 	1e-52	
ZP_03148595.1 	
DNA gyrase, A subunit [Geobacillus sp. G11MC16] >gb|EDY05538.1| DNA gyrase, A subunit [Geobacillus sp. G11MC16]
	211 	211 	96% 	1e-52	
YP_004205961.1 	
DNA gyrase subunit A [Bacillus subtilis BSn5] >gb|ADV94934.1| DNA gyrase subunit A [Bacillus subtilis BSn5]
	211 	211 	90% 	1e-52	Gene info linked to YP_004205961.1
ZP_02326646.1 	
DNA gyrase subunit A [Paenibacillus larvae subsp. larvae BRL-230010]
	211 	211 	96% 	1e-52	
YP_001124138.1 	
DNA gyrase subunit A [Geobacillus thermodenitrificans NG80-2] >gb|ABO65393.1| DNA gyrase subunit A [Geobacillus thermodenitrificans NG80-2]
	211 	211 	96% 	1e-52	Gene info linked to YP_001124138.1
YP_002929499.1 	
DNA gyrase subunit A [Eubacterium eligens ATCC 27750] >gb|ACR71052.1| DNA gyrase subunit A [Eubacterium eligens ATCC 27750]
	211 	211 	82% 	1e-52	Gene info linked to YP_002929499.1
NP_387888.1 	
DNA gyrase subunit A [Bacillus subtilis subsp. subtilis str. 168] >ref|ZP_03589663.1| DNA gyrase subunit A [Bacillus subtilis subsp. subtilis str. 168] >ref|ZP_03593943.1| DNA gyrase subunit A [Bacillus subtilis subsp. subtilis str. NCIB 3610] >ref|ZP_03598365.1| DNA gyrase subunit A [Bacillus subtilis subsp. subtilis str. JH642] >ref|ZP_03602628.1| DNA gyrase subunit A [Bacillus subtilis subsp. subtilis str. SMY] >sp|P05653.1|GYRA_BACSU RecName: Full=DNA gyrase subunit A >emb|CAA26222.1| unnamed protein product [Bacillus subtilis] >dbj|BAA05243.1| A subunit of DNA gyrase [Bacillus subtilis] >emb|CAB11783.1| DNA gyrase (subunit A) [Bacillus subtilis subsp. subtilis str. 168] >dbj|BAI83452.1| DNA gyrase subunit A [Bacillus subtilis subsp. natto BEST195]
	211 	211 	90% 	1e-52	Gene info linked to NP_387888.1PubChem BioAssay Info linked to NP_387888.1
ACJ67508.1 	
DNA gyrase subunit A [Bacillus subtilis]
	211 	211 	83% 	1e-52	
ACN43206.1 	
DNA gyrase subunit A [Bacillus subtilis]
	211 	211 	83% 	1e-52	
ACJ67490.1 	
DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67518.1| DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67519.1| DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67521.1| DNA gyrase subunit A [Bacillus subtilis]
	211 	211 	83% 	2e-52	
ACJ67504.1 	
DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67510.1| DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67512.1| DNA gyrase subunit A [Bacillus subtilis]
	211 	211 	83% 	2e-52	
ACJ67509.1 	
DNA gyrase subunit A [Bacillus subtilis]
	210 	210 	83% 	2e-52	
ACN43208.1 	
DNA gyrase subunit A [Bacillus subtilis] >gb|ACN43210.1| DNA gyrase subunit A [Bacillus subtilis]
	210 	210 	83% 	2e-52	
ACJ67514.1 	
DNA gyrase subunit A [Bacillus subtilis]
	210 	210 	83% 	2e-52	
ACJ67505.1 	
DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67511.1| DNA gyrase subunit A [Bacillus subtilis]
	210 	210 	83% 	2e-52	
ACJ67486.1 	
DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67488.1| DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67491.1| DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67492.1| DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67493.1| DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67494.1| DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67497.1| DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67516.1| DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67520.1| DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67522.1| DNA gyrase subunit A [Bacillus subtilis]
	210 	210 	83% 	2e-52	
NP_690928.1 	
DNA gyrase subunit A [Oceanobacillus iheyensis HTE831] >dbj|BAC11963.1| DNA gyrase subunit A [Oceanobacillus iheyensis HTE831]
	210 	210 	96% 	2e-52	Gene info linked to NP_690928.1
ZP_01470359.1 	
DNA gyrase subunit A [Synechococcus sp. RS9916] >gb|EAU74154.1| DNA gyrase subunit A [Synechococcus sp. RS9916]
	210 	210 	83% 	2e-52	
ACJ67506.1 	
DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67507.1| DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67513.1| DNA gyrase subunit A [Bacillus subtilis]
	210 	210 	83% 	2e-52	
ACN43200.1 	
DNA gyrase subunit A [Bacillus subtilis]
	210 	210 	84% 	2e-52	
YP_003505578.1 	
DNA gyrase, A subunit [Denitrovibrio acetiphilus DSM 12809] >gb|ADD69622.1| DNA gyrase, A subunit [Denitrovibrio acetiphilus DSM 12809]
	210 	210 	96% 	2e-52	Gene info linked to YP_003505578.1
ACJ67487.1 	
DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67489.1| DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67495.1| DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67496.1| DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67498.1| DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67499.1| DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67517.1| DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67523.1| DNA gyrase subunit A [Bacillus subtilis] >gb|ACJ67524.1| DNA gyrase subunit A [Bacillus subtilis]
	210 	210 	83% 	2e-52	
NP_894955.1 	
DNA gyrase subunit A [Prochlorococcus marinus str. MIT 9313] >emb|CAE21299.1| DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. MIT 9313]
	210 	210 	83% 	2e-52	Gene info linked to NP_894955.1
ACN43211.1 	
DNA gyrase subunit A [Bacillus subtilis]
	210 	210 	83% 	2e-52	
ZP_04154113.1 	
DNA gyrase subunit A [Bacillus pseudomycoides DSM 12442] >gb|EEM14319.1| DNA gyrase subunit A [Bacillus pseudomycoides DSM 12442]
	210 	210 	96% 	2e-52	
ZP_04155074.1 	
DNA gyrase subunit A [Bacillus mycoides Rock3-17] >ref|ZP_04160875.1| DNA gyrase subunit A [Bacillus mycoides Rock1-4] >gb|EEM07430.1| DNA gyrase subunit A [Bacillus mycoides Rock1-4] >gb|EEM13230.1| DNA gyrase subunit A [Bacillus mycoides Rock3-17]
	210 	210 	96% 	2e-52	
YP_001016931.1 	
DNA gyrase subunit A [Prochlorococcus marinus str. MIT 9303] >gb|ABM77666.1| DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. MIT 9303]
	210 	210 	83% 	2e-52	Gene info linked to YP_001016931.1
YP_004100859.1 	
DNA gyrase subunit A [Thermaerobacter marianensis DSM 12885] >gb|ADU50132.1| DNA gyrase subunit A [Thermaerobacter marianensis DSM 12885]
	210 	210 	96% 	2e-52	Gene info linked to YP_004100859.1
YP_002449046.1 	
DNA gyrase, A subunit [Bacillus cereus AH820] >ref|ZP_04093500.1| DNA gyrase subunit A [Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1] >ref|ZP_04094422.1| DNA gyrase subunit A [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1] >ref|ZP_04148808.1| DNA gyrase subunit A [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1] >ref|ZP_04254171.1| DNA gyrase subunit A [Bacillus cereus 95/8201] >gb|ACK91789.1| DNA gyrase, A subunit [Bacillus cereus AH820] >gb|EEL14164.1| DNA gyrase subunit A [Bacillus cereus 95/8201] >gb|EEM19516.1| DNA gyrase subunit A [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1] >gb|EEM73879.1| DNA gyrase subunit A [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1] >gb|EEM74856.1| DNA gyrase subunit A [Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1]
	210 	210 	96% 	3e-52	Gene info linked to YP_002449046.1
YP_291883.1 	
DNA gyrase subunit A [Prochlorococcus marinus str. NATL2A] >gb|AAZ58180.1| DNA gyrase subunit A [Prochlorococcus marinus str. NATL2A]
	210 	210 	83% 	3e-52	Gene info linked to YP_291883.1
ACJ67515.1 	
DNA gyrase subunit A [Bacillus subtilis]
	209 	209 	83% 	3e-52	
ZP_05045100.1 	
DNA gyrase, A subunit [Cyanobium sp. PCC 7001] >gb|EDY38409.1| DNA gyrase, A subunit [Cyanobium sp. PCC 7001]
	209 	209 	83% 	3e-52	
YP_001484399.1 	
DNA gyrase subunit A [Prochlorococcus marinus str. MIT 9215] >gb|ABV50813.1| DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. MIT 9215]
	209 	209 	83% 	3e-52	Gene info linked to YP_001484399.1
ACJ67503.1 	
DNA gyrase subunit A [Bacillus subtilis]
	209 	209 	83% 	4e-52	
ZP_05394444.1 	
DNA gyrase, A subunit [Clostridium carboxidivorans P7] >ref|ZP_06855179.1| DNA gyrase, A subunit [Clostridium carboxidivorans P7] >gb|EET85089.1| DNA gyrase, A subunit [Clostridium carboxidivorans P7] >gb|EFG87925.1| DNA gyrase, A subunit [Clostridium carboxidivorans P7]
	209 	209 	85% 	4e-52	
YP_003975577.1 	
DNA gyrase subunit A [Bacillus atrophaeus 1942] >gb|ADP34646.1| DNA gyrase subunit A [Bacillus atrophaeus 1942]
	209 	209 	90% 	4e-52	Gene info linked to YP_003975577.1
ACJ67500.1 	
DNA gyrase subunit A [Bacillus subtilis]
	209 	209 	83% 	4e-52	
ZP_06812077.1 	
DNA gyrase, A subunit [Geobacillus thermoglucosidasius C56-YS93] >gb|EFG51420.1| DNA gyrase, A subunit [Geobacillus thermoglucosidasius C56-YS93]
	209 	209 	96% 	5e-52	
ZP_04111484.1 	
DNA gyrase subunit A [Bacillus thuringiensis serovar monterrey BGSC 4AJ1] >gb|EEM56852.1| DNA gyrase subunit A [Bacillus thuringiensis serovar monterrey BGSC 4AJ1]
	209 	209 	96% 	5e-52	
ZP_02948128.1 	
DNA gyrase, A subunit [Clostridium butyricum 5521] >gb|EDT76881.1| DNA gyrase, A subunit [Clostridium butyricum 5521]
	209 	209 	92% 	5e-52	
ZP_01080653.1 	
DNA gyrase A subunit [Synechococcus sp. RS9917] >gb|EAQ68943.1| DNA gyrase A subunit [Synechococcus sp. RS9917]
	209 	209 	87% 	5e-52	
ZP_02393442.1 	
DNA gyrase, A subunit [Bacillus anthracis str. A0442] >ref|ZP_05199809.1| DNA gyrase subunit A [Bacillus anthracis str. Kruger B] >gb|EDR92349.1| DNA gyrase, A subunit [Bacillus anthracis str. A0442]
	209 	209 	96% 	6e-52	
ZP_04529604.1 	
DNA gyrase, A subunit [Clostridium butyricum E4 str. BoNT E BL5262] >gb|EEP52422.1| DNA gyrase, A subunit [Clostridium butyricum E4 str. BoNT E BL5262]
	209 	209 	92% 	6e-52	
NP_842578.1 	
DNA gyrase subunit A [Bacillus anthracis str. Ames] >ref|NP_976334.1| DNA gyrase subunit A [Bacillus cereus ATCC 10987] >ref|YP_016609.1| DNA gyrase subunit A [Bacillus anthracis str. 'Ames Ancestor'] >ref|YP_026297.1| DNA gyrase subunit A [Bacillus anthracis str. Sterne] >ref|YP_034366.1| DNA gyrase subunit A [Bacillus thuringiensis serovar konkukian str. 97-27] >ref|ZP_00390433.1| COG0188: Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Bacillus anthracis str. A2012] >ref|ZP_02217657.1| DNA gyrase, A subunit [Bacillus anthracis str. A0488] >ref|ZP_02399999.1| DNA gyrase, A subunit [Bacillus anthracis str. A0193] >ref|ZP_02880667.1| DNA gyrase, A subunit [Bacillus anthracis str. A0465] >ref|ZP_02898054.1| DNA gyrase, A subunit [Bacillus anthracis str. A0389] >ref|ZP_02936826.1| DNA gyrase, A subunit [Bacillus anthracis str. A0174] >ref|ZP_03022175.1| DNA gyrase, A subunit [Bacillus anthracis Tsiankovskii-I] >ref|ZP_03109221.1| DNA gyrase, A subunit [Bacillus cereus NVH0597-99] >ref|ZP_03112715.1| DNA gyrase, A subunit [Bacillus cereus 03BB108] >ref|YP_002812693.1| DNA gyrase, A subunit [Bacillus anthracis str. CDC 684] >ref|ZP_04081634.1| DNA gyrase subunit A [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1] >ref|ZP_04314859.1| DNA gyrase subunit A [Bacillus cereus BGSC 6E1] >ref|ZP_04326325.1| DNA gyrase subunit A [Bacillus cereus m1293] >ref|YP_002864663.1| DNA gyrase, A subunit [Bacillus anthracis str. A0248] >ref|ZP_05150923.1| DNA gyrase subunit A [Bacillus anthracis str. CNEVA-9066] >ref|ZP_05185937.1| DNA gyrase subunit A [Bacillus anthracis str. A1055] >ref|ZP_05192878.1| DNA gyrase subunit A [Bacillus anthracis str. Western North America USA6153] >ref|ZP_05208000.1| DNA gyrase subunit A [Bacillus anthracis str. Vollum] >ref|ZP_05213374.1| DNA gyrase subunit A [Bacillus anthracis str. Australia 94] >ref|YP_003789958.1| DNA gyrase subunit A [Bacillus anthracis CI] >gb|AAP24064.1| DNA gyrase, A subunit [Bacillus anthracis str. Ames] >gb|AAS38942.1| DNA gyrase, A subunit [Bacillus cereus ATCC 10987] >gb|AAT29084.1| DNA gyrase, A subunit [Bacillus anthracis str. 'Ames Ancestor'] >gb|AAT52348.1| DNA gyrase, A subunit [Bacillus anthracis str. Sterne] >gb|AAT58889.1| DNA topoisomerase II, ATP-hydrolyzing (DNA gyrase, subunit A) [Bacillus thuringiensis serovar konkukian str. 97-27] >gb|EDR16804.1| DNA gyrase, A subunit [Bacillus anthracis str. A0488] >gb|EDR85713.1| DNA gyrase, A subunit [Bacillus anthracis str. A0193] >gb|EDS96471.1| DNA gyrase, A subunit [Bacillus anthracis str. A0389] >gb|EDT17352.1| DNA gyrase, A subunit [Bacillus anthracis str. A0465] >gb|EDT65291.1| DNA gyrase, A subunit [Bacillus anthracis str. A0174] >gb|EDV13579.1| DNA gyrase, A subunit [Bacillus anthracis Tsiankovskii-I] >gb|EDX62367.1| DNA gyrase, A subunit [Bacillus cereus 03BB108] >gb|EDX65809.1| DNA gyrase, A subunit [Bacillus cereus NVH0597-99] >gb|ACP16161.1| DNA gyrase, A subunit [Bacillus anthracis str. CDC 684] >gb|EEK41952.1| DNA gyrase subunit A [Bacillus cereus m1293] >gb|EEK53475.1| DNA gyrase subunit A [Bacillus cereus BGSC 6E1] >gb|EEM86702.1| DNA gyrase subunit A [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1] >gb|ACQ50267.1| DNA gyrase, A subunit [Bacillus anthracis str. A0248] >gb|ADK02820.1| DNA gyrase subunit A [Bacillus cereus biovar anthracis str. CI]
	209 	209 	96% 	6e-52	Gene info linked to NP_842578.1
YP_001225312.1 	
DNA gyrase subunit A [Synechococcus sp. WH 7803] >emb|CAK24015.1| DNA gyrase subunit A [Synechococcus sp. WH 7803]
	208 	208 	87% 	6e-52	Gene info linked to YP_001225312.1
ACN43203.1 	
DNA gyrase subunit A [Bacillus subtilis] >gb|ACN43205.1| DNA gyrase subunit A [Bacillus subtilis]
	208 	208 	83% 	7e-52	
ZP_03236730.1 	
DNA gyrase, A subunit [Bacillus cereus H3081.97] >ref|YP_002336129.1| DNA gyrase subunit A [Bacillus cereus AH187] >ref|YP_002527827.1| DNA gyrase subunit a [Bacillus cereus Q1] >ref|ZP_04270767.1| DNA gyrase subunit A [Bacillus cereus BDRD-ST26] >gb|EDZ57309.1| DNA gyrase, A subunit [Bacillus cereus H3081.97] >gb|ACJ77466.1| DNA gyrase, A subunit [Bacillus cereus AH187] >gb|ACM10535.1| DNA topoisomerase II, ATP-hydrolyzing (DNA gyrase, subunit A) [Bacillus cereus Q1] >gb|EEK97568.1| DNA gyrase subunit A [Bacillus cereus BDRD-ST26]
	208 	208 	96% 	7e-52	
YP_892935.1 	
DNA gyrase subunit A [Bacillus thuringiensis str. Al Hakam] >gb|ABK83428.1| DNA gyrase subunit A [Bacillus thuringiensis str. Al Hakam]
	208 	208 	96% 	7e-52	Gene info linked to YP_892935.1
ZP_04303662.1 	
DNA gyrase subunit A [Bacillus cereus MM3] >gb|EEK64659.1| DNA gyrase subunit A [Bacillus cereus MM3]
	208 	208 	96% 	7e-52	
YP_730186.1 	
DNA gyrase subunit A [Synechococcus sp. CC9311] >gb|ABI45101.1| DNA gyrase, A subunit [Synechococcus sp. CC9311]
	208 	208 	83% 	8e-52	Gene info linked to YP_730186.1
YP_001009559.1 	
DNA gyrase subunit A [Prochlorococcus marinus str. AS9601] >gb|ABM70452.1| DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. AS9601]
	208 	208 	83% 	8e-52	Gene info linked to YP_001009559.1
YP_004093030.1 	
DNA gyrase, A subunit [Bacillus cellulosilyticus DSM 2522] >gb|ADU28299.1| DNA gyrase, A subunit [Bacillus cellulosilyticus DSM 2522]
	208 	208 	90% 	8e-52	Gene info linked to YP_004093030.1
AAP43927.1 	
DNA gyrase subunit A [Bacillus anthracis] >gb|AAP43928.1| DNA gyrase subunit A [Bacillus cereus]
	208 	208 	96% 	8e-52	
ZP_04292373.1 	
DNA gyrase subunit A [Bacillus cereus R309803] >gb|EEK75948.1| DNA gyrase subunit A [Bacillus cereus R309803]
	208 	208 	96% 	9e-52	
YP_001011467.1 	
DNA gyrase subunit A [Prochlorococcus marinus str. MIT 9515] >gb|ABM72360.1| DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. MIT 9515]
	208 	208 	87% 	9e-52	Gene info linked to YP_001011467.1
YP_001317909.1 	
DNA gyrase, A subunit [Alkaliphilus metalliredigens QYMF] >gb|ABR46250.1| DNA gyrase, A subunit [Alkaliphilus metalliredigens QYMF]
	208 	208 	86% 	1e-51	Gene info linked to YP_001317909.1
ZP_04105175.1 	
DNA gyrase subunit A [Bacillus thuringiensis serovar berliner ATCC 10792] >ref|ZP_04136125.1| DNA gyrase subunit A [Bacillus thuringiensis serovar thuringiensis str. T01001] >ref|ZP_04142498.1| DNA gyrase subunit A [Bacillus thuringiensis Bt407] >gb|EEM25839.1| DNA gyrase subunit A [Bacillus thuringiensis Bt407] >gb|EEM32210.1| DNA gyrase subunit A [Bacillus thuringiensis serovar thuringiensis str. T01001] >gb|EEM63162.1| DNA gyrase subunit A [Bacillus thuringiensis serovar berliner ATCC 10792]
	207 	207 	96% 	1e-51	
NP_896820.1 	
DNA gyrase subunit A [Synechococcus sp. WH 8102] >emb|CAE07242.1| DNA gyrase A subunit [Synechococcus sp. WH 8102]
	207 	207 	83% 	1e-51	Gene info linked to NP_896820.1
ZP_06113918.1 	
DNA gyrase, A subunit [Clostridium hathewayi DSM 13479] >gb|EFC99662.1| DNA gyrase, A subunit [Clostridium hathewayi DSM 13479]
	207 	207 	82% 	1e-51	
NP_829915.1 	
DNA gyrase subunit A [Bacillus cereus ATCC 14579] >gb|AAP07116.1| DNA gyrase subunit A [Bacillus cereus ATCC 14579]
	207 	207 	96% 	1e-51	Gene info linked to NP_829915.1
YP_003987473.1 	
DNA gyrase, A subunit [Geobacillus sp. Y4.1MC1] >gb|ADP72862.1| DNA gyrase, A subunit [Geobacillus sp. Y4.1MC1]
	207 	207 	96% 	1e-51	Gene info linked to YP_003987473.1
YP_002470472.1 	
DNA gyrase A subunit [Clostridium kluyveri NBRC 12016] >dbj|BAH05058.1| DNA gyrase A subunit [Clostridium kluyveri NBRC 12016]
	207 	207 	85% 	1e-51	Gene info linked to YP_002470472.1
ZP_04231615.1 	
DNA gyrase subunit A [Bacillus cereus Rock3-28] >gb|EEL36683.1| DNA gyrase subunit A [Bacillus cereus Rock3-28]
	207 	207 	96% 	1e-51	
ZP_04230844.1 	
DNA gyrase subunit A [Bacillus cereus Rock3-29] >ref|ZP_04248329.1| DNA gyrase subunit A [Bacillus cereus Rock1-3] >gb|EEL20005.1| DNA gyrase subunit A [Bacillus cereus Rock1-3] >gb|EEL37491.1| DNA gyrase subunit A [Bacillus cereus Rock3-29]
	207 	207 	96% 	1e-51	
ZP_03231056.1 	
DNA gyrase, A subunit [Bacillus cereus AH1134] >ref|YP_002364861.1| DNA gyrase subunit A [Bacillus cereus B4264] >ref|ZP_04087510.1| DNA gyrase subunit A [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1] >ref|ZP_04117739.1| DNA gyrase subunit A [Bacillus thuringiensis serovar kurstaki str. T03a001] >ref|ZP_04123361.1| DNA gyrase subunit A [Bacillus thuringiensis serovar pakistani str. T13001] >ref|ZP_04194707.1| DNA gyrase subunit A [Bacillus cereus AH676] >ref|ZP_04206155.1| DNA gyrase subunit A [Bacillus cereus F65185] >ref|ZP_04209966.1| DNA gyrase subunit A [Bacillus cereus Rock4-2] >ref|ZP_04242438.1| DNA gyrase subunit A [Bacillus cereus Rock1-15] >ref|ZP_04259693.1| DNA gyrase subunit A [Bacillus cereus BDRD-Cer4] >ref|ZP_04276383.1| DNA gyrase subunit A [Bacillus cereus BDRD-ST24] >ref|ZP_04281829.1| DNA gyrase subunit A [Bacillus cereus m1550] >ref|ZP_04309063.1| DNA gyrase subunit A [Bacillus cereus 172560W] >ref|ZP_04320686.1| DNA gyrase subunit A [Bacillus cereus ATCC 10876] >ref|YP_003662544.1| DNA gyrase subunit A [Bacillus thuringiensis BMB171] >gb|EDZ51849.1| DNA gyrase, A subunit [Bacillus cereus AH1134] >gb|ACK59281.1| DNA gyrase, A subunit [Bacillus cereus B4264] >gb|EEK47648.1| DNA gyrase subunit A [Bacillus cereus ATCC 10876] >gb|EEK59271.1| DNA gyrase subunit A [Bacillus cereus 172560W] >gb|EEK86492.1| DNA gyrase subunit A [Bacillus cereus m1550] >gb|EEK91960.1| DNA gyrase subunit A [Bacillus cereus BDRD-ST24] >gb|EEL08642.1| DNA gyrase subunit A [Bacillus cereus BDRD-Cer4] >gb|EEL25899.1| DNA gyrase subunit A [Bacillus cereus Rock1-15] >gb|EEL58330.1| DNA gyrase subunit A [Bacillus cereus Rock4-2] >gb|EEL62183.1| DNA gyrase subunit A [Bacillus cereus F65185] >gb|EEL73627.1| DNA gyrase subunit A [Bacillus cereus AH676] >gb|EEM44962.1| DNA gyrase subunit A [Bacillus thuringiensis serovar pakistani str. T13001] >gb|EEM50596.1| DNA gyrase subunit A [Bacillus thuringiensis serovar kurstaki str. T03a001] >gb|EEM80827.1| DNA gyrase subunit A [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1] >gb|ADH04824.1| DNA gyrase subunit A [Bacillus thuringiensis BMB171]
	207 	207 	96% 	1e-51	
YP_001393442.1 	
DNA gyrase subunit A [Clostridium kluyveri DSM 555] >gb|EDK32094.1| GyrA1 [Clostridium kluyveri DSM 555]
	207 	207 	85% 	1e-51	Gene info linked to YP_001393442.1
ZP_04225672.1 	
DNA gyrase subunit A [Bacillus cereus Rock3-42] >ref|ZP_07056524.1| DNA gyrase subunit A [Bacillus cereus SJ1] >gb|EEL42683.1| DNA gyrase subunit A [Bacillus cereus Rock3-42] >gb|EFI64494.1| DNA gyrase subunit A [Bacillus cereus SJ1]
	207 	207 	96% 	1e-51	
NP_780806.1 	
DNA gyrase subunit A [Clostridium tetani E88] >gb|AAO34743.1| DNA gyrase subunit A [Clostridium tetani E88]
	207 	207 	84% 	1e-51	Gene info linked to NP_780806.1
YP_001812511.1 	
DNA gyrase, A subunit [Exiguobacterium sibiricum 255-15] >gb|ACB59494.1| DNA gyrase, A subunit [Exiguobacterium sibiricum 255-15]
	207 	207 	96% 	2e-51	Gene info linked to YP_001812511.1
ZP_03734587.1 	
DNA gyrase, A subunit [Dethiobacter alkaliphilus AHT 1] >gb|EEG76915.1| DNA gyrase, A subunit [Dethiobacter alkaliphilus AHT 1]
	207 	207 	96% 	2e-51	
YP_002443558.1 	
DNA gyrase, A subunit [Bacillus cereus G9842] >ref|ZP_04069393.1| DNA gyrase subunit A [Bacillus thuringiensis IBL 4222] >ref|ZP_04129630.1| DNA gyrase subunit A [Bacillus thuringiensis serovar sotto str. T04001] >gb|ACK96811.1| DNA gyrase, A subunit [Bacillus cereus G9842] >gb|EEM38694.1| DNA gyrase subunit A [Bacillus thuringiensis serovar sotto str. T04001] >gb|EEM98961.1| DNA gyrase subunit A [Bacillus thuringiensis IBL 4222]
	207 	207 	96% 	2e-51	Gene info linked to YP_002443558.1
YP_003199333.1 	
DNA gyrase, A subunit [Desulfohalobium retbaense DSM 5692] >gb|ACV69755.1| DNA gyrase, A subunit [Desulfohalobium retbaense DSM 5692]
	207 	207 	90% 	2e-51	Gene info linked to YP_003199333.1
ZP_03103523.1 	
DNA gyrase, A subunit [Bacillus cereus W] >gb|EDX55258.1| DNA gyrase, A subunit [Bacillus cereus W]
	207 	207 	96% 	2e-51	
ZP_05789915.1 	
DNA gyrase, A subunit [Synechococcus sp. WH 8109] >gb|EEX07115.1| DNA gyrase, A subunit [Synechococcus sp. WH 8109]
	207 	207 	83% 	2e-51	
YP_001511573.1 	
DNA gyrase, A subunit [Alkaliphilus oremlandii OhILAs] >gb|ABW17577.1| DNA gyrase, A subunit [Alkaliphilus oremlandii OhILAs]
	207 	207 	85% 	2e-51	Gene info linked to YP_001511573.1
ZP_04189098.1 	
DNA gyrase subunit A [Bacillus cereus AH1271] >gb|EEL79248.1| DNA gyrase subunit A [Bacillus cereus AH1271]
	207 	207 	96% 	2e-51	
YP_003495272.1 	
DNA gyrase subunit A [Deferribacter desulfuricans SSM1] >dbj|BAI79516.1| DNA gyrase, A subunit [Deferribacter desulfuricans SSM1]
	207 	207 	83% 	2e-51	Gene info linked to YP_003495272.1
EAY58023.1 	
DNA gyrase, A subunit [Leptospirillum rubarum] >gb|EDZ39888.1| DNA gyrase, A subunit [Leptospirillum sp. Group II '5-way CG']
	207 	207 	83% 	2e-51	
YP_003179038.1 	
DNA gyrase, A subunit [Atopobium parvulum DSM 20469] >gb|ACV50447.1| DNA gyrase, A subunit [Atopobium parvulum DSM 20469]
	207 	207 	85% 	2e-51	Gene info linked to YP_003179038.1
YP_382238.1 	
DNA gyrase subunit A [Synechococcus sp. CC9605] >gb|ABB35683.1| DNA gyrase, A subunit [Synechococcus sp. CC9605]
	207 	207 	83% 	2e-51	Gene info linked to YP_382238.1
ZP_01084968.1 	
DNA gyrase subunit A [Synechococcus sp. WH 5701] >gb|EAQ75024.1| DNA gyrase subunit A [Synechococcus sp. WH 5701]
	207 	207 	83% 	2e-51	
YP_002747441.1 	
DNA gyrase, A subunit [Bacillus cereus 03BB102] >gb|ACO30493.1| DNA gyrase, A subunit [Bacillus cereus 03BB102]
	207 	207 	96% 	2e-51	Gene info linked to YP_002747441.1
YP_001015345.1 	
DNA gyrase subunit A [Prochlorococcus marinus str. NATL1A] >gb|ABM76080.1| DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. NATL1A]
	207 	207 	83% 	2e-51	Gene info linked to YP_001015345.1
ZP_02026376.1 	
hypothetical protein EUBVEN_01634 [Eubacterium ventriosum ATCC 27560] >gb|EDM51305.1| hypothetical protein EUBVEN_01634 [Eubacterium ventriosum ATCC 27560]
	207 	207 	96% 	2e-51	
ZP_04287111.1 	
DNA gyrase subunit A [Bacillus cereus ATCC 4342] >gb|EEK81245.1| DNA gyrase subunit A [Bacillus cereus ATCC 4342]
	206 	206 	96% 	2e-51	
YP_081625.1 	
DNA gyrase subunit A [Bacillus cereus E33L] >gb|AAU20222.1| DNA topoisomerase II, ATP-hydrolyzing (DNA gyrase, subunit A) [Bacillus cereus E33L]
	206 	206 	96% 	2e-51	Gene info linked to YP_081625.1
NP_240873.1 	
DNA gyrase subunit A [Bacillus halodurans C-125] >sp|O50628.1|GYRA_BACHD RecName: Full=DNA gyrase subunit A >dbj|BAA24188.1| A subunit of DNA gyrase [Bacillus sp.] >dbj|BAA82691.1| 76%-identity [Bacillus halodurans] >dbj|BAB03726.1| DNA gyrase subunit A [Bacillus halodurans C-125]
	206 	206 	96% 	2e-51	Gene info linked to NP_240873.1
EDZ39818.1 	
DNA gyrase, A subunit [Leptospirillum sp. Group II '5-way CG']
	206 	206 	83% 	3e-51	
ZP_04215683.1 	
DNA gyrase subunit A [Bacillus cereus Rock3-44] >gb|EEL52612.1| DNA gyrase subunit A [Bacillus cereus Rock3-44]
	206 	206 	96% 	3e-51	
ZP_04075138.1 	
DNA gyrase subunit A [Bacillus thuringiensis IBL 200] >gb|EEM93202.1| DNA gyrase subunit A [Bacillus thuringiensis IBL 200]
	206 	206 	96% 	3e-51	
ACJ67501.1 	
DNA gyrase subunit A [Bacillus subtilis]
	206 	206 	81% 	3e-51	
ZP_04431369.1 	
DNA gyrase, A subunit [Bacillus coagulans 36D1] >gb|EEN92404.1| DNA gyrase, A subunit [Bacillus coagulans 36D1]
	206 	206 	96% 	4e-51	
YP_001642903.1 	
DNA gyrase subunit A [Bacillus weihenstephanensis KBAB4] >ref|ZP_04200447.1| DNA gyrase subunit A [Bacillus cereus AH603] >ref|ZP_04265067.1| DNA gyrase subunit A [Bacillus cereus BDRD-ST196] >gb|ABY41275.1| DNA gyrase, A subunit [Bacillus weihenstephanensis KBAB4] >gb|EEL03280.1| DNA gyrase subunit A [Bacillus cereus BDRD-ST196] >gb|EEL67902.1| DNA gyrase subunit A [Bacillus cereus AH603]
	206 	206 	96% 	4e-51	Gene info linked to YP_001642903.1
ZP_07836175.1 	
DNA gyrase subunit A [Thermaerobacter subterraneus DSM 13965] >gb|EFR62415.1| DNA gyrase subunit A [Thermaerobacter subterraneus DSM 13965]
	206 	206 	96% 	5e-51	
CBK79395.1 	
DNA gyrase subunit A [Coprococcus catus GD/7]
	206 	206 	96% 	5e-51	
ZP_01468322.1 	
DNA gyrase subunit A [Synechococcus sp. BL107] >gb|EAU72215.1| DNA gyrase subunit A [Synechococcus sp. BL107]
	206 	206 	83% 	5e-51	
ZP_04171775.1 	
DNA gyrase subunit A [Bacillus mycoides DSM 2048] >ref|ZP_04297884.1| DNA gyrase subunit A [Bacillus cereus AH621] >gb|EEK70438.1| DNA gyrase subunit A [Bacillus cereus AH621] >gb|EEL96561.1| DNA gyrase subunit A [Bacillus mycoides DSM 2048]
	205 	205 	90% 	5e-51	
YP_003306827.1 	
DNA gyrase, A subunit [Sebaldella termitidis ATCC 33386] >gb|ACZ06896.1| DNA gyrase, A subunit [Sebaldella termitidis ATCC 33386]
	205 	205 	81% 	6e-51	Gene info linked to YP_003306827.1
YP_001307153.1 	
DNA gyrase subunit A [Clostridium beijerinckii NCIMB 8052] >gb|ABR32197.1| DNA gyrase, A subunit [Clostridium beijerinckii NCIMB 8052]
	205 	205 	84% 	6e-51	Gene info linked to YP_001307153.1
YP_003829340.1 	
DNA gyrase subunit A GyrA [Butyrivibrio proteoclasticus B316] >gb|ADL32758.1| DNA gyrase subunit A GyrA [Butyrivibrio proteoclasticus B316]
	205 	205 	93% 	6e-51	Gene info linked to YP_003829340.1
YP_001373377.1 	
DNA gyrase subunit A [Bacillus cereus subsp. cytotoxis NVH 391-98] >gb|ABS20382.1| DNA gyrase, A subunit [Bacillus cytotoxicus NVH 391-98]
	205 	205 	96% 	7e-51	Gene info linked to YP_001373377.1
ZP_04172417.1 	
DNA gyrase subunit A [Bacillus cereus AH1273] >ref|ZP_04183258.1| DNA gyrase subunit A [Bacillus cereus AH1272] >gb|EEL85064.1| DNA gyrase subunit A [Bacillus cereus AH1272] >gb|EEL95886.1| DNA gyrase subunit A [Bacillus cereus AH1273]
	205 	205 	96% 	7e-51	
YP_003472743.1 	
DNA gyrase subunit A [Staphylococcus lugdunensis HKU09-01] >gb|ADC88615.1| DNA gyrase subunit A [Staphylococcus lugdunensis HKU09-01]
	205 	205 	96% 	8e-51	Gene info linked to YP_003472743.1
ZP_07912848.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Staphylococcus lugdunensis M23590] >gb|EFU83228.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Staphylococcus lugdunensis M23590]
	204 	204 	96% 	9e-51	
ZP_04859807.1 	
DNA topoisomerase [Fusobacterium varium ATCC 27725] >gb|EES63996.1| DNA topoisomerase [Fusobacterium varium ATCC 27725]
	204 	204 	82% 	9e-51	
ZP_01860763.1 	
DNA gyrase subunit A [Bacillus sp. SG-1] >gb|EDL64147.1| DNA gyrase subunit A [Bacillus sp. SG-1]
	204 	204 	96% 	9e-51	
YP_003595323.1 	
DNA gyrase subunit A [Bacillus megaterium DSM 319] >gb|ADF36973.1| DNA gyrase, A subunit [Bacillus megaterium DSM 319]
	204 	204 	96% 	9e-51	Gene info linked to YP_003595323.1
CBL25025.1 	
DNA gyrase subunit A [Ruminococcus torques L2-14]
	204 	204 	82% 	1e-50	
ZP_05132746.1 	
subunit A [Clostridium sp. 7_2_43FAA] >gb|EEH99640.1| subunit A [Clostridium sp. 7_2_43FAA]
	204 	204 	85% 	1e-50	
YP_003560581.1 	
DNA gyrase subunit A [Bacillus megaterium QM B1551] >gb|ADE67147.1| DNA gyrase, A subunit [Bacillus megaterium QM B1551]
	204 	204 	96% 	1e-50	Gene info linked to YP_003560581.1
YP_003638806.1 	
DNA gyrase, A subunit [Thermincola sp. JR] >gb|ADG80905.1| DNA gyrase, A subunit [Thermincola potens JR]
	204 	204 	96% 	1e-50	Gene info linked to YP_003638806.1
YP_001210558.1 	
type IIA topoisomerase, A subunit [Pelotomaculum thermopropionicum SI] >dbj|BAF58189.1| type IIA topoisomerase, A subunit [Pelotomaculum thermopropionicum SI]
	204 	204 	96% 	1e-50	Gene info linked to YP_001210558.1
ZP_07953464.1 	
DNA gyrase, subunit A [Gemella moribillum M424] >gb|EFV36275.1| DNA gyrase, subunit A [Gemella moribillum M424]
	204 	204 	95% 	1e-50	
YP_684895.1 	
type II DNA topoisomerase II (gyrase), subunit A [uncultured methanogenic archaeon RC-I] >emb|CAJ35569.1| type II DNA topoisomerase II (gyrase), subunit A [uncultured methanogenic archaeon RC-I]
	204 	204 	96% 	1e-50	Gene info linked to YP_684895.1
YP_003426547.1 	
DNA gyrase subunit A [Bacillus pseudofirmus OF4] >gb|ADC49655.1| DNA gyrase subunit A [Bacillus pseudofirmus OF4]
	204 	204 	96% 	1e-50	Gene info linked to YP_003426547.1
ZP_04658388.1 	
DNA gyrase subunit A [Selenomonas flueggei ATCC 43531] >gb|EEQ49212.1| DNA gyrase subunit A [Selenomonas flueggei ATCC 43531]
	204 	204 	82% 	1e-50	
YP_003183460.1 	
DNA gyrase, A subunit [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] >gb|ACV57071.1| DNA gyrase, A subunit [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
	204 	204 	96% 	1e-50	Gene info linked to YP_003183460.1
NP_893180.1 	
DNA gyrase subunit A [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >emb|CAE19522.1| DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
	204 	204 	87% 	1e-50	Gene info linked to NP_893180.1
NP_634444.1 	
DNA gyrase, subunit A [Methanosarcina mazei Go1] >gb|AAM32116.1| DNA gyrase, subunit A [Methanosarcina mazei Go1]
	204 	204 	96% 	1e-50	Gene info linked to NP_634444.1
YP_002521890.1 	
DNA gyrase, A subunit [Thermomicrobium roseum DSM 5159] >gb|ACM04967.1| DNA gyrase, A subunit [Thermomicrobium roseum DSM 5159]
	204 	204 	93% 	1e-50	Gene info linked to YP_002521890.1
ZP_05733640.1 	
DNA gyrase, A subunit [Dialister invisus DSM 15470] >gb|EEW97104.1| DNA gyrase, A subunit [Dialister invisus DSM 15470]
	204 	204 	84% 	1e-50	
YP_003935043.1 	
DNA gyrase (type ii topoisomerase), subunit a [Clostridium sticklandii DSM 519] >emb|CBH20138.1| DNA gyrase (type II topoisomerase), subunit A [Clostridium sticklandii]
	204 	204 	96% 	1e-50	Gene info linked to YP_003935043.1
ZP_06369747.1 	
DNA gyrase, A subunit [Desulfovibrio sp. FW1012B] >gb|EFC20079.1| DNA gyrase, A subunit [Desulfovibrio sp. FW1012B]
	204 	204 	96% 	1e-50	
YP_001919472.1 	
DNA gyrase subunit A [Clostridium botulinum E3 str. Alaska E43] >gb|ACD51321.1| DNA gyrase, A subunit [Clostridium botulinum E3 str. Alaska E43]
	204 	204 	84% 	2e-50	Gene info linked to YP_001919472.1
YP_376735.1 	
DNA gyrase subunit A [Synechococcus sp. CC9902] >gb|ABB25691.1| DNA gyrase subunit A [Synechococcus sp. CC9902]
	204 	204 	83% 	2e-50	Gene info linked to YP_376735.1
ZP_07710352.1 	
DNA gyrase subunit A [Bacillus sp. m3-13]
	204 	204 	96% 	2e-50	
ZP_01124482.1 	
DNA gyrase subunit A [Synechococcus sp. WH 7805] >gb|EAR18073.1| DNA gyrase subunit A [Synechococcus sp. WH 7805]
	204 	204 	87% 	2e-50	
YP_003824428.1 	
DNA gyrase subunit A [Thermosediminibacter oceani DSM 16646] >gb|ADL06805.1| DNA gyrase subunit A [Thermosediminibacter oceani DSM 16646]
	204 	204 	87% 	2e-50	Gene info linked to YP_003824428.1
YP_001485267.1 	
DNA gyrase subunit A [Bacillus pumilus SAFR-032] >gb|ABV60707.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Bacillus pumilus SAFR-032]
	204 	204 	90% 	2e-50	Gene info linked to YP_001485267.1
YP_004151746.1 	
DNA gyrase, A subunit [Thermovibrio ammonificans HB-1] >gb|ADU97105.1| DNA gyrase, A subunit [Thermovibrio ammonificans HB-1]
	204 	204 	87% 	2e-50	Gene info linked to YP_004151746.1
ZP_04824088.1 	
DNA gyrase, A subunit [Clostridium botulinum E1 str. 'BoNT E Beluga'] >gb|EES51373.1| DNA gyrase, A subunit [Clostridium botulinum E1 str. 'BoNT E Beluga']
	203 	203 	84% 	2e-50	
ZP_08092940.1 	
DNA gyrase subunit A [Planococcus donghaensis MPA1U2] >gb|EGA91204.1| DNA gyrase subunit A [Planococcus donghaensis MPA1U2]
	203 	203 	82% 	2e-50	
YP_003322805.1 	
DNA gyrase, A subunit [Thermobaculum terrenum ATCC BAA-798] >gb|ACZ41983.1| DNA gyrase, A subunit [Thermobaculum terrenum ATCC BAA-798]
	203 	203 	95% 	2e-50	Gene info linked to YP_003322805.1
ZP_07333088.1 	
DNA gyrase, A subunit [Desulfovibrio fructosovorans JJ] >gb|EFL51708.1| DNA gyrase, A subunit [Desulfovibrio fructosovorans JJ]
	203 	203 	85% 	3e-50	
ZP_01173948.1 	
DNA gyrase subunit A [Bacillus sp. NRRL B-14911] >gb|EAR63332.1| DNA gyrase subunit A [Bacillus sp. NRRL B-14911]
	203 	203 	96% 	3e-50	
ZP_07397848.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Selenomonas sp. oral taxon 149 str. 67H29BP] >gb|EFM22801.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Selenomonas sp. oral taxon 149 str. 67H29BP]
	203 	203 	82% 	3e-50	
ZP_04566735.1 	
DNA gyrase subunit A [Fusobacterium mortiferum ATCC 9817] >gb|EEO36649.1| DNA gyrase subunit A [Fusobacterium mortiferum ATCC 9817]
	203 	203 	96% 	3e-50	
ZP_08032080.1 	
DNA gyrase, A subunit [Selenomonas artemidis F0399] >gb|EFW28668.1| DNA gyrase, A subunit [Selenomonas artemidis F0399]
	203 	203 	82% 	3e-50	
ZP_06644196.1 	
DNA gyrase, A subunit [Erysipelotrichaceae bacterium 5_2_54FAA] >gb|EFE47693.1| DNA gyrase, A subunit [Erysipelotrichaceae bacterium 5_2_54FAA]
	203 	203 	96% 	3e-50	
ZP_07828290.1 	
DNA gyrase, A subunit [Selenomonas sp. oral taxon 137 str. F0430] >gb|EFR42092.1| DNA gyrase, A subunit [Selenomonas sp. oral taxon 137 str. F0430]
	202 	202 	82% 	3e-50	
YP_001551012.1 	
DNA gyrase subunit A [Prochlorococcus marinus str. MIT 9211] >gb|ABX09058.1| DNA gyrase/topoisomerase IV, subunit A [Prochlorococcus marinus str. MIT 9211]
	202 	202 	87% 	4e-50	Gene info linked to YP_001551012.1
YP_001716209.1 	
DNA gyrase, A subunit [Candidatus Desulforudis audaxviator MP104C] >gb|ACA58577.1| DNA gyrase, A subunit [Candidatus Desulforudis audaxviator MP104C]
	202 	202 	83% 	4e-50	Gene info linked to YP_001716209.1
YP_002247895.1 	
DNA gyrase, A subunit [Thermodesulfovibrio yellowstonii DSM 11347] >gb|ACI20689.1| DNA gyrase, A subunit [Thermodesulfovibrio yellowstonii DSM 11347]
	202 	202 	85% 	4e-50	Gene info linked to YP_002247895.1
ZP_01968097.1 	
hypothetical protein RUMTOR_01664 [Ruminococcus torques ATCC 27756] >gb|EDK24206.1| hypothetical protein RUMTOR_01664 [Ruminococcus torques ATCC 27756]
	202 	202 	82% 	5e-50	
ZP_01439975.1 	
DNA gyrase subunit A [Fulvimarina pelagi HTCC2506] >gb|EAU40751.1| DNA gyrase subunit A [Fulvimarina pelagi HTCC2506]
	202 	202 	96% 	5e-50	
ZP_07877573.1 	
DNA gyrase subunit A [Pedobacter saltans DSM 12145] >gb|EFR80620.1| DNA gyrase subunit A [Pedobacter saltans DSM 12145]
	202 	202 	86% 	5e-50	
ZP_07959103.1 	
DNA gyrase, subunit A [Lachnospiraceae bacterium 8_1_57FAA] >gb|EFV19750.1| DNA gyrase, subunit A [Lachnospiraceae bacterium 8_1_57FAA]
	202 	202 	82% 	5e-50	
YP_003993861.1 	
DNA gyrase, A subunit [Halanaerobium sp. 'sapolanicus'] >gb|ADQ13507.1| DNA gyrase, A subunit [Halanaerobium sp. 'sapolanicus']
	202 	202 	82% 	6e-50	Gene info linked to YP_003993861.1
YP_001884272.1 	
DNA gyrase subunit A [Clostridium botulinum B str. Eklund 17B] >gb|ACD23928.1| DNA gyrase, A subunit [Clostridium botulinum B str. Eklund 17B]
	202 	202 	84% 	6e-50	Gene info linked to YP_001884272.1
ZP_02438912.1 	
hypothetical protein CLOSS21_01376 [Clostridium sp. SS2/1] >gb|EDS21986.1| hypothetical protein CLOSS21_01376 [Clostridium sp. SS2/1] >emb|CBL37199.1| DNA gyrase subunit A [butyrate-producing bacterium SSC/2]
	202 	202 	92% 	6e-50	
ZP_04452927.1 	
hypothetical protein GCWU000182_02242 [Abiotrophia defectiva ATCC 49176] >gb|EEP24590.1| hypothetical protein GCWU000182_02242 [Abiotrophia defectiva ATCC 49176]
	202 	202 	96% 	7e-50	
CBK75575.1 	
DNA gyrase subunit A [Butyrivibrio fibrisolvens 16/4]
	202 	202 	82% 	7e-50	
YP_002769492.1 	
DNA gyrase subunit A [Brevibacillus brevis NBRC 100599] >dbj|BAH40988.1| DNA gyrase subunit A [Brevibacillus brevis NBRC 100599]
	202 	202 	96% 	7e-50	Gene info linked to YP_002769492.1
ZP_03294148.1 	
hypothetical protein CLOHIR_02100 [Clostridium hiranonis DSM 13275] >gb|EEA84244.1| hypothetical protein CLOHIR_02100 [Clostridium hiranonis DSM 13275]
	202 	202 	82% 	7e-50	
ZP_05902213.1 	
DNA gyrase, A subunit [Leptotrichia hofstadii F0254] >gb|EEX74003.1| DNA gyrase, A subunit [Leptotrichia hofstadii F0254]
	202 	202 	82% 	7e-50	
ZP_07957573.1 	
hypothetical protein HMPREF0996_02557 [Lachnospiraceae bacterium 5_1_63FAA] >gb|EFV15678.1| hypothetical protein HMPREF0996_02557 [Lachnospiraceae bacterium 5_1_63FAA]
	201 	201 	92% 	8e-50	
YP_002951381.1 	
DNA gyrase subunit A [Desulfovibrio magneticus RS-1] >dbj|BAH73495.1| DNA gyrase subunit A [Desulfovibrio magneticus RS-1]
	201 	201 	97% 	8e-50	Gene info linked to YP_002951381.1
ZP_03495122.1 	
DNA gyrase, A subunit [Alicyclobacillus acidocaldarius LAA1] >gb|EED06191.1| DNA gyrase, A subunit [Alicyclobacillus acidocaldarius LAA1]
	201 	201 	96% 	1e-49	
YP_003165141.1 	
DNA gyrase, A subunit [Leptotrichia buccalis DSM 1135] >gb|ACV40150.1| DNA gyrase, A subunit [Leptotrichia buccalis C-1013-b]
	201 	201 	82% 	1e-49	Gene info linked to YP_003165141.1
YP_001679694.1 	
DNA gyrase, a subunit [Heliobacterium modesticaldum Ice1] >gb|ABZ83683.1| DNA gyrase, a subunit [Heliobacterium modesticaldum Ice1]
	201 	201 	96% 	1e-49	Gene info linked to YP_001679694.1
ZP_03568146.1 	
DNA gyrase, A subunit [Atopobium rimae ATCC 49626] >gb|EEE17384.1| DNA gyrase, A subunit [Atopobium rimae ATCC 49626]
	201 	201 	85% 	1e-49	
ZP_03779355.1 	
hypothetical protein CLOHYLEM_06427 [Clostridium hylemonae DSM 15053] >gb|EEG73481.1| hypothetical protein CLOHYLEM_06427 [Clostridium hylemonae DSM 15053]
	201 	201 	82% 	1e-49	
YP_001695785.1 	
DNA gyrase subunit A [Lysinibacillus sphaericus C3-41] >gb|ACA37655.1| DNA gyrase subunit A [Lysinibacillus sphaericus C3-41]
	201 	201 	83% 	2e-49	Gene info linked to YP_001695785.1
YP_003778223.1 	
DNA gyrase subunit A [Clostridium ljungdahlii DSM 13528] >gb|ADK13121.1| DNA gyrase, subunit A [Clostridium ljungdahlii DSM 13528]
	201 	201 	85% 	2e-49	Gene info linked to YP_003778223.1
YP_003850691.1 	
DNA gyrase, A subunit [Thermoanaerobacterium thermosaccharolyticum DSM 571] >gb|ADL67607.1| DNA gyrase, A subunit [Thermoanaerobacterium thermosaccharolyticum DSM 571]
	200 	200 	84% 	2e-49	Gene info linked to YP_003850691.1
YP_001955950.1 	
DNA gyrase subunit A [uncultured Termite group 1 bacterium phylotype Rs-D17] >dbj|BAG13489.1| DNA gyrase subunit A [uncultured Termite group 1 bacterium phylotype Rs-D17]
	200 	200 	85% 	2e-49	Gene info linked to YP_001955950.1
ZP_03801669.1 	
hypothetical protein COPCOM_03970 [Coprococcus comes ATCC 27758] >gb|EEG88047.1| hypothetical protein COPCOM_03970 [Coprococcus comes ATCC 27758]
	200 	200 	82% 	2e-49	
YP_002049399.1 	
DNA gyrase subunit A [Paulinella chromatophora] >gb|ACB43189.1| DNA gyrase subunit A [Paulinella chromatophora]
	200 	200 	83% 	2e-49	Gene info linked to YP_002049399.1
ZP_08092063.1 	
hypothetical protein HMPREF9474_03814 [Clostridium symbiosum WAL-14163] >gb|EGA92262.1| hypothetical protein HMPREF9474_03814 [Clostridium symbiosum WAL-14163] >gb|EGB16888.1| A subunit [Clostridium symbiosum WAL-14673]
	200 	200 	82% 	2e-49	
YP_002993370.1 	
DNA gyrase, A subunit [Desulfovibrio salexigens DSM 2638] >gb|ACS81831.1| DNA gyrase, A subunit [Desulfovibrio salexigens DSM 2638]
	200 	200 	97% 	2e-49	Gene info linked to YP_002993370.1
ZP_02040104.1 	
hypothetical protein RUMGNA_00866 [Ruminococcus gnavus ATCC 29149] >gb|EDN78705.1| hypothetical protein RUMGNA_00866 [Ruminococcus gnavus ATCC 29149]
	200 	200 	82% 	3e-49	
ZP_05634517.1 	
DNA gyrase subunit A [Fusobacterium ulcerans ATCC 49185] >ref|ZP_07929119.1| DNA gyrase subunit A [Fusobacterium ulcerans ATCC 49185] >gb|EFS27145.1| DNA gyrase subunit A [Fusobacterium ulcerans ATCC 49185]
	199 	199 	96% 	3e-49	
ZP_02420175.1 	
hypothetical protein ANACAC_02786 [Anaerostipes caccae DSM 14662] >ref|ZP_07931749.1| DNA gyrase, subunit A [Anaerostipes sp. 3_2_56FAA] >gb|EDR96657.1| hypothetical protein ANACAC_02786 [Anaerostipes caccae DSM 14662] >gb|EFV22133.1| DNA gyrase, subunit A [Anaerostipes sp. 3_2_56FAA]
	199 	199 	86% 	3e-49	
ZP_03718025.1 	
hypothetical protein EUBHAL_03120 [Eubacterium hallii DSM 3353] >gb|EEG35038.1| hypothetical protein EUBHAL_03120 [Eubacterium hallii DSM 3353]
	199 	199 	82% 	3e-49	
YP_002544518.1 	
DNA gyrase, A subunit [Agrobacterium radiobacter K84] >gb|ACM26590.1| DNA gyrase, A subunit [Agrobacterium radiobacter K84]
	199 	199 	96% 	3e-49	Gene info linked to YP_002544518.1
ZP_03633686.1 	
hypothetical protein HOLDEFILI_00967 [Holdemania filiformis DSM 12042] >gb|EEF68998.1| hypothetical protein HOLDEFILI_00967 [Holdemania filiformis DSM 12042]
	199 	199 	88% 	4e-49	
ZP_01995549.1 	
hypothetical protein DORLON_01543 [Dorea longicatena DSM 13814] >gb|EDM62956.1| hypothetical protein DORLON_01543 [Dorea longicatena DSM 13814]
	199 	199 	82% 	4e-49	
ZP_01724192.1 	
DNA gyrase subunit A [Bacillus sp. B14905] >gb|EAZ85378.1| DNA gyrase subunit A [Bacillus sp. B14905]
	199 	199 	83% 	4e-49	
ZP_01665124.1 	
DNA gyrase, A subunit [Thermosinus carboxydivorans Nor1] >gb|EAX48769.1| DNA gyrase, A subunit [Thermosinus carboxydivorans Nor1]
	199 	199 	96% 	4e-49	
ZP_04667159.1 	
conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA] >gb|EEQ60380.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
	199 	199 	86% 	4e-49	
ACD02000.1 	
putative gyrase subunit A [Clostridium septicum]
	199 	199 	85% 	5e-49	
ZP_03290172.1 	
hypothetical protein CLONEX_02386 [Clostridium nexile DSM 1787] >gb|EEA81706.1| hypothetical protein CLONEX_02386 [Clostridium nexile DSM 1787]
	199 	199 	82% 	5e-49	
NP_346654.1 	
DNA gyrase subunit A [Clostridium acetobutylicum ATCC 824] >sp|P94605.2|GYRA_CLOAB RecName: Full=DNA gyrase subunit A >gb|AAK77994.1|AE007513_7 DNA gyrase (topoisomerase II) A subunit [Clostridium acetobutylicum ATCC 824]
	199 	199 	86% 	5e-49	Gene info linked to NP_346654.1
AAB41131.1 	
DNA gyrase subunit A [Clostridium acetobutylicum ATCC 824]
	199 	199 	86% 	5e-49	
ZP_07756792.1 	
DNA gyrase, A subunit [Megasphaera micronuciformis F0359] >gb|EFQ04965.1| DNA gyrase, A subunit [Megasphaera micronuciformis F0359]
	199 	199 	83% 	5e-49	
CBW24947.1 	
DNA gyrase subunit A [Bacteriovorax marinus SJ]
	199 	199 	96% 	5e-49	
ZP_06894366.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Clostridium difficile NAP08] >gb|EFH05361.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Clostridium difficile NAP08]
	199 	199 	82% 	6e-49	
ZP_02431710.1 	
hypothetical protein CLOSCI_01940 [Clostridium scindens ATCC 35704] >gb|EDS06940.1| hypothetical protein CLOSCI_01940 [Clostridium scindens ATCC 35704]
	199 	199 	82% 	6e-49	
YP_002886096.1 	
DNA gyrase, A subunit [Exiguobacterium sp. AT1b] >gb|ACQ70651.1| DNA gyrase, A subunit [Exiguobacterium sp. AT1b]
	199 	199 	96% 	6e-49	Gene info linked to YP_002886096.1
XP_001770207.1 	
predicted protein [Physcomitrella patens subsp. patens] >gb|EDQ65041.1| predicted protein [Physcomitrella patens subsp. patens]
	198 	198 	82% 	6e-49	UniGene info linked to XP_001770207.1Gene info linked to XP_001770207.1
ZP_05403052.1 	
DNA gyrase subunit A [Clostridium difficile QCD-23m63] >ref|ZP_06904041.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Clostridium difficile NAP07] >gb|EFH14817.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Clostridium difficile NAP07]
	198 	198 	82% 	7e-49	
ZP_07320109.1 	
DNA gyrase, A subunit [Atopobium vaginae PB189-T1-4] >gb|EFL43541.1| DNA gyrase, A subunit [Atopobium vaginae PB189-T1-4]
	198 	198 	83% 	7e-49	
ZP_06424353.1 	
DNA gyrase, A subunit [Peptostreptococcus anaerobius 653-L] >gb|EFD05704.1| DNA gyrase, A subunit [Peptostreptococcus anaerobius 653-L]
	198 	198 	83% 	8e-49	
ZP_02088791.1 	
hypothetical protein CLOBOL_06347 [Clostridium bolteae ATCC BAA-613] >gb|EDP13369.1| hypothetical protein CLOBOL_06347 [Clostridium bolteae ATCC BAA-613]
	198 	198 	82% 	8e-49	
ZP_06602733.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Selenomonas noxia ATCC 43541] >gb|EFF67120.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Selenomonas noxia ATCC 43541]
	198 	198 	82% 	8e-49	
ZP_07825030.1 	
DNA gyrase, A subunit [Dialister microaerophilus UPII 345-E] >gb|EFR43365.1| DNA gyrase, A subunit [Dialister microaerophilus UPII 345-E]
	198 	198 	83% 	8e-49	
YP_565158.1 	
DNA gyrase subunit A [Methanococcoides burtonii DSM 6242] >gb|ABE51408.1| DNA gyrase subunit A [Methanococcoides burtonii DSM 6242]
	198 	198 	97% 	8e-49	Gene info linked to YP_565158.1
YP_843809.1 	
DNA gyrase, A subunit [Methanosaeta thermophila PT] >gb|ABK15169.1| DNA gyrase subunit A [Methanosaeta thermophila PT]
	198 	198 	90% 	9e-49	Gene info linked to YP_843809.1
NP_875529.1 	
DNA gyrase subunit A [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gb|AAQ00182.1| DNA gyrase A subunit [Prochlorococcus marinus subsp. marinus str. CCMP1375]
	198 	198 	83% 	9e-49	Gene info linked to NP_875529.1
CBN74882.1 	
DNA gyrase subunit A [Ectocarpus siliculosus]
	198 	198 	82% 	9e-49	
ZP_06391682.1 	
DNA gyrase, A subunit [Dethiosulfovibrio peptidovorans DSM 11002] >gb|EFC90623.1| DNA gyrase, A subunit [Dethiosulfovibrio peptidovorans DSM 11002]
	198 	198 	88% 	9e-49	
ZP_07944952.1 	
DNA gyrase, A subunit [Bilophila wadsworthia 3_1_6] >gb|EFV43891.1| DNA gyrase, A subunit [Bilophila wadsworthia 3_1_6]
	198 	198 	84% 	9e-49	
ZP_02235714.1 	
hypothetical protein DORFOR_02606 [Dorea formicigenerans ATCC 27755] >gb|EDR45999.1| hypothetical protein DORFOR_02606 [Dorea formicigenerans ATCC 27755]
	198 	198 	82% 	1e-48	
ZP_07897476.1 	
DNA gyrase, A subunit [Paenibacillus vortex V453] >gb|EFU43970.1| DNA gyrase, A subunit [Paenibacillus vortex V453]
	198 	198 	96% 	1e-48	
ZP_01227561.1 	
DNA gyrase/topo II, topoisomerase IV, A subunit [Aurantimonas manganoxydans SI85-9A1] >gb|EAS50329.1| DNA gyrase/topo II, topoisomerase IV, A subunit [Aurantimonas manganoxydans SI85-9A1]
	197 	197 	95% 	1e-48	
YP_003716969.1 	
DNA gyrase A subunit [Croceibacter atlanticus HTCC2559] >gb|EAP86586.1| DNA gyrase A subunit [Croceibacter atlanticus HTCC2559]
	197 	197 	96% 	1e-48	Gene info linked to YP_003716969.1
YP_004173721.1 	
DNA gyrase subunit A [Anaerolinea thermophila UNI-1] >dbj|BAJ63121.1| DNA gyrase subunit A [Anaerolinea thermophila UNI-1]
	197 	197 	81% 	1e-48	Gene info linked to YP_004173721.1
YP_003922806.1 	
DNA gyrase subunit A [Mycoplasma fermentans JER] >ref|YP_004136722.1| DNA gyrase subunit a [Mycoplasma fermentans M64] >gb|ADN68922.1| DNA gyrase subunit A [Mycoplasma fermentans JER] >gb|ADV34345.1| DNA gyrase subunit A [Mycoplasma fermentans M64]
	197 	197 	88% 	1e-48	Gene info linked to YP_003922806.1
YP_003475902.1 	
DNA gyrase, A subunit [Thermoanaerobacter italicus Ab9] >gb|ADD01340.1| DNA gyrase, A subunit [Thermoanaerobacter italicus Ab9]
	197 	197 	83% 	1e-48	Gene info linked to YP_003475902.1
YP_003675810.1 	
DNA gyrase, A subunit [Thermoanaerobacter mathranii subsp. mathranii str. A3] >gb|ADH59799.1| DNA gyrase, A subunit [Thermoanaerobacter mathranii subsp. mathranii str. A3]
	197 	197 	83% 	1e-48	Gene info linked to YP_003675810.1
YP_003827559.1 	
DNA gyrase, A subunit [Acetohalobium arabaticum DSM 5501] >gb|ADL12494.1| DNA gyrase, A subunit [Acetohalobium arabaticum DSM 5501]
	197 	197 	83% 	1e-48	Gene info linked to YP_003827559.1
ZP_07052083.1 	
DNA gyrase subunit A [Lysinibacillus fusiformis ZC1] >gb|EFI66139.1| DNA gyrase subunit A [Lysinibacillus fusiformis ZC1]
	197 	197 	83% 	1e-48	
BAH69645.1 	
hypothetical protein [Mycoplasma fermentans PG18]
	197 	197 	88% 	1e-48	
YP_001609790.1 	
DNA gyrase subunit A [Bartonella tribocorum CIP 105476] >emb|CAK01795.1| DNA gyrase subunit A [Bartonella tribocorum CIP 105476]
	197 	197 	96% 	1e-48	Gene info linked to YP_001609790.1
YP_001661670.1 	
DNA gyrase, A subunit [Thermoanaerobacter sp. X514] >ref|ZP_07131072.1| DNA gyrase, A subunit [Thermoanaerobacter sp. X561] >ref|YP_003902979.1| DNA gyrase subunit A [Thermoanaerobacter sp. X513] >gb|ABY91334.1| DNA gyrase, A subunit [Thermoanaerobacter sp. X514] >gb|EFK85585.1| DNA gyrase, A subunit [Thermoanaerobacter sp. X561] >gb|ADN53688.1| DNA gyrase, A subunit [Thermoanaerobacter sp. X513]
	197 	197 	83% 	1e-48	Gene info linked to YP_001661670.1
YP_001664020.1 	
DNA gyrase, A subunit [Thermoanaerobacter pseudethanolicus ATCC 33223] >ref|ZP_05492324.1| DNA gyrase, A subunit [Thermoanaerobacter ethanolicus CCSD1] >ref|YP_004185026.1| DNA gyrase subunit A [Thermoanaerobacter brockii subsp. finnii Ako-1] >gb|ABY93684.1| DNA gyrase, A subunit [Thermoanaerobacter pseudethanolicus ATCC 33223] >gb|EEU62691.1| DNA gyrase, A subunit [Thermoanaerobacter ethanolicus CCSD1] >gb|ADV78643.1| DNA gyrase, A subunit [Thermoanaerobacter brockii subsp. finnii Ako-1]
	197 	197 	83% 	1e-48	Gene info linked to YP_001664020.1
YP_002456512.1 	
DNA gyrase, A subunit [Desulfitobacterium hafniense DCB-2] >gb|ACL18076.1| DNA gyrase, A subunit [Desulfitobacterium hafniense DCB-2]
	197 	197 	95% 	1e-48	Gene info linked to YP_002456512.1
YP_002935951.1 	
DNA gyrase, A subunit [Eubacterium rectale ATCC 33656] >gb|ACR73817.1| DNA gyrase, A subunit [Eubacterium rectale ATCC 33656]
	197 	197 	82% 	2e-48	Gene info linked to YP_002935951.1
ZP_07546984.1 	
DNA gyrase, A subunit [Thermoanaerobacter wiegelii Rt8.B1] >gb|EFN49760.1| DNA gyrase, A subunit [Thermoanaerobacter wiegelii Rt8.B1]
	197 	197 	83% 	2e-48	
ACN43207.1 	
DNA gyrase subunit A [Bacillus mojavensis]
	197 	197 	79% 	2e-48	
YP_002826081.1 	
DNA gyrase subunit A [Sinorhizobium fredii NGR234] >gb|ACP25328.1| DNA gyrase subunit A [Sinorhizobium fredii NGR234]
	197 	197 	96% 	2e-48	Gene info linked to YP_002826081.1
YP_516239.1 	
DNA gyrase subunit A [Desulfitobacterium hafniense Y51] >dbj|BAE81795.1| DNA gyrase subunit A [Desulfitobacterium hafniense Y51]
	197 	197 	95% 	2e-48	Gene info linked to YP_516239.1
NP_616516.1 	
DNA topoisomerase (ATP-hydrolyzing), subunit A [Methanosarcina acetivorans C2A] >gb|AAM04996.1| DNA topoisomerase (ATP-hydrolyzing), subunit A [Methanosarcina acetivorans C2A]
	197 	197 	96% 	2e-48	Gene info linked to NP_616516.1
YP_002721188.1 	
DNA gyrase subunit A [Brachyspira hyodysenteriae WA1] >gb|ACN83484.1| DNA gyrase subunit A [Brachyspira hyodysenteriae WA1]
	197 	197 	96% 	2e-48	Gene info linked to YP_002721188.1
ZP_03946983.1 	
DNA topoisomerase (ATP-hydrolyzing) [Atopobium vaginae DSM 15829] >ref|ZP_07664791.1| DNA gyrase, A subunit [Atopobium vaginae DSM 15829] >gb|EEI84167.1| DNA topoisomerase (ATP-hydrolyzing) [Atopobium vaginae DSM 15829]
	197 	197 	85% 	2e-48	
YP_003189595.1 	
DNA gyrase, A subunit [Desulfotomaculum acetoxidans DSM 771] >gb|ACV60972.1| DNA gyrase, A subunit [Desulfotomaculum acetoxidans DSM 771]
	197 	197 	95% 	2e-48	Gene info linked to YP_003189595.1
ZP_02074191.1 	
hypothetical protein CLOL250_00955 [Clostridium sp. L2-50] >gb|EDO58232.1| hypothetical protein CLOL250_00955 [Clostridium sp. L2-50]
	196 	196 	84% 	3e-48	
YP_002972165.1 	
DNA gyrase subunit A [Bartonella grahamii as4aup] >gb|ACS51476.1| DNA gyrase subunit A [Bartonella grahamii as4aup]
	196 	196 	96% 	3e-48	Gene info linked to YP_002972165.1
YP_697358.1 	
DNA gyrase subunit A [Clostridium perfringens SM101] >gb|ABG85405.1| DNA gyrase, A subunit [Clostridium perfringens SM101]
	196 	196 	85% 	3e-48	Gene info linked to YP_697358.1
YP_003319977.1 	
DNA gyrase, A subunit [Sphaerobacter thermophilus DSM 20745] >gb|ACZ39155.1| DNA gyrase, A subunit [Sphaerobacter thermophilus DSM 20745]
	196 	196 	97% 	3e-48	Gene info linked to YP_003319977.1
ZP_02633735.1 	
DNA gyrase, A subunit [Clostridium perfringens E str. JGS1987] >ref|ZP_02864478.1| DNA gyrase, A subunit [Clostridium perfringens C str. JGS1495] >gb|EDS80519.1| DNA gyrase, A subunit [Clostridium perfringens C str. JGS1495] >gb|EDT13615.1| DNA gyrase, A subunit [Clostridium perfringens E str. JGS1987]
	196 	196 	85% 	3e-48	
YP_460051.1 	
DNA gyrase subunit A [Syntrophus aciditrophicus SB] >gb|ABC75883.1| DNA gyrase subunit A [Syntrophus aciditrophicus SB]
	196 	196 	83% 	3e-48	Gene info linked to YP_460051.1
YP_032408.1 	
DNA gyrase subunit A [Bartonella quintana str. Toulouse] >emb|CAF26268.1| DNA gyrase subunit a [Bartonella quintana str. Toulouse]
	196 	196 	96% 	3e-48	Gene info linked to YP_032408.1
ZP_02869577.1 	
DNA gyrase subunit A [candidate division TM7 single-cell isolate TM7a]
	196 	196 	82% 	3e-48	
YP_064386.1 	
DNA gyrase, subunit A [Desulfotalea psychrophila LSv54] >emb|CAG35379.1| probable DNA gyrase, subunit A [Desulfotalea psychrophila LSv54]
	196 	196 	84% 	3e-48	Gene info linked to YP_064386.1
ZP_06026485.1 	
DNA gyrase, A subunit [Fusobacterium periodonticum ATCC 33693] >gb|EFE86942.1| DNA gyrase, A subunit [Fusobacterium periodonticum ATCC 33693]
	196 	196 	81% 	3e-48	
ZP_02637635.1 	
DNA gyrase, A subunit [Clostridium perfringens B str. ATCC 3626] >gb|EDT22244.1| DNA gyrase, A subunit [Clostridium perfringens B str. ATCC 3626]
	196 	196 	85% 	3e-48	
ZP_02954780.1 	
DNA gyrase, A subunit [Clostridium perfringens D str. JGS1721] >gb|EDT70220.1| DNA gyrase, A subunit [Clostridium perfringens D str. JGS1721]
	196 	196 	85% 	4e-48	
YP_003795720.1 	
DNA gyrase subunit A [Candidatus Nitrospira defluvii] >emb|CBK39792.1| DNA gyrase, subunit A [Candidatus Nitrospira defluvii]
	196 	196 	83% 	4e-48	Gene info linked to YP_003795720.1
ZP_05331882.1 	
DNA gyrase subunit A [Clostridium difficile QCD-63q42]
	196 	196 	82% 	4e-48	
ZP_04446541.1 	
hypothetical protein COLINT_03281 [Collinsella intestinalis DSM 13280] >gb|EEP44031.1| hypothetical protein COLINT_03281 [Collinsella intestinalis DSM 13280]
	196 	196 	85% 	4e-48	
ZP_02643925.1 	
DNA gyrase, A subunit [Clostridium perfringens NCTC 8239] >gb|EDT77165.1| DNA gyrase, A subunit [Clostridium perfringens NCTC 8239]
	196 	196 	85% 	4e-48	
CBI77726.1 	
DNA gyrase subunit A [Bartonella rochalimae ATCC BAA-1498]
	196 	196 	96% 	4e-48	
ZP_04598679.1 	
hypothetical protein VEIDISOL_00077 [Veillonella dispar ATCC 17748] >gb|EEP66014.1| hypothetical protein VEIDISOL_00077 [Veillonella dispar ATCC 17748]
	196 	196 	88% 	4e-48	
YP_001086469.1 	
DNA gyrase subunit A [Clostridium difficile 630] >ref|ZP_05352896.1| DNA gyrase subunit A [Clostridium difficile ATCC 43255] >emb|CAJ66820.1| DNA gyrase subunit A [Clostridium difficile 630]
	196 	196 	82% 	4e-48	Gene info linked to YP_001086469.1
YP_003240125.1 	
DNA gyrase subunit A [Paenibacillus sp. Y412MC10] >gb|ACX62318.1| DNA gyrase, A subunit [Paenibacillus sp. Y412MC10]
	196 	196 	96% 	4e-48	Gene info linked to YP_003240125.1
YP_003180391.1 	
DNA gyrase, A subunit [Eggerthella lenta DSM 2243] >gb|ACV54002.1| DNA gyrase, A subunit [Eggerthella lenta DSM 2243]
	196 	196 	85% 	4e-48	Gene info linked to YP_003180391.1
YP_003151782.1 	
DNA gyrase, A subunit [Anaerococcus prevotii DSM 20548] >gb|ACV28061.1| DNA gyrase, A subunit [Anaerococcus prevotii DSM 20548]
	196 	196 	83% 	4e-48	Gene info linked to YP_003151782.1
NP_560923.1 	
DNA gyrase subunit A [Clostridium perfringens str. 13] >dbj|BAB79713.1| DNA gyrase subunit A [Clostridium perfringens str. 13]
	196 	196 	85% 	4e-48	Gene info linked to NP_560923.1
ABF17878.1 	
DNA gyrase subunit A [Staphylococcus xylosus]
	196 	196 	96% 	5e-48	
ZP_03167333.1 	
hypothetical protein RUMLAC_01001 [Ruminococcus lactaris ATCC 29176] >gb|EDY33246.1| hypothetical protein RUMLAC_01001 [Ruminococcus lactaris ATCC 29176]
	196 	196 	82% 	5e-48	
CBE70018.1 	
DNA gyrase, subunit A, type II topoisomerase [NC10 bacterium 'Dutch sediment']
	196 	196 	81% 	5e-48	
YP_694482.1 	
DNA gyrase subunit A [Clostridium perfringens ATCC 13124] >ref|ZP_02640898.1| DNA gyrase, A subunit [Clostridium perfringens CPE str. F4969] >gb|ABG84520.1| DNA gyrase, A subunit [Clostridium perfringens ATCC 13124] >gb|EDT25517.1| DNA gyrase, A subunit [Clostridium perfringens CPE str. F4969]
	196 	196 	85% 	5e-48	Gene info linked to YP_694482.1
YP_004158918.1 	
DNA gyrase subunit A [Bartonella clarridgeiae 73] >emb|CBI76338.1| DNA gyrase subunit A [Bartonella clarridgeiae 73]
	196 	196 	96% 	5e-48	Gene info linked to YP_004158918.1
EGB15489.1 	
DNA gyrase, A subunit [Desulfovibrio sp. ND132]
	195 	195 	84% 	6e-48	
YP_003238033.1 	
DNA gyrase, A subunit [Ammonifex degensii KC4] >gb|ACX51183.1| DNA gyrase, A subunit [Ammonifex degensii KC4]
	195 	195 	88% 	6e-48	Gene info linked to YP_003238033.1
YP_004123052.1 	
DNA gyrase subunit A [Desulfovibrio aespoeensis Aspo-2] >gb|ADU64306.1| DNA gyrase, A subunit [Desulfovibrio aespoeensis Aspo-2]
	195 	195 	82% 	6e-48	Gene info linked to YP_004123052.1
YP_428891.1 	
DNA gyrase, A subunit [Moorella thermoacetica ATCC 39073] >gb|ABC18348.1| DNA gyrase, A subunit [Moorella thermoacetica ATCC 39073]
	195 	195 	83% 	6e-48	Gene info linked to YP_428891.1
YP_004001427.1 	
DNA gyrase, a subunit [Caldicellulosiruptor owensensis OL] >gb|ADQ03627.1| DNA gyrase, A subunit [Caldicellulosiruptor owensensis OL]
	195 	195 	83% 	6e-48	Gene info linked to YP_004001427.1
YP_003826625.1 	
DNA gyrase subunit A [Acetohalobium arabaticum DSM 5501] >gb|ADL11560.1| DNA gyrase subunit A [Acetohalobium arabaticum DSM 5501]
	195 	195 	83% 	6e-48	Gene info linked to YP_003826625.1
YP_003312787.1 	
DNA gyrase, A subunit [Veillonella parvula DSM 2008] >gb|ACZ25507.1| DNA gyrase, A subunit [Veillonella parvula DSM 2008]
	195 	195 	88% 	6e-48	Gene info linked to YP_003312787.1
YP_003966145.1 	
DNA gyrase subunit A [Ilyobacter polytropus DSM 2926] >gb|ADO81797.1| DNA gyrase subunit A [Ilyobacter polytropus DSM 2926]
	195 	195 	96% 	7e-48	Gene info linked to YP_003966145.1
ADO76168.1 	
DNA gyrase subunit A [Halanaerobium praevalens DSM 2228]
	195 	195 	81% 	7e-48	
YP_002499362.1 	
DNA gyrase subunit A [Methylobacterium nodulans ORS 2060] >gb|ACL59059.1| DNA gyrase, A subunit [Methylobacterium nodulans ORS 2060]
	195 	195 	95% 	7e-48	Gene info linked to YP_002499362.1
ZP_07315349.1 	
DNA gyrase, A subunit [Veillonella atypica ACS-134-V-Col7a] >gb|EFL58725.1| DNA gyrase, A subunit [Veillonella atypica ACS-134-V-Col7a]
	195 	195 	88% 	7e-48	
YP_004052612.1 	
DNA gyrase subunit a [Marivirga tractuosa DSM 4126] >gb|ADR20504.1| DNA gyrase subunit A [Marivirga tractuosa DSM 4126]
	195 	195 	96% 	7e-48	Gene info linked to YP_004052612.1
ZP_05273820.1 	
DNA gyrase subunit A [Clostridium difficile QCD-66c26] >ref|ZP_05399177.1| DNA gyrase subunit A [Clostridium difficile QCD-37x79] >ref|ZP_07408336.1| DNA gyrase, A subunit [Clostridium difficile QCD-32g58]
	195 	195 	82% 	7e-48	
YP_306284.1 	
DNA gyrase subunit A [Methanosarcina barkeri str. Fusaro] >gb|AAZ71704.1| DNA gyrase subunit A [Methanosarcina barkeri str. Fusaro]
	195 	195 	96% 	8e-48	Gene info linked to YP_306284.1
ZP_05324156.1 	
DNA gyrase subunit A [Clostridium difficile CIP 107932] >ref|ZP_05358015.1| DNA gyrase subunit A [Clostridium difficile QCD-76w55] >ref|ZP_05386768.1| DNA gyrase subunit A [Clostridium difficile QCD-97b34] >ref|YP_003213060.1| DNA gyrase subunit A [Clostridium difficile CD196] >emb|CBA60051.1| DNA gyrase subunit A [Clostridium difficile CD196]
	195 	195 	82% 	8e-48	
YP_003839376.1 	
DNA gyrase, A subunit [Caldicellulosiruptor obsidiansis OB47] >gb|ADL41390.1| DNA gyrase, A subunit [Caldicellulosiruptor obsidiansis OB47]
	195 	195 	83% 	9e-48	Gene info linked to YP_003839376.1
ZP_01773216.1 	
Hypothetical protein COLAER_02250 [Collinsella aerofaciens ATCC 25986] >gb|EBA38599.1| Hypothetical protein COLAER_02250 [Collinsella aerofaciens ATCC 25986]
	195 	195 	85% 	9e-48	
YP_846803.1 	
DNA gyrase, A subunit [Syntrophobacter fumaroxidans MPOB] >gb|ABK18368.1| DNA gyrase subunit A [Syntrophobacter fumaroxidans MPOB]
	194 	194 	83% 	9e-48	Gene info linked to YP_846803.1
YP_003698125.1 	
DNA gyrase subunit A [Bacillus selenitireducens MLS10] >gb|ADH97559.1| DNA gyrase, A subunit [Bacillus selenitireducens MLS10]
	194 	194 	96% 	9e-48	Gene info linked to YP_003698125.1
YP_002014844.1 	
DNA gyrase subunit A [Prosthecochloris aestuarii DSM 271] >gb|ACF45197.1| DNA gyrase, A subunit [Prosthecochloris aestuarii DSM 271]
	194 	194 	83% 	1e-47	Gene info linked to YP_002014844.1
ZP_07670010.1 	
DNA gyrase, A subunit [Erysipelotrichaceae bacterium 3_1_53] >gb|EFP62972.1| DNA gyrase, A subunit [Erysipelotrichaceae bacterium 3_1_53]
	194 	194 	85% 	1e-47	
ZP_03298273.1 	
hypothetical protein COLSTE_02200 [Collinsella stercoris DSM 13279] >gb|EEA89656.1| hypothetical protein COLSTE_02200 [Collinsella stercoris DSM 13279]
	194 	194 	85% 	1e-47	
NP_385666.1 	
DNA gyrase subunit A [Sinorhizobium meliloti 1021] >emb|CAC46139.1| Probable DNA gyrase subunit A [Sinorhizobium meliloti 1021]
	194 	194 	96% 	1e-47	Gene info linked to NP_385666.1
ZP_07587664.1 	
DNA gyrase, A subunit [Sinorhizobium meliloti BL225C] >gb|EFN32158.1| DNA gyrase, A subunit [Sinorhizobium meliloti BL225C]
	194 	194 	96% 	1e-47	
CBI80788.1 	
DNA gyrase subunit A [Bartonella sp. 1-1C]
	194 	194 	96% 	1e-47	
ZP_06757572.1 	
DNA gyrase, A subunit [Veillonella sp. 6_1_27] >gb|EFG24687.1| DNA gyrase, A subunit [Veillonella sp. 6_1_27]
	194 	194 	88% 	1e-47	
ZP_06258886.1 	
DNA gyrase, A subunit [Veillonella parvula ATCC 17745] >gb|EFB85838.1| DNA gyrase, A subunit [Veillonella parvula ATCC 17745]
	194 	194 	88% 	1e-47	
YP_989035.1 	
DNA gyrase subunit A [Bartonella bacilliformis KC583] >gb|AAL82403.1|AF469609_2 gyrase A subunit [Bartonella bacilliformis] >gb|ABM45365.1| DNA gyrase, A subunit [Bartonella bacilliformis KC583]
	194 	194 	96% 	1e-47	Gene info linked to YP_989035.1
ZP_07596611.1 	
DNA gyrase, A subunit [Sinorhizobium meliloti AK83] >gb|EFN28003.1| DNA gyrase, A subunit [Sinorhizobium meliloti AK83]
	194 	194 	96% 	1e-47	
YP_003634425.1 	
DNA gyrase, A subunit [Brachyspira murdochii DSM 12563] >gb|ADG72226.1| DNA gyrase, A subunit [Brachyspira murdochii DSM 12563]
	194 	194 	96% 	1e-47	Gene info linked to YP_003634425.1
YP_001326926.1 	
DNA gyrase subunit A [Sinorhizobium medicae WSM419] >gb|ABR60091.1| DNA gyrase, A subunit [Sinorhizobium medicae WSM419]
	194 	194 	96% 	1e-47	Gene info linked to YP_001326926.1
YP_033797.1 	
DNA gyrase subunit A [Bartonella henselae str. Houston-1] >emb|CAF27803.1| DNA gyrase subunit a [Bartonella henselae str. Houston-1]
	194 	194 	82% 	1e-47	Gene info linked to YP_033797.1
YP_642799.1 	
DNA gyrase subunit A [Rubrobacter xylanophilus DSM 9941] >gb|ABG02987.1| DNA gyrase subunit A [Rubrobacter xylanophilus DSM 9941]
	194 	194 	97% 	1e-47	Gene info linked to YP_642799.1
YP_913071.1 	
DNA gyrase subunit A [Chlorobium phaeobacteroides DSM 266] >gb|ABL66647.1| DNA gyrase subunit A [Chlorobium phaeobacteroides DSM 266]
	194 	194 	97% 	1e-47	Gene info linked to YP_913071.1
YP_001228796.1 	
DNA gyrase, A subunit [Geobacter uraniireducens Rf4] >gb|ABQ24223.1| DNA gyrase subunit A [Geobacter uraniireducens Rf4]
	194 	194 	81% 	1e-47	Gene info linked to YP_001228796.1
ZP_06759366.1 	
DNA gyrase, A subunit [Veillonella sp. 3_1_44] >gb|EFG22933.1| DNA gyrase, A subunit [Veillonella sp. 3_1_44]
	194 	194 	88% 	1e-47	
YP_003991144.1 	
DNA gyrase, a subunit [Caldicellulosiruptor hydrothermalis 108] >gb|ADQ05775.1| DNA gyrase, A subunit [Caldicellulosiruptor hydrothermalis 108]
	194 	194 	83% 	1e-47	Gene info linked to YP_003991144.1
YP_003691396.1 	
DNA gyrase, A subunit [Desulfurivibrio alkaliphilus AHT2] >gb|ADH86777.1| DNA gyrase, A subunit [Desulfurivibrio alkaliphilus AHT2]
	194 	194 	83% 	1e-47	Gene info linked to YP_003691396.1
ZP_02442899.1 	
hypothetical protein ANACOL_02199 [Anaerotruncus colihominis DSM 17241] >gb|EDS11016.1| hypothetical protein ANACOL_02199 [Anaerotruncus colihominis DSM 17241]
	194 	194 	85% 	2e-47	
ZP_07827043.1 	
DNA gyrase, A subunit [Veillonella sp. oral taxon 158 str. F0412] >gb|EFR60338.1| DNA gyrase, A subunit [Veillonella sp. oral taxon 158 str. F0412]
	194 	194 	88% 	2e-47	
ZP_07052725.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Listeria grayi DSM 20601] >gb|EFI85092.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Listeria grayi DSM 20601]
	194 	194 	96% 	2e-47	
YP_003701379.1 	
DNA gyrase, A subunit [Syntrophothermus lipocalidus DSM 12680] >gb|ADI00814.1| DNA gyrase, A subunit [Syntrophothermus lipocalidus DSM 12680]
	194 	194 	82% 	2e-47	Gene info linked to YP_003701379.1
ZP_03524212.1 	
DNA gyrase subunit A [Rhizobium etli GR56]
	194 	194 	96% 	2e-47	
YP_002571947.1 	
DNA gyrase, A subunit [Caldicellulosiruptor bescii DSM 6725] >gb|ACM59174.1| DNA gyrase, A subunit [Caldicellulosiruptor bescii DSM 6725]
	193 	193 	83% 	2e-47	Gene info linked to YP_002571947.1
ZP_02079805.1 	
hypothetical protein CLOLEP_01250 [Clostridium leptum DSM 753] >gb|EDO61746.1| hypothetical protein CLOLEP_01250 [Clostridium leptum DSM 753]
	193 	193 	85% 	2e-47	
ZP_07738928.1 	
DNA gyrase subunit A [Aminomonas paucivorans DSM 12260] >gb|EFQ22817.1| DNA gyrase subunit A [Aminomonas paucivorans DSM 12260]
	193 	193 	85% 	2e-47	
ZP_03756112.1 	
hypothetical protein CLOSTASPAR_00092 [Clostridium asparagiforme DSM 15981] >gb|EEG57776.1| hypothetical protein CLOSTASPAR_00092 [Clostridium asparagiforme DSM 15981]
	193 	193 	86% 	2e-47	
NP_354513.2 	
DNA gyrase subunit A [Agrobacterium tumefaciens str. C58] >gb|AAK87298.2| DNA gyrase subunit A [Agrobacterium tumefaciens str. C58]
	193 	193 	96% 	2e-47	Gene info linked to NP_354513.2
YP_001978297.1 	
DNA gyrase protein, A subunit [Rhizobium etli CIAT 652] >gb|ACE91119.1| DNA gyrase protein, A subunit [Rhizobium etli CIAT 652]
	193 	193 	96% 	2e-47	Gene info linked to YP_001978297.1
YP_002549707.1 	
DNA gyrase subunit A [Agrobacterium vitis S4] >gb|ACM36699.1| DNA gyrase A subunit [Agrobacterium vitis S4]
	193 	193 	88% 	2e-47	Gene info linked to YP_002549707.1
YP_003805972.1 	
DNA gyrase, A subunit [Spirochaeta smaragdinae DSM 11293] >gb|ADK83378.1| DNA gyrase, A subunit [Spirochaeta smaragdinae DSM 11293]
	193 	193 	91% 	2e-47	Gene info linked to YP_003805972.1
ZP_06946695.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Finegoldia magna ATCC 53516] >gb|EFH93460.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Finegoldia magna ATCC 53516]
	193 	193 	83% 	2e-47	
ZP_07317348.1 	
DNA gyrase, A subunit [Veillonella atypica ACS-049-V-Sch6] >gb|EFL56645.1| DNA gyrase, A subunit [Veillonella atypica ACS-049-V-Sch6]
	193 	193 	88% 	2e-47	
ZP_01870843.1 	
DNA gyrase subunit A [Caminibacter mediatlanticus TB-2] >gb|EDM24176.1| DNA gyrase subunit A [Caminibacter mediatlanticus TB-2]
	193 	193 	81% 	2e-47	
YP_004025213.1 	
DNA gyrase, a subunit [Caldicellulosiruptor kristjanssonii 177R1B] >gb|ADQ39600.1| DNA gyrase, A subunit [Caldicellulosiruptor kristjanssonii 177R1B]
	193 	193 	83% 	2e-47	Gene info linked to YP_004025213.1
YP_673961.1 	
DNA gyrase subunit A [Mesorhizobium sp. BNC1] >gb|ABG62796.1| DNA gyrase subunit A [Chelativorans sp. BNC1]
	193 	193 	96% 	3e-47	Gene info linked to YP_673961.1
YP_001178862.1 	
DNA gyrase, A subunit [Caldicellulosiruptor saccharolyticus DSM 8903] >gb|ABP65671.1| DNA gyrase subunit A [Caldicellulosiruptor saccharolyticus DSM 8903]
	193 	193 	83% 	3e-47	Gene info linked to YP_001178862.1
YP_004022749.1 	
DNA gyrase, a subunit [Caldicellulosiruptor kronotskyensis 2002] >gb|ADQ44930.1| DNA gyrase, A subunit [Caldicellulosiruptor kronotskyensis 2002]
	193 	193 	83% 	3e-47	Gene info linked to YP_004022749.1
ZP_03967233.1 	
DNA topoisomerase [Sphingobacterium spiritivorum ATCC 33300] >gb|EEI92914.1| DNA topoisomerase [Sphingobacterium spiritivorum ATCC 33300]
	193 	193 	86% 	3e-47	
ZP_07082852.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Sphingobacterium spiritivorum ATCC 33861] >gb|EFK55981.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Sphingobacterium spiritivorum ATCC 33861]
	193 	193 	86% 	3e-47	
YP_003727049.1 	
DNA gyrase subunit A [Methanohalobium evestigatum Z-7303] >gb|ADI74253.1| DNA gyrase, A subunit [Methanohalobium evestigatum Z-7303]
	193 	193 	97% 	3e-47	Gene info linked to YP_003727049.1
ZP_03512913.1 	
DNA gyrase subunit A [Rhizobium etli 8C-3]
	193 	193 	96% 	3e-47	
YP_003893999.1 	
DNA gyrase subunit A [Methanoplanus petrolearius DSM 11571] >gb|ADN35561.1| DNA gyrase, A subunit [Methanoplanus petrolearius DSM 11571]
	192 	192 	96% 	4e-47	Gene info linked to YP_003893999.1
ZP_01451365.1 	
DNA gyrase, A subunit [Mariprofundus ferrooxydans PV-1] >gb|EAU55548.1| DNA gyrase, A subunit [Mariprofundus ferrooxydans PV-1]
	192 	192 	83% 	4e-47	
ZP_07903261.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Eubacterium saburreum DSM 3986] >gb|EFU77851.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Eubacterium saburreum DSM 3986]
	192 	192 	82% 	4e-47	
ABC90894.1 	
DNA gyrase subunit A protein [Rhizobium etli CFN 42]
	192 	192 	96% 	4e-47	Gene info linked to ABC90894.1
CBI79207.1 	
DNA gyrase subunit A [Bartonella sp. AR 15-3]
	192 	192 	96% 	4e-47	
ZP_04678278.1 	
DNA gyrase, A subunit [Staphylococcus warneri L37603] >gb|EEQ79638.1| DNA gyrase, A subunit [Staphylococcus warneri L37603]
	192 	192 	96% 	4e-47	
YP_469621.2 	
DNA gyrase subunit A [Rhizobium etli CFN 42]
	192 	192 	96% 	4e-47	Gene info linked to YP_469621.2
YP_001466491.1 	
DNA gyrase subunit A [Campylobacter concisus 13826] >gb|EAT98013.1| DNA gyrase, A subunit [Campylobacter concisus 13826]
	192 	192 	82% 	4e-47	Gene info linked to YP_001466491.1
YP_300096.1 	
DNA gyrase subunit A [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >dbj|BAE17151.1| DNA gyrase subunit A [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
	192 	192 	96% 	5e-47	Gene info linked to YP_300096.1
ZP_03784329.1 	
hypothetical protein RUMHYD_03812 [Blautia hydrogenotrophica DSM 10507] >gb|EEG47308.1| hypothetical protein RUMHYD_03812 [Blautia hydrogenotrophica DSM 10507]
	192 	192 	82% 	5e-47	
YP_002975751.1 	
DNA gyrase subunit A [Rhizobium leguminosarum bv. trifolii WSM1325] >gb|ACS56212.1| DNA gyrase, A subunit [Rhizobium leguminosarum bv. trifolii WSM1325]
	192 	192 	96% 	5e-47	Gene info linked to YP_002975751.1
ZP_07947765.1 	
DNA gyrase, subunit A [Eggerthella sp. 1_3_56FAA] >gb|EFV33241.1| DNA gyrase, subunit A [Eggerthella sp. 1_3_56FAA]
	192 	192 	85% 	5e-47	
CBI82383.1 	
DNA gyrase subunit A [Bartonella schoenbuchensis R1]
	192 	192 	96% 	6e-47	
YP_173511.1 	
DNA gyrase subunit A [Bacillus clausii KSM-K16] >dbj|BAD62550.1| DNA gyrase subunit A [Bacillus clausii KSM-K16]
	192 	192 	96% 	7e-47	Gene info linked to YP_173511.1
NP_621724.1 	
DNA gyrase (topoisomerase II) A subunit [Thermoanaerobacter tengcongensis MB4] >gb|AAM23328.1| DNA gyrase (topoisomerase II) A subunit [Thermoanaerobacter tengcongensis MB4]
	192 	192 	83% 	7e-47	Gene info linked to NP_621724.1
ZP_05092281.1 	
DNA gyrase, A subunit [Carboxydibrachium pacificum DSM 12653] >gb|EEB75853.1| DNA gyrase, A subunit [Carboxydibrachium pacificum DSM 12653]
	192 	192 	83% 	7e-47	
ZP_02868565.1 	
hypothetical protein CLOSPI_02408 [Clostridium spiroforme DSM 1552] >gb|EDS73982.1| hypothetical protein CLOSPI_02408 [Clostridium spiroforme DSM 1552]
	192 	192 	96% 	7e-47	
ZP_00741727.1 	
DNA gyrase subunit A [Bacillus thuringiensis serovar israelensis ATCC 35646] >gb|EAO54006.1| DNA gyrase subunit A [Bacillus thuringiensis serovar israelensis ATCC 35646]
	192 	192 	69% 	8e-47	
YP_001627770.1 	
DNA gyrase subunit A [Brucella suis ATCC 23445] >gb|ABY38200.1| DNA gyrase, A subunit [Brucella suis ATCC 23445]
	192 	192 	96% 	8e-47	Gene info linked to YP_001627770.1
NP_698102.1 	
DNA gyrase subunit A [Brucella suis 1330] >ref|ZP_05998773.1| DNA gyrase subunit A [Brucella suis bv. 3 str. 686] >gb|AAN30017.1| DNA gyrase, A subunit [Brucella suis 1330] >gb|EEY32743.1| DNA gyrase subunit A [Brucella suis bv. 3 str. 686]
	192 	192 	96% 	8e-47	Gene info linked to NP_698102.1
CAK18882.1 	
topoisomerase II subunit A [Staphylococcus intermedius]
	191 	191 	90% 	8e-47	
YP_003553121.1 	
DNA gyrase, A subunit [Aminobacterium colombiense DSM 12261] >gb|ADE56397.1| DNA gyrase, A subunit [Aminobacterium colombiense DSM 12261]
	191 	191 	85% 	8e-47	Gene info linked to YP_003553121.1
ZP_05755616.1 	
DNA gyrase subunit A [Brucella sp. F5/99] >ref|ZP_06001998.1| DNA gyrase subunit A [Brucella sp. F5/99] >gb|EEY26269.1| DNA gyrase subunit A [Brucella sp. F5/99]
	191 	191 	96% 	8e-47	
ACN43202.1 	
DNA gyrase subunit A [Bacillus mojavensis]
	191 	191 	68% 	8e-47	
ZP_04851189.1 	
DNA gyrase, A subunit [Paenibacillus sp. oral taxon 786 str. D14] >gb|EES74330.1| DNA gyrase, A subunit [Paenibacillus sp. oral taxon 786 str. D14]
	191 	191 	96% 	8e-47	
YP_001592937.1 	
DNA gyrase subunit A [Brucella canis ATCC 23365] >ref|ZP_05836835.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] >gb|ABX62166.1| DNA gyrase, A subunit [Brucella canis ATCC 23365] >gb|EEW90963.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
	191 	191 	96% 	8e-47	Gene info linked to YP_001592937.1
YP_221805.1 	
DNA gyrase subunit A [Brucella abortus bv. 1 str. 9-941] >ref|YP_414514.1| DNA gyrase subunit A [Brucella melitensis biovar Abortus 2308] >ref|YP_002732833.1| DNA gyrase subunit A [Brucella melitensis ATCC 23457] >ref|ZP_05152580.1| DNA gyrase subunit A [Brucella abortus bv. 6 str. 870] >ref|ZP_05179421.1| DNA gyrase subunit A [Brucella ceti M13/05/1] >ref|ZP_05466439.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] >ref|ZP_05822305.1| conserved hypothetical protein [Brucella abortus NCTC 8038] >ref|ZP_05867189.1| DNA gyrase subunit A [Brucella abortus bv. 6 str. 870] >ref|ZP_05870406.1| DNA gyrase subunit A [Brucella abortus bv. 4 str. 292] >ref|ZP_05874225.1| DNA gyrase subunit A [Brucella abortus bv. 2 str. 86/8/59] >ref|ZP_05933726.1| hypothetical protein BAJG_02890 [Brucella ceti M13/05/1] >ref|ZP_05953375.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] >ref|ZP_05956930.1| hypothetical protein BAHG_01382 [Brucella pinnipedialis B2/94] >ref|ZP_05961138.1| conserved hypothetical protein [Brucella ceti M644/93/1] >ref|ZP_06101321.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1] >ref|ZP_06107572.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] >ref|ZP_06110786.1| hypothetical protein BAPG_01350 [Brucella ceti M490/95/1] >ref|ZP_06793111.1| hypothetical protein BAZG_01365 [Brucella sp. NVSL 07-0026] >gb|AAX74444.1| GyrA, DNA gyrase, A subunit [Brucella abortus bv. 1 str. 9-941] >emb|CAJ11077.1| DNA gyrase/topoisomerase IV, subunit A:DNA gyrase, subunit A:DNA gyrase C-terminal repeat, beta-propeller [Brucella melitensis biovar Abortus 2308] >gb|ACO00879.1| DNA gyrase, A subunit [Brucella melitensis ATCC 23457] >gb|EEW79493.1| conserved hypothetical protein [Brucella abortus NCTC 8038] >gb|EEX55316.1| DNA gyrase subunit A [Brucella abortus bv. 4 str. 292] >gb|EEX59135.1| DNA gyrase subunit A [Brucella abortus bv. 2 str. 86/8/59] >gb|EEX61770.1| DNA gyrase subunit A [Brucella abortus bv. 6 str. 870] >gb|EEX91102.1| hypothetical protein BAJG_02890 [Brucella ceti M13/05/1] >gb|EEX98127.1| conserved hypothetical protein [Brucella ceti M644/93/1] >gb|EEY00453.1| hypothetical protein BAHG_01382 [Brucella pinnipedialis B2/94] >gb|EEY06701.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] >gb|EEZ08687.1| hypothetical protein BAPG_01350 [Brucella ceti M490/95/1] >gb|EEZ11917.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] >gb|EEZ17974.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] >gb|EEZ31222.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1] >gb|EFG38026.1| hypothetical protein BAZG_01365 [Brucella sp. NVSL 07-0026]
	191 	191 	96% 	8e-47	Gene info linked to YP_221805.1
ZP_02210469.1 	
hypothetical protein CLOBAR_00006 [Clostridium bartlettii DSM 16795] >gb|EDQ97917.1| hypothetical protein CLOBAR_00006 [Clostridium bartlettii DSM 16795]
	191 	191 	82% 	8e-47	
ZP_05447660.1 	
DNA gyrase subunit A [Brucella melitensis bv. 1 str. Rev.1]
	191 	191 	96% 	8e-47	
ZP_05180974.1 	
DNA gyrase subunit A [Brucella sp. 83/13] >ref|ZP_07471011.1| DNA gyrase, A subunit [Brucella sp. NF 2653] >gb|EFM62968.1| DNA gyrase, A subunit [Brucella sp. NF 2653]
	191 	191 	96% 	8e-47	
YP_003820272.1 	
DNA gyrase, A subunit [Clostridium saccharolyticum WM1] >gb|ADL02649.1| DNA gyrase, A subunit [Clostridium saccharolyticum WM1]
	191 	191 	96% 	9e-47	Gene info linked to YP_003820272.1
ZP_05460609.1 	
DNA gyrase subunit A [Brucella ceti B1/94]
	191 	191 	96% 	9e-47	
ZP_05996113.1 	
DNA gyrase subunit A [Brucella suis bv. 5 str. 513] >gb|EEY30083.1| DNA gyrase subunit A [Brucella suis bv. 5 str. 513]
	191 	191 	96% 	9e-47	
YP_001935021.1 	
DNA gyrase subunit A [Brucella abortus S19] >ref|ZP_04594517.1| DNA gyrase, A subunit [Brucella abortus str. 2308 A] >ref|ZP_05159287.1| DNA gyrase subunit A [Brucella abortus bv. 2 str. 86/8/59] >ref|ZP_05168543.1| DNA gyrase subunit A [Brucella pinnipedialis M163/99/10] >ref|ZP_05171988.1| DNA gyrase subunit A [Brucella pinnipedialis B2/94] >ref|ZP_05175986.1| DNA gyrase subunit A [Brucella ceti M644/93/1] >ref|ZP_05188934.1| DNA gyrase subunit A [Brucella abortus bv. 4 str. 292] >ref|ZP_05445285.1| DNA gyrase subunit A [Brucella pinnipedialis M292/94/1] >ref|ZP_05454467.1| DNA gyrase subunit A [Brucella melitensis bv. 3 str. Ether] >ref|ZP_05457559.1| DNA gyrase subunit A [Brucella ceti M490/95/1] >gb|ACD72547.1| DNA gyrase subunit A [Brucella abortus S19] >gb|EEP63029.1| DNA gyrase, A subunit [Brucella abortus str. 2308 A]
	191 	191 	96% 	9e-47	Gene info linked to YP_001935021.1
ZP_06096894.1 	
hypothetical protein BAKG_00488 [Brucella sp. 83/13] >gb|EEZ33012.1| hypothetical protein BAKG_00488 [Brucella sp. 83/13]
	191 	191 	96% 	9e-47	
ZP_05936546.1 	
conserved hypothetical protein [Brucella ceti B1/94] >gb|EEX87502.1| conserved hypothetical protein [Brucella ceti B1/94]
	191 	191 	96% 	9e-47	
ZP_05166216.1 	
DNA gyrase subunit A [Brucella suis bv. 3 str. 686]
	191 	191 	96% 	9e-47	
XP_002505901.1 	
predicted protein [Micromonas sp. RCC299] >gb|ACO67159.1| predicted protein [Micromonas sp. RCC299]
	191 	191 	94% 	9e-47	Gene info linked to XP_002505901.1
ZP_07474508.1 	
DNA gyrase, A subunit [Brucella sp. BO2] >gb|EFM59500.1| DNA gyrase, A subunit [Brucella sp. BO2]
	191 	191 	96% 	9e-47	
YP_355438.1 	
DNA gyrase, A subunit [Pelobacter carbinolicus DSM 2380] >gb|ABA87268.1| DNA gyrase subunit A [Pelobacter carbinolicus DSM 2380]
	191 	191 	83% 	9e-47	Gene info linked to YP_355438.1
ZP_05163672.1 	
DNA gyrase subunit A [Brucella suis bv. 5 str. 513]
	191 	191 	96% 	9e-47	
NP_539801.2 	
DNA gyrase subunit A [Brucella melitensis bv. 1 str. 16M] >ref|ZP_05836125.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] >ref|ZP_06103736.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. Rev.1] >gb|EEW86803.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] >gb|EEZ14538.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. Rev.1]
	191 	191 	96% 	9e-47	Gene info linked to NP_539801.2
ZP_03785609.1 	
DNA gyrase, A subunit [Brucella ceti str. Cudo] >gb|EEH14622.1| DNA gyrase, A subunit [Brucella ceti str. Cudo]
	191 	191 	96% 	9e-47	
ZP_05155639.1 	
DNA gyrase subunit A [Brucella abortus bv. 3 str. Tulya] >ref|ZP_05928373.1| DNA gyrase subunit A [Brucella abortus bv. 3 str. Tulya] >gb|EEX82560.1| DNA gyrase subunit A [Brucella abortus bv. 3 str. Tulya]
	191 	191 	96% 	9e-47	
ZP_05463109.1 	
DNA gyrase subunit A [Brucella abortus bv. 9 str. C68] >ref|ZP_05895467.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68] >ref|ZP_06932132.1| DNA gyrase, A subunit [Brucella abortus bv. 5 str. B3196] >gb|EEX80450.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68] >gb|EFH34930.1| DNA gyrase, A subunit [Brucella abortus bv. 5 str. B3196]
	191 	191 	96% 	9e-47	
YP_003107034.1 	
DNA gyrase subunit A [Brucella microti CCM 4915] >gb|ACU48085.1| DNA gyrase subunit A [Brucella microti CCM 4915]
	191 	191 	96% 	9e-47	Gene info linked to YP_003107034.1
ZP_03311885.1 	
hypothetical protein DESPIG_01805 [Desulfovibrio piger ATCC 29098] >gb|EEB33208.1| hypothetical protein DESPIG_01805 [Desulfovibrio piger ATCC 29098]
	191 	191 	97% 	1e-46	
AAL52065.1 	
DNA gyrase subunit a [Brucella melitensis bv. 1 str. 16M]
	191 	191 	96% 	1e-46	Gene info linked to AAL52065.1
YP_003786613.1 	
DNA gyrase subunit A [Brachyspira pilosicoli 95/1000] >gb|ADK32112.1| DNA gyrase, A subunit [Brachyspira pilosicoli 95/1000]
	191 	191 	96% 	1e-46	Gene info linked to YP_003786613.1
YP_003316791.1 	
DNA gyrase, A subunit [Thermanaerovibrio acidaminovorans DSM 6589] >gb|ACZ18509.1| DNA gyrase, A subunit [Thermanaerovibrio acidaminovorans DSM 6589]
	191 	191 	84% 	1e-46	Gene info linked to YP_003316791.1
YP_378410.1 	
DNA gyrase, subunit A [Chlorobium chlorochromatii CaD3] >gb|ABB27367.1| DNA gyrase subunit A [Chlorobium chlorochromatii CaD3]
	191 	191 	97% 	1e-46	Gene info linked to YP_378410.1
ZP_02167348.1 	
DNA gyrase subunit A [Hoeflea phototrophica DFL-43] >gb|EDQ32952.1| DNA gyrase subunit A [Hoeflea phototrophica DFL-43]
	191 	191 	96% 	1e-46	
YP_003268862.1 	
DNA gyrase, A subunit [Haliangium ochraceum DSM 14365] >gb|ACY16969.1| DNA gyrase, A subunit [Haliangium ochraceum DSM 14365]
	191 	191 	86% 	1e-46	Gene info linked to YP_003268862.1
ZP_02163158.1 	
DNA topoisomerase, ATP-hydrolyzing (DNA gyrase) (DNA topoisomerase II), subunit A [Kordia algicida OT-1] >gb|EDP95249.1| DNA topoisomerase, ATP-hydrolyzing (DNA gyrase) (DNA topoisomerase II), subunit A [Kordia algicida OT-1]
	191 	191 	82% 	1e-46	
ACN43198.1 	
DNA gyrase subunit A [Bacillus mojavensis]
	191 	191 	68% 	1e-46	
YP_004063269.1 	
DNA gyrase subunit A [Candidatus Liberibacter solanacearum CLso-ZC1] >gb|ADR52781.1| DNA gyrase subunit A [Candidatus Liberibacter solanacearum CLso-ZC1]
	191 	191 	88% 	1e-46	Gene info linked to YP_004063269.1
YP_004109188.1 	
DNA gyrase subunit A [Rhodopseudomonas palustris DX-1] >gb|ADU44455.1| DNA gyrase, A subunit [Rhodopseudomonas palustris DX-1]
	191 	191 	96% 	1e-46	Gene info linked to YP_004109188.1
YP_003291459.1 	
DNA gyrase, A subunit [Rhodothermus marinus DSM 4252] >gb|ACY49071.1| DNA gyrase, A subunit [Rhodothermus marinus DSM 4252]
	191 	191 	82% 	1e-46	Gene info linked to YP_003291459.1
ZP_01964693.1 	
hypothetical protein RUMOBE_02418 [Ruminococcus obeum ATCC 29174] >gb|EDM87010.1| hypothetical protein RUMOBE_02418 [Ruminococcus obeum ATCC 29174]
	191 	191 	92% 	1e-46	
CBL22603.1 	
DNA gyrase subunit A [Ruminococcus obeum A2-162]
	191 	191 	92% 	1e-46	
YP_003855240.1 	
DNA gyrase subunit A [Parvularcula bermudensis HTCC2503] >gb|ADM10098.1| DNA gyrase subunit A [Parvularcula bermudensis HTCC2503]
	191 	191 	94% 	1e-46	Gene info linked to YP_003855240.1
ZP_05964385.1 	
conserved hypothetical protein [Brucella neotomae 5K33] >gb|EEY04665.1| conserved hypothetical protein [Brucella neotomae 5K33]
	191 	191 	96% 	1e-46	
YP_002136834.1 	
DNA gyrase subunit A [Geobacter bemidjiensis Bem] >gb|ACH37038.1| DNA gyrase, A subunit [Geobacter bemidjiensis Bem]
	191 	191 	83% 	1e-46	Gene info linked to YP_002136834.1
CBL14978.1 	
DNA gyrase subunit A [Ruminococcus bromii L2-63]
	191 	191 	85% 	1e-46	
ZP_04777228.1 	
DNA gyrase, A subunit [Gemella haemolysans ATCC 10379] >gb|EER67936.1| DNA gyrase, A subunit [Gemella haemolysans ATCC 10379]
	191 	191 	95% 	1e-46	
YP_386500.1 	
DNA gyrase subunit A [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gb|ABB36805.1| DNA gyrase subunit A [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
	191 	191 	97% 	1e-46	Gene info linked to YP_386500.1
ZP_05348374.1 	
DNA gyrase, A subunit [Bryantella formatexigens DSM 14469] >gb|EET58907.1| DNA gyrase, A subunit [Bryantella formatexigens DSM 14469]
	191 	191 	82% 	1e-46	
ZP_05451335.1 	
DNA gyrase subunit A [Brucella neotomae 5K33]
	191 	191 	96% 	1e-46	
YP_003019850.1 	
DNA gyrase, A subunit [Geobacter sp. M21] >gb|ACT16092.1| DNA gyrase, A subunit [Geobacter sp. M21]
	191 	191 	83% 	1e-46	Gene info linked to YP_003019850.1
YP_002604882.1 	
GyrA [Desulfobacterium autotrophicum HRM2] >gb|ACN16718.1| GyrA [Desulfobacterium autotrophicum HRM2]
	191 	191 	85% 	1e-46	Gene info linked to YP_002604882.1
CAK18884.1 	
topoisomerase II subunit A [Staphylococcus pseudintermedius]
	191 	191 	90% 	1e-46	
ZP_07268589.1 	
DNA gyrase, A subunit [Finegoldia magna ACS-171-V-Col3] >gb|EFK94066.1| DNA gyrase, A subunit [Finegoldia magna ACS-171-V-Col3]
	191 	191 	83% 	2e-46	
ACN43199.1 	
DNA gyrase subunit A [Bacillus subtilis]
	191 	191 	72% 	2e-46	
AAM60780.1 	
topoisomerase II subunit A [Corynebacterium urealyticum]
	191 	191 	96% 	2e-46	
ADX75360.1 	
DNA gyrase, A subunit [Staphylococcus pseudintermedius ED99]
	191 	191 	90% 	2e-46	
YP_781681.1 	
DNA gyrase subunit A [Rhodopseudomonas palustris BisA53] >gb|ABJ06701.1| DNA gyrase subunit A [Rhodopseudomonas palustris BisA53]
	191 	191 	96% 	2e-46	Gene info linked to YP_781681.1
YP_004150610.1 	
DNA gyrase subunit A [Staphylococcus pseudintermedius HKU10-03] >gb|ADV06974.1| DNA gyrase subunit A [Staphylococcus pseudintermedius HKU10-03]
	191 	191 	90% 	2e-46	Gene info linked to YP_004150610.1
YP_002559412.1 	
DNA gyrase subunit A [Macrococcus caseolyticus JCSC5402] >dbj|BAH16716.1| DNA gyrase subunit A [Macrococcus caseolyticus JCSC5402]
	191 	191 	83% 	2e-46	Gene info linked to YP_002559412.1
YP_003008775.1 	
DNA gyrase, A subunit [Paenibacillus sp. JDR-2] >gb|ACS98688.1| DNA gyrase, A subunit [Paenibacillus sp. JDR-2]
	190 	190 	96% 	2e-46	Gene info linked to YP_003008775.1
CAK18886.1 	
topoisomerase II subunit A [Staphylococcus pseudintermedius]
	190 	190 	90% 	2e-46	
YP_184917.1 	
DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus COL] >ref|YP_001573931.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Staphylococcus aureus subsp. aureus USA300_TCH1516] >ref|ZP_05699392.1| DNA gyrase, A subunit [Staphylococcus aureus A5948] >sp|Q5HJZ0.1|GYRA_STAAC RecName: Full=DNA gyrase subunit A >gb|AAW37394.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus COL] >gb|ABX28052.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gb|EEV83708.1| DNA gyrase, A subunit [Staphylococcus aureus A5948] >gb|EFU28257.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Staphylococcus aureus subsp. aureus CGS01] >gb|EFW33266.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus MRSA131] >gb|EFW36171.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus MRSA177]
	190 	190 	96% 	2e-46	Gene info linked to YP_184917.1
ZP_07016613.1 	
DNA gyrase, A subunit [Desulfonatronospira thiodismutans ASO3-1] >gb|EFI34549.1| DNA gyrase, A subunit [Desulfonatronospira thiodismutans ASO3-1]
	190 	190 	82% 	2e-46	
ZP_03054925.1 	
DNA gyrase, A subunit [Bacillus pumilus ATCC 7061] >gb|EDW21352.1| DNA gyrase, A subunit [Bacillus pumilus ATCC 7061]
	190 	190 	90% 	2e-46	
ZP_07321125.1 	
DNA gyrase, A subunit [Finegoldia magna BVS033A4] >gb|EFL54210.1| DNA gyrase, A subunit [Finegoldia magna BVS033A4]
	190 	190 	83% 	2e-46	
YP_182324.1 	
DNA gyrase, A subunit [Dehalococcoides ethenogenes 195] >gb|AAW39212.1| DNA gyrase, A subunit [Dehalococcoides ethenogenes 195]
	190 	190 	82% 	2e-46	Gene info linked to YP_182324.1
YP_492728.1 	
DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus USA300_FPR3757] >ref|ZP_06328444.1| DNA gyrase, A subunit [Staphylococcus aureus A9765] >ref|ZP_06377441.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 132] >ref|ZP_06790574.1| hypothetical protein SKAG_01923 [Staphylococcus aureus A9754] >sp|Q2FKQ0.1|GYRA_STAA3 RecName: Full=DNA gyrase subunit A >gb|ABD20924.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gb|EFB99121.1| DNA gyrase, A subunit [Staphylococcus aureus A9765] >gb|EFG39811.1| hypothetical protein SKAG_01923 [Staphylococcus aureus A9754]
	190 	190 	96% 	2e-46	Gene info linked to YP_492728.1
YP_001331040.1 	
DNA gyrase A subunit [Staphylococcus aureus subsp. aureus str. Newman] >dbj|BAF66277.1| DNA gyrase A subunit [Staphylococcus aureus subsp. aureus str. Newman]
	190 	190 	96% 	2e-46	Gene info linked to YP_001331040.1
ZP_06670257.1 	
DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus M809] >gb|EFF08053.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus M809]
	190 	190 	96% 	2e-46	
ZP_06747149.1 	
DNA gyrase, A subunit [Fusobacterium sp. 1_1_41FAA] >gb|EFG29694.1| DNA gyrase, A subunit [Fusobacterium sp. 1_1_41FAA]
	190 	190 	81% 	2e-46	
YP_001994925.1 	
DNA gyrase subunit A [Chloroherpeton thalassium ATCC 35110] >gb|ACF12478.1| DNA gyrase, A subunit [Chloroherpeton thalassium ATCC 35110]
	190 	190 	83% 	2e-46	Gene info linked to YP_001994925.1
YP_001691314.1 	
DNA gyrase A subunit [Finegoldia magna ATCC 29328] >dbj|BAG07424.1| DNA gyrase A subunit [Finegoldia magna ATCC 29328]
	190 	190 	83% 	2e-46	Gene info linked to YP_001691314.1
ZP_05600631.1 	
DNA gyrase subunit A [Staphylococcus aureus subsp. aureus 55/2053] >ref|ZP_05603281.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus 65-1322] >ref|ZP_05605902.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus 68-397] >ref|ZP_05608525.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus E1410] >ref|ZP_05611174.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus M876] >ref|ZP_06314901.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus Btn1260] >ref|ZP_06317840.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus WW2703/97] >ref|ZP_06320076.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus WBG10049] >ref|ZP_06320712.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus M899] >ref|ZP_06330238.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus C101] >ref|ZP_06376931.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus A017934/97] >ref|ZP_06665827.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 58-424] >ref|ZP_06672844.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus M1015] >ref|ZP_06947836.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Staphylococcus aureus subsp. aureus MN8] >gb|EEV05322.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus 55/2053] >gb|EEV07961.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus 65-1322] >gb|EEV10583.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus 68-397] >gb|EEV13173.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus E1410] >gb|EEV15835.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus M876] >gb|EFB45155.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus C101] >gb|EFB53339.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus M899] >gb|EFB54292.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus WBG10049] >gb|EFB56403.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus WW2703/97] >gb|EFB59473.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus Btn1260] >gb|EFC27909.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus A017934/97] >gb|EFD96295.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus M1015] >gb|EFE27162.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus 58-424] >gb|EFH96419.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Staphylococcus aureus subsp. aureus MN8] >gb|ADQ75924.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Staphylococcus aureus subsp. aureus TCH60] >gb|EFU25620.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus CGS00]
	190 	190 	96% 	2e-46	
YP_767991.1 	
DNA gyrase subunit A [Rhizobium leguminosarum bv. viciae 3841] >emb|CAK07891.1| putative DNA gyrase subunit A [Rhizobium leguminosarum bv. viciae 3841]
	190 	190 	96% 	2e-46	Gene info linked to YP_767991.1
YP_002281257.1 	
DNA gyrase subunit A [Rhizobium leguminosarum bv. trifolii WSM2304] >gb|ACI55031.1| DNA gyrase, A subunit [Rhizobium leguminosarum bv. trifolii WSM2304]
	190 	190 	96% 	2e-46	Gene info linked to YP_002281257.1
ZP_05686124.1 	
DNA gyrase subunit A [Staphylococcus aureus A9635] >gb|EEV70583.1| DNA gyrase subunit A [Staphylococcus aureus A9635]
	190 	190 	96% 	2e-46	
ZP_07362683.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Staphylococcus aureus subsp. aureus ATCC BAA-39] >gb|EFM07444.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Staphylococcus aureus subsp. aureus ATCC BAA-39]
	190 	190 	96% 	2e-46	
ZP_05618284.1 	
DNA gyrase subunit A [Fusobacterium sp. 3_1_5R] >ref|ZP_07924010.1| DNA gyrase subunit A [Fusobacterium sp. 3_1_5R] >gb|EFS22036.1| DNA gyrase subunit A [Fusobacterium sp. 3_1_5R]
	190 	190 	96% 	2e-46	
ACN43197.1 	
DNA gyrase subunit A [Bacillus subtilis]
	190 	190 	72% 	2e-46	
ZP_07834479.1 	
DNA gyrase, A subunit [Clostridium sp. HGF2] >gb|EFR36087.1| DNA gyrase, A subunit [Clostridium sp. HGF2]
	190 	190 	85% 	2e-46	
ZP_06821925.1 	
hypothetical protein SIAG_01513 [Staphylococcus aureus subsp. aureus EMRSA16] >gb|EFG56706.1| hypothetical protein SIAG_01513 [Staphylococcus aureus subsp. aureus EMRSA16]
	190 	190 	96% 	2e-46	
YP_039483.1 	
DNA gyrase subunit A [Staphylococcus aureus subsp. aureus MRSA252] >ref|ZP_03566014.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus str. JKD6009] >sp|Q6GKT9.1|GYRA_STAAR RecName: Full=DNA gyrase subunit A >emb|CAG39034.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus MRSA252] >emb|CBI47890.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus TW20] >gb|ADL64094.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Staphylococcus aureus subsp. aureus str. JKD6008]
	190 	190 	96% 	3e-46	Gene info linked to YP_039483.1
ZP_07821325.1 	
DNA gyrase, A subunit [Peptoniphilus harei ACS-146-V-Sch2b] >gb|EFR33631.1| DNA gyrase, A subunit [Peptoniphilus harei ACS-146-V-Sch2b]
	190 	190 	82% 	3e-46	
ZP_06346333.1 	
DNA gyrase, A subunit [Clostridium sp. M62/1] >gb|EFE12502.1| DNA gyrase, A subunit [Clostridium sp. M62/1]
	190 	190 	96% 	3e-46	
YP_001771222.1 	
DNA gyrase, A subunit [Methylobacterium sp. 4-46] >gb|ACA18788.1| DNA gyrase, A subunit [Methylobacterium sp. 4-46]
	190 	190 	95% 	3e-46	Gene info linked to YP_001771222.1
YP_003868451.1 	
DNA gyrase subunit A [Paenibacillus polymyxa E681] >gb|ADM67913.1| DNA gyrase subunit A [Paenibacillus polymyxa E681]
	190 	190 	96% 	3e-46	Gene info linked to YP_003868451.1
ZP_03705943.1 	
hypothetical protein CLOSTMETH_00663 [Clostridium methylpentosum DSM 5476] >gb|EEG31628.1| hypothetical protein CLOSTMETH_00663 [Clostridium methylpentosum DSM 5476]
	190 	190 	85% 	3e-46	
YP_003064595.1 	
DNA gyrase subunit A [Candidatus Liberibacter asiaticus str. psy62] >gb|ACT56655.1| DNA gyrase subunit A [Candidatus Liberibacter asiaticus str. psy62]
	190 	190 	88% 	3e-46	Gene info linked to YP_003064595.1
YP_001419195.1 	
DNA gyrase, A subunit [Xanthobacter autotrophicus Py2] >gb|ABS69538.1| DNA gyrase, A subunit [Xanthobacter autotrophicus Py2]
	190 	190 	96% 	3e-46	Gene info linked to YP_001419195.1
YP_002351606.1 	
DNA gyrase, A subunit [Listeria monocytogenes HCC23] >ref|ZP_05294503.1| DNA gyrase, A subunit [Listeria monocytogenes FSL J1-208] >ref|ZP_06555042.1| DNA gyrase subunit A [Listeria monocytogenes FSL J2-071] >gb|ACK40992.1| DNA gyrase, A subunit [Listeria monocytogenes HCC23] >gb|EFD92156.1| DNA gyrase subunit A [Listeria monocytogenes FSL J2-071] >emb|CAR82709.1| DNA gyrase, A subunit [Listeria monocytogenes L99]
	189 	189 	96% 	3e-46	Gene info linked to YP_002351606.1
ZP_07838104.1 	
DNA gyrase, A subunit [Eubacterium cellulosolvens 6] >gb|EFR65851.1| DNA gyrase, A subunit [Eubacterium cellulosolvens 6]
	189 	189 	83% 	3e-46	
NP_469354.1 	
DNA gyrase subunit A [Listeria innocua Clip11262] >emb|CAC95240.1| DNA gyrase subunit A [Listeria innocua Clip11262]
	189 	189 	96% 	3e-46	Gene info linked to NP_469354.1
ZP_07842314.1 	
DNA gyrase, A subunit [Staphylococcus caprae C87] >gb|EFS16648.1| DNA gyrase, A subunit [Staphylococcus caprae C87]
	189 	189 	96% 	3e-46	
ABV27289.1 	
DNA gyrase A subunit [Candidatus Chloracidobacterium thermophilum]
	189 	189 	84% 	3e-46	
ZP_05275755.1 	
DNA gyrase subunit A [Listeria monocytogenes FSL J2-064]
	189 	189 	96% 	3e-46	
YP_012620.1 	
DNA gyrase, A subunit [Listeria monocytogenes str. 4b F2365] >ref|ZP_00230796.1| DNA gyrase, A subunit [Listeria monocytogenes str. 4b H7858] >ref|YP_002756753.1| DNA gyrase subunit A [Listeria monocytogenes Clip81459] >ref|ZP_05229774.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194] >ref|ZP_05241183.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503] >ref|ZP_05264221.1| DNA gyrase subunit A [Listeria monocytogenes HPB2262] >ref|ZP_07073377.1| DNA gyrase subunit A [Listeria monocytogenes FSL N1-017] >gb|AAT02797.1| DNA gyrase, A subunit [Listeria monocytogenes serotype 4b str. F2365] >gb|EAL09339.1| DNA gyrase, A subunit [Listeria monocytogenes str. 4b H7858] >emb|CAS03796.1| DNA gyrase subunit A [Listeria monocytogenes serotype 4b str. CLIP 80459] >gb|EEW17735.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503] >gb|EFF94439.1| DNA gyrase subunit A [Listeria monocytogenes HPB2262] >gb|EFG01773.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194] >gb|EFK42705.1| DNA gyrase subunit A [Listeria monocytogenes FSL N1-017]
	189 	189 	96% 	3e-46	Gene info linked to YP_012620.1
XP_002288768.1 	
DNA topoisomerase IV, ATP/GTP binding site [Thalassiosira pseudonana CCMP1335] >gb|EED94204.1| DNA topoisomerase IV, ATP/GTP binding site [Thalassiosira pseudonana CCMP1335]
	189 	189 	86% 	3e-46	Gene info linked to XP_002288768.1
CBL40438.1 	
DNA gyrase subunit A [butyrate-producing bacterium SS3/4]
	189 	189 	96% 	3e-46	
ZP_03475726.1 	
hypothetical protein PRABACTJOHN_01389 [Parabacteroides johnsonii DSM 18315] >gb|EEC97211.1| hypothetical protein PRABACTJOHN_01389 [Parabacteroides johnsonii DSM 18315]
	189 	189 	83% 	4e-46	
YP_532453.1 	
DNA gyrase subunit A [Rhodopseudomonas palustris BisB18] >gb|ABD88134.1| DNA gyrase subunit A [Rhodopseudomonas palustris BisB18]
	189 	189 	96% 	4e-46	Gene info linked to YP_532453.1
ZP_03613443.1 	
DNA gyrase, A subunit [Staphylococcus capitis SK14] >gb|EEE49285.1| DNA gyrase, A subunit [Staphylococcus capitis SK14]
	189 	189 	96% 	4e-46	
ZP_06310530.1 	
DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus C160] >ref|ZP_06325824.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus D139] >ref|ZP_06329014.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus C427] >ref|ZP_06340711.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus H19] >gb|EFB46095.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus C427] >gb|EFB48719.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus D139] >gb|EFC02055.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus C160] >gb|EFC08759.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus H19] >gb|ADI96550.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus ED133]
	189 	189 	96% 	4e-46	
EGA97411.1 	
DNA gyrase subunit A [Staphylococcus aureus O11] >gb|EGB00883.1| DNA gyrase subunit A [Staphylococcus aureus O46]
	189 	189 	96% 	4e-46	
ZP_04687122.1 	
DNA gyrase subunit A [Streptomyces ghanaensis ATCC 14672] >ref|ZP_06577901.1| DNA gyrase [Streptomyces ghanaensis ATCC 14672] >gb|EFE68362.1| DNA gyrase [Streptomyces ghanaensis ATCC 14672]
	189 	189 	85% 	4e-46	
ZP_03305511.1 	
hypothetical protein ANHYDRO_01953 [Anaerococcus hydrogenalis DSM 7454] >gb|EEB35182.1| hypothetical protein ANHYDRO_01953 [Anaerococcus hydrogenalis DSM 7454]
	189 	189 	96% 	4e-46	
ZP_07662434.1 	
DNA gyrase, A subunit [Roseibium sp. TrichSKD4] >gb|EFO29989.1| DNA gyrase, A subunit [Roseibium sp. TrichSKD4]
	189 	189 	85% 	4e-46	
YP_004196773.1 	
DNA gyrase subunit A [Geobacter sp. M18] >gb|ADW11497.1| DNA gyrase, A subunit [Geobacter sp. M18]
	189 	189 	83% 	4e-46	Gene info linked to YP_004196773.1
ZP_05630946.1 	
DNA gyrase subunit A [Fusobacterium gonidiaformans ATCC 25563] >ref|ZP_07914029.1| DNA gyrase, A subunit [Fusobacterium gonidiaformans ATCC 25563] >gb|EFS28499.1| DNA gyrase, A subunit [Fusobacterium gonidiaformans ATCC 25563]
	189 	189 	96% 	4e-46	
YP_003330936.1 	
DNA gyrase, A subunit [Dehalococcoides sp. VS] >gb|ACZ62608.1| DNA gyrase, A subunit [Dehalococcoides sp. VS]
	189 	189 	82% 	5e-46	Gene info linked to YP_003330936.1
YP_001259021.1 	
DNA gyrase subunit A [Brucella ovis ATCC 25840] >gb|ABQ61830.1| DNA gyrase, A subunit [Brucella ovis ATCC 25840]
	189 	189 	96% 	5e-46	Gene info linked to YP_001259021.1
ZP_04864570.1 	
DNA gyrase subunit A [Staphylococcus aureus subsp. aureus USA300_TCH959] >gb|EES94614.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus USA300_TCH959]
	189 	189 	96% 	5e-46	
YP_001240319.1 	
DNA gyrase subunit A [Bradyrhizobium sp. BTAi1] >gb|ABQ36413.1| DNA gyrase subunit A [Bradyrhizobium sp. BTAi1]
	189 	189 	85% 	5e-46	Gene info linked to YP_001240319.1
ZP_07525577.1 	
DNA gyrase, A subunit [Peptostreptococcus stomatis DSM 17678] >gb|EFM65226.1| DNA gyrase, A subunit [Peptostreptococcus stomatis DSM 17678]
	189 	189 	82% 	5e-46	
ZP_05404138.1 	
DNA gyrase, A subunit [Mitsuokella multacida DSM 20544] >gb|EEX69128.1| DNA gyrase, A subunit [Mitsuokella multacida DSM 20544]
	189 	189 	97% 	5e-46	
ZP_02862777.1 	
hypothetical protein ANASTE_01999 [Anaerofustis stercorihominis DSM 17244] >gb|EDS72288.1| hypothetical protein ANASTE_01999 [Anaerofustis stercorihominis DSM 17244]
	189 	189 	85% 	5e-46	
YP_486489.1 	
DNA gyrase subunit A [Rhodopseudomonas palustris HaA2] >gb|ABD07578.1| DNA gyrase subunit A [Rhodopseudomonas palustris HaA2]
	189 	189 	96% 	5e-46	Gene info linked to YP_486489.1
P20831.3 	
RecName: Full=DNA gyrase subunit A
	189 	189 	96% 	5e-46	
CAQ48446.1 	
DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus ST398]
	189 	189 	96% 	5e-46	
ZP_04455592.1 	
hypothetical protein GCWU000342_01615 [Shuttleworthia satelles DSM 14600] >gb|EEP28068.1| hypothetical protein GCWU000342_01615 [Shuttleworthia satelles DSM 14600]
	189 	189 	85% 	5e-46	
CBL20740.1 	
DNA gyrase subunit A [Ruminococcus sp. SR1/5]
	189 	189 	86% 	5e-46	
ZP_04818171.1 	
DNA gyrase subunit A [Staphylococcus epidermidis M23864:W1] >gb|EES41253.1| DNA gyrase subunit A [Staphylococcus epidermidis M23864:W1]
	189 	189 	96% 	5e-46	
YP_001557136.1 	
DNA gyrase, A subunit [Clostridium phytofermentans ISDg] >gb|ABX40397.1| DNA gyrase, A subunit [Clostridium phytofermentans ISDg]
	189 	189 	92% 	5e-46	Gene info linked to YP_001557136.1
YP_003355766.1 	
DNA gyrase subunit A [Methanocella paludicola SANAE] >dbj|BAI60783.1| DNA gyrase subunit A [Methanocella paludicola SANAE]
	189 	189 	96% 	5e-46	Gene info linked to YP_003355766.1
NP_661047.1 	
DNA gyrase subunit A [Chlorobium tepidum TLS] >gb|AAM71389.1| DNA gyrase subunit A [Chlorobium tepidum TLS]
	189 	189 	97% 	5e-46	Gene info linked to NP_661047.1
YP_848210.1 	
DNA gyrase subunit A [Listeria welshimeri serovar 6b str. SLCC5334] >emb|CAK19425.1| DNA gyrase subunit A [Listeria welshimeri serovar 6b str. SLCC5334]
	189 	189 	96% 	5e-46	Gene info linked to YP_848210.1
AAA73952.1 	
DNA gyrase A subunit [Staphylococcus aureus]
	189 	189 	96% 	5e-46	
ABL07039.1 	
DNA gyrase subunit A [Arcobacter butzleri]
	189 	189 	90% 	5e-46	
ZP_04867998.1 	
DNA gyrase subunit A [Staphylococcus aureus subsp. aureus TCH130] >gb|EES96865.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus TCH130]
	189 	189 	96% 	5e-46	
YP_002635557.1 	
DNA gyrase subunit A [Staphylococcus carnosus subsp. carnosus TM300] >emb|CAL29372.1| DNA gyrase subunit A [Staphylococcus carnosus subsp. carnosus TM300]
	189 	189 	96% 	5e-46	Gene info linked to YP_002635557.1
EFS04738.1 	
DNA gyrase, A subunit [Listeria seeligeri FSL S4-171]
	189 	189 	96% 	5e-46	
CBX27733.1 	
DNA gyrase subunit A [uncultured Desulfobacterium sp.]
	189 	189 	85% 	5e-46	
YP_003129054.1 	
DNA gyrase, A subunit [Halorhabdus utahensis DSM 12940] >gb|ACV10321.1| DNA gyrase, A subunit [Halorhabdus utahensis DSM 12940]
	189 	189 	83% 	5e-46	Gene info linked to YP_003129054.1
YP_003463252.1 	
DNA gyrase, A subunit [Listeria seeligeri serovar 1/2b str. SLCC3954] >emb|CBH26158.1| DNA gyrase, A subunit [Listeria seeligeri serovar 1/2b str. SLCC3954]
	189 	189 	96% 	6e-46	Gene info linked to YP_003463252.1
YP_001245396.1 	
DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus JH9] >ref|YP_001315161.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus JH1] >ref|ZP_04840057.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus str. CF-Marseille] >ref|ZP_05642523.1| DNA gyrase, A subunit [Staphylococcus aureus A9781] >ref|ZP_05681429.1| DNA gyrase subunit A [Staphylococcus aureus A9763] >ref|ZP_05683880.1| DNA gyrase, A subunit [Staphylococcus aureus A9719] >ref|ZP_05694385.1| DNA gyrase, A subunit [Staphylococcus aureus A6300] >ref|ZP_05697222.1| DNA gyrase, A subunit [Staphylococcus aureus A6224] >ref|ZP_05702374.1| DNA gyrase, A subunit [Staphylococcus aureus A5937] >ref|ZP_06335370.1| DNA gyrase, A subunit [Staphylococcus aureus A10102] >ref|ZP_06929767.1| hypothetical protein SLAG_01999 [Staphylococcus aureus A8796] >gb|ABQ47820.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus JH9] >gb|ABR50874.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus JH1] >gb|EEV25856.1| DNA gyrase, A subunit [Staphylococcus aureus A9781] >gb|EEV64500.1| DNA gyrase subunit A [Staphylococcus aureus A9763] >gb|EEV67551.1| DNA gyrase, A subunit [Staphylococcus aureus A9719] >gb|EEV77994.1| DNA gyrase, A subunit [Staphylococcus aureus A6300] >gb|EEV80444.1| DNA gyrase, A subunit [Staphylococcus aureus A6224] >gb|EEV86260.1| DNA gyrase, A subunit [Staphylococcus aureus A5937] >gb|EFB95594.1| DNA gyrase, A subunit [Staphylococcus aureus A10102] >gb|ADC36220.1| DNA gyrase subunit A [Staphylococcus aureus 04-02981] >gb|EFH36523.1| hypothetical protein SLAG_01999 [Staphylococcus aureus A8796] >emb|CBX33411.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus ECT-R 2] >gb|EFT85541.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus CGS03]
	189 	189 	96% 	6e-46	Gene info linked to YP_001245396.1
NP_463540.1 	
DNA gyrase subunit A [Listeria monocytogenes EGD-e] >ref|ZP_00234847.1| DNA gyrase, A subunit [Listeria monocytogenes str. 1/2a F6854] >ref|ZP_03666649.1| DNA gyrase subunit A [Listeria monocytogenes Finland 1988] >ref|ZP_03671377.1| DNA gyrase subunit A [Listeria monocytogenes FSL R2-561] >ref|ZP_05232118.1| DNA gyrase subunit A [Listeria monocytogenes FSL N3-165] >ref|ZP_05235356.1| DNA gyrase subunit A [Listeria monocytogenes 10403S] >ref|ZP_05259603.1| DNA gyrase subunit A [Listeria monocytogenes J0161] >ref|ZP_05263130.1| DNA gyrase [Listeria monocytogenes J2818] >ref|ZP_05269196.1| DNA gyrase subunit A [Listeria monocytogenes F6900] >ref|ZP_05297407.1| DNA gyrase subunit A [Listeria monocytogenes FSL J2-003] >ref|YP_003415124.1| DNA gyrase subunit A [Listeria monocytogenes 08-5578] >ref|YP_003418168.1| DNA gyrase subunit A [Listeria monocytogenes 08-5923] >emb|CAC98222.1| DNA gyrase subunit A [Listeria monocytogenes EGD-e] >gb|AAM48483.1| DNA gyrase subunit A [Listeria monocytogenes] >gb|EAL05309.1| DNA gyrase, A subunit [Listeria monocytogenes str. 1/2a F6854] >gb|EEW13134.1| DNA gyrase subunit A [Listeria monocytogenes FSL N3-165] >gb|EEW22709.1| DNA gyrase subunit A [Listeria monocytogenes F6900] >gb|ADB69762.1| DNA gyrase subunit A [Listeria monocytogenes 08-5578] >gb|ADB72806.1| DNA gyrase subunit A [Listeria monocytogenes 08-5923] >gb|EFF99454.1| DNA gyrase [Listeria monocytogenes J2818]
	189 	189 	96% 	6e-46	Gene info linked to NP_463540.1
ADL21971.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A, GyrA [Staphylococcus aureus subsp. aureus JKD6159]
	189 	189 	96% 	6e-46	
NP_644821.1 	
DNA gyrase subunit A [Staphylococcus aureus subsp. aureus MW2] >ref|YP_042139.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus MSSA476] >ref|YP_498614.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus NCTC 8325] >ref|ZP_06925844.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Staphylococcus aureus subsp. aureus ATCC 51811] >ref|ZP_07128919.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Staphylococcus aureus subsp. aureus TCH70] >sp|Q8NKW8.1|GYRA_STAAW RecName: Full=DNA gyrase subunit A >sp|Q6GD84.1|GYRA_STAAS RecName: Full=DNA gyrase subunit A >sp|Q2G2Q0.1|GYRA_STAA8 RecName: Full=DNA gyrase subunit A >dbj|BAA01370.1| DNA gyrase A [Staphylococcus aureus] >dbj|BAB93871.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus MW2] >emb|CAG41778.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus MSSA476] >gb|ABD29197.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus NCTC 8325] >gb|EFH24842.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Staphylococcus aureus subsp. aureus ATCC 51811] >gb|EFK82845.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Staphylococcus aureus subsp. aureus TCH70]
	189 	189 	96% 	6e-46	Gene info linked to NP_644821.1
CAA50571.1 	
DNA gyrase [Staphylococcus aureus]
	189 	189 	96% 	6e-46	
ZP_06897560.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Roseomonas cervicalis ATCC 49957] >gb|EFH10727.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Roseomonas cervicalis ATCC 49957]
	189 	189 	88% 	6e-46	
YP_001496386.1 	
DNA gyrase subunit A [Rickettsia bellii OSU 85-389] >gb|ABV79349.1| DNA gyrase subunit A [Rickettsia bellii OSU 85-389]
	189 	189 	82% 	6e-46	Gene info linked to YP_001496386.1
EFS01722.1 	
DNA gyrase, A subunit [Listeria seeligeri FSL N1-067]
	189 	189 	96% 	6e-46	
YP_537964.1 	
DNA gyrase subunit A [Rickettsia bellii RML369-C] >sp|Q1RID9.1|GYRA_RICBR RecName: Full=DNA gyrase subunit A >gb|ABE04875.1| DNA gyrase subunit A [Rickettsia bellii RML369-C]
	189 	189 	82% 	6e-46	Gene info linked to YP_537964.1
YP_191315.2 	
DNA gyrase subunit A [Gluconobacter oxydans 621H]
	189 	189 	82% 	6e-46	Gene info linked to YP_191315.2
YP_067162.1 	
DNA gyrase subunit A [Rickettsia typhi str. Wilmington] >sp|Q68XG2.1|GYRA_RICTY RecName: Full=DNA gyrase subunit A >gb|AAU03680.1| DNA gyrase [Rickettsia typhi str. Wilmington]
	189 	189 	82% 	6e-46	Gene info linked to YP_067162.1
NP_373244.1 	
DNA gyrase subunit A [Staphylococcus aureus subsp. aureus N315] >ref|ZP_05689808.1| hypothetical protein SAKG_01060 [Staphylococcus aureus A9299] >ref|ZP_05692297.1| hypothetical protein SAJG_01377 [Staphylococcus aureus A8115] >ref|YP_003280965.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus ED98] >ref|ZP_06302515.1| DNA gyrase, A subunit [Staphylococcus aureus A8117] >ref|ZP_06858188.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus MR1] >sp|Q99XG5.1|GYRA_STAAN RecName: Full=DNA gyrase subunit A >dbj|BAB41222.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus N315] >gb|EEV72136.1| hypothetical protein SAKG_01060 [Staphylococcus aureus A9299] >gb|EEV74787.1| hypothetical protein SAJG_01377 [Staphylococcus aureus A8115] >gb|ACY09959.1| DNA gyrase, A subunit [Staphylococcus aureus subsp. aureus ED98] >gb|EFC03460.1| DNA gyrase, A subunit [Staphylococcus aureus A8117]
	189 	189 	96% 	6e-46	Gene info linked to NP_373244.1
ZP_06816674.1 	
hypothetical protein SMAG_02043 [Staphylococcus aureus A8819] >gb|EFG44360.1| hypothetical protein SMAG_02043 [Staphylococcus aureus A8819]
	189 	189 	96% 	6e-46	
ZP_02869696.1 	
DNA gyrase subunit A [candidate division TM7 single-cell isolate TM7a]
	189 	189 	95% 	6e-46	
AAW60659.1 	
DNA gyrase subunit A [Gluconobacter oxydans 621H]
	189 	189 	82% 	6e-46	Gene info linked to AAW60659.1
ZP_04797695.1 	
DNA gyrase subunit A [Staphylococcus epidermidis W23144] >gb|EES35511.1| DNA gyrase subunit A [Staphylococcus epidermidis W23144]
	188 	188 	96% 	7e-46	
EFV88155.1 	
DNA gyrase, A subunit [Staphylococcus epidermidis FRI909]
	188 	188 	96% 	7e-46	
ZP_06885674.1 	
DNA gyrase, A subunit [Clostridium lentocellum DSM 5427] >gb|EFG97030.1| DNA gyrase, A subunit [Clostridium lentocellum DSM 5427]
	188 	188 	86% 	7e-46	
NP_763560.1 	
DNA gyrase subunit A [Staphylococcus epidermidis ATCC 12228] >ref|ZP_04825842.1| DNA gyrase subunit A [Staphylococcus epidermidis BCM-HMP0060] >ref|ZP_06283605.1| DNA gyrase, A subunit [Staphylococcus epidermidis SK135] >ref|ZP_06614228.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Staphylococcus epidermidis M23864:W2(grey)] >sp|P0C0R0.1|GYRA_STAES RecName: Full=DNA gyrase subunit A >gb|AAO03602.1|AE016744_5 DNA gyrase subunit A [Staphylococcus epidermidis ATCC 12228] >gb|EES57775.1| DNA gyrase subunit A [Staphylococcus epidermidis BCM-HMP0060] >gb|EFA88957.1| DNA gyrase, A subunit [Staphylococcus epidermidis SK135] >gb|EFE58681.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Staphylococcus epidermidis M23864:W2(grey)]
	188 	188 	96% 	7e-46	Gene info linked to NP_763560.1
ABL07040.1 	
DNA gyrase subunit A [Arcobacter butzleri]
	188 	188 	90% 	7e-46	
YP_002575715.1 	
DNA gyrase, subunit A [Campylobacter lari RM2100] >gb|ACM64464.1| DNA gyrase, subunit A [Campylobacter lari RM2100]
	188 	188 	81% 	7e-46	Gene info linked to YP_002575715.1
ZP_07891605.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Arcobacter butzleri JV22] >gb|ABL07041.1| DNA gyrase subunit A [Arcobacter butzleri] >gb|EFU70019.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Arcobacter butzleri JV22]
	188 	188 	90% 	7e-46	
NP_370530.1 	
DNA gyrase subunit A [Staphylococcus aureus subsp. aureus Mu50] >ref|YP_001440596.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus Mu3] >ref|ZP_05143412.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus Mu50-omega] >sp|Q932M0.1|GYRA_STAAM RecName: Full=DNA gyrase subunit A >dbj|BAB56168.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus Mu50] >dbj|BAF76889.1| DNA gyrase subunit A [Staphylococcus aureus subsp. aureus Mu3]
	188 	188 	96% 	8e-46	Gene info linked to NP_370530.1
ZP_08082481.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Erysipelothrix rhusiopathiae ATCC 19414] >gb|EFY08555.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Erysipelothrix rhusiopathiae ATCC 19414]
	188 	188 	94% 	8e-46	
XP_002463658.1 	
hypothetical protein SORBIDRAFT_01g003750 [Sorghum bicolor] >gb|EER90656.1| hypothetical protein SORBIDRAFT_01g003750 [Sorghum bicolor]
	188 	188 	94% 	8e-46	UniGene info linked to XP_002463658.1Gene info linked to XP_002463658.1
YP_003391817.1 	
DNA gyrase, A subunit [Conexibacter woesei DSM 14684] >gb|ADB48442.1| DNA gyrase, A subunit [Conexibacter woesei DSM 14684]
	188 	188 	96% 	8e-46	Gene info linked to YP_003391817.1
ABL07042.1 	
DNA gyrase subunit A [Arcobacter cryaerophilus]
	188 	188 	90% 	8e-46	
YP_001490699.1 	
DNA gyrase subunit A [Arcobacter butzleri RM4018] >gb|ABL07037.1| DNA gyrase subunit A [Arcobacter butzleri] >gb|ABV68029.1| DNA gyrase, subunit A [Arcobacter butzleri RM4018]
	188 	188 	90% 	8e-46	Gene info linked to YP_001490699.1
ZP_06012795.1 	
DNA gyrase, A subunit [Leptotrichia goodfellowii F0264] >gb|EEY34011.1| DNA gyrase, A subunit [Leptotrichia goodfellowii F0264]
	188 	188 	82% 	8e-46	
ZP_05389867.1 	
DNA gyrase subunit A [Listeria monocytogenes FSL J1-175]
	188 	188 	88% 	9e-46	
ABL07038.1 	
DNA gyrase subunit A [Arcobacter butzleri]
	188 	188 	90% 	9e-46	
XP_001422022.1 	
predicted protein [Ostreococcus lucimarinus CCE9901] >gb|ABP00316.1| predicted protein [Ostreococcus lucimarinus CCE9901]
	188 	188 	82% 	9e-46	Gene info linked to XP_001422022.1
ABM55382.1 	
DNA gyrase subunit A [Arcobacter butzleri] >gb|ABM55383.1| DNA gyrase subunit A [Arcobacter butzleri] >gb|ABM55384.1| DNA gyrase subunit A [Arcobacter butzleri] >gb|ABM55385.1| DNA gyrase subunit A [Arcobacter butzleri] >gb|ABM55386.1| DNA gyrase subunit A [Arcobacter butzleri] >gb|ABM55387.1| DNA gyrase subunit A [Arcobacter butzleri]
	188 	188 	90% 	9e-46	
CBK76390.1 	
DNA gyrase subunit A [Clostridium cf. saccharolyticum K10]
	188 	188 	96% 	9e-46	
YP_002250993.1 	
DNA gyrase, A subunit [Dictyoglomus thermophilum H-6-12] >gb|ACI19815.1| DNA gyrase, A subunit [Dictyoglomus thermophilum H-6-12]
	188 	188 	96% 	9e-46	Gene info linked to YP_002250993.1
YP_001494391.1 	
DNA gyrase subunit A [Rickettsia rickettsii str. 'Sheila Smith'] >ref|YP_001649637.1| DNA gyrase subunit A [Rickettsia rickettsii str. Iowa] >gb|ABV75883.1| DNA gyrase subunit A [Rickettsia rickettsii str. 'Sheila Smith'] >gb|ABY72231.1| DNA gyrase subunit A [Rickettsia rickettsii str. Iowa]
	188 	188 	82% 	1e-45	Gene info linked to YP_001494391.1
ZP_01312730.1 	
DNA gyrase, A subunit [Desulfuromonas acetoxidans DSM 684] >gb|EAT15618.1| DNA gyrase, A subunit [Desulfuromonas acetoxidans DSM 684]
	188 	188 	85% 	1e-45	
YP_001525244.1 	
DNA gyrase subunit A [Azorhizobium caulinodans ORS 571] >dbj|BAF88326.1| DNA gyrase subunit A [Azorhizobium caulinodans ORS 571]
	188 	188 	96% 	1e-45	Gene info linked to YP_001525244.1
YP_002130239.1 	
DNA gyrase subunit A [Phenylobacterium zucineum HLK1] >gb|ACG77810.1| DNA gyrase subunit A [Phenylobacterium zucineum HLK1]
	188 	188 	94% 	1e-45	Gene info linked to YP_002130239.1
YP_002353155.1 	
DNA gyrase, A subunit [Dictyoglomus turgidum DSM 6724] >gb|ACK42541.1| DNA gyrase, A subunit [Dictyoglomus turgidum DSM 6724]
	187 	187 	96% 	1e-45	Gene info linked to YP_002353155.1
YP_001958586.1 	
DNA gyrase, A subunit [Chlorobium phaeobacteroides BS1] >gb|ACE03105.1| DNA gyrase, A subunit [Chlorobium phaeobacteroides BS1]
	187 	187 	82% 	1e-45	Gene info linked to YP_001958586.1
ZP_07305044.1 	
LOW QUALITY PROTEIN: DNA gyrase, A subunit [Streptomyces viridochromogenes DSM 40736] >gb|EFL33413.1| LOW QUALITY PROTEIN: DNA gyrase, A subunit [Streptomyces viridochromogenes DSM 40736]
	187 	187 	85% 	1e-45	
YP_002436495.1 	
DNA gyrase, A subunit [Desulfovibrio vulgaris str. 'Miyazaki F'] >gb|ACL09027.1| DNA gyrase, A subunit [Desulfovibrio vulgaris str. 'Miyazaki F']
	187 	187 	96% 	1e-45	Gene info linked to YP_002436495.1
ZP_08028320.1 	
DNA gyrase, A subunit [Solobacterium moorei F0204] >gb|EFW25004.1| DNA gyrase, A subunit [Solobacterium moorei F0204]
	187 	187 	90% 	1e-45	
YP_002017069.1 	
DNA gyrase, A subunit [Pelodictyon phaeoclathratiforme BU-1] >gb|ACF42452.1| DNA gyrase, A subunit [Pelodictyon phaeoclathratiforme BU-1]
	187 	187 	97% 	1e-45	Gene info linked to YP_002017069.1
YP_415524.1 	
DNA gyrase subunit A [Staphylococcus aureus RF122] >emb|CAI79694.1| DNA gyrase subunit A [Staphylococcus aureus RF122]
	187 	187 	96% 	1e-45	Gene info linked to YP_415524.1
ZP_02427287.1 	
hypothetical protein CLORAM_00665 [Clostridium ramosum DSM 1402] >ref|ZP_04563898.1| DNA gyrase subunit A gyrA [Mollicutes bacterium D7] >gb|EDS19789.1| hypothetical protein CLORAM_00665 [Clostridium ramosum DSM 1402] >gb|EEO33543.1| DNA gyrase subunit A gyrA [Coprobacillus sp. D7]
	187 	187 	96% 	1e-45	
YP_004103209.1 	
DNA gyrase subunit A [Ruminococcus albus 7] >gb|ADU20575.1| DNA gyrase, A subunit [Ruminococcus albus 7]
	187 	187 	82% 	1e-45	Gene info linked to YP_004103209.1
YP_003737550.1 	
DNA gyrase, A subunit [Halalkalicoccus jeotgali B3] >gb|ADJ15758.1| DNA gyrase, A subunit [Halalkalicoccus jeotgali B3]
	187 	187 	83% 	1e-45	Gene info linked to YP_003737550.1
YP_001408750.1 	
DNA gyrase subunit A [Campylobacter curvus 525.92] >gb|EAT99986.1| DNA gyrase, A subunit [Campylobacter curvus 525.92]
	187 	187 	82% 	2e-45	Gene info linked to YP_001408750.1
YP_001111384.1 	
DNA gyrase, A subunit [Desulfotomaculum reducens MI-1] >gb|ABO48559.1| DNA gyrase subunit A [Desulfotomaculum reducens MI-1]
	187 	187 	96% 	2e-45	Gene info linked to YP_001111384.1
ABL07044.1 	
DNA gyrase subunit A [Arcobacter skirrowii]
	187 	187 	90% 	2e-45	
ZP_07476560.1 	
DNA gyrase, A subunit [Brucella sp. BO1] >gb|EFM57444.1| DNA gyrase, A subunit [Brucella sp. BO1]
	187 	187 	96% 	2e-45	
ZP_04680217.1 	
DNA gyrase, A subunit [Ochrobactrum intermedium LMG 3301] >gb|EEQ95723.1| DNA gyrase, A subunit [Ochrobactrum intermedium LMG 3301]
	187 	187 	96% 	2e-45	
YP_004088887.1 	
DNA gyrase, a subunit [Asticcacaulis excentricus CB 48] >gb|ADU14736.1| DNA gyrase, A subunit [Asticcacaulis excentricus CB 48]
	187 	187 	83% 	2e-45	Gene info linked to YP_004088887.1
ZP_01387151.1 	
DNA gyrase, A subunit [Chlorobium ferrooxidans DSM 13031] >gb|EAT58007.1| DNA gyrase, A subunit [Chlorobium ferrooxidans DSM 13031]
	187 	187 	97% 	2e-45	
ZP_05115734.1 	
DNA gyrase, A subunit [Labrenzia alexandrii DFL-11] >gb|EEE46333.1| DNA gyrase, A subunit [Labrenzia alexandrii DFL-11]
	187 	187 	87% 	2e-45	
YP_308642.1 	
DNA gyrase, A subunit [Dehalococcoides sp. CBDB1] >ref|YP_001214830.1| DNA gyrase subunit A [Dehalococcoides sp. BAV1] >ref|YP_003463234.1| DNA gyrase, A subunit [Dehalococcoides sp. GT] >emb|CAI83726.1| DNA gyrase, A subunit [Dehalococcoides sp. CBDB1] >gb|ABQ17952.1| DNA gyrase subunit A [Dehalococcoides sp. BAV1] >gb|ADC74778.1| DNA gyrase, A subunit [Dehalococcoides sp. GT]
	187 	187 	82% 	2e-45	Gene info linked to YP_308642.1
NP_420391.1 	
DNA gyrase subunit A [Caulobacter crescentus CB15] >ref|YP_002517024.1| DNA gyrase subunit A [Caulobacter crescentus NA1000] >gb|AAK23559.1| DNA gyrase subunit A [Caulobacter crescentus CB15] >gb|ACL95116.1| DNA gyrase subunit A [Caulobacter crescentus NA1000]
	187 	187 	94% 	2e-45	Gene info linked to NP_420391.1
YP_004168020.1 	
DNA gyrase subunit a [Nitratifractor salsuginis DSM 16511] >gb|ADV46271.1| DNA gyrase subunit A [Nitratifractor salsuginis DSM 16511]
	187 	187 	82% 	2e-45	Gene info linked to YP_004168020.1
ZP_05363282.1 	
DNA gyrase, A subunit [Campylobacter showae RM3277] >gb|EET80103.1| DNA gyrase, A subunit [Campylobacter showae RM3277]
	187 	187 	82% 	2e-45	
YP_003944237.1 	
DNA gyrase, a subunit [Paenibacillus polymyxa SC2] >gb|ADO53996.1| DNA gyrase, A subunit [Paenibacillus polymyxa SC2]
	187 	187 	96% 	2e-45	Gene info linked to YP_003944237.1
ZP_06708904.1 	
LOW QUALITY PROTEIN: DNA gyrase, A subunit [Streptomyces sp. e14] >gb|EFF92026.1| LOW QUALITY PROTEIN: DNA gyrase, A subunit [Streptomyces sp. e14]
	187 	187 	85% 	2e-45	
ABL07043.1 	
DNA gyrase subunit A [Arcobacter cibarius]
	187 	187 	97% 	2e-45	
YP_001406795.1 	
DNA gyrase subunit A [Campylobacter hominis ATCC BAA-381] >gb|ABS50924.1| DNA gyrase, A subunit [Campylobacter hominis ATCC BAA-381]
	186 	186 	83% 	3e-45	Gene info linked to YP_001406795.1
ZP_03610607.1 	
DNA gyrase, A subunit [Campylobacter rectus RM3267] >gb|EEF13505.1| DNA gyrase, A subunit [Campylobacter rectus RM3267]
	186 	186 	82% 	3e-45	
YP_001370727.1 	
DNA gyrase subunit A [Ochrobactrum anthropi ATCC 49188] >gb|ABS14898.1| DNA gyrase, A subunit [Ochrobactrum anthropi ATCC 49188]
	186 	186 	96% 	3e-45	Gene info linked to YP_001370727.1
YP_002916290.1 	
DNA gyrase subunit A [Rickettsia peacockii str. Rustic] >gb|ACR47242.1| DNA gyrase subunit A [Rickettsia peacockii str. Rustic]
	186 	186 	82% 	3e-45	Gene info linked to YP_002916290.1
ZP_01734626.1 	
DNA gyrase A subunit [Flavobacteria bacterium BAL38] >gb|EAZ94905.1| DNA gyrase A subunit [Flavobacteria bacterium BAL38]
	186 	186 	82% 	3e-45	
YP_001205976.1 	
DNA gyrase subunit A [Bradyrhizobium sp. ORS278] >emb|CAL77751.1| DNA gyrase, subunit A, type II topoisomerase [Bradyrhizobium sp. ORS278]
	186 	186 	83% 	3e-45	Gene info linked to YP_001205976.1
YP_569726.1 	
DNA gyrase subunit A [Rhodopseudomonas palustris BisB5] >gb|ABE39825.1| DNA gyrase subunit A [Rhodopseudomonas palustris BisB5]
	186 	186 	96% 	3e-45	Gene info linked to YP_569726.1
YP_001942188.1 	
DNA gyrase, A subunit [Chlorobium limicola DSM 245] >gb|ACD89209.1| DNA gyrase, A subunit [Chlorobium limicola DSM 245]
	186 	186 	97% 	3e-45	Gene info linked to YP_001942188.1
YP_003593691.1 	
DNA gyrase, subunit A [Caulobacter segnis ATCC 21756] >gb|ADG11073.1| DNA gyrase, A subunit [Caulobacter segnis ATCC 21756]
	186 	186 	94% 	3e-45	Gene info linked to YP_003593691.1
YP_002844950.1 	
DNA gyrase subunit A [Rickettsia africae ESF-5] >gb|ACP53207.1| DNA gyrase subunit A [Rickettsia africae ESF-5]
	186 	186 	82% 	3e-45	Gene info linked to YP_002844950.1
CAE28040.1 	
DNA gyrase subunit A [Rhodopseudomonas palustris CGA009]
	186 	186 	96% 	3e-45	Gene info linked to CAE28040.1
ZP_05473310.1 	
DNA gyrase, A subunit [Anaerococcus vaginalis ATCC 51170] >gb|EEU11999.1| DNA gyrase, A subunit [Anaerococcus vaginalis ATCC 51170]
	186 	186 	96% 	3e-45	
ZP_05083240.1 	
DNA gyrase, A subunit [Pseudovibrio sp. JE062] >gb|EEA96865.1| DNA gyrase, A subunit [Pseudovibrio sp. JE062]
	186 	186 	82% 	3e-45	
ZP_02077032.1 	
hypothetical protein EUBDOL_00825 [Eubacterium dolichum DSM 3991] >gb|EDP11647.1| hypothetical protein EUBDOL_00825 [Eubacterium dolichum DSM 3991]
	186 	186 	82% 	3e-45	
ZP_02178047.1 	
DNA gyrase A subunit [Hydrogenivirga sp. 128-5-R1-1] >gb|EDP75241.1| DNA gyrase A subunit [Hydrogenivirga sp. 128-5-R1-1]
	186 	186 	82% 	3e-45	
AAQ19682.1 	
DNA gyrase subunit A [Staphylococcus haemolyticus]
	186 	186 	96% 	3e-45	
ZP_06440513.1 	
DNA gyrase, A subunit [Anaerobaculum hydrogeniformans ATCC BAA-1850] >gb|EFD24515.1| DNA gyrase, A subunit [Anaerobaculum hydrogeniformans ATCC BAA-1850]
	186 	186 	84% 	3e-45	
ZP_04058925.1 	
DNA gyrase, A subunit [Staphylococcus hominis SK119] >ref|ZP_07842559.1| DNA gyrase, A subunit [Staphylococcus hominis subsp. hominis C80] >gb|EEK13220.1| DNA gyrase, A subunit [Staphylococcus hominis SK119] >gb|EFS20280.1| DNA gyrase, A subunit [Staphylococcus hominis subsp. hominis C80]
	186 	186 	96% 	3e-45	
NP_947941.2 	
DNA gyrase subunit A [Rhodopseudomonas palustris CGA009]
	186 	186 	96% 	3e-45	Gene info linked to NP_947941.2
NP_359910.1 	
DNA gyrase subunit A [Rickettsia conorii str. Malish 7] >sp|Q92IZ6.1|GYRA_RICCN RecName: Full=DNA gyrase subunit A >gb|AAL02811.1| DNA gyrase subunit A [Rickettsia conorii str. Malish 7]
	186 	186 	82% 	3e-45	Gene info linked to NP_359910.1
YP_001991852.1 	
DNA gyrase, A subunit [Rhodopseudomonas palustris TIE-1] >gb|ACF01377.1| DNA gyrase, A subunit [Rhodopseudomonas palustris TIE-1]
	186 	186 	96% 	3e-45	Gene info linked to YP_001991852.1
YP_003147872.1 	
DNA gyrase subunit A [Kytococcus sedentarius DSM 20547] >gb|ACV05107.1| DNA gyrase subunit A [Kytococcus sedentarius DSM 20547]
	186 	186 	87% 	3e-45	Gene info linked to YP_003147872.1
ZP_01882632.1 	
DNA topoisomerase, ATP-hydrolyzing (DNA gyrase) (DNA topoisomerase II), subunit A [Pedobacter sp. BAL39] >gb|EDM38383.1| DNA topoisomerase, ATP-hydrolyzing (DNA gyrase) (DNA topoisomerase II), subunit A [Pedobacter sp. BAL39]
	186 	186 	86% 	4e-45	
ZP_00142264.1 	
DNA gyrase subunit A [Rickettsia sibirica 246] >gb|EAA25673.1| DNA gyrase subunit A [Rickettsia sibirica 246]
	186 	186 	82% 	4e-45	
ZP_07921826.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Pseudoramibacter alactolyticus ATCC 23263] >gb|EFV01128.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Pseudoramibacter alactolyticus ATCC 23263]
	186 	186 	85% 	4e-45	
2XCS_B 	
Chain B, The 2.1a Crystal Structure Of S. Aureus Gyrase Complex With Gsk299423 And Dna >pdb|2XCS|D Chain D, The 2.1a Crystal Structure Of S. Aureus Gyrase Complex With Gsk299423 And Dna >pdb|2XCT|B Chain B, The Twinned 3.35a Structure Of S. Aureus Gyrase Complex With Ciprofloxacin And Dna >pdb|2XCT|D Chain D, The Twinned 3.35a Structure Of S. Aureus Gyrase Complex With Ciprofloxacin And Dna >pdb|2XCT|S Chain S, The Twinned 3.35a Structure Of S. Aureus Gyrase Complex With Ciprofloxacin And Dna >pdb|2XCT|U Chain U, The Twinned 3.35a Structure Of S. Aureus Gyrase Complex With Ciprofloxacin And Dna
	186 	186 	82% 	4e-45	Structure related to 2XCS_B
YP_003506233.1 	
DNA gyrase A subunit [Meiothermus ruber DSM 1279] >gb|ADD27213.1| DNA gyrase, A subunit [Meiothermus ruber DSM 1279]
	186 	186 	83% 	4e-45	Gene info linked to YP_003506233.1
YP_001493126.1 	
DNA gyrase subunit A [Rickettsia akari str. Hartford] >gb|ABV74618.1| DNA gyrase subunit A [Rickettsia akari str. Hartford]
	186 	186 	82% 	4e-45	Gene info linked to YP_001493126.1
BAB48264.1 	
DNA gyrase subunit A [Mesorhizobium loti MAFF303099]
	186 	186 	85% 	4e-45	Gene info linked to BAB48264.1
ABL09947.1 	
DNA gyrase subunit A [Arcobacter nitrofigilis DSM 7299]
	186 	186 	97% 	4e-45	
2XCO_A 	
Chain A, The 3.1a Crystal Structure Of The Catalytic Core (B'a' Region) Of Staphylococcus Aureus Dna Gyrase >pdb|2XCQ|A Chain A, The 2.98a Crystal Structure Of The Catalytic Core (B'a' Region) Of Staphylococcus Aureus Dna Gyrase
	186 	186 	82% 	4e-45	Structure related to 2XCO_A
2XCR_B 	
Chain B, The 3.5a Crystal Structure Of The Catalytic Core (B'a' Region) Of Staphylococcus Aureus Dna Gyrase Complexed With Gsk299423 And Dna >pdb|2XCR|D Chain D, The 3.5a Crystal Structure Of The Catalytic Core (B'a' Region) Of Staphylococcus Aureus Dna Gyrase Complexed With Gsk299423 And Dna >pdb|2XCR|S Chain S, The 3.5a Crystal Structure Of The Catalytic Core (B'a' Region) Of Staphylococcus Aureus Dna Gyrase Complexed With Gsk299423 And Dna >pdb|2XCR|U Chain U, The 3.5a Crystal Structure Of The Catalytic Core (B'a' Region) Of Staphylococcus Aureus Dna Gyrase Complexed With Gsk299423 And Dna
	186 	186 	82% 	4e-45	Structure related to 2XCR_B
YP_251921.1 	
DNA gyrase (topoisomerase II) subunit A [Staphylococcus haemolyticus JCSC1435] >dbj|BAE03315.1| DNA gyrase (topoisomerase II) subunit A [Staphylococcus haemolyticus JCSC1435]
	186 	186 	96% 	4e-45	Gene info linked to YP_251921.1
YP_003131928.1 	
DNA gyrase subunit A [Saccharomonospora viridis DSM 43017] >gb|ACU95101.1| DNA gyrase subunit A [Saccharomonospora viridis DSM 43017]
	186 	186 	85% 	4e-45	Gene info linked to YP_003131928.1
YP_003656392.1 	
DNA gyrase subunit A [Arcobacter nitrofigilis DSM 7299] >gb|ADG93885.1| DNA gyrase, A subunit [Arcobacter nitrofigilis DSM 7299]
	186 	186 	97% 	5e-45	Gene info linked to YP_003656392.1
NP_102478.2 	
DNA gyrase subunit A [Mesorhizobium loti MAFF303099]
	186 	186 	85% 	5e-45	Gene info linked to NP_102478.2
ZP_00368027.1 	
DNA gyrase, A subunit [Campylobacter coli RM2228] >ref|ZP_07401119.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Campylobacter coli JV20] >gb|EAL56419.1| DNA gyrase, A subunit [Campylobacter coli RM2228] >gb|EFM37682.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Campylobacter coli JV20]
	186 	186 	81% 	5e-45	
ZP_07027169.1 	
DNA gyrase, A subunit [Afipia sp. 1NLS2] >gb|EFI52012.1| DNA gyrase, A subunit [Afipia sp. 1NLS2]
	186 	186 	96% 	5e-45	
ZP_04699844.1 	
DNA gyrase, A subunit [Rickettsia endosymbiont of Ixodes scapularis] >gb|EER22391.1| DNA gyrase, A subunit [Rickettsia endosymbiont of Ixodes scapularis]
	186 	186 	82% 	5e-45	
ZP_02182678.1 	
DNA topoisomerase, ATP-hydrolyzing (DNA gyrase) (DNA topoisomerase II), subunit A [Flavobacteriales bacterium ALC-1] >gb|EDP70610.1| DNA topoisomerase, ATP-hydrolyzing (DNA gyrase) (DNA topoisomerase II), subunit A [Flavobacteriales bacterium ALC-1]
	186 	186 	96% 	5e-45	
YP_247071.1 	
DNA gyrase subunit A [Rickettsia felis URRWXCal2] >sp|Q4UKM1.1|GYRA_RICFE RecName: Full=DNA gyrase subunit A >gb|AAY61906.1| DNA gyrase subunit A [Rickettsia felis URRWXCal2]
	186 	186 	82% 	5e-45	Gene info linked to YP_247071.1
ZP_05854725.1 	
DNA gyrase, A subunit [Blautia hansenii DSM 20583] >gb|EEX21160.1| DNA gyrase, A subunit [Blautia hansenii DSM 20583]
	186 	186 	82% 	5e-45	
YP_190089.1 	
DNA gyrase, A subunit [Staphylococcus epidermidis RP62A] >sp|Q5HK04.1|GYRA_STAEQ RecName: Full=DNA gyrase subunit A >gb|AAW53372.1| DNA gyrase, A subunit [Staphylococcus epidermidis RP62A]
	186 	186 	96% 	5e-45	Gene info linked to YP_190089.1
NP_825499.1 	
DNA gyrase subunit A [Streptomyces avermitilis MA-4680] >dbj|BAC72034.1| putative DNA gyrase subunit A [Streptomyces avermitilis MA-4680]
	186 	186 	85% 	5e-45	Gene info linked to NP_825499.1
YP_001038756.1 	
DNA gyrase subunit A [Clostridium thermocellum ATCC 27405] >ref|ZP_05428884.1| DNA gyrase, A subunit [Clostridium thermocellum DSM 2360] >ref|ZP_06249718.1| DNA gyrase, A subunit [Clostridium thermocellum JW20] >gb|ABN53563.1| DNA gyrase subunit A [Clostridium thermocellum ATCC 27405] >gb|EEU02330.1| DNA gyrase, A subunit [Clostridium thermocellum DSM 2360] >gb|EFB38042.1| DNA gyrase, A subunit [Clostridium thermocellum JW20] >gb|ADU76002.1| DNA gyrase, A subunit [Clostridium thermocellum DSM 1313]
	186 	186 	83% 	5e-45	Gene info linked to YP_001038756.1
NP_187680.2 	
DNA gyrase subunit A family protein [Arabidopsis thaliana] >sp|Q9CAF6.2|GYRA_ARATH RecName: Full=Probable DNA gyrase subunit A, chloroplastic/mitochondrial; Flags: Precursor
	185 	185 	87% 	6e-45	UniGene info linked to NP_187680.2Gene info linked to NP_187680.2
YP_001499095.1 	
DNA gyrase subunit A [Rickettsia massiliae MTU5] >gb|ABV84548.1| DNA gyrase subunit A [Rickettsia massiliae MTU5]
	185 	185 	82% 	6e-45	Gene info linked to YP_001499095.1
YP_003303395.1 	
DNA gyrase, A subunit [Sulfurospirillum deleyianum DSM 6946] >gb|ACZ11360.1| DNA gyrase, A subunit [Sulfurospirillum deleyianum DSM 6946]
	185 	185 	80% 	6e-45	Gene info linked to YP_003303395.1
NP_602910.1 	
DNA gyrase subunit A [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >ref|ZP_06871321.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Fusobacterium nucleatum subsp. nucleatum ATCC 23726] >gb|AAL94209.1| DNA gyrase subunit A [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gb|EFG94946.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Fusobacterium nucleatum subsp. nucleatum ATCC 23726]
	185 	185 	82% 	6e-45	Gene info linked to NP_602910.1
ZP_06420890.1 	
DNA gyrase, A subunit [Prevotella buccae D17] >gb|EFC74627.1| DNA gyrase, A subunit [Prevotella buccae D17]
	185 	185 	82% 	7e-45	
ZP_07883732.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Prevotella buccae ATCC 33574] >gb|EFU29615.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Prevotella buccae ATCC 33574]
	185 	185 	82% 	7e-45	
YP_003478458.1 	
DNA gyrase, A subunit [Natrialba magadii ATCC 43099] >gb|ADD03896.1| DNA gyrase, A subunit [Natrialba magadii ATCC 43099]
	185 	185 	88% 	7e-45	Gene info linked to YP_003478458.1
ZP_04858325.1 	
conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA] >gb|EES75571.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
	185 	185 	92% 	7e-45	
YP_001957930.1 	
hypothetical protein Aasi_0828 [Candidatus Amoebophilus asiaticus 5a2] >gb|ACE06201.1| hypothetical protein Aasi_0828 [Candidatus Amoebophilus asiaticus 5a2]
	185 	185 	84% 	7e-45	Gene info linked to YP_001957930.1
YP_001927715.1 	
DNA gyrase, A subunit [Methylobacterium populi BJ001] >gb|ACB83180.1| DNA gyrase, A subunit [Methylobacterium populi BJ001]
	185 	185 	96% 	7e-45	Gene info linked to YP_001927715.1
ZP_06272373.1 	
DNA gyrase, A subunit [Streptomyces sp. ACTE] >gb|EFB67192.1| DNA gyrase, A subunit [Streptomyces sp. ACTE]
	185 	185 	83% 	7e-45	
CAJ72493.1 	
strongly similar to DNA gyrase subunit A, type II topoisomerase [Candidatus Kuenenia stuttgartiensis]
	185 	185 	97% 	7e-45	
YP_001997724.1 	
DNA gyrase subunit A [Chlorobaculum parvum NCIB 8327] >gb|ACF10524.1| DNA gyrase, A subunit [Chlorobaculum parvum NCIB 8327]
	185 	185 	82% 	7e-45	Gene info linked to YP_001997724.1
ZP_05552129.1 	
DNA gyrase, A subunit [Fusobacterium sp. 3_1_36A2] >ref|ZP_06749671.1| DNA gyrase, A subunit [Fusobacterium sp. 3_1_27] >gb|EEU31450.1| DNA gyrase, A subunit [Fusobacterium sp. 3_1_36A2] >gb|EFG35307.1| DNA gyrase, A subunit [Fusobacterium sp. 3_1_27]
	185 	185 	81% 	7e-45	
YP_001129697.1 	
DNA gyrase subunit A [Prosthecochloris vibrioformis DSM 265] >gb|ABP36195.1| DNA gyrase subunit A [Chlorobium phaeovibrioides DSM 265]
	185 	185 	95% 	7e-45	Gene info linked to YP_001129697.1
ZP_04571494.1 	
DNA gyrase subunit A [Fusobacterium sp. 4_1_13] >gb|EEO41269.1| DNA gyrase subunit A [Fusobacterium sp. 4_1_13]
	185 	185 	81% 	8e-45	
ZP_03701203.1 	
DNA gyrase, A subunit [Flavobacteria bacterium MS024-3C] >gb|EEG43058.1| DNA gyrase, A subunit [Flavobacteria bacterium MS024-3C]
	185 	185 	96% 	8e-45	
AAF19580.1 	
putative DNA gyrase A subunit [Arabidopsis thaliana]
	185 	185 	87% 	8e-45	
ZP_07961450.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Prevotella salivae DSM 15606] >gb|EFV05124.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Prevotella salivae DSM 15606]
	185 	185 	82% 	8e-45	
YP_002607076.1 	
DNA gyrase subunit A [Nautilia profundicola AmH] >gb|ACM92510.1| DNA gyrase, A subunit [Nautilia profundicola AmH]
	185 	185 	95% 	8e-45	Gene info linked to YP_002607076.1
AAG51377.1 	
putative DNA gyrase subunit A; 1114-7603 [Arabidopsis thaliana]
	185 	185 	87% 	8e-45	
NP_279849.1 	
DNA gyrase subunit A [Halobacterium sp. NRC-1] >ref|YP_001688948.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Halobacterium salinarum R1] >gb|AAG19329.1| DNA gyrase subunit A [Halobacterium sp. NRC-1] >emb|CAP13600.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Halobacterium salinarum R1]
	185 	185 	85% 	9e-45	Gene info linked to NP_279849.1
ZP_01546596.1 	
DNA gyrase subunit A [Stappia aggregata IAM 12614] >gb|EAV45152.1| DNA gyrase subunit A [Stappia aggregata IAM 12614]
	185 	185 	87% 	9e-45	
EFN51479.1 	
hypothetical protein CHLNCDRAFT_56398 [Chlorella variabilis]
	185 	185 	84% 	9e-45	
NP_220594.1 	
DNA gyrase subunit A [Rickettsia prowazekii str. Madrid E] >sp|P41080.1|GYRA_RICPR RecName: Full=DNA gyrase subunit A >gb|AAA68146.1| gyrase A subunit [Rickettsia prowazekii] >emb|CAA14671.1| DNA GYRASE SUBUNIT A (gyrA) [Rickettsia prowazekii] >gb|ADE29717.1| DNA gyrase subunit A [Rickettsia prowazekii Rp22] >prf||2104274A DNA gyrase
	184 	184 	82% 	1e-44	Gene info linked to NP_220594.1
YP_001874911.1 	
DNA gyrase subunit A [Elusimicrobium minutum Pei191] >gb|ACC97574.1| DNA gyrase, A subunit [Elusimicrobium minutum Pei191]
	184 	184 	82% 	1e-44	Gene info linked to YP_001874911.1
ZP_01052578.1 	
DNA gyrase subunit A [Polaribacter sp. MED152] >gb|EAQ42006.1| DNA gyrase subunit A [Polaribacter sp. MED152]
	184 	184 	96% 	1e-44	
YP_003801742.1 	
DNA gyrase subunit A [Olsenella uli DSM 7084] >gb|ADK68862.1| DNA gyrase subunit A [Olsenella uli DSM 7084]
	184 	184 	82% 	1e-44	Gene info linked to YP_003801742.1
ZP_02031758.1 	
hypothetical protein PARMER_01763 [Parabacteroides merdae ATCC 43184] >gb|EDN86402.1| hypothetical protein PARMER_01763 [Parabacteroides merdae ATCC 43184]
	184 	184 	83% 	1e-44	
XP_003062700.1 	
predicted protein [Micromonas pusilla CCMP1545] >gb|EEH53519.1| predicted protein [Micromonas pusilla CCMP1545]
	184 	184 	82% 	1e-44	Gene info linked to XP_003062700.1
YP_001355960.1 	
DNA gyrase subunit A [Nitratiruptor sp. SB155-2] >dbj|BAF69603.1| DNA gyrase subunit A [Nitratiruptor sp. SB155-2]
	184 	184 	95% 	1e-44	Gene info linked to YP_001355960.1
YP_001295667.1 	
DNA gyrase subunit A [Flavobacterium psychrophilum JIP02/86] >emb|CAL42851.1| DNA gyrase subunit A [Flavobacterium psychrophilum JIP02/86]
	184 	184 	82% 	1e-44	Gene info linked to YP_001295667.1
ZP_05031715.1 	
DNA gyrase, A subunit [Brevundimonas sp. BAL3] >gb|EDX79144.1| DNA gyrase, A subunit [Brevundimonas sp. BAL3]
	184 	184 	95% 	1e-44	
YP_073836.1 	
DNA gyrase A subunit [Symbiobacterium thermophilum IAM 14863] >dbj|BAD38992.1| DNA gyrase A subunit [Symbiobacterium thermophilum IAM 14863]
	184 	184 	97% 	1e-44	Gene info linked to YP_073836.1
ZP_04006957.1 	
DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus johnsonii ATCC 33200] >gb|EEJ60467.1| DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus johnsonii ATCC 33200]
	184 	184 	98% 	1e-44	
YP_001047319.1 	
DNA gyrase, A subunit [Methanoculleus marisnigri JR1] >gb|ABN57337.1| DNA gyrase subunit A [Methanoculleus marisnigri JR1]
	184 	184 	90% 	1e-44	Gene info linked to YP_001047319.1
YP_003806234.1 	
DNA gyrase, A subunit [Desulfarculus baarsii DSM 2075] >gb|ADK83640.1| DNA gyrase, A subunit [Desulfarculus baarsii DSM 2075]
	184 	184 	84% 	1e-44	Gene info linked to YP_003806234.1
YP_002289211.1 	
DNA gyrase, A subunit [Oligotropha carboxidovorans OM5] >gb|ACI93346.1| DNA gyrase, A subunit [Oligotropha carboxidovorans OM5]
	184 	184 	96% 	1e-44	Gene info linked to YP_002289211.1
YP_004196710.1 	
DNA gyrase subunit A [Desulfobulbus propionicus DSM 2032] >gb|ADW19419.1| DNA gyrase subunit A [Desulfobulbus propionicus DSM 2032]
	184 	184 	83% 	1e-44	Gene info linked to YP_004196710.1
YP_595159.1 	
Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Lawsonia intracellularis PHE/MN1-00] >emb|CAJ54838.1| Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Lawsonia intracellularis PHE/MN1-00]
	184 	184 	84% 	2e-44	Gene info linked to YP_595159.1
ZP_07387540.1 	
DNA gyrase, A subunit [Paenibacillus curdlanolyticus YK9] >gb|EFM10961.1| DNA gyrase, A subunit [Paenibacillus curdlanolyticus YK9]
	184 	184 	96% 	2e-44	
YP_002508920.1 	
DNA gyrase subunit A [Halothermothrix orenii H 168] >gb|ACL69925.1| DNA gyrase subunit A [Halothermothrix orenii H 168]
	184 	184 	98% 	2e-44	Gene info linked to YP_002508920.1
CBH36896.1 	
DNA gyrase subunit A [uncultured archaeon]
	184 	184 	88% 	2e-44	
ZP_01202813.1 	
DNA gyrase (type IIA topoisomerase), subunit A [Flavobacteria bacterium BBFL7] >gb|EAS18999.1| DNA gyrase (type IIA topoisomerase), subunit A [Flavobacteria bacterium BBFL7]
	184 	184 	96% 	2e-44	
YP_001414313.1 	
DNA gyrase, A subunit [Parvibaculum lavamentivorans DS-1] >gb|ABS64656.1| DNA gyrase, A subunit [Parvibaculum lavamentivorans DS-1]
	184 	184 	86% 	2e-44	Gene info linked to YP_001414313.1
YP_001194930.1 	
DNA gyrase, A subunit [Flavobacterium johnsoniae UW101] >gb|ABQ05611.1| DNA gyrase subunit A [Flavobacterium johnsoniae UW101]
	184 	184 	82% 	2e-44	Gene info linked to YP_001194930.1
YP_004013626.1 	
DNA gyrase, A subunit [Rhodomicrobium vannielii ATCC 17100] >gb|ADP72527.1| DNA gyrase, A subunit [Rhodomicrobium vannielii ATCC 17100]
	184 	184 	96% 	2e-44	Gene info linked to YP_004013626.1
YP_004013964.1 	
DNA gyrase, A subunit [Frankia sp. EuI1c] >gb|ADP78094.1| DNA gyrase, A subunit [Frankia sp. EuI1c]
	184 	184 	83% 	2e-44	Gene info linked to YP_004013964.1
YP_003542019.1 	
DNA gyrase subunit A [Methanohalophilus mahii DSM 5219] >gb|ADE36374.1| DNA gyrase subunit A [Methanohalophilus mahii DSM 5219]
	184 	184 	82% 	2e-44	Gene info linked to YP_003542019.1
YP_003159585.1 	
DNA gyrase, A subunit [Desulfomicrobium baculatum DSM 4028] >gb|ACU91169.1| DNA gyrase, A subunit [Desulfomicrobium baculatum DSM 4028]
	184 	184 	92% 	2e-44	Gene info linked to YP_003159585.1
YP_004050086.1 	
DNA gyrase subunit a [Calditerrivibrio nitroreducens DSM 19672] >gb|ADR17923.1| DNA gyrase subunit A [Calditerrivibrio nitroreducens DSM 19672]
	184 	184 	84% 	2e-44	Gene info linked to YP_004050086.1
ZP_07356550.1 	
DNA gyrase, A subunit [Desulfovibrio sp. 3_1_syn3] >gb|EFL86954.1| DNA gyrase, A subunit [Desulfovibrio sp. 3_1_syn3]
	184 	184 	84% 	2e-44	
ACN88537.1 	
DNA gyrase subunit A [Arcobacter halophilus]
	184 	184 	90% 	2e-44	
ZP_07036537.1 	
DNA gyrase, A subunit [Peptoniphilus sp. oral taxon 386 str. F0131] >gb|EFI41681.1| DNA gyrase, A subunit [Peptoniphilus sp. oral taxon 386 str. F0131]
	184 	184 	82% 	2e-44	
ZP_05008706.1 	
DNA gyrase subunit A [Streptomyces clavuligerus ATCC 27064] >ref|ZP_06772389.1| DNA gyrase subunit A [Streptomyces clavuligerus ATCC 27064] >gb|EDY53005.1| DNA gyrase subunit A [Streptomyces clavuligerus ATCC 27064] >gb|EFG07988.1| DNA gyrase subunit A [Streptomyces clavuligerus ATCC 27064]
	184 	184 	85% 	2e-44	
ZP_00144249.1 	
DNA gyrase subunit A [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gb|EAA24152.1| DNA gyrase subunit A [Fusobacterium nucleatum subsp. vincentii ATCC 49256]
	183 	183 	81% 	2e-44	
ZP_05900060.1 	
DNA gyrase, A subunit [Selenomonas sputigena ATCC 35185] >gb|EEX75933.1| DNA gyrase, A subunit [Selenomonas sputigena ATCC 35185]
	183 	183 	85% 	2e-44	
YP_001741393.1 	
DNA gyrase, A subunit [Candidatus Cloacamonas acidaminovorans] >emb|CAO81187.1| DNA gyrase, A subunit [Candidatus Cloacamonas acidaminovorans]
	183 	183 	96% 	2e-44	Gene info linked to YP_001741393.1
YP_864996.1 	
DNA gyrase subunit A [Magnetococcus sp. MC-1] >gb|ABK43590.1| DNA gyrase subunit A [Magnetococcus sp. MC-1]
	183 	183 	83% 	2e-44	Gene info linked to YP_864996.1
YP_761439.1 	
DNA gyrase subunit A [Hyphomonas neptunium ATCC 15444] >gb|ABI76923.1| DNA gyrase, A subunit [Hyphomonas neptunium ATCC 15444]
	183 	183 	83% 	2e-44	Gene info linked to YP_761439.1
ZP_03656342.1 	
DNA gyrase subunit A [Helicobacter canadensis MIT 98-5491] >ref|ZP_04870542.1| DNA gyrase subunit A [Helicobacter canadensis MIT 98-5491] >ref|ZP_07804060.1| DNA gyrase A subunit [Helicobacter canadensis MIT 98-5491] >gb|EES89722.1| DNA gyrase subunit A [Helicobacter canadensis MIT 98-5491] >gb|EFR48515.1| DNA gyrase A subunit [Helicobacter canadensis MIT 98-5491]
	183 	183 	97% 	3e-44	
ZP_01745651.1 	
DNA gyrase subunit A [Sagittula stellata E-37] >gb|EBA09010.1| DNA gyrase subunit A [Sagittula stellata E-37]
	183 	183 	84% 	3e-44	
ZP_06269392.1 	
DNA gyrase, A subunit [Prevotella bivia JCVIHMP010] >gb|EFB92156.1| DNA gyrase, A subunit [Prevotella bivia JCVIHMP010]
	183 	183 	83% 	3e-44	
ZP_07312002.1 	
DNA gyrase, A subunit [Streptomyces griseoflavus Tu4000] >gb|EFL40371.1| DNA gyrase, A subunit [Streptomyces griseoflavus Tu4000]
	183 	183 	85% 	3e-44	

YP_001754829.1 	
DNA gyrase, A subunit [Methylobacterium radiotolerans JCM 2831] >gb|ACB24146.1| DNA gyrase, A subunit [Methylobacterium radiotolerans JCM 2831]
	183 	183 	96% 	3e-44	Gene info linked to YP_001754829.1
YP_001684496.1 	
DNA gyrase subunit A [Caulobacter sp. K31] >gb|ABZ71998.1| DNA gyrase, A subunit [Caulobacter sp. K31]
	183 	183 	86% 	3e-44	Gene info linked to YP_001684496.1
YP_637185.1 	
DNA gyrase subunit A [Mycobacterium sp. MCS] >ref|YP_936024.1| DNA gyrase subunit A [Mycobacterium sp. KMS] >gb|ABG06129.1| DNA gyrase subunit A [Mycobacterium sp. MCS] >gb|ABL89234.1| DNA gyrase subunit A [Mycobacterium sp. KMS]
	183 	183 	88% 	3e-44	Gene info linked to YP_637185.1
ZP_03916078.1 	
DNA topoisomerase (ATP-hydrolyzing) [Anaerococcus lactolyticus ATCC 51172] >gb|EEI86332.1| DNA topoisomerase (ATP-hydrolyzing) [Anaerococcus lactolyticus ATCC 51172]
	183 	183 	83% 	3e-44	
ZP_05441406.1 	
DNA gyrase subunit A [Fusobacterium sp. D11] >ref|ZP_05815481.1| DNA gyrase, A subunit [Fusobacterium sp. 3_1_33] >ref|ZP_06524909.1| DNA gyrase subunit A [Fusobacterium sp. D11] >gb|EEW94652.1| DNA gyrase, A subunit [Fusobacterium sp. 3_1_33] >gb|EFD81098.1| DNA gyrase subunit A [Fusobacterium sp. D11]
	183 	183 	81% 	3e-44	
ZP_08033888.1 	
DNA gyrase, A subunit [Actinomyces sp. oral taxon 171 str. F0337] >gb|EFW26852.1| DNA gyrase, A subunit [Actinomyces sp. oral taxon 171 str. F0337]
	183 	183 	83% 	3e-44	
ZP_04569041.1 	
DNA gyrase subunit A [Fusobacterium sp. 2_1_31] >gb|EEO39090.1| DNA gyrase subunit A [Fusobacterium sp. 2_1_31]
	183 	183 	81% 	3e-44	
YP_318414.1 	
DNA gyrase subunit A [Nitrobacter winogradskyi Nb-255] >gb|ABA05062.1| DNA gyrase subunit A [Nitrobacter winogradskyi Nb-255]
	183 	183 	96% 	3e-44	Gene info linked to YP_318414.1
ZP_04703305.1 	
DNA gyrase subunit A [Streptomyces albus J1074] >ref|ZP_06592029.1| subunit A [Streptomyces albus J1074] >gb|EFE82490.1| subunit A [Streptomyces albus J1074]
	183 	183 	85% 	3e-44	
YP_004060943.1 	
DNA gyrase subunit a [Sulfuricurvum kujiense DSM 16994] >gb|ADR34743.1| DNA gyrase subunit A [Sulfuricurvum kujiense DSM 16994]
	183 	183 	98% 	3e-44	Gene info linked to YP_004060943.1
YP_001491967.1 	
DNA gyrase subunit A [Rickettsia canadensis str. McKiel] >gb|ABV73182.1| DNA gyrase subunit A [Rickettsia canadensis str. McKiel]
	183 	183 	82% 	3e-44	Gene info linked to YP_001491967.1
YP_003574167.1 	
DNA gyrase subunit A [Prevotella ruminicola 23] >gb|ADE82645.1| DNA gyrase, A subunit [Prevotella ruminicola 23]
	183 	183 	83% 	3e-44	Gene info linked to YP_003574167.1
ZP_01288025.1 	
DNA gyrase, subunit A [delta proteobacterium MLMS-1] >gb|EAT05545.1| DNA gyrase, subunit A [delta proteobacterium MLMS-1]
	182 	182 	83% 	4e-44	
YP_001931336.1 	
DNA topoisomerase (ATP-hydrolyzing) [Sulfurihydrogenibium sp. YO3AOP1] >gb|ACD66782.1| DNA topoisomerase (ATP-hydrolyzing) [Sulfurihydrogenibium sp. YO3AOP1]
	182 	182 	82% 	4e-44	Gene info linked to YP_001931336.1
ZP_01289913.1 	
DNA gyrase, subunit A [delta proteobacterium MLMS-1] >gb|EAT03669.1| DNA gyrase, subunit A [delta proteobacterium MLMS-1]
	182 	182 	83% 	4e-44	
NP_628060.1 	
DNA gyrase subunit A [Streptomyces coelicolor A3(2)] >sp|P35885.2|GYRA_STRCO RecName: Full=DNA gyrase subunit A >emb|CAB92993.1| DNA gyrase subunit A [Streptomyces coelicolor A3(2)]
	182 	182 	85% 	4e-44	Gene info linked to NP_628060.1
ZP_05807400.1 	
DNA gyrase, A subunit [Mesorhizobium opportunistum WSM2075] >gb|EEW35955.1| DNA gyrase, A subunit [Mesorhizobium opportunistum WSM2075]
	182 	182 	85% 	4e-44	
ZP_05738300.1 	
DNA gyrase, A subunit [Granulicatella adiacens ATCC 49175] >gb|EEW36831.1| DNA gyrase, A subunit [Granulicatella adiacens ATCC 49175]
	182 	182 	90% 	4e-44	
T10970 	
DNA topoisomerase (ATP-hydrolyzing) (EC 5.99.1.3) chain A - Streptomyces coelicolor >gb|AAA65216.1| DNA gyrase [Streptomyces coelicolor A3(2)] >prf||2104262E DNA gyrase
	182 	182 	85% 	4e-44	
ZP_07721043.1 	
DNA gyrase, A subunit [Algoriphagus sp. PR1] >gb|EAZ83133.1| DNA gyrase, A subunit [Algoriphagus sp. PR1]
	182 	182 	96% 	4e-44	
NP_964020.1 	
DNA gyrase subunit A [Lactobacillus johnsonii NCC 533] >gb|AAS07986.1| DNA gyrase subunit A [Lactobacillus johnsonii NCC 533]
	182 	182 	88% 	4e-44	Gene info linked to NP_964020.1
ZP_06160386.1 	
DNA gyrase, A subunit [Slackia exigua ATCC 700122] >gb|EEZ61143.1| DNA gyrase, A subunit [Slackia exigua ATCC 700122]
	182 	182 	97% 	4e-44	
Q7XZF7.2 	
RecName: Full=Probable DNA gyrase subunit A, chloroplastic/mitochondrial; Flags: Precursor
	182 	182 	94% 	4e-44	
ZP_07360300.1 	
DNA gyrase subunit A [Actinomyces viscosus C505]
	182 	182 	83% 	4e-44	
ZP_06255206.1 	
DNA gyrase, A subunit [Prevotella oris F0302] >gb|EFB32393.1| DNA gyrase, A subunit [Prevotella oris F0302]
	182 	182 	82% 	4e-44	
NP_861164.1 	
DNA gyrase subunit A [Helicobacter hepaticus ATCC 51449] >gb|AAP78230.1| DNA gyrase [Helicobacter hepaticus ATCC 51449]
	182 	182 	97% 	4e-44	Gene info linked to NP_861164.1
AAP73860.1 	
putative DNA gyrase subunit [Oryza sativa Japonica Group]
	182 	182 	94% 	5e-44	
YP_003169752.1 	
DNA gyrase subunit A [Lactobacillus rhamnosus GG] >emb|CAR85901.1| DNA gyrase subunit A [Lactobacillus rhamnosus GG] >dbj|BAI40533.1| DNA gyrase A subunit [Lactobacillus rhamnosus GG]
	182 	182 	90% 	5e-44	Gene info linked to YP_003169752.1
ZP_06918343.1 	
DNA gyrase, A subunit [Streptomyces sviceus ATCC 29083] >gb|EDY60917.2| DNA gyrase, A subunit [Streptomyces sviceus ATCC 29083]
	182 	182 	85% 	5e-44	
ZP_03211649.1 	
DNA gyrase, A subunit [Lactobacillus rhamnosus HN001] >gb|EDY98916.1| DNA gyrase, A subunit [Lactobacillus rhamnosus HN001]
	182 	182 	90% 	5e-44	
ZP_07034106.1 	
DNA gyrase, A subunit [Prevotella oris C735] >gb|EFI49802.1| DNA gyrase, A subunit [Prevotella oris C735]
	182 	182 	82% 	5e-44	
ZP_01251825.1 	
DNA gyrase A subunit [Psychroflexus torquis ATCC 700755] >gb|EAS73649.1| DNA gyrase A subunit [Psychroflexus torquis ATCC 700755]
	182 	182 	96% 	5e-44	
ZP_02187136.1 	
Type IIA topoisomerase , A subunit [alpha proteobacterium BAL199] >gb|EDP66318.1| Type IIA topoisomerase , A subunit [alpha proteobacterium BAL199]
	182 	182 	83% 	5e-44	
ZP_06720172.1 	
DNA gyrase, A subunit [Ruminococcus albus 8] >gb|EFF15332.1| DNA gyrase, A subunit [Ruminococcus albus 8]
	182 	182 	82% 	5e-44	
YP_003709377.1 	
DNA gyrase subunit A [Waddlia chondrophila WSU 86-1044] >gb|ADI38371.1| DNA gyrase subunit A [Waddlia chondrophila WSU 86-1044]
	182 	182 	97% 	6e-44	Gene info linked to YP_003709377.1
ZP_05557067.1 	
DNA gyrase, A subunit [Lactobacillus jensenii 27-2-CHN] >ref|ZP_05862516.1| DNA gyrase, A subunit [Lactobacillus jensenii 115-3-CHN] >ref|ZP_06339514.1| DNA gyrase, A subunit [Lactobacillus jensenii 208-1] >ref|ZP_06922684.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus jensenii JV-V16] >gb|EEU20826.1| DNA gyrase, A subunit [Lactobacillus jensenii 27-2-CHN] >gb|EEX23639.1| DNA gyrase, A subunit [Lactobacillus jensenii 115-3-CHN] >gb|EFA93978.1| DNA gyrase, A subunit [Lactobacillus jensenii 208-1] >gb|EFH30163.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus jensenii JV-V16]
	182 	182 	88% 	6e-44	
ZP_04439823.1 	
DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus rhamnosus LMS2-1] >ref|YP_003172697.1| DNA gyrase subunit A [Lactobacillus rhamnosus Lc 705] >gb|EEN81532.1| DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus rhamnosus LMS2-1] >emb|CAR88846.1| DNA gyrase subunit A [Lactobacillus rhamnosus Lc 705]
	182 	182 	90% 	6e-44	
ZP_06529890.1 	
DNA topoisomerase subunit A [Streptomyces lividans TK24] >gb|EFD68140.1| DNA topoisomerase subunit A [Streptomyces lividans TK24]
	182 	182 	85% 	6e-44	
YP_861544.1 	
DNA gyrase subunit A [Gramella forsetii KT0803] >emb|CAL66477.1| DNA gyrase subunit A [Gramella forsetii KT0803]
	182 	182 	82% 	6e-44	Gene info linked to YP_861544.1
XP_002884807.1 	
DNA gyrase subunit A family protein [Arabidopsis lyrata subsp. lyrata] >gb|EFH61066.1| DNA gyrase subunit A family protein [Arabidopsis lyrata subsp. lyrata]
	182 	182 	87% 	6e-44	Gene info linked to XP_002884807.1
ZP_03931030.1 	
DNA topoisomerase (ATP-hydrolyzing) [Anaerococcus tetradius ATCC 35098] >gb|EEI82152.1| DNA topoisomerase (ATP-hydrolyzing) [Anaerococcus tetradius ATCC 35098]
	182 	182 	83% 	6e-44	
ZP_07627897.1 	
DNA gyrase, A subunit [Prevotella amnii CRIS 21A-A] >gb|EFN91206.1| DNA gyrase, A subunit [Prevotella amnii CRIS 21A-A]
	182 	182 	83% 	7e-44	
ZP_07287908.1 	
DNA gyrase subunit A [Streptomyces sp. C] >gb|EFL16277.1| DNA gyrase subunit A [Streptomyces sp. C]
	182 	182 	85% 	7e-44	
ZP_01811184.1 	
DNA gyrase, A subunit [candidate division TM7 genomosp. GTL1] >gb|EDK72438.1| DNA gyrase, A subunit [candidate division TM7 genomosp. GTL1]
	182 	182 	83% 	7e-44	
CAJ33722.1 	
DNA gyrase subunit A [Bacillus plakortidis]
	182 	182 	77% 	7e-44	
YP_374031.1 	
DNA gyrase, subunit A [Chlorobium luteolum DSM 273] >gb|ABB22988.1| DNA gyrase subunit A [Chlorobium luteolum DSM 273]
	182 	182 	83% 	7e-44	Gene info linked to YP_374031.1
ZP_05626873.1 	
DNA gyrase subunit A [Fusobacterium sp. D12] >ref|ZP_07924603.1| DNA gyrase subunit A [Fusobacterium sp. D12] >gb|EFS22629.1| DNA gyrase subunit A [Fusobacterium sp. D12]
	182 	182 	96% 	8e-44	
ZP_07296300.1 	
DNA gyrase, A subunit [Streptomyces hygroscopicus ATCC 53653] >gb|EFL24669.1| DNA gyrase, A subunit [Streptomyces hygroscopicus ATCC 53653]
	182 	182 	85% 	8e-44	
YP_003819558.1 	
DNA gyrase, A subunit [Brevundimonas subvibrioides ATCC 15264] >gb|ADL01935.1| DNA gyrase, A subunit [Brevundimonas subvibrioides ATCC 15264]
	182 	182 	95% 	8e-44	Gene info linked to YP_003819558.1
YP_003490180.1 	
DNA gyrase subunit A [Streptomyces scabiei 87.22] >emb|CBG71635.1| DNA gyrase subunit A [Streptomyces scabiei 87.22]
	182 	182 	85% 	8e-44	Gene info linked to YP_003490180.1
ZP_07611009.1 	
DNA gyrase, A subunit [Streptomyces violaceusniger Tu 4113] >gb|EFN13521.1| DNA gyrase, A subunit [Streptomyces violaceusniger Tu 4113]
	181 	181 	85% 	8e-44	
YP_002246983.1 	
DNA gyrase, A subunit [Coprothermobacter proteolyticus DSM 5265] >gb|ACI17976.1| DNA gyrase, A subunit [Coprothermobacter proteolyticus DSM 5265]
	181 	181 	81% 	8e-44	Gene info linked to YP_002246983.1
NP_325978.1 	
DNA gyrase subunit A [Mycoplasma pulmonis UAB CTIP] >emb|CAC13320.1| DNA GYRASE SUBUNIT A [Mycoplasma pulmonis]
	181 	181 	88% 	8e-44	Gene info linked to NP_325978.1
YP_004143215.1 	
DNA gyrase, A subunit [Mesorhizobium ciceri biovar biserrulae WSM1271] >gb|ADV13165.1| DNA gyrase, A subunit [Mesorhizobium ciceri biovar biserrulae WSM1271]
	181 	181 	85% 	9e-44	Gene info linked to YP_004143215.1
YP_003092429.1 	
DNA gyrase, A subunit [Pedobacter heparinus DSM 2366] >gb|ACU04367.1| DNA gyrase, A subunit [Pedobacter heparinus DSM 2366]
	181 	181 	86% 	9e-44	Gene info linked to YP_003092429.1
ZP_05417547.1 	
DNA gyrase, A subunit [Bacteroides finegoldii DSM 17565] >gb|EEX43185.1| DNA gyrase, A subunit [Bacteroides finegoldii DSM 17565]
	181 	181 	83% 	9e-44	
YP_003125076.1 	
DNA gyrase, A subunit [Chitinophaga pinensis DSM 2588] >gb|ACU62875.1| DNA gyrase, A subunit [Chitinophaga pinensis DSM 2588]
	181 	181 	82% 	9e-44	Gene info linked to YP_003125076.1
ZP_05002371.1 	
DNA gyrase subunit A [Streptomyces sp. Mg1] >gb|EDX26882.1| DNA gyrase subunit A [Streptomyces sp. Mg1]
	181 	181 	83% 	9e-44	
YP_003833155.1 	
DNA gyrase subunit A [Micromonospora aurantiaca ATCC 27029] >gb|ADL43579.1| DNA gyrase, A subunit [Micromonospora aurantiaca ATCC 27029]
	181 	181 	83% 	1e-43	Gene info linked to YP_003833155.1
ZP_07326568.1 	
DNA gyrase, A subunit [Acetivibrio cellulolyticus CD2] >gb|EFL62043.1| DNA gyrase, A subunit [Acetivibrio cellulolyticus CD2]
	181 	181 	83% 	1e-43	
YP_002478604.1 	
DNA gyrase, A subunit [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774] >gb|ACL47926.1| DNA gyrase, A subunit [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
	181 	181 	96% 	1e-43	Gene info linked to YP_002478604.1
ZP_06287664.1 	
DNA gyrase, A subunit [Prevotella buccalis ATCC 35310] >gb|EFA91304.1| DNA gyrase, A subunit [Prevotella buccalis ATCC 35310]
	181 	181 	83% 	1e-43	
YP_003397736.1 	
DNA gyrase, A subunit [Acidaminococcus fermentans DSM 20731] >gb|ADB46421.1| DNA gyrase, A subunit [Acidaminococcus fermentans DSM 20731]
	181 	181 	96% 	1e-43	Gene info linked to YP_003397736.1
YP_003756297.1 	
DNA gyrase, A subunit [Hyphomicrobium denitrificans ATCC 51888] >gb|ADJ23976.1| DNA gyrase, A subunit [Hyphomicrobium denitrificans ATCC 51888]
	181 	181 	95% 	1e-43	Gene info linked to YP_003756297.1
ZP_03926878.1 	
DNA topoisomerase (ATP-hydrolyzing) [Actinomyces urogenitalis DSM 15434] >gb|EEH66263.1| DNA topoisomerase (ATP-hydrolyzing) [Actinomyces urogenitalis DSM 15434]
	181 	181 	83% 	1e-43	
NP_757390.1 	
DNA gyrase subunit A [Mycoplasma penetrans HF-2] >dbj|BAC43794.1| DNA gyrase subunit A [Mycoplasma penetrans HF-2]
	181 	181 	85% 	1e-43	Gene info linked to NP_757390.1
XP_002987395.1 	
hypothetical protein SELMODRAFT_126010 [Selaginella moellendorffii] >gb|EFJ11482.1| hypothetical protein SELMODRAFT_126010 [Selaginella moellendorffii]
	181 	181 	96% 	1e-43	UniGene info linked to XP_002987395.1Gene info linked to XP_002987395.1
ADP85207.1 	
DNA gyrase, A subunit [Desulfovibrio vulgaris RCH1]
	181 	181 	96% 	1e-43	
YP_009229.1 	
DNA gyrase subunit A [Desulfovibrio vulgaris str. Hildenborough] >ref|YP_965455.1| DNA gyrase, A subunit [Desulfovibrio vulgaris subsp. vulgaris DP4] >gb|AAS94488.1| DNA gyrase, A subunit [Desulfovibrio vulgaris str. Hildenborough] >gb|ABM27028.1| DNA gyrase subunit A [Desulfovibrio vulgaris DP4]
	181 	181 	96% 	1e-43	Gene info linked to YP_009229.1
ZP_05859830.1 	
DNA gyrase, A subunit [Jonquetella anthropi E3_33 E1] >gb|EEX49167.1| DNA gyrase, A subunit [Jonquetella anthropi E3_33 E1]
	181 	181 	82% 	1e-43	
YP_003863869.1 	
DNA gyrase subunit A [Maribacter sp. HTCC2170] >gb|EAR01865.1| DNA gyrase A subunit [Maribacter sp. HTCC2170]
	181 	181 	96% 	1e-43	Gene info linked to YP_003863869.1
YP_001132093.1 	
DNA gyrase, A subunit [Mycobacterium gilvum PYR-GCK] >ref|YP_004074582.1| DNA gyrase subunit A [Mycobacterium sp. Spyr1] >gb|ABP43305.1| DNA gyrase subunit A [Mycobacterium gilvum PYR-GCK] >gb|ADT96747.1| DNA gyrase subunit A [Mycobacterium sp. Spyr1]
	181 	181 	88% 	1e-43	Gene info linked to YP_001132093.1
ZP_07216171.1 	
DNA gyrase, A subunit [Bacteroides sp. 20_3] >gb|EFK62437.1| DNA gyrase, A subunit [Bacteroides sp. 20_3]
	181 	181 	83% 	1e-43	
ZP_06985634.1 	
DNA gyrase, A subunit [Bacteroides sp. 3_1_19] >gb|EFI09833.1| DNA gyrase, A subunit [Bacteroides sp. 3_1_19]
	181 	181 	83% 	1e-43	
YP_001302475.1 	
DNA gyrase A subunit [Parabacteroides distasonis ATCC 8503] >ref|ZP_05285689.1| DNA gyrase A subunit [Bacteroides sp. 2_1_7] >ref|ZP_05545501.1| DNA gyrase, A subunit [Parabacteroides sp. D13] >ref|ZP_06074898.1| DNA gyrase, A subunit [Bacteroides sp. 2_1_33B] >gb|ABR42853.1| DNA gyrase A subunit [Parabacteroides distasonis ATCC 8503] >gb|EEU52247.1| DNA gyrase, A subunit [Parabacteroides sp. D13] >gb|EEY84867.1| DNA gyrase, A subunit [Bacteroides sp. 2_1_33B]
	181 	181 	83% 	1e-43	Gene info linked to YP_001302475.1
ZP_06818108.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus amylolyticus DSM 11664] >gb|EFG55822.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus amylolyticus DSM 11664]
	181 	181 	95% 	1e-43	
ZP_00371404.1 	
DNA gyrase, A subunit [Campylobacter upsaliensis RM3195] >gb|EAL53087.1| DNA gyrase, A subunit [Campylobacter upsaliensis RM3195]
	181 	181 	82% 	1e-43	
YP_004959.1 	
DNA gyrase subunit A [Thermus thermophilus HB27] >gb|AAS81332.1| DNA gyrase subunit A [Thermus thermophilus HB27]
	181 	181 	87% 	1e-43	Gene info linked to YP_004959.1
YP_144621.1 	
DNA gyrase subunit A [Thermus thermophilus HB8] >gb|AAF89614.1|AF167401_1 gyrase subunit A [Thermus thermophilus] >dbj|BAD71178.1| DNA gyrase subunit A [Thermus thermophilus HB8]
	181 	181 	87% 	1e-43	Gene info linked to YP_144621.1
ZP_04584096.1 	
DNA gyrase subunit A [Sulfurihydrogenibium yellowstonense SS-5] >gb|EEP61358.1| DNA gyrase subunit A [Sulfurihydrogenibium yellowstonense SS-5]
	181 	181 	82% 	1e-43	
YP_003995045.1 	
DNA gyrase, A subunit [Halanaerobium sp. 'sapolanicus'] >gb|ADQ14691.1| DNA gyrase, A subunit [Halanaerobium sp. 'sapolanicus']
	181 	181 	88% 	1e-43	Gene info linked to YP_003995045.1
YP_004056087.1 	
DNA gyrase subunit A [Mycoplasma bovis PG45] >gb|ADR24951.1| DNA gyrase, A subunit [Mycoplasma bovis PG45]
	181 	181 	88% 	1e-43	Gene info linked to YP_004056087.1
YP_426831.1 	
DNA gyrase subunit A [Rhodospirillum rubrum ATCC 11170] >gb|ABC22544.1| DNA gyrase subunit A [Rhodospirillum rubrum ATCC 11170]
	181 	181 	96% 	1e-43	Gene info linked to YP_426831.1
ZP_04645816.1 	
DNA gyrase, A subunit [Lactobacillus jensenii 269-3] >ref|ZP_05866064.1| DNA gyrase, A subunit [Lactobacillus jensenii SJ-7A-US] >ref|ZP_06337036.1| DNA gyrase, A subunit [Lactobacillus jensenii 208-1] >ref|ZP_07813256.1| DNA gyrase, A subunit [Lactobacillus jensenii 1153] >gb|EEQ24209.1| DNA gyrase, A subunit [Lactobacillus jensenii 269-3] >gb|EEX26927.1| DNA gyrase, A subunit [Lactobacillus jensenii SJ-7A-US] >gb|EFA96447.1| DNA gyrase, A subunit [Lactobacillus jensenii 208-1] >gb|EFR61216.1| DNA gyrase, A subunit [Lactobacillus jensenii 1153]
	181 	181 	88% 	2e-43	
ZP_07746429.1 	
DNA gyrase subunit A [Mucilaginibacter paludis DSM 18603] >gb|EFQ77713.1| DNA gyrase subunit A [Mucilaginibacter paludis DSM 18603]
	181 	181 	86% 	2e-43	
ZP_07365383.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Prevotella marshii DSM 16973] >gb|EFM02174.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Prevotella marshii DSM 16973]
	181 	181 	82% 	2e-43	
ZP_01048922.1 	
DNA gyrase subunit A [Dokdonia donghaensis MED134] >gb|EAQ40156.1| DNA gyrase subunit A [Dokdonia donghaensis MED134]
	181 	181 	96% 	2e-43	
YP_004165703.1 	
DNA gyrase subunit a [Cellulophaga algicola DSM 14237] >gb|ADV50205.1| DNA gyrase subunit A [Cellulophaga algicola DSM 14237]
	181 	181 	96% 	2e-43	Gene info linked to YP_004165703.1
YP_001602567.1 	
DNA gyrase subunit A [Gluconacetobacter diazotrophicus PAl 5] >ref|YP_002274949.1| DNA gyrase subunit A [Gluconacetobacter diazotrophicus PAl 5] >emb|CAP56266.1| putative DNA gyrase subunit A [Gluconacetobacter diazotrophicus PAl 5] >gb|ACI50334.1| DNA gyrase, A subunit [Gluconacetobacter diazotrophicus PAl 5]
	181 	181 	83% 	2e-43	Gene info linked to YP_001602567.1
YP_001256702.1 	
DNA gyrase subunit A [Mycoplasma agalactiae PG2] >emb|CAL59263.1| DNA gyrase subunit A [Mycoplasma agalactiae PG2]
	181 	181 	88% 	2e-43	Gene info linked to YP_001256702.1
YP_004224347.1 	
type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Microbacterium testaceum StLB037] >dbj|BAJ74467.1| type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Microbacterium testaceum StLB037]
	181 	181 	84% 	2e-43	Gene info linked to YP_004224347.1
ZP_05077534.1 	
DNA gyrase, A subunit [Rhodobacterales bacterium Y4I] >gb|EDZ45513.1| DNA gyrase, A subunit [Rhodobacterales bacterium Y4I]
	181 	181 	84% 	2e-43	
ZP_05791510.1 	
DNA gyrase, A subunit [Butyrivibrio crossotus DSM 2876] >gb|EFF69125.1| DNA gyrase, A subunit [Butyrivibrio crossotus DSM 2876]
	181 	181 	96% 	2e-43	
NP_771336.2 	
DNA gyrase subunit A [Bradyrhizobium japonicum USDA 110]
	181 	181 	85% 	2e-43	Gene info linked to NP_771336.2
BAC49961.1 	
DNA gyrase subunit A [Bradyrhizobium japonicum USDA 110]
	180 	180 	85% 	2e-43	Gene info linked to BAC49961.1
ZP_07737843.1 	
DNA topoisomerase (ATP-hydrolyzing) [Caldicellulosiruptor lactoaceticus 6A] >gb|EFR11708.1| DNA topoisomerase (ATP-hydrolyzing) [Caldicellulosiruptor lactoaceticus 6A]
	180 	180 	70% 	2e-43	
YP_003292223.1 	
DNA gyrase, subunit A [Lactobacillus johnsonii FI9785] >emb|CAX65956.1| DNA gyrase, subunit A [Lactobacillus johnsonii FI9785]
	180 	180 	88% 	2e-43	Gene info linked to YP_003292223.1
CAM76808.1 	
DNA gyrase, subunit A [Magnetospirillum gryphiswaldense MSR-1]
	180 	180 	94% 	2e-43	
YP_003515787.1 	
DNA gyrase subunit A [Mycoplasma agalactiae] >emb|CBH40833.1| DNA gyrase subunit A [Mycoplasma agalactiae]
	180 	180 	88% 	2e-43	Gene info linked to YP_003515787.1
XP_002271674.1 	
PREDICTED: similar to DNA gyrase subunit A, chloroplastic/mitochondrial [Vitis vinifera]
	180 	180 	94% 	2e-43	UniGene info linked to XP_002271674.1Gene info linked to XP_002271674.1Genome view with mapviewer linked to XP_002271674.1
YP_421744.1 	
Type IIA topoisomerase, A subunit [Magnetospirillum magneticum AMB-1] >dbj|BAE51185.1| Type IIA topoisomerase , A subunit [Magnetospirillum magneticum AMB-1]
	180 	180 	94% 	2e-43	Gene info linked to YP_421744.1
ZP_04546994.1 	
subunit A [Bacteroides sp. D1] >ref|ZP_06084659.1| DNA gyrase, A subunit [Bacteroides sp. 2_1_22] >ref|ZP_06722942.1| DNA gyrase, A subunit [Bacteroides ovatus SD CC 2a] >ref|ZP_06764945.1| DNA gyrase, A subunit [Bacteroides xylanisolvens SD CC 1b] >ref|ZP_07002353.1| DNA gyrase, A subunit [Bacteroides sp. D22] >gb|EEO49951.1| subunit A [Bacteroides sp. D1] >gb|EEZ04011.1| DNA gyrase, A subunit [Bacteroides sp. 2_1_22] >gb|EFF57735.1| DNA gyrase, A subunit [Bacteroides ovatus SD CC 2a] >gb|EFG15321.1| DNA gyrase, A subunit [Bacteroides xylanisolvens SD CC 1b] >gb|EFI11286.1| DNA gyrase, A subunit [Bacteroides sp. D22]
	180 	180 	83% 	2e-43	
YP_813861.1 	
DNA gyrase, A subunit [Lactobacillus gasseri ATCC 33323] >ref|ZP_04643724.1| DNA gyrase, A subunit [Lactobacillus gasseri 202-4] >gb|ABJ59423.1| DNA gyrase subunit A [Lactobacillus gasseri ATCC 33323] >gb|EEQ26289.1| DNA gyrase, A subunit [Lactobacillus gasseri 202-4]
	180 	180 	88% 	2e-43	Gene info linked to YP_813861.1
YP_757103.1 	
DNA gyrase subunit A [Maricaulis maris MCS10] >gb|ABI66165.1| DNA gyrase subunit A [Maricaulis maris MCS10]
	180 	180 	86% 	2e-43	Gene info linked to YP_757103.1
ZP_00208476.1 	
COG0188: Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Magnetospirillum magnetotacticum MS-1]
	180 	180 	94% 	2e-43	
YP_003085443.1 	
DNA gyrase, A subunit [Dyadobacter fermentans DSM 18053] >gb|ACT92278.1| DNA gyrase, A subunit [Dyadobacter fermentans DSM 18053]
	180 	180 	96% 	2e-43	Gene info linked to YP_003085443.1
YP_502514.1 	
DNA gyrase, A subunit [Methanospirillum hungatei JF-1] >gb|ABD40795.1| DNA gyrase subunit A [Methanospirillum hungatei JF-1]
	180 	180 	96% 	2e-43	Gene info linked to YP_502514.1
ZP_07686489.1 	
DNA gyrase, A subunit [Oscillochloris trichoides DG6] >gb|EFO79755.1| DNA gyrase, A subunit [Oscillochloris trichoides DG6]
	180 	180 	88% 	2e-43	
XP_002979914.1 	
hypothetical protein SELMODRAFT_111960 [Selaginella moellendorffii] >gb|EFJ18784.1| hypothetical protein SELMODRAFT_111960 [Selaginella moellendorffii]
	180 	180 	82% 	2e-43	UniGene info linked to XP_002979914.1Gene info linked to XP_002979914.1
ACJ67502.1 	
DNA gyrase subunit A [Bacillus subtilis]
	180 	180 	70% 	2e-43	
ZP_04969731.1 	
DNA topoisomerase (ATP-hydrolyzing) [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] >gb|EDK87815.1| DNA topoisomerase (ATP-hydrolyzing) [Fusobacterium nucleatum subsp. polymorphum ATCC 10953]
	180 	180 	81% 	3e-43	
ZP_07894030.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Campylobacter upsaliensis JV21] >gb|EFU71708.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Campylobacter upsaliensis JV21]
	180 	180 	82% 	3e-43	
CBI29133.3 	
unnamed protein product [Vitis vinifera]
	180 	180 	94% 	3e-43	
YP_024193.1 	
DNA gyrase subunit A [Picrophilus torridus DSM 9790] >gb|AAT44000.1| DNA gyrase subunit A [Picrophilus torridus DSM 9790]
	180 	180 	83% 	3e-43	Gene info linked to YP_024193.1
ZP_07058849.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus gasseri JV-V03] >gb|EFJ69536.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus gasseri JV-V03]
	180 	180 	88% 	3e-43	
ADI08509.1 	
DNA gyrase subunit A [Streptomyces bingchenggensis BCW-1]
	180 	180 	85% 	3e-43	
ZP_04750756.1 	
DNA gyrase subunit A [Mycobacterium kansasii ATCC 12478]
	180 	180 	88% 	3e-43	
YP_002502765.1 	
putative DNA gyrase subunit A [Mycobacterium leprae Br4923] >emb|CAR70099.1| putative DNA gyrase subunit A [Mycobacterium leprae Br4923]
	180 	180 	88% 	3e-43	Gene info linked to YP_002502765.1
YP_752736.1 	
DNA gyrase, A subunit [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gb|ABI67365.1| DNA gyrase subunit A [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
	180 	180 	82% 	3e-43	Gene info linked to YP_752736.1
EES52258.1 	
DNA gyrase, A subunit [Leptospirillum ferrodiazotrophum]
	180 	180 	83% 	3e-43	
YP_577038.1 	
DNA gyrase subunit A [Nitrobacter hamburgensis X14] >gb|ABE62578.1| DNA gyrase subunit A [Nitrobacter hamburgensis X14]
	180 	180 	96% 	3e-43	Gene info linked to YP_577038.1
YP_002429662.1 	
DNA gyrase, A subunit [Desulfatibacillum alkenivorans AK-01] >gb|ACL02194.1| DNA gyrase, A subunit [Desulfatibacillum alkenivorans AK-01]
	179 	179 	86% 	3e-43	Gene info linked to YP_002429662.1
NP_301134.1 	
putative DNA gyrase subunit A [Mycobacterium leprae TN] >emb|CAC29514.1| putative DNA gyrase subunit A [Mycobacterium leprae]
	179 	179 	88% 	3e-43	Gene info linked to NP_301134.1
XP_002186250.1 	
predicted protein [Phaeodactylum tricornutum CCAP 1055/1] >gb|ACI65720.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
	179 	179 	95% 	3e-43	UniGene info linked to XP_002186250.1Gene info linked to XP_002186250.1
YP_001528560.1 	
DNA gyrase, A subunit [Desulfococcus oleovorans Hxd3] >gb|ABW66483.1| DNA gyrase, A subunit [Desulfococcus oleovorans Hxd3]
	179 	179 	83% 	3e-43	Gene info linked to YP_001528560.1
ZP_05852009.1 	
DNA gyrase, A subunit [Granulicatella elegans ATCC 700633] >gb|EEW92849.1| DNA gyrase, A subunit [Granulicatella elegans ATCC 700633]
	179 	179 	90% 	3e-43	
YP_135191.1 	
DNA gyrase subunit A [Haloarcula marismortui ATCC 43049] >gb|AAV45485.1| DNA gyrase subunit A [Haloarcula marismortui ATCC 43049]
	179 	179 	88% 	3e-43	Gene info linked to YP_135191.1
YP_003983788.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Rothia dentocariosa ATCC 17931] >gb|ADP40354.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Rothia dentocariosa ATCC 17931]
	179 	179 	84% 	4e-43	Gene info linked to YP_003983788.1
ZP_03658351.1 	
DNA gyrase subunit A [Helicobacter cinaedi CCUG 18818] >ref|ZP_07806036.1| DNA gyrase [Helicobacter cinaedi CCUG 18818] >gb|EFR46491.1| DNA gyrase [Helicobacter cinaedi CCUG 18818]
	179 	179 	97% 	4e-43	
YP_001950285.1 	
DNA gyrase, A subunit [Geobacter lovleyi SZ] >gb|ACD93765.1| DNA gyrase, A subunit [Geobacter lovleyi SZ]
	179 	179 	85% 	4e-43	Gene info linked to YP_001950285.1
CBK65717.1 	
DNA gyrase subunit A [Bacteroides xylanisolvens XB1A]
	179 	179 	83% 	4e-43	
CAA92430.1 	
DNA gyrase A subunit [Mycobacterium leprae] >emb|CAA94713.1| DNA gyrase A, and intein [Mycobacterium leprae]
	179 	179 	88% 	4e-43	
Q57532.2 	
RecName: Full=DNA gyrase subunit A; Contains: RecName: Full=Mle gyrA intein
	179 	179 	88% 	4e-43	
ZP_01047479.1 	
DNA gyrase subunit A [Nitrobacter sp. Nb-311A] >gb|EAQ34584.1| DNA gyrase subunit A [Nitrobacter sp. Nb-311A]
	179 	179 	96% 	4e-43	
ZP_06609063.1 	
DNA gyrase, A subunit [Actinomyces odontolyticus F0309] >gb|EFF79672.1| DNA gyrase, A subunit [Actinomyces odontolyticus F0309]
	179 	179 	83% 	4e-43	
YP_003361658.1 	
type IIA topoisomerase, A subunit [Rothia mucilaginosa DY-18] >dbj|BAI63838.1| type IIA topoisomerase, A subunit [Rothia mucilaginosa DY-18]
	179 	179 	84% 	4e-43	Gene info linked to YP_003361658.1
YP_950864.1 	
DNA gyrase, A subunit [Mycobacterium vanbaalenii PYR-1] >gb|ABM10858.1| DNA gyrase subunit A [Mycobacterium vanbaalenii PYR-1]
	179 	179 	88% 	4e-43	Gene info linked to YP_950864.1
ZP_07038685.1 	
DNA gyrase, A subunit [Bacteroides sp. 3_1_23] >gb|EFI39989.1| DNA gyrase, A subunit [Bacteroides sp. 3_1_23]
	179 	179 	83% 	4e-43	
ZP_05367558.1 	
DNA gyrase, A subunit [Rothia mucilaginosa ATCC 25296] >gb|EET75851.1| DNA gyrase, A subunit [Rothia mucilaginosa ATCC 25296]
	179 	179 	84% 	4e-43	
XP_002315402.1 	
predicted protein [Populus trichocarpa] >gb|EEF01573.1| predicted protein [Populus trichocarpa]
	179 	179 	94% 	4e-43	UniGene info linked to XP_002315402.1Gene info linked to XP_002315402.1
ZP_02063764.1 	
hypothetical protein BACOVA_00722 [Bacteroides ovatus ATCC 8483] >ref|ZP_04551149.1| DNA gyrase subunit A [Bacteroides sp. 2_2_4] >ref|ZP_06616022.1| DNA gyrase, A subunit [Bacteroides ovatus SD CMC 3f] >gb|EDO13530.1| hypothetical protein BACOVA_00722 [Bacteroides ovatus ATCC 8483] >gb|EEO55294.1| DNA gyrase subunit A [Bacteroides sp. 2_2_4] >gb|EFF53986.1| DNA gyrase, A subunit [Bacteroides ovatus SD CMC 3f]
	179 	179 	83% 	5e-43	
NP_077912.1 	
DNA gyrase subunit A [Ureaplasma parvum serovar 3 str. ATCC 700970] >ref|YP_001752161.1| DNA gyrase subunit A [Ureaplasma parvum serovar 3 str. ATCC 27815] >ref|ZP_02931663.1| DNA gyrase, A subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >ref|ZP_02958161.1| DNA gyrase, A subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >ref|ZP_02971542.1| DNA gyrase, A subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] >sp|Q9PR63.1|GYRA_UREPA RecName: Full=DNA gyrase subunit A >pir||F82937 DNA topoisomerase chain A, DNA gyrase A subunit UU082 [imported] - Ureaplasma urealyticum >gb|AAF30487.1|AE002107_11 DNA topoisomerase chain A - DNA gyrase A subunit [Ureaplasma parvum serovar 3 str. ATCC 700970] >gb|ACA32732.1| DNA gyrase, A subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gb|EDT49026.1| DNA gyrase, A subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gb|EDT88040.1| DNA gyrase, A subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gb|EDU19474.1| DNA gyrase, A subunit [Ureaplasma parvum serovar 6 str. ATCC 27818]
	179 	179 	95% 	5e-43	GEO profiles info linked to NP_077912.1Gene info linked to NP_077912.1
ZP_05756643.1 	
DNA gyrase subunit A [Bacteroides sp. D2] >ref|ZP_07914834.1| conserved hypothetical protein [Bacteroides sp. D2] >gb|EFS29304.1| conserved hypothetical protein [Bacteroides sp. D2]
	179 	179 	83% 	5e-43	
YP_004172987.1 	
DNA gyrase subunit A [Anaerolinea thermophila UNI-1] >dbj|BAJ62387.1| DNA gyrase subunit A [Anaerolinea thermophila UNI-1]
	179 	179 	87% 	5e-43	Gene info linked to YP_004172987.1
YP_003473041.1 	
DNA topoisomerase (ATP-hydrolyzing) [Thermocrinis albus DSM 14484] >gb|ADC88914.1| DNA topoisomerase (ATP-hydrolyzing) [Thermocrinis albus DSM 14484]
	179 	179 	86% 	5e-43	Gene info linked to YP_003473041.1
ZP_04845682.1 	
conserved hypothetical protein [Bacteroides sp. 1_1_6] >gb|EES70424.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
	179 	179 	83% 	5e-43	
ZP_06995222.1 	
DNA gyrase, A subunit [Bacteroides sp. 1_1_14] >gb|EFI04671.1| DNA gyrase, A subunit [Bacteroides sp. 1_1_14]
	179 	179 	83% 	6e-43	
AAN87428.1 	
DNA gyrase subunit A [Heliobacillus mobilis]
	179 	179 	96% 	6e-43	
NP_809812.1 	
DNA gyrase subunit A [Bacteroides thetaiotaomicron VPI-5482] >gb|AAO76006.1| DNA gyrase subunit A [Bacteroides thetaiotaomicron VPI-5482]
	179 	179 	83% 	6e-43	Gene info linked to NP_809812.1
ZP_08076317.1 	
DNA gyrase, A subunit [Phascolarctobacterium sp. YIT 12067] >gb|EFY04912.1| DNA gyrase, A subunit [Phascolarctobacterium sp. YIT 12067]
	179 	179 	96% 	6e-43	
ZP_06261663.1 	
DNA gyrase, A subunit [Lactobacillus gasseri 224-1] >gb|EFB61683.1| DNA gyrase, A subunit [Lactobacillus gasseri 224-1]
	179 	179 	88% 	6e-43	
ZP_03702404.1 	
DNA gyrase, A subunit [Flavobacteria bacterium MS024-2A] >gb|EEG42441.1| DNA gyrase, A subunit [Flavobacteria bacterium MS024-2A]
	179 	179 	82% 	6e-43	
ZP_03928920.1 	
type IIA topoisomerase [Acidaminococcus sp. D21] >gb|EEH90150.1| type IIA topoisomerase [Acidaminococcus sp. D21]
	179 	179 	96% 	6e-43	
ZP_07072672.1 	
DNA gyrase, A subunit [Rothia dentocariosa M567] >gb|EFJ78398.1| DNA gyrase, A subunit [Rothia dentocariosa M567]
	179 	179 	84% 	6e-43	
ZP_07322667.1 	
DNA gyrase, A subunit [Prevotella disiens FB035-09AN] >gb|EFL46929.1| DNA gyrase, A subunit [Prevotella disiens FB035-09AN]
	179 	179 	83% 	6e-43	
YP_002463646.1 	
DNA gyrase subunit A [Chloroflexus aggregans DSM 9485] >gb|ACL25210.1| DNA gyrase, A subunit [Chloroflexus aggregans DSM 9485]
	179 	179 	95% 	7e-43	Gene info linked to YP_002463646.1
YP_004030804.1 	
DNA gyrase, A subunit [Lactobacillus amylovorus GRL 1112] >gb|ADQ58009.1| DNA gyrase, A subunit [Lactobacillus amylovorus GRL 1112]
	179 	179 	88% 	7e-43	Gene info linked to YP_004030804.1
ZP_02693364.1 	
DNA gyrase subunit A [Epulopiscium sp. 'N.t. morphotype B']
	179 	179 	82% 	7e-43	
ZP_02043889.1 	
hypothetical protein ACTODO_00741 [Actinomyces odontolyticus ATCC 17982] >gb|EDN80301.1| hypothetical protein ACTODO_00741 [Actinomyces odontolyticus ATCC 17982]
	178 	178 	83% 	7e-43	
YP_003110803.1 	
DNA gyrase, A subunit [Catenulispora acidiphila DSM 44928] >gb|ACU68962.1| DNA gyrase, A subunit [Catenulispora acidiphila DSM 44928]
	178 	178 	85% 	7e-43	Gene info linked to YP_003110803.1
YP_001614364.1 	
DNA gyrase subunit A [Sorangium cellulosum 'So ce 56'] >emb|CAN93884.1| DNA gyrase subunit A [Sorangium cellulosum 'So ce 56']
	178 	178 	82% 	8e-43	Gene info linked to YP_001614364.1
ZP_05787544.1 	
DNA gyrase, A subunit [Silicibacter lacuscaerulensis ITI-1157] >gb|EEX10660.1| DNA gyrase, A subunit [Silicibacter lacuscaerulensis ITI-1157]
	178 	178 	84% 	8e-43	
ZP_05427709.1 	
DNA gyrase, A subunit [Eubacterium saphenum ATCC 49989] >gb|EEU03376.1| DNA gyrase, A subunit [Eubacterium saphenum ATCC 49989]
	178 	178 	96% 	8e-43	
ZP_06808179.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Aerococcus viridans ATCC 11563] >gb|EFG49427.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Aerococcus viridans ATCC 11563]
	178 	178 	100% 	8e-43	
ZP_06405548.1 	
DNA gyrase, A subunit [Prevotella sp. oral taxon 299 str. F0039] >gb|EFC71816.1| DNA gyrase, A subunit [Prevotella sp. oral taxon 299 str. F0039]
	178 	178 	83% 	8e-43	
ZP_05225903.1 	
DNA gyrase, A subunit [Mycobacterium intracellulare ATCC 13950]
	178 	178 	88% 	9e-43	
YP_266397.1 	
DNA gyrase subunit A [Candidatus Pelagibacter ubique HTCC1062] >gb|AAZ21793.1| DNA gyrase subunit A [Candidatus Pelagibacter ubique HTCC1062]
	178 	178 	83% 	9e-43	Gene info linked to YP_266397.1
YP_003508823.1 	
DNA gyrase subunit A [Stackebrandtia nassauensis DSM 44728] >gb|ADD39730.1| DNA gyrase, A subunit [Stackebrandtia nassauensis DSM 44728]
	178 	178 	85% 	9e-43	Gene info linked to YP_003508823.1
ZP_01265246.1 	
DNA gyrase subunit A [Candidatus Pelagibacter ubique HTCC1002] >gb|EAS84346.1| DNA gyrase subunit A [Candidatus Pelagibacter ubique HTCC1002]
	178 	178 	83% 	9e-43	
ZP_01056894.1 	
DNA gyrase subunit A [Roseobacter sp. MED193] >gb|EAQ45046.1| DNA gyrase subunit A [Roseobacter sp. MED193]
	178 	178 	84% 	9e-43	
ZP_03207139.1 	
hypothetical protein BACPLE_00759 [Bacteroides plebeius DSM 17135] >gb|EDY96323.1| hypothetical protein BACPLE_00759 [Bacteroides plebeius DSM 17135]
	178 	178 	83% 	1e-42	
ZP_07705176.1 	
DNA gyrase, A subunit [Dermacoccus sp. Ellin185] >gb|EFP58541.1| DNA gyrase, A subunit [Dermacoccus sp. Ellin185]
	178 	178 	85% 	1e-42	
YP_003403823.1 	
DNA gyrase, A subunit [Haloterrigena turkmenica DSM 5511] >gb|ADB61150.1| DNA gyrase, A subunit [Haloterrigena turkmenica DSM 5511]
	178 	178 	88% 	1e-42	Gene info linked to YP_003403823.1
YP_003516867.1 	
DNA gyrase subunit A [Helicobacter mustelae 12198] >emb|CBG40138.1| DNA gyrase subunit A [Helicobacter mustelae 12198]
	178 	178 	88% 	1e-42	Gene info linked to YP_003516867.1
YP_003256919.1 	
DNA gyrase A subunit [Blattabacterium sp. (Periplaneta americana) str. BPLAN] >gb|ACX83776.1| DNA gyrase A subunit [Blattabacterium sp. (Periplaneta americana) str. BPLAN]
	178 	178 	82% 	1e-42	Gene info linked to YP_003256919.1
YP_003324606.1 	
DNA gyrase subunit A [Xylanimonas cellulosilytica DSM 15894] >gb|ACZ29048.1| DNA gyrase, A subunit [Xylanimonas cellulosilytica DSM 15894]
	178 	178 	83% 	1e-42	Gene info linked to YP_003324606.1
ZP_06288288.1 	
DNA gyrase, A subunit [Prevotella timonensis CRIS 5C-B1] >gb|EFA98534.1| DNA gyrase, A subunit [Prevotella timonensis CRIS 5C-B1]
	177 	177 	83% 	1e-42	
AAC16230.1 	
DNA gyrase subunit a [Rhodobacter capsulatus SB 1003]
	177 	177 	84% 	1e-42	
EGB08052.1 	
hypothetical protein AURANDRAFT_53761 [Aureococcus anophagefferens]
	177 	177 	86% 	1e-42	
ZP_02143807.1 	
DNA gyrase, A subunit [Phaeobacter gallaeciensis BS107] >gb|EDQ14608.1| DNA gyrase, A subunit [Phaeobacter gallaeciensis BS107]
	177 	177 	84% 	1e-42	
ZP_02153623.1 	
DNA gyrase, A subunit [Oceanibulbus indolifex HEL-45] >gb|EDQ04561.1| DNA gyrase, A subunit [Oceanibulbus indolifex HEL-45]
	177 	177 	87% 	1e-42	
ZP_05626331.1 	
DNA gyrase, A subunit [Campylobacter gracilis RM3268] >gb|EEV16408.1| DNA gyrase, A subunit [Campylobacter gracilis RM3268]
	177 	177 	81% 	1e-42	
ZP_02148469.1 	
DNA gyrase subunit A [Phaeobacter gallaeciensis 2.10] >gb|EDQ09807.1| DNA gyrase subunit A [Phaeobacter gallaeciensis 2.10]
	177 	177 	84% 	1e-42	
ABH03380.1 	
DNA gyrase A subunit [Helicobacter pullorum NCTC 12824]
	177 	177 	97% 	1e-42	
ZP_03995606.1 	
DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus crispatus JV-V01] >ref|ZP_05549313.1| DNA gyrase, A subunit [Lactobacillus crispatus 125-2-CHN] >ref|ZP_05555051.1| DNA gyrase, subunit A [Lactobacillus crispatus MV-1A-US] >ref|ZP_06019250.1| DNA gyrase, A subunit [Lactobacillus crispatus MV-3A-US] >ref|ZP_06626932.1| DNA gyrase, A subunit [Lactobacillus crispatus 214-1] >gb|EEJ70304.1| DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus crispatus JV-V01] >gb|EEU18933.1| DNA gyrase, A subunit [Lactobacillus crispatus 125-2-CHN] >gb|EEU28724.1| DNA gyrase, subunit A [Lactobacillus crispatus MV-1A-US] >gb|EEX30174.1| DNA gyrase, A subunit [Lactobacillus crispatus MV-3A-US] >gb|EFD99535.1| DNA gyrase, A subunit [Lactobacillus crispatus 214-1]
	177 	177 	88% 	1e-42	
ZP_03803365.1 	
hypothetical protein PROPEN_01728 [Proteus penneri ATCC 35198] >gb|EEG85905.1| hypothetical protein PROPEN_01728 [Proteus penneri ATCC 35198]
	177 	177 	85% 	1e-42	
ZP_04809926.1 	
DNA gyrase subunit A [Helicobacter pullorum MIT 98-5489] >gb|EEQ63035.1| DNA gyrase subunit A [Helicobacter pullorum MIT 98-5489]
	177 	177 	97% 	1e-42	
ZP_08026825.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Actinomyces sp. oral taxon 178 str. F0338] >gb|EFW09617.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Actinomyces sp. oral taxon 178 str. F0338]
	177 	177 	83% 	1e-42	
YP_003178543.1 	
DNA gyrase, A subunit [Halomicrobium mukohataei DSM 12286] >gb|ACV48836.1| DNA gyrase, A subunit [Halomicrobium mukohataei DSM 12286]
	177 	177 	88% 	1e-42	Gene info linked to YP_003178543.1
ZP_01060718.1 	
DNA gyrase A subunit [Leeuwenhoekiella blandensis MED217] >gb|EAQ49417.1| DNA gyrase A subunit [Leeuwenhoekiella blandensis MED217]
	177 	177 	82% 	1e-42	
ZP_05082349.1 	
DNA gyrase, A subunit [beta proteobacterium KB13] >gb|EDZ65036.1| DNA gyrase, A subunit [beta proteobacterium KB13]
	177 	177 	83% 	2e-42	
YP_001620026.1 	
DNA gyrase subunit A [Acholeplasma laidlawii PG-8A] >gb|ABX80650.1| DNA gyrase, subunit A [Acholeplasma laidlawii PG-8A]
	177 	177 	90% 	2e-42	Gene info linked to YP_001620026.1
ZP_01890905.1 	
DNA gyrase A subunit [unidentified eubacterium SCB49] >gb|EDM44116.1| DNA gyrase A subunit [unidentified eubacterium SCB49]
	177 	177 	82% 	2e-42	
YP_001938071.1 	
DNA gyrase subunit A [Orientia tsutsugamushi str. Ikeda] >dbj|BAG40837.1| DNA gyrase subunit A [Orientia tsutsugamushi str. Ikeda]
	177 	177 	82% 	2e-42	Gene info linked to YP_001938071.1
YP_003578116.1 	
DNA gyrase subunit A [Rhodobacter capsulatus SB 1003] >gb|ADE85709.1| DNA gyrase, A subunit [Rhodobacter capsulatus SB 1003]
	177 	177 	84% 	2e-42	Gene info linked to YP_003578116.1
ZP_05124123.1 	
DNA gyrase, A subunit [Rhodobacteraceae bacterium KLH11] >gb|EEE38755.1| DNA gyrase, A subunit [Rhodobacteraceae bacterium KLH11]
	177 	177 	84% 	2e-42	
ZP_06474616.1 	
DNA gyrase, A subunit [Frankia symbiont of Datisca glomerata] >gb|EFD28684.1| DNA gyrase, A subunit [Frankia symbiont of Datisca glomerata]
	177 	177 	83% 	2e-42	
YP_794214.1 	
DNA gyrase, A subunit [Lactobacillus brevis ATCC 367] >gb|ABJ63183.1| DNA gyrase subunit A [Lactobacillus brevis ATCC 367] >dbj|BAH66655.1| DNA gyrase subunit A [Lactobacillus brevis]
	177 	177 	90% 	2e-42	Gene info linked to YP_794214.1
YP_314706.1 	
DNA gyrase subunit A [Thiobacillus denitrificans ATCC 25259] >gb|AAZ96901.1| DNA gyrase, subunit A [Thiobacillus denitrificans ATCC 25259]
	177 	177 	83% 	2e-42	Gene info linked to YP_314706.1
YP_710307.1 	
DNA gyrase subunit A [Frankia alni ACN14a] >emb|CAJ58692.1| DNA gyrase, subunit A, type II topoisomerase [Frankia alni ACN14a]
	177 	177 	85% 	2e-42	Gene info linked to YP_710307.1
ZP_01446446.1 	
DNA gyrase subunit A [alpha proteobacterium HTCC2255] >gb|EAU52618.1| DNA gyrase subunit A [alpha proteobacterium HTCC2255]
	177 	177 	90% 	2e-42	
YP_004090329.1 	
DNA gyrase, A subunit [Ethanoligenens harbinense YUAN-3] >gb|ADU25598.1| DNA gyrase, A subunit [Ethanoligenens harbinense YUAN-3]
	177 	177 	82% 	2e-42	Gene info linked to YP_004090329.1
ZP_06622646.1 	
DNA gyrase, A subunit [Turicibacter sanguinis PC909] >gb|EFF63044.1| DNA gyrase, A subunit [Turicibacter sanguinis PC909]
	177 	177 	90% 	2e-42	
ZP_08071387.1 	
DNA gyrase, A subunit [Methylocystis sp. ATCC 49242] >gb|EFY00899.1| DNA gyrase, A subunit [Methylocystis sp. ATCC 49242]
	177 	177 	96% 	2e-42	
YP_001275095.1 	
DNA gyrase subunit A [Roseiflexus sp. RS-1] >gb|ABQ89145.1| DNA gyrase subunit A [Roseiflexus sp. RS-1]
	177 	177 	88% 	2e-42	Gene info linked to YP_001275095.1
ZP_07373715.1 	
DNA gyrase, A subunit [Ahrensia sp. R2A130] >gb|EFL90360.1| DNA gyrase, A subunit [Ahrensia sp. R2A130]
	177 	177 	88% 	2e-42	
YP_446304.1 	
DNA gyrase, A subunit [Salinibacter ruber DSM 13855] >gb|ABC43595.1| DNA gyrase, A subunit [Salinibacter ruber DSM 13855]
	177 	177 	82% 	2e-42	Gene info linked to YP_446304.1
YP_001220746.1 	
DNA gyrase subunit A [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >emb|CAN00012.1| DNA gyrase subunit A [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
	177 	177 	96% 	2e-42	Gene info linked to YP_001220746.1
ZP_04694601.1 	
DNA gyrase subunit A [Streptomyces roseosporus NRRL 15998] >ref|ZP_04709787.1| DNA gyrase subunit A [Streptomyces roseosporus NRRL 11379] >ref|ZP_06585515.1| DNA gyrase subunit A [Streptomyces roseosporus NRRL 15998] >gb|EFE75976.1| DNA gyrase subunit A [Streptomyces roseosporus NRRL 15998]
	177 	177 	85% 	2e-42	
YP_003600478.1 	
DNA gyrase, a subunit [Lactobacillus crispatus ST1] >emb|CBL49453.1| DNA gyrase, A subunit [Lactobacillus crispatus ST1]
	177 	177 	88% 	2e-42	Gene info linked to YP_003600478.1
YP_001029856.1 	
DNA gyrase subunit A [Methanocorpusculum labreanum Z] >gb|ABN06589.1| DNA gyrase subunit A [Methanocorpusculum labreanum Z]
	177 	177 	84% 	2e-42	Gene info linked to YP_001029856.1
ZP_05734738.1 	
DNA gyrase, A subunit [Prevotella tannerae ATCC 51259] >gb|EEX72789.1| DNA gyrase, A subunit [Prevotella tannerae ATCC 51259]
	177 	177 	82% 	2e-42	
ZP_03963549.1 	
DNA gyrase, A subunit [Lactobacillus paracasei subsp. paracasei ATCC 25302] >gb|EEI68896.1| DNA gyrase, A subunit [Lactobacillus paracasei subsp. paracasei ATCC 25302]
	176 	176 	90% 	3e-42	
ZP_05058196.1 	
DNA gyrase, A subunit [Verrucomicrobiae bacterium DG1235] >gb|EDY83336.1| DNA gyrase, A subunit [Verrucomicrobiae bacterium DG1235]
	176 	176 	83% 	3e-42	
YP_003880542.1 	
DNA gyrase A subunit [Candidatus Sulcia muelleri CARI] >gb|ADM89844.1| DNA gyrase A subunit [Candidatus Sulcia muelleri CARI]
	176 	176 	96% 	3e-42	Gene info linked to YP_003880542.1
ZP_04673841.1 	
DNA gyrase subunit A [Lactobacillus paracasei subsp. paracasei 8700:2] >ref|YP_003787156.1| DNA gyrase subunit A [Lactobacillus casei str. Zhang] >gb|EEQ66094.1| DNA gyrase subunit A [Lactobacillus paracasei subsp. paracasei 8700:2] >gb|ADK17306.1| DNA gyrase, A subunit [Lactobacillus casei str. Zhang]
	176 	176 	90% 	3e-42	
YP_001985996.1 	
DNA gyrase, A subunit [Lactobacillus casei BL23] >emb|CAQ65138.1| DNA gyrase, A subunit [Lactobacillus casei BL23]
	176 	176 	90% 	3e-42	Gene info linked to YP_001985996.1
YP_001248224.1 	
DNA gyrase subunit A [Orientia tsutsugamushi str. Boryong] >emb|CAM79318.1| DNA gyrase subunit A protein [Orientia tsutsugamushi str. Boryong]
	176 	176 	82% 	3e-42	Gene info linked to YP_001248224.1
ZP_07061406.1 	
DNA gyrase, A subunit [Prevotella bryantii B14] >gb|EFI71336.1| DNA gyrase, A subunit [Prevotella bryantii B14]
	176 	176 	82% 	3e-42	
YP_003572298.1 	
DNA gyrase subunit A [Salinibacter ruber M8] >emb|CBH25346.1| DNA gyrase subunit A [Salinibacter ruber M8]
	176 	176 	82% 	3e-42	Gene info linked to YP_003572298.1
ZP_01552096.1 	
DNA gyrase subunit A [Methylophilales bacterium HTCC2181] >gb|EAV47154.1| DNA gyrase subunit A [Methylophilales bacterium HTCC2181]
	176 	176 	83% 	3e-42	
ZP_07847306.1 	
DNA gyrase, A subunit [Enterococcus faecium TX0133a04] >ref|ZP_07849847.1| DNA gyrase, A subunit [Enterococcus faecium TX0133C] >ref|ZP_07856343.1| DNA gyrase, A subunit [Enterococcus faecium TX0133A] >ref|ZP_07859172.1| DNA gyrase, A subunit [Enterococcus faecium TX0133B] >ref|ZP_07863021.1| DNA gyrase, A subunit [Enterococcus faecium TX0133a01] >gb|EFR66696.1| DNA gyrase, A subunit [Enterococcus faecium TX0133a01] >gb|EFR70572.1| DNA gyrase, A subunit [Enterococcus faecium TX0133B] >gb|EFR73373.1| DNA gyrase, A subunit [Enterococcus faecium TX0133A] >gb|EFR77088.1| DNA gyrase, A subunit [Enterococcus faecium TX0133C] >gb|EFS05211.1| DNA gyrase, A subunit [Enterococcus faecium TX0133a04]
	176 	176 	83% 	3e-42	
ZP_05660970.1 	
DNA gyrase subunit A [Enterococcus faecium 1,231,502] >ref|ZP_05672762.1| DNA gyrase subunit A [Enterococcus faecium 1,231,408] >ref|ZP_06702592.1| DNA gyrase, A subunit [Enterococcus faecium U0317] >gb|EEV44303.1| DNA gyrase subunit A [Enterococcus faecium 1,231,502] >gb|EEV56095.1| DNA gyrase subunit A [Enterococcus faecium 1,231,408] >gb|EFF27941.1| DNA gyrase, A subunit [Enterococcus faecium U0317]
	176 	176 	83% 	3e-42	
YP_004079715.1 	
DNA gyrase, a subunit [Micromonospora sp. L5] >gb|ADU05564.1| DNA gyrase, A subunit [Micromonospora sp. L5]
	176 	176 	83% 	3e-42	Gene info linked to YP_004079715.1
ZP_06341552.1 	
DNA gyrase, A subunit [Bulleidia extructa W1219] >gb|EFC06404.1| DNA gyrase, A subunit [Bulleidia extructa W1219]
	176 	176 	94% 	3e-42	
ZP_02931894.1 	
DNA gyrase, A subunit [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >ref|YP_002284501.1| DNA gyrase subunit A [Ureaplasma urealyticum serovar 10 str. ATCC 33699] >ref|ZP_03771864.1| DNA gyrase, A subunit [Ureaplasma urealyticum serovar 2 str. ATCC 27814] >gb|EDT49684.1| DNA gyrase, A subunit [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gb|ACI60302.1| DNA gyrase, A subunit [Ureaplasma urealyticum serovar 10 str. ATCC 33699] >gb|EEH02431.1| DNA gyrase, A subunit [Ureaplasma urealyticum serovar 2 str. ATCC 27814]
	176 	176 	95% 	3e-42	
ZP_07729411.1 	
DNA gyrase, A subunit [Lactobacillus oris PB013-T2-3] >gb|EFQ53532.1| DNA gyrase, A subunit [Lactobacillus oris PB013-T2-3]
	176 	176 	90% 	3e-42	
ZP_07851557.1 	
DNA gyrase, A subunit [Enterococcus faecium TX0082] >gb|EFS09995.1| DNA gyrase, A subunit [Enterococcus faecium TX0082]
	176 	176 	83% 	3e-42	
ZP_05921611.1 	
DNA gyrase subunit A [Enterococcus faecium TC 6] >ref|ZP_06446925.1| DNA gyrase, A subunit [Enterococcus faecium D344SRF] >ref|ZP_06696425.1| DNA gyrase, A subunit [Enterococcus faecium E1636] >gb|EEW66252.1| DNA gyrase subunit A [Enterococcus faecium TC 6] >gb|EFD09586.1| DNA gyrase, A subunit [Enterococcus faecium D344SRF] >gb|EFF22212.1| DNA gyrase, A subunit [Enterococcus faecium E1636]
	176 	176 	83% 	3e-42	
YP_796581.1 	
DNA gyrase subunit A [Leptospira borgpetersenii serovar Hardjo-bovis L550] >ref|YP_799526.1| DNA gyrase subunit A [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gb|ABJ77648.1| DNA gyrase subunit A [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gb|ABJ74768.1| DNA gyrase subunit A [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
	176 	176 	80% 	3e-42	Gene info linked to YP_796581.1
YP_003142432.1 	
DNA gyrase subunit A [Slackia heliotrinireducens DSM 20476] >gb|ACV21083.1| DNA gyrase subunit A [Slackia heliotrinireducens DSM 20476]
	176 	176 	95% 	3e-42	Gene info linked to YP_003142432.1
YP_004033040.1 	
DNA gyrase subunit a [Lactobacillus delbrueckii subsp. bulgaricus ND02] >gb|ADQ60063.1| DNA gyrase subunit A [Lactobacillus delbrueckii subsp. bulgaricus ND02]
	176 	176 	95% 	3e-42	Gene info linked to YP_004033040.1
ZP_00604079.1 	
DNA gyrase, subunit A [Enterococcus faecium DO] >ref|ZP_05713035.1| DNA gyrase, A subunit [Enterococcus faecium DO] >ref|ZP_06677708.1| DNA gyrase, A subunit [Enterococcus faecium E1162] >ref|ZP_06680460.1| DNA gyrase, A subunit [Enterococcus faecium E1071] >gb|EAN09584.1| DNA gyrase, subunit A [Enterococcus faecium DO] >gb|EFF19965.1| DNA gyrase, A subunit [Enterococcus faecium E1071] >gb|EFF34277.1| DNA gyrase, A subunit [Enterococcus faecium E1162]
	176 	176 	83% 	3e-42	
ZP_06699155.1 	
DNA gyrase, A subunit [Enterococcus faecium E1679] >gb|EFF25489.1| DNA gyrase, A subunit [Enterococcus faecium E1679]
	176 	176 	83% 	4e-42	
ZP_05658304.1 	
DNA gyrase subunit A [Enterococcus faecium 1,230,933] >gb|EEV41637.1| DNA gyrase subunit A [Enterococcus faecium 1,230,933]
	176 	176 	83% 	4e-42	
ZP_05670187.1 	
DNA gyrase subunit A [Enterococcus faecium 1,231,410] >gb|EEV53520.1| DNA gyrase subunit A [Enterococcus faecium 1,231,410]
	176 	176 	83% 	4e-42	
YP_001547386.1 	
DNA gyrase subunit A [Herpetosiphon aurantiacus ATCC 23779] >gb|ABX07258.1| DNA gyrase, A subunit [Herpetosiphon aurantiacus ATCC 23779]
	176 	176 	95% 	4e-42	Gene info linked to YP_001547386.1
ZP_06824683.1 	
DNA gyrase subunit A [Streptomyces sp. SPB74] >gb|EDY46761.1| DNA gyrase subunit A [Streptomyces sp. SPB74]
	176 	176 	83% 	4e-42	
ZP_06411080.1 	
DNA gyrase, A subunit [Frankia sp. EUN1f] >gb|EFC86162.1| DNA gyrase, A subunit [Frankia sp. EUN1f]
	176 	176 	83% 	4e-42	
ZP_05830428.1 	
DNA gyrase subunit A [Enterococcus faecium C68] >gb|EEW63712.1| DNA gyrase subunit A [Enterococcus faecium C68]
	176 	176 	83% 	4e-42	
ZP_05665245.1 	
DNA gyrase subunit A [Enterococcus faecium 1,231,501] >gb|EEV48578.1| DNA gyrase subunit A [Enterococcus faecium 1,231,501]
	176 	176 	83% 	4e-42	
YP_805314.1 	
DNA gyrase, A subunit [Lactobacillus casei ATCC 334] >gb|ABJ68872.1| DNA gyrase subunit A [Lactobacillus casei ATCC 334]
	176 	176 	90% 	4e-42	Gene info linked to YP_805314.1
ZP_07715980.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Aeromicrobium marinum DSM 15272] >gb|EFQ84570.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Aeromicrobium marinum DSM 15272]
	176 	176 	88% 	4e-42	
YP_002362528.1 	
DNA gyrase, A subunit [Methylocella silvestris BL2] >gb|ACK51166.1| DNA gyrase, A subunit [Methylocella silvestris BL2]
	176 	176 	96% 	4e-42	Gene info linked to YP_002362528.1
YP_003432493.1 	
DNA gyrase subunit A [Hydrogenobacter thermophilus TK-6] >dbj|BAI69292.1| DNA gyrase subunit A [Hydrogenobacter thermophilus TK-6] >gb|ADO45229.1| DNA topoisomerase (ATP-hydrolyzing) [Hydrogenobacter thermophilus TK-6]
	176 	176 	81% 	4e-42	Gene info linked to YP_003432493.1
YP_003693603.1 	
DNA gyrase, A subunit [Starkeya novella DSM 506] >gb|ADH88984.1| DNA gyrase, A subunit [Starkeya novella DSM 506]
	176 	176 	96% 	4e-42	Gene info linked to YP_003693603.1
YP_003875450.1 	
DNA gyrase subunit A [Spirochaeta thermophila DSM 6192] >gb|ADN03177.1| DNA gyrase subunit A [Spirochaeta thermophila DSM 6192]
	176 	176 	85% 	4e-42	Gene info linked to YP_003875450.1
YP_001708802.1 	
DNA gyrase subunit A [Clavibacter michiganensis subsp. sepedonicus] >emb|CAQ00134.1| DNA gyrase subunit A [Clavibacter michiganensis subsp. sepedonicus]
	176 	176 	96% 	5e-42	Gene info linked to YP_001708802.1
ZP_05739645.1 	
DNA gyrase, A subunit [Silicibacter sp. TrichCH4B] >gb|EEW58941.1| DNA gyrase, A subunit [Silicibacter sp. TrichCH4B]
	176 	176 	84% 	5e-42	
YP_001928991.1 	
DNA gyrase A subunit [Porphyromonas gingivalis ATCC 33277] >dbj|BAG33394.1| DNA gyrase A subunit [Porphyromonas gingivalis ATCC 33277]
	176 	176 	83% 	5e-42	Gene info linked to YP_001928991.1
YP_116213.1 	
DNA gyrase subunit A [Nocardia farcinica IFM 10152] >dbj|BAD54849.1| putative DNA gyrase A subunit [Nocardia farcinica IFM 10152]
	176 	176 	88% 	5e-42	Gene info linked to YP_116213.1
ZP_07880538.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Actinomyces sp. oral taxon 180 str. F0310] >gb|EFU60848.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Actinomyces sp. oral taxon 180 str. F0310]
	176 	176 	83% 	5e-42	
ZP_05655551.1 	
DNA gyrase subunit A [Enterococcus casseliflavus EC20] >gb|EEV38884.1| DNA gyrase subunit A [Enterococcus casseliflavus EC20]
	176 	176 	83% 	5e-42	
YP_001068311.1 	
DNA gyrase subunit A [Mycobacterium sp. JLS] >gb|ABN95820.1| DNA gyrase subunit A [Mycobacterium sp. JLS]
	176 	176 	88% 	5e-42	Gene info linked to YP_001068311.1
YP_001634859.1 	
DNA gyrase subunit A [Chloroflexus aurantiacus J-10-fl] >ref|YP_002569107.1| DNA gyrase subunit A [Chloroflexus sp. Y-400-fl] >gb|ABY34470.1| DNA gyrase, A subunit [Chloroflexus aurantiacus J-10-fl] >gb|ACM52781.1| DNA gyrase, A subunit [Chloroflexus sp. Y-400-fl]
	176 	176 	95% 	5e-42	Gene info linked to YP_001634859.1
YP_003059807.1 	
DNA gyrase, A subunit [Hirschia baltica ATCC 49814] >gb|ACT59110.1| DNA gyrase, A subunit [Hirschia baltica ATCC 49814]
	176 	176 	83% 	5e-42	Gene info linked to YP_003059807.1
NP_905548.1 	
DNA gyrase, A subunit [Porphyromonas gingivalis W83] >gb|AAQ66447.1| DNA gyrase, A subunit [Porphyromonas gingivalis W83]
	176 	176 	83% 	5e-42	Gene info linked to NP_905548.1
ZP_02139219.1 	
DNA gyrase, A subunit [Roseobacter litoralis Och 149] >gb|EDQ19548.1| DNA gyrase, A subunit [Roseobacter litoralis Och 149]
	176 	176 	87% 	6e-42	
EFU21089.1 	
DNA gyrase subunit A [Spirochaeta thermophila DSM 6578]
	176 	176 	85% 	6e-42	
YP_618243.1 	
DNA gyrase, subunit A [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >emb|CAI96852.1| DNA gyrase, subunit A [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842]
	175 	175 	95% 	6e-42	Gene info linked to YP_618243.1
ZP_01446115.1 	
DNA gyrase subunit A [Pelagibaca bermudensis HTCC2601] >gb|EAU43654.1| DNA gyrase subunit A [Roseovarius sp. HTCC2601]
	175 	175 	84% 	6e-42	
BAB93454.1 	
DNA gyraseA [Porphyromonas gingivalis]
	175 	175 	83% 	6e-42	
ZP_06407610.1 	
DNA gyrase, A subunit [Prevotella melaninogenica D18] >gb|EFC73572.1| DNA gyrase, A subunit [Prevotella melaninogenica D18]
	175 	175 	83% 	6e-42	
ZP_03495816.1 	
DNA gyrase, A subunit [Thermus aquaticus Y51MC23] >gb|EED11394.1| DNA gyrase, A subunit [Thermus aquaticus Y51MC23]
	175 	175 	87% 	6e-42	
YP_001642006.1 	
DNA gyrase, A subunit [Methylobacterium extorquens PA1] >ref|YP_002423720.1| DNA gyrase, A subunit [Methylobacterium chloromethanicum CM4] >ref|YP_002965897.1| DNA gyrase, subunit A (type II topoisomerase) [Methylobacterium extorquens AM1] >ref|YP_003071027.1| DNA gyrase, subunit A (type II topoisomerase) [Methylobacterium extorquens DM4] >gb|ABY32935.1| DNA gyrase, A subunit [Methylobacterium extorquens PA1] >gb|ACK85792.1| DNA gyrase, A subunit [Methylobacterium chloromethanicum CM4] >gb|ACS42620.1| DNA gyrase, subunit A (type II topoisomerase) [Methylobacterium extorquens AM1] >emb|CAX27222.1| DNA gyrase, subunit A (type II topoisomerase) [Methylobacterium extorquens DM4]
	175 	175 	96% 	6e-42	Gene info linked to YP_001642006.1
ADX69250.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus helveticus H10]
	175 	175 	88% 	6e-42	
BAJ29721.1 	
putative DNA gyrase subunit A [Kitasatospora setae KM-6054]
	175 	175 	88% 	6e-42	
YP_001576588.1 	
DNA gyrase [Lactobacillus helveticus DPC 4571] >gb|ABX26303.1| DNA gyrase [Lactobacillus helveticus DPC 4571]
	175 	175 	88% 	7e-42	Gene info linked to YP_001576588.1
ZP_05667743.1 	
DNA gyrase subunit A [Enterococcus faecium 1,141,733] >gb|EEV51076.1| DNA gyrase subunit A [Enterococcus faecium 1,141,733]
	175 	175 	83% 	7e-42	
ZP_03980694.1 	
DNA topoisomerase (ATP-hydrolyzing) [Enterococcus faecium TX1330] >ref|ZP_05675945.1| DNA gyrase subunit A [Enterococcus faecium Com12] >ref|ZP_06625517.1| DNA gyrase, A subunit [Enterococcus faecium PC4.1] >gb|EEI61196.1| DNA topoisomerase (ATP-hydrolyzing) [Enterococcus faecium TX1330] >gb|EEV59278.1| DNA gyrase subunit A [Enterococcus faecium Com12] >gb|EFF60062.1| DNA gyrase, A subunit [Enterococcus faecium PC4.1]
	175 	175 	83% 	7e-42	
ZP_05645934.1 	
DNA gyrase subunit A [Enterococcus casseliflavus EC30] >ref|ZP_05652856.1| DNA gyrase subunit A [Enterococcus casseliflavus EC10] >gb|EEV29267.1| DNA gyrase subunit A [Enterococcus casseliflavus EC30] >gb|EEV36189.1| DNA gyrase subunit A [Enterococcus casseliflavus EC10]
	175 	175 	83% 	7e-42	
YP_658368.1 	
DNA gyrase / DNA topoisomerase II subunit A [Haloquadratum walsbyi DSM 16790] >emb|CAJ52762.1| DNA gyrase / DNA topoisomerase II subunit A [Haloquadratum walsbyi DSM 16790]
	175 	175 	82% 	7e-42	Gene info linked to YP_658368.1
ZP_05678929.1 	
DNA gyrase subunit A [Enterococcus faecium Com15] >ref|ZP_06674179.1| DNA gyrase, A subunit [Enterococcus faecium E1039] >ref|ZP_06683687.1| DNA gyrase, A subunit [Enterococcus faecium E980] >gb|EEV62262.1| DNA gyrase subunit A [Enterococcus faecium Com15] >gb|EFF32532.1| DNA gyrase, A subunit [Enterococcus faecium E1039] >gb|EFF36573.1| DNA gyrase, A subunit [Enterococcus faecium E980]
	175 	175 	83% 	7e-42	
YP_002729376.1 	
DNA gyrase, A subunit [Sulfurihydrogenibium azorense Az-Fu1] >gb|ACN98308.1| DNA gyrase, A subunit [Sulfurihydrogenibium azorense Az-Fu1]
	175 	175 	83% 	7e-42	Gene info linked to YP_002729376.1
YP_678292.1 	
DNA gyrase subunit A [Cytophaga hutchinsonii ATCC 33406] >gb|ABG58950.1| DNA gyrase subunit A [Cytophaga hutchinsonii ATCC 33406]
	175 	175 	85% 	7e-42	Gene info linked to YP_678292.1
ZP_07092453.1 	
DNA gyrase, A subunit [Lactobacillus delbrueckii subsp. bulgaricus PB2003/044-T3-4] >gb|EFK32089.1| DNA gyrase, A subunit [Lactobacillus delbrueckii subsp. bulgaricus PB2003/044-T3-4]
	175 	175 	95% 	8e-42	
ZP_04606629.1 	
DBA gyrase A subunit gyrA [Micromonospora sp. ATCC 39149] >gb|EEP72559.1| DBA gyrase A subunit gyrA [Micromonospora sp. ATCC 39149]
	175 	175 	83% 	8e-42	
ZP_02093812.1 	
hypothetical protein PEPMIC_00567 [Parvimonas micra ATCC 33270] >gb|EDP23988.1| hypothetical protein PEPMIC_00567 [Parvimonas micra ATCC 33270]
	175 	175 	84% 	8e-42	
ZP_08085779.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Prevotella oralis ATCC 33269] >gb|EFZ36248.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Prevotella oralis ATCC 33269]
	175 	175 	83% 	8e-42	
YP_812140.1 	
DNA gyrase, A subunit [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gb|ABJ57702.1| DNA gyrase subunit A [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
	175 	175 	95% 	8e-42	Gene info linked to YP_812140.1
ZP_06849545.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Mycobacterium parascrofulaceum ATCC BAA-614] >gb|EFG77059.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Mycobacterium parascrofulaceum ATCC BAA-614]
	175 	175 	88% 	9e-42	
ZP_07272865.1 	
DNA gyrase, A subunit [Streptomyces sp. SPB78] >gb|EFL01234.1| DNA gyrase, A subunit [Streptomyces sp. SPB78]
	175 	175 	83% 	9e-42	
YP_327396.1 	
DNA gyrase subunit A [Natronomonas pharaonis DSM 2160] >emb|CAI49841.1| DNA gyrase subunit A [Natronomonas pharaonis DSM 2160]
	175 	175 	84% 	9e-42	Gene info linked to YP_327396.1
YP_001534935.1 	
DNA gyrase subunit A [Salinispora arenicola CNS-205] >gb|ABV95944.1| DNA gyrase, A subunit [Salinispora arenicola CNS-205]
	175 	175 	83% 	9e-42	Gene info linked to YP_001534935.1
BAA84772.1 	
DNA gyrase A subunit [Bacteroides fragilis]
	175 	175 	83% 	9e-42	
ZP_07976111.1 	
DNA gyrase subunit A [Streptomyces sp. SA3_actG] >ref|ZP_07986782.1| DNA gyrase subunit A [Streptomyces sp. SA3_actF]
	175 	175 	83% 	9e-42	
YP_871768.1 	
DNA gyrase subunit A [Acidothermus cellulolyticus 11B] >gb|ABK51782.1| DNA gyrase subunit A [Acidothermus cellulolyticus 11B]
	175 	175 	85% 	9e-42	Gene info linked to YP_871768.1
ZP_03681832.1 	
hypothetical protein CATMIT_00453 [Catenibacterium mitsuokai DSM 15897] >gb|EEF94902.1| hypothetical protein CATMIT_00453 [Catenibacterium mitsuokai DSM 15897]
	175 	175 	96% 	9e-42	
ZP_01958967.1 	
hypothetical protein BACCAC_00555 [Bacteroides caccae ATCC 43185] >gb|EDM22182.1| hypothetical protein BACCAC_00555 [Bacteroides caccae ATCC 43185]
	175 	175 	83% 	9e-42	
YP_099694.1 	
DNA gyrase A subunit [Bacteroides fragilis YCH46] >ref|YP_212117.1| DNA gyrase A subunit [Bacteroides fragilis NCTC 9343] >ref|ZP_04843105.1| conserved hypothetical protein [Bacteroides sp. 3_2_5] >ref|ZP_06092594.1| DNA gyrase, A subunit [Bacteroides sp. 2_1_16] >dbj|BAD49160.1| DNA gyrase A subunit [Bacteroides fragilis YCH46] >emb|CAH08193.1| DNA gyrase A subunit [Bacteroides fragilis NCTC 9343] >gb|EES86336.1| conserved hypothetical protein [Bacteroides sp. 3_2_5] >gb|EEZ27980.1| DNA gyrase, A subunit [Bacteroides sp. 2_1_16] >emb|CBW22962.1| DNA gyrase A subunit [Bacteroides fragilis 638R]
	175 	175 	83% 	1e-41	Gene info linked to YP_099694.1
YP_003585112.1 	
DNA gyrase subunit A [Zunongwangia profunda SM-A87] >gb|ADF52916.1| DNA gyrase subunit A [Zunongwangia profunda SM-A87]
	175 	175 	97% 	1e-41	Gene info linked to YP_003585112.1
ZP_00960826.1 	
DNA gyrase subunit A [Roseovarius nubinhibens ISM] >gb|EAP76397.1| DNA gyrase subunit A [Roseovarius nubinhibens ISM]
	174 	174 	84% 	1e-41	
YP_003996994.1 	
DNA gyrase subunit a [Leadbetterella byssophila DSM 17132] >gb|ADQ16641.1| DNA gyrase subunit A [Leadbetterella byssophila DSM 17132]
	174 	174 	82% 	1e-41	Gene info linked to YP_003996994.1
ZP_05745027.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus antri DSM 16041] >gb|EEW54433.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus antri DSM 16041]
	174 	174 	90% 	1e-41	
YP_001234310.1 	
DNA gyrase subunit A [Acidiphilium cryptum JF-5] >gb|ABQ30391.1| DNA gyrase subunit A [Acidiphilium cryptum JF-5]
	174 	174 	88% 	1e-41	Gene info linked to YP_001234310.1
ZP_01014776.1 	
DNA gyrase subunit A [Maritimibacter alkaliphilus HTCC2654] >gb|EAQ11569.1| DNA gyrase subunit A [Rhodobacterales bacterium HTCC2654]
	174 	174 	84% 	1e-41	
YP_479130.1 	
DNA gyrase subunit A [Frankia sp. CcI3] >gb|ABD09401.1| DNA gyrase subunit A [Frankia sp. CcI3]
	174 	174 	85% 	1e-41	Gene info linked to YP_479130.1
ZP_05651047.1 	
DNA gyrase subunit A [Enterococcus gallinarum EG2] >gb|EEV34380.1| DNA gyrase subunit A [Enterococcus gallinarum EG2]
	174 	174 	83% 	1e-41	
ZP_05553943.1 	
DNA gyrase, A subunit [Lactobacillus coleohominis 101-4-CHN] >gb|EEU29747.1| DNA gyrase, A subunit [Lactobacillus coleohominis 101-4-CHN]
	174 	174 	96% 	1e-41	
YP_001833177.1 	
DNA gyrase, A subunit [Beijerinckia indica subsp. indica ATCC 9039] >gb|ACB95688.1| DNA gyrase, A subunit [Beijerinckia indica subsp. indica ATCC 9039]
	174 	174 	96% 	1e-41	Gene info linked to YP_001833177.1
ZP_05089274.1 	
DNA gyrase, A subunit [Ruegeria sp. R11] >gb|EEB70966.1| DNA gyrase, A subunit [Ruegeria sp. R11]
	174 	174 	84% 	1e-41	
ZP_06421385.1 	
DNA gyrase, A subunit [Prevotella sp. oral taxon 317 str. F0108] >gb|EFC68956.1| DNA gyrase, A subunit [Prevotella sp. oral taxon 317 str. F0108]
	174 	174 	83% 	1e-41	
ZP_02964532.1 	
DNA gyrase, A subunit [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >ref|ZP_02997078.1| DNA gyrase, A subunit [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >ref|ZP_03004135.1| DNA gyrase, A subunit [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >ref|ZP_03004216.1| DNA gyrase, A subunit [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >ref|ZP_03079464.1| DNA gyrase, A subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >ref|ZP_03205980.1| DNA gyrase, A subunit [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >ref|ZP_03771985.1| DNA gyrase, A subunit [Ureaplasma urealyticum serovar 8 str. ATCC 27618] >gb|EDU06357.1| DNA gyrase, A subunit [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gb|EDU56744.1| DNA gyrase, A subunit [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gb|EDU66806.1| DNA gyrase, A subunit [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gb|EDX53202.1| DNA gyrase, A subunit [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gb|EDX54189.1| DNA gyrase, A subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gb|EDY74744.1| DNA gyrase, A subunit [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gb|EEH01219.1| DNA gyrase, A subunit [Ureaplasma urealyticum serovar 8 str. ATCC 27618]
	174 	174 	95% 	1e-41	
ZP_05857832.1 	
DNA gyrase, A subunit [Prevotella veroralis F0319] >gb|EEX18285.1| DNA gyrase, A subunit [Prevotella veroralis F0319]
	174 	174 	83% 	1e-41	
ZP_06967306.1 	
DNA gyrase, A subunit [Ktedonobacter racemifer DSM 44963] >gb|EFH90417.1| DNA gyrase, A subunit [Ktedonobacter racemifer DSM 44963]
	174 	174 	96% 	1e-41	
YP_004161845.1 	
DNA gyrase subunit A [Bacteroides helcogenes P 36-108] >gb|ADV44259.1| DNA gyrase subunit A [Bacteroides helcogenes P 36-108]
	174 	174 	83% 	1e-41	Gene info linked to YP_004161845.1
YP_003957998.1 	
DNA gyrase subunit A [Eubacterium limosum KIST612] >gb|ADO35035.1| DNA gyrase subunit A [Eubacterium limosum KIST612]
	174 	174 	85% 	1e-41	Gene info linked to YP_003957998.1
ZP_05752110.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus helveticus DSM 20075] >gb|EEW68421.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus helveticus DSM 20075]
	174 	174 	88% 	1e-41	
YP_001532819.1 	
DNA gyrase, A subunit [Dinoroseobacter shibae DFL 12] >gb|ABV93218.1| DNA gyrase, A subunit [Dinoroseobacter shibae DFL 12]
	174 	174 	84% 	1e-41	Gene info linked to YP_001532819.1
ZP_06277270.1 	
DNA gyrase, A subunit [Streptomyces sp. ACT-1] >gb|EFB83477.1| DNA gyrase, A subunit [Streptomyces sp. ACT-1]
	174 	174 	85% 	1e-41	
YP_001825218.1 	
DNA gyrase subunit A [Streptomyces griseus subsp. griseus NBRC 13350] >dbj|BAG20535.1| putative DNA gyrase subunit A [Streptomyces griseus subsp. griseus NBRC 13350]
	174 	174 	85% 	1e-41	Gene info linked to YP_001825218.1
ADW04606.1 	
DNA gyrase, A subunit [Streptomyces flavogriseus ATCC 33331]
	174 	174 	85% 	1e-41	
NP_710187.1 	
DNA gyrase subunit A [Leptospira interrogans serovar Lai str. 56601] >ref|YP_000006.1| DNA gyrase subunit A [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gb|AAN47205.1|AE011192_6 DNA gyrase subunit A [Leptospira interrogans serovar Lai str. 56601] >gb|AAN64016.1|AF434658_13 DNA gyrase subunit A [Leptospira interrogans] >gb|AAS68643.1| DNA gyrase subunit A [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130]
	174 	174 	81% 	2e-41	Gene info linked to NP_710187.1
NP_787134.1 	
DNA gyrase subunit A [Tropheryma whipplei str. Twist] >ref|NP_788961.1| DNA gyrase subunit A [Tropheryma whipplei TW08/27] >emb|CAD66698.1| DNA gyrase subunit A [Tropheryma whipplei TW08/27] >gb|AAO44103.1| DNA gyrase subunit A [Tropheryma whipplei str. Twist]
	174 	174 	84% 	2e-41	Gene info linked to NP_787134.1
CAX83815.1 	
DNA gyrase subunit A [uncultured bacterium]
	174 	174 	95% 	2e-41	
YP_004057520.1 	
DNA gyrase subunit a [Oceanithermus profundus DSM 14977] >gb|ADR36347.1| DNA gyrase subunit A [Oceanithermus profundus DSM 14977]
	174 	174 	87% 	2e-41	Gene info linked to YP_004057520.1
YP_192945.1 	
DNA gyrase subunit A [Lactobacillus acidophilus NCFM] >ref|ZP_04020394.1| DNA gyrase subunit A [Lactobacillus acidophilus ATCC 4796] >gb|AAV41914.1| DNA gyrase subunit A [Lactobacillus acidophilus NCFM] >gb|EEJ77099.1| DNA gyrase subunit A [Lactobacillus acidophilus ATCC 4796]
	174 	174 	88% 	2e-41	Gene info linked to YP_192945.1
YP_003650637.1 	
DNA gyrase subunit A [Thermobispora bispora DSM 43833] >gb|ADG86744.1| DNA gyrase, A subunit [Thermobispora bispora DSM 43833]
	174 	174 	82% 	2e-41	Gene info linked to YP_003650637.1
NP_951066.1 	
DNA gyrase subunit A [Geobacter sulfurreducens PCA] >gb|AAR33339.1| DNA gyrase, A subunit [Geobacter sulfurreducens PCA] >gb|ADI82868.1| DNA gyrase, A subunit [Geobacter sulfurreducens KN400]
	174 	174 	95% 	2e-41	Gene info linked to NP_951066.1
ZP_01753451.1 	
DNA gyrase subunit A [Roseobacter sp. SK209-2-6] >gb|EBA17818.1| DNA gyrase subunit A [Roseobacter sp. SK209-2-6]
	174 	174 	84% 	2e-41	
ZP_04011638.1 	
DNA topoisomerase [Lactobacillus ultunensis DSM 16047] >gb|EEJ71743.1| DNA topoisomerase [Lactobacillus ultunensis DSM 16047]
	174 	174 	88% 	2e-41	
YP_352687.1 	
DNA gyrase subunit A [Rhodobacter sphaeroides 2.4.1] >gb|ABA78786.1| DNA gyrase/topoisomerase IV, subunit A [Rhodobacter sphaeroides 2.4.1]
	174 	174 	81% 	2e-41	Gene info linked to YP_352687.1
YP_001043169.1 	
DNA gyrase subunit A [Rhodobacter sphaeroides ATCC 17029] >gb|ABN76397.1| DNA gyrase, A subunit [Rhodobacter sphaeroides ATCC 17029]
	174 	174 	81% 	2e-41	Gene info linked to YP_001043169.1
YP_003762235.1 	
DNA gyrase subunit A [Amycolatopsis mediterranei U32] >gb|ADJ41833.1| DNA gyrase subunit A [Amycolatopsis mediterranei U32]
	174 	174 	83% 	2e-41	Gene info linked to YP_003762235.1
ZP_01167049.1 	
DNA gyrase subunit A [Oceanospirillum sp. MED92] >gb|EAR60810.1| DNA gyrase subunit A [Oceanospirillum sp. MED92]
	174 	174 	82% 	2e-41	
ZP_00999289.1 	
DNA gyrase subunit A [Oceanicola batsensis HTCC2597] >gb|EAQ03539.1| DNA gyrase subunit A [Oceanicola batsensis HTCC2597]
	174 	174 	84% 	2e-41	
ZP_06559338.1 	
DNA gyrase, A subunit [Megasphaera genomosp. type_1 str. 28L] >gb|EFD94719.1| DNA gyrase, A subunit [Megasphaera genomosp. type_1 str. 28L]
	174 	174 	85% 	2e-41	
YP_049307.1 	
DNA gyrase subunit A [Pectobacterium atrosepticum SCRI1043] >emb|CAG74111.1| DNA gyrase subunit A [Pectobacterium atrosepticum SCRI1043]
	174 	174 	85% 	2e-41	Gene info linked to YP_049307.1
YP_003685835.1 	
DNA gyrase, A subunit [Meiothermus silvanus DSM 9946] >gb|ADH64327.1| DNA gyrase, A subunit [Meiothermus silvanus DSM 9946]
	174 	174 	87% 	2e-41	Gene info linked to YP_003685835.1
YP_002759996.1 	
DNA gyrase subunit A [Gemmatimonas aurantiaca T-27] >dbj|BAH37526.1| DNA gyrase subunit A [Gemmatimonas aurantiaca T-27]
	174 	174 	83% 	2e-41	Gene info linked to YP_002759996.1
ZP_06251204.1 	
DNA gyrase, A subunit [Prevotella copri DSM 18205] >gb|EFB36380.1| DNA gyrase, A subunit [Prevotella copri DSM 18205]
	174 	174 	82% 	2e-41	
ZP_04580286.1 	
DNA gyrase subunit A [Helicobacter bilis ATCC 43879] >gb|EEO24947.1| DNA gyrase subunit A [Helicobacter bilis ATCC 43879]
	174 	174 	97% 	2e-41	
ZP_00954981.1 	
DNA gyrase subunit A [Sulfitobacter sp. EE-36] >gb|EAP84489.1| DNA gyrase subunit A [Sulfitobacter sp. EE-36]
	174 	174 	87% 	2e-41	
YP_004097299.1 	
DNA gyrase subunit A [Intrasporangium calvum DSM 43043] >gb|ADU46572.1| DNA gyrase subunit A [Intrasporangium calvum DSM 43043]
	173 	173 	83% 	2e-41	Gene info linked to YP_004097299.1
ZP_01742285.1 	
DNA gyrase subunit A [Rhodobacterales bacterium HTCC2150] >gb|EBA03399.1| DNA gyrase subunit A [Rhodobacterales bacterium HTCC2150]
	173 	173 	84% 	2e-41	
YP_003302964.1 	
DNA gyrase subunit A [Mycoplasma hominis] >gb|AAB37247.2| DNA gyrase subunit A [Mycoplasma hominis ATCC 23114] >emb|CAX37561.1| DNA gyrase subunit A [Mycoplasma hominis ATCC 23114]
	173 	173 	88% 	2e-41	Gene info linked to YP_003302964.1
YP_002000136.1 	
DNA gyrase subunit A [Mycoplasma arthritidis 158L3-1] >gb|ACF07432.1| DNA gyrase subunit A [Mycoplasma arthritidis 158L3-1]
	173 	173 	88% 	2e-41	Gene info linked to YP_002000136.1
ZP_06202894.1 	
DNA gyrase, A subunit [Bacteroides sp. D20] >gb|EFA18545.1| DNA gyrase, A subunit [Bacteroides sp. D20]
	173 	173 	83% 	2e-41	
ZP_02034835.1 	
hypothetical protein BACCAP_00423 [Bacteroides capillosus ATCC 29799] >gb|EDN01758.1| hypothetical protein BACCAP_00423 [Bacteroides capillosus ATCC 29799]
	173 	173 	82% 	2e-41	
YP_682947.1 	
DNA gyrase subunit A [Roseobacter denitrificans OCh 114] >gb|ABG32261.1| DNA gyrase, A subunit [Roseobacter denitrificans OCh 114]
	173 	173 	87% 	3e-41	Gene info linked to YP_682947.1
ZP_05069596.1 	
DNA gyrase, A subunit [Candidatus Pelagibacter sp. HTCC7211] >gb|EDZ60595.1| DNA gyrase, A subunit [Candidatus Pelagibacter sp. HTCC7211]
	173 	173 	87% 	3e-41	
NP_967035.1 	
DNA gyrase subunit A [Bdellovibrio bacteriovorus HD100] >emb|CAE77689.1| DNA gyrase subunit A [Bdellovibrio bacteriovorus HD100]
	173 	173 	95% 	3e-41	Gene info linked to NP_967035.1
YP_003891729.1 	
DNA gyrase subunit A [Sulfurimonas autotrophica DSM 16294] >gb|ADN08717.1| DNA gyrase subunit A [Sulfurimonas autotrophica DSM 16294]
	173 	173 	82% 	3e-41	Gene info linked to YP_003891729.1
ZP_08011102.1 	
DNA gyrase subunit A gyrA [Coprobacillus sp. 29_1] >gb|EFW04811.1| DNA gyrase subunit A gyrA [Coprobacillus sp. 29_1]
	173 	173 	96% 	3e-41	
ZP_06054999.1 	
DNA gyrase, A subunit [alpha proteobacterium HIMB114] >gb|EEY74768.1| DNA gyrase, A subunit [alpha proteobacterium HIMB114]
	173 	173 	91% 	3e-41	
YP_003297654.1 	
DNA gyrase subunit A [Thermomonospora curvata DSM 43183] >gb|ACY95616.1| DNA gyrase, A subunit [Thermomonospora curvata DSM 43183]
	173 	173 	83% 	3e-41	Gene info linked to YP_003297654.1
ZP_05594425.1 	
conserved hypothetical protein [Enterococcus faecalis AR01/DG] >gb|EEU89219.1| conserved hypothetical protein [Enterococcus faecalis ARO1/DG]
	173 	173 	83% 	3e-41	
AAD52968.1 	
DNA gyrase alpha subunit [Acholeplasma laidlawii]
	173 	173 	90% 	3e-41	
ZP_02070575.1 	
hypothetical protein BACUNI_01996 [Bacteroides uniformis ATCC 8492] >ref|ZP_07939175.1| DNA gyrase, subunit A [Bacteroides sp. 4_1_36] >gb|EDO54520.1| hypothetical protein BACUNI_01996 [Bacteroides uniformis ATCC 8492] >gb|EFV25584.1| DNA gyrase, subunit A [Bacteroides sp. 4_1_36]
	173 	173 	83% 	3e-41	
YP_001504382.1 	
DNA gyrase subunit A [Frankia sp. EAN1pec] >gb|ABW09476.1| DNA gyrase, A subunit [Frankia sp. EAN1pec]
	173 	173 	83% 	3e-41	Gene info linked to YP_001504382.1
ADX68054.1 	
DNA gyrase, A subunit [Weeksella virosa DSM 16922]
	173 	173 	85% 	3e-41	
YP_003195586.1 	
DNA gyrase subunit A [Robiginitalea biformata HTCC2501] >gb|EAR15241.1| DNA gyrase A subunit [Robiginitalea biformata HTCC2501]
	173 	173 	96% 	3e-41	Gene info linked to YP_003195586.1
ZP_07655494.1 	
DNA gyrase, A subunit [Methylobacter tundripaludum SV96] >gb|EFO04587.1| DNA gyrase, A subunit [Methylobacter tundripaludum SV96]
	173 	173 	96% 	3e-41	
ZP_07936247.1 	
DNA gyrase, subunit A [Bacteroides eggerthii 1_2_48FAA] >gb|EFV28510.1| DNA gyrase, subunit A [Bacteroides eggerthii 1_2_48FAA]
	173 	173 	83% 	3e-41	
YP_002986666.1 	
DNA gyrase, A subunit [Dickeya dadantii Ech703] >gb|ACS84844.1| DNA gyrase, A subunit [Dickeya dadantii Ech703]
	173 	173 	85% 	3e-41	Gene info linked to YP_002986666.1
ZP_03459916.1 	
hypothetical protein BACEGG_02717 [Bacteroides eggerthii DSM 20697] >gb|EEC52966.1| hypothetical protein BACEGG_02717 [Bacteroides eggerthii DSM 20697]
	173 	173 	83% 	3e-41	
YP_745040.1 	
DNA gyrase subunit A [Granulibacter bethesdensis CGDNIH1] >gb|ABI62117.1| DNA gyrase subunit A [Granulibacter bethesdensis CGDNIH1]
	173 	173 	88% 	3e-41	Gene info linked to YP_745040.1
YP_382980.1 	
DNA gyrase subunit A [Geobacter metallireducens GS-15] >gb|ABB30255.1| DNA gyrase subunit A [Geobacter metallireducens GS-15]
	173 	173 	95% 	3e-41	Gene info linked to YP_382980.1
YP_002297295.1 	
DNA gyrase, A subunit [Rhodospirillum centenum SW] >gb|ACI98482.1| DNA gyrase, A subunit [Rhodospirillum centenum SW]
	173 	173 	82% 	3e-41	Gene info linked to YP_002297295.1
ZP_06833534.1 	
DNA gyrase subunit A [Gluconacetobacter hansenii ATCC 23769] >gb|EFG85322.1| DNA gyrase subunit A [Gluconacetobacter hansenii ATCC 23769]
	172 	172 	83% 	4e-41	
XP_002944211.1 	
PREDICTED: DNA gyrase subunit A-like, partial [Xenopus (Silurana) tropicalis]
	172 	172 	80% 	4e-41	UniGene info linked to XP_002944211.1Gene info linked to XP_002944211.1Genome view with mapviewer linked to XP_002944211.1
YP_053247.1 	
DNA gyrase subunit A [Mesoplasma florum L1] >gb|AAT75363.1| DNA gyrase subunit A [Mesoplasma florum L1]
	172 	172 	85% 	4e-41	Gene info linked to YP_053247.1
YP_003061592.1 	
DNA gyrase, A subunit [Lactobacillus plantarum JDM1] >gb|ACT60895.1| DNA gyrase, A subunit [Lactobacillus plantarum JDM1]
	172 	172 	83% 	4e-41	Gene info linked to YP_003061592.1
NP_783872.1 	
DNA gyrase, A subunit [Lactobacillus plantarum WCFS1] >ref|ZP_07079000.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus plantarum subsp. plantarum ATCC 14917] >ref|YP_003923325.1| DNA gyrase, A subunit [Lactobacillus plantarum subsp. plantarum ST-III] >emb|CAD62708.1| DNA gyrase, A subunit [Lactobacillus plantarum WCFS1] >gb|EFK28530.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus plantarum subsp. plantarum ATCC 14917] >gb|ADN97231.1| DNA gyrase, A subunit [Lactobacillus plantarum subsp. plantarum ST-III]
	172 	172 	83% 	4e-41	Gene info linked to NP_783872.1
YP_003386846.1 	
DNA gyrase, A subunit [Spirosoma linguale DSM 74] >gb|ADB38047.1| DNA gyrase, A subunit [Spirosoma linguale DSM 74]
	172 	172 	82% 	5e-41	Gene info linked to YP_003386846.1
CAK98251.1 	
dna gyrase subunit a protein [Spiroplasma citri]
	172 	172 	82% 	5e-41	
YP_003814859.1 	
DNA gyrase, A subunit [Prevotella melaninogenica ATCC 25845] >gb|ADK96556.1| DNA gyrase, A subunit [Prevotella melaninogenica ATCC 25845]
	172 	172 	83% 	5e-41	Gene info linked to YP_003814859.1
YP_613327.1 	
DNA gyrase subunit A [Ruegeria sp. TM1040] >gb|ABF64065.1| DNA gyrase A subunit [Ruegeria sp. TM1040]
	172 	172 	84% 	5e-41	Gene info linked to YP_613327.1
YP_003448574.1 	
DNA gyrase subunit A [Azospirillum sp. B510] >dbj|BAI72030.1| DNA gyrase subunit A [Azospirillum sp. B510]
	172 	172 	81% 	5e-41	Gene info linked to YP_003448574.1
YP_002525302.1 	
DNA gyrase subunit A [Rhodobacter sphaeroides KD131] >gb|ACM00801.1| DNA gyrase subunit A (Dna topoisomerase ii (Subunit a)) [Rhodobacter sphaeroides KD131]
	172 	172 	81% 	5e-41	Gene info linked to YP_002525302.1
YP_001167372.1 	
DNA gyrase subunit A [Rhodobacter sphaeroides ATCC 17025] >gb|ABP70067.1| DNA gyrase, A subunit [Rhodobacter sphaeroides ATCC 17025]
	172 	172 	81% 	5e-41	Gene info linked to YP_001167372.1
ZP_03953393.1 	
DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus hilgardii ATCC 8290] >gb|EEI24762.1| DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus hilgardii ATCC 8290]
	172 	172 	83% 	6e-41	
ZP_05281525.1 	
DNA gyrase A subunit [Bacteroides fragilis 3_1_12] >ref|ZP_07809351.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12] >gb|EFR53285.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
	172 	172 	83% 	6e-41	
ZP_03938182.1 	
DNA topoisomerase [Lactobacillus brevis subsp. gravesensis ATCC 27305] >ref|ZP_03941206.1| DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus buchneri ATCC 11577] >gb|EEI20951.1| DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus buchneri ATCC 11577] >gb|EEI72429.1| DNA topoisomerase [Lactobacillus brevis subsp. gravesensis ATCC 27305]
	172 	172 	83% 	6e-41	
ZP_05099554.1 	
DNA gyrase, A subunit [Roseobacter sp. GAI101] >gb|EEB83856.1| DNA gyrase, A subunit [Roseobacter sp. GAI101]
	172 	172 	87% 	6e-41	
ZP_05918005.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Prevotella sp. oral taxon 472 str. F0295] >gb|EEX52560.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Prevotella sp. oral taxon 472 str. F0295]
	172 	172 	83% 	6e-41	
YP_001404793.1 	
DNA gyrase, A subunit [Candidatus Methanoregula boonei 6A8] >gb|ABS56150.1| DNA gyrase, A subunit [Candidatus Methanoregula boonei 6A8]
	172 	172 	97% 	6e-41	Gene info linked to YP_001404793.1
ZP_05887716.1 	
DNA gyrase subunit A [Vibrio coralliilyticus ATCC BAA-450] >gb|EEX31283.1| DNA gyrase subunit A [Vibrio coralliilyticus ATCC BAA-450]
	172 	172 	96% 	6e-41	
YP_004212041.1 	
DNA gyrase, A subunit [Rahnella sp. Y9602] >gb|ADW72914.1| DNA gyrase, A subunit [Rahnella sp. Y9602]
	172 	172 	85% 	6e-41	Gene info linked to YP_004212041.1
NP_958940.1 	
DNA gyrase subunit A [Mycobacterium avium subsp. paratuberculosis K-10] >gb|AAS02323.1| GyrA [Mycobacterium avium subsp. paratuberculosis K-10]
	172 	172 	88% 	6e-41	Gene info linked to NP_958940.1
YP_003260560.1 	
DNA gyrase, A subunit [Pectobacterium wasabiae WPP163] >gb|ACX88953.1| DNA gyrase, A subunit [Pectobacterium wasabiae WPP163]
	172 	172 	85% 	6e-41	Gene info linked to YP_003260560.1
P41513.1 	
RecName: Full=DNA gyrase subunit A >emb|CAA56777.1| DNA topoisomerase (ATP-hydrolysing) [Pectobacterium carotovorum]
	172 	172 	85% 	7e-41	
ZP_06889034.1 	
DNA gyrase, A subunit [Methylosinus trichosporium OB3b] >gb|EFH02466.1| DNA gyrase, A subunit [Methylosinus trichosporium OB3b]
	172 	172 	82% 	7e-41	
ADJ78360.1 	
DNA gyrase subunit A [Lactobacillus salivarius CECT 5713]
	172 	172 	83% 	7e-41	
ZP_01118021.1 	
DNA gyrase A subunit [Polaribacter irgensii 23-P] >gb|EAR12530.1| DNA gyrase A subunit [Polaribacter irgensii 23-P]
	172 	172 	82% 	7e-41	
YP_003153488.1 	
DNA gyrase subunit A [Brachybacterium faecium DSM 4810] >gb|ACU83898.1| DNA gyrase subunit A [Brachybacterium faecium DSM 4810]
	172 	172 	83% 	7e-41	Gene info linked to YP_003153488.1
YP_008073.1 	
DNA gyrase subunit A [Candidatus Protochlamydia amoebophila UWE25] >emb|CAF23798.1| probable DNA gyrase subunit A [Candidatus Protochlamydia amoebophila UWE25]
	172 	172 	97% 	7e-41	Gene info linked to YP_008073.1
ZP_03832249.1 	
DNA gyrase subunit A [Pectobacterium carotovorum subsp. carotovorum WPP14]
	172 	172 	85% 	7e-41	
YP_002535484.1 	
DNA gyrase, A subunit [Geobacter sp. FRC-32] >gb|ACM18383.1| DNA gyrase, A subunit [Geobacter sp. FRC-32]
	172 	172 	81% 	7e-41	Gene info linked to YP_002535484.1
YP_301493.1 	
DNA topoisomerase IV subunit A [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >dbj|BAE18548.1| topoisomerase IV subunit A [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
	172 	172 	88% 	7e-41	Gene info linked to YP_301493.1
YP_003677966.1 	
DNA gyrase, A subunit [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111] >gb|ADH65460.1| DNA gyrase, A subunit [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
	172 	172 	83% 	7e-41	Gene info linked to YP_003677966.1
ZP_05342044.1 	
DNA gyrase, A subunit [Thalassiobium sp. R2A62] >gb|EET47711.1| DNA gyrase, A subunit [Thalassiobium sp. R2A62]
	172 	172 	84% 	7e-41	
ZP_04055114.1 	
DNA gyrase, A subunit [Porphyromonas uenonis 60-3] >gb|EEK17021.1| DNA gyrase, A subunit [Porphyromonas uenonis 60-3]
	172 	172 	83% 	7e-41	
EFE27931.2 	
DNA gyrase, A subunit [Filifactor alocis ATCC 35896]
	172 	172 	95% 	8e-41	
ZP_05071080.1 	
DNA gyrase, A subunit [Campylobacterales bacterium GD 1] >gb|EDZ63728.1| DNA gyrase, A subunit [Campylobacterales bacterium GD 1]
	172 	172 	80% 	8e-41	
YP_004036665.1 	
DNA gyrase subunit a [Halogeometricum borinquense DSM 11551] >gb|ADQ67220.1| DNA gyrase subunit A [Halogeometricum borinquense DSM 11551]
	172 	172 	83% 	8e-41	Gene info linked to YP_004036665.1
ZP_06125386.2 	
DNA gyrase, A subunit [Providencia rettgeri DSM 1131] >gb|EFE53845.1| DNA gyrase, A subunit [Providencia rettgeri DSM 1131]
	172 	172 	85% 	8e-41	
YP_002565661.1 	
DNA gyrase, A subunit [Halorubrum lacusprofundi ATCC 49239] >gb|ACM56591.1| DNA gyrase, A subunit [Halorubrum lacusprofundi ATCC 49239]
	172 	172 	83% 	8e-41	Gene info linked to YP_002565661.1
ZP_05877219.1 	
DNA gyrase subunit A [Vibrio furnissii CIP 102972] >gb|EEX41500.1| DNA gyrase subunit A [Vibrio furnissii CIP 102972]
	171 	171 	96% 	8e-41	
ZP_02435235.1 	
hypothetical protein BACSTE_01477 [Bacteroides stercoris ATCC 43183] >gb|EDS16027.1| hypothetical protein BACSTE_01477 [Bacteroides stercoris ATCC 43183]
	171 	171 	83% 	9e-41	
YP_879309.1 	
DNA gyrase subunit A [Mycobacterium avium 104] >gb|ABK64957.1| DNA gyrase, A subunit [Mycobacterium avium 104]
	171 	171 	88% 	9e-41	Gene info linked to YP_879309.1
ABS86853.1 	
gyrase A [Mycobacterium avium subsp. paratuberculosis]
	171 	171 	88% 	9e-41	
ZP_01305925.1 	
DNA gyrase subunit A [Oceanobacter sp. RED65] >gb|EAT13115.1| DNA gyrase subunit A [Oceanobacter sp. RED65]
	171 	171 	83% 	9e-41	
ZP_06298502.1 	
hypothetical protein pah_c008o057 [Parachlamydia acanthamoebae str. Hall's coccus] >gb|EFB42444.1| hypothetical protein pah_c008o057 [Parachlamydia acanthamoebae str. Hall's coccus]
	171 	171 	85% 	9e-41	
CAA58885.1 	
DNA gyrase [Mycobacterium smegmatis]
	171 	171 	88% 	9e-41	
ZP_05214575.1 	
DNA gyrase subunit A [Mycobacterium avium subsp. avium ATCC 25291]
	171 	171 	88% 	1e-40	
YP_002755139.1 	
DNA gyrase, A subunit [Acidobacterium capsulatum ATCC 51196] >gb|ACO34051.1| DNA gyrase, A subunit [Acidobacterium capsulatum ATCC 51196]
	171 	171 	97% 	1e-40	Gene info linked to YP_002755139.1
YP_003475556.1 	
DNA gyrase subunit A [Clostridiales genomosp. BVAB3 str. UPII9-5] >gb|ADC90751.1| DNA gyrase, A subunit [Clostridiales genomosp. BVAB3 str. UPII9-5]
	171 	171 	82% 	1e-40	Gene info linked to YP_003475556.1
YP_003016689.1 	
DNA gyrase, A subunit [Pectobacterium carotovorum subsp. carotovorum PC1] >gb|ACT12153.1| DNA gyrase, A subunit [Pectobacterium carotovorum subsp. carotovorum PC1]
	171 	171 	85% 	1e-40	Gene info linked to YP_003016689.1
YP_693471.1 	
DNA gyrase, subunit A [Alcanivorax borkumensis SK2] >emb|CAL17199.1| DNA gyrase, subunit A [Alcanivorax borkumensis SK2]
	171 	171 	82% 	1e-40	Gene info linked to YP_693471.1
CAX49878.1 	
DNA gyrase subunit A [Neisseria meningitidis 8013]
	171 	171 	90% 	1e-40	
ZP_03959906.1 	
DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus vaginalis ATCC 49540] >gb|EEJ40517.1| DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus vaginalis ATCC 49540]
	171 	171 	82% 	1e-40	
BAC56210.1 	
DNA gyrase subunit A [Streptococcus suis]
	171 	171 	96% 	1e-40	
YP_001623181.1 	
DNA gyrase subunit A [Renibacterium salmoninarum ATCC 33209] >gb|ABY21767.1| DNA gyrase subunit A [Renibacterium salmoninarum ATCC 33209]
	171 	171 	84% 	1e-40	Gene info linked to YP_001623181.1
ZP_06196113.1 	
DNA gyrase, A subunit [Pediococcus acidilactici 7_4] >gb|EFA27256.1| DNA gyrase, A subunit [Pediococcus acidilactici 7_4]
	171 	171 	83% 	1e-40	
YP_003443943.1 	
DNA gyrase subunit A [Allochromatium vinosum DSM 180] >gb|ADC62911.1| DNA gyrase, A subunit [Allochromatium vinosum DSM 180]
	171 	171 	82% 	1e-40	Gene info linked to YP_003443943.1
YP_884429.1 	
DNA gyrase subunit A [Mycobacterium smegmatis str. MC2 155] >sp|P48354.1|GYRA_MYCS2 RecName: Full=DNA gyrase subunit A >emb|CAA63918.1| DNA gyrase subunit A [Mycobacterium smegmatis str. MC2 155] >gb|ABK69994.1| DNA gyrase, A subunit [Mycobacterium smegmatis str. MC2 155]
	171 	171 	88% 	1e-40	Gene info linked to YP_884429.1
EFU07353.1 	
DNA gyrase, A subunit [Enterococcus faecalis TX0645]
	171 	171 	83% 	1e-40	
EFT95312.1 	
DNA gyrase, A subunit [Enterococcus faecalis TX0012]
	171 	171 	83% 	1e-40	
ZP_05564990.1 	
DNA gyrase A subunit [Enterococcus faecalis Merz96] >gb|EEU67947.1| DNA gyrase A subunit [Enterococcus faecalis Merz96]
	171 	171 	83% 	1e-40	
ZP_07087708.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Chryseobacterium gleum ATCC 35910] >gb|EFK34500.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Chryseobacterium gleum ATCC 35910]
	171 	171 	82% 	1e-40	
ZP_03948152.1 	
DNA gyrase, A subunit [Enterococcus faecalis TX0104] >ref|ZP_06628585.1| DNA gyrase, A subunit [Enterococcus faecalis R712] >ref|ZP_06632467.1| DNA gyrase, A subunit [Enterococcus faecalis S613] >ref|ZP_07767748.1| DNA gyrase, A subunit [Enterococcus faecalis DAPTO 512] >ref|ZP_07791231.1| DNA gyrase, A subunit [Enterococcus faecalis DAPTO 516] >gb|EEI12400.1| DNA gyrase, A subunit [Enterococcus faecalis TX0104] >gb|EFE17327.1| DNA gyrase, A subunit [Enterococcus faecalis R712] >gb|EFE19631.1| DNA gyrase, A subunit [Enterococcus faecalis S613] >gb|EFQ08530.1| DNA gyrase, A subunit [Enterococcus faecalis DAPTO 512] >gb|EFQ66287.1| DNA gyrase, A subunit [Enterococcus faecalis DAPTO 516]
	171 	171 	83% 	1e-40	
ZP_05425113.1 	
conserved hypothetical protein [Enterococcus faecalis T2] >gb|EET98021.1| conserved hypothetical protein [Enterococcus faecalis T2]
	171 	171 	83% 	1e-40	
NP_214520.1 	
DNA gyrase subunit A [Mycobacterium tuberculosis H37Rv] >ref|YP_001281286.1| DNA gyrase subunit A [Mycobacterium tuberculosis H37Ra] >ref|ZP_02551746.1| DNA gyrase subunit A [Mycobacterium tuberculosis H37Ra] >ref|ZP_07495845.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu012] >emb|CAB02427.1| DNA GYRASE (SUBUNIT A) GYRA (DNA TOPOISOMERASE (ATP-HYDROLYSING)) (DNA TOPOISOMERASE II) (TYPE II DNA TOPOISOMERASE) [Mycobacterium tuberculosis H37Rv] >gb|ABQ71724.1| DNA gyrase subunit A [Mycobacterium tuberculosis H37Ra] >gb|EFP52733.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu012]
	171 	171 	87% 	1e-40	Gene info linked to NP_214520.1
ZP_07416631.1 	
DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu001] >ref|ZP_07487074.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu010] >ref|ZP_07491291.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu011] >gb|EFO72843.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu001] >gb|EFP45159.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu010] >gb|EFP49046.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu011]
	171 	171 	87% 	1e-40	
YP_455262.1 	
DNA gyrase subunit A [Sodalis glossinidius str. 'morsitans'] >dbj|BAE74857.1| DNA gyrase subunit A [Sodalis glossinidius str. 'morsitans']
	171 	171 	85% 	1e-40	Gene info linked to YP_455262.1
YP_004201673.1 	
DNA gyrase subunit A [Thermus scotoductus SA-01] >gb|ADW21124.1| DNA gyrase, subunit A [Thermus scotoductus SA-01]
	171 	171 	87% 	1e-40	Gene info linked to YP_004201673.1
NP_334415.1 	
DNA gyrase subunit A [Mycobacterium tuberculosis CDC1551] >ref|YP_976112.1| DNA gyrase subunit A [Mycobacterium bovis BCG str. Pasteur 1173P2] >ref|YP_976139.1| DNA gyrase subunit A [Mycobacterium bovis BCG str. Pasteur 1173P2] >ref|YP_001285951.1| DNA gyrase subunit A [Mycobacterium tuberculosis F11] >ref|ZP_03418171.1| DNA gyrase subunit A [Mycobacterium tuberculosis 02_1987] >ref|ZP_03422525.1| DNA gyrase subunit A [Mycobacterium tuberculosis 94_M4241A] >ref|ZP_03435031.1| DNA gyrase subunit A [Mycobacterium tuberculosis T85] >ref|ZP_03534518.1| DNA gyrase subunit A [Mycobacterium tuberculosis GM 1503] >ref|YP_002643056.1| DNA gyrase subunit A [Mycobacterium bovis BCG str. Tokyo 172] >ref|ZP_04926737.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis C] >ref|ZP_04982510.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis str. Haarlem] >ref|ZP_05139381.1| DNA gyrase subunit A [Mycobacterium tuberculosis '98-R604 INH-RIF-EM'] >ref|ZP_05762333.1| DNA gyrase subunit A [Mycobacterium tuberculosis CPHL_A] >ref|ZP_05770634.1| DNA gyrase subunit A [Mycobacterium tuberculosis K85] >ref|ZP_06435275.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis CPHL_A] >ref|ZP_06452809.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis K85] >ref|ZP_06507154.1| subunit A gyrA [Mycobacterium tuberculosis 02_1987] >ref|ZP_06519481.1| subunit A gyrA [Mycobacterium tuberculosis T85] >ref|ZP_06523499.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis GM 1503] >ref|ZP_06801305.1| DNA gyrase subunit A [Mycobacterium tuberculosis 210] >ref|ZP_07014813.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis 94_M4241A] >ref|ZP_07417161.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu002] >ref|ZP_07420934.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu003] >ref|ZP_07425302.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu004] >ref|ZP_07429839.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu005] >ref|ZP_07433902.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu006] >ref|ZP_07438243.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu008] >ref|ZP_07442452.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu007] >ref|ZP_07482841.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu009] >gb|AAK44229.1| DNA gyrase subunit A [Mycobacterium tuberculosis CDC1551] >emb|CAL69990.1| DNA gyrase subunit A gyrA [Mycobacterium bovis BCG str. Pasteur 1173P2] >emb|CAL70020.1| Dna gyrase subunit A gyrA (DNA topoisomerase) [Mycobacterium bovis BCG str. Pasteur 1173P2] >gb|EAY61479.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis C] >gb|EBA44023.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis str. Haarlem] >gb|ABR04349.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis F11] >dbj|BAH24308.1| DNA gyrase subunit A [Mycobacterium bovis BCG str. Tokyo 172] >gb|EFD15690.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis CPHL_A] >gb|EFD41591.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis K85] >gb|EFD55792.1| subunit A gyrA [Mycobacterium tuberculosis 02_1987] >gb|EFD75643.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis GM 1503] >gb|EFD79679.1| subunit A gyrA [Mycobacterium tuberculosis T85] >gb|EFI32492.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis 94_M4241A] >gb|EFP17012.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu002] >gb|EFP21386.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu003] >gb|EFP25129.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu004] >gb|EFP28733.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu005] >gb|EFP32747.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu006] >gb|EFP36531.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu007] >gb|EFP40449.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu008] >gb|EFP41155.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis SUMu009]
	171 	171 	87% 	1e-40	Gene info linked to NP_334415.1
Q07702.2 	
RecName: Full=DNA gyrase subunit A >gb|AAA83017.1| gyrase A [Mycobacterium tuberculosis H37Rv]
	171 	171 	87% 	1e-40	PubChem BioAssay Info linked to Q07702.2
ZP_07368204.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Pediococcus acidilactici DSM 20284] >gb|EFL95586.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Pediococcus acidilactici DSM 20284]
	171 	171 	83% 	1e-40	
ZP_03985737.1 	
DNA gyrase, A subunit [Enterococcus faecalis HH22] >gb|EEI56172.1| DNA gyrase, A subunit [Enterococcus faecalis HH22]
	171 	171 	83% 	1e-40	
YP_003705589.1 	
DNA gyrase subunit A [Truepera radiovictrix DSM 17093] >gb|ADI15046.1| DNA gyrase, A subunit [Truepera radiovictrix DSM 17093]
	171 	171 	83% 	1e-40	Gene info linked to YP_003705589.1
ZP_07645837.1 	
DNA gyrase, A subunit [Streptococcus mitis SK564] >gb|EFN99080.1| DNA gyrase, A subunit [Streptococcus mitis SK564]
	171 	171 	94% 	1e-40	
ZP_07094975.1 	
DNA gyrase, A subunit [Peptoniphilus sp. oral taxon 836 str. F0141] >gb|EFK38366.1| DNA gyrase, A subunit [Peptoniphilus sp. oral taxon 836 str. F0141]
	171 	171 	81% 	1e-40	
ZP_05568159.1 	
conserved hypothetical protein [Enterococcus faecalis HIP11704] >gb|EEU71116.1| conserved hypothetical protein [Enterococcus faecalis HIP11704]
	171 	171 	83% 	1e-40	
ZP_06290426.1 	
DNA gyrase, A subunit [Peptoniphilus lacrimalis 315-B] >gb|EFA90816.1| DNA gyrase, A subunit [Peptoniphilus lacrimalis 315-B]
	171 	171 	81% 	1e-40	
ZP_05422140.1 	
conserved hypothetical protein [Enterococcus faecalis T1] >ref|ZP_05595831.1| DNA gyrase A gyrA [Enterococcus faecalis T11] >gb|EET95048.1| conserved hypothetical protein [Enterococcus faecalis T1] >gb|EEU90625.1| DNA gyrase A gyrA [Enterococcus faecalis T11]
	171 	171 	83% 	1e-40	
ZP_04439419.1 	
DNA gyrase, A subunit [Enterococcus faecalis ATCC 29200] >gb|EEN70123.1| DNA gyrase, A subunit [Enterococcus faecalis ATCC 29200]
	171 	171 	83% 	1e-40	
NP_853676.1 	
DNA gyrase subunit A [Mycobacterium bovis AF2122/97] >emb|CAD92868.1| DNA GYRASE (SUBUNIT A) GYRA (DNA TOPOISOMERASE (ATP-HYDROLYSING)) (DNA TOPOISOMERASE II) (TYPE II DNA TOPOISOMERASE) [Mycobacterium bovis AF2122/97]
	171 	171 	87% 	1e-40	Gene info linked to NP_853676.1
EFU12242.1 	
DNA gyrase, A subunit [Enterococcus faecalis TX1341]
	171 	171 	83% 	1e-40	
ZP_05766481.1 	
DNA gyrase subunit A [Mycobacterium tuberculosis T46] >ref|ZP_06431117.1| DNA gyrase, A subunit [Mycobacterium tuberculosis T46] >gb|EFD11532.1| DNA gyrase, A subunit [Mycobacterium tuberculosis T46]
	171 	171 	87% 	1e-40	
ZP_05582852.1 	
DNA gyrase A subunit gyrA [Enterococcus faecalis CH188] >ref|ZP_07762293.1| DNA gyrase, A subunit [Enterococcus faecalis TX0635] >gb|EEU83823.1| DNA gyrase A subunit gyrA [Enterococcus faecalis CH188] >gb|EFQ16786.1| DNA gyrase, A subunit [Enterococcus faecalis TX0635] >gb|EFU91035.1| DNA gyrase, A subunit [Enterococcus faecalis TX0630]
	171 	171 	83% 	1e-40	
EFU09739.1 	
DNA gyrase, A subunit [Enterococcus faecalis TX1302]
	171 	171 	83% 	2e-40	
ZP_05779937.1 	
DNA gyrase, A subunit [Citreicella sp. SE45] >gb|EEX13701.1| DNA gyrase, A subunit [Citreicella sp. SE45]
	171 	171 	84% 	2e-40	
ZP_05575713.1 	
conserved hypothetical protein [Enterococcus faecalis E1Sol] >gb|EEU76684.1| conserved hypothetical protein [Enterococcus faecalis E1Sol]
	171 	171 	83% 	2e-40	
ZP_01693029.1 	
DNA gyrase, A subunit [Microscilla marina ATCC 23134] >gb|EAY25959.1| DNA gyrase, A subunit [Microscilla marina ATCC 23134]
	171 	171 	80% 	2e-40	
NP_813819.1 	
DNA gyrase, A subunit [Enterococcus faecalis V583] >ref|ZP_04435849.1| DNA gyrase, A subunit [Enterococcus faecalis TX1322] >ref|ZP_05475368.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200] >ref|ZP_05502439.1| conserved hypothetical protein [Enterococcus faecalis T3] >ref|ZP_05560347.1| hypothetical protein EFYG_02229 [Enterococcus faecalis T8] >ref|ZP_05561181.1| conserved hypothetical protein [Enterococcus faecalis DS5] >ref|ZP_05573048.1| conserved hypothetical protein [Enterococcus faecalis JH1] >ref|ZP_05578370.1| conserved hypothetical protein [Enterococcus faecalis Fly1] >ref|ZP_05582200.1| conserved hypothetical protein [Enterococcus faecalis D6] >ref|ZP_05598338.1| DNA gyrase subunit A gyrA [Enterococcus faecalis X98] >ref|ZP_06746601.1| DNA gyrase, A subunit [Enterococcus faecalis PC1.1] >ref|ZP_07108256.1| DNA gyrase, A subunit [Enterococcus faecalis TUSoD Ef11] >ref|ZP_07550286.1| DNA gyrase, A subunit [Enterococcus faecalis TX4248] >ref|ZP_07555227.1| DNA gyrase, A subunit [Enterococcus faecalis TX0855] >ref|ZP_07557614.1| DNA gyrase, A subunit [Enterococcus faecalis TX2134] >ref|ZP_07564234.1| DNA gyrase, A subunit [Enterococcus faecalis TX0860] >ref|ZP_07567247.1| DNA gyrase, A subunit [Enterococcus faecalis TX0109] >ref|ZP_07576415.1| DNA gyrase, A subunit [Enterococcus faecalis TX0411] >ref|ZP_07760574.1| DNA gyrase, A subunit [Enterococcus faecalis TX0470] >ref|ZP_07770609.1| DNA gyrase, A subunit [Enterococcus faecalis TX0102] >dbj|BAB69479.1| DNA gyrase A subunit [Enterococcus faecalis] >gb|AAO79891.1| DNA gyrase, A subunit [Enterococcus faecalis V583] >gb|EEN73693.1| DNA gyrase, A subunit [Enterococcus faecalis TX1322] >gb|EEU17225.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200] >gb|EEU22805.1| conserved hypothetical protein [Enterococcus faecalis T3] >gb|EEU24546.1| hypothetical protein EFYG_02229 [Enterococcus faecalis T8] >gb|EEU64138.1| conserved hypothetical protein [Enterococcus faecalis DS5] >gb|EEU74019.1| conserved hypothetical protein [Enterococcus faecalis JH1] >gb|EEU79341.1| conserved hypothetical protein [Enterococcus faecalis Fly1] >gb|EEU83171.1| conserved hypothetical protein [Enterococcus faecalis D6] >gb|EEU93132.1| DNA gyrase subunit A gyrA [Enterococcus faecalis X98] >gb|EFG20172.1| DNA gyrase, A subunit [Enterococcus faecalis PC1.1] >emb|CBL30982.1| DNA gyrase subunit A [Enterococcus sp. 7L76] >gb|EFK76458.1| DNA gyrase, A subunit [Enterococcus faecalis TUSoD Ef11] >gb|EFM65519.1| DNA gyrase, A subunit [Enterococcus faecalis TX0411] >gb|EFM71065.1| DNA gyrase, A subunit [Enterococcus faecalis TX0109] >gb|EFM72684.1| DNA gyrase, A subunit [Enterococcus faecalis TX0860] >gb|EFM75971.1| DNA gyrase, A subunit [Enterococcus faecalis TX2134] >gb|EFM78385.1| DNA gyrase, A subunit [Enterococcus faecalis TX0855] >gb|EFM83281.1| DNA gyrase, A subunit [Enterococcus faecalis TX4248] >gb|EFQ13571.1| DNA gyrase, A subunit [Enterococcus faecalis TX0102] >gb|EFQ70224.1| DNA gyrase, A subunit [Enterococcus faecalis TX0470] >gb|EFT38604.1| DNA gyrase, A subunit [Enterococcus faecalis TX2137] >gb|EFT42049.1| DNA gyrase, A subunit [Enterococcus faecalis TX4000] >gb|EFT45483.1| DNA gyrase, A subunit [Enterococcus faecalis TX0017] >gb|EFT48306.1| DNA gyrase, A subunit [Enterococcus faecalis TX0027] >gb|EFT87606.1| DNA gyrase, A subunit [Enterococcus faecalis TX2141] >gb|EFT92288.1| DNA gyrase, A subunit [Enterococcus faecalis TX4244] >gb|EFT97738.1| DNA gyrase, A subunit [Enterococcus faecalis TX0031] >gb|EFT99134.1| DNA gyrase, A subunit [Enterococcus faecalis TX0043] >gb|EFU02769.1| DNA gyrase, A subunit [Enterococcus faecalis TX0312] >gb|EFU14524.1| DNA gyrase, A subunit [Enterococcus faecalis TX1342] >gb|EFU18194.1| DNA gyrase, A subunit [Enterococcus faecalis TX1346] >gb|EFU86177.1| DNA gyrase, A subunit [Enterococcus faecalis TX0309B] >gb|EFU94128.1| DNA gyrase, A subunit [Enterococcus faecalis TX0309A] >gb|ADX78684.1| DNA gyrase, A subunit [Enterococcus faecalis 62]
	171 	171 	83% 	2e-40	Gene info linked to NP_813819.1
ZP_07641740.1 	
DNA gyrase, A subunit [Streptococcus mitis SK597] >gb|EFO00641.1| DNA gyrase, A subunit [Streptococcus mitis SK597]
	171 	171 	94% 	2e-40	
ZP_03423111.1 	
DNA gyrase subunit A [Mycobacterium tuberculosis T92] >ref|ZP_03430830.1| DNA gyrase subunit A [Mycobacterium tuberculosis EAS054] >ref|ZP_03534854.1| DNA gyrase subunit A [Mycobacterium tuberculosis T17] >ref|ZP_06448115.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis T17] >ref|ZP_06507846.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis T92] >ref|ZP_06515443.1| subunit A gyrA [Mycobacterium tuberculosis EAS054] >gb|EFD45290.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis T17] >gb|EFD56484.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis T92] >gb|EFD64081.1| subunit A gyrA [Mycobacterium tuberculosis EAS054]
	171 	171 	87% 	2e-40	
AAF85899.1 	
DNA gyrase A subunit [Streptococcus pneumoniae]
	171 	171 	94% 	2e-40	
ZP_07462838.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus mitis ATCC 6249] >gb|EFM31824.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus mitis ATCC 6249]
	171 	171 	94% 	2e-40	
YP_167281.1 	
DNA gyrase subunit A [Ruegeria pomeroyi DSS-3] >gb|AAV95322.1| DNA gyrase, A subunit [Ruegeria pomeroyi DSS-3]
	171 	171 	84% 	2e-40	Gene info linked to YP_167281.1
YP_003225708.1 	
DNA gyrase, A subunit [Zymomonas mobilis subsp. mobilis NCIB 11163] >gb|ACV75124.1| DNA gyrase, A subunit [Zymomonas mobilis subsp. mobilis NCIMB 11163]
	171 	171 	85% 	2e-40	Gene info linked to YP_003225708.1
YP_002634089.1 	
topoisomerase IV subunit A [Staphylococcus carnosus subsp. carnosus TM300] >emb|CAL27904.1| topoisomerase IV subunit A [Staphylococcus carnosus subsp. carnosus TM300]
	171 	171 	82% 	2e-40	Gene info linked to YP_002634089.1
YP_162427.1 	
DNA gyrase subunit A [Zymomonas mobilis subsp. mobilis ZM4] >gb|AAV89316.1| DNA gyrase, A subunit [Zymomonas mobilis subsp. mobilis ZM4]
	171 	171 	85% 	2e-40	Gene info linked to YP_162427.1
BAC98435.1 	
GyrA protein [Burkholderia glumae]
	171 	171 	82% 	2e-40	
ZP_04384956.1 	
DNA gyrase, A subunit [Rhodococcus erythropolis SK121] >gb|EEN87659.1| DNA gyrase, A subunit [Rhodococcus erythropolis SK121]
	171 	171 	88% 	2e-40	
ZP_04759370.1 	
DNA gyrase, A subunit [Zymomonas mobilis subsp. mobilis ATCC 10988] >gb|EER63686.1| DNA gyrase, A subunit [Zymomonas mobilis subsp. mobilis ATCC 10988]
	171 	171 	85% 	2e-40	
EEC76398.1 	
hypothetical protein OsI_14033 [Oryza sativa Indica Group] >gb|EEE60163.1| hypothetical protein OsJ_13077 [Oryza sativa Japonica Group]
	170 	170 	94% 	2e-40	
YP_003168113.1 	
DNA gyrase subunit A [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] >gb|ACV36184.1| DNA gyrase, A subunit [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
	170 	170 	85% 	2e-40	Gene info linked to YP_003168113.1
YP_002763457.1 	
DNA gyrase subunit A [Rhodococcus erythropolis PR4] >dbj|BAH30718.1| DNA gyrase subunit A [Rhodococcus erythropolis PR4]
	170 	170 	88% 	2e-40	Gene info linked to YP_002763457.1
ZP_07819601.1 	
DNA gyrase, A subunit [Porphyromonas asaccharolytica PR426713P-I] >gb|EFR35457.1| DNA gyrase, A subunit [Porphyromonas asaccharolytica PR426713P-I]
	170 	170 	83% 	2e-40	
ZP_04009479.1 	
DNA gyrase subunit A [Lactobacillus salivarius ATCC 11741] >gb|EEJ73898.1| DNA gyrase subunit A [Lactobacillus salivarius ATCC 11741]
	170 	170 	83% 	2e-40	
BAC98437.1 	
GyrA protein [Burkholderia glumae]
	170 	170 	82% 	2e-40	
ZP_08099892.1 	
DNA gyrase subunit A [Vibrio brasiliensis LMG 20546] >gb|EGA64151.1| DNA gyrase subunit A [Vibrio brasiliensis LMG 20546]
	170 	170 	82% 	2e-40	
YP_003332670.1 	
DNA gyrase, A subunit [Dickeya dadantii Ech586] >gb|ACZ75965.1| DNA gyrase, A subunit [Dickeya dadantii Ech586]
	170 	170 	85% 	2e-40	Gene info linked to YP_003332670.1
YP_534912.1 	
DNA gyrase subunit A [Lactobacillus salivarius UCC118] >ref|ZP_07206684.1| DNA gyrase, A subunit [Lactobacillus salivarius ACS-116-V-Col5a] >gb|ABD98829.1| DNA gyrase subunit A [Lactobacillus salivarius UCC118] >gb|EFK79617.1| DNA gyrase, A subunit [Lactobacillus salivarius ACS-116-V-Col5a]
	170 	170 	83% 	2e-40	Gene info linked to YP_534912.1
ZP_07204331.1 	
DNA gyrase, A subunit [delta proteobacterium NaphS2] >gb|EFK06331.1| DNA gyrase, A subunit [delta proteobacterium NaphS2]
	170 	170 	85% 	2e-40	
YP_003312820.1 	
DNA gyrase subunit A [Sanguibacter keddieii DSM 10542] >gb|ACZ19986.1| DNA gyrase subunit A [Sanguibacter keddieii DSM 10542]
	170 	170 	84% 	2e-40	Gene info linked to YP_003312820.1
YP_204587.1 	
DNA gyrase (type II topoisomerase), subunit A [Vibrio fischeri ES114] >gb|AAW85699.1| DNA gyrase (type II topoisomerase), subunit A [Vibrio fischeri ES114]
	170 	170 	88% 	2e-40	Gene info linked to YP_204587.1
YP_002156004.1 	
DNA gyrase, A subunit [Vibrio fischeri MJ11] >gb|ACH66882.1| DNA gyrase, A subunit [Vibrio fischeri MJ11]
	170 	170 	88% 	2e-40	Gene info linked to YP_002156004.1
YP_002910760.1 	
GyrA protein [Burkholderia glumae BGR1] >dbj|BAC98434.1| GyrA protein [Burkholderia glumae] >gb|ACR28056.1| GyrA protein [Burkholderia glumae BGR1]
	170 	170 	82% 	2e-40	Gene info linked to YP_002910760.1
BAC98438.1 	
GyrA protein [Burkholderia glumae]
	170 	170 	82% 	2e-40	
ZP_07380069.1 	
DNA gyrase, A subunit [Pantoea sp. aB] >gb|EFM18434.1| DNA gyrase, A subunit [Pantoea sp. aB]
	170 	170 	85% 	2e-40	
ZP_08021340.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus australis ATCC 700641] >gb|EFV99413.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus australis ATCC 700641]
	170 	170 	94% 	2e-40	
YP_003353590.1 	
DNA gyrase subunit A [Lactococcus lactis subsp. lactis KF147] >gb|ADA64841.1| DNA gyrase, subunit A [Lactococcus lactis subsp. lactis KF147]
	170 	170 	83% 	2e-40	Gene info linked to YP_003353590.1
ZP_06266848.1 	
DNA gyrase, A subunit [Pyramidobacter piscolens W5455] >gb|EFB89896.1| DNA gyrase, A subunit [Pyramidobacter piscolens W5455]
	170 	170 	82% 	2e-40	
NP_267267.1 	
DNA gyrase subunit A [Lactococcus lactis subsp. lactis Il1403] >gb|AAK05209.1|AE006343_5 DNA gyrase subunit A [Lactococcus lactis subsp. lactis Il1403]
	170 	170 	83% 	2e-40	Gene info linked to NP_267267.1
BAC98436.1 	
GyrA protein [Burkholderia glumae]
	170 	170 	82% 	2e-40	
ADT86906.1 	
DNA gyrase, subunit A [Vibrio furnissii NCTC 11218]
	170 	170 	96% 	2e-40	
YP_003271260.1 	
DNA gyrase subunit A [Gordonia bronchialis DSM 43247] >gb|ACY19367.1| DNA gyrase, A subunit [Gordonia bronchialis DSM 43247]
	170 	170 	88% 	2e-40	Gene info linked to YP_003271260.1
YP_809169.1 	
DNA gyrase subunit A [Lactococcus lactis subsp. cremoris SK11] >gb|ABJ72747.1| DNA gyrase subunit A [Lactococcus lactis subsp. cremoris SK11]
	170 	170 	83% 	2e-40	Gene info linked to YP_809169.1
ADJ60440.1 	
DNA gyrase subunit A [Lactococcus lactis subsp. cremoris NZ9000]
	170 	170 	83% 	2e-40	
ZP_01903448.1 	
DNA gyrase, A subunit [Roseobacter sp. AzwK-3b] >gb|EDM70944.1| DNA gyrase, A subunit [Roseobacter sp. AzwK-3b]
	170 	170 	84% 	2e-40	
YP_001032742.1 	
DNA gyrase subunit A [Lactococcus lactis subsp. cremoris MG1363] >emb|CAL98031.1| DNA gyrase subunit A [Lactococcus lactis subsp. cremoris MG1363]
	170 	170 	83% 	2e-40	Gene info linked to YP_001032742.1
ZP_03828096.1 	
DNA gyrase subunit A [Pectobacterium carotovorum subsp. brasiliensis PBR1692]
	170 	170 	85% 	2e-40	
YP_545797.1 	
DNA gyrase subunit A [Methylobacillus flagellatus KT] >gb|ABE49956.1| DNA gyrase subunit A [Methylobacillus flagellatus KT]
	170 	170 	83% 	2e-40	Gene info linked to YP_545797.1
ZP_01366616.1 	
hypothetical protein PaerPA_01003764 [Pseudomonas aeruginosa PACS2] >ref|YP_790012.1| DNA gyrase subunit A [Pseudomonas aeruginosa UCBPP-PA14] >ref|ZP_06877823.1| DNA gyrase subunit A [Pseudomonas aeruginosa PAb1] >gb|ABJ12393.1| DNA gyrase subunit A [Pseudomonas aeruginosa UCBPP-PA14]
	170 	170 	83% 	2e-40	
3ILW_A 	
Chain A, Structure Of Dna Gyrase Subunit A N-Terminal Domain >pdb|3ILW|B Chain B, Structure Of Dna Gyrase Subunit A N-Terminal Domain
	170 	170 	82% 	3e-40	Structure related to 3ILW_A
ZP_04573646.1 	
DNA gyrase subunit A [Fusobacterium sp. 7_1] >gb|EEO43673.1| DNA gyrase subunit A [Fusobacterium sp. 7_1]
	170 	170 	66% 	3e-40	
YP_803559.1 	
DNA gyrase subunit A [Pediococcus pentosaceus ATCC 25745] >gb|ABJ67117.1| DNA gyrase subunit A [Pediococcus pentosaceus ATCC 25745]
	170 	170 	83% 	3e-40	Gene info linked to YP_803559.1
YP_001347342.1 	
DNA gyrase subunit A [Pseudomonas aeruginosa PA7] >gb|ABR82215.1| DNA gyrase, A subunit [Pseudomonas aeruginosa PA7]
	170 	170 	83% 	3e-40	Gene info linked to YP_001347342.1
YP_003758984.1 	
DNA gyrase subunit A [Dehalogenimonas lykanthroporepellens BL-DC-9] >gb|ADJ26663.1| DNA gyrase, A subunit [Dehalogenimonas lykanthroporepellens BL-DC-9]
	170 	170 	82% 	3e-40	Gene info linked to YP_003758984.1
YP_002151463.1 	
DNA gyrase subunit A [Proteus mirabilis HI4320] >emb|CAR43604.1| DNA gyrase subunit A [Proteus mirabilis HI4320]
	170 	170 	85% 	3e-40	Gene info linked to YP_002151463.1
ZP_08044931.1 	
DNA gyrase subunit A [Haladaptatus paucihalophilus DX253] >gb|EFW91735.1| DNA gyrase subunit A [Haladaptatus paucihalophilus DX253]
	170 	170 	84% 	3e-40	
ZP_08081354.1 	

DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus ruminis ATCC 25644] >gb|EFZ34151.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus ruminis ATCC 25644]
	170 	170 	83% 	3e-40	
ZP_07715511.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Corynebacterium pseudogenitalium ATCC 33035] >gb|EFQ79291.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Corynebacterium pseudogenitalium ATCC 33035]
	170 	170 	88% 	3e-40	
ABS86855.1 	
gyrase A [Mycobacterium avium subsp. paratuberculosis]
	170 	170 	85% 	3e-40	
YP_002439504.1 	
DNA gyrase subunit A [Pseudomonas aeruginosa LESB58] >emb|CAW26628.1| DNA gyrase subunit A [Pseudomonas aeruginosa LESB58]
	170 	170 	83% 	3e-40	Gene info linked to YP_002439504.1
YP_001102288.1 	
DNA gyrase subunit A [Saccharopolyspora erythraea NRRL 2338] >ref|ZP_06563692.1| DNA gyrase subunit A [Saccharopolyspora erythraea NRRL 2338] >emb|CAL99362.1| DNA gyrase subunit A [Saccharopolyspora erythraea NRRL 2338]
	170 	170 	83% 	3e-40	Gene info linked to YP_001102288.1
NP_251858.1 	
DNA gyrase subunit A [Pseudomonas aeruginosa PAO1] >ref|ZP_04929453.1| DNA gyrase subunit A [Pseudomonas aeruginosa C3719] >ref|ZP_04935178.1| DNA gyrase subunit A [Pseudomonas aeruginosa 2192] >ref|ZP_07794484.1| DNA gyrase subunit A [Pseudomonas aeruginosa 39016] >sp|P48372.1|GYRA_PSEAE RecName: Full=DNA gyrase subunit A >gb|AAG06556.1|AE004741_1 DNA gyrase subunit A [Pseudomonas aeruginosa PAO1] >gb|AAA68625.1| gyrase A subunit [Pseudomonas aeruginosa PAO1] >gb|EAZ53572.1| DNA gyrase subunit A [Pseudomonas aeruginosa C3719] >gb|EAZ59297.1| DNA gyrase subunit A [Pseudomonas aeruginosa 2192] >gb|EFQ39580.1| DNA gyrase subunit A [Pseudomonas aeruginosa 39016]
	170 	170 	83% 	3e-40	Gene info linked to NP_251858.1PubChem BioAssay Info linked to NP_251858.1
ZP_05365123.1 	
DNA gyrase, A subunit [Corynebacterium tuberculostearicum SK141] >gb|EET78147.1| DNA gyrase, A subunit [Corynebacterium tuberculostearicum SK141]
	170 	170 	88% 	3e-40	
ZP_03840481.1 	
DNA gyrase subunit A [Proteus mirabilis ATCC 29906] >gb|EEI48648.1| DNA gyrase subunit A [Proteus mirabilis ATCC 29906]
	170 	170 	85% 	3e-40	
YP_001430478.1 	
DNA gyrase subunit A [Roseiflexus castenholzii DSM 13941] >gb|ABU56460.1| DNA gyrase, A subunit [Roseiflexus castenholzii DSM 13941]
	170 	170 	88% 	3e-40	Gene info linked to YP_001430478.1
ZP_06155641.1 	
DNA gyrase subunit A [Photobacterium damselae subsp. damselae CIP 102761] >gb|EEZ41338.1| DNA gyrase subunit A [Photobacterium damselae subsp. damselae CIP 102761]
	170 	170 	87% 	3e-40	
ZP_02424156.1 	
hypothetical protein ALIPUT_00271 [Alistipes putredinis DSM 17216] >gb|EDS04400.1| hypothetical protein ALIPUT_00271 [Alistipes putredinis DSM 17216]
	170 	170 	81% 	3e-40	
YP_001853859.1 	
DNA gyrase subunit A [Kocuria rhizophila DC2201] >dbj|BAG28353.1| DNA gyrase subunit A [Kocuria rhizophila DC2201]
	170 	170 	84% 	3e-40	Gene info linked to YP_001853859.1
YP_899704.1 	
DNA gyrase, A subunit [Pelobacter propionicus DSM 2379] >gb|ABK97646.1| DNA gyrase subunit A [Pelobacter propionicus DSM 2379]
	170 	170 	85% 	3e-40	Gene info linked to YP_899704.1
3IFZ_A 	
Chain A, Crystal Structure Of The First Part Of The Mycobacterium Tuberculosis Dna Gyrase Reaction Core: The Breakage And Reunion Domain At 2.7 A Resolution >pdb|3IFZ|B Chain B, Crystal Structure Of The First Part Of The Mycobacterium Tuberculosis Dna Gyrase Reaction Core: The Breakage And Reunion Domain At 2.7 A Resolution
	169 	169 	82% 	3e-40	Structure related to 3IFZ_A
AAM27206.1 	
DNA gyrase GyrA [Streptococcus pneumoniae]
	169 	169 	94% 	3e-40	
YP_001118807.1 	
DNA gyrase subunit A [Burkholderia vietnamiensis G4] >gb|ABO53972.1| DNA gyrase subunit A [Burkholderia vietnamiensis G4]
	169 	169 	82% 	3e-40	Gene info linked to YP_001118807.1
YP_003095573.1 	
DNA gyrase subunit A [Flavobacteriaceae bacterium 3519-10] >gb|ACU07511.1| DNA gyrase subunit A [Flavobacteriaceae bacterium 3519-10]
	169 	169 	82% 	3e-40	Gene info linked to YP_003095573.1
YP_003188917.1 	
DNA gyrase subunit A [Acetobacter pasteurianus IFO 3283-01] >dbj|BAI00538.1| DNA gyrase subunit A [Acetobacter pasteurianus IFO 3283-01] >dbj|BAI03589.1| DNA gyrase subunit A [Acetobacter pasteurianus IFO 3283-03] >dbj|BAI06634.1| DNA gyrase subunit A [Acetobacter pasteurianus IFO 3283-07] >dbj|BAI09684.1| DNA gyrase subunit A [Acetobacter pasteurianus IFO 3283-22] >dbj|BAI12732.1| DNA gyrase subunit A [Acetobacter pasteurianus IFO 3283-26] >dbj|BAI15778.1| DNA gyrase subunit A [Acetobacter pasteurianus IFO 3283-32] >dbj|BAI18759.1| DNA gyrase subunit A [Acetobacter pasteurianus IFO 3283-01-42C] >dbj|BAI21808.1| DNA gyrase subunit A [Acetobacter pasteurianus IFO 3283-12]
	169 	169 	86% 	3e-40	Gene info linked to YP_003188917.1
YP_288070.1 	
DNA gyrase subunit A [Thermobifida fusca YX] >gb|AAZ54047.1| DNA gyrase subunit A [Thermobifida fusca YX]
	169 	169 	83% 	3e-40	Gene info linked to YP_288070.1
ZP_00952180.1 	
DNA gyrase subunit A [Oceanicaulis alexandrii HTCC2633] >gb|EAP91333.1| DNA gyrase subunit A [Oceanicaulis alexandrii HTCC2633]
	169 	169 	88% 	3e-40	
ZP_05041097.1 	
DNA gyrase, A subunit [Alcanivorax sp. DG881] >gb|EDX88518.1| DNA gyrase, A subunit [Alcanivorax sp. DG881]
	169 	169 	82% 	4e-40	
CBK97526.1 	
DNA gyrase subunit A [Eubacterium siraeum 70/3]
	169 	169 	82% 	4e-40	
ZP_02423563.1 	
hypothetical protein EUBSIR_02432 [Eubacterium siraeum DSM 15702] >gb|EDR99811.1| hypothetical protein EUBSIR_02432 [Eubacterium siraeum DSM 15702]
	169 	169 	82% 	4e-40	
NP_901968.1 	
DNA gyrase subunit A [Chromobacterium violaceum ATCC 12472] >gb|AAQ59970.1| DNA gyrase, subunit A [Chromobacterium violaceum ATCC 12472]
	169 	169 	85% 	4e-40	Gene info linked to NP_901968.1
AAF85898.1 	
DNA gyrase A subunit [Streptococcus pneumoniae]
	169 	169 	94% 	4e-40	
YP_001198441.1 	
DNA gyrase subunit A [Streptococcus suis 05ZYH33] >ref|YP_001200644.1| DNA gyrase subunit A [Streptococcus suis 98HAH33] >ref|YP_003024974.1| DNA gyrase subunit A [Streptococcus suis SC84] >ref|YP_003026797.1| DNA gyrase subunit A [Streptococcus suis P1/7] >ref|YP_003028603.1| DNA gyrase subunit A [Streptococcus suis BM407] >dbj|BAB83960.1| DNA gyrase subunit A [Streptococcus suis] >gb|ABP90041.1| DNA gyrase subunit A [Streptococcus suis 05ZYH33] >gb|ABP92244.1| DNA gyrase subunit A [Streptococcus suis 98HAH33] >emb|CAZ51745.1| DNA gyrase subunit A [Streptococcus suis SC84] >emb|CAZ55705.1| DNA gyrase subunit A [Streptococcus suis BM407] >emb|CAR45950.1| DNA gyrase subunit A [Streptococcus suis P1/7] >gb|ADE31404.1| DNA gyrase subunit A [Streptococcus suis GZ1] >gb|ADV70127.1| DNA gyrase subunit A [Streptococcus suis JS14]
	169 	169 	96% 	4e-40	Gene info linked to YP_001198441.1
BAC56218.1 	
DNA gyrase subunit A [Streptococcus suis]
	169 	169 	96% 	4e-40	
ZP_07734824.1 	
DNA gyrase, A subunit [Lactobacillus iners LEAF 2053A-b] >gb|EFQ47975.1| DNA gyrase, A subunit [Lactobacillus iners LEAF 2053A-b]
	169 	169 	88% 	4e-40	
ZP_05743674.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus iners DSM 13335] >ref|ZP_07267031.1| DNA gyrase, A subunit [Lactobacillus iners AB-1] >gb|EEW51961.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus iners DSM 13335]
	169 	169 	88% 	4e-40	
YP_003211239.1 	
DNA gyrase subunit a [Cronobacter turicensis z3032] >emb|CBA32359.1| DNA gyrase subunit A [Cronobacter turicensis z3032]
	169 	169 	85% 	4e-40	Gene info linked to YP_003211239.1
ZP_07731391.1 	
DNA gyrase, A subunit [Lactobacillus iners LEAF 3008A-a] >gb|EFQ51653.1| DNA gyrase, A subunit [Lactobacillus iners LEAF 3008A-a]
	169 	169 	88% 	4e-40	
CBA05271.1 	
DNA gyrase subunit A [Neisseria meningitidis alpha275]
	169 	169 	90% 	4e-40	
ZP_06610258.1 	
DNA gyrase, A subunit [Mycoplasma alligatoris A21JP2] >gb|EFF41605.1| DNA gyrase, A subunit [Mycoplasma alligatoris A21JP2]
	169 	169 	82% 	4e-40	
YP_003199435.1 	
DNA gyrase subunit A [Nakamurella multipartita DSM 44233] >gb|ACV76446.1| DNA gyrase, A subunit [Nakamurella multipartita DSM 44233]
	169 	169 	85% 	4e-40	Gene info linked to YP_003199435.1
ZP_07643466.1 	
DNA gyrase, A subunit [Streptococcus mitis SK321] >gb|EFN97274.1| DNA gyrase, A subunit [Streptococcus mitis SK321]

	169 	169 	94% 	4e-40	
YP_003150425.1 	
DNA gyrase subunit A [Cryptobacterium curtum DSM 15641] >gb|ACU93743.1| DNA gyrase subunit A [Cryptobacterium curtum DSM 15641]
	169 	169 	85% 	4e-40	Gene info linked to YP_003150425.1
YP_003645003.1 	
DNA gyrase, A subunit [Tsukamurella paurometabola DSM 20162] >gb|ADG76664.1| DNA gyrase, A subunit [Tsukamurella paurometabola DSM 20162]
	169 	169 	88% 	5e-40	Gene info linked to YP_003645003.1
ZP_07733361.1 	
DNA gyrase, A subunit [Lactobacillus iners LEAF 2052A-d] >gb|EFQ49575.1| DNA gyrase, A subunit [Lactobacillus iners LEAF 2052A-d]
	169 	169 	88% 	5e-40	
ACI05548.1 	
GyrA [Mycobacterium indicus pranii]
	169 	169 	88% 	5e-40	
ZP_08050994.1 	
DNA gyrase, A subunit [Streptococcus sp. M334] >gb|EFX59315.1| DNA gyrase, A subunit [Streptococcus sp. M334]
	169 	169 	94% 	5e-40	
ZP_03644241.1 	
hypothetical protein BACCOPRO_02618 [Bacteroides coprophilus DSM 18228] >gb|EEF77109.1| hypothetical protein BACCOPRO_02618 [Bacteroides coprophilus DSM 18228]
	169 	169 	83% 	5e-40	
YP_003913220.1 	
DNA gyrase subunit A [Ferrimonas balearica DSM 9799] >gb|ADN76146.1| DNA gyrase subunit A [Ferrimonas balearica DSM 9799]
	169 	169 	82% 	5e-40	Gene info linked to YP_003913220.1
YP_003048425.1 	
DNA gyrase, A subunit [Methylotenera mobilis JLW8] >gb|ACT47898.1| DNA gyrase, A subunit [Methylotenera mobilis JLW8]
	169 	169 	83% 	5e-40	Gene info linked to YP_003048425.1
YP_001156872.1 	
DNA gyrase subunit A [Salinispora tropica CNB-440] >gb|ABP52494.1| DNA gyrase subunit A [Salinispora tropica CNB-440]
	169 	169 	83% 	5e-40	Gene info linked to YP_001156872.1
YP_284456.1 	
DNA gyrase subunit A [Dechloromonas aromatica RCB] >gb|AAZ45986.1| DNA gyrase subunit A [Dechloromonas aromatica RCB]
	169 	169 	83% 	5e-40	Gene info linked to YP_284456.1
ZP_07732767.1 	
DNA gyrase, A subunit [Lactobacillus iners LEAF 2062A-h1] >gb|EFQ50123.1| DNA gyrase, A subunit [Lactobacillus iners LEAF 2062A-h1]
	169 	169 	88% 	5e-40	
ZP_07701791.1 	
DNA gyrase, A subunit [Lactobacillus iners LactinV 01V1-a] >gb|EFO71047.1| DNA gyrase, A subunit [Lactobacillus iners LactinV 01V1-a]
	169 	169 	88% 	5e-40	
YP_002263175.1 	
DNA gyrase subunit A [Aliivibrio salmonicida LFI1238] >emb|CAQ79452.1| DNA gyrase subunit A [Aliivibrio salmonicida LFI1238]
	169 	169 	85% 	5e-40	Gene info linked to YP_002263175.1
ZP_07699947.1 	
DNA gyrase, A subunit [Lactobacillus iners LactinV 03V1-b] >gb|EFO69838.1| DNA gyrase, A subunit [Lactobacillus iners LactinV 03V1-b]
	169 	169 	88% 	5e-40	
ZP_03624340.1 	
DNA gyrase, A subunit [Streptococcus suis 89/1591] >ref|ZP_07249067.1| DNA gyrase subunit A [Streptococcus suis 05HAS68] >dbj|BAC56214.1| DNA gyrase subunit A [Streptococcus suis] >gb|EEF65376.1| DNA gyrase, A subunit [Streptococcus suis 89/1591]
	169 	169 	96% 	5e-40	
ZP_07907052.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus iners ATCC 55195] >gb|EFU78478.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus iners ATCC 55195]
	169 	169 	88% 	5e-40	
ZP_07698130.1 	
DNA gyrase, A subunit [Lactobacillus iners LactinV 11V1-d] >gb|EFO66083.1| DNA gyrase, A subunit [Lactobacillus iners LactinV 11V1-d]
	169 	169 	88% 	5e-40	
ZP_07698909.1 	
DNA gyrase, A subunit [Lactobacillus iners LactinV 09V1-c] >ref|ZP_07703587.1| DNA gyrase, A subunit [Lactobacillus iners SPIN 2503V10-D] >gb|EFO68007.1| DNA gyrase, A subunit [Lactobacillus iners LactinV 09V1-c] >gb|EFO71951.1| DNA gyrase, A subunit [Lactobacillus iners SPIN 2503V10-D]
	169 	169 	88% 	5e-40	
ZP_01237041.1 	
putative DNA topoisomerase (ATP-hydrolyzing) [Vibrio angustum S14] >gb|EAS62807.1| putative DNA topoisomerase (ATP-hydrolyzing) [Vibrio angustum S14]
	169 	169 	88% 	5e-40	
YP_003159988.1 	
DNA gyrase, A subunit [Jonesia denitrificans DSM 20603] >gb|ACV07685.1| DNA gyrase, A subunit [Jonesia denitrificans DSM 20603]
	169 	169 	83% 	5e-40	Gene info linked to YP_003159988.1
ZP_05913298.1 	
DNA gyrase subunit A [Brevibacterium linens BL2]
	169 	169 	84% 	5e-40	
YP_003005320.1 	
DNA gyrase subunit A [Dickeya zeae Ech1591] >gb|ACT07841.1| DNA gyrase, A subunit [Dickeya zeae Ech1591]
	169 	169 	85% 	6e-40	Gene info linked to YP_003005320.1
ZP_01881006.1 	
DNA gyrase subunit A [Roseovarius sp. TM1035] >gb|EDM30525.1| DNA gyrase subunit A [Roseovarius sp. TM1035]
	169 	169 	84% 	6e-40	
YP_001187344.1 	
DNA gyrase subunit A [Pseudomonas mendocina ymp] >gb|ABP84612.1| DNA gyrase subunit A [Pseudomonas mendocina ymp]
	169 	169 	83% 	6e-40	Gene info linked to YP_001187344.1
ADC31700.1 	
DNA gyrase subunit A [Mycoplasma gallisepticum str. F]
	169 	169 	85% 	6e-40	
YP_003674147.1 	
DNA gyrase, A subunit [Methylotenera sp. 301] >gb|ADI29570.1| DNA gyrase, A subunit [Methylotenera sp. 301]
	169 	169 	83% 	6e-40	Gene info linked to YP_003674147.1
CBL35439.1 	
DNA gyrase subunit A [Eubacterium siraeum V10Sc8a]
	169 	169 	82% 	6e-40	
YP_003621130.1 	
DNA gyrase, A subunit [Leuconostoc kimchii IMSNU 11154] >gb|ADG40161.1| DNA gyrase, A subunit [Leuconostoc kimchii IMSNU 11154]
	169 	169 	82% 	7e-40	Gene info linked to YP_003621130.1
BAC56222.1 	
DNA gyrase subunit A [Streptococcus suis]
	169 	169 	96% 	7e-40	
ZP_04716873.1 	
DNA gyrase, A subunit [Alteromonas macleodii ATCC 27126]
	169 	169 	85% 	7e-40	
BAC56225.1 	
DNA gyrase subunit A [Streptococcus suis]
	169 	169 	96% 	7e-40	
YP_825227.1 	
DNA gyrase subunit A [Candidatus Solibacter usitatus Ellin6076] >gb|ABJ84942.1| DNA gyrase subunit A [Candidatus Solibacter usitatus Ellin6076]
	169 	169 	84% 	7e-40	Gene info linked to YP_825227.1
ZP_03973773.1 	
DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus reuteri CF48-3A] >ref|ZP_07126252.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus reuteri SD2112] >gb|ABS84202.1| DNA gyrase A subunit [Lactobacillus reuteri] >gb|EEI66363.1| DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus reuteri CF48-3A] >gb|EFK87554.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus reuteri SD2112]
	169 	169 	82% 	7e-40	
EFR58717.1 	
DNA gyrase, A subunit [Alistipes sp. HGB5]
	169 	169 	83% 	7e-40	
YP_001270619.1 	
DNA gyrase subunit A [Lactobacillus reuteri DSM 20016] >ref|YP_001841002.1| DNA gyrase subunit A [Lactobacillus reuteri JCM 1112] >ref|ZP_03848405.1| DNA gyrase subunit A [Lactobacillus reuteri MM2-3] >ref|ZP_03961849.1| DNA gyrase subunit A [Lactobacillus reuteri MM4-1A] >gb|ABQ82282.1| DNA gyrase subunit A [Lactobacillus reuteri DSM 20016] >dbj|BAG24522.1| DNA gyrase subunit A [Lactobacillus reuteri JCM 1112] >gb|EEI08955.1| DNA gyrase subunit A [Lactobacillus reuteri MM2-3] >gb|EEI73671.1| DNA gyrase subunit A [Lactobacillus reuteri MM4-1A]
	169 	169 	82% 	7e-40	Gene info linked to YP_001270619.1
YP_004112880.1 	
DNA gyrase subunit A [Desulfurispirillum indicum S5] >gb|ADU66324.1| DNA gyrase, A subunit [Desulfurispirillum indicum S5]
	168 	168 	96% 	7e-40	Gene info linked to YP_004112880.1
YP_917627.1 	
DNA gyrase subunit A [Paracoccus denitrificans PD1222] >gb|ABL71931.1| DNA gyrase, A subunit [Paracoccus denitrificans PD1222]
	168 	168 	84% 	7e-40	Gene info linked to YP_917627.1
ZP_05925312.1 	
DNA gyrase subunit A [Vibrio sp. RC341] >gb|EEX66597.1| DNA gyrase subunit A [Vibrio sp. RC341]
	168 	168 	96% 	7e-40	
ZP_06161683.1 	
DNA gyrase, A subunit [Actinomyces sp. oral taxon 848 str. F0332] >gb|EEZ79104.1| DNA gyrase, A subunit [Actinomyces sp. oral taxon 848 str. F0332]
	168 	168 	83% 	8e-40	
YP_001358923.1 	
DNA gyrase subunit A [Sulfurovum sp. NBC37-1] >dbj|BAF72566.1| DNA gyrase subunit A [Sulfurovum sp. NBC37-1]
	168 	168 	82% 	8e-40	Gene info linked to YP_001358923.1
ZP_05719378.1 	
DNA gyrase, subunit A [Vibrio mimicus VM603] >ref|ZP_06033246.1| DNA gyrase subunit A [Vibrio mimicus VM223] >gb|EEW08080.1| DNA gyrase, subunit A [Vibrio mimicus VM603] >gb|EEY43893.1| DNA gyrase subunit A [Vibrio mimicus VM223]
	168 	168 	96% 	8e-40	
NP_072664.1 	
DNA gyrase subunit A [Mycoplasma genitalium G37] >ref|ZP_05405432.1| DNA gyrase subunit A [Mycoplasma genitalium G37] >sp|P47250.1|GYRA_MYCGE RecName: Full=DNA gyrase subunit A >gb|AAC71220.1| DNA gyrase, A subunit [Mycoplasma genitalium G37] >gb|ABY79415.1| DNA gyrase, A subunit [synthetic Mycoplasma genitalium JCVI-1.0]
	168 	168 	85% 	8e-40	Gene info linked to NP_072664.1
YP_003376211.1 	
DNA gyrase, subunit a protein [Xanthomonas albilineans GPE PC73] >emb|CBA16221.1| probable dna gyrase, subunit a protein [Xanthomonas albilineans]
	168 	168 	81% 	8e-40	Gene info linked to YP_003376211.1
ZP_06078960.1 	
DNA gyrase subunit A [Vibrio sp. RC586] >gb|EEZ00314.1| DNA gyrase subunit A [Vibrio sp. RC586]
	168 	168 	96% 	8e-40	
ZP_03073395.1 	
DNA gyrase, A subunit [Lactobacillus reuteri 100-23] >gb|EDX43341.1| DNA gyrase, A subunit [Lactobacillus reuteri 100-23]
	168 	168 	82% 	8e-40	
ZP_01075180.1 	
DNA gyrase subunit A [Marinomonas sp. MED121] >gb|EAQ66940.1| DNA gyrase subunit A [Marinomonas sp. MED121]
	168 	168 	83% 	8e-40	
ADI06407.1 	
DNA topoisomerase IV subunit A [Streptomyces bingchenggensis BCW-1]
	168 	168 	84% 	8e-40	
ZP_05120117.1 	
DNA gyrase, A subunit [Vibrio parahaemolyticus 16] >gb|EED26094.1| DNA gyrase, A subunit [Vibrio parahaemolyticus 16]
	168 	168 	82% 	8e-40	
YP_003881998.1 	
DNA gyrase subunit A [Dickeya dadantii 3937] >gb|ADM97441.1| DNA gyrase subunit A [Dickeya dadantii 3937]
	168 	168 	85% 	8e-40	Gene info linked to YP_003881998.1
ZP_07283704.1 	
DNA gyrase, A subunit [Streptomyces sp. AA4] >gb|EFL12073.1| DNA gyrase, A subunit [Streptomyces sp. AA4]
	168 	168 	85% 	8e-40	
BAA77788.1 	
DNA gyrase [Vibrio parahaemolyticus]
	168 	168 	82% 	8e-40	
ZP_05715247.1 	
DNA gyrase, subunit A [Vibrio mimicus VM573] >ref|ZP_06039396.1| DNA gyrase subunit A [Vibrio mimicus MB-451] >gb|EEW12276.1| DNA gyrase, subunit A [Vibrio mimicus VM573] >gb|EEY38780.1| DNA gyrase subunit A [Vibrio mimicus MB-451]
	168 	168 	96% 	8e-40	
YP_003446119.1 	
DNA gyrase, subunit A [Streptococcus mitis B6] >emb|CBJ22254.1| DNA gyrase, subunit A [Streptococcus mitis B6]
	168 	168 	94% 	8e-40	Gene info linked to YP_003446119.1
YP_061220.1 	
DNA gyrase subunit A [Leifsonia xyli subsp. xyli str. CTCB07] >gb|AAT88115.1| DNA gyrase subunit A [Leifsonia xyli subsp. xyli str. CTCB07]
	168 	168 	84% 	8e-40	Gene info linked to YP_061220.1
YP_002880035.1 	
DNA gyrase, A subunit [Beutenbergia cavernae DSM 12333] >gb|ACQ78273.1| DNA gyrase, A subunit [Beutenbergia cavernae DSM 12333]
	168 	168 	83% 	8e-40	Gene info linked to YP_002880035.1
NP_798311.1 	
DNA gyrase subunit A [Vibrio parahaemolyticus RIMD 2210633] >ref|ZP_01992216.1| DNA gyrase, A subunit [Vibrio parahaemolyticus AQ3810] >ref|ZP_05776479.1| DNA gyrase, A subunit [Vibrio parahaemolyticus K5030] >ref|ZP_05892093.1| DNA gyrase, A subunit [Vibrio parahaemolyticus AN-5034] >ref|ZP_05907229.1| DNA gyrase, A subunit [Vibrio parahaemolyticus Peru-466] >ref|ZP_05909996.1| DNA gyrase, A subunit [Vibrio parahaemolyticus AQ4037] >dbj|BAC60195.1| DNA gyrase, subunit A [Vibrio parahaemolyticus RIMD 2210633] >gb|EDM57918.1| DNA gyrase, A subunit [Vibrio parahaemolyticus AQ3810] >gb|EFO36303.1| DNA gyrase, A subunit [Vibrio parahaemolyticus Peru-466] >gb|EFO42977.1| DNA gyrase, A subunit [Vibrio parahaemolyticus AN-5034] >gb|EFO46225.1| DNA gyrase, A subunit [Vibrio parahaemolyticus AQ4037] >gb|EFO50936.1| DNA gyrase, A subunit [Vibrio parahaemolyticus K5030]
	168 	168 	82% 	8e-40	Gene info linked to NP_798311.1
YP_003520907.1 	
GyrA [Pantoea ananatis LMG 20103] >gb|ADD77779.1| GyrA [Pantoea ananatis LMG 20103]
	168 	168 	85% 	8e-40	Gene info linked to YP_003520907.1
ZP_01261646.1 	
DNA gyrase, subunit A [Vibrio alginolyticus 12G01] >gb|EAS75003.1| DNA gyrase, subunit A [Vibrio alginolyticus 12G01]
	168 	168 	82% 	8e-40	
AAA57072.1 	
DNA gyrase subunit A [Mycoplasma genitalium]
	168 	168 	85% 	9e-40	
ABY87166.1 	
DNA gyrase A [Xanthomonas albilineans]
	168 	168 	81% 	9e-40	
YP_003686978.1 	
DNA gyrase subunit A [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1] >emb|CBL55517.1| DNA gyrase subunit A [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
	168 	168 	83% 	9e-40	Gene info linked to YP_003686978.1
YP_002513606.1 	
DNA gyrase, A subunit [Thioalkalivibrio sp. HL-EbGR7] >gb|ACL72619.1| DNA gyrase, A subunit [Thioalkalivibrio sp. HL-EbGR7]
	168 	168 	83% 	9e-40	Gene info linked to YP_002513606.1
ZP_03586547.1 	
DNA gyrase, A subunit [Burkholderia multivorans CGD1] >gb|EED98834.1| DNA gyrase, A subunit [Burkholderia multivorans CGD1]
	168 	168 	82% 	9e-40	
YP_003285736.1 	
DNA gyrase subunit A [Vibrio sp. Ex25] >gb|ACY51271.1| DNA gyrase subunit A [Vibrio sp. Ex25]
	168 	168 	82% 	9e-40	Gene info linked to YP_003285736.1
EFS86518.1 	
DNA gyrase, A subunit [Propionibacterium acnes HL001PA1] >gb|EFT09871.1| DNA gyrase, A subunit [Propionibacterium acnes HL082PA2] >gb|EFT66429.1| DNA gyrase, A subunit [Propionibacterium acnes HL060PA1]
	168 	168 	83% 	9e-40	
YP_001450518.1 	
DNA gyrase subunit A [Streptococcus gordonii str. Challis substr. CH1] >gb|ABV10548.1| DNA gyrase, A subunit [Streptococcus gordonii str. Challis substr. CH1]
	168 	168 	94% 	9e-40	Gene info linked to YP_001450518.1
ACF04292.1 	
GyrA [Neisseria meningitidis] >gb|ACF04293.1| GyrA [Neisseria meningitidis]
	168 	168 	90% 	9e-40	
BAC56228.1 	
DNA gyrase subunit A [Streptococcus suis]
	168 	168 	96% 	9e-40	
EFT77149.1 	
DNA gyrase, A subunit [Propionibacterium acnes HL050PA2]
	168 	168 	83% 	1e-39	
ZP_06262384.1 	
DNA gyrase, A subunit [Propionibacterium acnes J139] >gb|EFB87880.1| DNA gyrase, A subunit [Propionibacterium acnes J139] >gb|EFT27005.1| DNA gyrase, A subunit [Propionibacterium acnes HL110PA3] >gb|EFT63195.1| DNA gyrase, A subunit [Propionibacterium acnes HL110PA4]
	168 	168 	83% 	1e-39	
ZP_05986432.1 	
DNA gyrase, A subunit [Neisseria lactamica ATCC 23970] >gb|EEZ76382.1| DNA gyrase, A subunit [Neisseria lactamica ATCC 23970]
	168 	168 	90% 	1e-39	
ZP_06181138.1 	
DNA gyrase, subunit A [Vibrio alginolyticus 40B] >gb|EEZ82595.1| DNA gyrase, subunit A [Vibrio alginolyticus 40B]
	168 	168 	82% 	1e-39	
ZP_06805054.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Brevibacterium mcbrellneri ATCC 49030] >gb|EFG48036.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Brevibacterium mcbrellneri ATCC 49030]
	168 	168 	84% 	1e-39	
ZP_03574294.1 	
DNA gyrase, A subunit [Burkholderia multivorans CGD2M] >ref|ZP_03579305.1| DNA gyrase, A subunit [Burkholderia multivorans CGD2] >gb|EEE06035.1| DNA gyrase, A subunit [Burkholderia multivorans CGD2] >gb|EEE11511.1| DNA gyrase, A subunit [Burkholderia multivorans CGD2M]
	168 	168 	82% 	1e-39	
ACF04296.1 	
GyrA [Neisseria meningitidis]
	168 	168 	90% 	1e-39	
YP_003029922.1 	
DNA gyrase subunit A gyrA [Mycobacterium tuberculosis KZN 1435] >ref|ZP_05222838.1| DNA gyrase subunit A [Mycobacterium tuberculosis KZN 4207] >ref|ZP_06950254.1| DNA gyrase subunit A [Mycobacterium tuberculosis KZN 4207] >ref|ZP_07813652.1| DNA gyrase subunit A [Mycobacterium tuberculosis KZN V2475] >gb|ACT23027.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis KZN 1435]
	168 	168 	87% 	1e-39	Gene info linked to YP_003029922.1
YP_001580446.1 	
DNA gyrase subunit A [Burkholderia multivorans ATCC 17616] >ref|YP_001945457.1| DNA gyrase subunit A [Burkholderia multivorans ATCC 17616] >gb|ABX15949.1| DNA gyrase, A subunit [Burkholderia multivorans ATCC 17616] >dbj|BAG42921.1| DNA gyrase subunit A [Burkholderia multivorans ATCC 17616]
	168 	168 	82% 	1e-39	Gene info linked to YP_001580446.1
ZP_06441466.1 	
DNA gyrase subunit A gyrA [Mycobacterium tuberculosis KZN 605] >ref|ZP_06958561.1| DNA gyrase subunit A [Mycobacterium tuberculosis KZN R506] >gb|EFD19381.1| DNA gyrase subunit A gyrA [Mycobacterium tuberculosis KZN 605]
	168 	168 	87% 	1e-39	
NP_274400.1 	
DNA gyrase subunit A [Neisseria meningitidis MC58] >ref|YP_003083400.1| DNA gyrase subunit A [Neisseria meningitidis alpha14] >gb|AAF41750.1| DNA gyrase subunit A [Neisseria meningitidis MC58] >emb|CBA06523.1| DNA gyrase subunit A [Neisseria meningitidis alpha14] >gb|ADO31822.1| DNA gyrase subunit A [Neisseria meningitidis alpha710] >gb|EFV63181.1| DNA gyrase, A subunit [Neisseria meningitidis H44/76]
	168 	168 	90% 	1e-39	Gene info linked to NP_274400.1
CBA76530.1 	
DNA gyrase subunit A [Arsenophonus nasoniae]
	168 	168 	85% 	1e-39	
EFS77346.1 	
DNA gyrase, A subunit [Propionibacterium acnes HL086PA1]
	168 	168 	83% 	1e-39	
YP_003580202.1 	
DNA gyrase, A subunit [Propionibacterium acnes SK137] >gb|ADE00537.1| DNA gyrase, A subunit [Propionibacterium acnes SK137] >gb|EFS37022.1| DNA gyrase, A subunit [Propionibacterium acnes HL074PA1] >gb|EFS49493.1| DNA gyrase, A subunit [Propionibacterium acnes HL083PA1] >gb|EFS70027.1| DNA gyrase, A subunit [Propionibacterium acnes HL007PA1] >gb|EFS70487.1| DNA gyrase, A subunit [Propionibacterium acnes HL056PA1] >gb|EFT19302.1| DNA gyrase, A subunit [Propionibacterium acnes HL053PA1] >gb|EFT21716.1| DNA gyrase, A subunit [Propionibacterium acnes HL045PA1] >gb|EFT29286.1| DNA gyrase, A subunit [Propionibacterium acnes HL005PA1] >gb|EFT69129.1| DNA gyrase, A subunit [Propionibacterium acnes HL038PA1]
	168 	168 	83% 	1e-39	Gene info linked to YP_003580202.1
EFT07963.1 	
DNA gyrase, A subunit [Propionibacterium acnes HL082PA1]
	168 	168 	83% 	1e-39	
ZP_01948050.1 	
DNA gyrase, subunit A [Vibrio cholerae 1587] >gb|EAY35460.1| DNA gyrase, subunit A [Vibrio cholerae 1587]
	168 	168 	96% 	1e-39	
ZP_01809751.1 	
DNA gyrase subunit A [Campylobacter jejuni subsp. jejuni CG8486] >gb|EDK22636.1| DNA gyrase subunit A [Campylobacter jejuni subsp. jejuni CG8486]
	168 	168 	82% 	1e-39	
ZP_01955901.1 	
DNA gyrase, subunit A [Vibrio cholerae MZO-3] >ref|ZP_04419052.1| DNA gyrase subunit A [Vibrio cholerae 12129(1)] >gb|EAY41883.1| DNA gyrase, subunit A [Vibrio cholerae MZO-3] >gb|EEN98922.1| DNA gyrase subunit A [Vibrio cholerae 12129(1)]
	168 	168 	96% 	1e-39	
ZP_06425971.1 	
DNA gyrase, A subunit [Propionibacterium acnes SK187] >ref|ZP_06429144.1| DNA gyrase, A subunit [Propionibacterium acnes J165] >gb|EFD03567.1| DNA gyrase, A subunit [Propionibacterium acnes SK187] >gb|EFD07552.1| DNA gyrase, A subunit [Propionibacterium acnes J165] >gb|EFS40644.1| DNA gyrase, A subunit [Propionibacterium acnes HL110PA1] >gb|EFS44742.1| DNA gyrase, A subunit [Propionibacterium acnes HL110PA2] >gb|EFS45364.1| DNA gyrase, A subunit [Propionibacterium acnes HL087PA2] >gb|EFS51926.1| DNA gyrase, A subunit [Propionibacterium acnes HL025PA1] >gb|EFS53142.1| DNA gyrase, A subunit [Propionibacterium acnes HL059PA1] >gb|EFS55367.1| DNA gyrase, A subunit [Propionibacterium acnes HL046PA2] >gb|EFS59236.1| DNA gyrase, A subunit [Propionibacterium acnes HL036PA1] >gb|EFS62248.1| DNA gyrase, A subunit [Propionibacterium acnes HL036PA2] >gb|EFS63916.1| DNA gyrase, A subunit [Propionibacterium acnes HL063PA1] >gb|EFS66707.1| DNA gyrase, A subunit [Propionibacterium acnes HL063PA2] >gb|EFS80055.1| DNA gyrase, A subunit [Propionibacterium acnes HL005PA4] >gb|EFS90154.1| DNA gyrase, A subunit [Propionibacterium acnes HL036PA3] >gb|EFS94739.1| DNA gyrase, A subunit [Propionibacterium acnes HL067PA1] >gb|EFS99701.1| DNA gyrase, A subunit [Propionibacterium acnes HL027PA1] >gb|EFT03271.1| DNA gyrase, A subunit [Propionibacterium acnes HL002PA1] >gb|EFT05773.1| DNA gyrase, A subunit [Propionibacterium acnes HL002PA2] >gb|EFT13170.1| DNA gyrase, A subunit [Propionibacterium acnes HL037PA1] >gb|EFT24341.1| DNA gyrase, A subunit [Propionibacterium acnes HL072PA2] >gb|EFT31195.1| DNA gyrase, A subunit [Propionibacterium acnes HL005PA2] >gb|EFT34787.1| DNA gyrase, A subunit [Propionibacterium acnes HL005PA3] >gb|EFT51015.1| DNA gyrase, A subunit [Propionibacterium acnes HL053PA2] >gb|EFT53464.1| DNA gyrase, A subunit [Propionibacterium acnes HL078PA1] >gb|EFT55066.1| DNA gyrase, A subunit [Propionibacterium acnes HL027PA2] >gb|EFT58599.1| DNA gyrase, A subunit [Propionibacterium acnes HL002PA3] >gb|EFT60000.1| DNA gyrase, A subunit [Propionibacterium acnes HL072PA1] >gb|EFT71308.1| DNA gyrase, A subunit [Propionibacterium acnes HL059PA2] >gb|EFT81831.1| DNA gyrase, A subunit [Propionibacterium acnes HL030PA2]
	168 	168 	83% 	1e-39	
YP_001883863.1 	
DNA gyrase subunit A [Borrelia hermsii DAH] >gb|AAX16943.1| DNA gyrase subunit A [Borrelia hermsii DAH]
	168 	168 	81% 	1e-39	Gene info linked to YP_001883863.1
YP_179162.1 	
DNA gyrase subunit A [Campylobacter jejuni RM1221] >gb|AAW35497.1| DNA gyrase, A subunit [Campylobacter jejuni RM1221] >gb|ADT72799.1| DNA gyrase subunit A [Campylobacter jejuni subsp. jejuni S3]

	168 	168 	82% 	1e-39	Gene info linked to YP_179162.1
EFS36379.1 	
DNA gyrase, A subunit [Propionibacterium acnes HL013PA1] >gb|EFS81322.1| DNA gyrase, A subunit [Propionibacterium acnes HL050PA1] >gb|EFS85658.1| DNA gyrase, A subunit [Propionibacterium acnes HL050PA3] >gb|EFT74304.1| DNA gyrase, A subunit [Propionibacterium acnes HL046PA1]
	168 	168 	83% 	1e-39	
ZP_04400652.1 	
DNA gyrase subunit A [Vibrio cholerae B33] >gb|EEO16079.1| DNA gyrase subunit A [Vibrio cholerae B33]
	168 	168 	96% 	1e-39	
CAA70294.1 	
DNA gyrase subunit A [Rhodobacter sphaeroides]
	168 	168 	81% 	1e-39	
YP_054731.1 	
DNA gyrase subunit A [Propionibacterium acnes KPA171202] >gb|AAT81773.1| DNA gyrase subunit A [Propionibacterium acnes KPA171202] >gb|EFT79464.1| DNA gyrase, A subunit [Propionibacterium acnes HL030PA1]
	168 	168 	83% 	1e-39	Gene info linked to YP_054731.1
ZP_06373903.1 	
DNA gyrase subunit A [Campylobacter jejuni subsp. jejuni 1336] >gb|EFC30932.1| DNA gyrase subunit A [Campylobacter jejuni subsp. jejuni 1336]
	168 	168 	82% 	1e-39	
ZP_04410790.1 	
DNA gyrase subunit A [Vibrio cholerae TM 11079-80] >gb|EEO06472.1| DNA gyrase subunit A [Vibrio cholerae TM 11079-80]
	168 	168 	96% 	1e-39	
ZP_04405090.1 	
DNA gyrase subunit A [Vibrio cholerae TMA 21] >gb|EEO12360.1| DNA gyrase subunit A [Vibrio cholerae TMA 21]
	167 	167 	96% 	1e-39	
ZP_01979964.1 	
DNA gyrase, subunit A [Vibrio cholerae MZO-2] >gb|EDM53130.1| DNA gyrase, subunit A [Vibrio cholerae MZO-2]
	167 	167 	96% 	1e-39	
ZP_07369480.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Neisseria meningitidis ATCC 13091] >gb|EFM04787.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Neisseria meningitidis ATCC 13091]
	167 	167 	90% 	1e-39	
YP_975334.1 	
DNA gyrase subunit A [Neisseria meningitidis FAM18] >emb|CAM10548.1| DNA gyrase subunit A [Neisseria meningitidis FAM18]
	167 	167 	90% 	1e-39	Gene info linked to YP_975334.1
YP_001000706.1 	
DNA gyrase subunit A [Campylobacter jejuni subsp. jejuni 81-176] >ref|ZP_02271385.1| DNA gyrase subunit A [Campylobacter jejuni subsp. jejuni 81-176] >gb|EAQ72106.1| DNA gyrase, A subunit [Campylobacter jejuni subsp. jejuni 81-176]
	167 	167 	82% 	1e-39	Gene info linked to YP_001000706.1
NP_230903.1 	
DNA gyrase, subunit A [Vibrio cholerae O1 biovar El Tor str. N16961] >ref|ZP_01678064.1| DNA gyrase, subunit A [Vibrio cholerae 2740-80] >ref|ZP_01682231.1| DNA gyrase, subunit A [Vibrio cholerae V52] >ref|YP_001216823.1| DNA gyrase, subunit A [Vibrio cholerae O395] >ref|YP_002809981.1| DNA gyrase, subunit A [Vibrio cholerae M66-2] >ref|ZP_04394665.1| DNA gyrase subunit A [Vibrio cholerae BX 330286] >ref|ZP_04407736.1| DNA gyrase subunit A [Vibrio cholerae RC9] >ref|ZP_04415262.1| DNA gyrase subunit A [Vibrio cholerae bv. albensis VL426] >ref|YP_002878823.1| DNA gyrase subunit A [Vibrio cholerae MJ-1236] >ref|ZP_05237732.1| DNA gyrase [Vibrio cholerae MO10] >ref|ZP_06030181.1| DNA gyrase subunit A [Vibrio cholerae INDRE 91/1] >ref|ZP_06037119.1| DNA gyrase subunit A [Vibrio cholerae RC27] >gb|AAF94417.1| DNA gyrase, subunit A [Vibrio cholerae O1 biovar El Tor str. N16961] >gb|EAX57525.1| DNA gyrase, subunit A [Vibrio cholerae 2740-80] >gb|EAX60960.1| DNA gyrase, subunit A [Vibrio cholerae V52] >gb|ABQ20112.1| DNA gyrase, subunit A [Vibrio cholerae O395] >gb|ACP05530.1| DNA gyrase, subunit A [Vibrio cholerae M66-2] >gb|ACP09385.1| DNA gyrase, subunit A [Vibrio cholerae O395] >gb|EEO04455.1| DNA gyrase subunit A [Vibrio cholerae bv. albensis VL426] >gb|EEO09981.1| DNA gyrase subunit A [Vibrio cholerae RC9] >gb|EEO22295.1| DNA gyrase subunit A [Vibrio cholerae BX 330286] >gb|ACQ61253.1| DNA gyrase subunit A [Vibrio cholerae MJ-1236] >gb|EET22501.1| DNA gyrase [Vibrio cholerae MO10] >gb|EEY40949.1| DNA gyrase subunit A [Vibrio cholerae RC27] >gb|EEY47906.1| DNA gyrase subunit A [Vibrio cholerae INDRE 91/1]
	167 	167 	96% 	1e-39	Gene info linked to NP_230903.1
YP_003657431.1 	
DNA gyrase subunit A [Segniliparus rotundus DSM 44985] >gb|ADG96600.1| DNA gyrase, A subunit [Segniliparus rotundus DSM 44985]
	167 	167 	83% 	1e-39	Gene info linked to YP_003657431.1
YP_003377941.1 	
DNA gyrase subunit A [Kribbella flavida DSM 17836] >gb|ADB29142.1| DNA gyrase, A subunit [Kribbella flavida DSM 17836]
	167 	167 	83% 	1e-39	Gene info linked to YP_003377941.1
YP_003559767.1 	
DNA gyrase, A subunit [Mycoplasma crocodyli MP145] >gb|ADE19889.1| DNA gyrase, A subunit [Mycoplasma crocodyli MP145]
	167 	167 	98% 	1e-39	Gene info linked to YP_003559767.1
YP_003635126.1 	
DNA gyrase, A subunit [Cellulomonas flavigena DSM 20109] >gb|ADG72927.1| DNA gyrase, A subunit [Cellulomonas flavigena DSM 20109]
	167 	167 	85% 	1e-39	Gene info linked to YP_003635126.1
ZP_02884869.1 	
DNA gyrase, A subunit [Burkholderia graminis C4D1M] >gb|EDT09663.1| DNA gyrase, A subunit [Burkholderia graminis C4D1M]
	167 	167 	82% 	1e-39	
YP_904257.1 	
DNA gyrase subunit A [Mycobacterium ulcerans Agy99] >gb|ABL02786.1| DNA gyrase (subunit A) GyrA [Mycobacterium ulcerans Agy99]
	167 	167 	88% 	1e-39	Gene info linked to YP_904257.1
ZP_06372096.1 	
DNA gyrase subunit A [Campylobacter jejuni subsp. jejuni 414] >gb|EFC32731.1| DNA gyrase subunit A [Campylobacter jejuni subsp. jejuni 414]
	167 	167 	82% 	1e-39	
ZP_01068665.1 	
DNA gyrase, A subunit [Campylobacter jejuni subsp. jejuni CF93-6] >gb|EAQ56299.1| DNA gyrase, A subunit [Campylobacter jejuni subsp. jejuni CF93-6]
	167 	167 	82% 	1e-39	
ZP_05419603.1 	
DNA gyrase subunit A [Vibrio cholera CIRS 101] >gb|EET92127.1| DNA gyrase subunit A [Vibrio cholera CIRS 101]
	167 	167 	96% 	1e-39	
YP_001482540.1 	
DNA gyrase subunit A [Campylobacter jejuni subsp. jejuni 81116] >gb|ABV52563.1| DNA gyrase subunit A [Campylobacter jejuni subsp. jejuni 81116] >gb|ADN91196.1| DNA gyrase subunit A [Campylobacter jejuni subsp. jejuni M1] >gb|EFV11100.1| DNA gyrase, A subunit [Campylobacter jejuni subsp. jejuni 327]
	167 	167 	82% 	1e-39	Gene info linked to YP_001482540.1
YP_368394.1 	
DNA gyrase subunit A [Burkholderia sp. 383] >gb|ABB07750.1| DNA gyrase subunit A [Burkholderia sp. 383]
	167 	167 	82% 	1e-39	Gene info linked to YP_368394.1
ZP_03924510.1 	
DNA topoisomerase (ATP-hydrolyzing) [Actinomyces coleocanis DSM 15436] >gb|EEH64311.1| DNA topoisomerase (ATP-hydrolyzing) [Actinomyces coleocanis DSM 15436]
	167 	167 	96% 	1e-39	
YP_001300549.1 	
DNA gyrase A subunit [Bacteroides vulgatus ATCC 8482] >ref|ZP_06743173.1| DNA gyrase, A subunit [Bacteroides vulgatus PC510] >gb|ABR40927.1| DNA gyrase A subunit [Bacteroides vulgatus ATCC 8482] >gb|EFG16975.1| DNA gyrase, A subunit [Bacteroides vulgatus PC510]
	167 	167 	83% 	1e-39	Gene info linked to YP_001300549.1
ZP_01972319.1 	
DNA gyrase, subunit A [Vibrio cholerae NCTC 8457] >gb|EAZ72405.1| DNA gyrase, subunit A [Vibrio cholerae NCTC 8457]
	167 	167 	96% 	1e-39	
AAZ92933.1 	
DNA gyrase subunit A [Streptococcus pneumoniae]
	167 	167 	94% 	1e-39	
AAZ92939.1 	
DNA gyrase subunit A [Streptococcus pneumoniae]
	167 	167 	94% 	1e-39	
YP_001856973.1 	
DNA gyrase subunit A [Burkholderia phymatum STM815] >gb|ACC69927.1| DNA gyrase, A subunit [Burkholderia phymatum STM815]
	167 	167 	83% 	1e-39	Gene info linked to YP_001856973.1
ZP_01099281.1 	
DNA gyrase, A subunit [Campylobacter jejuni subsp. jejuni 84-25] >ref|YP_002344422.1| DNA gyrase subunit A [Campylobacter jejuni subsp. jejuni NCTC 11168] >sp|Q03470.1|GYRA_CAMJE RecName: Full=DNA gyrase subunit A >gb|AAA23028.1| DNA gyrase A [Campylobacter jejuni] >gb|EAQ94857.1| DNA gyrase, A subunit [Campylobacter jejuni subsp. jejuni 84-25] >emb|CAL35145.1| DNA gyrase subunit A [Campylobacter jejuni subsp. jejuni NCTC 11168] >gb|ADC28609.1| DNA gyrase subunit A [Campylobacter jejuni subsp. jejuni IA3902] >gb|EFV07289.1| DNA gyrase, A subunit [Campylobacter jejuni subsp. jejuni DFVF1099]
	167 	167 	82% 	1e-39	
ZP_08102731.1 	
DNA gyrase subunit A [Vibrio sinaloensis DSM 21326] >gb|EGA70188.1| DNA gyrase subunit A [Vibrio sinaloensis DSM 21326]
	167 	167 	96% 	1e-39	
ZP_08061563.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus infantis ATCC 700779] >gb|EFX36727.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus infantis ATCC 700779]
	167 	167 	94% 	1e-39	
ZP_01071144.1 	
DNA gyrase, A subunit [Campylobacter jejuni subsp. jejuni HB93-13] >gb|EAQ61034.1| DNA gyrase, A subunit [Campylobacter jejuni subsp. jejuni HB93-13]
	167 	167 	82% 	1e-39	
ZP_07888218.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus sanguinis ATCC 49296] >gb|EFU62587.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus sanguinis ATCC 49296]
	167 	167 	94% 	1e-39	
AAC23563.1 	
DNA gyrase subunit A [Streptococcus pneumoniae]
	167 	167 	94% 	1e-39	
ZP_01982413.1 	
DNA gyrase, A subunit [Vibrio cholerae 623-39] >gb|EDL72915.1| DNA gyrase, A subunit [Vibrio cholerae 623-39]
	167 	167 	96% 	1e-39	
ZP_04920010.1 	
DNA gyrase, subunit A [Vibrio cholerae V51] >gb|EAZ49392.1| DNA gyrase, subunit A [Vibrio cholerae V51]
	167 	167 	96% 	1e-39	
YP_003931714.1 	
DNA gyrase subunit A [Pantoea vagans C9-1] >gb|ADO10265.1| DNA gyrase subunit A [Pantoea vagans C9-1]
	167 	167 	85% 	1e-39	Gene info linked to YP_003931714.1
ADX56055.1 	
DNA gyrase, A subunit [Burkholderia sp. CCGE1001]
	167 	167 	82% 	1e-39	
YP_001835799.1 	
DNA gyrase subunit A [Streptococcus pneumoniae CGSP14] >gb|ACB90334.1| DNA gyrase subunit A [Streptococcus pneumoniae CGSP14]
	167 	167 	94% 	1e-39	Gene info linked to YP_001835799.1
YP_003724725.1 	
DNA topoisomerase [Streptococcus pneumoniae TCH8431/19A] >gb|ADI69511.1| DNA topoisomerase (ATP-hydrolyzing) [Streptococcus pneumoniae TCH8431/19A]
	167 	167 	94% 	1e-39	Gene info linked to YP_003724725.1
YP_003051307.1 	
DNA gyrase, A subunit [Methylovorus sp. SIP3-4] >ref|YP_004039991.1| DNA gyrase, a subunit [Methylovorus sp. MP688] >gb|ACT50780.1| DNA gyrase, A subunit [Methylovorus sp. SIP3-4] >gb|ADQ84755.1| DNA gyrase, A subunit [Methylovorus sp. MP688]
	167 	167 	83% 	1e-39	Gene info linked to YP_003051307.1
AAZ92938.1 	
DNA gyrase subunit A [Streptococcus pneumoniae]
	167 	167 	94% 	1e-39	
ZP_07995686.1 	
A subunit [Bacteroides sp. 3_1_40A] >gb|EFV68294.1| A subunit [Bacteroides sp. 3_1_40A]
	167 	167 	83% 	1e-39	
YP_001599427.1 	
DNA gyrase subunit A [Neisseria meningitidis 053442] >gb|ABX73470.1| DNA gyrase subunit A [Neisseria meningitidis 053442]
	167 	167 	90% 	1e-39	Gene info linked to YP_001599427.1
AAZ92960.1 	
DNA gyrase subunit A [Streptococcus pneumoniae]
	167 	167 	94% 	1e-39	
ZP_04540411.1 	
DNA gyrase A subunit [Bacteroides sp. 9_1_42FAA] >gb|EEO61744.1| DNA gyrase A subunit [Bacteroides sp. 9_1_42FAA]
	167 	167 	83% 	1e-39	
ZP_02179268.1 	
DNA gyrase A subunit [Hydrogenivirga sp. 128-5-R1-1] >gb|EDP73965.1| DNA gyrase A subunit [Hydrogenivirga sp. 128-5-R1-1]
	167 	167 	81% 	1e-39	
AAZ92934.1 	
DNA gyrase subunit A [Streptococcus pneumoniae]
	167 	167 	94% 	1e-39	
YP_620445.1 	
DNA gyrase subunit A [Burkholderia cenocepacia AU 1054] >gb|ABF75472.1| DNA gyrase subunit A [Burkholderia cenocepacia AU 1054]
	167 	167 	82% 	1e-39	Gene info linked to YP_620445.1
ZP_05254724.1 	
DNA gyrase subunit A [Bacteroides sp. 4_3_47FAA] >gb|EET15116.1| DNA gyrase subunit A [Bacteroides sp. 4_3_47FAA]
	167 	167 	83% 	2e-39	
ZP_04705283.1 	
DNA topoisomerase IV subunit A [Streptomyces albus J1074] >ref|ZP_06593996.1| DNA topoisomerase IV subunit A [Streptomyces albus J1074] >gb|EFE84457.1| DNA topoisomerase IV subunit A [Streptomyces albus J1074]
	167 	167 	83% 	2e-39	
YP_834686.1 	
DNA gyrase subunit A [Burkholderia cenocepacia HI2424] >gb|ABK07793.1| DNA gyrase subunit A [Burkholderia cenocepacia HI2424]
	167 	167 	82% 	2e-39	Gene info linked to YP_834686.1
ZP_02378912.1 	
DNA gyrase subunit A [Burkholderia ubonensis Bu]
	167 	167 	82% 	2e-39	
AAO42743.1 	
DNA gyrase subunit A [Campylobacter jejuni]
	167 	167 	82% 	2e-39	
ACF04301.1 	
GyrA [Neisseria lactamica]
	167 	167 	90% 	2e-39	
ZP_03301316.1 	
hypothetical protein BACDOR_02698 [Bacteroides dorei DSM 17855] >ref|ZP_04555884.1| DNA gyrase A subunit [Bacteroides sp. D4] >gb|EEB24865.1| hypothetical protein BACDOR_02698 [Bacteroides dorei DSM 17855] >gb|EEO46167.1| DNA gyrase A subunit [Bacteroides dorei 5_1_36/D4]
	167 	167 	83% 	2e-39	
YP_001764298.1 	
DNA gyrase subunit A [Burkholderia cenocepacia MC0-3] >gb|ACA90176.1| DNA gyrase, A subunit [Burkholderia cenocepacia MC0-3]
	167 	167 	82% 	2e-39	Gene info linked to YP_001764298.1
ZP_06612302.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus oralis ATCC 35037] >ref|ZP_07640486.1| DNA gyrase, A subunit [Streptococcus oralis ATCC 35037] >gb|EFE56405.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus oralis ATCC 35037] >gb|EFO01946.1| DNA gyrase, A subunit [Streptococcus oralis ATCC 35037]
	167 	167 	94% 	2e-39	
ACN88536.1 	
DNA gyrase subunit A [Arcobacter sp. CL-S1]
	167 	167 	70% 	2e-39	
ZP_01820621.1 	
DNA gyrase subunit A [Streptococcus pneumoniae SP6-BS73] >gb|EDK76298.1| DNA gyrase subunit A [Streptococcus pneumoniae SP6-BS73]
	167 	167 	94% 	2e-39	
ZP_01826089.1 	
DNA gyrase subunit A [Streptococcus pneumoniae SP11-BS70] >ref|ZP_01834574.1| DNA gyrase subunit A [Streptococcus pneumoniae SP23-BS72] >ref|ZP_02717284.1| DNA gyrase, A subunit [Streptococcus pneumoniae CDC3059-06] >ref|ZP_02723010.1| DNA gyrase, A subunit [Streptococcus pneumoniae MLV-016] >ref|YP_002511067.1| DNA gyrase subunit A [Streptococcus pneumoniae ATCC 700669] >ref|YP_002736198.1| DNA gyrase subunit A [Streptococcus pneumoniae JJA] >ref|YP_003876835.1| type IIA topoisomerase subunit A [Streptococcus pneumoniae AP200] >emb|CAA06715.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92932.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92937.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92962.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92963.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92968.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92973.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|EDK62535.1| DNA gyrase subunit A [Streptococcus pneumoniae SP11-BS70] >gb|EDK82061.1| DNA gyrase subunit A [Streptococcus pneumoniae SP23-BS72] >gb|EDT97112.1| DNA gyrase, A subunit [Streptococcus pneumoniae CDC3059-06] >gb|EDT97740.1| DNA gyrase, A subunit [Streptococcus pneumoniae MLV-016] >emb|CAR68925.1| DNA gyrase subunit A [Streptococcus pneumoniae ATCC 700669] >gb|ACO19375.1| DNA gyrase, A subunit [Streptococcus pneumoniae JJA] >emb|CBW34648.1| DNA gyrase subunit A [Streptococcus pneumoniae INV200] >gb|ADM84833.1| Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Streptococcus pneumoniae AP200]
	167 	167 	94% 	2e-39	
AAZ92941.1 	
DNA gyrase subunit A [Streptococcus pneumoniae]
	167 	167 	94% 	2e-39	
ZP_01823231.1 	
DNA gyrase subunit A [Streptococcus pneumoniae SP9-BS68] >ref|ZP_01830791.1| DNA gyrase, A subunit [Streptococcus pneumoniae SP18-BS74] >ref|ZP_02713246.1| DNA gyrase, A subunit [Streptococcus pneumoniae SP195] >ref|YP_001694651.1| DNA gyrase subunit A [Streptococcus pneumoniae Hungary19A-6] >ref|YP_002740511.1| DNA gyrase subunit A [Streptococcus pneumoniae 70585] >ref|YP_003879223.1| DNA gyrase subunit A [Streptococcus pneumoniae 670-6B] >gb|AAZ92949.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92950.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92951.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92952.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|EDK68392.1| DNA gyrase, A subunit [Streptococcus pneumoniae SP18-BS74] >gb|EDK78679.1| DNA gyrase subunit A [Streptococcus pneumoniae SP9-BS68] >gb|ACA37043.1| DNA gyrase, A subunit [Streptococcus pneumoniae Hungary19A-6] >gb|EDT92926.1| DNA gyrase, A subunit [Streptococcus pneumoniae SP195] >gb|ACO16451.1| DNA gyrase, A subunit [Streptococcus pneumoniae 70585] >gb|ADM91123.1| DNA gyrase, A subunit [Streptococcus pneumoniae 670-6B]
	167 	167 	94% 	2e-39	
CBA04223.1 	
DNA gyrase subunit A [Neisseria meningitidis alpha153]
	167 	167 	90% 	2e-39	
AAZ92959.1 	
DNA gyrase subunit A [Streptococcus pneumoniae]
	167 	167 	94% 	2e-39	
NP_358692.1 	
DNA gyrase subunit A [Streptococcus pneumoniae R6] >ref|YP_816548.1| DNA gyrase subunit A [Streptococcus pneumoniae D39] >ref|ZP_02711050.1| DNA gyrase, A subunit [Streptococcus pneumoniae CDC1087-00] >sp|Q8DPM2.1|GYRA_STRR6 RecName: Full=DNA gyrase subunit A >gb|AAK99902.1| DNA gyrase subunit A [Streptococcus pneumoniae R6] >gb|AAZ92935.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92972.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92978.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|ABJ54972.1| DNA gyrase, A subunit [Streptococcus pneumoniae D39] >gb|EDT90964.1| DNA gyrase, A subunit [Streptococcus pneumoniae CDC1087-00]
	167 	167 	94% 	2e-39	Gene info linked to NP_358692.1
ZP_01827519.1 	
DNA gyrase subunit A [Streptococcus pneumoniae SP14-BS69] >gb|EDK66191.1| DNA gyrase subunit A [Streptococcus pneumoniae SP14-BS69]
	167 	167 	94% 	2e-39	
ZP_03914845.1 	
DNA gyrase subunit A [Leuconostoc mesenteroides subsp. cremoris ATCC 19254] >gb|EEJ41616.1| DNA gyrase subunit A [Leuconostoc mesenteroides subsp. cremoris ATCC 19254]
	167 	167 	82% 	2e-39	
ZP_02715283.1 	
DNA gyrase, A subunit [Streptococcus pneumoniae CDC0288-04] >gb|AAZ92931.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92940.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|EDT94912.1| DNA gyrase, A subunit [Streptococcus pneumoniae CDC0288-04]
	167 	167 	94% 	2e-39	
ACF04294.1 	
GyrA [Neisseria meningitidis] >gb|ACF04295.1| GyrA [Neisseria meningitidis]
	167 	167 	90% 	2e-39	
AAZ92929.1 	
DNA gyrase subunit A [Streptococcus pneumoniae]
	167 	167 	94% 	2e-39	
NP_345685.1 	
DNA gyrase subunit A [Streptococcus pneumoniae TIGR4] >ref|ZP_01408566.1| hypothetical protein SpneT_02000974 [Streptococcus pneumoniae TIGR4] >ref|ZP_01833340.1| DNA gyrase subunit A [Streptococcus pneumoniae SP19-BS75] >ref|ZP_02709829.1| DNA gyrase, A subunit [Streptococcus pneumoniae CDC1873-00] >ref|YP_002742456.1| DNA gyrase subunit A [Streptococcus pneumoniae Taiwan19F-14] >ref|ZP_04524174.1| DNA gyrase subunit A [Streptococcus pneumoniae CCRI 1974] >ref|ZP_04598374.1| DNA gyrase subunit A [Streptococcus pneumoniae CCRI 1974M2] >ref|ZP_06964040.1| DNA gyrase subunit A [Streptococcus pneumoniae str. Canada MDR_19F] >ref|ZP_06977902.1| DNA gyrase subunit A [Streptococcus pneumoniae str. Canada MDR_19A] >sp|P72524.3|GYRA_STRPN RecName: Full=DNA gyrase subunit A >gb|AAK75325.1| DNA gyrase, A subunit [Streptococcus pneumoniae TIGR4] >gb|AAZ92942.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92945.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92955.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92957.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92958.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92974.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92977.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|EDK70532.1| DNA gyrase subunit A [Streptococcus pneumoniae SP19-BS75] >gb|EDT50014.1| DNA gyrase, A subunit [Streptococcus pneumoniae CDC1873-00] >gb|ACO24166.1| DNA gyrase, A subunit [Streptococcus pneumoniae Taiwan19F-14]
	167 	167 	94% 	2e-39	Gene info linked to NP_345685.1
AAZ92976.1 	
DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92979.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92980.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92981.1| DNA gyrase subunit A [Streptococcus pneumoniae]
	167 	167 	94% 	2e-39	
ZP_04390821.1 	
DNA gyrase, A subunit [Porphyromonas endodontalis ATCC 35406] >gb|EEN81865.1| DNA gyrase, A subunit [Porphyromonas endodontalis ATCC 35406]
	167 	167 	83% 	2e-39	
YP_002738398.1 	
DNA gyrase subunit A [Streptococcus pneumoniae P1031] >gb|ACO22159.1| DNA gyrase, A subunit [Streptococcus pneumoniae P1031] >emb|CBW36728.1| DNA gyrase subunit A [Streptococcus pneumoniae INV104]
	167 	167 	94% 	2e-39	Gene info linked to YP_002738398.1
AAO42742.1 	
DNA gyrase subunit A [Campylobacter jejuni]
	167 	167 	82% 	2e-39	
ZP_07344834.1 	
DNA gyrase subunit A [Streptococcus pneumoniae SP-BS293] >ref|ZP_07347486.1| DNA gyrase subunit A [Streptococcus pneumoniae SP14-BS292] >ref|ZP_07350129.1| DNA gyrase subunit A [Streptococcus pneumoniae BS397] >ref|ZP_07352053.1| DNA gyrase subunit A [Streptococcus pneumoniae BS457] >ref|ZP_07353913.1| DNA gyrase subunit A [Streptococcus pneumoniae BS458] >gb|EFL67607.1| DNA gyrase subunit A [Streptococcus pneumoniae SP14-BS292] >gb|EFL70254.1| DNA gyrase subunit A [Streptococcus pneumoniae SP-BS293] >gb|EFL72677.1| DNA gyrase subunit A [Streptococcus pneumoniae BS458] >gb|EFL74584.1| DNA gyrase subunit A [Streptococcus pneumoniae BS457] >gb|EFL76248.1| DNA gyrase subunit A [Streptococcus pneumoniae BS397]
	167 	167 	94% 	2e-39	
ADO77172.1 	
DNA gyrase, A subunit [Halanaerobium praevalens DSM 2228]
	167 	167 	91% 	2e-39	
ZP_04582882.1 	
DNA gyrase, subunit A (gyrA) [Helicobacter winghamensis ATCC BAA-430] >gb|EEO25982.1| DNA gyrase, subunit A (gyrA) [Helicobacter winghamensis ATCC BAA-430]
	167 	167 	97% 	2e-39	
AAZ92954.1 	
DNA gyrase subunit A [Streptococcus pneumoniae]
	167 	167 	94% 	2e-39	
AAZ92956.1 	
DNA gyrase subunit A [Streptococcus pneumoniae]
	167 	167 	94% 	2e-39	
YP_817551.1 	
DNA gyrase subunit A [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gb|ABJ61178.1| DNA gyrase subunit A [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293]
	167 	167 	82% 	2e-39	Gene info linked to YP_817551.1
AAZ92943.1 	
DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92944.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92947.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92961.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92965.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92966.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92967.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92970.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92975.1| DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92986.1| DNA gyrase subunit A [Streptococcus pneumoniae]
	167 	167 	94% 	2e-39	
AAZ92983.1 	
DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92985.1| DNA gyrase subunit A [Streptococcus pneumoniae]
	167 	167 	94% 	2e-39	
AAZ92946.1 	
DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92984.1| DNA gyrase subunit A [Streptococcus pneumoniae]
	167 	167 	94% 	2e-39	
ZP_07910576.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Mobiluncus curtisii subsp. holmesii ATCC 35242] >gb|EFU81775.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Mobiluncus curtisii subsp. holmesii ATCC 35242]
	167 	167 	83% 	2e-39	
ZP_06088936.1 	
DNA gyrase, A subunit [Bacteroides sp. 3_1_33FAA] >gb|EEZ20819.1| DNA gyrase, A subunit [Bacteroides sp. 3_1_33FAA]
	167 	167 	83% 	2e-39	
ZP_04755568.1 	
DNA topoisomerase (ATP-hydrolyzing) [Francisella philomiragia subsp. philomiragia ATCC 25015] >ref|ZP_05249234.1| DNA gyrase subunit A gyrA [Francisella philomiragia subsp. philomiragia ATCC 25015] >gb|EET20959.1| DNA gyrase subunit A gyrA [Francisella philomiragia subsp. philomiragia ATCC 25015]
	167 	167 	83% 	2e-39	
YP_003907852.1 	
DNA gyrase subunit A [Burkholderia sp. CCGE1003] >gb|ADN58561.1| DNA gyrase, A subunit [Burkholderia sp. CCGE1003]
	167 	167 	82% 	2e-39	Gene info linked to YP_003907852.1
YP_001677920.1 	
DNA topoisomerase (ATP-hydrolyzing) [Francisella philomiragia subsp. philomiragia ATCC 25017] >gb|ABZ87419.1| DNA topoisomerase (ATP-hydrolyzing) [Francisella philomiragia subsp. philomiragia ATCC 25017]
	167 	167 	83% 	2e-39	Gene info linked to YP_001677920.1
BAA32701.1 	
DNA gyrase A subunit [Streptococcus pneumoniae]
	167 	167 	94% 	2e-39	
ZP_08049894.1 	
DNA gyrase, A subunit [Streptococcus sp. C300] >gb|EFX56684.1| DNA gyrase, A subunit [Streptococcus sp. C300]
	167 	167 	94% 	2e-39	
ZP_04729931.1 	
DNA gyrase subunit A [Neisseria gonorrhoeae PID18] >ref|ZP_06135711.1| DNA gyrase subunit A [Neisseria gonorrhoeae PID18] >gb|EEZ50351.1| DNA gyrase subunit A [Neisseria gonorrhoeae PID18]
	167 	167 	90% 	2e-39	
YP_002342912.1 	
DNA gyrase subunit A [Neisseria meningitidis Z2491] >emb|CAM08741.1| DNA gyrase subunit A [Neisseria meningitidis Z2491] >emb|CBY91018.1| DNA gyrase subunit A [Neisseria meningitidis WUE 2594]
	167 	167 	90% 	2e-39	Gene info linked to YP_002342912.1
ZP_06837191.1 	
DNA gyrase, A subunit [Corynebacterium ammoniagenes DSM 20306] >gb|EFG81759.1| DNA gyrase, A subunit [Corynebacterium ammoniagenes DSM 20306]
	167 	167 	88% 	2e-39	
ZP_02185347.1 	
DNA gyrase, A subunit [Carnobacterium sp. AT7] >gb|EDP67847.1| DNA gyrase, A subunit [Carnobacterium sp. AT7]
	167 	167 	83% 	2e-39	
ZP_07398992.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Peptoniphilus duerdenii ATCC BAA-1640] >gb|EFM26019.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Peptoniphilus duerdenii ATCC BAA-1640]
	167 	167 	85% 	2e-39	
AAF85900.1 	
DNA gyrase A subunit [Streptococcus pneumoniae]
	167 	167 	94% 	2e-39	
ZP_07907292.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Mobiluncus curtisii ATCC 51333] >gb|EFU81036.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Mobiluncus curtisii ATCC 51333]
	167 	167 	83% 	2e-39	
YP_003605809.1 	
DNA gyrase, A subunit [Burkholderia sp. CCGE1002] >gb|ADG16298.1| DNA gyrase, A subunit [Burkholderia sp. CCGE1002]
	167 	167 	82% 	2e-39	Gene info linked to YP_003605809.1
ZP_03719063.1 	
hypothetical protein NEIFLAOT_00887 [Neisseria flavescens NRL30031/H210] >gb|EEG34019.1| hypothetical protein NEIFLAOT_00887 [Neisseria flavescens NRL30031/H210]
	167 	167 	90% 	2e-39	
AAO16801.1 	
GyrA [Streptococcus pneumoniae]
	167 	167 	94% 	2e-39	
ZP_08059220.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus cristatus ATCC 51100] >gb|EFX53230.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus cristatus ATCC 51100]
	167 	167 	94% 	2e-39	
AAZ92930.1 	
DNA gyrase subunit A [Streptococcus pneumoniae]
	167 	167 	94% 	2e-39	
YP_001437075.1 	
DNA gyrase subunit A [Cronobacter sakazakii ATCC BAA-894] >gb|ABU76239.1| hypothetical protein ESA_00969 [Cronobacter sakazakii ATCC BAA-894]
	167 	167 	85% 	2e-39	Gene info linked to YP_001437075.1
ZP_04962496.1 	
DNA gyrase, subunit A [Vibrio cholerae AM-19226] >gb|EDN14353.1| DNA gyrase, subunit A [Vibrio cholerae AM-19226]
	167 	167 	96% 	2e-39	
YP_003718497.1 	
DNA topoisomerase [Mobiluncus curtisii ATCC 43063] >ref|ZP_07372439.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Mobiluncus curtisii subsp. curtisii ATCC 35241] >gb|ADI67003.1| DNA topoisomerase (ATP-hydrolyzing) [Mobiluncus curtisii ATCC 43063] >gb|EFL93487.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Mobiluncus curtisii subsp. curtisii ATCC 35241]
	167 	167 	83% 	2e-39	Gene info linked to YP_003718497.1
ZP_02961100.2 	
hypothetical protein PROSTU_03092 [Providencia stuartii ATCC 25827] >gb|EDU59897.1| hypothetical protein PROSTU_03092 [Providencia stuartii ATCC 25827]
	167 	167 	85% 	2e-39	
NP_213671.1 	
DNA gyrase A subunit [Aquifex aeolicus VF5] >sp|O67108.1|GYRA_AQUAE RecName: Full=DNA gyrase subunit A >gb|AAC07064.1| DNA gyrase A subunit [Aquifex aeolicus VF5]
	167 	167 	82% 	2e-39	Gene info linked to NP_213671.1
YP_004066520.1 	
DNA gyrase, A subunit [Campylobacter jejuni subsp. jejuni ICDCCJ07001] >gb|ADT66331.1| DNA gyrase, A subunit [Campylobacter jejuni subsp. jejuni ICDCCJ07001]
	167 	167 	82% 	2e-39	Gene info linked to YP_004066520.1
YP_002232057.1 	
DNA gyrase subunit A [Burkholderia cenocepacia J2315] >emb|CAR53261.1| DNA Gyrase, subunit A [Burkholderia cenocepacia J2315]
	167 	167 	82% 	2e-39	Gene info linked to YP_002232057.1
NP_853505.1 	
DNA gyrase subunit A [Mycoplasma gallisepticum str. R(low)] >sp|P47719.2|GYRA_MYCGA RecName: Full=DNA gyrase subunit A >gb|AAP57073.1| DNA gyrase subunit A [Mycoplasma gallisepticum str. R(low)] >gb|ADC30944.1| DNA gyrase subunit A [Mycoplasma gallisepticum str. R(high)]
	167 	167 	85% 	2e-39	Gene info linked to NP_853505.1
YP_001848332.1 	
DNA gyrase (subunit A) GyrA [Mycobacterium marinum M] >gb|ACC38477.1| DNA gyrase (subunit A) GyrA [Mycobacterium marinum M]
	167 	167 	88% 	2e-39	Gene info linked to YP_001848332.1
YP_003097827.1 	
DNA gyrase, A subunit [Actinosynnema mirum DSM 43827] >gb|ACU33981.1| DNA gyrase, A subunit [Actinosynnema mirum DSM 43827]
	167 	167 	83% 	2e-39	Gene info linked to YP_003097827.1
ZP_01036433.1 	
DNA gyrase, subunit A [Roseovarius sp. 217] >gb|EAQ25069.1| DNA gyrase, subunit A [Roseovarius sp. 217]
	167 	167 	84% 	2e-39	
YP_001727283.1 	
DNA gyrase, A subunit [Leuconostoc citreum KM20] >gb|ACA81839.1| DNA gyrase, A subunit [Leuconostoc citreum KM20]
	167 	167 	82% 	2e-39	Gene info linked to YP_001727283.1
ZP_08087186.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus sanguinis VMC66] >gb|EFX93744.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus sanguinis VMC66]
	167 	167 	94% 	2e-39	
ZP_06715433.1 	
DNA gyrase, A subunit [Edwardsiella tarda ATCC 23685] >gb|EFE22244.1| DNA gyrase, A subunit [Edwardsiella tarda ATCC 23685]
	167 	167 	85% 	2e-39	
YP_207769.1 	
DNA gyrase subunit A [Neisseria gonorrhoeae FA 1090] >ref|ZP_04725062.1| DNA gyrase subunit A [Neisseria gonorrhoeae FA19] >ref|ZP_04732229.1| DNA gyrase subunit A [Neisseria gonorrhoeae PID1] >ref|ZP_04736671.1| DNA gyrase subunit A [Neisseria gonorrhoeae PID332] >ref|ZP_06130819.1| DNA gyrase subunit A [Neisseria gonorrhoeae FA19] >ref|ZP_06138050.1| DNA gyrase subunit A [Neisseria gonorrhoeae PID1] >ref|ZP_06149208.1| DNA gyrase subunit A [Neisseria gonorrhoeae PID332] >ref|ZP_06643085.1| DNA gyrase, A subunit [Neisseria gonorrhoeae F62] >gb|AAW89357.1| DNA gyrase subunit A [Neisseria gonorrhoeae FA 1090] >gb|EEZ45459.1| DNA gyrase subunit A [Neisseria gonorrhoeae FA19] >gb|EEZ52690.1| DNA gyrase subunit A [Neisseria gonorrhoeae PID1] >gb|EEZ55030.1| DNA gyrase subunit A [Neisseria gonorrhoeae PID332] >gb|EFF39444.1| DNA gyrase, A subunit [Neisseria gonorrhoeae F62]
	167 	167 	90% 	2e-39	Gene info linked to YP_207769.1
ZP_01103668.1 	
DNA gyrase, subunit A [Congregibacter litoralis KT71] >gb|EAQ96785.1| DNA gyrase, subunit A [Congregibacter litoralis KT71]
	167 	167 	81% 	2e-39	
ZP_01069152.1 	
DNA gyrase, A subunit [Campylobacter jejuni subsp. jejuni 260.94] >gb|EAQ59352.1| DNA gyrase, A subunit [Campylobacter jejuni subsp. jejuni 260.94]
	167 	167 	82% 	2e-39	
ZP_04741079.1 	
DNA gyrase subunit A [Neisseria gonorrhoeae SK-93-1035] >ref|ZP_06153676.1| DNA gyrase subunit A [Neisseria gonorrhoeae SK-93-1035] >gb|EEZ59498.1| DNA gyrase subunit A [Neisseria gonorrhoeae SK-93-1035]
	167 	167 	90% 	2e-39	
ZP_06842790.1 	
DNA gyrase, A subunit [Burkholderia sp. Ch1-1] >gb|EFG69514.1| DNA gyrase, A subunit [Burkholderia sp. Ch1-1]
	167 	167 	82% 	2e-39	
ZP_07294366.1 	
DNA gyrase, A subunit [Streptomyces hygroscopicus ATCC 53653] >gb|EFL22735.1| DNA gyrase, A subunit [Streptomyces hygroscopicus ATCC 53653]
	167 	167 	84% 	2e-39	
YP_560025.1 	
DNA gyrase subunit A [Burkholderia xenovorans LB400] >gb|ABE31973.1| DNA gyrase subunit A [Burkholderia xenovorans LB400]
	167 	167 	82% 	2e-39	Gene info linked to YP_560025.1
YP_002486099.1 	
DNA gyrase, A subunit [Arthrobacter chlorophenolicus A6] >gb|ACL38010.1| DNA gyrase, A subunit [Arthrobacter chlorophenolicus A6]
	167 	167 	84% 	2e-39	Gene info linked to YP_002486099.1
YP_001397894.1 	
DNA gyrase subunit A [Campylobacter jejuni subsp. doylei 269.97] >gb|ABS43870.1| DNA gyrase, A subunit [Campylobacter jejuni subsp. doylei 269.97]
	167 	167 	82% 	2e-39	Gene info linked to YP_001397894.1
YP_001035174.1 	
DNA gyrase subunit A [Streptococcus sanguinis SK36] >gb|ABN44624.1| DNA gyrase A subunit, putative [Streptococcus sanguinis SK36]
	167 	167 	94% 	3e-39	Gene info linked to YP_001035174.1
ZP_06069805.1 	
DNA gyrase, A subunit [Acinetobacter lwoffii SH145] >gb|EEY89422.1| DNA gyrase, A subunit [Acinetobacter lwoffii SH145]
	166 	166 	88% 	3e-39	
ZP_05060442.1 	
DNA gyrase, A subunit [gamma proteobacterium HTCC5015] >gb|EDY87392.1| DNA gyrase, A subunit [gamma proteobacterium HTCC5015]
	166 	166 	83% 	3e-39	
Q5YLB5.1 	
RecName: Full=DNA gyrase subunit A, chloroplastic/mitochondrial; Flags: Precursor >gb|AAR07942.1| DNA gyrase A subunit [Nicotiana benthamiana]
	166 	166 	81% 	3e-39	
ZP_01003541.1 	
DNA gyrase subunit A [Loktanella vestfoldensis SKA53] >gb|EAQ06334.1| DNA gyrase subunit A [Loktanella vestfoldensis SKA53]
	166 	166 	84% 	3e-39	
ZP_07604242.1 	
DNA topoisomerase (ATP-hydrolyzing) [Streptomyces violaceusniger Tu 4113] >gb|EFN20166.1| DNA topoisomerase (ATP-hydrolyzing) [Streptomyces violaceusniger Tu 4113]
	166 	166 	84% 	3e-39	
ADU84664.1 	
DNA gyrase subunit A [Helicobacter pylori SouthAfrica7]
	166 	166 	88% 	3e-39	
BAE19968.1 	
DNA gyrase subunit A [Photobacterium damselae subsp. piscicida]
	166 	166 	87% 	3e-39	
ZP_07706620.1 	
DNA gyrase/topoisomerase IV, A subunit [Dermacoccus sp. Ellin185] >gb|EFP57066.1| DNA gyrase/topoisomerase IV, A subunit [Dermacoccus sp. Ellin185]
	166 	166 	83% 	3e-39	
YP_004028370.1 	
DNA gyrase subunit A [Burkholderia rhizoxinica HKI 454] >emb|CBW74226.1| DNA gyrase subunit A (EC 5.99.1.3) [Burkholderia rhizoxinica HKI 454]
	166 	166 	82% 	3e-39	Gene info linked to YP_004028370.1
YP_002466119.1 	
DNA gyrase, A subunit [Methanosphaerula palustris E1-9c] >gb|ACL16396.1| DNA gyrase, A subunit [Methanosphaerula palustris E1-9c]
	166 	166 	95% 	3e-39	Gene info linked to YP_002466119.1
ZP_01818353.1 	
DNA gyrase subunit A [Streptococcus pneumoniae SP3-BS71] >gb|EDK73677.1| DNA gyrase subunit A [Streptococcus pneumoniae SP3-BS71]
	166 	166 	94% 	3e-39	
ZP_03320433.1 	
hypothetical protein PROVALCAL_03391 [Providencia alcalifaciens DSM 30120] >gb|EEB44579.1| hypothetical protein PROVALCAL_03391 [Providencia alcalifaciens DSM 30120]
	166 	166 	85% 	3e-39	
YP_003284109.1 	
DNA gyrase subunit A [Blattabacterium sp. (Blattella germanica) str. Bge] >gb|ACY40499.1| DNA gyrase subunit A [Blattabacterium sp. (Blattella germanica) str. Bge]
	166 	166 	82% 	3e-39	Gene info linked to YP_003284109.1
YP_003550726.1 	
type IIA topoisomerase ,subunit A [Candidatus Puniceispirillum marinum IMCC1322] >gb|ADE38642.1| Type IIA topoisomerase , A subunit [Candidatus Puniceispirillum marinum IMCC1322]
	166 	166 	91% 	3e-39	Gene info linked to YP_003550726.1
ZP_06198802.1 	
DNA gyrase, A subunit [Streptococcus sp. M143] >gb|EFA24416.1| DNA gyrase, A subunit [Streptococcus sp. M143]
	166 	166 	94% 	3e-39	
ZP_06052277.1 	
DNA gyrase subunit A [Grimontia hollisae CIP 101886] >gb|EEY72343.1| DNA gyrase subunit A [Grimontia hollisae CIP 101886]
	166 	166 	85% 	3e-39	
ZP_06005640.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Prevotella bergensis DSM 17361] >gb|EFA44947.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Prevotella bergensis DSM 17361]
	166 	166 	83% 	3e-39	
AAZ92936.1 	
DNA gyrase subunit A [Streptococcus pneumoniae]
	166 	166 	85% 	3e-39	
AAZ92953.1 	
DNA gyrase subunit A [Streptococcus pneumoniae] >gb|AAZ92971.1| DNA gyrase subunit A [Streptococcus pneumoniae] >emb|CBW32746.1| DNA gyrase subunit A [Streptococcus pneumoniae OXC141]
	166 	166 	94% 	3e-39	
YP_002798771.1 	
DNA gyrase subunit A [Azotobacter vinelandii DJ] >gb|ACO77796.1| DNA gyrase, A subunit [Azotobacter vinelandii DJ]
	166 	166 	83% 	3e-39	Gene info linked to YP_002798771.1
ZP_06900620.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus parasanguinis ATCC 15912] >gb|EFH18358.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus parasanguinis ATCC 15912]
	166 	166 	94% 	4e-39	
AAZ92982.1 	
DNA gyrase subunit A [Streptococcus pneumoniae]
	166 	166 	94% 	4e-39	
ZP_05127220.1 	
DNA gyrase, A subunit [gamma proteobacterium NOR5-3] >gb|EED33767.1| DNA gyrase, A subunit [gamma proteobacterium NOR5-3]
	166 	166 	81% 	4e-39	
AAZ92969.1 	
DNA gyrase subunit A [Streptococcus pneumoniae]
	166 	166 	94% 	4e-39	
AAZ92948.1 	
DNA gyrase subunit A [Streptococcus pneumoniae]
	166 	166 	94% 	4e-39	
YP_593845.1 	
DNA gyrase subunit A [Candidatus Koribacter versatilis Ellin345] >gb|ABF43771.1| DNA gyrase subunit A [Candidatus Koribacter versatilis Ellin345]
	166 	166 	97% 	4e-39	Gene info linked to YP_593845.1
AAZ92964.1 	
DNA gyrase subunit A [Streptococcus pneumoniae]
	166 	166 	94% 	4e-39	
YP_412873.1 	
DNA gyrase subunit A [Nitrosospira multiformis ATCC 25196] >gb|ABB75481.1| DNA gyrase subunit A [Nitrosospira multiformis ATCC 25196]
	166 	166 	83% 	4e-39	Gene info linked to YP_412873.1
YP_002833546.1 	
DNA gyrase subunit A [Corynebacterium aurimucosum ATCC 700975] >ref|ZP_06042525.1| DNA gyrase subunit A [Corynebacterium aurimucosum ATCC 700975] >gb|ACP31608.1| DNA gyrase subunit A [Corynebacterium aurimucosum ATCC 700975]
	166 	166 	88% 	4e-39	Gene info linked to YP_002833546.1
ZP_07967078.1 	

DNA gyrase, subunit A [Segniliparus rugosus ATCC BAA-974] >gb|EFV11741.1| DNA gyrase, subunit A [Segniliparus rugosus ATCC BAA-974]
	166 	166 	88% 	4e-39	
YP_001907166.1 	
DNA gyrase subunit A [Erwinia tasmaniensis Et1/99] >emb|CAO96272.1| DNA gyrase subunit A [Erwinia tasmaniensis Et1/99]
	166 	166 	85% 	4e-39	Gene info linked to YP_001907166.1
YP_003915226.1 	
DNA gyrase subunit A [Arthrobacter arilaitensis Re117] >emb|CBT74255.1| DNA gyrase subunit A [Arthrobacter arilaitensis Re117]
	166 	166 	84% 	4e-39	Gene info linked to YP_003915226.1
ZP_08013446.1 	
DNA gyrase subunit A [Streptococcus anginosus 1_2_62CV] >gb|EFW08398.1| DNA gyrase subunit A [Streptococcus anginosus 1_2_62CV]
	166 	166 	94% 	4e-39	
ZP_07645199.1 	
DNA gyrase, A subunit [Streptococcus mitis NCTC 12261] >gb|EFN94520.1| DNA gyrase, A subunit [Streptococcus mitis NCTC 12261]
	166 	166 	94% 	4e-39	
BAC57595.1 	
DNA gyraseA [Campylobacter jejuni]
	166 	166 	82% 	4e-39	
YP_001341707.1 	
DNA gyrase subunit A [Marinomonas sp. MWYL1] >gb|ABR71772.1| DNA gyrase, A subunit [Marinomonas sp. MWYL1]
	166 	166 	83% 	4e-39	Gene info linked to YP_001341707.1
EFS72874.1 	
DNA gyrase, A subunit [Propionibacterium acnes HL037PA2] >gb|EFS92967.1| DNA gyrase, A subunit [Propionibacterium acnes HL044PA1] >gb|EFT15015.1| DNA gyrase, A subunit [Propionibacterium acnes HL037PA3]
	166 	166 	83% 	4e-39	
ZP_07458419.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus sp. oral taxon 071 str. 73H25AP] >gb|EFM35487.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus sp. oral taxon 071 str. 73H25AP]
	166 	166 	94% 	4e-39	
YP_004048813.1 	
DNA gyrase subunit A [Neisseria lactamica ST-640] >gb|ACF04300.1| GyrA [Neisseria lactamica] >emb|CBN87450.1| DNA gyrase subunit A [Neisseria lactamica 020-06]
	166 	166 	90% 	4e-39	Gene info linked to YP_004048813.1
YP_003547891.1 	
DNA gyrase, A subunit [Coraliomargarita akajimensis DSM 45221] >gb|ADE53721.1| DNA gyrase, A subunit [Coraliomargarita akajimensis DSM 45221]
	166 	166 	96% 	5e-39	Gene info linked to YP_003547891.1
ZP_08063031.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus parasanguinis ATCC 903] >gb|EFX39283.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus parasanguinis ATCC 903]
	166 	166 	94% 	5e-39	
ADV07967.1 	
DNA gyrase subunit A [Neisseria gonorrhoeae TCDC-NG08107]
	166 	166 	90% 	5e-39	
YP_002001910.1 	
DNA gyrase subunit A [Neisseria gonorrhoeae NCCP11945] >gb|ACF29961.1| DNA gyrase subunit A [Neisseria gonorrhoeae NCCP11945]
	166 	166 	90% 	5e-39	Gene info linked to YP_002001910.1
ADX71229.1 	
DNA gyrase subunit A [Arthrobacter phenanthrenivorans Sphe3]
	166 	166 	84% 	5e-39	
YP_003149370.1 	
DNA topoisomerase IV subunit A [Kytococcus sedentarius DSM 20547] >gb|ACV06605.1| DNA topoisomerase IV subunit A [Kytococcus sedentarius DSM 20547]
	166 	166 	83% 	5e-39	Gene info linked to YP_003149370.1
CBX21662.1 	
unnamed protein product [Neisseria lactamica Y92-1009]
	166 	166 	90% 	5e-39	
ZP_04719058.1 	
DNA gyrase subunit A [Neisseria gonorrhoeae 35/02] >ref|ZP_06129136.1| DNA gyrase subunit A [Neisseria gonorrhoeae 35/02] >gb|EEZ43776.1| DNA gyrase subunit A [Neisseria gonorrhoeae 35/02]
	166 	166 	90% 	5e-39	
ZP_04720871.1 	
DNA gyrase subunit A [Neisseria gonorrhoeae DGI18] >ref|ZP_04722940.1| DNA gyrase subunit A [Neisseria gonorrhoeae FA6140] >ref|ZP_04727603.1| DNA gyrase subunit A [Neisseria gonorrhoeae MS11] >ref|ZP_04734489.1| DNA gyrase subunit A [Neisseria gonorrhoeae PID24-1] >ref|ZP_04738792.1| DNA gyrase subunit A [Neisseria gonorrhoeae SK-92-679] >ref|ZP_05107081.1| DNA gyrase subunit A [Neisseria gonorrhoeae 1291] >ref|ZP_05794132.1| DNA gyrase subunit A [Neisseria gonorrhoeae DGI2] >ref|ZP_06133364.1| DNA gyrase subunit A [Neisseria gonorrhoeae MS11] >ref|ZP_06151366.1| DNA gyrase subunit A [Neisseria gonorrhoeae SK-92-679] >ref|ZP_06569326.1| DNA gyrase subunit A [Neisseria gonorrhoeae DGI2] >gb|EEH62295.1| DNA gyrase subunit A [Neisseria gonorrhoeae 1291] >gb|EEZ48004.1| DNA gyrase subunit A [Neisseria gonorrhoeae MS11] >gb|EEZ57188.1| DNA gyrase subunit A [Neisseria gonorrhoeae SK-92-679] >gb|EFE04062.1| DNA gyrase subunit A [Neisseria gonorrhoeae DGI2]
	166 	166 	90% 	5e-39	
ZP_07895467.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Enterococcus italicus DSM 15952] >gb|EFU74367.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Enterococcus italicus DSM 15952]
	166 	166 	83% 	5e-39	
ZP_03010136.1 	
hypothetical protein BACCOP_02006 [Bacteroides coprocola DSM 17136] >gb|EDV00865.1| hypothetical protein BACCOP_02006 [Bacteroides coprocola DSM 17136]
	166 	166 	83% 	5e-39	
YP_003917204.1 	
putative DNA gyrase subunit A [Arthrobacter arilaitensis Re117] >emb|CBT76233.1| putative DNA gyrase subunit A [Arthrobacter arilaitensis Re117]
	166 	166 	84% 	5e-39	Gene info linked to YP_003917204.1
ZP_01752196.1 	
DNA gyrase, A subunit [Roseobacter sp. CCS2] >gb|EBA10863.1| DNA gyrase, A subunit [Roseobacter sp. CCS2]
	166 	166 	84% 	5e-39	
YP_004116556.1 	
DNA gyrase subunit A [Pantoea sp. At-9b] >gb|ADU70000.1| DNA gyrase, A subunit [Pantoea sp. At-9b]
	166 	166 	85% 	5e-39	Gene info linked to YP_004116556.1
YP_004099185.1 	
DNA topoisomerase IV subunit A [Intrasporangium calvum DSM 43043] >gb|ADU48458.1| DNA topoisomerase IV subunit A [Intrasporangium calvum DSM 43043]
	166 	166 	83% 	5e-39	Gene info linked to YP_004099185.1
NP_840419.1 	
DNA gyrase subunit A [Nitrosomonas europaea ATCC 19718] >emb|CAD84243.1| DNA gyrase/topoisomerase IV, subunit A [Nitrosomonas europaea ATCC 19718]
	166 	166 	85% 	5e-39	Gene info linked to NP_840419.1
ZP_05523169.1 	
DNA topoisomerase IV subunit A [Streptomyces lividans TK24] >ref|ZP_06528003.1| DNA topoisomerase IV subunit A [Streptomyces lividans TK24] >gb|EFD66253.1| DNA topoisomerase IV subunit A [Streptomyces lividans TK24]
	166 	166 	83% 	5e-39	
ZP_04450709.1 	
hypothetical protein GCWU000282_01987 [Catonella morbi ATCC 51271] >gb|EEP22125.1| hypothetical protein GCWU000282_01987 [Catonella morbi ATCC 51271]
	166 	166 	82% 	5e-39	
ZP_05982050.1 	
DNA gyrase, A subunit [Neisseria cinerea ATCC 14685] >gb|EEZ72624.1| DNA gyrase, A subunit [Neisseria cinerea ATCC 14685]
	166 	166 	90% 	6e-39	
ZP_05074594.1 	
DNA gyrase, A subunit [Rhodobacterales bacterium HTCC2083] >gb|EDZ42254.1| DNA gyrase, A subunit [Rhodobacteraceae bacterium HTCC2083]
	166 	166 	84% 	6e-39	
ZP_05623061.1 	
DNA gyrase, A subunit [Treponema vincentii ATCC 35580] >gb|EEV19699.1| DNA gyrase, A subunit [Treponema vincentii ATCC 35580]
	165 	165 	97% 	6e-39	
YP_703641.1 	
DNA gyrase subunit A [Rhodococcus jostii RHA1] >gb|ABG95483.1| DNA topoisomerase subunit A [Rhodococcus jostii RHA1]
	165 	165 	88% 	6e-39	Gene info linked to YP_703641.1
YP_003771473.1 	
DNA gyrase subunit A [Leuconostoc gasicomitatum LMG 18811] >emb|CBL90654.1| DNA gyrase, A subunit [Leuconostoc gasicomitatum LMG 18811]
	165 	165 	82% 	6e-39	Gene info linked to YP_003771473.1
ZP_06060585.1 	
DNA gyrase subunit A [Streptococcus sp. 2_1_36FAA] >gb|EEY79769.1| DNA gyrase subunit A [Streptococcus sp. 2_1_36FAA]
	165 	165 	94% 	6e-39	
YP_002780689.1 	
DNA gyrase subunit A [Rhodococcus opacus B4] >dbj|BAH51744.1| DNA gyrase subunit A [Rhodococcus opacus B4]
	165 	165 	88% 	6e-39	Gene info linked to YP_002780689.1
ZP_03268135.1 	
DNA gyrase, A subunit [Burkholderia sp. H160] >gb|EEA00277.1| DNA gyrase, A subunit [Burkholderia sp. H160]
	165 	165 	82% 	6e-39	
ZP_06831205.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Rhodococcus equi ATCC 33707] >ref|YP_004004860.1| DNA gyrase subunit a [Rhodococcus equi 103S] >dbj|BAF02675.1| DNA gyrase subunit A [Rhodococcus equi] >gb|EFG60584.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Rhodococcus equi ATCC 33707] >emb|CBH46171.1| DNA gyrase subunit A [Rhodococcus equi 103S]
	165 	165 	88% 	6e-39	
YP_002037821.1 	
DNA gyrase subunit A [Streptococcus pneumoniae G54] >gb|ACF55945.1| DNA gyrase, A subunit [Streptococcus pneumoniae G54]
	165 	165 	94% 	6e-39	Gene info linked to YP_002037821.1
YP_003296382.1 	
DNA gyrase subunit A [Edwardsiella tarda EIB202] >gb|ACY85171.1| DNA gyrase subunit A [Edwardsiella tarda EIB202] >gb|ADM42214.1| DNA gyrase subunit A [Edwardsiella tarda FL6-60]
	165 	165 	85% 	7e-39	Gene info linked to YP_003296382.1
YP_002417544.1 	
DNA gyrase, subunit A [Vibrio splendidus LGP32] >emb|CAV19119.1| DNA gyrase, subunit A [Vibrio splendidus LGP32]
	165 	165 	96% 	7e-39	Gene info linked to YP_002417544.1
ZP_07864824.1 	
DNA gyrase, A subunit [Streptococcus anginosus F0211] >gb|EFU21631.1| DNA gyrase, A subunit [Streptococcus anginosus F0211]
	165 	165 	94% 	7e-39	
ZP_06862143.1 	
DNA gyrase subunit A [Citromicrobium bathyomarinum JL354]
	165 	165 	85% 	7e-39	
ZP_05985304.1 	
DNA gyrase, A subunit [Neisseria subflava NJ9703] >gb|EFC51795.1| DNA gyrase, A subunit [Neisseria subflava NJ9703]
	165 	165 	90% 	7e-39	
ZP_01129172.1 	
DNA gyrase subunit A [marine actinobacterium PHSC20C1] >gb|EAR26168.1| DNA gyrase subunit A [marine actinobacterium PHSC20C1]
	165 	165 	84% 	7e-39	
ZP_07728007.1 	
DNA gyrase, A subunit [Streptococcus parasanguinis F0405] >gb|EFQ55102.1| DNA gyrase, A subunit [Streptococcus parasanguinis F0405]
	165 	165 	94% 	7e-39	
ZP_07694628.1 	
DNA gyrase, A subunit [Streptococcus infantis SK1302] >gb|EFO53413.1| DNA gyrase, A subunit [Streptococcus infantis SK1302]
	165 	165 	94% 	7e-39	
YP_003335813.1 	
DNA topoisomerase [Streptosporangium roseum DSM 43021] >gb|ACZ83070.1| DNA topoisomerase (ATP-hydrolyzing) [Streptosporangium roseum DSM 43021]
	165 	165 	85% 	7e-39	Gene info linked to YP_003335813.1
ZP_01066753.1 	
DNA gyrase, subunit A [Vibrio sp. MED222] >gb|EAQ51928.1| DNA gyrase, subunit A [Vibrio sp. MED222]
	165 	165 	96% 	7e-39	
ZP_07867532.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Parascardovia denticolens DSM 10105] >gb|EFT83008.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Parascardovia denticolens DSM 10105]
	165 	165 	85% 	7e-39	
YP_113878.1 	
DNA gyrase, A subunit [Methylococcus capsulatus str. Bath] >gb|AAU92294.1| DNA gyrase, A subunit [Methylococcus capsulatus str. Bath]
	165 	165 	83% 	7e-39	Gene info linked to YP_113878.1
ZP_01160577.1 	
putative DNA topoisomerase (ATP-hydrolyzing) [Photobacterium sp. SKA34] >gb|EAR55725.1| putative DNA topoisomerase (ATP-hydrolyzing) [Photobacterium sp. SKA34]
	165 	165 	85% 	7e-39	
ZP_03936227.1 	
DNA topoisomerase (ATP-hydrolyzing) [Corynebacterium striatum ATCC 6940] >gb|EEI77250.1| DNA topoisomerase (ATP-hydrolyzing) [Corynebacterium striatum ATCC 6940]
	165 	165 	88% 	8e-39	
YP_899105.1 	
DNA gyrase, subunit A [Francisella tularensis subsp. novicida U112] >ref|ZP_03057064.1| DNA gyrase, A subunit [Francisella tularensis subsp. novicida FTE] >ref|ZP_03246880.1| DNA gyrase, A subunit [Francisella novicida FTG] >ref|ZP_04990354.1| DNA gyrase [Francisella novicida GA99-3548] >gb|ABK90351.1| DNA gyrase, subunit A [Francisella novicida U112] >gb|EDN38246.1| DNA gyrase [Francisella novicida GA99-3548] >gb|EDX20124.1| DNA gyrase, A subunit [Francisella tularensis subsp. novicida FTE] >gb|EDZ90795.1| DNA gyrase, A subunit [Francisella novicida FTG]
	165 	165 	83% 	8e-39	Gene info linked to YP_899105.1
YP_001479495.1 	
DNA gyrase subunit A [Serratia proteamaculans 568] >gb|ABV42367.1| DNA gyrase, A subunit [Serratia proteamaculans 568]
	165 	165 	85% 	8e-39	Gene info linked to YP_001479495.1
ACF04290.1 	
GyrA [Neisseria meningitidis] >gb|ACF04291.1| GyrA [Neisseria meningitidis] >gb|ACF04297.1| GyrA [Neisseria meningitidis] >gb|ACF04299.1| GyrA [Neisseria meningitidis]
	165 	165 	90% 	8e-39	
ZP_03822549.1 	
DNA gyrase [Acinetobacter sp. ATCC 27244] >gb|EEH69560.1| DNA gyrase [Acinetobacter sp. ATCC 27244]
	165 	165 	88% 	8e-39	
ZP_04988898.1 	
hypothetical protein FTCG_01000 [Francisella tularensis subsp. novicida GA99-3549] >gb|EDN36790.1| hypothetical protein FTCG_01000 [Francisella novicida GA99-3549]
	165 	165 	83% 	8e-39	
ZP_06751468.1 	
DNA gyrase, A subunit [Parascardovia denticolens F0305] >gb|EFG32681.1| DNA gyrase, A subunit [Parascardovia denticolens F0305]
	165 	165 	85% 	8e-39	
YP_277983.1 	
DNA gyrase, subunit A [Candidatus Blochmannia pennsylvanicus str. BPEN] >gb|AAZ41106.1| DNA gyrase, subunit A [Candidatus Blochmannia pennsylvanicus str. BPEN]
	165 	165 	88% 	8e-39	Gene info linked to YP_277983.1
YP_394619.1 	
DNA gyrase, A subunit [Lactobacillus sakei subsp. sakei 23K] >emb|CAI54308.1| DNA gyrase, A subunit [Lactobacillus sakei subsp. sakei 23K]
	165 	165 	83% 	8e-39	Gene info linked to YP_394619.1
ZP_00991854.1 	
DNA gyrase, subunit A [Vibrio splendidus 12B01] >gb|EAP93129.1| DNA gyrase, subunit A [Vibrio splendidus 12B01]
	165 	165 	96% 	9e-39	
ZP_06066430.1 	
DNA gyrase, A subunit [Acinetobacter junii SH205] >gb|EEY94261.1| DNA gyrase, A subunit [Acinetobacter junii SH205]
	165 	165 	88% 	9e-39	
YP_607166.1 	
DNA gyrase subunit A [Pseudomonas entomophila L48] >emb|CAK14356.1| DNA gyrase, subunit A, type II topoisomerase [Pseudomonas entomophila L48]
	165 	165 	83% 	9e-39	Gene info linked to YP_607166.1
YP_932570.1 	
DNA gyrase subunit A [Azoarcus sp. BH72] >emb|CAL93683.1| DNA topoisomerase (ATP-hydrolysing) [Azoarcus sp. BH72]
	165 	165 	85% 	9e-39	Gene info linked to YP_932570.1
ZP_07798167.1 	
DNA gyrase, A subunit [Faecalibacterium cf. prausnitzii KLE1255] >gb|EFQ08468.1| DNA gyrase, A subunit [Faecalibacterium cf. prausnitzii KLE1255]
	165 	165 	85% 	9e-39	
ZP_06755387.1 	
DNA gyrase, A subunit [Scardovia inopinata F0304] >gb|EFG26479.1| DNA gyrase, A subunit [Scardovia inopinata F0304]
	165 	165 	85% 	9e-39	
YP_219907.1 	
DNA gyrase subunit A [Chlamydophila abortus S26/3] >emb|CAH63946.1| DNA gyrase subunit A [Chlamydophila abortus S26/3]
	165 	165 	82% 	9e-39	Gene info linked to YP_219907.1
YP_892598.1 	
DNA gyrase subunit A [Campylobacter fetus subsp. fetus 82-40] >sp|P47235.1|GYRA_CAMFE RecName: Full=DNA gyrase subunit A >gb|AAA67068.1| DNA gyrase A subunit [Campylobacter fetus] >gb|ABK82785.1| DNA gyrase, A subunit [Campylobacter fetus subsp. fetus 82-40]
	165 	165 	80% 	9e-39	Gene info linked to YP_892598.1
YP_002222892.1 	
DNA gyrase, subunit A [Borrelia recurrentis A1] >gb|ACH94671.1| DNA gyrase, subunit A [Borrelia recurrentis A1]
	165 	165 	81% 	9e-39	Gene info linked to YP_002222892.1
ZP_01157464.1 	
DNA gyrase subunit A [Oceanicola granulosus HTCC2516] >gb|EAR50398.1| DNA gyrase subunit A [Oceanicola granulosus HTCC2516]
	165 	165 	84% 	9e-39	
YP_002731329.1 	
DNA gyrase subunit A [Persephonella marina EX-H1] >gb|ACO02997.1| DNA gyrase subunit A [Persephonella marina EX-H1]
	165 	165 	82% 	9e-39	Gene info linked to YP_002731329.1
YP_002222083.1 	
DNA gyrase, subunit A [Borrelia duttonii Ly] >gb|ACH93377.1| DNA gyrase, subunit A [Borrelia duttonii Ly]
	165 	165 	81% 	1e-38	Gene info linked to YP_002222083.1
XP_001712376.1 	
gyrA [Hemiselmis andersenii] >gb|ABW98051.1| gyrA [Hemiselmis andersenii]
	165 	165 	96% 	1e-38	Gene info linked to XP_001712376.1
ZP_01987946.1 	
DNA gyrase, A subunit [Vibrio harveyi HY01] >gb|EDL67361.1| DNA gyrase, A subunit [Vibrio harveyi HY01]
	165 	165 	87% 	1e-38	
NP_791570.1 	
DNA gyrase subunit A [Pseudomonas syringae pv. tomato str. DC3000] >ref|ZP_03396863.1| DNA gyrase, subunit A [Pseudomonas syringae pv. tomato T1] >ref|ZP_07229754.1| DNA gyrase subunit A [Pseudomonas syringae pv. tomato Max13] >ref|ZP_07251779.1| DNA gyrase subunit A [Pseudomonas syringae pv. tomato K40] >ref|ZP_07256017.1| DNA gyrase subunit A [Pseudomonas syringae pv. tomato NCPPB 1108] >gb|AAO55265.1| DNA gyrase, subunit A [Pseudomonas syringae pv. tomato str. DC3000] >gb|EEB60207.1| DNA gyrase, subunit A [Pseudomonas syringae pv. tomato T1]
	165 	165 	83% 	1e-38	Gene info linked to NP_791570.1
YP_513302.1 	
DNA gyrase, subunit A [Francisella tularensis subsp. holarctica LVS] >ref|YP_001427998.1| DNA gyrase subunit A [Francisella tularensis subsp. holarctica FTNF002-00] >ref|ZP_02274086.1| DNA gyrase, A subunit [Francisella tularensis subsp. holarctica FSC200] >ref|ZP_04983322.1| DNA gyrase subunit A gyrA [Francisella tularensis subsp. holarctica 257] >ref|ZP_04984784.1| DNA topoisomerase [Francisella tularensis subsp. holarctica FSC022] >ref|ZP_06559236.1| DNA gyrase, subunit A [Francisella tularensis subsp. holarctica URFT1] >ref|ZP_06802782.1| DNA gyrase, subunit A [Francisella tularensis subsp. holarctica URFT1] >emb|CAJ78973.1| DNA gyrase, subunit A [Francisella tularensis subsp. holarctica LVS] >gb|EBA52206.1| DNA gyrase subunit A gyrA [Francisella tularensis subsp. holarctica 257] >gb|ABU61042.1| DNA gyrase, A subunit [Francisella tularensis subsp. holarctica FTNF002-00] >gb|EDO65862.1| DNA topoisomerase [Francisella tularensis subsp. holarctica FSC022]
	165 	165 	83% 	1e-38	Gene info linked to YP_513302.1
YP_001891154.1 	
DNA gyrase, A subunit [Francisella tularensis subsp. mediasiatica FSC147] >gb|ACD30376.1| DNA gyrase, A subunit [Francisella tularensis subsp. mediasiatica FSC147]
	164 	164 	83% 	1e-38	Gene info linked to YP_001891154.1
YP_001445915.1 	
DNA gyrase subunit A [Vibrio harveyi ATCC BAA-1116] >gb|ABU71688.1| hypothetical protein VIBHAR_02730 [Vibrio harveyi ATCC BAA-1116]
	164 	164 	87% 	1e-38	Gene info linked to YP_001445915.1
ACF04298.1 	
GyrA [Neisseria lactamica]
	164 	164 	90% 	1e-38	
YP_763145.1 	
DNA gyrase, subunit A [Francisella tularensis subsp. holarctica OSU18] >gb|ABI82508.1| DNA topoisomerase (ATP-hydrolyzing) [Francisella tularensis subsp. holarctica OSU18]
	164 	164 	83% 	1e-38	Gene info linked to YP_763145.1
NP_906613.1 	
DNA gyrase subunit A [Wolinella succinogenes DSM 1740] >emb|CAE09513.1| DNA GYRASE SUBUNIT A [Wolinella succinogenes]
	164 	164 	97% 	1e-38	Gene info linked to NP_906613.1
ZP_07992961.1 	
DNA gyrase subunit A [Neisseria mucosa C102] >gb|EFV81129.1| DNA gyrase subunit A [Neisseria mucosa C102]
	164 	164 	90% 	1e-38	
YP_001817548.1 	
DNA gyrase, A subunit [Opitutus terrae PB90-1] >gb|ACB73948.1| DNA gyrase, A subunit [Opitutus terrae PB90-1]
	164 	164 	81% 	1e-38	Gene info linked to YP_001817548.1
ZP_07741470.1 	
DNA gyrase, A subunit [Vibrio caribbenthicus ATCC BAA-2122] >gb|EFP98229.1| DNA gyrase, A subunit [Vibrio caribbenthicus ATCC BAA-2122]
	164 	164 	82% 	1e-38	
YP_001121412.1 	
DNA gyrase, subunit A [Francisella tularensis subsp. tularensis WY96-3418] >gb|ABO46292.1| DNA gyrase, A subunit [Francisella tularensis subsp. tularensis WY96-3418]
	164 	164 	83% 	1e-38	Gene info linked to YP_001121412.1
BAC57594.1 	
DNA gyrase A [Campylobacter jejuni]
	164 	164 	82% 	1e-38	
ZP_03697195.1 	
DNA gyrase, A subunit [Lutiella nitroferrum 2002] >gb|EEG09681.1| DNA gyrase, A subunit [Lutiella nitroferrum 2002]
	164 	164 	85% 	1e-38	
ZP_07404358.1 	
DNA gyrase, A subunit [Corynebacterium matruchotii ATCC 14266] >gb|EFM48213.1| DNA gyrase, A subunit [Corynebacterium matruchotii ATCC 14266]
	164 	164 	83% 	1e-38	
ZP_04758660.1 	
DNA gyrase, A subunit [Neisseria flavescens SK114] >gb|EER55573.1| DNA gyrase, A subunit [Neisseria flavescens SK114]
	164 	164 	90% 	1e-38	
YP_002136813.1 	
DNA gyrase, A subunit [Anaeromyxobacter sp. K] >gb|ACG75684.1| DNA gyrase, A subunit [Anaeromyxobacter sp. K]
	164 	164 	82% 	1e-38	Gene info linked to YP_002136813.1
YP_003713041.1 	
DNA gyrase, subunit A, type II topoisomerase [Xenorhabdus nematophila ATCC 19061] >emb|CBJ90909.1| DNA gyrase, subunit A, type II topoisomerase [Xenorhabdus nematophila ATCC 19061]
	164 	164 	85% 	1e-38	Gene info linked to YP_003713041.1
ZP_02889495.1 	
DNA gyrase, A subunit [Burkholderia ambifaria IOP40-10] >gb|EDT04930.1| DNA gyrase, A subunit [Burkholderia ambifaria IOP40-10]
	164 	164 	82% 	1e-38	
ZP_01815223.1 	
DNA gyrase, subunit A [Vibrionales bacterium SWAT-3] >gb|EDK27387.1| DNA gyrase, subunit A [Vibrionales bacterium SWAT-3]
	164 	164 	96% 	1e-38	
CBK87197.1 	
DNA gyrase subunit A [Enterobacter cloacae subsp. cloacae NCTC 9394]
	164 	164 	85% 	1e-38	
YP_772809.1 	
DNA gyrase subunit A [Burkholderia ambifaria AMMD] >gb|ABI86475.1| DNA gyrase subunit A [Burkholderia ambifaria AMMD]
	164 	164 	82% 	1e-38	Gene info linked to YP_772809.1
YP_001172840.1 	
DNA gyrase subunit A [Pseudomonas stutzeri A1501] >gb|ABP79998.1| DNA gyrase subunit A [Pseudomonas stutzeri A1501]
	164 	164 	83% 	1e-38	Gene info linked to YP_001172840.1
YP_001807627.1 	
DNA gyrase subunit A [Burkholderia ambifaria MC40-6] >gb|ACB63411.1| DNA gyrase, A subunit [Burkholderia ambifaria MC40-6]
	164 	164 	82% 	1e-38	Gene info linked to YP_001807627.1
ZP_06062859.1 	
type IIA topoisomerase [Acinetobacter johnsonii SH046] >gb|EEY96638.1| type IIA topoisomerase [Acinetobacter johnsonii SH046]
	164 	164 	88% 	1e-38	
ZP_03710090.1 	
hypothetical protein CORMATOL_00906 [Corynebacterium matruchotii ATCC 33806] >gb|EEG27589.1| hypothetical protein CORMATOL_00906 [Corynebacterium matruchotii ATCC 33806]
	164 	164 	83% 	1e-38	
YP_004044994.1 	
DNA gyrase subunit a [Riemerella anatipestifer DSM 15868] >gb|ADQ81488.1| DNA gyrase subunit A [Riemerella anatipestifer DSM 15868]
	164 	164 	96% 	1e-38	Gene info linked to YP_004044994.1
YP_002494884.1 	
DNA gyrase, A subunit [Anaeromyxobacter dehalogenans 2CP-1] >gb|ACL67818.1| DNA gyrase, A subunit [Anaeromyxobacter dehalogenans 2CP-1]
	164 	164 	82% 	1e-38	Gene info linked to YP_002494884.1
YP_201045.1 	
DNA gyrase subunit A [Xanthomonas oryzae pv. oryzae KACC10331] >ref|YP_451313.1| DNA gyrase subunit A [Xanthomonas oryzae pv. oryzae MAFF 311018] >ref|YP_001913289.1| DNA gyrase subunit A [Xanthomonas oryzae pv. oryzae PXO99A] >gb|AAW75660.1| DNA gyrase subunit A [Xanthomonas oryzae pv. oryzae KACC10331] >dbj|BAE69039.1| DNA gyrase subunit A [Xanthomonas oryzae pv. oryzae MAFF 311018] >gb|ACD58757.1| DNA gyrase, A subunit [Xanthomonas oryzae pv. oryzae PXO99A]
	164 	164 	81% 	1e-38	Gene info linked to YP_201045.1
ZP_02905395.1 	
DNA gyrase, A subunit [Burkholderia ambifaria MEX-5] >gb|EDT43475.1| DNA gyrase, A subunit [Burkholderia ambifaria MEX-5]
	164 	164 	82% 	1e-38	
EFT35811.1 	
DNA gyrase subunit A [Riemerella anatipestifer RA-YM]
	164 	164 	96% 	1e-38	
YP_002890016.1 	
DNA gyrase, A subunit [Thauera sp. MZ1T] >gb|ACR01639.1| DNA gyrase, A subunit [Thauera sp. MZ1T]
	164 	164 	85% 	1e-38	Gene info linked to YP_002890016.1
NP_629959.1 	
DNA topoisomerase IV subunit A [Streptomyces coelicolor A3(2)] >emb|CAA15793.1| DNA gyrase-like protein [Streptomyces coelicolor A3(2)]
	164 	164 	83% 	1e-38	Gene info linked to NP_629959.1
ZP_04587479.1 	
DNA gyrase subunit A [Pseudomonas syringae pv. oryzae str. 1_6]
	164 	164 	83% 	1e-38	
YP_003531703.1 	
DNA gyrase subunit A [Erwinia amylovora CFBP1430] >ref|YP_003539336.1| DNA gyrase subunit A [Erwinia amylovora ATCC 49946] >emb|CBJ46938.1| DNA gyrase subunit A [Erwinia amylovora ATCC 49946] >emb|CBA21544.1| DNA gyrase, A subunit [Erwinia amylovora CFBP1430] >emb|CBX81229.1| DNA gyrase, A subunit [Erwinia amylovora ATCC BAA-2158]
	164 	164 	85% 	1e-38	Gene info linked to YP_003531703.1
ZP_01039756.1 	
DNA gyrase subunit A [Erythrobacter sp. NAP1] >gb|EAQ30227.1| DNA gyrase subunit A [Erythrobacter sp. NAP1]
	164 	164 	85% 	1e-38	
CBY17028.1 	
DNA gyrase subunit A [Chlamydophila psittaci RD1]
	164 	164 	82% 	1e-38	
YP_003957070.1 	
DNA gyrase subunit A [Stigmatella aurantiaca DW4/3-1] >gb|ADO75243.1| DNA gyrase, A subunit [Stigmatella aurantiaca DW4/3-1]
	164 	164 	84% 	1e-38	Gene info linked to YP_003957070.1
NP_871448.1 	
hypothetical protein WGLp445 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >dbj|BAC24591.1| gyrA [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis]
	164 	164 	85% 	1e-38	Gene info linked to NP_871448.1
YP_829508.1 	
DNA gyrase subunit A [Arthrobacter sp. FB24] >gb|ABK01408.1| DNA gyrase subunit A [Arthrobacter sp. FB24]
	164 	164 	84% 	2e-38	Gene info linked to YP_829508.1
ZP_06484730.1 	
DNA gyrase subunit A [Xanthomonas campestris pv. vasculorum NCPPB702] >ref|ZP_06490659.1| DNA gyrase subunit A [Xanthomonas campestris pv. musacearum NCPPB4381]
	164 	164 	81% 	2e-38	
BAC76770.1 	
DNA gyrase A [Treponema denticola]
	164 	164 	85% 	2e-38	
YP_001837429.1 	
DNA gyrase subunit A [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >ref|YP_001961134.1| DNA gyrase subunit A [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gb|ABZ92556.1| DNA gyrase subunit A [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gb|ABZ96153.1| DNA gyrase subunit A [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
	164 	164 	81% 	2e-38	Gene info linked to YP_001837429.1
YP_275809.1 	
DNA gyrase subunit A [Pseudomonas syringae pv. phaseolicola 1448A] >gb|AAZ37312.1| DNA gyrase, A subunit [Pseudomonas syringae pv. phaseolicola 1448A]
	164 	164 	83% 	2e-38	Gene info linked to YP_275809.1
YP_001896627.1 	
DNA gyrase subunit A [Burkholderia phytofirmans PsJN] >gb|ACD17403.1| DNA gyrase, A subunit [Burkholderia phytofirmans PsJN]
	164 	164 	82% 	2e-38	Gene info linked to YP_001896627.1
ZP_06498047.1 	
DNA gyrase subunit A [Pseudomonas syringae pv. syringae FF5]
	164 	164 	83% 	2e-38	
ZP_06456685.1 	
DNA gyrase subunit A [Pseudomonas syringae pv. aesculi str. NCPPB3681] >ref|ZP_06479516.1| DNA gyrase subunit A [Pseudomonas syringae pv. aesculi str. 2250] >ref|ZP_07006052.1| DNA gyrase subunit A [Pseudomonas savastanoi pv. savastanoi NCPPB 3335] >gb|EFH98377.1| DNA gyrase subunit A [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
	164 	164 	83% 	2e-38	
ZP_06178268.1 	
DNA gyrase, subunit A [Vibrio harveyi 1DA3] >gb|EEZ85452.1| DNA gyrase, subunit A [Vibrio harveyi 1DA3]
	164 	164 	87% 	2e-38	
ZP_02197384.1 	
DNA gyrase, subunit A [Vibrio sp. AND4] >gb|EDP57541.1| DNA gyrase, subunit A [Vibrio sp. AND4]
	164 	164 	82% 	2e-38	
YP_363403.1 	
DNA gyrase subunit A [Xanthomonas campestris pv. vesicatoria str. 85-10] >emb|CAJ23349.1| DNA gyrase subunit A [Xanthomonas campestris pv. vesicatoria str. 85-10]
	164 	164 	81% 	2e-38	Gene info linked to YP_363403.1
ZP_05639888.1 	
DNA gyrase subunit A [Pseudomonas syringae pv. tabaci ATCC 11528] >gb|EFW79440.1| DNA gyrase subunit A [Pseudomonas syringae pv. glycinea str. B076] >gb|EFW83561.1| DNA gyrase subunit A [Pseudomonas syringae pv. glycinea str. race 4]
	164 	164 	83% 	2e-38	
ZP_05968493.1 	
DNA gyrase, A subunit [Enterobacter cancerogenus ATCC 35316] >gb|EFC55986.1| DNA gyrase, A subunit [Enterobacter cancerogenus ATCC 35316]
	164 	164 	85% 	2e-38	
YP_002121039.1 	
DNA topoisomerase (ATP-hydrolyzing) [Hydrogenobaculum sp. Y04AAS1] >gb|ACG57061.1| DNA topoisomerase (ATP-hydrolyzing) [Hydrogenobaculum sp. Y04AAS1]
	164 	164 	82% 	2e-38	Gene info linked to YP_002121039.1
ZP_02242791.1 	
DNA gyrase subunit A [Xanthomonas oryzae pv. oryzicola BLS256]
	164 	164 	81% 	2e-38	
ZP_06704976.1 	
DNA gyrase subunit A [Xanthomonas fuscans subsp. aurantifolii str. ICPB 11122] >ref|ZP_06731230.1| DNA gyrase subunit A [Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535] >gb|EFF43510.1| DNA gyrase subunit A [Xanthomonas fuscans subsp. aurantifolii str. ICPB 11122] >gb|EFF47656.1| DNA gyrase subunit A [Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535]
	164 	164 	81% 	2e-38	
YP_003614006.1 	
DNA gyrase subunit A [Enterobacter cloacae subsp. cloacae ATCC 13047] >gb|ADF63057.1| DNA gyrase subunit A [Enterobacter cloacae subsp. cloacae ATCC 13047]
	164 	164 	85% 	2e-38	Gene info linked to YP_003614006.1
CBL01264.1 	
DNA gyrase subunit A [Faecalibacterium prausnitzii SL3/3]
	164 	164 	85% 	2e-38	
YP_510436.1 	
DNA gyrase subunit A [Jannaschia sp. CCS1] >gb|ABD55411.1| DNA gyrase A subunit [Jannaschia sp. CCS1]
	164 	164 	84% 	2e-38	Gene info linked to YP_510436.1
YP_002028961.1 	
DNA gyrase subunit A [Stenotrophomonas maltophilia R551-3] >gb|ACF52278.1| DNA gyrase, A subunit [Stenotrophomonas maltophilia R551-3]
	163 	163 	81% 	2e-38	Gene info linked to YP_002028961.1
YP_003782409.1 	
DNA gyrase subunit A [Corynebacterium pseudotuberculosis FRC41] >gb|ADK27802.1| DNA gyrase subunit A [Corynebacterium pseudotuberculosis FRC41] >gb|ADL09508.1| DNA gyrase subunit A [Corynebacterium pseudotuberculosis C231] >gb|ADL19919.1| DNA gyrase subunit A [Corynebacterium pseudotuberculosis 1002] >gb|ADO25307.1| DNA gyrase subunit A [Corynebacterium pseudotuberculosis I19]
	163 	163 	83% 	2e-38	Gene info linked to YP_003782409.1
ZP_02091488.1 	
hypothetical protein FAEPRAM212_01768 [Faecalibacterium prausnitzii M21/2] >gb|EDP21445.1| hypothetical protein FAEPRAM212_01768 [Faecalibacterium prausnitzii M21/2]
	163 	163 	85% 	2e-38	
ZP_05973771.2 	
DNA gyrase, A subunit [Providencia rustigianii DSM 4541] >gb|EFB71315.1| DNA gyrase, A subunit [Providencia rustigianii DSM 4541]
	163 	163 	85% 	2e-38	
ZP_07950977.1 	
DNA gyrase, subunit A [Enterobacteriaceae bacterium 9_2_54FAA] >gb|EFV40632.1| DNA gyrase, subunit A [Enterobacteriaceae bacterium 9_2_54FAA]
	163 	163 	85% 	3e-38	
YP_003742418.1 	
DNA gyrase subunit A [Erwinia billingiae Eb661] >emb|CAX60571.1| DNA gyrase subunit A [Erwinia billingiae Eb661]
	163 	163 	85% 	3e-38	Gene info linked to YP_003742418.1
YP_002892633.1 	
DNA gyrase, A subunit [Tolumonas auensis DSM 9187] >gb|ACQ93047.1| DNA gyrase, A subunit [Tolumonas auensis DSM 9187]
	163 	163 	88% 	3e-38	Gene info linked to YP_002892633.1
NP_599264.1 	
DNA gyrase subunit A [Corynebacterium glutamicum ATCC 13032] >ref|YP_224307.1| DNA gyrase subunit A [Corynebacterium glutamicum ATCC 13032] >dbj|BAB97406.1| DNA gyrase (topoisomerase II) A subunit [Corynebacterium glutamicum ATCC 13032] >emb|CAF18578.1| DNA TOPOISOMERASE (ATP-HYDROLYSING) [Corynebacterium glutamicum ATCC 13032]
	163 	163 	87% 	3e-38	Gene info linked to NP_599264.1
ZP_05704943.1 	
DNA gyrase, A subunit [Cardiobacterium hominis ATCC 15826] >gb|EEV88905.1| DNA gyrase, A subunit [Cardiobacterium hominis ATCC 15826]
	163 	163 	87% 	3e-38	
ZP_04946252.1 	
DNA gyrase subunit A [Burkholderia dolosa AUO158] >gb|EAY69423.1| DNA gyrase subunit A [Burkholderia dolosa AUO158]
	163 	163 	82% 	3e-38	
YP_002648308.1 	
DNA gyrase subunit A [Erwinia pyrifoliae Ep1/96] >emb|CAX55064.1| DNA gyrase subunit A [Erwinia pyrifoliae Ep1/96] >emb|CAY73749.1| DNA gyrase, A subunit [Erwinia pyrifoliae DSM 12163] >gb|ADP13089.1| DNA gyrase subunit A [Erwinia sp. Ejp617]
	163 	163 	85% 	3e-38	Gene info linked to YP_002648308.1
YP_002934033.1 	
DNA gyrase subunit A [Edwardsiella ictaluri 93-146] >gb|ACR69798.1| DNA gyrase, A subunit, putative [Edwardsiella ictaluri 93-146]
	163 	163 	85% 	3e-38	Gene info linked to YP_002934033.1
YP_170497.1 	
DNA gyrase, subunit A [Francisella tularensis subsp. tularensis SCHU S4] >ref|YP_667629.1| DNA gyrase, subunit A [Francisella tularensis subsp. tularensis FSC198] >ref|ZP_03666259.1| DNA gyrase, subunit A [Francisella tularensis subsp. tularensis MA00-2987] >ref|ZP_04987235.1| DNA gyrase [Francisella tularensis subsp. tularensis FSC033] >ref|ZP_05248176.1| DNA gyrase A [Francisella tularensis subsp. tularensis MA00-2987] >emb|CAG46208.1| DNA gyrase, subunit A [Francisella tularensis subsp. tularensis SCHU S4] >emb|CAL09591.1| DNA gyrase, subunit A [Francisella tularensis subsp. tularensis FSC198] >gb|EDN35127.1| DNA gyrase [Francisella tularensis subsp. tularensis FSC033] >gb|EET19901.1| DNA gyrase A [Francisella tularensis subsp. tularensis MA00-2987] >gb|ADA79221.1| DNA gyrase, subunit A [Francisella tularensis subsp. tularensis NE061598]
	163 	163 	83% 	3e-38	Gene info linked to YP_170497.1
YP_001136876.1 	
DNA gyrase subunit A [Corynebacterium glutamicum R] >dbj|BAF52974.1| hypothetical protein [Corynebacterium glutamicum R]
	163 	163 	87% 	3e-38	Gene info linked to YP_001136876.1
ZP_01224476.1 	
DNA gyrase subunit A [marine gamma proteobacterium HTCC2207] >gb|EAS46972.1| DNA gyrase subunit A [marine gamma proteobacterium HTCC2207]
	163 	163 	85% 	3e-38	
YP_945840.1 	
DNA gyrase subunit A [Arthrobacter aurescens TC1] >gb|ABM07057.1| DNA gyrase, A subunit [Arthrobacter aurescens TC1]
	163 	163 	84% 	3e-38	Gene info linked to YP_945840.1
YP_002219465.1 	
DNA gyrase subunit A [Acidithiobacillus ferrooxidans ATCC 53993] >ref|YP_002425372.1| DNA gyrase, A subunit [Acidithiobacillus ferrooxidans ATCC 23270] >gb|ACH83258.1| DNA gyrase, A subunit [Acidithiobacillus ferrooxidans ATCC 53993] >gb|ACK78946.1| DNA gyrase, A subunit [Acidithiobacillus ferrooxidans ATCC 23270]
	163 	163 	83% 	3e-38	Gene info linked to YP_002219465.1
YP_809657.1 	
DNA gyrase subunit A [Oenococcus oeni PSU-1] >gb|ABJ56011.1| DNA gyrase subunit A [Oenococcus oeni PSU-1]
	163 	163 	82% 	3e-38	Gene info linked to YP_809657.1
YP_442169.1 	
DNA gyrase subunit A [Burkholderia thailandensis E264] >ref|ZP_05586620.1| DNA gyrase subunit A [Burkholderia thailandensis E264] >gb|ABC38834.1| DNA gyrase, A subunit [Burkholderia thailandensis E264]
	163 	163 	82% 	3e-38	Gene info linked to YP_442169.1
ZP_02544446.1 	
DNA gyrase subunit A [candidate division TM7 single-cell isolate TM7c]
	163 	163 	97% 	4e-38	
ZP_02373921.1 	
DNA gyrase subunit A [Burkholderia thailandensis TXDOH]
	163 	163 	82% 	4e-38	
NP_641963.1 	
DNA gyrase subunit A [Xanthomonas axonopodis pv. citri str. 306] >gb|AAM36499.1| DNA gyrase subunit A [Xanthomonas axonopodis pv. citri str. 306]
	163 	163 	81% 	4e-38	Gene info linked to NP_641963.1
ZP_05064056.1 	
DNA gyrase, A subunit [Octadecabacter antarcticus 238] >gb|EDY89295.1| DNA gyrase, A subunit [Octadecabacter antarcticus 238]
	163 	163 	84% 	4e-38	
ZP_01544923.1 	
DNA gyrase, A subunit [Oenococcus oeni ATCC BAA-1163] >emb|CAH41001.1| DNA gyrase subunit A [Oenococcus oeni] >gb|EAV38889.1| DNA gyrase, A subunit [Oenococcus oeni ATCC BAA-1163]
	163 	163 	82% 	4e-38	
YP_047231.1 	
DNA gyrase, subunit A, type II topoisomerase [Acinetobacter sp. ADP1] >emb|CAG69409.1| DNA gyrase, subunit A, type II topoisomerase [Acinetobacter sp. ADP1]
	163 	163 	88% 	4e-38	Gene info linked to YP_047231.1
YP_001748248.1 	
DNA gyrase subunit A [Pseudomonas putida W619] >gb|ACA71879.1| DNA gyrase, A subunit [Pseudomonas putida W619]
	162 	162 	83% 	4e-38	Gene info linked to YP_001748248.1
ZP_07264338.1 	
DNA gyrase subunit A [Pseudomonas syringae pv. syringae 642]
	162 	162 	83% 	4e-38	
YP_236717.1 	
DNA gyrase subunit A [Pseudomonas syringae pv. syringae B728a] >gb|AAY38679.1| DNA gyrase, subunit A [Pseudomonas syringae pv. syringae B728a]
	162 	162 	83% 	4e-38	Gene info linked to YP_236717.1
ZP_02387756.1 	
DNA gyrase subunit A [Burkholderia thailandensis Bt4]
	162 	162 	82% 	4e-38	
YP_003941032.1 	
DNA gyrase, A subunit [Enterobacter cloacae SCF1] >gb|ADO47748.1| DNA gyrase, A subunit [Enterobacter cloacae SCF1]
	162 	162 	85% 	4e-38	Gene info linked to YP_003941032.1
ZP_07089998.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Corynebacterium genitalium ATCC 33030] >gb|EFK55311.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Corynebacterium genitalium ATCC 33030]
	162 	162 	83% 	4e-38	
ZP_06728441.1 	
DNA topoisomerase (ATP-hydrolyzing) [Acinetobacter haemolyticus ATCC 19194] >gb|EFF81866.1| DNA topoisomerase (ATP-hydrolyzing) [Acinetobacter haemolyticus ATCC 19194]
	162 	162 	88% 	4e-38	
YP_001982590.1 	
DNA gyrase, A subunit [Cellvibrio japonicus Ueda107] >gb|ACE83928.1| DNA gyrase, A subunit [Cellvibrio japonicus Ueda107]
	162 	162 	83% 	4e-38	Gene info linked to YP_001982590.1
ZP_03979495.1 	
DNA topoisomerase (ATP-hydrolyzing) [Corynebacterium lipophiloflavum DSM 44291] >gb|EEI16486.1| DNA topoisomerase (ATP-hydrolyzing) [Corynebacterium lipophiloflavum DSM 44291]
	162 	162 	87% 	4e-38	
YP_003535620.1 	
DNA gyrase subunit A [Haloferax volcanii DS2] >gb|ADE02547.1| DNA gyrase subunit A [Haloferax volcanii DS2]
	162 	162 	82% 	4e-38	Gene info linked to YP_003535620.1
NP_829373.1 	
DNA gyrase subunit A [Chlamydophila caviae GPIC] >gb|AAP05251.1| DNA gyrase, subunit A [Chlamydophila caviae GPIC]
	162 	162 	82% 	4e-38	Gene info linked to NP_829373.1
ZP_06552616.1 	
hypothetical protein AWRIB429_0006 [Oenococcus oeni AWRIB429] >gb|EFD89358.1| hypothetical protein AWRIB429_0006 [Oenococcus oeni AWRIB429]
	162 	162 	82% 	4e-38	
ZP_06502280.1 	
DNA gyrase, A subunit [Micrococcus luteus SK58] >gb|EFD50698.1| DNA gyrase, A subunit [Micrococcus luteus SK58]
	162 	162 	84% 	4e-38	
ZP_04678038.1 	
DNA topoisomerase IV, A subunit [Staphylococcus warneri L37603] >gb|EEQ79897.1| DNA topoisomerase IV, A subunit [Staphylococcus warneri L37603]
	162 	162 	88% 	5e-38	
YP_664733.1 	
DNA gyrase subunit A [Helicobacter acinonychis str. Sheeba] >emb|CAJ99734.1| DNA gyrase subunit A [Helicobacter acinonychis str. Sheeba]
	162 	162 	88% 	5e-38	Gene info linked to YP_664733.1
ZP_02063018.1 	
DNA gyrase, A subunit [Rickettsiella grylli] >gb|EDP47023.1| DNA gyrase, A subunit [Rickettsiella grylli]
	162 	162 	85% 	5e-38	
YP_003460449.1 	
DNA gyrase, A subunit [Thioalkalivibrio sp. K90mix] >gb|ADC71713.1| DNA gyrase, A subunit [Thioalkalivibrio sp. K90mix]
	162 	162 	58% 	5e-38	Gene info linked to YP_003460449.1
ZP_06503273.1 	
DNA gyrase, A subunit [Micrococcus luteus SK58] >gb|EFD49619.1| DNA gyrase, A subunit [Micrococcus luteus SK58]
	162 	162 	84% 	5e-38	
ZP_02468323.1 	
DNA gyrase subunit A [Burkholderia thailandensis MSMB43]
	162 	162 	82% 	5e-38	
YP_574218.1 	
DNA gyrase subunit A [Chromohalobacter salexigens DSM 3043] >gb|ABE59519.1| DNA gyrase subunit A [Chromohalobacter salexigens DSM 3043]
	162 	162 	82% 	5e-38	Gene info linked to YP_574218.1
YP_001700776.1 	
DNA gyrase subunit A [Mycobacterium abscessus ATCC 19977] >emb|CAM60122.1| DNA gyrase (subunit A) GyrA (DNA topoisomerase) [Mycobacterium abscessus]
	162 	162 	88% 	5e-38	Gene info linked to YP_001700776.1
YP_002266281.1 	
DNA gyrase subunit A [Helicobacter pylori G27] >gb|ACI27415.1| DNA gyrase subunit A [Helicobacter pylori G27]
	162 	162 	97% 	5e-38	Gene info linked to YP_002266281.1
YP_001667601.1 	
DNA gyrase subunit A [Pseudomonas putida GB-1] >gb|ABY97265.1| DNA gyrase, A subunit [Pseudomonas putida GB-1]
	162 	162 	83% 	5e-38	Gene info linked to YP_001667601.1
ZP_07455416.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Eubacterium yurii subsp. margaretiae ATCC 43715] >gb|EFM38130.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Eubacterium yurii subsp. margaretiae ATCC 43715]
	162 	162 	96% 	5e-38	
YP_002785925.1 	
DNA topoisomerase [Deinococcus deserti VCD115] >gb|ACO46171.1| putative DNA topoisomerase, ATP-hydrolyzing (DNA gyrase, subunit A) (DNA topoisomerase II) [Deinococcus deserti VCD115]
	162 	162 	83% 	5e-38	Gene info linked to YP_002785925.1
YP_627427.1 	
DNA gyrase subunit A [Helicobacter pylori HPAG1] >gb|ABF84753.1| DNA gyrase subunit A [Helicobacter pylori HPAG1]
	162 	162 	95% 	5e-38	Gene info linked to YP_627427.1
YP_002563402.1 	
DNA gyrase subunit A (gyrA) [Anaplasma marginale str. Florida] >gb|ACM49146.1| DNA gyrase subunit A (gyrA) [Anaplasma marginale str. Florida]
	162 	162 	96% 	6e-38	Gene info linked to YP_002563402.1
ZP_02448547.1 	
DNA gyrase subunit A [Burkholderia pseudomallei 91]
	162 	162 	82% 	6e-38	
ZP_08065497.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus peroris ATCC 700780] >gb|EFX40530.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus peroris ATCC 700780]
	162 	162 	93% 	6e-38	
ZP_05844765.1 	
DNA gyrase, A subunit [Rhodobacter sp. SW2] >gb|EEW24343.1| DNA gyrase, A subunit [Rhodobacter sp. SW2]
	162 	162 	84% 	6e-38	
YP_157516.1 	
DNA gyrase subunit A [Aromatoleum aromaticum EbN1] >emb|CAI06615.1| DNA gyrase subunit A [Aromatoleum aromaticum EbN1]
	162 	162 	85% 	6e-38	Gene info linked to YP_157516.1
ZP_03014416.1 	
hypothetical protein BACINT_01989 [Bacteroides intestinalis DSM 17393] >gb|EDV06890.1| hypothetical protein BACINT_01989 [Bacteroides intestinalis DSM 17393]
	162 	162 	83% 	6e-38	
ZP_06980216.1 	
DNA gyrase, A subunit [Neisseria sp. oral taxon 014 str. F0314] >gb|EFI24388.1| DNA gyrase, A subunit [Neisseria sp. oral taxon 014 str. F0314]
	162 	162 	90% 	6e-38	
ZP_05278895.1 	
DNA gyrase subunit A [Anaplasma marginale str. Virginia]
	162 	162 	96% 	6e-38	
NP_636945.1 	
DNA gyrase subunit A [Xanthomonas campestris pv. campestris str. ATCC 33913] >ref|YP_243729.1| DNA gyrase subunit A [Xanthomonas campestris pv. campestris str. 8004] >ref|YP_001904091.1| DNA gyrase subunit A [Xanthomonas campestris pv. campestris str. B100] >gb|AAM40869.1| DNA gyrase subunit A [Xanthomonas campestris pv. campestris str. ATCC 33913] >gb|AAY49709.1| DNA gyrase subunit A [Xanthomonas campestris pv. campestris str. 8004] >emb|CAP52047.1| DNA gyrase subunit A [Xanthomonas campestris pv. campestris]
	162 	162 	81% 	6e-38	Gene info linked to NP_636945.1
ZP_00946102.1 	
DNA gyrase subunit A [Ralstonia solanacearum UW551] >gb|EAP71391.1| DNA gyrase subunit A [Ralstonia solanacearum UW551]
	162 	162 	88% 	6e-38	
YP_003731109.1 	
DNA gyrase, A subunit [Acinetobacter sp. DR1] >gb|ADI89736.1| DNA gyrase, A subunit [Acinetobacter sp. DR1]
	162 	162 	88% 	6e-38	Gene info linked to YP_003731109.1
YP_249778.1 	
DNA gyrase subunit A [Corynebacterium jeikeium K411] >ref|ZP_05847442.1| DNA gyrase subunit A [Corynebacterium jeikeium ATCC 43734] >emb|CAI36160.1| DNA gyrase subunit A [Corynebacterium jeikeium K411] >gb|EEW15648.1| DNA gyrase subunit A [Corynebacterium jeikeium ATCC 43734]
	162 	162 	83% 	6e-38	Gene info linked to YP_249778.1
ZP_04621343.1 	
DNA gyrase subunit A [Yersinia aldovae ATCC 35236] >gb|EEP94147.1| DNA gyrase subunit A [Yersinia aldovae ATCC 35236]
	162 	162 	85% 	7e-38	
YP_391460.1 	
DNA gyrase, A subunit [Thiomicrospira crunogena XCL-2] >gb|ABB41786.1| DNA gyrase subunit A [Thiomicrospira crunogena XCL-2]
	162 	162 	87% 	7e-38	Gene info linked to YP_391460.1
YP_467546.1 	
DNA gyrase subunit A [Anaeromyxobacter dehalogenans 2CP-C] >gb|ABC84109.1| DNA gyrase subunit A [Anaeromyxobacter dehalogenans 2CP-C]
	162 	162 	82% 	7e-38	Gene info linked to YP_467546.1
AAY40350.1 	
DNA gyrase subunit A [Edwardsiella tarda]
	162 	162 	85% 	7e-38	
ZP_05496922.1 	
DNA gyrase, A subunit [Clostridium papyrosolvens DSM 2782] >gb|EEU58153.1| DNA gyrase, A subunit [Clostridium papyrosolvens DSM 2782]
	162 	162 	82% 	7e-38	
ZP_06595088.1 	
DNA gyrase, A subunit [Bifidobacterium breve DSM 20213] >gb|EFE90144.1| DNA gyrase, A subunit [Bifidobacterium breve DSM 20213]
	162 	162 	85% 	7e-38	
ZP_06184708.1 	
DNA gyrase, A subunit [Mobiluncus mulieris 28-1] >ref|ZP_07451252.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Mobiluncus mulieris ATCC 35239] >ref|ZP_07636908.1| DNA gyrase, A subunit [Mobiluncus mulieris FB024-16] >gb|EEZ90626.1| DNA gyrase, A subunit [Mobiluncus mulieris 28-1] >gb|EFM47013.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Mobiluncus mulieris ATCC 35239] >gb|EFN94113.1| DNA gyrase, A subunit [Mobiluncus mulieris FB024-16]
	162 	162 	83% 	7e-38	
ZP_05977952.1 	
DNA gyrase, A subunit [Neisseria mucosa ATCC 25996] >gb|EFC88049.1| DNA gyrase, A subunit [Neisseria mucosa ATCC 25996]
	162 	162 	90% 	7e-38	
ZP_04685445.1 	
DNA topoisomerase IV subunit A [Streptomyces ghanaensis ATCC 14672] >ref|ZP_06576207.1| DNA topoisomerase IV subunit A [Streptomyces ghanaensis ATCC 14672] >gb|EFE66668.1| DNA topoisomerase IV subunit A [Streptomyces ghanaensis ATCC 14672]
	162 	162 	84% 	8e-38	
ZP_07467872.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Corynebacterium accolens ATCC 49726] >gb|EFM44837.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Corynebacterium accolens ATCC 49726]
	162 	162 	83% 	8e-38	
ZP_03539947.1 	
DNA gyrase, A subunit [Borrelia garinii Far04] >gb|EED30242.1| DNA gyrase, A subunit [Borrelia garinii Far04]
	162 	162 	81% 	8e-38	
YP_003040394.1 	
DNA gyrase subunit A [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949] >emb|CAQ83650.1| dna gyrase subunit a [Photorhabdus asymbiotica]
	162 	162 	85% 	8e-38	Gene info linked to YP_003040394.1
ZP_03994658.1 	
DNA topoisomerase (ATP-hydrolyzing) [Mobiluncus mulieris ATCC 35243] >gb|EEJ53059.1| DNA topoisomerase (ATP-hydrolyzing) [Mobiluncus mulieris ATCC 35243]
	162 	162 	83% 	8e-38	
ZP_03932300.1 	
DNA topoisomerase (ATP-hydrolyzing) [Corynebacterium accolens ATCC 49725] >gb|EEI15038.1| DNA topoisomerase (ATP-hydrolyzing) [Corynebacterium accolens ATCC 49725]
	162 	162 	83% 	8e-38	
ZP_01617188.1 	
DNA gyrase subunit A [marine gamma proteobacterium HTCC2143] >gb|EAW30951.1| DNA gyrase subunit A [marine gamma proteobacterium HTCC2143]
	162 	162 	82% 	8e-38	
YP_004041960.1 	
DNA gyrase subunit a [Paludibacter propionicigenes WB4] >gb|ADQ78975.1| DNA gyrase subunit A [Paludibacter propionicigenes WB4]
	162 	162 	83% 	8e-38	Gene info linked to YP_004041960.1
ZP_01868163.1 	
DNA gyrase, subunit A [Vibrio shilonii AK1] >gb|EDL53157.1| DNA gyrase, subunit A [Vibrio shilonii AK1]
	162 	162 	87% 	8e-38	
YP_001452135.1 	
DNA gyrase subunit A [Citrobacter koseri ATCC BAA-895] >gb|ABV11699.1| hypothetical protein CKO_00543 [Citrobacter koseri ATCC BAA-895]
	162 	162 	85% 	8e-38	Gene info linked to YP_001452135.1
YP_004146800.1 	
DNA gyrase, A subunit [Pseudoxanthomonas suwonensis 11-1] >gb|ADV27569.1| DNA gyrase, A subunit [Pseudoxanthomonas suwonensis 11-1]
	162 	162 	81% 	8e-38	Gene info linked to YP_004146800.1
YP_001141770.1 	
DNA gyrase [Aeromonas salmonicida subsp. salmonicida A449] >gb|ABO90022.1| DNA gyrase [Aeromonas salmonicida subsp. salmonicida A449]
	161 	161 	83% 	9e-38	Gene info linked to YP_001141770.1
ZP_04963073.1 	
DNA gyrase, A subunit [Burkholderia pseudomallei 406e] >gb|EDO82688.1| DNA gyrase, A subunit [Burkholderia pseudomallei 406e]
	161 	161 	82% 	9e-38	
ZP_03539080.1 	
DNA gyrase, A subunit [Borrelia garinii PBr] >gb|EED29178.1| DNA gyrase, A subunit [Borrelia garinii PBr]
	161 	161 	81% 	9e-38	
ZP_07306978.1 	
DNA gyrase, A subunit [Streptomyces viridochromogenes DSM 40736] >gb|EFL35347.1| DNA gyrase, A subunit [Streptomyces viridochromogenes DSM 40736]
	161 	161 	83% 	9e-38	
NP_938418.1 	
DNA gyrase subunit A [Corynebacterium diphtheriae NCTC 13129] >emb|CAE48520.1| DNA gyrase subunit A [Corynebacterium diphtheriae]
	161 	161 	83% 	9e-38	Gene info linked to NP_938418.1
ZP_03451991.1 	
DNA gyrase, A subunit [Burkholderia pseudomallei 576] >ref|YP_002897752.1| DNA gyrase, A subunit [Burkholderia pseudomallei MSHR346] >ref|ZP_04902084.1| DNA gyrase, A subunit [Burkholderia pseudomallei S13] >gb|EDS85096.1| DNA gyrase, A subunit [Burkholderia pseudomallei S13] >gb|EEC35915.1| DNA gyrase, A subunit [Burkholderia pseudomallei 576] >gb|ACQ95370.1| DNA gyrase, A subunit [Burkholderia pseudomallei MSHR346]
	161 	161 	82% 	9e-38	
ZP_04887681.1 	
DNA gyrase, A subunit [Burkholderia pseudomallei 1655] >gb|EDU08665.1| DNA gyrase, A subunit [Burkholderia pseudomallei 1655]
	161 	161 	82% 	9e-38	
ZP_06538748.1 	
DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Typhi str. AG3]
	161 	161 	85% 	1e-37	
YP_802686.1 	
DNA gyrase, A subunit [Buchnera aphidicola str. Cc (Cinara cedri)] >gb|ABJ90593.1| DNA gyrase, A subunit [Buchnera aphidicola str. Cc (Cinara cedri)]
	161 	161 	85% 	1e-37	Gene info linked to YP_802686.1
YP_102248.1 	
DNA gyrase subunit A [Burkholderia mallei ATCC 23344] >ref|YP_001026943.1| DNA gyrase subunit A [Burkholderia mallei NCTC 10229] >ref|YP_001079770.1| DNA gyrase subunit A [Burkholderia mallei NCTC 10247] >ref|ZP_04883453.1| DNA gyrase, A subunit [Burkholderia mallei ATCC 10399] >ref|ZP_04976304.1| DNA gyrase, A subunit [Burkholderia mallei 2002721280] >gb|AAU48810.1| DNA gyrase, A subunit [Burkholderia mallei ATCC 23344] >gb|ABN02528.1| DNA gyrase, A subunit [Burkholderia mallei NCTC 10229] >gb|ABO06828.1| DNA gyrase, A subunit [Burkholderia mallei NCTC 10247] >gb|EDK87179.1| DNA gyrase, A subunit [Burkholderia mallei 2002721280] >gb|EDP87807.1| DNA gyrase, A subunit [Burkholderia mallei ATCC 10399]
	161 	161 	82% 	1e-37	Gene info linked to YP_102248.1
ZP_06863910.1 	
DNA gyrase, A subunit [Neisseria polysaccharea ATCC 43768] >gb|EFH23336.1| DNA gyrase, A subunit [Neisseria polysaccharea ATCC 43768]
	161 	161 	90% 	1e-37	
YP_993880.1 	
DNA gyrase subunit A [Burkholderia mallei SAVP1] >ref|ZP_04609705.1| DNA gyrase, A subunit [Burkholderia mallei GB8 horse 4] >ref|ZP_04819906.1| DNA gyrase, A subunit [Burkholderia mallei PRL-20] >ref|ZP_04910291.1| DNA gyrase, A subunit [Burkholderia mallei FMH] >ref|ZP_04915259.1| DNA gyrase, A subunit [Burkholderia mallei JHU] >gb|ABM50056.1| DNA gyrase, A subunit [Burkholderia mallei SAVP1] >gb|EDK52523.1| DNA gyrase, A subunit [Burkholderia mallei FMH] >gb|EDK57856.1| DNA gyrase, A subunit [Burkholderia mallei JHU] >gb|EEP87573.1| DNA gyrase, A subunit [Burkholderia mallei GB8 horse 4] >gb|EES46405.1| DNA gyrase, A subunit [Burkholderia mallei PRL-20]
	161 	161 	82% 	1e-37	Gene info linked to YP_993880.1
YP_109117.1 	
DNA gyrase subunit A [Burkholderia pseudomallei K96243] >ref|YP_334380.1| DNA gyrase subunit A [Burkholderia pseudomallei 1710b] >ref|YP_001059907.1| DNA gyrase subunit A [Burkholderia pseudomallei 668] >ref|YP_001067196.1| DNA gyrase subunit A [Burkholderia pseudomallei 1106a] >ref|ZP_01764302.1| DNA gyrase, A subunit [Burkholderia pseudomallei 305] >ref|ZP_02403910.1| DNA gyrase subunit A [Burkholderia pseudomallei DM98] >ref|ZP_02412435.1| DNA gyrase subunit A [Burkholderia pseudomallei 14] >ref|ZP_02456739.1| DNA gyrase subunit A [Burkholderia pseudomallei 9] >ref|ZP_02472279.1| DNA gyrase subunit A [Burkholderia pseudomallei B7210] >ref|ZP_02482760.1| DNA gyrase subunit A [Burkholderia pseudomallei 7894] >ref|ZP_02490950.1| DNA gyrase subunit A [Burkholderia pseudomallei NCTC 13177] >ref|ZP_02499084.1| DNA gyrase subunit A [Burkholderia pseudomallei 112] >ref|ZP_02507075.1| DNA gyrase subunit A [Burkholderia pseudomallei BCC215] >ref|ZP_03793429.1| DNA gyrase, A subunit [Burkholderia pseudomallei Pakistan 9] >ref|ZP_04814147.1| DNA gyrase, A subunit [Burkholderia pseudomallei 1106b] >ref|ZP_04898469.1| DNA gyrase, A subunit [Burkholderia pseudomallei Pasteur 52237] >ref|ZP_04952211.1| DNA gyrase, A subunit [Burkholderia pseudomallei 1710a] >emb|CAH36528.1| DNA Gyrase, subunit A [Burkholderia pseudomallei K96243] >gb|ABA50748.1| DNA gyrase, A subunit [Burkholderia pseudomallei 1710b] >gb|ABN83755.1| DNA gyrase, A subunit [Burkholderia pseudomallei 668] >gb|ABN90955.1| DNA gyrase, A subunit [Burkholderia pseudomallei 1106a] >gb|EBA51316.1| DNA gyrase, A subunit [Burkholderia pseudomallei 305] >gb|EDO95556.1| DNA gyrase, A subunit [Burkholderia pseudomallei Pasteur 52237] >gb|EEH26056.1| DNA gyrase, A subunit [Burkholderia pseudomallei Pakistan 9] >gb|EES24772.1| DNA gyrase, A subunit [Burkholderia pseudomallei 1106b] >gb|EET09230.1| DNA gyrase, A subunit [Burkholderia pseudomallei 1710a]
	161 	161 	82% 	1e-37	Gene info linked to YP_109117.1
ZP_04612702.1 	
DNA gyrase subunit A [Yersinia rohdei ATCC 43380] >gb|EEQ02706.1| DNA gyrase subunit A [Yersinia rohdei ATCC 43380]
	161 	161 	85% 	1e-37	
YP_003263220.1 	
DNA gyrase, A subunit [Halothiobacillus neapolitanus c2] >gb|ACX96173.1| DNA gyrase, A subunit [Halothiobacillus neapolitanus c2]
	161 	161 	87% 	1e-37	Gene info linked to YP_003263220.1
NP_207495.1 	
DNA gyrase subunit A [Helicobacter pylori 26695] >sp|P48370.2|GYRA_HELPY RecName: Full=DNA gyrase subunit A >gb|AAD07753.1| DNA gyrase, sub A (gyrA) [Helicobacter pylori 26695]
	161 	161 	97% 	1e-37	Gene info linked to NP_207495.1
YP_582868.1 	
DNA gyrase subunit A [Cupriavidus metallidurans CH34] >gb|ABF07599.1| DNA gyrase (type II topoisomerase), subunit A [Cupriavidus metallidurans CH34]
	161 	161 	87% 	1e-37	Gene info linked to YP_582868.1
YP_945432.1 	
DNA gyrase subunit A [Borrelia turicatae 91E135] >gb|AAX17762.1| DNA gyrase subunit A [Borrelia turicatae 91E135]
	161 	161 	81% 	1e-37	Gene info linked to YP_945432.1
ZP_05053763.1 	
DNA gyrase, A subunit [Octadecabacter antarcticus 307] >gb|EDY80029.1| DNA gyrase, A subunit [Octadecabacter antarcticus 307]
	161 	161 	84% 	1e-37	
ZP_07675775.1 	
DNA gyrase, A subunit [Ralstonia sp. 5_7_47FAA] >gb|EFP65762.1| DNA gyrase, A subunit [Ralstonia sp. 5_7_47FAA]
	161 	161 	88% 	1e-37	
ZP_02363670.1 	
DNA gyrase subunit A [Burkholderia oklahomensis C6786]
	161 	161 	82% 	1e-37	
ZP_05320169.1 	
DNA gyrase, A subunit [Neisseria sicca ATCC 29256] >gb|EET42897.1| DNA gyrase, A subunit [Neisseria sicca ATCC 29256]
	161 	161 	90% 	1e-37	
ZP_05881832.1 	
DNA gyrase subunit A [Vibrio metschnikovii CIP 69.14] >gb|EEX37258.1| DNA gyrase subunit A [Vibrio metschnikovii CIP 69.14]
	161 	161 	82% 	1e-37	
YP_004171702.1 	
DNA gyrase subunit A [Deinococcus maricopensis DSM 21211] >gb|ADV68037.1| DNA gyrase, A subunit [Deinococcus maricopensis DSM 21211]
	161 	161 	83% 	1e-37	Gene info linked to YP_004171702.1
YP_001177515.1 	
DNA gyrase subunit A [Enterobacter sp. 638] >gb|ABP61464.1| DNA gyrase subunit A [Enterobacter sp. 638]
	161 	161 	85% 	1e-37	Gene info linked to YP_001177515.1
ADU79863.1 	
DNA gyrase subunit A [Helicobacter pylori India7]
	161 	161 	97% 	1e-37	
ZP_06736175.1 	
hypothetical protein NEIELOOT_03033 [Neisseria elongata subsp. glycolytica ATCC 29315] >gb|EFE48199.1| hypothetical protein NEIELOOT_03033 [Neisseria elongata subsp. glycolytica ATCC 29315]
	161 	161 	90% 	1e-37	
YP_001269255.1 	
DNA gyrase subunit A [Pseudomonas putida F1] >gb|ABQ80071.1| DNA gyrase subunit A [Pseudomonas putida F1]
	161 	161 	83% 	1e-37	Gene info linked to YP_001269255.1
ADR61433.1 	
DNA gyrase subunit A [Pseudomonas putida BIRD-1]
	161 	161 	83% 	1e-37	
EGA39242.1 	
DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008283]
	161 	161 	85% 	1e-37	
YP_002980815.1 	
DNA gyrase subunit A [Ralstonia pickettii 12D] >gb|ACS62143.1| DNA gyrase, A subunit [Ralstonia pickettii 12D]
	161 	161 	88% 	1e-37	Gene info linked to YP_002980815.1
YP_001898354.1 	
DNA gyrase, A subunit [Ralstonia pickettii 12J] >gb|ACD25922.1| DNA gyrase, A subunit [Ralstonia pickettii 12J]
	161 	161 	88% 	1e-37	Gene info linked to YP_001898354.1
NP_743923.1 	
DNA gyrase subunit A [Pseudomonas putida KT2440] >gb|AAN67387.1|AE016365_2 DNA gyrase, subunit A [Pseudomonas putida KT2440]
	161 	161 	83% 	1e-37	Gene info linked to NP_743923.1
YP_072877.1 	
DNA gyrase, subunit A [Borrelia garinii PBi] >gb|AAU07285.1| DNA gyrase, subunit A [Borrelia garinii PBi]
	161 	161 	81% 	1e-37	Gene info linked to YP_072877.1
YP_296783.1 	
DNA gyrase subunit A [Ralstonia eutropha JMP134] >gb|AAZ61939.1| DNA gyrase subunit A [Ralstonia eutropha JMP134]
	161 	161 	87% 	1e-37	Gene info linked to YP_296783.1
YP_001972873.1 	
DNA gyrase subunit A [Stenotrophomonas maltophilia K279a] >emb|CAQ46582.1| putative DNA gyrase subunit A [Stenotrophomonas maltophilia K279a]
	161 	161 	81% 	1e-37	Gene info linked to YP_001972873.1
ABV03201.1 	
GyrA [Chlamydia trachomatis]
	161 	161 	82% 	1e-37	
ZP_01895129.1 	
DNA gyrase, A subunit [Marinobacter algicola DG893] >gb|EDM46787.1| DNA gyrase, A subunit [Marinobacter algicola DG893]
	161 	161 	83% 	1e-37	
ZP_01739546.1 	
DNA gyrase, A subunit [Marinobacter sp. ELB17] >gb|EAZ97567.1| DNA gyrase, A subunit [Marinobacter sp. ELB17]
	161 	161 	83% 	1e-37	
YP_003365897.1 	
DNA gyrase subunit A [Citrobacter rodentium ICC168] >emb|CBG89099.1| DNA gyrase subunit A [Citrobacter rodentium ICC168]
	161 	161 	85% 	1e-37	Gene info linked to YP_003365897.1
ABV03192.1 	
GyrA [Chlamydia trachomatis] >gb|ABV03193.1| GyrA [Chlamydia trachomatis] >gb|ABV03194.1| GyrA [Chlamydia trachomatis] >gb|ABV03195.1| GyrA [Chlamydia trachomatis] >gb|ABV03196.1| GyrA [Chlamydia trachomatis] >gb|ABV03197.1| GyrA [Chlamydia trachomatis] >gb|ABV03198.1| GyrA [Chlamydia trachomatis] >gb|ABV03199.1| GyrA [Chlamydia trachomatis] >gb|ABV03200.1| GyrA [Chlamydia trachomatis]
	161 	161 	82% 	1e-37	
ZP_01899862.1 	
DNA gyrase, subunit A, type II topoisomerase [Moritella sp. PE36] >gb|EDM65692.1| DNA gyrase, subunit A, type II topoisomerase [Moritella sp. PE36]
	161 	161 	85% 	1e-37	
ABV03191.1 	
GyrA [Chlamydia trachomatis]
	161 	161 	82% 	1e-37	
ZP_04819225.1 	
DNA topoisomerase IV subunit A [Staphylococcus epidermidis M23864:W1] >gb|EES40221.1| DNA topoisomerase IV subunit A [Staphylococcus epidermidis M23864:W1]
	161 	161 	88% 	1e-37	
ADN79837.1 	
DNA gyrase subunit A [Helicobacter pylori 908]
	161 	161 	88% 	1e-37	
ZP_04640959.1 	
DNA gyrase subunit A [Yersinia mollaretii ATCC 43969] >gb|EEQ10548.1| DNA gyrase subunit A [Yersinia mollaretii ATCC 43969]
	161 	161 	85% 	1e-37	
YP_001336287.1 	
DNA gyrase subunit A [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gb|ABR78057.1| DNA gyrase subunit A [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
	160 	160 	85% 	1e-37	Gene info linked to YP_001336287.1
ADK86940.1 	
DNA gyrase, A subunit [Mycoplasma pneumoniae FH]
	160 	160 	94% 	1e-37	
YP_002237364.1 	
DNA gyrase, A subunit [Klebsiella pneumoniae 342] >ref|ZP_06547866.1| DNA gyrase, A subunit [Klebsiella sp. 1_1_55] >gb|ACI09783.1| DNA gyrase, A subunit [Klebsiella pneumoniae 342] >gb|EFD85886.1| DNA gyrase, A subunit [Klebsiella sp. 1_1_55]
	160 	160 	85% 	2e-37	Gene info linked to YP_002237364.1
ZP_03065641.1 	
DNA gyrase, A subunit [Shigella dysenteriae 1012] >gb|EDX34544.1| DNA gyrase, A subunit [Shigella dysenteriae 1012] >gb|EFW53759.1| DNA gyrase subunit A [Shigella boydii ATCC 9905]
	160 	160 	85% 	2e-37	
YP_002956135.1 	
DNA gyrase subunit A [Micrococcus luteus NCTC 2665] >ref|ZP_06246701.1| DNA gyrase subunit A [Micrococcus luteus NCTC 2665] >gb|ACS29581.1| DNA gyrase subunit A [Micrococcus luteus NCTC 2665]
	160 	160 	84% 	2e-37	Gene info linked to YP_002956135.1
YP_001625554.1 	
DNA topoisomerase IV subunit A [Renibacterium salmoninarum ATCC 33209] >gb|ABY24140.1| DNA gyrase subunit A [Renibacterium salmoninarum ATCC 33209]
	160 	160 	83% 	2e-37	Gene info linked to YP_001625554.1
YP_001469979.1 	
DNA gyrase, A subunit [Thermotoga lettingae TMO] >gb|ABV32915.1| DNA gyrase, A subunit [Thermotoga lettingae TMO]
	160 	160 	82% 	2e-37	Gene info linked to YP_001469979.1
ZP_00995998.1 	
putative DNA gyrase subunit A [Janibacter sp. HTCC2649] >gb|EAP97946.1| putative DNA gyrase subunit A [Janibacter sp. HTCC2649]
	160 	160 	82% 	2e-37	
ADU41007.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Helicobacter pylori 35A]
	160 	160 	85% 	2e-37	
YP_002920503.1 	
DNA gyrase subunit A [Klebsiella pneumoniae NTUH-K2044] >ref|ZP_06016413.1| DNA gyrase subunit A [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] >dbj|BAH64436.1| DNA gyrase subunit A [Klebsiella pneumoniae NTUH-K2044] >gb|EEW40521.1| DNA gyrase subunit A [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884]
	160 	160 	85% 	2e-37	Gene info linked to YP_002920503.1
YP_616213.1 	
DNA gyrase subunit A [Sphingopyxis alaskensis RB2256] >gb|ABF52880.1| DNA gyrase subunit A [Sphingopyxis alaskensis RB2256]
	160 	160 	85% 	2e-37	Gene info linked to YP_616213.1
YP_393154.1 	
DNA gyrase subunit A [Sulfurimonas denitrificans DSM 1251] >gb|ABB43919.1| DNA gyrase subunit A [Sulfurimonas denitrificans DSM 1251]
	160 	160 	82% 	2e-37	Gene info linked to YP_393154.1
YP_003928619.1 	
DNA gyrase subunit A [Helicobacter pylori SJM180] >gb|ADO02302.1| DNA gyrase subunit A [Helicobacter pylori SJM180]
	160 	160 	97% 	2e-37	Gene info linked to YP_003928619.1
YP_458157.1 	
DNA gyrase subunit A [Erythrobacter litoralis HTCC2594] >gb|ABC63360.1| type IIA topoisomeraseA subunit [Erythrobacter litoralis HTCC2594]
	160 	160 	87% 	2e-37	Gene info linked to YP_458157.1
YP_001654517.1 	
DNA gyrase subunit A [Chlamydia trachomatis 434/Bu] >ref|YP_001653529.1| DNA gyrase subunit A [Chlamydia trachomatis L2b/UCH-1/proctitis] >ref|ZP_07223902.1| DNA gyrase subunit A [Chlamydia trachomatis L2tet1] >emb|CAP03880.1| DNA gyrase subunit A [Chlamydia trachomatis 434/Bu] >emb|CAP06834.1| DNA gyrase subunit A [Chlamydia trachomatis L2b/UCH-1/proctitis]
	160 	160 	87% 	2e-37	Gene info linked to YP_001654517.1
YP_001005708.1 	
DNA gyrase subunit A [Yersinia enterocolitica subsp. enterocolitica 8081] >emb|CAL11487.1| DNA gyrase subunit A [Yersinia enterocolitica subsp. enterocolitica 8081]
	160 	160 	85% 	2e-37	Gene info linked to YP_001005708.1
ADI34786.1 	
DNA gyrase, A subunit [Helicobacter pylori v225d]
	160 	160 	85% 	2e-37	
ZP_07289726.1 	
DNA gyrase subunit A [Streptomyces sp. C] >gb|EFL18095.1| DNA gyrase subunit A [Streptomyces sp. C]
	160 	160 	84% 	2e-37	
ZP_03680530.1 	
hypothetical protein BACCELL_04903 [Bacteroides cellulosilyticus DSM 14838] >gb|EEF87486.1| hypothetical protein BACCELL_04903 [Bacteroides cellulosilyticus DSM 14838]
	160 	160 	83% 	2e-37	
ZP_03350721.1 	
DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Typhi str. E01-6750]
	160 	160 	85% 	2e-37	
YP_001002159.1 	
DNA gyrase, A subunit [Halorhodospira halophila SL1] >gb|ABM61357.1| DNA gyrase subunit A [Halorhodospira halophila SL1]
	160 	160 	82% 	2e-37	Gene info linked to YP_001002159.1
YP_217262.1 	
DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gb|AAX66181.1| DNA gyrase, subunit A, type II topoisomerase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >dbj|BAJ37236.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Typhimurium str. T000240]
	160 	160 	85% 	2e-37	Gene info linked to YP_217262.1
YP_002216341.1 	
DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gb|ACH75747.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
	160 	160 	85% 	2e-37	Gene info linked to YP_002216341.1
YP_002227190.1 	
DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] >emb|CAR38131.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
	160 	160 	85% 	2e-37	Gene info linked to YP_002227190.1
ZP_03214477.1 	
DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gb|EDZ03508.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Virchow str. SL491]
	160 	160 	85% 	2e-37	
YP_709880.1 	
DNA gyrase, subunit A [Borrelia afzelii PKo] >gb|ABH01704.1| DNA gyrase, subunit A [Borrelia afzelii PKo]
	160 	160 	81% 	2e-37	Gene info linked to YP_709880.1
NP_804448.1 	
DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gb|AAO68297.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
	160 	160 	85% 	2e-37	Gene info linked to NP_804448.1
BAC76771.1 	
DNA gyrase A [Treponema denticola]
	160 	160 	85% 	2e-37	
ZP_06544200.1 	
DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Typhi str. E98-3139]
	160 	160 	85% 	2e-37	
YP_001842822.1 	
DNA gyrase subunit A [Lactobacillus fermentum IFO 3956] >dbj|BAG26342.1| DNA gyrase subunit A [Lactobacillus fermentum IFO 3956]
	160 	160 	82% 	2e-37	Gene info linked to YP_001842822.1
ZP_08041093.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus equinus ATCC 9812] >gb|EFW89393.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus equinus ATCC 9812]
	160 	160 	83% 	2e-37	
YP_002321521.1 	
DNA gyrase, A subunit [Bifidobacterium longum subsp. infantis ATCC 15697] >gb|ACJ51143.1| DNA gyrase, A subunit [Bifidobacterium longum subsp. infantis ATCC 15697] >dbj|BAJ67602.1| DNA gyrase subunit A [Bifidobacterium longum subsp. infantis JCM 1222]
	160 	160 	85% 	2e-37	Gene info linked to YP_002321521.1
ZP_02654691.1 	
DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >ref|ZP_03074596.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gb|EDX43815.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gb|EDZ22356.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191]
	160 	160 	85% 	2e-37	
NP_461214.1 	
DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] >ref|YP_149906.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >ref|YP_001586975.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >ref|ZP_02343496.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >ref|ZP_02667317.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >ref|ZP_02683690.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >ref|ZP_02699904.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Newport str. SL317] >ref|ZP_02830000.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >ref|YP_002041533.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Newport str. SL254] >ref|YP_002046326.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >ref|YP_002147228.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Agona str. SL483] >ref|ZP_03164052.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >ref|YP_002141400.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] >ref|YP_002244342.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] >ref|YP_002637041.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] >sp|P37411.3|GYRA_SALTY RecName: Full=DNA gyrase subunit A >gb|AAL21173.1| DNA gyrase, subunit A [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] >gb|AAV76594.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gb|ABX66142.1| hypothetical protein SPAB_00716 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gb|ACF64181.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gb|ACF68916.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gb|EDX49866.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Newport str. SL317] >emb|CAR58685.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] >gb|ACH49308.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gb|EDY24853.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gb|EDZ13148.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gb|EDZ25414.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gb|EDZ31674.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gb|EDZ36145.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >emb|CAR33838.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] >gb|ACN45600.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] >emb|CBG25307.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Typhimurium str. D23580] >gb|ACY89244.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S] >emb|CBW18343.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344] >emb|CBY96481.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1] >gb|EFX48099.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Typhimurium str. TN061786] >gb|EFY13930.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. 315996572] >gb|EFY14569.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-1] >gb|EFY21529.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-3] >gb|EFY27019.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-4] >gb|EFY31163.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-1] >gb|EFY35832.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-2] >gb|EFY36803.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. 531954] >gb|EFY42299.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. NC_MB110209-0054] >gb|EFY47925.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. OH_2009072675] >gb|EFY52410.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. CASC_09SCPH15965] >gb|EFY55710.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. 19N] >gb|EFY62108.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. 81038-01] >gb|EFY65978.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. MD_MDA09249507] >gb|EFY69919.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. 414877] >gb|EFY74636.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. 366867] >gb|EFY79638.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. 413180] >gb|EFY83670.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. 446600] >gb|EFZ06892.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Choleraesuis str. A50] >gb|ADX18032.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Typhimurium str. 4/74] >gb|EFZ81360.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. 609458-1] >gb|EFZ83473.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. 556150-1] >gb|EFZ89202.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. 609460] >gb|EFZ93516.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. 507440-20] >gb|EFZ97166.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. 556152] >gb|EGA02960.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. MB101509-0077] >gb|EGA07341.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. MB102109-0047] >gb|EGA11592.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. MB110209-0055] >gb|EGA16348.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. MB111609-0052] >gb|EGA19806.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. 2009083312] >gb|EGA25154.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. 2009085258] >gb|EGA28862.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. 315731156] >gb|EGA32502.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2009159199] >gb|EGA35459.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008282] >gb|EGA46628.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008284] >gb|EGA51619.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008285] >gb|EGA54203.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008287]
	160 	160 	85% 	2e-37	Gene info linked to NP_461214.1
ACF39982.1 	
DNA gyrase subunit A [Clostridium perfringens] >gb|ACF39997.1| DNA gyrase subunit A [Clostridium perfringens]
	160 	160 	61% 	2e-37	
CAK55539.1 	
DNA gyrase subunit [Salmonella enterica subsp. enterica serovar Typhi] >emb|CAK55542.1| DNA gyrase subunit [Salmonella enterica subsp. enterica serovar Typhi]
	160 	160 	85% 	2e-37	
ZP_04632405.1 	
DNA gyrase subunit A [Yersinia frederiksenii ATCC 33641] >gb|EEQ14856.1| DNA gyrase subunit A [Yersinia frederiksenii ATCC 33641]
	160 	160 	85% 	2e-37	
BAJ59799.1 	
DNA gyrase subunit A [Helicobacter pylori F57]
	160 	160 	85% 	2e-37	
BAJ55309.1 	
DNA gyrase subunit A [Helicobacter pylori F16]
	160 	160 	85% 	2e-37	
ZP_01308795.1 	
DNA gyrase A subunit [Candidatus Sulcia muelleri str. Hc (Homalodisca coagulata)] >ref|YP_001597837.1| type IV DNA gyrase A subunit [Candidatus Sulcia muelleri GWSS] >gb|EAT14075.1| DNA gyrase A subunit [Candidatus Sulcia muelleri str. Hc (Homalodisca coagulata)] >gb|ABS30440.1| type IV DNA gyrase A subunit [Candidatus Sulcia muelleri GWSS]
	160 	160 	82% 	2e-37	
NP_456817.1 	
DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >ref|ZP_03376502.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Typhi str. J185] >pir||AF0790 DNA topoisomerase (ATP-hydrolysing) (EC 5.99.1.3) - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >emb|CAD07504.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Typhi]
	160 	160 	85% 	2e-37	Gene info linked to NP_456817.1
ZP_02662344.1 	
DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >ref|YP_002115344.1| DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gb|ACF90041.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gb|EDY29046.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480]
	160 	160 	85% 	2e-37	
NP_109692.1 	
DNA gyrase subunit A [Mycoplasma pneumoniae M129] >sp|P22446.2|GYRA_MYCPN RecName: Full=DNA gyrase subunit A >gb|AAB95798.1| DNA gyrase subunit A [Mycoplasma pneumoniae M129]
	160 	160 	94% 	2e-37	Gene info linked to NP_109692.1
YP_958300.1 	
DNA gyrase, A subunit [Marinobacter aquaeolei VT8] >gb|ABM18113.1| DNA gyrase subunit A [Marinobacter aquaeolei VT8]
	160 	160 	83% 	2e-37	Gene info linked to YP_958300.1
NP_975018.1 	
DNA gyrase subunit A [Mycoplasma mycoides subsp. mycoides SC str. PG1] >emb|CAE76660.1| DNA Gyrase Subunit A [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gb|ADK69904.1| DNA gyrase, A subunit [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
	160 	160 	85% 	2e-37	Gene info linked to NP_975018.1
ADU83122.1 	
DNA gyrase subunit A [Helicobacter pylori Lithuania75]
	160 	160 	85% 	2e-37	
ZP_07941384.1 	
DNA gyrase, subunit A [Bifidobacterium sp. 12_1_47BFAA] >gb|EFV37646.1| DNA gyrase, subunit A [Bifidobacterium sp. 12_1_47BFAA]
	160 	160 	85% 	2e-37	
NP_695820.1 	
DNA gyrase subunit A [Bifidobacterium longum NCC2705] >gb|AAN24456.1| DNA gyrase subunit A [Bifidobacterium longum NCC2705]
	160 	160 	85% 	2e-37	Gene info linked to NP_695820.1
NP_878759.1 	
DNA gyrase subunit A [Candidatus Blochmannia floridanus] >emb|CAD83165.1| DNA gyrase subunit A [Candidatus Blochmannia floridanus]
	160 	160 	85% 	2e-37	Gene info linked to NP_878759.1
ZP_00121175.1 	
COG0188: Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Bifidobacterium longum DJO10A] >ref|YP_001955374.1| DNA gyrase subunit A [Bifidobacterium longum DJO10A] >ref|ZP_03977555.1| DNA topoisomerase (ATP-hydrolyzing) [Bifidobacterium longum subsp. infantis ATCC 55813] >ref|ZP_04665868.1| DNA gyrase A subunit [Bifidobacterium longum subsp. infantis CCUG 52486] >ref|YP_004000966.1| gyra [Bifidobacterium longum subsp. longum BBMN68] >ref|YP_004207931.1| DNA gyrase subunit A [Bifidobacterium longum subsp. infantis 157F] >ref|YP_004219769.1| DNA gyrase subunit A [Bifidobacterium longum subsp. longum JCM 1217] >gb|ACD98876.1| Type IIA topoisomerase A subunit [Bifidobacterium longum DJO10A] >gb|EEI79917.1| DNA topoisomerase (ATP-hydrolyzing) [Bifidobacterium longum subsp. infantis ATCC 55813] >gb|EEQ54701.1| DNA gyrase A subunit [Bifidobacterium longum subsp. infantis CCUG 52486] >gb|ADQ02373.1| GyrA [Bifidobacterium longum subsp. longum BBMN68] >dbj|BAJ65677.1| DNA gyrase subunit A [Bifidobacterium longum subsp. longum JCM 1217] >dbj|BAJ70153.1| DNA gyrase subunit A [Bifidobacterium longum subsp. infantis 157F]
	160 	160 	85% 	2e-37	Gene info linked to ZP_00121175.1
ADP97124.1 	
DNA gyrase subunit A-like protein [marine bacterium HP15]
	160 	160 	83% 	2e-37	
YP_001910139.1 	
DNA gyrase subunit A [Helicobacter pylori Shi470] >gb|ACD48109.1| DNA gyrase subunit A [Helicobacter pylori Shi470]
	160 	160 	85% 	2e-37	Gene info linked to YP_001910139.1
ZP_02920444.1 	
hypothetical protein STRINF_01325 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gb|EDT47528.1| hypothetical protein STRINF_01325 [Streptococcus infantarius subsp. infantarius ATCC BAA-102]
	160 	160 	83% 	2e-37	
NP_970909.1 	
DNA gyrase, A subunit [Treponema denticola ATCC 35405] >gb|AAS10790.1| DNA gyrase, A subunit [Treponema denticola ATCC 35405]
	160 	160 	85% 	2e-37	Gene info linked to NP_970909.1
ZP_05293330.1 	
DNA gyrase subunit A [Acidithiobacillus caldus ATCC 51756] >gb|EET26805.1| DNA gyrase subunit A [Acidithiobacillus caldus ATCC 51756]
	160 	160 	83% 	2e-37	
ZP_03220124.1 	
DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gb|EDZ06724.1| DNA gyrase, A subunit [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433]
	160 	160 	85% 	2e-37	
ZP_02356552.1 	
DNA gyrase subunit A [Burkholderia oklahomensis EO147]
	160 	160 	82% 	2e-37	
ACX99241.1 	
DNA gyrase subunit A [Helicobacter pylori 52]
	160 	160 	88% 	2e-37	
ZP_07274675.1 	
DNA gyrase, A subunit [Streptomyces sp. SPB78] >gb|EFL03044.1| DNA gyrase, A subunit [Streptomyces sp. SPB78]
	160 	160 	84% 	2e-37	
YP_856853.1 	
DNA gyrase, A subunit [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gb|ABK36039.1| DNA gyrase, A subunit [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
	160 	160 	83% 	2e-37	Gene info linked to YP_856853.1
YP_003543183.1 	
DNA gyrase, A subunit [Candidatus Sulcia muelleri DMIN] >gb|ADE35319.1| DNA gyrase, A subunit [Candidatus Sulcia muelleri DMIN]
	160 	160 	82% 	3e-37	Gene info linked to YP_003543183.1
YP_001569685.1 	
DNA gyrase subunit A [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980] >gb|ABX20543.1| hypothetical protein SARI_00617 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--]
	160 	160 	85% 	3e-37	Gene info linked to YP_001569685.1
YP_001871775.1 	
DNA gyrase subunit A [Yersinia pseudotuberculosis PB1/+] >gb|ACC88318.1| DNA gyrase, A subunit [Yersinia pseudotuberculosis PB1/+]
	160 	160 	85% 	3e-37	Gene info linked to YP_001871775.1
YP_001721575.1 	
DNA gyrase subunit A [Yersinia pseudotuberculosis YPIII] >gb|ACA69122.1| DNA gyrase, A subunit [Yersinia pseudotuberculosis YPIII]
	160 	160 	85% 	3e-37	Gene info linked to YP_001721575.1
YP_069791.1 	
DNA gyrase subunit A [Yersinia pseudotuberculosis IP 32953] >emb|CAH20496.1| DNA gyrase subunit A [Yersinia pseudotuberculosis IP 32953]
	160 	160 	85% 	3e-37	Gene info linked to YP_069791.1
YP_001401731.1 	
DNA gyrase subunit A [Yersinia pseudotuberculosis IP 31758] >gb|ABS48911.1| DNA gyrase, A subunit [Yersinia pseudotuberculosis IP 31758]
	160 	160 	85% 	3e-37	Gene info linked to YP_001401731.1
NP_670272.1 	
DNA gyrase subunit A [Yersinia pestis KIM 10] >ref|NP_992299.1| DNA gyrase subunit A [Yersinia pestis biovar Microtus str. 91001] >ref|YP_650843.1| DNA gyrase subunit A [Yersinia pestis Antiqua] >ref|YP_648688.1| DNA gyrase subunit A [Yersinia pestis Nepal516] >ref|YP_001163822.1| DNA gyrase subunit A [Yersinia pestis Pestoides F] >ref|ZP_01888827.1| DNA gyrase subunit A [Yersinia pestis CA88-4125] >ref|ZP_02220399.1| DNA gyrase, A subunit [Yersinia pestis biovar Orientalis str. F1991016] >ref|ZP_02226874.1| DNA gyrase, A subunit [Yersinia pestis biovar Orientalis str. IP275] >ref|ZP_02230745.1| DNA gyrase, A subunit [Yersinia pestis biovar Antiqua str. E1979001] >ref|ZP_02237580.1| DNA gyrase, A subunit [Yersinia pestis biovar Antiqua str. B42003004] >ref|ZP_02305809.1| DNA gyrase, A subunit [Yersinia pestis biovar Antiqua str. UG05-0454] >ref|ZP_02311466.1| DNA gyrase, A subunit [Yersinia pestis biovar Orientalis str. MG05-1020] >ref|ZP_02316034.1| DNA gyrase, A subunit [Yersinia pestis biovar Mediaevalis str. K1973002] >ref|YP_002346250.1| DNA gyrase subunit A [Yersinia pestis CO92] >ref|ZP_04461319.1| DNA gyrase subunit A [Yersinia pestis biovar Orientalis str. PEXU2] >ref|ZP_04463411.1| DNA gyrase subunit A [Yersinia pestis biovar Orientalis str. India 195] >ref|ZP_04509305.1| DNA gyrase subunit A [Yersinia pestis Pestoides A] >ref|ZP_04518464.1| DNA gyrase subunit A [Yersinia pestis Nepal516] >ref|ZP_06204235.1| DNA gyrase, A subunit [Yersinia pestis KIM D27] >ref|YP_003567292.1| DNA gyrase subunit A [Yersinia pestis Z176003] >gb|AAM86523.1|AE013898_6 DNA gyrase, subunit A, type II topoisomerase [Yersinia pestis KIM 10] >gb|AAS61176.1| DNA gyrase subunit A [Yersinia pestis biovar Microtus str. 91001] >gb|ABG19088.1| DNA gyrase subunit A [Yersinia pestis Nepal516] >gb|ABG12898.1| DNA gyrase subunit A [Yersinia pestis Antiqua] >emb|CAL19877.1| DNA gyrase subunit A [Yersinia pestis CO92] >gb|ABP40849.1| DNA gyrase subunit A [Yersinia pestis Pestoides F] >gb|EDM41242.1| DNA gyrase subunit A [Yersinia pestis CA88-4125] >gb|EDR32313.1| DNA gyrase, A subunit [Yersinia pestis biovar Orientalis str. IP275] >gb|EDR40759.1| DNA gyrase, A subunit [Yersinia pestis biovar Orientalis str. F1991016] >gb|EDR43544.1| DNA gyrase, A subunit [Yersinia pestis biovar Antiqua str. E1979001] >gb|EDR51796.1| DNA gyrase, A subunit [Yersinia pestis biovar Antiqua str. B42003004] >gb|EDR58475.1| DNA gyrase, A subunit [Yersinia pestis biovar Orientalis str. MG05-1020] >gb|EDR61653.1| DNA gyrase, A subunit [Yersinia pestis biovar Antiqua str. UG05-0454] >gb|EDR66893.1| DNA gyrase, A subunit [Yersinia pestis biovar Mediaevalis str. K1973002] >gb|EEO75224.1| DNA gyrase subunit A [Yersinia pestis Nepal516] >gb|EEO81673.1| DNA gyrase subunit A [Yersinia pestis biovar Orientalis str. India 195] >gb|EEO87573.1| DNA gyrase subunit A [Yersinia pestis biovar Orientalis str. PEXU2] >gb|EEO91017.1| DNA gyrase subunit A [Yersinia pestis Pestoides A] >gb|ACY57990.1| DNA gyrase subunit A [Yersinia pestis D106004] >gb|ACY61751.1| DNA gyrase subunit A [Yersinia pestis D182038] >gb|EFA46442.1| DNA gyrase, A subunit [Yersinia pestis KIM D27] >gb|ADE64030.1| DNA gyrase subunit A [Yersinia pestis Z176003] >gb|ADV99513.1| DNA gyrase subunit A [Yersinia pestis biovar Medievalis str. Harbin 35]
	160 	160 	85% 	3e-37	Gene info linked to NP_670272.1
YP_003660336.1 	
DNA gyrase subunit A [Bifidobacterium longum subsp. longum JDM301] >gb|ADG99505.1| DNA gyrase, A subunit [Bifidobacterium longum subsp. longum JDM301]
	160 	160 	85% 	3e-37	Gene info linked to YP_003660336.1
ADJ40688.1 	
DNA gyrase subunit A [Lactobacillus fermentum CECT 5716]
	160 	160 	82% 	3e-37	
ZP_03435466.1 	
DNA gyrase, A subunit [Borrelia afzelii ACA-1] >gb|EEC21136.1| DNA gyrase, A subunit [Borrelia afzelii ACA-1]
	160 	160 	81% 	3e-37	
ZP_05380553.1 	
DNA gyrase subunit A [Chlamydia trachomatis 70] >ref|ZP_05381476.1| DNA gyrase subunit A [Chlamydia trachomatis 70s] >ref|ZP_05382403.1| DNA gyrase subunit A [Chlamydia trachomatis D(s)2923] >emb|CBJ14703.1| DNA gyrase subunit A [Chlamydia trachomatis Sweden2] >gb|ADH16953.1| DNA gyrase subunit A [Chlamydia trachomatis E/150] >gb|ADH20648.1| DNA gyrase subunit A [Chlamydia trachomatis E/11023]
	160 	160 	87% 	3e-37	
ZP_03944173.1 	
ATP-hydrolyzing DNA topoisomerase [Lactobacillus fermentum ATCC 14931] >gb|EEI22807.1| ATP-hydrolyzing DNA topoisomerase [Lactobacillus fermentum ATCC 14931]
	160 	160 	82% 	3e-37	
YP_002887807.1 	
DNA gyrase subunit A [Chlamydia trachomatis B/Jali20/OT] >emb|CAX10637.1| DNA gyrase subunit A [Chlamydia trachomatis B/Jali20/OT]
	160 	160 	87% 	3e-37	Gene info linked to YP_002887807.1
YP_003373311.1 	
DNA gyrase, A subunit [Gardnerella vaginalis 409-05] >gb|ADB14274.1| DNA gyrase, A subunit [Gardnerella vaginalis 409-05]
	160 	160 	85% 	3e-37	Gene info linked to YP_003373311.1
ZP_03945199.1 	
ATP-hydrolyzing DNA topoisomerase [Lactobacillus fermentum ATCC 14931] >gb|EEI21794.1| ATP-hydrolyzing DNA topoisomerase [Lactobacillus fermentum ATCC 14931]
	160 	160 	88% 	3e-37	
ACX97828.1 	
DNA gyrase subunit A [Helicobacter pylori 51]
	160 	160 	85% 	3e-37	
ACU79003.1 	
DNA gyrase, A subunit [Mycoplasma mycoides subsp. capri str. GM12] >gb|ACU79834.1| DNA gyrase, A subunit [Mycoplasma mycoides subsp. capri str. GM12] >gb|ADH21637.1| DNA gyrase, A subunit [synthetic Mycoplasma mycoides JCVI-syn1.0]
	160 	160 	85% 	3e-37	
ZP_05863438.1 	
DNA gyrase, A subunit [Lactobacillus fermentum 28-3-CHN] >gb|EEX26177.1| DNA gyrase, A subunit [Lactobacillus fermentum 28-3-CHN]
	160 	160 	82% 	3e-37	
ZP_06927160.1 	
type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Gardnerella vaginalis AMD] >gb|EFH27496.1| type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Gardnerella vaginalis AMD]
	160 	160 	85% 	3e-37	
ACF39989.1 	
DNA gyrase subunit A [Clostridium perfringens]
	160 	160 	61% 	3e-37	
YP_002301343.1 	
DNA gyrase subunit A [Helicobacter pylori P12] >gb|ACJ07863.1| DNA gyrase subunit A [Helicobacter pylori P12]
	160 	160 	88% 	3e-37	Gene info linked to YP_002301343.1
NP_219693.1 	
DNA gyrase subunit A [Chlamydia trachomatis D/UW-3/CX] >ref|ZP_05353559.1| DNA gyrase subunit A [Chlamydia trachomatis 6276] >ref|ZP_05358536.1| DNA gyrase subunit A [Chlamydia trachomatis 6276s] >sp|O84192.1|GYRA_CHLTR RecName: Full=DNA gyrase subunit A >gb|AAC67781.1| DNA Gyrase Subunit A [Chlamydia trachomatis D/UW-3/CX] >gb|ADH17878.1| DNA gyrase subunit A [Chlamydia trachomatis G/9768] >gb|ADH18798.1| DNA gyrase subunit A [Chlamydia trachomatis G/11222] >gb|ADH96821.1| DNA gyrase subunit A [Chlamydia trachomatis G/9301] >gb|ADI50865.1| DNA gyrase subunit A [Chlamydia trachomatis D-EC] >gb|ADI51877.1| DNA gyrase subunit A [Chlamydia trachomatis D-LC]
	160 	160 	87% 	3e-37	Gene info linked to NP_219693.1
ACF39987.1 	
DNA gyrase subunit A [Clostridium perfringens] >gb|ACF39990.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ACF39993.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ACF39995.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ACF40002.1| DNA gyrase subunit A [Clostridium perfringens]
	160 	160 	61% 	3e-37	
YP_001605843.1 	
DNA gyrase subunit A [Yersinia pestis Angola] >gb|ABX88531.1| DNA gyrase, A subunit [Yersinia pestis Angola]
	160 	160 	85% 	3e-37	Gene info linked to YP_001605843.1
YP_327997.1 	
DNA gyrase subunit A [Chlamydia trachomatis A/HAR-13] >ref|YP_002888689.1| DNA gyrase subunit A [Chlamydia trachomatis B/TZ1A828/OT] >gb|AAX50449.1| DNA gyrase subunit A [Chlamydia trachomatis A/HAR-13] >emb|CAX09744.1| DNA gyrase subunit A [Chlamydia trachomatis B/TZ1A828/OT]
	160 	160 	87% 	3e-37	Gene info linked to YP_327997.1
ZP_05613483.1 	
DNA gyrase, A subunit [Faecalibacterium prausnitzii A2-165] >gb|EEU98319.1| DNA gyrase, A subunit [Faecalibacterium prausnitzii A2-165]
	160 	160 	85% 	3e-37	
ZP_06976818.1 	
type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Gardnerella vaginalis 5-1] >gb|EFH71307.1| type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Gardnerella vaginalis 5-1]
	160 	160 	85% 	3e-37	
ZP_02333892.1 	
DNA gyrase, A subunit [Yersinia pestis FV-1]
	160 	160 	85% 	3e-37	
YP_004081853.1 	
DNA topoisomerase (ATP-hydrolyzing) [Micromonospora sp. L5] >gb|ADU07702.1| DNA topoisomerase (ATP-hydrolyzing) [Micromonospora sp. L5]
	160 	160 	83% 	3e-37	Gene info linked to YP_004081853.1
YP_003926937.1 	
DNA gyrase subunit A [Helicobacter pylori PeCan4] >gb|ADO06887.1| DNA gyrase subunit A [Helicobacter pylori PeCan4]
	159 	159 	88% 	3e-37	Gene info linked to YP_003926937.1
YP_004126489.1 	
DNA gyrase, a subunit [Alicycliphilus denitrificans BC] >gb|ADU99601.1| DNA gyrase, A subunit [Alicycliphilus denitrificans BC]
	159 	159 	81% 	3e-37	Gene info linked to YP_004126489.1
YP_002004811.1 	
DNA gyrase subunit a [Cupriavidus taiwanensis LMG 19424] >emb|CAQ68742.1| DNA gyrase, subunit A, type II topoisomerase [Cupriavidus taiwanensis LMG 19424]
	159 	159 	87% 	3e-37	Gene info linked to YP_002004811.1
ACF39998.1 	
DNA gyrase subunit A [Clostridium perfringens]
	159 	159 	61% 	3e-37	
ACF39999.1 	
DNA gyrase subunit A [Clostridium perfringens]
	159 	159 	61% 	3e-37	
ZP_06055909.1 	
type IIA topoisomerase [Acinetobacter calcoaceticus RUH2202] >gb|EEY77208.1| type IIA topoisomerase [Acinetobacter calcoaceticus RUH2202]
	159 	159 	88% 	3e-37	
YP_153695.1 	
DNA gyrase subunit A [Anaplasma marginale str. St. Maries] >gb|AAV86440.1| DNA gyrase subunit A [Anaplasma marginale str. St. Maries]
	159 	159 	96% 	3e-37	Gene info linked to YP_153695.1
YP_873180.1 	
DNA topoisomerase IV subunit A [Acidothermus cellulolyticus 11B] >gb|ABK53194.1| DNA topoisomerase IV subunit A [Acidothermus cellulolyticus 11B]
	159 	159 	88% 	4e-37	Gene info linked to YP_873180.1
ADU81552.1 	
DNA gyrase subunit A [Helicobacter pylori Gambia94/24]
	159 	159 	88% 	4e-37	
YP_003438351.1 	
DNA gyrase, A subunit [Klebsiella variicola At-22] >gb|ADC57339.1| DNA gyrase, A subunit [Klebsiella variicola At-22]
	159 	159 	85% 	4e-37	Gene info linked to YP_003438351.1
BAJ58206.1 	
DNA gyrase subunit A [Helicobacter pylori F32]
	159 	159 	85% 	4e-37	
YP_002795829.1 	
DNA gyrase subunit A [Laribacter hongkongensis HLHK9] >gb|ACO74820.1| GyrA [Laribacter hongkongensis HLHK9]
	159 	159 	85% 	4e-37	Gene info linked to YP_002795829.1
S30571 	
DNA topoisomerase (ATP-hydrolyzing) (EC 5.99.1.3) chain A - Haloferax sp >emb|CAA42740.1| DNA gyrase A subunit [Haloferax sp. Aa2.2]
	159 	159 	83% 	4e-37	
ADO03916.1 	
DNA gyrase subunit A [Helicobacter pylori Cuz20]
	159 	159 	85% 	4e-37	
ZP_04638588.1 	
DNA gyrase subunit A [Yersinia intermedia ATCC 29909] >gb|EEQ17253.1| DNA gyrase subunit A [Yersinia intermedia ATCC 29909]
	159 	159 	85% 	4e-37	
ZP_07636077.1 	
DNA gyrase subunit A [Ruminococcaceae bacterium D16]
	159 	159 	85% 	4e-37	
ZP_05277023.1 	
DNA gyrase subunit A [Anaplasma marginale str. Mississippi]
	159 	159 	96% 	4e-37	
ZP_03439100.1 	
hypothetical protein HP9810_5g15 [Helicobacter pylori 98-10] >gb|EEC23299.1| hypothetical protein HP9810_5g15 [Helicobacter pylori 98-10]
	159 	159 	85% 	4e-37	
YP_001359763.1 	
DNA gyrase, A subunit [Kineococcus radiotolerans SRS30216] >gb|ABS01499.1| DNA gyrase, A subunit [Kineococcus radiotolerans SRS30216]
	159 	159 	83% 	4e-37	Gene info linked to YP_001359763.1
ACF39980.1 	
DNA gyrase subunit A [Clostridium perfringens] >gb|ACF39981.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ACF39983.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ACF39984.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ACF39985.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ACF39988.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ACF39991.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ACF39996.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ACF40000.1| DNA gyrase subunit A [Clostridium perfringens]
	159 	159 	61% 	4e-37	
ZP_01220228.1 	
putative DNA topoisomerase (ATP-hydrolyzing) [Photobacterium profundum 3TCK] >gb|EAS43331.1| putative DNA topoisomerase (ATP-hydrolyzing) [Photobacterium profundum 3TCK]
	159 	159 	96% 	4e-37	
NP_069301.1 	
DNA gyrase, subunit A (gyrA) [Archaeoglobus fulgidus DSM 4304] >gb|AAB90772.1| DNA gyrase, subunit A (gyrA) [Archaeoglobus fulgidus DSM 4304]
	159 	159 	84% 	4e-37	Gene info linked to NP_069301.1
ZP_05133559.1 	
DNA gyrase, A subunit [Stenotrophomonas sp. SKA14] >gb|EED37620.1| DNA gyrase, A subunit [Stenotrophomonas sp. SKA14]
	159 	159 	81% 	4e-37	
YP_003057422.1 	
DNA gyrase subunit A [Helicobacter pylori B38] >emb|CAX29200.1| DNA gyrase subunit A [Helicobacter pylori B38]
	159 	159 	97% 	4e-37	Gene info linked to YP_003057422.1
ZP_03438196.1 	
hypothetical protein HPB128_201g14 [Helicobacter pylori B128] >ref|YP_003728923.1| DNA gyrase, subunit A [Helicobacter pylori B8] >gb|EEC24238.1| hypothetical protein HPB128_201g14 [Helicobacter pylori B128] >emb|CBI66459.1| DNA gyrase, subunit A [Helicobacter pylori B8]
	159 	159 	97% 	4e-37	
YP_004046839.1 	
DNA gyrase, A subunit [Mycoplasma leachii PG50] >gb|ADR24228.1| DNA gyrase, A subunit [Mycoplasma leachii PG50]
	159 	159 	85% 	4e-37	Gene info linked to YP_004046839.1
ZP_08035684.1 	
DNA gyrase, A subunit [Treponema phagedenis F0421] >gb|EFW39069.1| DNA gyrase, A subunit [Treponema phagedenis F0421]
	159 	159 	96% 	4e-37	
ZP_04615080.1 	
DNA gyrase subunit A [Yersinia ruckeri ATCC 29473] >gb|EEQ00312.1| DNA gyrase subunit A [Yersinia ruckeri ATCC 29473]
	159 	159 	85% 	4e-37	
YP_002939751.1 	
DNA gyrase, A subunit [Kosmotoga olearia TBF 19.5.1] >gb|ACR78747.1| DNA gyrase, A subunit [Kosmotoga olearia TBF 19.5.1]
	159 	159 	97% 	4e-37	Gene info linked to YP_002939751.1
ZP_01133917.1 	
DNA gyrase, subunit A, type II topoisomerase [Pseudoalteromonas tunicata D2] >gb|EAR28109.1| DNA gyrase, subunit A, type II topoisomerase [Pseudoalteromonas tunicata D2]
	159 	159 	85% 	4e-37	
AAA74376.1 	
gyrase A [Helicobacter pylori]
	159 	159 	88% 	5e-37	
ZP_07840898.1 	
DNA topoisomerase IV, A subunit [Staphylococcus caprae C87] >gb|EFS17440.1| DNA topoisomerase IV, A subunit [Staphylococcus caprae C87]
	159 	159 	88% 	5e-37	
AAC34892.1 	
DNA gyrase A subunit [Methylovorus sp. SS1]
	159 	159 	83% 	5e-37	
ADJ41205.1 	
Topoisomerase IV subunit A [Lactobacillus fermentum CECT 5716]
	159 	159 	88% 	5e-37	
YP_001712820.1 	
DNA gyrase, subunit A, type II topoisomerase [Acinetobacter baumannii AYE] >emb|CAJ77862.1| DNA gyrase [Acinetobacter baumannii AYE] >emb|CAM85817.1| DNA gyrase, subunit A, type II topoisomerase [Acinetobacter baumannii AYE]
	159 	159 	88% 	5e-37	Gene info linked to YP_001712820.1
ZP_07981247.1 	
DNA topoisomerase IV subunit A [Streptomyces sp. SA3_actG] >ref|ZP_07986085.1| DNA topoisomerase IV subunit A [Streptomyces sp. SA3_actF]
	159 	159 	84% 	5e-37	
YP_001843720.1 	
topoisomerase IV subunit A [Lactobacillus fermentum IFO 3956] >dbj|BAG27240.1| topoisomerase IV subunit A [Lactobacillus fermentum IFO 3956]
	159 	159 	88% 	5e-37	Gene info linked to YP_001843720.1
YP_002324767.1 	
DNA gyrase, A subunit [Acinetobacter baumannii AB307-0294] >ref|ZP_06782471.1| DNA gyrase, A subunit [Acinetobacter sp. 6013113] >ref|ZP_06796338.1| DNA gyrase, A subunit [Acinetobacter sp. 6013150] >ref|ZP_07236819.1| DNA gyrase, A subunit [Acinetobacter baumannii AB058] >gb|ACJ56371.1| DNA gyrase, A subunit [Acinetobacter baumannii AB307-0294]
	159 	159 	88% 	5e-37	Gene info linked to YP_002324767.1
YP_001847528.1 	
Type IIA topoisomerase (DNA gyrase/topo II) [Acinetobacter baumannii ACICU] >ref|YP_002320361.1| DNA gyrase, A subunit [Acinetobacter baumannii AB0057] >ref|ZP_06785405.1| DNA gyrase, A subunit [Acinetobacter sp. 6014059] >ref|ZP_07226145.1| DNA gyrase, A subunit [Acinetobacter baumannii AB056] >ref|ZP_07239806.1| DNA gyrase, A subunit [Acinetobacter baumannii AB059] >gb|ACC58181.1| Type IIA topoisomerase (DNA gyrase/topo II) [Acinetobacter baumannii ACICU] >gb|ACJ42372.1| DNA gyrase, A subunit [Acinetobacter baumannii AB0057] >gb|ADX04557.1| gyrA [Acinetobacter baumannii 1656-2]
	159 	159 	88% 	5e-37	Gene info linked to YP_001847528.1
YP_261406.1 	
DNA gyrase subunit A [Pseudomonas fluorescens Pf-5] >gb|AAY93569.1| DNA gyrase, A subunit [Pseudomonas fluorescens Pf-5]
	159 	159 	83% 	5e-37	Gene info linked to YP_261406.1
YP_001706419.1 	
DNA gyrase, subunit A, type II topoisomerase [Acinetobacter baumannii SDF] >emb|CAP00226.1| DNA gyrase, subunit A, type II topoisomerase [Acinetobacter baumannii]
	159 	159 	88% 	5e-37	Gene info linked to YP_001706419.1
YP_003643570.1 	
DNA gyrase, A subunit [Thiomonas intermedia K12] >gb|ADG31240.1| DNA gyrase, A subunit [Thiomonas intermedia K12]
	159 	159 	96% 	5e-37	Gene info linked to YP_003643570.1
ZP_05823532.1 	
type IIA topoisomerase [Acinetobacter sp. RUH2624] >gb|EEX01191.1| type IIA topoisomerase [Acinetobacter sp. RUH2624]
	159 	159 	88% 	5e-37	
YP_001085645.1 	
DNA gyrase [Acinetobacter baumannii ATCC 17978]
	159 	159 	88% 	5e-37	Gene info linked to YP_001085645.1
P48371.1 	
RecName: Full=DNA gyrase subunit A >gb|AAA82128.1| DNA gyrase subunit A [Neisseria gonorrhoeae]
	159 	159 	90% 	5e-37	
ZP_06900625.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus parasanguinis ATCC 15912] >gb|EFH18191.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus parasanguinis ATCC 15912]
	159 	159 	88% 	5e-37	
YP_741767.1 	
DNA gyrase subunit A [Alkalilimnicola ehrlichii MLHE-1] >gb|ABI56277.1| DNA gyrase subunit A [Alkalilimnicola ehrlichii MLHE-1]
	159 	159 	83% 	5e-37	Gene info linked to YP_741767.1
YP_003937784.1 	
gyrA1 DNA gyrase subunit A [Bifidobacterium bifidum S17] >gb|ADO52210.1| gyrA1 DNA gyrase subunit A [Bifidobacterium bifidum S17]
	159 	159 	85% 	6e-37	Gene info linked to YP_003937784.1
YP_403987.1 	
DNA gyrase subunit A [Shigella dysenteriae Sd197] >ref|ZP_07679711.1| DNA gyrase, A subunit [Shigella dysenteriae 1617] >gb|ABB62496.1| DNA gyrase, subunit A [Shigella dysenteriae Sd197] >gb|EFP72922.1| DNA gyrase, A subunit [Shigella dysenteriae 1617]
	159 	159 	85% 	6e-37	Gene info linked to YP_403987.1
ZP_04660304.1 	
DNA gyrase, A subunit [Acinetobacter baumannii AB900] >ref|ZP_05828726.1| DNA gyrase, A subunit [Acinetobacter baumannii ATCC 19606] >gb|ABO13043.2| DNA gyrase [Acinetobacter baumannii ATCC 17978] >gb|EEX03067.1| DNA gyrase, A subunit [Acinetobacter baumannii ATCC 19606]
	159 	159 	88% 	6e-37	
NP_223359.1 	
DNA gyrase subunit A [Helicobacter pylori J99] >sp|Q9ZLD9.1|GYRA_HELPJ RecName: Full=DNA gyrase subunit A >gb|AAD06219.1| DNA GYRASE SUBUNIT A [Helicobacter pylori J99]
	159 	159 	88% 	6e-37	Gene info linked to NP_223359.1
ZP_04629680.1 	
DNA gyrase subunit A [Yersinia bercovieri ATCC 43970] >gb|EEQ05427.1| DNA gyrase subunit A [Yersinia bercovieri ATCC 43970]
	159 	159 	85% 	6e-37	
YP_424037.1 	
DNA gyrase, A subunit [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gb|ABC01443.1| DNA gyrase, A subunit [Mycoplasma capricolum subsp. capricolum ATCC 27343]
	159 	159 	85% 	6e-37	Gene info linked to YP_424037.1
ZP_07666275.1 	
DNA gyrase subunit A [Gardnerella vaginalis ATCC 14018]
	159 	159 	85% 	6e-37	
ADQ29608.1 	
DNA gyrase, A subunit [Borrelia burgdorferi N40]
	159 	159 	81% 	6e-37	
ACF39986.1 	
DNA gyrase subunit A [Clostridium perfringens]

	159 	159 	61% 	6e-37	
YP_001788087.1 	
DNA topoisomerase IV subunit A [Clostridium botulinum A3 str. Loch Maree] >gb|ACA56692.1| DNA topoisomerase, GyrA/ParC subunit family [Clostridium botulinum A3 str. Loch Maree]
	159 	159 	84% 	6e-37	Gene info linked to YP_001788087.1
CBJ01868.1 	
DNA gyrase subunit A [Escherichia coli ETEC H10407]
	159 	159 	85% 	6e-37	
YP_002905365.1 	
DNA gyrase subunit A [Corynebacterium kroppenstedtii DSM 44385] >gb|ACR16822.1| DNA gyrase subunit A [Corynebacterium kroppenstedtii DSM 44385]
	159 	159 	83% 	6e-37	Gene info linked to YP_002905365.1
YP_342234.1 	
DNA gyrase, subunit A [Nitrosococcus oceani ATCC 19707] >ref|ZP_05048627.1| DNA gyrase, A subunit [Nitrosococcus oceani AFC27] >gb|ABA56704.1| DNA gyrase subunit A [Nitrosococcus oceani ATCC 19707] >gb|EDZ65503.1| DNA gyrase, A subunit [Nitrosococcus oceani AFC27]
	159 	159 	83% 	6e-37	Gene info linked to YP_342234.1
ZP_06191047.1 	
DNA gyrase subunit A [Serratia odorifera 4Rx13] >gb|EFA16553.1| DNA gyrase subunit A [Serratia odorifera 4Rx13]
	159 	159 	85% 	6e-37	
ZP_05863003.1 	
DNA topoisomerase IV, A subunit [Lactobacillus fermentum 28-3-CHN] >gb|EEX26382.1| DNA topoisomerase IV, A subunit [Lactobacillus fermentum 28-3-CHN]
	159 	159 	88% 	6e-37	
ADO05399.1 	
DNA gyrase subunit A [Helicobacter pylori Sat464]
	159 	159 	85% 	7e-37	
YP_003985240.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Gardnerella vaginalis ATCC 14019] >gb|ADP38217.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Gardnerella vaginalis ATCC 14019]
	159 	159 	85% 	7e-37	Gene info linked to YP_003985240.1
ZP_04622926.1 	
DNA gyrase subunit A [Yersinia kristensenii ATCC 33638] >gb|EEP92425.1| DNA gyrase subunit A [Yersinia kristensenii ATCC 33638]
	159 	159 	85% 	7e-37	
ACF40001.1 	
DNA gyrase subunit A [Clostridium perfringens]
	159 	159 	61% 	7e-37	
ZP_07466650.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus bovis ATCC 700338] >gb|EFM27432.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus bovis ATCC 700338]
	159 	159 	83% 	7e-37	
ZP_03796607.1 	
DNA gyrase, A subunit [Borrelia burgdorferi 29805] >gb|EEH32214.1| DNA gyrase, A subunit [Borrelia burgdorferi 29805]
	159 	159 	81% 	7e-37	
ZP_07774215.1 	
DNA gyrase, subunit A [Pseudomonas fluorescens WH6] >gb|EFQ64979.1| DNA gyrase, subunit A [Pseudomonas fluorescens WH6]
	159 	159 	83% 	7e-37	
ZP_03673144.1 	
DNA gyrase, A subunit [Borrelia burgdorferi WI91-23] >gb|EEF82967.1| DNA gyrase, A subunit [Borrelia burgdorferi WI91-23]
	159 	159 	81% 	7e-37	
ZP_07803303.1 	
DNA gyrase A subunit [Bifidobacterium bifidum NCIMB 41171] >gb|EFR51237.1| DNA gyrase A subunit [Bifidobacterium bifidum NCIMB 41171]
	159 	159 	85% 	7e-37	
ZP_05966425.1 	
DNA gyrase, A subunit [Bifidobacterium gallicum DSM 20093] >gb|EFA22416.1| DNA gyrase, A subunit [Bifidobacterium gallicum DSM 20093]
	159 	159 	85% 	7e-37	
YP_001724410.1 	
DNA gyrase subunit A [Escherichia coli ATCC 8739] >gb|ACA77083.1| DNA gyrase, A subunit [Escherichia coli ATCC 8739]
	159 	159 	85% 	7e-37	Gene info linked to YP_001724410.1
NP_930282.1 	
DNA gyrase subunit A [Photorhabdus luminescens subsp. laumondii TTO1] >emb|CAE15424.1| DNA gyrase subunit A [Photorhabdus luminescens subsp. laumondii TTO1]
	159 	159 	85% 	7e-37	Gene info linked to NP_930282.1
ZP_08063023.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus parasanguinis ATCC 903] >gb|EFX39275.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus parasanguinis ATCC 903]
	158 	158 	88% 	7e-37	
CAZ88949.1 	
DNA gyrase subunit A [Thiomonas sp. 3As]
	158 	158 	96% 	7e-37	
ZP_03647279.1 	
DNA gyrase subunit A [Bifidobacterium bifidum NCIMB 41171] >ref|YP_003970190.1| GyrA DNA gyrase subunit A [Bifidobacterium bifidum PRL2010] >gb|ADP35153.1| GyrA DNA gyrase subunit A [Bifidobacterium bifidum PRL2010]
	158 	158 	85% 	7e-37	
YP_001381655.1 	
DNA gyrase, A subunit [Anaeromyxobacter sp. Fw109-5] >gb|ABS28671.1| DNA gyrase, A subunit [Anaeromyxobacter sp. Fw109-5]
	158 	158 	83% 	7e-37	Gene info linked to YP_001381655.1
YP_747782.1 	
DNA gyrase subunit A [Nitrosomonas eutropha C91] >gb|ABI59817.1| DNA gyrase subunit A [Nitrosomonas eutropha C91]
	158 	158 	83% 	7e-37	Gene info linked to YP_747782.1
ZP_03087397.1 	
DNA gyrase, subunit A (gyrA) [Borrelia burgdorferi 80a]
	158 	158 	81% 	8e-37	
YP_725304.1 	
DNA gyrase subunit A [Ralstonia eutropha H16] >emb|CAJ91936.1| DNA gyrase subunit A [Ralstonia eutropha H16]
	158 	158 	87% 	8e-37	Gene info linked to YP_725304.1
ZP_04447284.1 	
hypothetical protein BIFANG_02257 [Bifidobacterium angulatum DSM 20098] >gb|EEP21861.1| hypothetical protein BIFANG_02257 [Bifidobacterium angulatum DSM 20098]
	158 	158 	85% 	8e-37	
CBY27917.1 	
DNA gyrase subunit A [Yersinia enterocolitica subsp. palearctica Y11]
	158 	158 	85% 	8e-37	
ABY55552.1 	
GyrA [Shigella boydii]
	158 	158 	85% 	8e-37	
ZP_03675347.1 	
DNA gyrase, A subunit [Borrelia spielmanii A14S] >gb|EEF84345.1| DNA gyrase, A subunit [Borrelia spielmanii A14S]
	158 	158 	81% 	8e-37	
ZP_03589606.1 	
DNA gyrase, A subunit [Borrelia burgdorferi 72a] >ref|ZP_03674188.1| DNA gyrase, A subunit [Borrelia burgdorferi CA-11.2a] >ref|ZP_03769668.1| DNA gyrase, A subunit [Borrelia burgdorferi 94a] >ref|ZP_03770613.1| DNA gyrase, A subunit [Borrelia burgdorferi 118a] >gb|EEE18309.1| DNA gyrase, A subunit [Borrelia burgdorferi 72a] >gb|EEF83634.1| DNA gyrase, A subunit [Borrelia burgdorferi CA-11.2a] >gb|EEG99371.1| DNA gyrase, A subunit [Borrelia burgdorferi 118a] >gb|EEH00087.1| DNA gyrase, A subunit [Borrelia burgdorferi 94a]
	158 	158 	81% 	8e-37	
YP_689720.1 	
DNA gyrase subunit A [Shigella flexneri 5 str. 8401] >gb|ABF04415.1| DNA gyrase subunit A [Shigella flexneri 5 str. 8401]
	158 	158 	85% 	8e-37	Gene info linked to YP_689720.1
ZP_06982903.1 	
DNA gyrase, A subunit [Bacteroidetes oral taxon 274 str. F0058] >gb|EFI17368.1| DNA gyrase, A subunit [Bacteroidetes oral taxon 274 str. F0058]
	158 	158 	83% 	8e-37	
ZP_01116316.1 	
DNA gyrase subunit A [Reinekea sp. MED297] >gb|EAR07751.1| DNA gyrase subunit A [Reinekea sp. MED297]
	158 	158 	83% 	8e-37	
EFX34722.1 	
DNA gyrase subunit A [Escherichia coli O157:H7 str. LSU-61]
	158 	158 	85% 	9e-37	
YP_002382106.1 	
DNA gyrase subunit A [Escherichia fergusonii ATCC 35469] >emb|CAQ88469.1| DNA gyrase (type II topoisomerase), subunit A [Escherichia fergusonii ATCC 35469]
	158 	158 	85% 	9e-37	Gene info linked to YP_002382106.1
YP_001459032.1 	
DNA gyrase subunit A [Escherichia coli HS] >gb|ABV06649.1| DNA gyrase, A subunit [Escherichia coli HS]
	158 	158 	85% 	9e-37	Gene info linked to YP_001459032.1
EFZ47575.1 	
DNA gyrase, A subunit [Escherichia coli E128010]
	158 	158 	85% 	9e-37	
YP_003362902.1 	
type IIA topoisomerase, A subunit [Rothia mucilaginosa DY-18] >dbj|BAI65082.1| type IIA topoisomerase, A subunit [Rothia mucilaginosa DY-18]
	158 	158 	82% 	9e-37	Gene info linked to YP_003362902.1
ZP_07142135.1 	
DNA gyrase, A subunit [Escherichia coli MS 182-1] >gb|EFK00923.1| DNA gyrase, A subunit [Escherichia coli MS 182-1]
	158 	158 	85% 	9e-37	
YP_003524683.1 	
DNA gyrase, A subunit [Sideroxydans lithotrophicus ES-1] >gb|ADE12296.1| DNA gyrase, A subunit [Sideroxydans lithotrophicus ES-1]
	158 	158 	83% 	9e-37	Gene info linked to YP_003524683.1
YP_001744424.1 	
DNA gyrase, A subunit [Escherichia coli SMS-3-5] >ref|ZP_07121530.1| DNA gyrase, A subunit [Escherichia coli MS 84-1] >ref|ZP_07162987.1| DNA gyrase, A subunit [Escherichia coli MS 116-1] >ref|ZP_07171019.1| DNA gyrase, A subunit [Escherichia coli MS 175-1] >ref|ZP_07209434.1| DNA gyrase, A subunit [Escherichia coli MS 124-1] >ref|ZP_07687539.1| DNA gyrase, A subunit [Escherichia coli MS 145-7] >gb|ACB17857.1| DNA gyrase, A subunit [Escherichia coli SMS-3-5] >gb|EFJ64203.1| DNA gyrase, A subunit [Escherichia coli MS 175-1] >gb|EFJ87886.1| DNA gyrase, A subunit [Escherichia coli MS 84-1] >gb|EFK15241.1| DNA gyrase, A subunit [Escherichia coli MS 116-1] >gb|EFK69243.1| DNA gyrase, A subunit [Escherichia coli MS 124-1] >gb|EFO60659.1| DNA gyrase, A subunit [Escherichia coli MS 145-7] >gb|EFU35134.1| DNA gyrase, A subunit [Escherichia coli MS 85-1]
	158 	158 	85% 	9e-37	Gene info linked to YP_001744424.1
ZP_06938130.1 	

DNA gyrase subunit A [Escherichia coli OP50]
	158 	158 	85% 	9e-37	
ZP_06352071.1 	
DNA gyrase, A subunit [Citrobacter youngae ATCC 29220] >gb|EFE10086.1| DNA gyrase, A subunit [Citrobacter youngae ATCC 29220]
	158 	158 	85% 	9e-37	
ZP_07503045.1 	
DNA gyrase subunit A [Escherichia coli M605] >dbj|BAI55652.1| DNA gyrase subunit A [Escherichia coli SE15]
	158 	158 	85% 	9e-37	
ACX39099.1 	
DNA gyrase, A subunit [Escherichia coli DH1] >dbj|BAJ44022.1| DNA gyrase subunit A [Escherichia coli DH1]
	158 	158 	85% 	9e-37	
YP_515418.1 	
DNA gyrase subunit A [Chlamydophila felis Fe/C-56] >dbj|BAE81273.1| DNA gyrase subunit A [Chlamydophila felis Fe/C-56]
	158 	158 	82% 	9e-37	Gene info linked to YP_515418.1
ZP_03059644.1 	
DNA gyrase, A subunit [Escherichia coli B171] >gb|EDX30985.1| DNA gyrase, A subunit [Escherichia coli B171]
	158 	158 	85% 	9e-37	
ZP_07186281.1 	
DNA gyrase, A subunit [Escherichia coli MS 69-1] >gb|EFJ81085.1| DNA gyrase, A subunit [Escherichia coli MS 69-1]
	158 	158 	85% 	9e-37	
YP_003466665.1 	
DNA gyrase, subunit A, type II topoisomerase [Xenorhabdus bovienii SS-2004] >emb|CBJ79871.1| DNA gyrase, subunit A, type II topoisomerase [Xenorhabdus bovienii SS-2004]
	158 	158 	85% 	9e-37	Gene info linked to YP_003466665.1
NP_754659.1 	
DNA gyrase subunit A [Escherichia coli CFT073] >ref|YP_541510.1| DNA gyrase subunit A [Escherichia coli UTI89] >ref|YP_853338.1| DNA gyrase subunit A [Escherichia coli APEC O1] >ref|YP_002329879.1| DNA gyrase subunit A [Escherichia coli O127:H6 str. E2348/69] >ref|YP_002392061.1| DNA gyrase subunit A [Escherichia coli S88] >ref|YP_002398606.1| DNA gyrase subunit A [Escherichia coli ED1a] >ref|ZP_04005093.1| DNA gyrase subunit A [Escherichia coli 83972] >ref|ZP_04535187.1| subunit A [Escherichia sp. 3_2_53FAA] >ref|ZP_07176502.1| DNA gyrase, A subunit [Escherichia coli MS 45-1] >ref|ZP_07195968.1| DNA gyrase, A subunit [Escherichia coli MS 185-1] >ref|ZP_07448818.1| DNA gyrase subunit A [Escherichia coli NC101] >ref|ZP_07512939.1| DNA gyrase subunit A [Escherichia coli TA206] >gb|AAN81227.1|AE016763_186 DNA gyrase subunit A [Escherichia coli CFT073] >gb|ABE07979.1| DNA gyrase subunit A [Escherichia coli UTI89] >gb|ABJ01624.1| DNA gyrase subunit A [Escherichia coli APEC O1] >emb|CAS09923.1| DNA gyrase (type II topoisomerase), subunit A [Escherichia coli O127:H6 str. E2348/69] >emb|CAR03659.1| DNA gyrase (type II topoisomerase), subunit A [Escherichia coli S88] >emb|CAR08878.2| DNA gyrase (type II topoisomerase), subunit A [Escherichia coli ED1a] >emb|CAP76733.1| DNA gyrase subunit A [Escherichia coli LF82] >gb|EEH87331.1| subunit A [Escherichia sp. 3_2_53FAA] >gb|EEJ46104.1| DNA gyrase subunit A [Escherichia coli 83972] >gb|ADE90578.1| DNA gyrase, A subunit [Escherichia coli IHE3034] >gb|EFJ55596.1| DNA gyrase, A subunit [Escherichia coli MS 185-1] >gb|EFJ92135.1| DNA gyrase, A subunit [Escherichia coli MS 45-1] >gb|EFM52502.1| DNA gyrase subunit A [Escherichia coli NC101] >gb|ADN47072.1| DNA gyrase [Escherichia coli ABU 83972] >gb|ADN70535.1| DNA gyrase subunit A [Escherichia coli UM146] >gb|ADR27679.1| DNA gyrase subunit A [Escherichia coli O83:H1 str. NRG 857C] >gb|EFU45292.1| DNA gyrase, A subunit [Escherichia coli MS 110-3] >gb|EFU51538.1| DNA gyrase, A subunit [Escherichia coli MS 153-1] >gb|EFU57334.1| DNA gyrase, A subunit [Escherichia coli MS 16-3] >gb|EFW70723.1| DNA gyrase subunit A [Escherichia coli WV_060327] >gb|EFZ73337.1| DNA gyrase, A subunit [Escherichia coli RN587/1]
	158 	158 	85% 	9e-37	Gene info linked to NP_754659.1
NP_311141.1 	
DNA gyrase subunit A [Escherichia coli O157:H7 str. Sakai] >ref|ZP_02774654.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC4113] >ref|ZP_02779983.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC4401] >ref|ZP_02786346.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC4501] >ref|ZP_02792856.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC4486] >ref|ZP_02798060.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC4196] >ref|ZP_02805085.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC4076] >ref|ZP_02812142.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC869] >ref|ZP_02823400.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC508] >ref|ZP_03080986.1| DNA gyrase subunit A [Escherichia coli O157:H7 str. EC4024] >ref|ZP_03251922.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC4206] >ref|ZP_03255384.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC4045] >ref|ZP_03259190.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC4042] >ref|YP_002271637.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC4115] >ref|ZP_03442949.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. TW14588] >ref|YP_002413280.1| DNA gyrase subunit A [Escherichia coli UMN026] >ref|YP_003078959.1| DNA gyrase (type II topoisomerase), subunit A [Escherichia coli O157:H7 str. TW14359] >ref|ZP_05937597.1| DNA gyrase (type II topoisomerase), subunit A [Escherichia coli O157:H7 str. FRIK2000] >ref|ZP_05951667.1| DNA gyrase (type II topoisomerase), subunit A [Escherichia coli O157:H7 str. FRIK966] >ref|YP_003500293.1| DNA gyrase, A subunit [Escherichia coli O55:H7 str. CB9615] >ref|ZP_06649689.1| DNA gyrase subunit A [Escherichia coli FVEC1412] >ref|ZP_06654170.1| A subunit [Escherichia coli B354] >ref|ZP_06658167.1| A subunit [Escherichia coli B185] >ref|ZP_06990977.1| DNA gyrase subunit A [Escherichia coli FVEC1302] >ref|ZP_07151676.1| DNA gyrase, A subunit [Escherichia coli MS 21-1] >ref|ZP_07508508.1| DNA gyrase subunit A [Escherichia coli M718] >ref|ZP_07619497.1| DNA gyrase subunit A [Escherichia coli TA280] >ref|ZP_07624783.1| DNA gyrase subunit A [Escherichia coli H299] >dbj|BAB36537.1| DNA gyrase subunit A [Escherichia coli O157:H7 str. Sakai] >gb|EDU34966.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC4196] >gb|EDU54171.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC4113] >gb|EDU71066.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC4076] >gb|EDU76002.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC4401] >gb|EDU81372.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC4486] >gb|EDU86698.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC4501] >gb|EDU91343.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC869] >gb|EDU97407.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC508] >gb|EDZ78987.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC4206] >gb|EDZ84019.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC4045] >gb|EDZ86675.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC4042] >gb|ACI34786.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. EC4115] >gb|ACI81091.1| DNA gyrase subunit A [Escherichia coli] >gb|ACI81092.1| DNA gyrase subunit A [Escherichia coli] >gb|ACI81093.1| DNA gyrase subunit A [Escherichia coli] >gb|ACI81094.1| DNA gyrase subunit A [Escherichia coli] >gb|ACI81095.1| DNA gyrase subunit A [Escherichia coli] >gb|EEC27658.1| DNA gyrase, A subunit [Escherichia coli O157:H7 str. TW14588] >emb|CAR13752.1| DNA gyrase (type II topoisomerase), subunit A [Escherichia coli UMN026] >gb|ACT72883.1| DNA gyrase (type II topoisomerase), subunit A [Escherichia coli O157:H7 str. TW14359] >emb|CBG35304.1| DNA gyrase subunit A [Escherichia coli 042] >gb|ADD57309.1| DNA gyrase, A subunit [Escherichia coli O55:H7 str. CB9615] >gb|EFF00932.1| DNA gyrase subunit A [Escherichia coli FVEC1412] >gb|EFF06151.1| A subunit [Escherichia coli B185] >gb|EFF13546.1| A subunit [Escherichia coli B354] >gb|EFI20334.1| DNA gyrase subunit A [Escherichia coli FVEC1302] >gb|EFK21606.1| DNA gyrase, A subunit [Escherichia coli MS 21-1] >gb|EFW66793.1| DNA gyrase subunit A [Escherichia coli O157:H7 str. EC1212] >gb|EFX10536.1| DNA gyrase subunit A [Escherichia coli O157:H7 str. G5101] >gb|EFX15365.1| DNA gyrase subunit A [Escherichia coli O157:H- str. 493-89] >gb|EFX19923.1| DNA gyrase subunit A [Escherichia coli O157:H- str. H 2687] >gb|EFX25097.1| DNA gyrase subunit A [Escherichia coli O55:H7 str. 3256-97 TW 07815] >gb|EFX30435.1| DNA gyrase subunit A [Escherichia coli O55:H7 str. USDA 5905] >gb|EFZ54288.1| DNA gyrase, A subunit [Shigella sonnei 53G]
	158 	158 	85% 	9e-37	Gene info linked to NP_311141.1
ZP_07116099.1 	
DNA gyrase, A subunit [Escherichia coli MS 198-1] >gb|EFJ74449.1| DNA gyrase, A subunit [Escherichia coli MS 198-1]
	158 	158 	85% 	9e-37	
CAA40461.1 	
DNA gyrase subunit A [Escherichia coli K-12]
	158 	158 	85% 	9e-37	
YP_311170.1 	
DNA gyrase subunit A [Shigella sonnei Ss046] >gb|AAZ88935.1| DNA gyrase subunit A [Shigella sonnei Ss046]
	158 	158 	85% 	9e-37	Gene info linked to YP_311170.1
NP_416734.1 	
DNA gyrase (type II topoisomerase), subunit A [Escherichia coli str. K-12 substr. MG1655] >ref|NP_708120.1| DNA gyrase subunit A [Shigella flexneri 2a str. 301] >ref|NP_837835.1| DNA gyrase subunit A [Shigella flexneri 2a str. 2457T] >ref|YP_408472.1| DNA gyrase subunit A [Shigella boydii Sb227] >ref|AP_002828.1| DNA gyrase (type II topoisomerase), subunit A [Escherichia coli str. K-12 substr. W3110] >ref|YP_670169.1| DNA gyrase subunit A [Escherichia coli 536] >ref|YP_001463578.1| DNA gyrase subunit A [Escherichia coli E24377A] >ref|YP_001731169.1| DNA gyrase (type II topoisomerase), subunit A [Escherichia coli str. K-12 substr. DH10B] >ref|YP_001881059.1| DNA gyrase subunit A [Shigella boydii CDC 3083-94] >ref|ZP_03028306.1| DNA gyrase, A subunit [Escherichia coli B7A] >ref|ZP_03031552.1| DNA gyrase, A subunit [Escherichia coli F11] >ref|ZP_03043485.1| DNA gyrase, A subunit [Escherichia coli E22] >ref|ZP_03049145.1| DNA gyrase, A subunit [Escherichia coli E110019] >ref|YP_002293767.1| DNA gyrase subunit A [Escherichia coli SE11] >ref|YP_002387707.1| DNA gyrase subunit A [Escherichia coli IAI1] >ref|YP_002403504.1| DNA gyrase subunit A [Escherichia coli 55989] >ref|YP_002927200.1| DNA gyrase (type II topoisomerase), subunit A [Escherichia coli BW2952] >ref|ZP_05431472.1| DNA gyrase subunit A [Shigella sp. D9] >ref|YP_003222605.1| DNA gyrase subunit A [Escherichia coli O103:H2 str. 12009] >ref|YP_003230172.1| DNA gyrase subunit A [Escherichia coli O26:H11 str. 11368] >ref|YP_003235363.1| DNA gyrase subunit A [Escherichia coli O111:H- str. 11128] >ref|ZP_06662996.1| A subunit [Escherichia coli B088] >ref|ZP_07102818.1| DNA gyrase, A subunit [Escherichia coli MS 119-7] >ref|ZP_07135195.1| DNA gyrase, A subunit [Escherichia coli MS 115-1] >ref|ZP_07175434.1| DNA gyrase, A subunit [Escherichia coli MS 200-1] >ref|ZP_07187922.1| DNA gyrase, A subunit [Escherichia coli MS 196-1] >ref|ZP_07221774.1| DNA gyrase, A subunit [Escherichia coli MS 78-1] >ref|ZP_07247473.1| DNA gyrase, A subunit [Escherichia coli MS 146-1] >ref|ZP_07498245.1| DNA gyrase subunit A [Escherichia coli H736] >ref|ZP_07518128.1| DNA gyrase subunit A [Escherichia coli TA143] >ref|ZP_07590846.1| DNA gyrase, A subunit [Escherichia coli W] >ref|ZP_07787686.1| DNA gyrase, A subunit [Escherichia coli 1827-70] >sp|P0AES4.1|GYRA_ECOLI RecName: Full=DNA gyrase subunit A >sp|P0AES5.1|GYRA_SHIFL RecName: Full=DNA gyrase subunit A >emb|CAA29919.1| unnamed protein product [Escherichia coli] >emb|CAA29676.1| unnamed protein product [Escherichia coli] >gb|AAC75291.1| DNA gyrase (type II topoisomerase), subunit A [Escherichia coli str. K-12 substr. MG1655] >dbj|BAA16048.1| DNA gyrase (type II topoisomerase), subunit A [Escherichia coli str. K12 substr. W3110] >gb|AAN43827.1| DNA gyrase, subunit A, type II topoisomerase [Shigella flexneri 2a str. 301] >gb|AAP17645.1| DNA gyrase, subunit A, type II topoisomerase [Shigella flexneri 2a str. 2457T] >gb|ABB66644.1| DNA gyrase, subunit A [Shigella boydii Sb227] >gb|ABG70268.1| DNA gyrase subunit A [Escherichia coli 536] >gb|ABV16650.1| DNA gyrase, A subunit [Escherichia coli E24377A] >gb|ACB03391.1| DNA gyrase (type II topoisomerase), subunit A [Escherichia coli str. K-12 substr. DH10B] >gb|ACD08537.1| DNA gyrase, A subunit [Shigella boydii CDC 3083-94] >gb|EDV63155.1| DNA gyrase, A subunit [Escherichia coli B7A] >gb|EDV69099.1| DNA gyrase, A subunit [Escherichia coli F11] >gb|EDV84655.1| DNA gyrase, A subunit [Escherichia coli E22] >gb|EDV88899.1| DNA gyrase, A subunit [Escherichia coli E110019] >dbj|BAG78016.1| DNA gyrase subunit A [Escherichia coli SE11] >emb|CAU98348.1| DNA gyrase (type II topoisomerase), subunit A [Escherichia coli 55989] >emb|CAQ99153.1| DNA gyrase (type II topoisomerase), subunit A [Escherichia coli IAI1] >gb|ACR62815.1| DNA gyrase (type II topoisomerase), subunit A [Escherichia coli BW2952] >dbj|BAI26432.1| DNA gyrase subunit A [Escherichia coli O26:H11 str. 11368] >dbj|BAI31471.1| DNA gyrase subunit A [Escherichia coli O103:H2 str. 12009] >dbj|BAI36812.1| DNA gyrase subunit A [Escherichia coli O111:H- str. 11128] >gb|EFE62832.1| A subunit [Escherichia coli B088] >gb|EFI88729.1| DNA gyrase, A subunit [Escherichia coli MS 196-1] >gb|EFJ62141.1| DNA gyrase, A subunit [Escherichia coli MS 200-1] >gb|EFJ97569.1| DNA gyrase, A subunit [Escherichia coli MS 115-1] >gb|EFK45949.1| DNA gyrase, A subunit [Escherichia coli MS 119-7] >gb|EFK72629.1| DNA gyrase, A subunit [Escherichia coli MS 78-1] >gb|EFK89015.1| DNA gyrase, A subunit [Escherichia coli MS 146-1] >gb|EFN39205.1| DNA gyrase, A subunit [Escherichia coli W] >gb|EFP99344.1| DNA gyrase, A subunit [Escherichia coli 1827-70] >gb|EFS15744.1| DNA gyrase, A subunit [Shigella flexneri 2a str. 2457T] >gb|ADT75858.1| DNA gyrase (type II topoisomerase), subunit A [Escherichia coli W] >gb|EFU96124.1| DNA gyrase, A subunit [Escherichia coli 3431] >gb|EFW52210.1| DNA gyrase subunit A [Shigella dysenteriae CDC 74-1112] >gb|EFW74414.1| DNA gyrase subunit A [Escherichia coli EC4100B] >gb|EFZ42662.1| DNA gyrase, A subunit [Escherichia coli EPECa14] >gb|EFZ57553.1| DNA gyrase, A subunit [Escherichia coli LT-68] >gb|EFZ62432.1| DNA gyrase, A subunit [Escherichia coli 1180] >gb|EFZ69528.1| DNA gyrase, A subunit [Escherichia coli 1357] >gb|ADX50156.1| DNA gyrase, A subunit [Escherichia coli KO11]
	158 	158 	85% 	9e-37	Gene info linked to NP_416734.1
ZP_02901725.1 	
DNA gyrase, A subunit [Escherichia albertii TW07627] >gb|EDS92537.1| DNA gyrase, A subunit [Escherichia albertii TW07627]
	158 	158 	85% 	9e-37	
ZP_07098382.1 	
DNA gyrase, A subunit [Escherichia coli MS 107-1] >gb|EFK50376.1| DNA gyrase, A subunit [Escherichia coli MS 107-1]
	158 	158 	85% 	9e-37	
ZP_07523025.1 	
DNA gyrase subunit A [Escherichia coli TA271]
	158 	158 	85% 	1e-36	
EET89686.1 	
DNA gyrase, A subunit [Candidatus Micrarchaeum acidiphilum ARMAN-2]
	158 	158 	81% 	1e-36	
ZP_07781747.1 	
DNA gyrase, A subunit [Escherichia coli 2362-75] >gb|EFR15634.1| DNA gyrase, A subunit [Escherichia coli 2362-75]
	158 	158 	85% 	1e-36	
NP_607235.1 	
DNA gyrase subunit A [Streptococcus pyogenes MGAS8232] >sp|Q8P116.1|GYRA_STRP8 RecName: Full=DNA gyrase subunit A >gb|AAL97734.1| DNA gyrase A subunit [Streptococcus pyogenes MGAS8232]
	158 	158 	83% 	1e-36	Gene info linked to NP_607235.1
YP_001938817.1 	
DNA gyrase subunit A [Methylacidiphilum infernorum V4] >gb|ACD82218.1| DNA gyrase subunit A [Methylacidiphilum infernorum V4]
	158 	158 	96% 	1e-36	Gene info linked to YP_001938817.1
NP_296838.1 	
DNA gyrase subunit A [Chlamydia muridarum Nigg] >ref|ZP_06194640.1| DNA gyrase subunit A [Chlamydia muridarum Nigg] >ref|ZP_06195567.1| DNA gyrase subunit A [Chlamydia muridarum Weiss] >ref|ZP_07224844.1| DNA gyrase subunit A [Chlamydia muridarum MopnTet14] >sp|Q9PKK4.1|GYRA_CHLMU RecName: Full=DNA gyrase subunit A >gb|AAF39312.1| DNA gyrase, subunit A [Chlamydia muridarum Nigg]
	158 	158 	82% 	1e-36	Gene info linked to NP_296838.1
ZP_05435952.1 	
DNA gyrase subunit A [Escherichia sp. 4_1_40B]
	158 	158 	85% 	1e-36	
ZP_03002446.1 	
DNA gyrase, A subunit [Escherichia coli 53638] >ref|ZP_03068138.1| DNA gyrase, A subunit [Escherichia coli 101-1] >ref|YP_003035677.1| DNA gyrase subunit A [Escherichia coli BL21-Gold(DE3)pLysS AG] >ref|YP_003045350.1| DNA gyrase subunit A [Escherichia coli B str. REL606] >ref|ZP_07146753.1| DNA gyrase, A subunit [Escherichia coli MS 187-1] >gb|EDU65478.1| DNA gyrase, A subunit [Escherichia coli 53638] >gb|EDX40749.1| DNA gyrase, A subunit [Escherichia coli 101-1] >emb|CAQ32633.1| DNA gyrase, subunit A, subunit of DNA gyrase [Escherichia coli BL21(DE3)] >gb|ACT28492.1| DNA gyrase, A subunit [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] >gb|ACT39814.1| DNA gyrase subunit A [Escherichia coli B str. REL606] >gb|ACT43980.1| DNA gyrase subunit A [Escherichia coli BL21(DE3)] >gb|EFK24287.1| DNA gyrase, A subunit [Escherichia coli MS 187-1]
	158 	158 	85% 	1e-36	
ADQ90734.1 	
DNA gyrase subunit A [Mycoplasma hyopneumoniae 168]
	158 	158 	96% 	1e-36	
YP_002408327.1 	
DNA gyrase subunit A [Escherichia coli IAI39] >emb|CAR18495.1| DNA gyrase (type II topoisomerase), subunit A [Escherichia coli IAI39]
	158 	158 	85% 	1e-36	Gene info linked to YP_002408327.1
CAA68611.1 	
gyrase alpha subunit [Escherichia coli]
	158 	158 	85% 	1e-36	
ADA74657.1 	
DNA gyrase subunit A [Shigella flexneri 2002017]
	158 	158 	85% 	1e-36	
YP_003430551.1 	
DNA gyrase A subunit [Streptococcus gallolyticus UCN34] >ref|ZP_07464569.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus gallolyticus subsp. gallolyticus TX20005] >emb|CBI13620.1| DNA gyrase A subunit [Streptococcus gallolyticus UCN34] >gb|EFM29583.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus gallolyticus subsp. gallolyticus TX20005]
	158 	158 	83% 	1e-36	Gene info linked to YP_003430551.1
ZP_04562752.1 	
DNA gyrase subunit A [Citrobacter sp. 30_2] >gb|EEH93728.1| DNA gyrase subunit A [Citrobacter sp. 30_2]
	158 	158 	85% 	1e-36	
EFW58187.1 	
DNA gyrase subunit A [Shigella flexneri CDC 796-83]
	158 	158 	85% 	1e-36	
YP_116054.1 	
DNA gyrase subunit A [Mycoplasma hyopneumoniae 232] >gb|AAV27617.1| DNA gyrase subunit A [Mycoplasma hyopneumoniae 232] >gb|AAZ44615.2| DNA gyrase subunit A [Mycoplasma hyopneumoniae J]
	158 	158 	96% 	1e-36	Gene info linked to YP_116054.1
ACF39992.1 	
DNA gyrase subunit A [Clostridium perfringens] >gb|ACF39994.1| DNA gyrase subunit A [Clostridium perfringens]
	158 	158 	61% 	1e-36	
ZP_02617828.1 	
DNA topoisomerase, GyrA/ParC subunit family [Clostridium botulinum Bf] >ref|YP_002863759.1| DNA topoisomerase, GyrA/ParC subunit family [Clostridium botulinum Ba4 str. 657] >gb|EDT85626.1| DNA topoisomerase, GyrA/ParC subunit family [Clostridium botulinum Bf] >gb|ACQ52256.1| DNA topoisomerase, GyrA/ParC subunit family [Clostridium botulinum Ba4 str. 657]
	158 	158 	85% 	1e-36	
NP_780116.1 	
DNA gyrase subunit A [Xylella fastidiosa Temecula1] >ref|YP_001830714.1| DNA gyrase subunit A [Xylella fastidiosa M23] >gb|AAO29765.1| DNA gyrase subunit A [Xylella fastidiosa Temecula1] >gb|ACB93440.1| DNA gyrase, A subunit [Xylella fastidiosa M23]
	158 	158 	81% 	1e-36	Gene info linked to NP_780116.1
YP_003846928.1 	
DNA gyrase, A subunit [Gallionella capsiferriformans ES-2] >gb|ADL55164.1| DNA gyrase, A subunit [Gallionella capsiferriformans ES-2]
	158 	158 	84% 	1e-36	Gene info linked to YP_003846928.1
YP_279326.1 	
DNA gyrase subunit A [Mycoplasma hyopneumoniae J]
	158 	158 	96% 	1e-36	Gene info linked to YP_279326.1
ZP_00680440.1 	
DNA gyrase, subunit A [Xylella fastidiosa Ann-1] >gb|EAO34062.1| DNA gyrase, subunit A [Xylella fastidiosa Ann-1]
	158 	158 	81% 	1e-36	
ZP_05367392.1 	
DNA gyrase subunit A [Rothia mucilaginosa ATCC 25296] >gb|EET76091.1| DNA gyrase subunit A [Rothia mucilaginosa ATCC 25296]
	158 	158 	82% 	1e-36	
ABV03202.1 	
GyrA [Chlamydia trachomatis] >gb|ABV03203.1| GyrA [Chlamydia trachomatis]
	158 	158 	82% 	1e-36	
ZP_06639495.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Serratia odorifera DSM 4582] >gb|EFE95629.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Serratia odorifera DSM 4582]
	158 	158 	85% 	1e-36	
AAZ53894.2 	
DNA gyrase subunit A [Mycoplasma hyopneumoniae 7448]
	158 	158 	96% 	1e-36	Gene info linked to AAZ53894.2
YP_001392049.1 	
DNA topoisomerase IV subunit A [Clostridium botulinum F str. Langeland] >ref|YP_001782377.1| DNA topoisomerase IV subunit A [Clostridium botulinum B1 str. Okra] >gb|ABS42358.1| DNA topoisomerase, GyrA/ParC subunit family [Clostridium botulinum F str. Langeland] >gb|ACA45349.1| DNA topoisomerase, GyrA/ParC subunit family [Clostridium botulinum B1 str. Okra] >gb|ADG00440.1| DNA topoisomerase, GyrA/ParC subunit family [Clostridium botulinum F str. 230613]
	158 	158 	85% 	1e-36	Gene info linked to YP_001392049.1
YP_908869.1 	
DNA gyrase subunit A [Bifidobacterium adolescentis ATCC 15703] >dbj|BAF38787.1| DNA gyrase (topoisomerase II) A subunit [Bifidobacterium adolescentis ATCC 15703]
	158 	158 	85% 	1e-36	Gene info linked to YP_908869.1
YP_604485.1 	
DNA gyrase, A subunit [Deinococcus geothermalis DSM 11300] >gb|ABF45316.1| DNA gyrase, A subunit [Deinococcus geothermalis DSM 11300]
	158 	158 	82% 	1e-36	Gene info linked to YP_604485.1
NP_299829.1 	
DNA gyrase subunit A [Xylella fastidiosa 9a5c] >gb|AAF85349.1|AE004062_4 DNA gyrase subunit A [Xylella fastidiosa 9a5c]
	158 	158 	81% 	1e-36	Gene info linked to NP_299829.1
ZP_02917536.1 	
hypothetical protein BIFDEN_00820 [Bifidobacterium dentium ATCC 27678] >ref|YP_003359529.1| DNA gyrase subunit A [Bifidobacterium dentium Bd1] >ref|ZP_07457365.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Bifidobacterium dentium ATCC 27679] >ref|ZP_07696079.1| DNA gyrase, A subunit [Bifidobacterium dentium JCVIHMP022] >gb|EDT45004.1| hypothetical protein BIFDEN_00820 [Bifidobacterium dentium ATCC 27678] >gb|ADB08705.1| DNA gyrase subunit A [Bifidobacterium dentium Bd1] >gb|EFM40902.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Bifidobacterium dentium ATCC 27679] >gb|EFO77711.1| DNA gyrase, A subunit [Bifidobacterium dentium JCVIHMP022]
	157 	157 	85% 	1e-36	
ZP_02027759.1 	
hypothetical protein BIFADO_00161 [Bifidobacterium adolescentis L2-32] >gb|EDN83260.1| hypothetical protein BIFADO_00161 [Bifidobacterium adolescentis L2-32]
	157 	157 	85% 	1e-36	
ZP_07149599.1 	
DNA gyrase subunit A [Corynebacterium resistens DSM 45100]
	157 	157 	83% 	1e-36	
CBJ38063.1 	
DNA gyrase, subunit A, type II topoisomerase [Ralstonia solanacearum CMR15]
	157 	157 	88% 	1e-36	
NP_212569.1 	
DNA gyrase, subunit A (gyrA) [Borrelia burgdorferi B31] >ref|ZP_03436743.1| DNA gyrase, A subunit [Borrelia burgdorferi 156a] >ref|YP_002374946.1| DNA gyrase, A subunit [Borrelia burgdorferi ZS7] >ref|ZP_03623388.1| DNA gyrase, A subunit [Borrelia burgdorferi 64b] >ref|ZP_03797270.1| DNA gyrase, A subunit [Borrelia burgdorferi Bol26] >sp|O51396.1|GYRA_BORBU RecName: Full=DNA gyrase subunit A >gb|AAC66803.1| DNA gyrase, subunit A (gyrA) [Borrelia burgdorferi B31] >gb|EEC22031.1| DNA gyrase, A subunit [Borrelia burgdorferi 156a] >gb|ACK75164.1| DNA gyrase, A subunit [Borrelia burgdorferi ZS7] >gb|EEF56712.1| DNA gyrase, A subunit [Borrelia burgdorferi 64b] >gb|EEH31686.1| DNA gyrase, A subunit [Borrelia burgdorferi Bol26] >gb|ADQ30405.1| DNA gyrase, A subunit [Borrelia burgdorferi JD1]
	157 	157 	81% 	1e-36	Gene info linked to NP_212569.1
ADH19725.1 	
DNA gyrase subunit A [Chlamydia trachomatis G/11074]
	157 	157 	87% 	1e-36	
YP_002255772.1 	
dna gyrase (subunit a)(type II topoisomerase) protein [Ralstonia solanacearum MolK2] >emb|CAQ37574.1| dna gyrase (subunit a)(type II topoisomerase) protein [Ralstonia solanacearum MolK2]
	157 	157 	88% 	1e-36	Gene info linked to YP_002255772.1
YP_287917.1 	
DNA gyrase subunit A [Mycoplasma hyopneumoniae 7448]
	157 	157 	96% 	1e-36	Gene info linked to YP_287917.1
ZP_06692192.1 	
hypothetical protein HMPREF0013_02041 [Acinetobacter sp. SH024] >gb|EFF86705.1| hypothetical protein HMPREF0013_02041 [Acinetobacter sp. SH024]
	157 	157 	88% 	1e-36	
ZP_07310313.1 	
DNA gyrase, A subunit [Streptomyces griseoflavus Tu4000] >gb|EFL38682.1| DNA gyrase, A subunit [Streptomyces griseoflavus Tu4000]
	157 	157 	93% 	1e-36	
ZP_03560895.1 	
DNA gyrase, A subunit [Glaciecola sp. HTCC2999]
	157 	157 	85% 	1e-36	
ZP_05620425.1 	
DNA gyrase, A subunit [Enhydrobacter aerosaccus SK60] >gb|EEV22160.1| DNA gyrase, A subunit [Enhydrobacter aerosaccus SK60]
	157 	157 	83% 	1e-36	
ZP_05105601.1 	
DNA gyrase, A subunit [Methylophaga thiooxidans DMS010] >gb|EEF78598.1| DNA gyrase, A subunit [Methylophaga thiooxidans DMS010]
	157 	157 	83% 	1e-36	
CBZ04656.1 	
topoisomerase IV subunit A [Clostridium botulinum H04402 065]
	157 	157 	85% 	1e-36	
ZP_00651473.1 	
DNA gyrase, subunit A [Xylella fastidiosa Dixon] >ref|ZP_00681974.1| DNA gyrase, subunit A [Xylella fastidiosa Ann-1] >ref|YP_001776610.1| DNA gyrase subunit A [Xylella fastidiosa M12] >gb|EAO13710.1| DNA gyrase, subunit A [Xylella fastidiosa Dixon] >gb|EAO32496.1| DNA gyrase, subunit A [Xylella fastidiosa Ann-1] >gb|ACA12980.1| DNA gyrase subunit A [Xylella fastidiosa M12]
	157 	157 	81% 	1e-36	
ZP_07727925.1 	
DNA topoisomerase IV, A subunit [Streptococcus parasanguinis F0405] >gb|EFQ55020.1| DNA topoisomerase IV, A subunit [Streptococcus parasanguinis F0405]
	157 	157 	88% 	1e-36	
ZP_03743409.1 	
hypothetical protein BIFPSEUDO_04003 [Bifidobacterium pseudocatenulatum DSM 20438] >gb|EEG70262.1| hypothetical protein BIFPSEUDO_04003 [Bifidobacterium pseudocatenulatum DSM 20438]
	157 	157 	85% 	1e-36	
YP_003746361.1 	
DNA gyrase subunit A [Ralstonia solanacearum CFBP2957] >emb|CBJ43767.1| DNA gyrase, subunit A, type II topoisomerase [Ralstonia solanacearum CFBP2957]
	157 	157 	88% 	2e-36	Gene info linked to YP_003746361.1
YP_349806.1 	
DNA gyrase subunit A [Pseudomonas fluorescens Pf0-1] >gb|ABA75815.1| DNA gyrase subunit A [Pseudomonas fluorescens Pf0-1]
	157 	157 	83% 	2e-36	Gene info linked to YP_349806.1
NP_519022.1 	
DNA gyrase subunit A [Ralstonia solanacearum GMI1000] >emb|CAD14603.1| probable dna gyrase (subunit a)(type II topoisomerase) protein [Ralstonia solanacearum GMI1000]
	157 	157 	88% 	2e-36	Gene info linked to NP_519022.1
NP_288805.1 	
DNA gyrase subunit A [Escherichia coli O157:H7 EDL933] >gb|AAG57360.1|AE005455_1 DNA gyrase, subunit A, type II topoisomerase [Escherichia coli O157:H7 str. EDL933]
	157 	157 	85% 	2e-36	Gene info linked to NP_288805.1
YP_001255270.1 	
DNA topoisomerase, GyrA/ParC subunit family [Clostridium botulinum A str. ATCC 3502] >ref|YP_001385013.1| DNA topoisomerase IV subunit A [Clostridium botulinum A str. ATCC 19397] >ref|YP_001388483.1| DNA topoisomerase IV subunit A [Clostridium botulinum A str. Hall] >emb|CAL84332.1| DNA gyrase subunit A [Clostridium botulinum A str. ATCC 3502] >gb|ABS33103.1| DNA topoisomerase, GyrA/ParC subunit family [Clostridium botulinum A str. ATCC 19397] >gb|ABS38831.1| DNA topoisomerase, GyrA/ParC subunit family [Clostridium botulinum A str. Hall]
	157 	157 	84% 	2e-36	Gene info linked to YP_001255270.1
ZP_03489312.1 	
hypothetical protein EUBIFOR_01901 [Eubacterium biforme DSM 3989] >gb|EEC89544.1| hypothetical protein EUBIFOR_01901 [Eubacterium biforme DSM 3989]
	157 	157 	96% 	2e-36	
AAO16802.1 	
ParC [Streptococcus pneumoniae]
	157 	157 	84% 	2e-36	
EFV97294.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus agalactiae ATCC 13813]
	157 	157 	83% 	2e-36	
YP_001354365.1 	
DNA gyrase subunit A [Janthinobacterium sp. Marseille] >gb|ABR89127.1| DNA gyrase subunit A [Janthinobacterium sp. Marseille]
	157 	157 	58% 	2e-36	Gene info linked to YP_001354365.1
YP_003108414.1 	
putative partial DNA gyrase A subunit [Candidatus Sulcia muelleri SMDSEM] >gb|ACU52741.1| putative partial DNA gyrase A subunit [Candidatus Sulcia muelleri SMDSEM]
	157 	157 	82% 	2e-36	Gene info linked to YP_003108414.1
NP_735397.1 	
DNA gyrase subunit A [Streptococcus agalactiae NEM316] >ref|ZP_00789425.1| DNA gyrase, A subunit [Streptococcus agalactiae 515] >emb|CAD46607.1| DNA gyrase A subunit [Streptococcus agalactiae NEM316] >gb|EAO71802.1| DNA gyrase, A subunit [Streptococcus agalactiae 515]
	157 	157 	83% 	2e-36	Gene info linked to NP_735397.1
YP_001094074.1 	
DNA gyrase, A subunit [Shewanella loihica PV-4] >gb|ABO23815.1| DNA gyrase subunit A [Shewanella loihica PV-4]
	157 	157 	82% 	2e-36	Gene info linked to YP_001094074.1
ZP_01125902.1 	
DNA gyrase, A subunit [Nitrococcus mobilis Nb-231] >gb|EAR23385.1| DNA gyrase, A subunit [Nitrococcus mobilis Nb-231]
	157 	157 	83% 	2e-36	
ZP_06503260.1 	
DNA gyrase/topoisomerase IV, A subunit [Micrococcus luteus SK58] >gb|EFD49712.1| DNA gyrase/topoisomerase IV, A subunit [Micrococcus luteus SK58]
	157 	157 	82% 	2e-36	
ZP_08021346.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus australis ATCC 700641] >gb|EFV99419.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus australis ATCC 700641]
	157 	157 	88% 	2e-36	
ZP_02964038.1 	
DNA gyrase subunit A [Bifidobacterium animalis subsp. lactis HN019] >ref|YP_002468888.1| DNA gyrase subunit A [Bifidobacterium animalis subsp. lactis AD011] >ref|YP_002967466.1| DNA gyrase subunit A [Bifidobacterium animalis subsp. lactis Bl-04] >ref|YP_002969033.1| DNA gyrase subunit A [Bifidobacterium animalis subsp. lactis DSM 10140] >gb|EDT88739.1| DNA gyrase subunit A [Bifidobacterium animalis subsp. lactis HN019] >gb|ACL28312.1| DNA gyrase, A subunit [Bifidobacterium animalis subsp. lactis AD011] >gb|ACS45404.1| DNA gyrase subunit A [Bifidobacterium animalis subsp. lactis Bl-04] >gb|ACS46971.1| DNA gyrase subunit A [Bifidobacterium animalis subsp. lactis DSM 10140] >gb|ADC85021.1| DNA gyrase subunit A [Bifidobacterium animalis subsp. lactis BB-12] >gb|ADG32594.1| DNA gyrase subunit A [Bifidobacterium animalis subsp. lactis V9]
	157 	157 	85% 	2e-36	
ZP_00786437.1 	
DNA gyrase, A subunit, truncation [Streptococcus agalactiae COH1] >gb|EAO74824.1| DNA gyrase, A subunit, truncation [Streptococcus agalactiae COH1]
	157 	157 	83% 	2e-36	
AAB95117.1 	
DNA gyrase [Serratia marcescens]
	157 	157 	85% 	2e-36	
ZP_02328279.1 	
DNA topoisomerase IV subunit A [Paenibacillus larvae subsp. larvae BRL-230010] >ref|ZP_08055849.1| DNA topoisomerase IV subunit A-like protein [Paenibacillus larvae subsp. larvae B-3650] >gb|EFX46605.1| DNA topoisomerase IV subunit A-like protein [Paenibacillus larvae subsp. larvae B-3650]
	157 	157 	82% 	2e-36	
ZP_07641532.1 	
DNA topoisomerase IV, A subunit [Streptococcus mitis SK597] >gb|EFO00867.1| DNA topoisomerase IV, A subunit [Streptococcus mitis SK597]
	157 	157 	84% 	2e-36	
CBK99403.1 	
DNA gyrase subunit A [Faecalibacterium prausnitzii L2-6]
	157 	157 	82% 	2e-36	
ZP_07029136.1 	
DNA gyrase, A subunit [Acidobacterium sp. MP5ACTX8] >gb|EFI58230.1| DNA gyrase, A subunit [Acidobacterium sp. MP5ACTX8]
	157 	157 	95% 	2e-36	
ZP_05315027.1 	
DNA gyrase, A subunit [Nitrosomonas sp. AL212] >gb|EET32314.1| DNA gyrase, A subunit [Nitrosomonas sp. AL212]
	157 	157 	83% 	2e-36	
AAZ93284.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	157 	157 	84% 	2e-36	
ZP_04057806.1 	
DNA gyrase, A subunit [Capnocytophaga gingivalis ATCC 33624] >gb|EEK14408.1| DNA gyrase, A subunit [Capnocytophaga gingivalis ATCC 33624]
	157 	157 	96% 	2e-36	
YP_130640.1 	
putative DNA topoisomerase (ATP-hydrolyzing) [Photobacterium profundum SS9] >emb|CAG20838.1| putative DNA topoisomerase (ATP-hydrolyzing) [Photobacterium profundum SS9]
	157 	157 	96% 	2e-36	Gene info linked to YP_130640.1
YP_002560415.1 	
topoisomerase IV subunit A [Macrococcus caseolyticus JCSC5402] >dbj|BAH17719.1| topoisomerase IV subunit A [Macrococcus caseolyticus JCSC5402]
	157 	157 	82% 	3e-36	Gene info linked to YP_002560415.1
ZP_03323284.1 	
hypothetical protein BIFCAT_00042 [Bifidobacterium catenulatum DSM 16992] >gb|EEB22412.1| hypothetical protein BIFCAT_00042 [Bifidobacterium catenulatum DSM 16992]
	157 	157 	85% 	3e-36	
YP_004178383.1 	
DNA gyrase subunit A [Isosphaera pallida ATCC 43644] >gb|ADV61834.1| DNA gyrase subunit A [Isosphaera pallida ATCC 43644]
	157 	157 	96% 	3e-36	Gene info linked to YP_004178383.1
ZP_02717152.1 	
DNA topoisomerase IV, A subunit [Streptococcus pneumoniae CDC3059-06] >gb|EDT97581.1| DNA topoisomerase IV, A subunit [Streptococcus pneumoniae CDC3059-06]
	157 	157 	84% 	3e-36	
ZP_07645012.1 	
DNA topoisomerase IV, A subunit [Streptococcus mitis NCTC 12261] >gb|AAD34369.1|AF129764_3 ParC [Streptococcus mitis] >gb|EFN94671.1| DNA topoisomerase IV, A subunit [Streptococcus mitis NCTC 12261]
	157 	157 	84% 	3e-36	
YP_002871283.1 	
DNA gyrase subunit A [Pseudomonas fluorescens SBW25] >emb|CAY47892.1| DNA gyrase subunit A [Pseudomonas fluorescens SBW25]
	157 	157 	83% 	3e-36	Gene info linked to YP_002871283.1
ZP_04956655.1 	
DNA gyrase, A subunit [gamma proteobacterium NOR51-B] >gb|EED34239.1| DNA gyrase, A subunit [gamma proteobacterium NOR51-B]
	157 	157 	85% 	3e-36	
AAZ93283.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93307.1| topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93309.1| topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93324.1| topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93326.1| topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93328.1| topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93329.1| topoisomerase IV subunit A [Streptococcus pneumoniae]
	157 	157 	84% 	3e-36	
ZP_06597274.1 	
DNA gyrase, A subunit [Oribacterium sp. oral taxon 078 str. F0262] >gb|EFE93147.1| DNA gyrase, A subunit [Oribacterium sp. oral taxon 078 str. F0262]
	156 	156 	83% 	3e-36	
AAZ93302.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93308.1| topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93311.1| topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93314.1| topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93315.1| topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93323.1| topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93327.1| topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	3e-36	
AAZ93288.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	3e-36	
YP_002957378.1 	
DNA topoisomerase IV subunit A [Micrococcus luteus NCTC 2665] >ref|ZP_06245429.1| DNA topoisomerase IV subunit A [Micrococcus luteus NCTC 2665] >gb|ACS30824.1| DNA topoisomerase IV subunit A [Micrococcus luteus NCTC 2665]
	156 	156 	82% 	3e-36	Gene info linked to YP_002957378.1
AAZ93294.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	3e-36	
AAZ93313.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	3e-36	
ZP_01830865.1 	
DNA topoisomerase IV subunit A [Streptococcus pneumoniae SP18-BS74] >gb|EDK68206.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae SP18-BS74]
	156 	156 	84% 	3e-36	
AAZ93310.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93332.1| topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	3e-36	
BAJ56729.1 	
DNA gyrase subunit A [Helicobacter pylori F30]
	156 	156 	85% 	3e-36	
YP_001694308.1 	
DNA topoisomerase IV subunit A [Streptococcus pneumoniae Hungary19A-6] >ref|YP_002735873.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae JJA] >ref|YP_002738033.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae P1031] >gb|ACA36001.1| DNA topoisomerase IV, A subunit [Streptococcus pneumoniae Hungary19A-6] >gb|ACO19093.1| DNA topoisomerase IV, A subunit [Streptococcus pneumoniae JJA] >gb|ACO20988.1| DNA topoisomerase IV, A subunit [Streptococcus pneumoniae P1031]
	156 	156 	84% 	3e-36	Gene info linked to YP_001694308.1
YP_001835516.1 	
DNA topoisomerase IV subunit A [Streptococcus pneumoniae CGSP14] >gb|ACB90051.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae CGSP14]
	156 	156 	84% 	3e-36	Gene info linked to YP_001835516.1
ZP_02709658.2 	
DNA topoisomerase IV, A subunit [Streptococcus pneumoniae CDC1873-00] >ref|YP_002740164.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae 70585] >ref|YP_002742760.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae Taiwan19F-14] >ref|ZP_04524644.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae CCRI 1974] >ref|ZP_04598086.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae CCRI 1974M2] >ref|ZP_06962831.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae str. Canada MDR_19F] >ref|ZP_06978965.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae str. Canada MDR_19A] >gb|EDT50140.1| DNA topoisomerase IV, A subunit [Streptococcus pneumoniae CDC1873-00] >gb|ACO16802.1| DNA topoisomerase IV, A subunit [Streptococcus pneumoniae 70585] >gb|ACO23199.1| DNA topoisomerase IV, A subunit [Streptococcus pneumoniae Taiwan19F-14]
	156 	156 	84% 	3e-36	
YP_001100824.1 	
DNA gyrase subunit A [Herminiimonas arsenicoxydans] >emb|CAL62703.1| DNA gyrase subunit A [Herminiimonas arsenicoxydans]
	156 	156 	58% 	3e-36	Gene info linked to YP_001100824.1
NP_736625.1 	
DNA gyrase subunit A [Corynebacterium efficiens YS-314] >ref|ZP_05751195.1| dna topoisomerase (ATP-hydrolysing) [Corynebacterium efficiens YS-314] >dbj|BAC16825.1| putative DNA gyrase subunit A [Corynebacterium efficiens YS-314] >gb|EEW48667.1| dna topoisomerase (ATP-hydrolysing) [Corynebacterium efficiens YS-314]
	156 	156 	87% 	3e-36	Gene info linked to NP_736625.1
ZP_02714487.2 	
DNA topoisomerase IV, A subunit [Streptococcus pneumoniae SP195] >gb|EDT91891.1| DNA topoisomerase IV, A subunit [Streptococcus pneumoniae SP195]
	156 	156 	84% 	3e-36	
ZP_02715087.2 	
DNA topoisomerase IV, A subunit [Streptococcus pneumoniae CDC0288-04] >gb|EDT95178.1| DNA topoisomerase IV, A subunit [Streptococcus pneumoniae CDC0288-04]
	156 	156 	84% 	3e-36	
AAZ93296.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	3e-36	
AAZ93304.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	3e-36	
ZP_04782808.1 	
DNA gyrase subunit A [Weissella paramesenteroides ATCC 33313] >gb|EER75009.1| DNA gyrase subunit A [Weissella paramesenteroides ATCC 33313]
	156 	156 	82% 	3e-36	
ZP_03131207.1 	
DNA gyrase, A subunit [Chthoniobacter flavus Ellin428] >gb|EDY18237.1| DNA gyrase, A subunit [Chthoniobacter flavus Ellin428]
	156 	156 	90% 	3e-36	
AAZ93279.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93321.1| topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93325.1| topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	3e-36	
AAF85904.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	3e-36	
AAZ93318.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	3e-36	
ZP_02615486.1 	
DNA topoisomerase, GyrA/ParC subunit family [Clostridium botulinum NCTC 2916] >ref|YP_002805274.1| DNA topoisomerase, GyrA/ParC subunit family [Clostridium botulinum A2 str. Kyoto] >gb|EDT80315.1| DNA topoisomerase, GyrA/ParC subunit family [Clostridium botulinum NCTC 2916] >gb|ACO84027.1| DNA topoisomerase, GyrA/ParC subunit family [Clostridium botulinum A2 str. Kyoto]
	156 	156 	85% 	3e-36	
ZP_01828871.1 	
DNA topoisomerase IV subunit A [Streptococcus pneumoniae SP14-BS69] >ref|ZP_01835752.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae SP23-BS72] >gb|EDK64974.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae SP14-BS69] >gb|EDK81168.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae SP23-BS72] >emb|CBW34384.1| topoisomerase IV subunit A [Streptococcus pneumoniae INV200]
	156 	156 	84% 	3e-36	
YP_060188.1 	
DNA gyrase subunit A [Streptococcus pyogenes MGAS10394] >ref|YP_602517.1| DNA gyrase subunit A [Streptococcus pyogenes MGAS10750] >ref|YP_001128473.1| DNA gyrase subunit A [Streptococcus pyogenes str. Manfredo] >ref|ZP_07460631.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus pyogenes ATCC 10782] >sp|Q5XC58.1|GYRA_STRP6 RecName: Full=DNA gyrase subunit A >gb|AAT87005.1| DNA gyrase subunit A [Streptococcus pyogenes MGAS10394] >gb|ABF37973.1| DNA gyrase subunit A [Streptococcus pyogenes MGAS10750] >emb|CAM30243.1| DNA gyrase subunit A [Streptococcus pyogenes str. Manfredo] >gb|EFM33513.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus pyogenes ATCC 10782]
	156 	156 	83% 	3e-36	Gene info linked to YP_060188.1
AAZ93289.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	3e-36	
ZP_02710311.1 	
DNA topoisomerase IV, A subunit [Streptococcus pneumoniae CDC1087-00] >ref|YP_002510788.1| topoisomerase IV subunit A [Streptococcus pneumoniae ATCC 700669] >gb|EDT91509.1| DNA topoisomerase IV, A subunit [Streptococcus pneumoniae CDC1087-00] >emb|CAR68614.1| topoisomerase IV subunit A [Streptococcus pneumoniae ATCC 700669] >emb|CBW36389.1| topoisomerase IV subunit A [Streptococcus pneumoniae INV104]
	156 	156 	84% 	3e-36	
ZP_01819721.1 	
DNA topoisomerase IV subunit A [Streptococcus pneumoniae SP6-BS73] >gb|EDK77029.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae SP6-BS73]
	156 	156 	84% 	3e-36	
ZP_06048228.1 	
DNA gyrase subunit A [Vibrio cholerae CT 5369-93] >gb|EEY52628.1| DNA gyrase subunit A [Vibrio cholerae CT 5369-93]
	156 	156 	88% 	3e-36	
AAZ93303.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93320.1| topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	3e-36	
AAZ93306.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93312.1| topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93333.1| topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	3e-36	
YP_003725078.1 	
DNA topoisomerase [Streptococcus pneumoniae TCH8431/19A] >emb|CAA91551.2| DNA topoisomerase IV [Streptococcus pneumoniae] >gb|ADI69864.1| DNA topoisomerase (ATP-hydrolyzing) [Streptococcus pneumoniae TCH8431/19A]
	156 	156 	84% 	3e-36	Gene info linked to YP_003725078.1
NP_664614.1 	
DNA gyrase subunit A [Streptococcus pyogenes MGAS315] >ref|NP_802271.1| DNA gyrase subunit A [Streptococcus pyogenes SSI-1] >ref|YP_280316.1| DNA gyrase subunit A [Streptococcus pyogenes MGAS6180] >sp|Q8K7H2.1|GYRA_STRP3 RecName: Full=DNA gyrase subunit A >gb|AAM79417.1| DNA gyrase subunit A [Streptococcus pyogenes MGAS315] >dbj|BAC64104.1| putative DNA gyrase A subunit [Streptococcus pyogenes SSI-1] >gb|AAX71961.1| DNA gyrase subunit A [Streptococcus pyogenes MGAS6180]
	156 	156 	83% 	3e-36	Gene info linked to NP_664614.1
AAK63177.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	3e-36	
AAZ93291.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	3e-36	
ZP_01823114.1 	
DNA topoisomerase IV subunit A [Streptococcus pneumoniae SP9-BS68] >gb|EDK78770.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae SP9-BS68]
	156 	156 	84% 	3e-36	
YP_002285906.1 	
DNA gyrase subunit A [Streptococcus pyogenes NZ131] >gb|ACI61211.1| DNA gyrase subunit A [Streptococcus pyogenes NZ131]
	156 	156 	83% 	3e-36	Gene info linked to YP_002285906.1
AAZ93278.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	3e-36	
YP_003777081.1 	
DNA gyrase subunit A protein [Herbaspirillum seropedicae SmR1] >gb|ADJ65173.1| DNA gyrase subunit A protein [Herbaspirillum seropedicae SmR1]
	156 	156 	82% 	3e-36	Gene info linked to YP_003777081.1
YP_002037490.1 	
DNA topoisomerase IV subunit A [Streptococcus pneumoniae G54] >gb|ACF55467.1| DNA topoisomerase IV, A subunit [Streptococcus pneumoniae G54]
	156 	156 	84% 	3e-36	Gene info linked to YP_002037490.1
2NOV_A 	
Chain A, Breakage-Reunion Domain Of S.Pneumoniae Topo Iv: Crystal Structure Of A Gram-Positive Quinolone Target >pdb|2NOV|B Chain B, Breakage-Reunion Domain Of S.Pneumoniae Topo Iv: Crystal Structure Of A Gram-Positive Quinolone Target >pdb|2NOV|C Chain C, Breakage-Reunion Domain Of S.Pneumoniae Topo Iv: Crystal Structure Of A Gram-Positive Quinolone Target >pdb|2NOV|D Chain D, Breakage-Reunion Domain Of S.Pneumoniae Topo Iv: Crystal Structure Of A Gram-Positive Quinolone Target >pdb|3FOE|A Chain A, Structural Insight Into The Quinolone-Dna Cleavage Complex Of Type Iia Topoisomerases >pdb|3FOE|B Chain B, Structural Insight Into The Quinolone-Dna Cleavage Complex Of Type Iia Topoisomerases >pdb|3FOF|A Chain A, Structural Insight Into The Quinolone-Dna Cleavage Complex Of Type Iia Topoisomerases >pdb|3FOF|B Chain B, Structural Insight Into The Quinolone-Dna Cleavage Complex Of Type Iia Topoisomerases >pdb|3K9F|A Chain A, Detailed Structural Insight Into The Quinolone-Dna Cleavage Complex Of Type Iia Topoisomerases >pdb|3K9F|B Chain B, Detailed Structural Insight Into The Quinolone-Dna Cleavage Complex Of Type Iia Topoisomerases >pdb|3KSA|A Chain A, Detailed Structural Insight Into The Dna Cleavage Complex Of Type Iia Topoisomerases (Cleaved Form) >pdb|3KSA|B Chain B, Detailed Structural Insight Into The Dna Cleavage Complex Of Type Iia Topoisomerases (Cleaved Form) >pdb|3KSB|A Chain A, Detailed Structural Insight Into The Dna Cleavage Complex Of Type Iia Topoisomerases (Re-Sealed Form) >pdb|3KSB|B Chain B, Detailed Structural Insight Into The Dna Cleavage Complex Of Type Iia Topoisomerases (Re-Sealed Form) >pdb|3LTN|A Chain A, Inhibitor-Stabilized Topoisomerase Iv-Dna Cleavage Complex (S. Pneumoniae) >pdb|3LTN|B Chain B, Inhibitor-Stabilized Topoisomerase Iv-Dna Cleavage Complex (S. Pneumoniae)
	156 	156 	81% 	3e-36	Structure related to 2NOV_A
YP_598597.1 	
DNA gyrase subunit A [Streptococcus pyogenes MGAS10270] >gb|ABF34053.1| DNA gyrase subunit A [Streptococcus pyogenes MGAS10270]
	156 	156 	83% 	3e-36	Gene info linked to YP_598597.1
NP_269303.1 	
DNA gyrase subunit A [Streptococcus pyogenes M1 GAS] >ref|YP_282237.1| DNA gyrase subunit A [Streptococcus pyogenes MGAS5005] >sp|Q9L7Q5.1|GYRA_STRP1 RecName: Full=DNA gyrase subunit A >gb|AAF63266.1| DNA gyrase A subunit [Streptococcus pyogenes] >gb|AAK34024.1| DNA gyrase A subunit [Streptococcus pyogenes M1 GAS] >gb|AAZ51492.1| DNA gyrase subunit A [Streptococcus pyogenes MGAS5005]
	156 	156 	83% 	3e-36	Gene info linked to NP_269303.1
YP_003484845.1 	
DNA gyrase A subunit [Streptococcus mutans NN2025] >dbj|BAH87953.1| DNA gyrase A subunit [Streptococcus mutans NN2025]
	156 	156 	83% 	3e-36	Gene info linked to YP_003484845.1
AAZ93334.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	3e-36	
AAZ93322.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	4e-36	
ZP_01831886.1 	
DNA topoisomerase IV subunit A [Streptococcus pneumoniae SP19-BS75] >ref|ZP_07340168.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae BS455] >ref|ZP_07346702.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae SP-BS293] >ref|ZP_07349031.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae SP14-BS292] >ref|ZP_07350935.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae BS397] >ref|ZP_07353333.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae BS457] >ref|ZP_07355580.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae BS458] >ref|YP_003879626.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae 670-6B] >gb|EDK71925.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae SP19-BS75] >gb|EFL66016.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae BS455] >gb|EFL66259.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae SP14-BS292] >gb|EFL68587.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae SP-BS293] >gb|EFL71032.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae BS458] >gb|EFL73284.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae BS457] >gb|EFL75614.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae BS397] >gb|ADM91526.1| DNA topoisomerase IV, A subunit [Streptococcus pneumoniae 670-6B]
	156 	156 	84% 	4e-36	
ZP_06710426.1 	
DNA gyrase, A subunit [Streptomyces sp. e14] >gb|EFF93548.1| DNA gyrase, A subunit [Streptomyces sp. e14]
	156 	156 	82% 	4e-36	
AAZ93290.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	4e-36	
AAZ93280.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93282.1| topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93316.1| topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	4e-36	
YP_001265039.1 	
DNA gyrase subunit A [Sphingomonas wittichii RW1] >gb|ABQ70901.1| DNA gyrase subunit A [Sphingomonas wittichii RW1]
	156 	156 	83% 	4e-36	Gene info linked to YP_001265039.1
ZP_07645489.1 	
DNA topoisomerase IV, A subunit [Streptococcus mitis SK564] >gb|EFN99481.1| DNA topoisomerase IV, A subunit [Streptococcus mitis SK564]
	156 	156 	84% 	4e-36	
ZP_04999840.1 	
DNA topoisomerase IV subunit A [Streptomyces sp. Mg1] >gb|EDX24351.1| DNA topoisomerase IV subunit A [Streptomyces sp. Mg1]
	156 	156 	84% 	4e-36	
AAZ93295.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	4e-36	
NP_721501.1 	
DNA gyrase subunit A [Streptococcus mutans UA159] >gb|AAN58807.1|AE014948_10 DNA gyrase A subunit [Streptococcus mutans UA159]
	156 	156 	83% 	4e-36	Gene info linked to NP_721501.1
YP_002260335.1 	
dna gyrase (subunit a)(type II topoisomerase) protein [Ralstonia solanacearum IPO1609] >emb|CAQ62272.1| dna gyrase (subunit a)(type II topoisomerase) protein [Ralstonia solanacearum IPO1609]
	156 	156 	88% 	4e-36	Gene info linked to YP_002260335.1
ZP_07725445.1 	
DNA gyrase, A subunit [Streptococcus downei F0415] >gb|EFQ57544.1| DNA gyrase, A subunit [Streptococcus downei F0415]
	156 	156 	83% 	4e-36	
YP_003835193.1 	
DNA topoisomerase [Micromonospora aurantiaca ATCC 27029] >gb|ADL45617.1| DNA topoisomerase (ATP-hydrolyzing) [Micromonospora aurantiaca ATCC 27029]
	156 	156 	83% 	4e-36	Gene info linked to YP_003835193.1
ZP_04578074.1 	
DNA gyrase subunit A [Oxalobacter formigenes OXCC13] >gb|EEO29047.1| DNA gyrase subunit A [Oxalobacter formigenes OXCC13]
	156 	156 	81% 	4e-36	
ZP_01304529.1 	
DNA gyrase, A subunit [Sphingomonas sp. SKA58] >gb|EAT07585.1| DNA gyrase, A subunit [Sphingomonas sp. SKA58]
	156 	156 	85% 	4e-36	
ZP_06597125.1 	
DNA gyrase subunit A [Bifidobacterium breve DSM 20213] >gb|EFE88306.1| DNA gyrase subunit A [Bifidobacterium breve DSM 20213]
	156 	156 	82% 	4e-36	
YP_003446019.1 	
topoisomerase IV subunit A [Streptococcus mitis B6] >emb|CBJ22154.1| topoisomerase IV subunit A [Streptococcus mitis B6]
	156 	156 	86% 	4e-36	Gene info linked to YP_003446019.1
CAK18890.1 	
topoisomerase IV subunit A [Staphylococcus pseudintermedius]
	156 	156 	88% 	4e-36	
AAZ93286.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93287.1| topoisomerase IV subunit A [Streptococcus pneumoniae]
	156 	156 	84% 	4e-36	
YP_001823201.1 	
DNA topoisomerase IV subunit A [Streptomyces griseus subsp. griseus NBRC 13350] >dbj|BAG18518.1| putative A subunit of topoisomerase IV [Streptomyces griseus subsp. griseus NBRC 13350]
	156 	156 	84% 	5e-36	Gene info linked to YP_001823201.1
YP_002309405.1 	
DNA gyrase subunit A [Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2] >dbj|BAG83994.1| DNA gyrase subunit A [Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2]
	156 	156 	85% 	5e-36	Gene info linked to YP_002309405.1
YP_004149248.1 	
Topoisomerase IV subunit A [Staphylococcus pseudintermedius HKU10-03] >gb|ADV05612.1| Topoisomerase IV subunit A [Staphylococcus pseudintermedius HKU10-03]
	155 	155 	88% 	5e-36	Gene info linked to YP_004149248.1
CAK18892.1 	
topoisomerase IV subunit A [Staphylococcus pseudintermedius]
	155 	155 	88% 	5e-36	
ZP_07462855.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus mitis ATCC 6249] >gb|EFM31841.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus mitis ATCC 6249]
	155 	155 	84% 	5e-36	
ZP_08024211.1 	
DNA gyrase subunit A [Dietzia cinnamea P4] >gb|EFV91247.1| DNA gyrase subunit A [Dietzia cinnamea P4]
	155 	155 	88% 	5e-36	
NP_868573.1 	
DNA gyrase subunit A [Rhodopirellula baltica SH 1] >emb|CAD75950.1| DNA gyrase subunit A [Rhodopirellula baltica SH 1]
	155 	155 	83% 	5e-36	Gene info linked to NP_868573.1
YP_003753116.1 	
DNA gyrase, subunit A, type II topoisomerase [Ralstonia solanacearum PSI07] >emb|CBJ51849.1| DNA gyrase, subunit A, type II topoisomerase [Ralstonia solanacearum PSI07]
	155 	155 	88% 	5e-36	Gene info linked to YP_003753116.1
ZP_06277870.1 	
DNA topoisomerase (ATP-hydrolyzing) [Streptomyces sp. ACT-1] >gb|EFB83057.1| DNA topoisomerase (ATP-hydrolyzing) [Streptomyces sp. ACT-1]
	155 	155 	84% 	5e-36	
AAM46065.1 	
DNA gyrase alpha subunit [Peanut witches'-broom phytoplasma]
	155 	155 	97% 	5e-36	
YP_588831.1 	
DNA gyrase, A subunit [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gb|ABF13966.1| DNA gyrase, A subunit [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)]
	155 	155 	87% 	5e-36	Gene info linked to YP_588831.1
YP_003407194.1 	
DNA gyrase subunit A [Geodermatophilus obscurus DSM 43160] >gb|ADB72823.1| DNA gyrase, A subunit [Geodermatophilus obscurus DSM 43160]
	155 	155 	83% 	5e-36	Gene info linked to YP_003407194.1
ZP_03394433.1 	
DNA gyrase, A subunit [Corynebacterium amycolatum SK46] >gb|EEB62499.1| DNA gyrase, A subunit [Corynebacterium amycolatum SK46]
	155 	155 	83% 	5e-36	
ACF39979.1 	
DNA gyrase subunit A [Clostridium perfringens]
	155 	155 	61% 	6e-36	
ZP_07643217.1 	
DNA topoisomerase IV, A subunit [Streptococcus mitis SK321] >gb|EFN97351.1| DNA topoisomerase IV, A subunit [Streptococcus mitis SK321]
	155 	155 	81% 	6e-36	
ZP_07640504.1 	
DNA topoisomerase IV, A subunit [Streptococcus oralis ATCC 35037] >gb|EFO01964.1| DNA topoisomerase IV, A subunit [Streptococcus oralis ATCC 35037]
	155 	155 	84% 	6e-36	
ZP_05361524.1 	
DNA gyrase, A subunit [Acinetobacter radioresistens SK82] >ref|ZP_06072531.1| DNA gyrase, A subunit [Acinetobacter radioresistens SH164] >gb|EET81768.1| DNA gyrase, A subunit [Acinetobacter radioresistens SK82] >gb|EEY86745.1| DNA gyrase, A subunit [Acinetobacter radioresistens SH164]
	155 	155 	88% 	6e-36	
ZP_03613313.1 	
DNA topoisomerase IV, A subunit [Staphylococcus capitis SK14] >gb|EEE49575.1| DNA topoisomerase IV, A subunit [Staphylococcus capitis SK14]
	155 	155 	88% 	6e-36	
YP_924138.1 	
DNA topoisomerase IV subunit A [Nocardioides sp. JS614] >gb|ABL82451.1| DNA topoisomerase IV subunit A [Nocardioides sp. JS614]
	155 	155 	83% 	6e-36	Gene info linked to YP_924138.1
YP_696748.1 	
DNA topoisomerase IV subunit A [Clostridium perfringens ATCC 13124] >ref|ZP_02638520.1| DNA topoisomerase, GyrA/ParC subunit family [Clostridium perfringens CPE str. F4969] >gb|ABG83503.1| DNA gyrase/topoisomerase IV, A subunit family protein [Clostridium perfringens ATCC 13124] >gb|EDT27674.1| DNA topoisomerase, GyrA/ParC subunit family [Clostridium perfringens CPE str. F4969]
	155 	155 	95% 	6e-36	Gene info linked to YP_696748.1
ZP_04696744.1 	
DNA topoisomerase IV subunit A [Streptomyces roseosporus NRRL 15998] >ref|ZP_04711936.1| DNA topoisomerase IV subunit A [Streptomyces roseosporus NRRL 11379] >ref|ZP_06587663.1| DNA topoisomerase IV subunit A [Streptomyces roseosporus NRRL 15998] >gb|EFE78124.1| DNA topoisomerase IV subunit A [Streptomyces roseosporus NRRL 15998]
	155 	155 	84% 	6e-36	
YP_001568277.1 	
DNA gyrase, A subunit [Petrotoga mobilis SJ95] >gb|ABX31954.1| DNA gyrase, A subunit [Petrotoga mobilis SJ95]
	155 	155 	83% 	6e-36	Gene info linked to YP_001568277.1
ZP_02995128.1 	
hypothetical protein CLOSPO_02250 [Clostridium sporogenes ATCC 15579] >gb|EDU36082.1| hypothetical protein CLOSPO_02250 [Clostridium sporogenes ATCC 15579]
	155 	155 	84% 	6e-36	
YP_003528091.1 	
DNA gyrase, A subunit [Nitrosococcus halophilus Nc4] >gb|ADE15704.1| DNA gyrase, A subunit [Nitrosococcus halophilus Nc4]
	155 	155 	83% 	7e-36	Gene info linked to YP_003528091.1
ZP_06271406.1 	
DNA topoisomerase (ATP-hydrolyzing) [Streptomyces sp. ACTE] >gb|EFB68223.1| DNA topoisomerase (ATP-hydrolyzing) [Streptomyces sp. ACTE]
	155 	155 	84% 	7e-36	
ZP_06823043.1 	
DNA gyrase subunit A [Streptomyces sp. SPB74] >gb|EDY42137.1| DNA gyrase subunit A [Streptomyces sp. SPB74]
	155 	155 	84% 	7e-36	
YP_001855285.1 	
DNA topoisomerase IV subunit A [Kocuria rhizophila DC2201] >dbj|BAG29779.1| DNA gyrase subunit A [Kocuria rhizophila DC2201]
	155 	155 	82% 	7e-36	Gene info linked to YP_001855285.1
ZP_06612322.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus oralis ATCC 35037] >gb|EFE56425.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus oralis ATCC 35037]
	155 	155 	84% 	7e-36	
ZP_00995057.1 	
DNA gyrase subunit A [Janibacter sp. HTCC2649] >gb|EAP98852.1| DNA gyrase subunit A [Janibacter sp. HTCC2649]
	155 	155 	84% 	7e-36	
ZP_05571156.1 	
DNA gyrase subunit A [Ferroplasma acidarmanus fer1]
	155 	155 	86% 	8e-36	
2WL2_A 	
Chain A, Crystal Structure Of N-Terminal Domain Of Gyra With The Antibiotic Simocyclinone D8 >pdb|2WL2|B Chain B, Crystal Structure Of N-Terminal Domain Of Gyra With The Antibiotic Simocyclinone D8 >pdb|2Y3P|A Chain A, Crystal Structure Of N-Terminal Domain Of Gyra With The Antibiotic Simocyclinone D8 >pdb|2Y3P|B Chain B, Crystal Structure Of N-Terminal Domain Of Gyra With The Antibiotic Simocyclinone D8
	155 	155 	82% 	8e-36	
YP_002552860.1 	
DNA gyrase subunit a [Acidovorax ebreus TPSY] >gb|ACM32860.1| DNA gyrase, A subunit [Acidovorax ebreus TPSY]
	155 	155 	82% 	8e-36	Gene info linked to YP_002552860.1
YP_003072937.1 	
DNA gyrase, A subunit [Teredinibacter turnerae T7901] >gb|ACR11518.1| DNA gyrase, A subunit [Teredinibacter turnerae T7901]
	155 	155 	81% 	8e-36	Gene info linked to YP_003072937.1
1AB4_A 	
Chain A, 59kda Fragment Of Gyrase A From E. Coli
	155 	155 	82% 	8e-36	Structure related to 1AB4_A
ZP_06811807.1 	
DNA topoisomerase IV, A subunit [Geobacillus thermoglucosidasius C56-YS93] >ref|YP_003989331.1| DNA topoisomerase IV, A subunit [Geobacillus sp. Y4.1MC1] >gb|EFG51711.1| DNA topoisomerase IV, A subunit [Geobacillus thermoglucosidasius C56-YS93] >gb|ADP74720.1| DNA topoisomerase IV, A subunit [Geobacillus sp. Y4.1MC1]
	155 	155 	82% 	8e-36	
XP_001713528.1 	
DNA gyrase A-subunit [Guillardia theta] >gb|AAK39823.1|AF165818_31 DNA gyrase A-subunit [Guillardia theta]
	155 	155 	84% 	8e-36	Gene info linked to XP_001713528.1
BAA22542.1 	
DNA gyrase subunit A [Streptococcus thermophilus]
	155 	155 	96% 	8e-36	
ZP_04060698.1 	
DNA topoisomerase IV, A subunit [Staphylococcus hominis SK119] >gb|EEK11293.1| DNA topoisomerase IV, A subunit [Staphylococcus hominis SK119]
	155 	155 	88% 	8e-36	
ZP_02721447.2 	
DNA topoisomerase IV, A subunit [Streptococcus pneumoniae MLV-016] >gb|EDT99156.1| DNA topoisomerase IV, A subunit [Streptococcus pneumoniae MLV-016]
	155 	155 	84% 	8e-36	
ZP_02864778.1 	
DNA gyrase/topoisomerase IV, A subunit [Clostridium perfringens C str. JGS1495] >gb|EDS80429.1| DNA gyrase/topoisomerase IV, A subunit [Clostridium perfringens C str. JGS1495]
	155 	155 	88% 	8e-36	
ZP_08050902.1 	
DNA topoisomerase IV, A subunit [Streptococcus sp. M334] >gb|EFX59223.1| DNA topoisomerase IV, A subunit [Streptococcus sp. M334]
	155 	155 	84% 	8e-36	
ZP_06198784.1 	
topoisomerase IV, subunit A [Streptococcus sp. M143] >gb|EFA24398.1| topoisomerase IV, subunit A [Streptococcus sp. M143]
	155 	155 	81% 	9e-36	
ZP_07843838.1 	
DNA topoisomerase IV, A subunit [Staphylococcus hominis subsp. hominis C80] >gb|EFS18855.1| DNA topoisomerase IV, A subunit [Staphylococcus hominis subsp. hominis C80]
	155 	155 	88% 	9e-36	
ZP_01862894.1 	
DNA gyrase subunit A [Erythrobacter sp. SD-21] >gb|EDL50329.1| DNA gyrase subunit A [Erythrobacter sp. SD-21]
	155 	155 	84% 	9e-36	
NP_562984.1 	
DNA topoisomerase IV subunit A [Clostridium perfringens str. 13] >ref|ZP_02951810.1| DNA topoisomerase, GyrA/ParC subunit family [Clostridium perfringens D str. JGS1721] >dbj|BAB81774.1| DNA topoisomerase IV subunit A [Clostridium perfringens str. 13] >gb|EDT73269.1| DNA topoisomerase, GyrA/ParC subunit family [Clostridium perfringens D str. JGS1721]
	155 	155 	88% 	9e-36	Gene info linked to NP_562984.1
AAZ93292.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	155 	155 	84% 	9e-36	
ZP_01817853.1 	
DNA topoisomerase IV subunit A [Streptococcus pneumoniae SP3-BS71] >ref|ZP_01824723.1| DNA topoisomerase IV, A subunit [Streptococcus pneumoniae SP11-BS70] >ref|YP_003876418.1| type IIA topoisomerase subunit A [Streptococcus pneumoniae AP200] >gb|EDK63809.1| DNA topoisomerase IV, A subunit [Streptococcus pneumoniae SP11-BS70] >gb|EDK74091.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae SP3-BS71] >emb|CBW32423.1| topoisomerase IV subunit A [Streptococcus pneumoniae OXC141] >gb|ADM84416.1| Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Streptococcus pneumoniae AP200]
	155 	155 	84% 	9e-36	
AAF85902.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	155 	155 	84% 	9e-36	
ZP_03773381.1 	
DNA gyrase, A subunit [Borrelia sp. SV1] >gb|EEH00869.1| DNA gyrase, A subunit [Borrelia sp. SV1]
	155 	155 	81% 	9e-36	
AAZ93301.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	155 	155 	84% 	9e-36	
ZP_02641320.1 	
DNA topoisomerase, GyrA/ParC subunit family [Clostridium perfringens NCTC 8239] >gb|EDT79814.1| DNA topoisomerase, GyrA/ParC subunit family [Clostridium perfringens NCTC 8239]
	155 	155 	88% 	9e-36	
AAZ93297.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93298.1| topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93299.1| topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93300.1| topoisomerase IV subunit A [Streptococcus pneumoniae]
	155 	155 	84% 	9e-36	
ZP_02631881.1 	
DNA topoisomerase, GyrA/ParC subunit family [Clostridium perfringens E str. JGS1987] >gb|EDT15289.1| DNA topoisomerase, GyrA/ParC subunit family [Clostridium perfringens E str. JGS1987]
	155 	155 	88% 	9e-36	
YP_003627215.1 	
DNA gyrase subunit A [Moraxella catarrhalis RH4] >gb|ADG61322.1| DNA gyrase subunit A [Moraxella catarrhalis RH4]
	155 	155 	83% 	1e-35	Gene info linked to YP_003627215.1
NP_890006.2 	
DNA gyrase subunit A [Bordetella bronchiseptica RB50] >ref|NP_885309.2| DNA gyrase subunit A [Bordetella parapertussis 12822]
	155 	155 	80% 	1e-35	Gene info linked to NP_890006.2
AAZ93281.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93285.1| topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93319.1| topoisomerase IV subunit A [Streptococcus pneumoniae]
	155 	155 	84% 	1e-35	
YP_522834.1 	
DNA gyrase subunit A [Rhodoferax ferrireducens T118] >gb|ABD69303.1| DNA gyrase subunit A [Rhodoferax ferrireducens T118]
	155 	155 	80% 	1e-35	Gene info linked to YP_522834.1
NP_879745.1 	
DNA gyrase subunit A [Bordetella pertussis Tohama I] >emb|CAE41246.1| DNA gyrase subunit A [Bordetella pertussis Tohama I]
	154 	154 	80% 	1e-35	Gene info linked to NP_879745.1
CAK18888.1 	
topoisomerase IV subunit A [Staphylococcus intermedius]
	154 	154 	88% 	1e-35	
ZP_08049912.1 	
DNA topoisomerase IV, A subunit [Streptococcus sp. C300] >gb|EFX56702.1| DNA topoisomerase IV, A subunit [Streptococcus sp. C300]
	154 	154 	81% 	1e-35	
ADX76677.1 	
DNA topoisomerase IV, A subunit [Staphylococcus pseudintermedius ED99]
	154 	154 	88% 	1e-35	
AAZ93317.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	154 	154 	84% 	1e-35	
YP_141638.1 	
DNA gyrase subunit A [Streptococcus thermophilus CNRZ1066] >gb|AAV62823.1| DNA gyrase A subunit [Streptococcus thermophilus CNRZ1066] >gb|ADQ63271.1| DNA gyrase A subunit [Streptococcus thermophilus ND03]
	154 	154 	83% 	1e-35	Gene info linked to YP_141638.1
CAE38419.1 	
DNA gyrase subunit A [Bordetella parapertussis] >emb|CAE33965.1| DNA gyrase subunit A [Bordetella bronchiseptica RB50]
	154 	154 	80% 	1e-35	Gene info linked to CAE38419.1
NP_218446.1 	
DNA gyrase, subunit A (gyrA) [Treponema pallidum subsp. pallidum str. Nichols] >ref|YP_001933013.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Treponema pallidum subsp. pallidum SS14] >sp|O83051.1|GYRA_TREPA RecName: Full=DNA gyrase subunit A >gb|AAC64998.1| DNA gyrase, subunit A (gyrA) [Treponema pallidum subsp. pallidum str. Nichols] >gb|ACD70434.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Treponema pallidum subsp. pallidum SS14] >gb|ADD72160.1| DNA gyrase, A subunit [Treponema pallidum subsp. pallidum str. Chicago]
	154 	154 	83% 	1e-35	Gene info linked to NP_218446.1
YP_003436497.1 	
DNA gyrase, A subunit [Ferroglobus placidus DSM 10642] >gb|ADC66222.1| DNA gyrase, A subunit [Ferroglobus placidus DSM 10642]
	154 	154 	82% 	1e-35	Gene info linked to YP_003436497.1
CBX19919.1 	
gyrase A [Clostridium perfringens]
	154 	154 	57% 	1e-35	
YP_003759465.1 	
DNA gyrase subunit A [Nitrosococcus watsoni C-113] >gb|ADJ27144.1| DNA gyrase, A subunit [Nitrosococcus watsoni C-113]
	154 	154 	83% 	1e-35	Gene info linked to YP_003759465.1
YP_139726.1 	
DNA gyrase subunit A [Streptococcus thermophilus LMG 18311] >gb|AAV60911.1| DNA gyrase A subunit [Streptococcus thermophilus LMG 18311]
	154 	154 	96% 	1e-35	Gene info linked to YP_139726.1
YP_001799404.1 	
DNA gyrase subunit A [Corynebacterium urealyticum DSM 7109] >emb|CAQ03970.1| DNA gyrase subunit A [Corynebacterium urealyticum DSM 7109]
	154 	154 	87% 	1e-35	Gene info linked to YP_001799404.1
YP_001798880.1 	
DNA gyrase alpha subunit [Candidatus Phytoplasma australiense] >emb|CAM11549.1| DNA gyrase alpha subunit [Candidatus Phytoplasma australiense]
	154 	154 	93% 	1e-35	Gene info linked to YP_001798880.1
YP_820637.1 	
DNA gyrase subunit A [Streptococcus thermophilus LMD-9] >gb|ABJ66441.1| DNA gyrase subunit A [Streptococcus thermophilus LMD-9]
	154 	154 	96% 	1e-35	Gene info linked to YP_820637.1
EFY02598.1 	
DNA gyrase subunit A [Streptococcus dysgalactiae subsp. dysgalactiae ATCC 27957]
	154 	154 	83% 	1e-35	
ZP_07723948.1 	
DNA gyrase, A subunit [Streptococcus vestibularis F0396] >gb|EFQ59451.1| DNA gyrase, A subunit [Streptococcus vestibularis F0396]
	154 	154 	83% 	1e-35	
ZP_06774180.1 	
DNA topoisomerase IV subunit A [Streptomyces clavuligerus ATCC 27064] >gb|EFG09779.1| DNA topoisomerase IV subunit A [Streptomyces clavuligerus ATCC 27064]
	154 	154 	91% 	1e-35	
ABU96667.1 	
DNA gyrase subunit A [Streptococcus dysgalactiae subsp. equisimilis]
	154 	154 	83% 	1e-35	
ZP_07458402.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus sp. oral taxon 071 str. 73H25AP] >gb|EFM35470.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus sp. oral taxon 071 str. 73H25AP]
	154 	154 	81% 	1e-35	
YP_002123388.1 	
DNA gyrase subunit A [Streptococcus equi subsp. zooepidemicus MGCS10565] >gb|ACG62375.1| DNA gyrase subunit A GyrA [Streptococcus equi subsp. zooepidemicus MGCS10565]
	154 	154 	83% 	1e-35	Gene info linked to YP_002123388.1
YP_003545577.1 	
DNA gyrase subunit A [Sphingobium japonicum UT26S] >dbj|BAI96965.1| DNA gyrase subunit A [Sphingobium japonicum UT26S]
	154 	154 	85% 	1e-35	Gene info linked to YP_003545577.1
ABU96668.1 	
DNA gyrase subunit A [Streptococcus dysgalactiae subsp. equisimilis]
	154 	154 	83% 	1e-35	
NP_358351.1 	
DNA topoisomerase IV subunit A [Streptococcus pneumoniae R6] >ref|YP_816238.1| DNA topoisomerase IV subunit A [Streptococcus pneumoniae D39] >gb|AAK99561.1| Topoisomerase IV subunit A [Streptococcus pneumoniae R6] >gb|ABJ53927.1| DNA topoisomerase IV, A subunit [Streptococcus pneumoniae D39]
	154 	154 	84% 	1e-35	Gene info linked to NP_358351.1
YP_002996625.1 	
DNA gyrase subunit A [Streptococcus dysgalactiae subsp. equisimilis GGS_124] >dbj|BAH81411.1| DNA gyrase subunit A [Streptococcus dysgalactiae subsp. equisimilis GGS_124]
	154 	154 	83% 	2e-35	Gene info linked to YP_002996625.1
ABU96666.1 	
DNA gyrase subunit A [Streptococcus dysgalactiae subsp. equisimilis]
	154 	154 	83% 	2e-35	
YP_596723.1 	
DNA gyrase subunit A [Streptococcus pyogenes MGAS9429] >ref|YP_600544.1| DNA gyrase subunit A [Streptococcus pyogenes MGAS2096] >gb|ABF32179.1| DNA gyrase subunit A [Streptococcus pyogenes MGAS9429] >gb|ABF36000.1| DNA gyrase subunit A [Streptococcus pyogenes MGAS2096]
	154 	154 	83% 	2e-35	Gene info linked to YP_596723.1
ZP_08047677.1 	
DNA gyrase, A subunit [Streptococcus sp. C150] >gb|EFX55252.1| DNA gyrase, A subunit [Streptococcus sp. C150]
	154 	154 	96% 	2e-35	
AAM27207.1 	
topoisomerase IV ParC [Streptococcus pneumoniae]
	154 	154 	84% 	2e-35	
ABU96671.1 	
DNA gyrase subunit A [Streptococcus dysgalactiae subsp. equisimilis] >gb|ADX24516.1| DNA gyrase subunit A [Streptococcus dysgalactiae subsp. equisimilis ATCC 12394]
	154 	154 	83% 	2e-35	
ZP_08069474.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus vestibularis ATCC 49124] >gb|EFX96366.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Streptococcus vestibularis ATCC 49124]
	154 	154 	83% 	2e-35	
ZP_07394926.1 	
DNA gyrase A subunit [Candidatus Regiella insecticola LSR1] >gb|EFL92689.1| DNA gyrase A subunit [Candidatus Regiella insecticola LSR1]
	154 	154 	87% 	2e-35	
NP_823599.1 	
DNA topoisomerase IV subunit A [Streptomyces avermitilis MA-4680] >dbj|BAC70134.1| putative a subunit of topoisomerase IV [Streptomyces avermitilis MA-4680]
	154 	154 	84% 	2e-35	Gene info linked to NP_823599.1
ZP_04062237.1 	
DNA gyrase, A subunit [Streptococcus salivarius SK126] >gb|EEK09946.1| DNA gyrase, A subunit [Streptococcus salivarius SK126]
	154 	154 	96% 	2e-35	
ABU96669.1 	
DNA gyrase subunit A [Streptococcus dysgalactiae subsp. equisimilis] >gb|ABU96670.1| DNA gyrase subunit A [Streptococcus dysgalactiae subsp. equisimilis]
	154 	154 	83% 	2e-35	
AAZ93331.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	154 	154 	84% 	2e-35	
P14829.1 	
RecName: Full=DNA gyrase subunit A >emb|CAA34724.1| unnamed protein product [Klebsiella pneumoniae]
	154 	154 	85% 	2e-35	
ZP_05095137.1 	
DNA gyrase, A subunit [marine gamma proteobacterium HTCC2148] >gb|EEB78687.1| DNA gyrase, A subunit [marine gamma proteobacterium HTCC2148]
	154 	154 	82% 	2e-35	
ZP_08018555.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Lautropia mirabilis ATCC 51599] >gb|EFV94985.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Lautropia mirabilis ATCC 51599]
	154 	154 	58% 	2e-35	
YP_001050432.1 	

DNA gyrase, A subunit [Shewanella baltica OS155] >ref|YP_001366488.1| DNA gyrase subunit A [Shewanella baltica OS185] >ref|YP_002357985.1| DNA gyrase, A subunit [Shewanella baltica OS223] >gb|ABN61563.1| DNA gyrase subunit A [Shewanella baltica OS155] >gb|ABS08425.1| DNA gyrase, A subunit [Shewanella baltica OS185] >gb|ACK46562.1| DNA gyrase, A subunit [Shewanella baltica OS223]
	154 	154 	83% 	2e-35	Gene info linked to YP_001050432.1
ZP_07390470.1 	
DNA gyrase, A subunit [Shewanella baltica OS183] >ref|ZP_07582607.1| DNA gyrase, A subunit [Shewanella baltica BA175] >gb|EFM17067.1| DNA gyrase, A subunit [Shewanella baltica OS183] >gb|EFN43634.1| DNA gyrase, A subunit [Shewanella baltica BA175]
	154 	154 	83% 	2e-35	
ZP_01408369.1 	
hypothetical protein SpneT_02001168 [Streptococcus pneumoniae TIGR4]
	154 	154 	84% 	2e-35	
AAZ93277.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	154 	154 	84% 	2e-35	
ZP_03672525.1 	
DNA gyrase, A subunit [Borrelia valaisiana VS116] >gb|EEF81764.1| DNA gyrase, A subunit [Borrelia valaisiana VS116]
	154 	154 	81% 	2e-35	
NP_345344.1 	
DNA topoisomerase IV subunit A [Streptococcus pneumoniae TIGR4] >sp|P72525.3|PARC_STRPN RecName: Full=DNA topoisomerase 4 subunit A; AltName: Full=Topoisomerase IV subunit A >gb|AAK74984.1| topoisomerase IV, subunit A [Streptococcus pneumoniae TIGR4]
	154 	154 	84% 	2e-35	Gene info linked to NP_345344.1
AAZ93293.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	154 	154 	84% 	2e-35	
YP_001630491.1 	
DNA gyrase subunit A [Bordetella petrii DSM 12804] >emb|CAP42222.1| DNA gyrase subunit A [Bordetella petrii]
	154 	154 	80% 	2e-35	Gene info linked to YP_001630491.1
ZP_01911772.1 	
DNA gyrase, A subunit [Plesiocystis pacifica SIR-1] >gb|EDM75303.1| DNA gyrase, A subunit [Plesiocystis pacifica SIR-1]
	154 	154 	80% 	2e-35	
CBX19904.1 	
gyrase A [Clostridium perfringens]
	154 	154 	56% 	2e-35	
ZP_07071368.1 	
DNA gyrase, A subunit [Rothia dentocariosa M567] >gb|EFJ77094.1| DNA gyrase, A subunit [Rothia dentocariosa M567]
	154 	154 	82% 	2e-35	
ZP_05006277.1 	
DNA topoisomerase IV subunit A [Streptomyces clavuligerus ATCC 27064] >gb|EDY50576.1| DNA topoisomerase IV subunit A [Streptomyces clavuligerus ATCC 27064]
	154 	154 	91% 	2e-35	
YP_699348.1 	
DNA topoisomerase IV subunit A [Clostridium perfringens SM101] >gb|ABG87374.1| DNA gyrase/topoisomerase IV, A subunit family protein [Clostridium perfringens SM101]
	154 	154 	88% 	2e-35	Gene info linked to YP_699348.1
YP_986701.1 	
DNA gyrase subunit A [Acidovorax sp. JS42] >gb|ABM42625.1| DNA gyrase subunit A [Acidovorax sp. JS42]
	154 	154 	82% 	2e-35	Gene info linked to YP_986701.1
YP_003984650.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Rothia dentocariosa ATCC 17931] >gb|ADP41216.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Rothia dentocariosa ATCC 17931]
	154 	154 	82% 	2e-35	Gene info linked to YP_003984650.1
ZP_02634395.1 	
DNA topoisomerase, GyrA/ParC subunit family [Clostridium perfringens B str. ATCC 3626] >gb|EDT25223.1| DNA topoisomerase, GyrA/ParC subunit family [Clostridium perfringens B str. ATCC 3626]
	154 	154 	88% 	2e-35	
YP_003897790.1 	
DNA gyrase subunit A [Halomonas elongata DSM 2581] >emb|CBV42605.1| DNA gyrase subunit A [Halomonas elongata DSM 2581]
	154 	154 	82% 	2e-35	Gene info linked to YP_003897790.1
YP_734050.1 	
DNA gyrase subunit A [Shewanella sp. MR-4] >gb|ABI38993.1| DNA gyrase subunit A [Shewanella sp. MR-4]
	154 	154 	83% 	2e-35	Gene info linked to YP_734050.1
YP_506822.1 	
DNA gyrase, A subunit [Neorickettsia sennetsu str. Miyayama] >gb|ABD46289.1| DNA gyrase, A subunit [Neorickettsia sennetsu str. Miyayama]
	154 	154 	84% 	2e-35	Gene info linked to YP_506822.1
NP_687972.1 	
DNA gyrase subunit A [Streptococcus agalactiae 2603V/R] >ref|YP_329676.1| DNA gyrase subunit A [Streptococcus agalactiae A909] >ref|ZP_00780946.1| DNA gyrase, A subunit [Streptococcus agalactiae 18RS21] >ref|ZP_00787389.1| DNA gyrase, A subunit [Streptococcus agalactiae CJB111] >gb|AAM99844.1|AE014235_17 DNA gyrase, A subunit [Streptococcus agalactiae 2603V/R] >gb|ABA45619.1| DNA gyrase, A subunit [Streptococcus agalactiae A909] >gb|EAO62465.1| DNA gyrase, A subunit [Streptococcus agalactiae 18RS21] >gb|EAO73914.1| DNA gyrase, A subunit [Streptococcus agalactiae CJB111]
	154 	154 	83% 	2e-35	Gene info linked to NP_687972.1
YP_001155277.1 	
DNA gyrase subunit A [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1] >gb|ABP33713.1| DNA gyrase subunit A [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]
	154 	154 	59% 	2e-35	Gene info linked to YP_001155277.1
YP_003154864.1 	
DNA topoisomerase IV subunit A [Brachybacterium faecium DSM 4810] >gb|ACU85274.1| DNA topoisomerase IV subunit A [Brachybacterium faecium DSM 4810]
	154 	154 	82% 	2e-35	Gene info linked to YP_003154864.1
NP_646059.1 	
DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus MW2] >sp|Q8NWU8.1|PARC_STAAW RecName: Full=DNA topoisomerase 4 subunit A; AltName: Full=Topoisomerase IV subunit A >dbj|BAB95107.1| topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus MW2]
	154 	154 	81% 	2e-35	Gene info linked to NP_646059.1
ZP_07888237.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus sanguinis ATCC 49296] >gb|EFU62606.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus sanguinis ATCC 49296]
	154 	154 	83% 	2e-35	
YP_339939.1 	
DNA gyrase, subunit A, type II topoisomerase [Pseudoalteromonas haloplanktis TAC125] >emb|CAI86496.1| DNA gyrase, subunit A, type II topoisomerase [Pseudoalteromonas haloplanktis TAC125]
	154 	154 	85% 	2e-35	Gene info linked to YP_339939.1
EFV83517.1 	
DNA gyrase subunit A [Achromobacter xylosoxidans C54]
	154 	154 	80% 	2e-35	
ZP_07694295.1 	
DNA topoisomerase IV, A subunit [Streptococcus infantis SK1302] >gb|EFO53752.1| DNA topoisomerase IV, A subunit [Streptococcus infantis SK1302]
	154 	154 	81% 	2e-35	
YP_869609.1 	
DNA gyrase subunit A [Shewanella sp. ANA-3] >gb|ABK48203.1| DNA gyrase subunit A [Shewanella sp. ANA-3]
	154 	154 	83% 	2e-35	Gene info linked to YP_869609.1
YP_002746473.1 	
DNA gyrase subunit A [Streptococcus equi subsp. equi 4047] >emb|CAW93866.1| DNA gyrase subunit A [Streptococcus equi subsp. equi 4047]
	154 	154 	83% 	2e-35	Gene info linked to YP_002746473.1
ZP_03917945.1 	
DNA topoisomerase (ATP-hydrolyzing) [Corynebacterium glucuronolyticum ATCC 51867] >gb|EEI27759.1| DNA topoisomerase (ATP-hydrolyzing) [Corynebacterium glucuronolyticum ATCC 51867]
	154 	154 	88% 	2e-35	
YP_738104.1 	
DNA gyrase subunit A [Shewanella sp. MR-7] >gb|ABI43047.1| DNA gyrase subunit A [Shewanella sp. MR-7]
	154 	154 	83% 	2e-35	Gene info linked to YP_738104.1
ZP_04762535.1 	
DNA gyrase, A subunit [Acidovorax delafieldii 2AN] >gb|EER60655.1| DNA gyrase, A subunit [Acidovorax delafieldii 2AN]
	153 	153 	80% 	2e-35	
YP_002744470.1 	
DNA gyrase subunit A [Streptococcus equi subsp. zooepidemicus] >emb|CAW99217.1| DNA gyrase subunit A [Streptococcus equi subsp. zooepidemicus]
	153 	153 	83% 	2e-35	Gene info linked to YP_002744470.1
YP_004033909.1 	
DNA topoisomerase iv subunit a [Lactobacillus delbrueckii subsp. bulgaricus ND02] >gb|ADQ60932.1| DNA topoisomerase IV subunit A [Lactobacillus delbrueckii subsp. bulgaricus ND02]
	153 	153 	91% 	2e-35	Gene info linked to YP_004033909.1
EFS74835.1 	
DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL037PA2] >gb|EFS91684.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL044PA1] >gb|EFT15992.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL037PA3]
	153 	153 	82% 	2e-35	
YP_001728377.1 	
DNA topoisomerase IV, A subunit [Leuconostoc citreum KM20] >gb|ACA82933.1| DNA topoisomerase IV, A subunit [Leuconostoc citreum KM20]
	153 	153 	88% 	2e-35	Gene info linked to YP_001728377.1
ZP_03971390.1 	
DNA topoisomerase (ATP-hydrolyzing) [Corynebacterium glucuronolyticum ATCC 51866] >gb|EEI63864.1| DNA topoisomerase (ATP-hydrolyzing) [Corynebacterium glucuronolyticum ATCC 51866]
	153 	153 	88% 	2e-35	
ZP_05945654.1 	
DNA gyrase subunit A [Vibrio orientalis CIP 102891] >gb|EEX92461.1| DNA gyrase subunit A [Vibrio orientalis CIP 102891]
	153 	153 	82% 	2e-35	
ZP_00784104.1 	

DNA gyrase, A subunit, FRAMESHIFT [Streptococcus agalactiae H36B] >gb|EAO77157.1| DNA gyrase, A subunit, FRAMESHIFT [Streptococcus agalactiae H36B]
	153 	153 	83% 	3e-35	
CBX19908.1 	
gyrase A [Clostridium perfringens]
	153 	153 	56% 	3e-35	
ZP_04866153.1 	
DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus USA300_TCH959] >gb|EES93127.1| DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus USA300_TCH959]
	153 	153 	81% 	3e-35	
ZP_08065589.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus peroris ATCC 700780] >gb|EFX40426.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus peroris ATCC 700780]
	153 	153 	94% 	3e-35	
ABR28421.1 	
DNA gyrase A subunit [Delftia tsuruhatensis]
	153 	153 	82% 	3e-35	
BAB93453.1 	
DNA gyrase A [Actinobacillus actinomycetemcomitans]
	153 	153 	85% 	3e-35	
CBX19909.1 	
gyrase A [Clostridium perfringens]
	153 	153 	56% 	3e-35	
YP_001565733.1 	
DNA gyrase subunit A [Delftia acidovorans SPH-1] >gb|ABS12103.1| DNA gyrase A subunit [Delftia acidovorans] >gb|ABX37348.1| DNA gyrase, A subunit [Delftia acidovorans SPH-1]
	153 	153 	82% 	3e-35	Gene info linked to YP_001565733.1
YP_809029.1 	
DNA topoisomerase IV subunit A [Lactococcus lactis subsp. cremoris SK11] >gb|ABJ72607.1| DNA topoisomerase IV subunit A [Lactococcus lactis subsp. cremoris SK11]
	153 	153 	82% 	3e-35	Gene info linked to YP_809029.1
ZP_01215928.1 	
DNA gyrase, A subunit [Psychromonas sp. CNPT3] >gb|EAS39217.1| DNA gyrase, A subunit [Psychromonas sp. CNPT3]
	153 	153 	83% 	3e-35	
CBX19905.1 	
gyrase A [Clostridium perfringens]
	153 	153 	56% 	3e-35	
ZP_06144222.1 	
DNA gyrase subunit A [Ruminococcus flavefaciens FD-1]
	153 	153 	90% 	3e-35	
YP_618974.1 	
DNA topoisomerase IV subunit A [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >ref|YP_812916.1| DNA topoisomerase IV subunit A [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >emb|CAI97796.1| DNA topoisomerase IV, subunit A [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gb|ABJ58478.1| DNA topoisomerase IV subunit A [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
	153 	153 	91% 	3e-35	Gene info linked to YP_618974.1
YP_003306589.1 	
DNA gyrase, A subunit [Streptobacillus moniliformis DSM 12112] >gb|ACZ01712.1| DNA gyrase, A subunit [Streptobacillus moniliformis DSM 12112]
	153 	153 	85% 	3e-35	Gene info linked to YP_003306589.1
YP_002487698.1 	
DNA topoisomerase (ATP-hydrolyzing) [Arthrobacter chlorophenolicus A6] >gb|ACL39609.1| DNA topoisomerase (ATP-hydrolyzing) [Arthrobacter chlorophenolicus A6]
	153 	153 	90% 	3e-35	Gene info linked to YP_002487698.1
NP_761835.1 	
Type IIA topoisomerase, A subunit [Vibrio vulnificus CMCP6]
	153 	153 	82% 	3e-35	Gene info linked to NP_761835.1
NP_267140.1 	
DNA topoisomerase IV subunit A [Lactococcus lactis subsp. lactis Il1403] >ref|YP_003353465.1| topoisomerase IV subunit A [Lactococcus lactis subsp. lactis KF147] >gb|AAK05082.1|AE006332_11 topoisomerase IV subunit B [Lactococcus lactis subsp. lactis Il1403] >gb|ADA64716.1| Topoisomerase IV, subunit A [Lactococcus lactis subsp. lactis KF147]
	153 	153 	82% 	3e-35	Gene info linked to NP_267140.1
YP_001596456.1 	
DNA gyrase, A subunit [Coxiella burnetii RSA 331] >gb|ABX77581.1| DNA gyrase, A subunit [Coxiella burnetii RSA 331]
	153 	153 	87% 	3e-35	Gene info linked to YP_001596456.1
AAO11362.2 	
DNA gyrase, A subunit [Vibrio vulnificus]
	153 	153 	82% 	3e-35	
EFT52603.1 	
DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL078PA1]
	153 	153 	82% 	3e-35	
NP_934040.1 	
DNA gyrase, subunit A [Vibrio vulnificus YJ016] >dbj|BAC94011.1| DNA gyrase, subunit A [Vibrio vulnificus YJ016]
	153 	153 	82% 	3e-35	Gene info linked to NP_934040.1
YP_997868.1 	
DNA gyrase subunit A [Verminephrobacter eiseniae EF01-2] >gb|ABM58850.1| DNA gyrase subunit A [Verminephrobacter eiseniae EF01-2]
	153 	153 	58% 	3e-35	Gene info linked to YP_997868.1
YP_004189196.1 	
DNA gyrase subunit A [Vibrio vulnificus MO6-24/O] >gb|ADV86993.1| DNA gyrase subunit A [Vibrio vulnificus MO6-24/O]
	153 	153 	82% 	3e-35	Gene info linked to YP_004189196.1

YP_921244.1 	
DNA gyrase subunit A [Nocardioides sp. JS614] >gb|ABL79557.1| DNA gyrase subunit A [Nocardioides sp. JS614]
	153 	153 	83% 	3e-35	Gene info linked to YP_921244.1
YP_003381310.1 	
DNA topoisomerase [Kribbella flavida DSM 17836] >gb|ADB32511.1| DNA topoisomerase (ATP-hydrolyzing) [Kribbella flavida DSM 17836]
	153 	153 	83% 	3e-35	Gene info linked to YP_003381310.1
ZP_01946409.2 	
DNA gyrase, A subunit [Coxiella burnetii 'MSU Goat Q177'] >ref|ZP_02219941.1| DNA gyrase, A subunit [Coxiella burnetii RSA 334] >gb|EAX32985.2| DNA gyrase, A subunit [Coxiella burnetii 'MSU Goat Q177'] >gb|EDR35052.1| DNA gyrase, A subunit [Coxiella burnetii RSA 334]
	153 	153 	87% 	3e-35	
YP_002305638.1 	
DNA gyrase subunit A [Coxiella burnetii CbuK_Q154] >ref|NP_819556.2| DNA gyrase subunit A [Coxiella burnetii RSA 493] >gb|AAO90070.2| DNA gyrase subunit A [Coxiella burnetii RSA 493] >gb|ACJ20493.1| DNA gyrase subunit A [Coxiella burnetii CbuK_Q154]
	153 	153 	87% 	3e-35	Gene info linked to YP_002305638.1
AAM60779.1 	
topoisomerase IV subunit A [Corynebacterium urealyticum DSM 7109]
	153 	153 	81% 	3e-35	
YP_003622328.1 	
DNA topoisomerase IV subunit A [Leuconostoc kimchii IMSNU 11154] >gb|ADG41359.1| DNA topoisomerase IV subunit A [Leuconostoc kimchii IMSNU 11154]
	153 	153 	84% 	3e-35	Gene info linked to YP_003622328.1
YP_002303914.1 	
DNA gyrase subunit A [Coxiella burnetii CbuG_Q212] >gb|ACJ18769.1| DNA gyrase subunit A [Coxiella burnetii CbuG_Q212]
	153 	153 	87% 	3e-35	Gene info linked to YP_002303914.1
YP_055754.1 	
DNA topoisomerase IV subunit A [Propionibacterium acnes KPA171202] >ref|ZP_06427064.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes SK187] >ref|ZP_06428788.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes J165] >ref|YP_003581269.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes SK137] >gb|AAT82796.1| DNA gyrase subunit A [Propionibacterium acnes KPA171202] >gb|EFD02953.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes SK187] >gb|EFD07729.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes J165] >gb|ADD99761.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes SK137] >gb|EFS35805.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL013PA1] >gb|EFS38143.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL074PA1] >gb|EFS46019.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL087PA2] >gb|EFS47763.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL083PA1] >gb|EFS50644.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL025PA1] >gb|EFS53694.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL059PA1] >gb|EFS56288.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL046PA2] >gb|EFS58055.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL036PA1] >gb|EFS60567.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL036PA2] >gb|EFS62930.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL063PA1] >gb|EFS65218.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL063PA2] >gb|EFS68083.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL007PA1] >gb|EFS71456.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL056PA1] >gb|EFS76460.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL086PA1] >gb|EFS79265.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL005PA4] >gb|EFS82115.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL050PA1] >gb|EFS83927.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL050PA3] >gb|EFS89060.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL036PA3] >gb|EFS95449.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL067PA1] >gb|EFT00073.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL027PA1] >gb|EFT02288.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL002PA1] >gb|EFT04090.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL002PA2] >gb|EFT11945.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL037PA1] >gb|EFT17469.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL053PA1] >gb|EFT20147.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL045PA1] >gb|EFT22504.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL072PA2] >gb|EFT28019.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL005PA1] >gb|EFT56275.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL027PA2] >gb|EFT57618.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL002PA3] >gb|EFT60912.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL072PA1] >gb|EFT67894.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL038PA1] >gb|EFT70525.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL059PA2] >gb|EFT73070.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL046PA1] >gb|EFT77615.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL030PA1] >gb|EFT80289.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL030PA2]
	153 	153 	82% 	4e-35	Gene info linked to YP_055754.1
YP_662040.1 	
DNA gyrase, A subunit [Pseudoalteromonas atlantica T6c] >gb|ABG40986.1| DNA gyrase subunit A [Pseudoalteromonas atlantica T6c]
	153 	153 	85% 	4e-35	Gene info linked to YP_662040.1
CBX19911.1 	
gyrase A [Clostridium perfringens]
	153 	153 	55% 	4e-35	
ZP_08053947.1 	
DNA gyrase subunit A [Helicobacter suis HS1] >ref|ZP_08053953.1| DNA gyrase subunit A [Helicobacter suis HS5] >gb|EFX42521.1| DNA gyrase subunit A [Helicobacter suis HS5] >gb|EFX42567.1| DNA gyrase subunit A [Helicobacter suis HS1]
	153 	153 	82% 	4e-35	
ADL25539.1 	
DNA gyrase, A subunit [Fibrobacter succinogenes subsp. succinogenes S85]
	153 	153 	96% 	4e-35	
YP_016191.1 	
DNA gyrase subunit A [Mycoplasma mobile 163K] >gb|AAT27980.1| DNA gyrase subunit A [Mycoplasma mobile 163K]
	152 	152 	86% 	4e-35	Gene info linked to YP_016191.1
NP_240011.1 	
DNA gyrase subunit A [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >sp|P57277.1|GYRA_BUCAI RecName: Full=DNA gyrase subunit A >pir||A84951 DNA topoisomerase (ATP-hydrolyzing) (EC 5.99.1.3) chain A [imported] - Buchnera sp. (strain APS) >dbj|BAB12897.1| DNA gyrase subunit A [Buchnera aphidicola str. APS (Acyrthosiphon pisum)]
	152 	152 	85% 	4e-35	Gene info linked to NP_240011.1
P48369.1 	
RecName: Full=DNA gyrase subunit A >gb|AAB41037.1| DNA gyrase [Aeromonas salmonicida]
	152 	152 	83% 	4e-35	
YP_927606.1 	
DNA gyrase subunit A [Shewanella amazonensis SB2B] >gb|ABL99936.1| DNA gyrase subunit A [Shewanella amazonensis SB2B]
	152 	152 	82% 	4e-35	Gene info linked to YP_927606.1
NP_371879.1 	
DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus Mu50] >ref|YP_001441933.1| DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus Mu3] >ref|ZP_04840263.1| DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus str. CF-Marseille] >ref|ZP_05144744.2| DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus Mu50-omega] >ref|ZP_05681675.1| topoisomerase IV subunit A [Staphylococcus aureus A9763] >ref|ZP_05695618.1| DNA topoisomerase IV, subunit A [Staphylococcus aureus A6300] >ref|ZP_05697418.1| DNA topoisomerase IV, subunit A [Staphylococcus aureus A6224] >ref|ZP_05702659.1| topoisomerase IV subunit A [Staphylococcus aureus A5937] >ref|YP_003282247.1| DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus ED98] >ref|ZP_06336503.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus A10102] >sp|Q931S2.1|PARC_STAAM RecName: Full=DNA topoisomerase 4 subunit A; AltName: Full=Topoisomerase IV subunit A >dbj|BAB57517.1| topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus Mu50] >dbj|BAF78226.1| topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus Mu3] >gb|EEV64431.1| topoisomerase IV subunit A [Staphylococcus aureus A9763] >gb|EEV76624.1| DNA topoisomerase IV, subunit A [Staphylococcus aureus A6300] >gb|EEV80201.1| DNA topoisomerase IV, subunit A [Staphylococcus aureus A6224] >gb|EEV85842.1| topoisomerase IV subunit A [Staphylococcus aureus A5937] >gb|ACY11241.1| DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus ED98] >gb|EFB94513.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus A10102] >gb|ADC37520.1| Topoisomerase IV subunit A [Staphylococcus aureus 04-02981]
	152 	152 	81% 	4e-35	Gene info linked to NP_371879.1
ZP_07092846.1 	
DNA topoisomerase IV, A subunit [Lactobacillus delbrueckii subsp. bulgaricus PB2003/044-T3-4] >gb|EFK31675.1| DNA topoisomerase IV, A subunit [Lactobacillus delbrueckii subsp. bulgaricus PB2003/044-T3-4]
	152 	152 	91% 	4e-35	
NP_374468.1 	
DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus N315] >ref|ZP_05688807.1| topoisomerase IV subunit A [Staphylococcus aureus A9299] >ref|ZP_05693020.1| topoisomerase IV subunit A [Staphylococcus aureus A8115] >ref|ZP_06301081.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus A8117] >ref|ZP_06857981.1| DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus MR1] >sp|Q93KF4.1|PARC_STAAN RecName: Full=DNA topoisomerase 4 subunit A; AltName: Full=Topoisomerase IV subunit A >dbj|BAB42447.1| topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus N315] >gb|EEV73076.1| topoisomerase IV subunit A [Staphylococcus aureus A9299] >gb|EEV74137.1| topoisomerase IV subunit A [Staphylococcus aureus A8115] >gb|EFC04968.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus A8117]
	152 	152 	81% 	4e-35	Gene info linked to NP_374468.1
YP_003248457.1 	
DNA gyrase, A subunit [Fibrobacter succinogenes subsp. succinogenes S85] >sp|P35810.2|GYRA_FIBSS RecName: Full=DNA gyrase subunit A >gb|ACX73975.1| DNA gyrase, A subunit [Fibrobacter succinogenes subsp. succinogenes S85]
	152 	152 	96% 	4e-35	Gene info linked to YP_003248457.1
ZP_04577986.1 	
DNA gyrase subunit A [Oxalobacter formigenes HOxBLS] >gb|EEO28948.1| DNA gyrase subunit A [Oxalobacter formigenes HOxBLS]
	152 	152 	81% 	4e-35	
YP_003977762.1 	
DNA gyrase subunit A [Achromobacter xylosoxidans A8] >gb|ADP15047.1| DNA gyrase, A subunit [Achromobacter xylosoxidans A8]
	152 	152 	80% 	4e-35	Gene info linked to YP_003977762.1
ZP_06263343.1 	
DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes J139] >gb|EFB88839.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes J139] >gb|EFT10849.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL082PA2] >gb|EFT25177.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL110PA3] >gb|EFT63885.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL110PA4] >gb|EFT65310.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL060PA1] >gb|EFT75386.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL050PA2]
	152 	152 	82% 	4e-35	
EFS87234.1 	
DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL001PA1]
	152 	152 	82% 	4e-35	
NP_660529.1 	
DNA gyrase subunit A [Buchnera aphidicola str. Sg (Schizaphis graminum)] >sp|Q8K9W2.1|GYRA_BUCAP RecName: Full=DNA gyrase subunit A >gb|AAM67740.1| DNA gyrase subunit A [Buchnera aphidicola str. Sg (Schizaphis graminum)]
	152 	152 	85% 	4e-35	Gene info linked to NP_660529.1
EFS40229.1 	
DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL110PA1] >gb|EFS43154.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL110PA2] >gb|EFT06887.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL082PA1] >gb|EFT50053.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL053PA2]
	152 	152 	82% 	4e-35	
CBX34593.1 	
DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus ECT-R 2]
	152 	152 	81% 	4e-35	
ZP_06908995.1 	
DNA topoisomerase IV subunit A [Streptomyces pristinaespiralis ATCC 25486] >gb|EDY63244.1| DNA topoisomerase IV subunit A [Streptomyces pristinaespiralis ATCC 25486]
	152 	152 	84% 	4e-35	
YP_004072812.1 	
DNA gyrase, A subunit [Helicobacter felis ATCC 49179] >emb|CBY82222.1| DNA gyrase, A subunit [Helicobacter felis ATCC 49179]
	152 	152 	85% 	5e-35	Gene info linked to YP_004072812.1
YP_002311810.1 	
DNA gyrase subunit A [Shewanella piezotolerans WP3] >gb|ACJ29223.1| DNA gyrase, subunit A [Shewanella piezotolerans WP3]
	152 	152 	83% 	5e-35	Gene info linked to YP_002311810.1
YP_001789996.1 	
DNA gyrase subunit A [Leptothrix cholodnii SP-6] >gb|ACB33231.1| DNA gyrase, A subunit [Leptothrix cholodnii SP-6]
	152 	152 	80% 	5e-35	Gene info linked to YP_001789996.1
YP_001246787.1 	
DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus JH9] >ref|YP_001316581.1| DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus JH1] >ref|ZP_05644568.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus A9781] >ref|ZP_05683437.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus A9719] >ref|ZP_06816106.1| DNA topoisomerase IV [Staphylococcus aureus A8819] >ref|ZP_06928411.1| DNA topoisomerase IV [Staphylococcus aureus A8796] >gb|ABQ49211.1| DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus JH9] >gb|ABR52294.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus JH1] >gb|EEV27901.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus A9781] >gb|EEV67850.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus A9719] >gb|EFG44909.1| DNA topoisomerase IV [Staphylococcus aureus A8819] >gb|EFH37804.1| DNA topoisomerase IV [Staphylococcus aureus A8796] >gb|EFT87142.1| DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus CGS03]
	152 	152 	81% 	5e-35	Gene info linked to YP_001246787.1
P0C1U9.1 	
RecName: Full=DNA topoisomerase 4 subunit A; AltName: Full=Topoisomerase IV subunit A >dbj|BAA11085.1| DNA topoisomerase IV GrlA subunit [Staphylococcus aureus]
	152 	152 	81% 	5e-35	PubChem BioAssay Info linked to P0C1U9.1
YP_831121.1 	
DNA topoisomerase IV subunit A [Arthrobacter sp. FB24] >gb|ABK03021.1| DNA topoisomerase IV subunit A [Arthrobacter sp. FB24]
	152 	152 	83% 	5e-35	Gene info linked to YP_831121.1
ZP_07889269.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Aggregatibacter segnis ATCC 33393] >gb|EFU67973.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Aggregatibacter segnis ATCC 33393]
	152 	152 	85% 	5e-35	
YP_003328752.1 	
DNA gyrase subunit A [Anaplasma centrale str. Israel] >gb|ACZ49438.1| DNA gyrase subunit A [Anaplasma centrale str. Israel]
	152 	152 	96% 	5e-35	Gene info linked to YP_003328752.1
NP_111061.1 	
DNA gyrase subunit A [Thermoplasma volcanium GSS1] >dbj|BAB59684.1| DNA gyrase subunit a [Thermoplasma volcanium GSS1]
	152 	152 	81% 	5e-35	Gene info linked to NP_111061.1
YP_878398.1 	
DNA topoisomerase IV subunit A [Clostridium novyi NT] >gb|ABK60446.1| DNA gyrase, A subunit [Clostridium novyi NT]
	152 	152 	96% 	5e-35	Gene info linked to YP_878398.1
YP_001021429.1 	
DNA gyrase subunit A [Methylibium petroleiphilum PM1] >gb|ABM95194.1| DNA gyrase subunit A [Methylibium petroleiphilum PM1]
	152 	152 	80% 	5e-35	Gene info linked to YP_001021429.1
ZP_06668841.1 	
DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus M809] >gb|EFF09595.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus M809]
	152 	152 	81% 	6e-35	
ZP_06024372.1 	
DNA topoisomerase IV subunit A [Staphylococcus aureus 930918-3] >gb|EEW44946.1| DNA topoisomerase IV subunit A [Staphylococcus aureus 930918-3]
	152 	152 	81% 	6e-35	
ADW02963.1 	
DNA topoisomerase (ATP-hydrolyzing) [Streptomyces flavogriseus ATCC 33331]
	152 	152 	84% 	6e-35	
YP_562954.1 	
DNA gyrase, A subunit [Shewanella denitrificans OS217] >gb|ABE55231.1| DNA gyrase subunit A [Shewanella denitrificans OS217]
	152 	152 	83% 	6e-35	Gene info linked to YP_562954.1
YP_785869.1 	
DNA gyrase subunit A [Bordetella avium 197N] >emb|CAJ48956.1| DNA gyrase subunit A [Bordetella avium 197N]
	152 	152 	80% 	6e-35	Gene info linked to YP_785869.1
ZP_05607094.1 	
topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus 68-397] >gb|EEV09459.1| topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus 68-397]
	152 	152 	81% 	6e-35	
YP_186243.1 	
DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus COL] >ref|YP_499880.1| DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus NCTC 8325] >ref|YP_001332302.1| DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus str. Newman] >ref|YP_001575179.1| DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus USA300_TCH1516] >ref|ZP_04867563.1| DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus TCH130] >ref|ZP_05699777.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus A5948] >ref|ZP_06022691.1| DNA topoisomerase IV subunit A [Staphylococcus aureus D30] >ref|ZP_07129518.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Staphylococcus aureus subsp. aureus TCH70] >sp|Q5HG64.1|PARC_STAAC RecName: Full=DNA topoisomerase 4 subunit A; AltName: Full=Topoisomerase IV subunit A >sp|Q2FYS4.1|PARC_STAA8 RecName: Full=DNA topoisomerase 4 subunit A; AltName: Full=Topoisomerase IV subunit A >dbj|BAA11087.1| DNA topoisomerase IV GrlA subunit [Staphylococcus aureus] >gb|AAW36639.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus COL] >gb|ABD30448.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus NCTC 8325] >dbj|BAF67540.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus str. Newman] >gb|ABX29300.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gb|EES97395.1| DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus TCH130] >gb|EEV83408.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus A5948] >gb|EEW46631.1| DNA topoisomerase IV subunit A [Staphylococcus aureus D30] >gb|EFK81523.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Staphylococcus aureus subsp. aureus TCH70] >gb|EFU26739.1| DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus CGS01] >gb|EFW32171.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus MRSA131] >gb|EFW35686.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus MRSA177]
	152 	152 	81% 	6e-35	Gene info linked to YP_186243.1
ZP_05687668.1 	
DNA topoisomerase IV, A subunit [Staphylococcus aureus A9635] >gb|EEV68998.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus A9635]
	152 	152 	81% 	6e-35	
ZP_06328344.1 	
DNA topoisomerase IV, A subunit [Staphylococcus aureus A9765] >gb|EFB99272.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus A9765]
	152 	152 	81% 	6e-35	
YP_493948.1 	
DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus USA300_FPR3757] >ref|ZP_06789106.1| DNA topoisomerase IV [Staphylococcus aureus A9754] >gb|ABD20523.1| DNA topoisomerase IV, subunit A [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gb|EFG41581.1| DNA topoisomerase IV [Staphylococcus aureus A9754]
	152 	152 	81% 	6e-35	Gene info linked to YP_493948.1
ZP_05601846.1 	
topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus 55/2053] >ref|ZP_05604479.1| topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus 65-1322] >ref|ZP_05609830.1| topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus E1410] >ref|ZP_05612360.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus M876] >ref|ZP_06311823.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus C160] >ref|ZP_06313555.1| DNA topoisomerase IV A subunit [Staphylococcus aureus subsp. aureus Btn1260] >ref|ZP_06316489.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus WW2703/97] >ref|ZP_06318740.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus WBG10049] >ref|ZP_06321931.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus M899] >ref|ZP_06331923.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus C101] >ref|ZP_06375570.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus A017934/97] >ref|ZP_06671409.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus M1015] >ref|ZP_06949808.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Staphylococcus aureus subsp. aureus MN8] >gb|EEV04016.1| topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus 55/2053] >gb|EEV06409.1| topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus 65-1322] >gb|EEV11702.1| topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus E1410] >gb|EEV14715.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus M876] >gb|EFB44029.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus C101] >gb|EFB52536.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus M899] >gb|EFB55851.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus WBG10049] >gb|EFB57778.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus WW2703/97] >gb|EFB60506.1| DNA topoisomerase IV A subunit [Staphylococcus aureus subsp. aureus Btn1260] >gb|EFC00517.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus C160] >gb|EFC29085.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus A017934/97] >gb|EFD97859.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus M1015] >gb|EFH94772.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Staphylococcus aureus subsp. aureus MN8] >gb|EFU24665.1| DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus CGS00]
	152 	152 	81% 	6e-35	
EGA98846.1 	
DNA topoisomerase IV subunit A [Staphylococcus aureus O11] >gb|EGB01618.1| DNA topoisomerase IV subunit A [Staphylococcus aureus O46]
	152 	152 	81% 	6e-35	
ZP_06667023.1 	
DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus 58-424] >gb|EFE26438.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus 58-424]
	152 	152 	81% 	6e-35	
YP_040772.1 	
DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus MRSA252] >ref|ZP_06820501.1| DNA topoisomerase IV [Staphylococcus aureus subsp. aureus EMRSA16] >sp|Q6GH50.1|PARC_STAAR RecName: Full=DNA topoisomerase 4 subunit A; AltName: Full=Topoisomerase IV subunit A >emb|CAG40365.1| topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus MRSA252] >gb|EFG57861.1| DNA topoisomerase IV [Staphylococcus aureus subsp. aureus EMRSA16]
	152 	152 	81% 	6e-35	Gene info linked to YP_040772.1
CAQ49781.1 	
DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus ST398]
	152 	152 	81% 	6e-35	
YP_001032821.1 	
DNA topoisomerase IV subunit A [Lactococcus lactis subsp. cremoris MG1363] >emb|CAL98110.1| topoisomerase IV subunit A [Lactococcus lactis subsp. cremoris MG1363] >gb|ADJ60522.1| DNA topoisomerase IV subunit A [Lactococcus lactis subsp. cremoris NZ9000]
	152 	152 	82% 	6e-35	Gene info linked to YP_001032821.1
ZP_05851562.1 	
DNA topoisomerase IV, A subunit [Granulicatella elegans ATCC 700633] >gb|EEW93508.1| DNA topoisomerase IV, A subunit [Granulicatella elegans ATCC 700633]
	152 	152 	84% 	6e-35	
ZP_08061643.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus infantis ATCC 700779] >gb|EFX36557.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus infantis ATCC 700779]
	152 	152 	81% 	6e-35	
CBI49235.1 	
topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus TW20]
	152 	152 	81% 	6e-35	
ADQ77316.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Staphylococcus aureus subsp. aureus TCH60]
	152 	152 	81% 	6e-35	
ADI97877.1 	
Topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus ED133]
	152 	152 	81% 	7e-35	
ZP_06378754.1 	
DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus 132]
	152 	152 	81% 	7e-35	
AAF85903.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	152 	152 	84% 	7e-35	
2INR_A 	
Chain A, Crystal Structure Of A 59 Kda Fragment Of Topoisomerase Iv Subunit A (Grla) From Staphylococcus Aureus
	152 	152 	81% 	7e-35	Structure related to 2INR_A
YP_630704.1 	
type II DNA topoisomerase subunit A [Myxococcus xanthus DK 1622] >gb|ABF92662.1| type II DNA topoisomerase, A subunit [Myxococcus xanthus DK 1622]
	152 	152 	82% 	7e-35	Gene info linked to YP_630704.1
YP_001798049.1 	
DNA gyrase, A subunit [Polynucleobacter necessarius subsp. necessarius STIR1] >gb|ACB44435.1| DNA gyrase, A subunit [Polynucleobacter necessarius subsp. necessarius STIR1]
	152 	152 	80% 	7e-35	Gene info linked to YP_001798049.1
ZP_01976269.1 	
DNA gyrase, subunit A [Vibrio cholerae B33] >gb|EAZ76104.1| DNA gyrase, subunit A [Vibrio cholerae B33]
	152 	152 	58% 	7e-35	
ZP_07363722.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Staphylococcus aureus subsp. aureus ATCC BAA-39] >gb|EFM06317.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Staphylococcus aureus subsp. aureus ATCC BAA-39]
	152 	152 	81% 	7e-35	
ZP_06924422.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Staphylococcus aureus subsp. aureus ATCC 51811] >gb|EFH26136.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Staphylococcus aureus subsp. aureus ATCC 51811]
	152 	152 	81% 	7e-35	
ZP_06324374.1 	
DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus D139] >ref|ZP_06343314.1| DNA topoisomerase 4 subunit A [Staphylococcus aureus subsp. aureus H19] >gb|EFB49455.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus D139] >gb|EFC07659.1| DNA topoisomerase 4 subunit A [Staphylococcus aureus subsp. aureus H19] >gb|ADL23164.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Staphylococcus aureus subsp. aureus JKD6159]
	152 	152 	81% 	7e-35	
YP_001554832.1 	
DNA gyrase subunit A [Shewanella baltica OS195] >gb|ABX49572.1| DNA gyrase, A subunit [Shewanella baltica OS195] >gb|ADT94556.1| DNA gyrase, A subunit [Shewanella baltica OS678]
	152 	152 	83% 	7e-35	Gene info linked to YP_001554832.1
YP_043419.1 	
DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus MSSA476] >sp|Q6G9K4.1|PARC_STAAS RecName: Full=DNA topoisomerase 4 subunit A; AltName: Full=Topoisomerase IV subunit A >emb|CAG43072.1| topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus MSSA476]
	152 	152 	81% 	7e-35	Gene info linked to YP_043419.1
ZP_06686577.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Achromobacter piechaudii ATCC 43553] >gb|EFF76467.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Achromobacter piechaudii ATCC 43553]
	152 	152 	80% 	7e-35	
ZP_06326801.1 	
DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus C427] >gb|EFB47250.1| DNA topoisomerase IV, A subunit [Staphylococcus aureus subsp. aureus C427]
	152 	152 	81% 	7e-35	
YP_003006872.1 	
DNA gyrase, A subunit [Aggregatibacter aphrophilus NJ8700] >gb|ACS96785.1| DNA gyrase, A subunit [Aggregatibacter aphrophilus NJ8700]
	152 	152 	85% 	7e-35	Gene info linked to YP_003006872.1
YP_001651334.1 	
DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gb|ABY68890.1| DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
	152 	152 	85% 	7e-35	Gene info linked to YP_001651334.1
ZP_07823001.1 	
DNA gyrase, A subunit [Streptococcus pseudoporcinus SPIN 20026] >gb|EFR45276.1| DNA gyrase, A subunit [Streptococcus pseudoporcinus SPIN 20026]
	152 	152 	96% 	7e-35	
YP_002943537.1 	
DNA gyrase, A subunit [Variovorax paradoxus S110] >gb|ACS18271.1| DNA gyrase, A subunit [Variovorax paradoxus S110]
	152 	152 	80% 	7e-35	Gene info linked to YP_002943537.1
ABA29617.1 	
DNA gyrase subunit A [Streptococcus pneumoniae]
	152 	152 	67% 	7e-35	
AAA53116.1 	
gyrase-like protein alpha subunit [Staphylococcus aureus]
	152 	152 	81% 	8e-35	
NP_300333.1 	
DNA gyrase subunit A [Chlamydophila pneumoniae J138] >ref|NP_445032.1| DNA gyrase subunit A [Chlamydophila pneumoniae AR39] >ref|NP_876557.1| DNA gyrase subunit A [Chlamydophila pneumoniae TW-183] >sp|Q9Z8R4.2|GYRA_CHLPN RecName: Full=DNA gyrase subunit A >gb|AAF38315.1| DNA gyrase, subunit A [Chlamydophila pneumoniae AR39] >dbj|BAA98484.1| DNA gyrase subunit A [Chlamydophila pneumoniae J138] >dbj|BAC57415.1| DNA Gyrase Subunit A [Chlamydophila pneumoniae] >gb|AAP98214.1| DNA topoisomerase IV subunit A [Chlamydophila pneumoniae TW-183]
	152 	152 	82% 	8e-35	Gene info linked to NP_300333.1
ZP_01459257.1 	
DNA gyrase/topoisomerase IV, A subunit [Stigmatella aurantiaca DW4/3-1] >gb|EAU69833.1| DNA gyrase/topoisomerase IV, A subunit [Stigmatella aurantiaca DW4/3-1]

	152 	152 	60% 	8e-35	
ACZ33249.1 	
DNA gyrase, A subunit [Chlamydophila pneumoniae LPCoLN]
	152 	152 	82% 	8e-35	
NP_224479.1 	
DNA gyrase subunit A [Chlamydophila pneumoniae CWL029] >gb|AAD18423.1| DNA Gyrase Subunit A [Chlamydophila pneumoniae CWL029]
	152 	152 	82% 	8e-35	Gene info linked to NP_224479.1
ZP_07360964.1 	
DNA topoisomerase IV subunit A [Actinomyces viscosus C505]
	152 	152 	82% 	8e-35	
AAZ93305.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae] >gb|AAZ93330.1| topoisomerase IV subunit A [Streptococcus pneumoniae]
	152 	152 	84% 	8e-35	
YP_001306425.1 	
DNA gyrase, A subunit [Thermosipho melanesiensis BI429] >gb|ABR31040.1| DNA gyrase, A subunit [Thermosipho melanesiensis BI429]
	152 	152 	96% 	8e-35	Gene info linked to YP_001306425.1
ZP_01131560.1 	
DNA gyrase subunit A [marine actinobacterium PHSC20C1] >gb|EAR23746.1| DNA gyrase subunit A [marine actinobacterium PHSC20C1]
	152 	152 	82% 	8e-35	
YP_001424883.2 	
DNA gyrase subunit A [Coxiella burnetii Dugway 5J108-111] >gb|ABS77442.2| DNA gyrase subunit A [Coxiella burnetii Dugway 5J108-111]
	151 	151 	87% 	9e-35	Gene info linked to YP_001424883.2
CAA65021.1 	
DNA topoisomerase IV C subunit [Streptococcus pneumoniae]
	151 	151 	84% 	9e-35	
ZP_02479129.1 	
DNA gyrase subunit A [Haemophilus parasuis 29755] >gb|EDS23755.1| DNA gyrase subunit A [Haemophilus parasuis 29755]
	151 	151 	85% 	9e-35	
YP_963331.1 	
DNA gyrase, A subunit [Shewanella sp. W3-18-1] >ref|YP_001183590.1| DNA gyrase, A subunit [Shewanella putrefaciens CN-32] >gb|ABM24777.1| DNA gyrase subunit A [Shewanella sp. W3-18-1] >gb|ABP75791.1| DNA gyrase subunit A [Shewanella putrefaciens CN-32] >gb|ADV54396.1| DNA gyrase, A subunit [Shewanella putrefaciens 200]
	151 	151 	83% 	1e-34	Gene info linked to YP_963331.1
ZP_00133972.2 	
COG0188: Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >ref|YP_001052999.1| DNA gyrase subunit A [Actinobacillus pleuropneumoniae L20] >gb|ABN73394.1| DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 5b str. L20]
	151 	151 	85% 	1e-34	
ZP_07538097.1 	
DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 10 str. D13039] >gb|EFM97040.1| DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 10 str. D13039]
	151 	151 	85% 	1e-34	
ZP_07338687.1 	
DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 2 str. 4226] >ref|ZP_07527194.1| DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >ref|ZP_07529322.1| DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 2 str. S1536] >ref|ZP_07535903.1| DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] >ref|ZP_07540249.1| DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 11 str. 56153] >gb|EFL78685.1| DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 2 str. 4226] >gb|EFM86202.1| DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gb|EFM88400.1| DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 2 str. S1536] >gb|EFM94928.1| DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] >gb|EFM99267.1| DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
	151 	151 	85% 	1e-34	
YP_002467939.1 	
DNA gyrase subunit A [Buchnera aphidicola str. 5A (Acyrthosiphon pisum)] >ref|ZP_05635236.1| DNA gyrase subunit A [Buchnera aphidicola str. LSR1 (Acyrthosiphon pisum)] >gb|ACL30552.1| DNA gyrase subunit A [Buchnera aphidicola str. 5A (Acyrthosiphon pisum)]
	151 	151 	85% 	1e-34	Gene info linked to YP_002467939.1
YP_517778.1 	
hypothetical protein DSY1545 [Desulfitobacterium hafniense Y51] >dbj|BAE83334.1| hypothetical protein [Desulfitobacterium hafniense Y51]
	151 	151 	84% 	1e-34	Gene info linked to YP_517778.1
ZP_06818925.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Lactobacillus amylolyticus DSM 11664] >gb|EFG54952.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Lactobacillus amylolyticus DSM 11664]
	151 	151 	88% 	1e-34	
ADP66004.1 	
DNA gyrase subunit A [Buchnera aphidicola str. LL01 (Acyrthosiphon pisum)] >gb|ADP66574.1| DNA gyrase subunit A [Buchnera aphidicola str. TLW03 (Acyrthosiphon pisum)]
	151 	151 	85% 	1e-34	
YP_002468494.1 	
DNA gyrase subunit A [Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum)] >gb|ACL29999.1| DNA gyrase subunit A [Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum)]
	151 	151 	85% 	1e-34	Gene info linked to YP_002468494.1
ADP67156.1 	
DNA gyrase subunit A [Buchnera aphidicola str. JF99 (Acyrthosiphon pisum)]
	151 	151 	85% 	1e-34	
ZP_05981721.1 	
DNA gyrase, A subunit [Subdoligranulum variabile DSM 15176] >gb|EFB74642.1| DNA gyrase, A subunit [Subdoligranulum variabile DSM 15176]
	151 	151 	82% 	1e-34	
AAF85901.1 	
topoisomerase IV subunit A [Streptococcus pneumoniae]
	151 	151 	84% 	1e-34	
ZP_07818067.1 	
DNA gyrase, A subunit [Eremococcus coleocola ACS-139-V-Col8] >gb|EFR31883.1| DNA gyrase, A subunit [Eremococcus coleocola ACS-139-V-Col8]
	151 	151 	94% 	1e-34	
NP_718001.1 	
DNA gyrase, A subunit [Shewanella oneidensis MR-1] >gb|AAN55445.1|AE015681_9 DNA gyrase, A subunit [Shewanella oneidensis MR-1]
	151 	151 	83% 	1e-34	Gene info linked to NP_718001.1
YP_155749.1 	
DNA gyrase subunit A [Idiomarina loihiensis L2TR] >gb|AAV82200.1| DNA gyrase subunit A [Idiomarina loihiensis L2TR]
	151 	151 	85% 	1e-34	Gene info linked to YP_155749.1
YP_002459139.1 	
DNA gyrase, A subunit [Desulfitobacterium hafniense DCB-2] >gb|ACL20703.1| DNA gyrase, A subunit [Desulfitobacterium hafniense DCB-2]
	151 	151 	84% 	1e-34	Gene info linked to YP_002459139.1
ZP_05649346.1 	
topoisomerase IV A subunit [Enterococcus gallinarum EG2] >gb|EEV32679.1| topoisomerase IV A subunit [Enterococcus gallinarum EG2]
	151 	151 	82% 	1e-34	
YP_416689.1 	
DNA topoisomerase IV subunit A [Staphylococcus aureus RF122] >emb|CAI80901.1| topoisomerase IV subunit A [Staphylococcus aureus RF122]
	151 	151 	81% 	1e-34	Gene info linked to YP_416689.1
ZP_06634400.1 	
DNA gyrase A [Aggregatibacter actinomycetemcomitans D7S-1] >gb|EFE00719.1| DNA gyrase A [Aggregatibacter actinomycetemcomitans D7S-1]
	151 	151 	85% 	1e-34	
YP_290187.1 	
DNA topoisomerase IV subunit A [Thermobifida fusca YX] >gb|AAZ56164.1| DNA topoisomerase IV subunit A [Thermobifida fusca YX]
	151 	151 	82% 	1e-34	Gene info linked to YP_290187.1
ZP_04753355.1 	
DNA gyrase subunit A [Actinobacillus minor NM305] >gb|EER47206.1| DNA gyrase subunit A [Actinobacillus minor NM305]
	151 	151 	85% 	1e-34	
CBA28847.1 	
DNA gyrase subunit A [Curvibacter putative symbiont of Hydra magnipapillata]
	151 	151 	80% 	1e-34	
YP_003146080.1 	
DNA gyrase subunit A [Kangiella koreensis DSM 16069] >gb|ACV26312.1| DNA gyrase, A subunit [Kangiella koreensis DSM 16069]
	151 	151 	83% 	1e-34	Gene info linked to YP_003146080.1
YP_004154103.1 	
DNA gyrase, a subunit [Variovorax paradoxus EPS] >gb|ADU35992.1| DNA gyrase, A subunit [Variovorax paradoxus EPS]
	151 	151 	80% 	1e-34	Gene info linked to YP_004154103.1
YP_002474656.1 	
DNA gyrase subunit A [Haemophilus parasuis SH0165] >gb|ACL31708.1| DNA gyrase subunit A [Haemophilus parasuis SH0165]
	151 	151 	85% 	1e-34	Gene info linked to YP_002474656.1
YP_003843856.1 	
DNA topoisomerase (ATP-hydrolyzing) [Clostridium cellulovorans 743B] >ref|ZP_07631350.1| DNA topoisomerase IV subunit A [Clostridium cellulovorans 743B] >gb|ADL52092.1| DNA topoisomerase (ATP-hydrolyzing) [Clostridium cellulovorans 743B]
	151 	151 	88% 	1e-34	Gene info linked to YP_003843856.1
YP_003112534.1 	
DNA topoisomerase (ATP-hydrolyzing) [Catenulispora acidiphila DSM 44928] >gb|ACU70693.1| DNA topoisomerase (ATP-hydrolyzing) [Catenulispora acidiphila DSM 44928]
	151 	151 	83% 	1e-34	Gene info linked to YP_003112534.1
YP_003471762.1 	
Topoisomerase IV subunit A [Staphylococcus lugdunensis HKU09-01] >gb|ADC87635.1| Topoisomerase IV subunit A [Staphylococcus lugdunensis HKU09-01]
	151 	151 	88% 	1e-34	Gene info linked to YP_003471762.1
YP_003082119.1 	
DNA gyrase, A subunit [Neorickettsia risticii str. Illinois] >gb|ACT69880.1| DNA gyrase, A subunit [Neorickettsia risticii str. Illinois]
	151 	151 	84% 	1e-34	Gene info linked to YP_003082119.1
ZP_03566345.1 	
DNA topoisomerase IV subunit A [Staphylococcus aureus subsp. aureus str. JKD6009] >gb|ADL65363.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Staphylococcus aureus subsp. aureus str. JKD6008]
	151 	151 	81% 	1e-34	
ZP_07864817.1 	
DNA topoisomerase IV, A subunit [Streptococcus anginosus F0211] >gb|EFU21624.1| DNA topoisomerase IV, A subunit [Streptococcus anginosus F0211]
	151 	151 	84% 	1e-34	
YP_003488101.1 	
GyrA-like gyrase subunit [Streptomyces scabiei 87.22] >emb|CBG69542.1| GyrA-like gyrase subunit [Streptomyces scabiei 87.22]
	151 	151 	83% 	1e-34	Gene info linked to YP_003488101.1
NP_764592.1 	
DNA topoisomerase IV subunit A [Staphylococcus epidermidis ATCC 12228] >sp|Q8CSN8.1|PARC_STAES RecName: Full=DNA topoisomerase 4 subunit A; AltName: Full=Topoisomerase IV subunit A >gb|AAO04634.1|AE016747_131 topoisomerase IV subunit A [Staphylococcus epidermidis ATCC 12228]
	151 	151 	88% 	1e-34	Gene info linked to NP_764592.1
ZP_01627125.1 	
DNA gyrase subunit A [marine gamma proteobacterium HTCC2080] >gb|EAW40130.1| DNA gyrase subunit A [marine gamma proteobacterium HTCC2080]
	151 	151 	85% 	1e-34	
YP_001968083.1 	
DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >ref|ZP_07544502.1| DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 13 str. N273] >gb|ACE60941.1| DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gb|EFN03503.1| DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 13 str. N273]
	150 	150 	85% 	2e-34	Gene info linked to YP_001968083.1
ZP_07941461.1 	
topoisomerase IV [Bifidobacterium sp. 12_1_47BFAA] >gb|EFV37509.1| topoisomerase IV [Bifidobacterium sp. 12_1_47BFAA]
	150 	150 	82% 	2e-34	
ZP_07542436.1 	
DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 12 str. 1096] >gb|EFN01374.1| DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
	150 	150 	85% 	2e-34	
ZP_04600617.1 	
hypothetical protein GCWU000324_00066 [Kingella oralis ATCC 51147] >gb|EEP69589.1| hypothetical protein GCWU000324_00066 [Kingella oralis ATCC 51147]
	150 	150 	90% 	2e-34	
ZP_03487793.1 	
hypothetical protein EUBIFOR_00358 [Eubacterium biforme DSM 3989] >gb|EEC91028.1| hypothetical protein EUBIFOR_00358 [Eubacterium biforme DSM 3989]
	150 	150 	87% 	2e-34	
ZP_07531489.1 	
DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 4 str. M62] >gb|EFM90562.1| DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 4 str. M62]
	150 	150 	85% 	2e-34	
YP_003602956.1 	
DNA gyrase, A subunit [Candidatus Riesia pediculicola USDA] >gb|ADD79918.1| DNA gyrase, A subunit [Candidatus Riesia pediculicola USDA]
	150 	150 	82% 	2e-34	Gene info linked to YP_003602956.1
YP_004209126.1 	
DNA topoisomerase IV subunit A [Bifidobacterium longum subsp. infantis 157F] >dbj|BAJ71348.1| DNA topoisomerase IV subunit A [Bifidobacterium longum subsp. infantis 157F]
	150 	150 	82% 	2e-34	Gene info linked to YP_004209126.1
EFT32203.1 	
DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL005PA2] >gb|EFT34008.1| DNA gyrase/topoisomerase IV, A subunit [Propionibacterium acnes HL005PA3]
	150 	150 	82% 	2e-34	
NP_696595.1 	
DNA topoisomerase IV subunit A [Bifidobacterium longum NCC2705] >gb|AAN25231.1| DNA gyrase subunit A [Bifidobacterium longum NCC2705]
	150 	150 	82% 	2e-34	Gene info linked to NP_696595.1
YP_001954247.1 	
DNA topoisomerase IV subunit A [Bifidobacterium longum DJO10A] >ref|ZP_04664314.1| DNA topoisomerase IV subunit A [Bifidobacterium longum subsp. infantis CCUG 52486] >ref|YP_003999937.1| para [Bifidobacterium longum subsp. longum BBMN68] >ref|YP_004220928.1| DNA topoisomerase IV subunit A [Bifidobacterium longum subsp. longum JCM 1217] >gb|ACD97749.1| DNA topoisomerase plasmid partition protein A [Bifidobacterium longum DJO10A] >gb|EEQ55611.1| DNA topoisomerase IV subunit A [Bifidobacterium longum subsp. infantis CCUG 52486] >gb|ADQ03031.1| ParA [Bifidobacterium longum subsp. longum BBMN68] >dbj|BAJ66836.1| DNA topoisomerase IV subunit A [Bifidobacterium longum subsp. longum JCM 1217]
	150 	150 	82% 	2e-34	Gene info linked to YP_001954247.1
YP_818829.1 	
DNA topoisomerase IV subunit A [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gb|ABJ62456.1| DNA topoisomerase IV subunit A [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293]
	150 	150 	84% 	2e-34	Gene info linked to YP_818829.1
ZP_07335762.1 	
DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 6 str. Femo] >ref|ZP_07533720.1| DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 6 str. Femo] >gb|EFL81778.1| DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 6 str. Femo] >gb|EFM92736.1| DNA gyrase subunit A [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
	150 	150 	85% 	2e-34	
YP_003681215.1 	
DNA topoisomerase (ATP-hydrolyzing) [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111] >gb|ADH68709.1| DNA topoisomerase (ATP-hydrolyzing) [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
	150 	150 	82% 	2e-34	Gene info linked to YP_003681215.1
ZP_04433265.1 	
DNA topoisomerase IV, A subunit [Bacillus coagulans 36D1] >gb|EEN91021.1| DNA topoisomerase IV, A subunit [Bacillus coagulans 36D1]
	150 	150 	88% 	2e-34	
YP_002949674.1 	
DNA topoisomerase IV, A subunit [Geobacillus sp. WCH70] >gb|ACS24408.1| DNA topoisomerase IV, A subunit [Geobacillus sp. WCH70]
	150 	150 	82% 	2e-34	Gene info linked to YP_002949674.1
ZP_05629717.1 	
DNA gyrase subunit A [Actinobacillus minor 202] >gb|EEV25049.1| DNA gyrase subunit A [Actinobacillus minor 202]
	150 	150 	85% 	2e-34	
ZP_01614517.1 	
DNA gyrase, subunit A, type II topoisomerase [Alteromonadales bacterium TW-7] >gb|EAW26219.1| DNA gyrase, subunit A, type II topoisomerase [Alteromonadales bacterium TW-7]
	150 	150 	85% 	2e-34	
ZP_03977721.1 	
DNA topoisomerase plasmid partition protein A [Bifidobacterium longum subsp. infantis ATCC 55813] >gb|EEI79823.1| DNA topoisomerase plasmid partition protein A [Bifidobacterium longum subsp. infantis ATCC 55813]
	150 	150 	82% 	2e-34	
ZP_08070061.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus vestibularis ATCC 49124] >gb|EFX95753.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus vestibularis ATCC 49124]
	150 	150 	87% 	2e-34	
ZP_00206762.1 	
COG0188: Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Bifidobacterium longum DJO10A]
	150 	150 	82% 	2e-34	
YP_003256203.1 	
DNA gyrase subunit A [Aggregatibacter actinomycetemcomitans D11S-1] >gb|ACX82984.1| DNA gyrase, A subunit [Aggregatibacter actinomycetemcomitans D11S-1]
	150 	150 	85% 	2e-34	Gene info linked to YP_003256203.1
YP_001501922.1 	
DNA gyrase subunit A [Shewanella pealeana ATCC 700345] >gb|ABV87387.1| DNA gyrase, A subunit [Shewanella pealeana ATCC 700345]
	150 	150 	83% 	2e-34	Gene info linked to YP_001501922.1
CBX19916.1 	
gyrase A [Clostridium perfringens]
	150 	150 	54% 	2e-34	
YP_002924287.1 	
DNA gyrase (type II topoisomerase), subunit A [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] >gb|ACQ68139.1| DNA gyrase (type II topoisomerase), subunit A [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
	150 	150 	85% 	2e-34	Gene info linked to YP_002924287.1
NP_245778.1 	
DNA gyrase subunit A [Pasteurella multocida subsp. multocida str. Pm70] >gb|AAK02925.1| GyrA [Pasteurella multocida subsp. multocida str. Pm70]
	150 	150 	85% 	2e-34	Gene info linked to NP_245778.1
3NUH_A 	
Chain A, A Domain Insertion In E. Coli Gyrb Adopts A Novel Fold That Plays A Critical Role In Gyrase Function
	150 	150 	83% 	2e-34	Structure related to 3NUH_A
YP_629032.1 	
DNA gyrase subunit A [Myxococcus xanthus DK 1622] >gb|ABF88110.1| DNA gyrase, A subunit [Myxococcus xanthus DK 1622]
	150 	150 	83% 	2e-34	Gene info linked to YP_629032.1
ZP_07572601.1 	
DNA gyrase, A subunit [Sphingobium chlorophenolicum L-1] >gb|EFN12037.1| DNA gyrase, A subunit [Sphingobium chlorophenolicum L-1]
	150 	150 	85% 	2e-34	
ZP_03714877.1 	
hypothetical protein EIKCOROL_02587 [Eikenella corrodens ATCC 23834] >gb|EEG22787.1| hypothetical protein EIKCOROL_02587 [Eikenella corrodens ATCC 23834]
	150 	150 	90% 	2e-34	
ZP_07386034.1 	
DNA gyrase, A subunit [Paenibacillus curdlanolyticus YK9] >gb|EFM12013.1| DNA gyrase, A subunit [Paenibacillus curdlanolyticus YK9]
	150 	150 	82% 	2e-34	
ZP_04797080.1 	
DNA topoisomerase IV subunit A [Staphylococcus epidermidis W23144] >gb|EES36083.1| DNA topoisomerase IV subunit A [Staphylococcus epidermidis W23144]
	150 	150 	88% 	2e-34	
YP_003661449.1 	
DNA gyrase/topoisomerase IV subunit A [Bifidobacterium longum subsp. longum JDM301] >gb|ADH00619.1| DNA gyrase/topoisomerase IV, subunit A [Bifidobacterium longum subsp. longum JDM301]
	150 	150 	82% 	2e-34	Gene info linked to YP_003661449.1
YP_188505.1 	
DNA topoisomerase IV subunit A [Staphylococcus epidermidis RP62A] >ref|ZP_04825261.1| DNA topoisomerase IV subunit A [Staphylococcus epidermidis BCM-HMP0060] >ref|ZP_06285076.1| DNA topoisomerase IV, A subunit [Staphylococcus epidermidis SK135] >ref|ZP_06613355.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Staphylococcus epidermidis M23864:W2(grey)] >sp|Q5HPI5.1|PARC_STAEQ RecName: Full=DNA topoisomerase 4 subunit A; AltName: Full=Topoisomerase IV subunit A >gb|AAW54308.1| DNA topoisomerase IV, A subunit [Staphylococcus epidermidis RP62A] >gb|EES58373.1| DNA topoisomerase IV subunit A [Staphylococcus epidermidis BCM-HMP0060] >gb|EFA87761.1| DNA topoisomerase IV, A subunit [Staphylococcus epidermidis SK135] >gb|EFE59350.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Staphylococcus epidermidis M23864:W2(grey)]
	150 	150 	88% 	2e-34	Gene info linked to YP_188505.1
ZP_03973490.1 	
DNA topoisomerase IV subunit A [Lactobacillus reuteri CF48-3A] >ref|ZP_07127568.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Lactobacillus reuteri SD2112] >gb|EEI66664.1| DNA topoisomerase IV subunit A [Lactobacillus reuteri CF48-3A] >gb|EFK86116.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Lactobacillus reuteri SD2112]
	150 	150 	87% 	3e-34	
YP_004184637.1 	
DNA gyrase subunit A [Terriglobus saanensis SP1PR4] >gb|ADV84643.1| DNA gyrase, A subunit [Terriglobus saanensis SP1PR4]
	150 	150 	97% 	3e-34	Gene info linked to YP_004184637.1
ZP_08029251.1 	
DNA topoisomerase IV, A subunit [Solobacterium moorei F0204] >gb|EFW23999.1| DNA topoisomerase IV, A subunit [Solobacterium moorei F0204]
	150 	150 	88% 	3e-34	
YP_903555.1 	
DNA gyrase subunit A [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gb|ABL02084.1| DNA gyrase subunit A [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)]
	150 	150 	83% 	3e-34	Gene info linked to YP_903555.1
ZP_03073928.1 	
DNA topoisomerase IV, A subunit [Lactobacillus reuteri 100-23] >gb|EDX41693.1| DNA topoisomerase IV, A subunit [Lactobacillus reuteri 100-23]
	150 	150 	87% 	3e-34	
ZP_07723567.1 	
DNA topoisomerase IV, A subunit [Streptococcus vestibularis F0396] >gb|EFQ59070.1| DNA topoisomerase IV, A subunit [Streptococcus vestibularis F0396]
	150 	150 	87% 	3e-34	
ZP_04062868.1 	
DNA topoisomerase IV, A subunit [Streptococcus salivarius SK126] >gb|EEK09209.1| DNA topoisomerase IV, A subunit [Streptococcus salivarius SK126]
	150 	150 	87% 	3e-34	
YP_001674259.1 	
DNA gyrase subunit A [Shewanella halifaxensis HAW-EB4] >gb|ABZ76600.1| DNA gyrase, A subunit [Shewanella halifaxensis HAW-EB4]
	150 	150 	83% 	3e-34	Gene info linked to YP_001674259.1
ZP_08067067.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Actinobacillus ureae ATCC 25976] >gb|EFX92176.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Actinobacillus ureae ATCC 25976]
	150 	150 	85% 	3e-34	
ZP_04977953.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Mannheimia haemolytica PHL213] >gb|EDN74349.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Mannheimia haemolytica PHL213]
	150 	150 	85% 	3e-34	
ZP_05991429.1 	
DNA gyrase subunit A [Mannheimia haemolytica serotype A2 str. OVINE] >gb|EEY10603.1| DNA gyrase subunit A [Mannheimia haemolytica serotype A2 str. OVINE]
	150 	150 	85% 	3e-34	
YP_002535027.1 	
DNA gyrase subunit A [Thermotoga neapolitana DSM 4359] >gb|ACM23661.1| DNA gyrase subunit A [Thermotoga neapolitana DSM 4359]
	150 	150 	96% 	3e-34	Gene info linked to YP_002535027.1
YP_001271384.1 	
DNA topoisomerase IV subunit A [Lactobacillus reuteri DSM 20016] >ref|YP_001841749.1| topoisomerase IV A subunit [Lactobacillus reuteri JCM 1112] >ref|ZP_03848973.1| DNA topoisomerase IV subunit A [Lactobacillus reuteri MM2-3] >ref|ZP_03961165.1| DNA topoisomerase IV subunit A [Lactobacillus reuteri MM4-1A] >gb|ABQ83047.1| DNA topoisomerase IV subunit A [Lactobacillus reuteri DSM 20016] >dbj|BAG25269.1| topoisomerase IV A subunit [Lactobacillus reuteri JCM 1112] >gb|EEI08412.1| DNA topoisomerase IV subunit A [Lactobacillus reuteri MM2-3] >gb|EEI74393.1| DNA topoisomerase IV subunit A [Lactobacillus reuteri MM4-1A]
	150 	150 	87% 	3e-34	Gene info linked to YP_001271384.1
ZP_05988183.1 	
DNA gyrase subunit A [Mannheimia haemolytica serotype A2 str. BOVINE] >gb|EEY13846.1| DNA gyrase subunit A [Mannheimia haemolytica serotype A2 str. BOVINE]
	150 	150 	85% 	3e-34	
YP_003772258.1 	
DNA topoisomerase IV subunit A [Leuconostoc gasicomitatum LMG 18811] >emb|CBL91439.1| DNA topoisomerase IV, A subunit [Leuconostoc gasicomitatum LMG 18811]
	150 	150 	84% 	3e-34	Gene info linked to YP_003772258.1
ZP_07911231.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Staphylococcus lugdunensis M23590] >gb|EFU85011.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Staphylococcus lugdunensis M23590]
	149 	149 	88% 	3e-34	
ZP_01467060.1 	
hypothetical protein STIAU_4480 [Stigmatella aurantiaca DW4/3-1] >gb|EAU62174.1| hypothetical protein STIAU_4480 [Stigmatella aurantiaca DW4/3-1]
	149 	149 	82% 	3e-34	
ZP_08013440.1 	
DNA topoisomerase 4 subunit A [Streptococcus anginosus 1_2_62CV] >gb|EFW08392.1| DNA topoisomerase 4 subunit A [Streptococcus anginosus 1_2_62CV]
	149 	149 	84% 	3e-34	
YP_002322443.1 	
DNA gyrase/topoisomerase IV, subunit A [Bifidobacterium longum subsp. infantis ATCC 15697] >gb|ACJ52065.1| DNA gyrase/topoisomerase IV, subunit A [Bifidobacterium longum subsp. infantis ATCC 15697] >dbj|BAJ68573.1| DNA topoisomerase IV subunit A [Bifidobacterium longum subsp. infantis JCM 1222]
	149 	149 	82% 	4e-34	Gene info linked to YP_002322443.1
CBX19910.1 	
gyrase A [Clostridium perfringens]
	149 	149 	54% 	4e-34	
ZP_04608391.1 	
DNA gyrase subunit A gyrA [Micromonospora sp. ATCC 39149] >gb|EEP74321.1| DNA gyrase subunit A gyrA [Micromonospora sp. ATCC 39149]
	149 	149 	83% 	4e-34	
ZP_03634365.1 	
hypothetical protein HOLDEFILI_01658 [Holdemania filiformis DSM 12042] >gb|EEF68196.1| hypothetical protein HOLDEFILI_01658 [Holdemania filiformis DSM 12042]
	149 	149 	88% 	4e-34	
ZP_08032363.1 	
DNA gyrase/topoisomerase IV, A subunit [Actinomyces sp. oral taxon 171 str. F0337] >gb|EFW28376.1| DNA gyrase/topoisomerase IV, A subunit [Actinomyces sp. oral taxon 171 str. F0337]
	149 	149 	82% 	4e-34	
ABA63506.1 	
gyrase subunit A [Clostridium perfringens]
	149 	149 	53% 	4e-34	
YP_719375.1 	
DNA gyrase subunit A [Haemophilus somnus 129PT] >ref|YP_001784900.1| DNA gyrase, A subunit [Haemophilus somnus 2336] >gb|ABI25438.1| DNA gyrase subunit A [Haemophilus somnus 129PT] >gb|ACA31341.1| DNA gyrase, A subunit [Haemophilus somnus 2336]
	149 	149 	85% 	4e-34	Gene info linked to YP_719375.1
CBX19915.1 	
gyrase A [Clostridium perfringens]
	149 	149 	54% 	4e-34	
ZP_05552624.1 	
DNA gyrase, A subunit [Lactobacillus coleohominis 101-4-CHN] >gb|EEU30817.1| DNA gyrase, A subunit [Lactobacillus coleohominis 101-4-CHN]
	149 	149 	83% 	4e-34	
YP_395586.1 	
DNA topoisomerase IV subunit A [Lactobacillus sakei subsp. sakei 23K] >emb|CAI55277.1| Topoisomerase IV, subunit A [Lactobacillus sakei subsp. sakei 23K]
	149 	149 	88% 	4e-34	Gene info linked to YP_395586.1
YP_001760680.1 	
DNA gyrase subunit A [Shewanella woodyi ATCC 51908] >gb|ACA86585.1| DNA gyrase, A subunit [Shewanella woodyi ATCC 51908]
	149 	149 	83% 	5e-34	Gene info linked to YP_001760680.1
YP_003952770.1 	
type II DNA topoisomerase subunit A [Stigmatella aurantiaca DW4/3-1] >gb|ADO70943.1| Type II DNA topoisomerase, A subunit [Stigmatella aurantiaca DW4/3-1]
	149 	149 	82% 	5e-34	Gene info linked to YP_003952770.1
YP_003763513.1 	
DNA gyrase subunit A [Amycolatopsis mediterranei U32] >gb|ADJ43111.1| DNA gyrase subunit A [Amycolatopsis mediterranei U32]
	149 	149 	83% 	5e-34	Gene info linked to YP_003763513.1
EFV89567.1 	
DNA topoisomerase IV, A subunit [Staphylococcus epidermidis FRI909]
	149 	149 	88% 	5e-34	
ZP_03913888.1 	
DNA topoisomerase IV subunit A [Leuconostoc mesenteroides subsp. cremoris ATCC 19254] >gb|EEJ42608.1| DNA topoisomerase IV subunit A [Leuconostoc mesenteroides subsp. cremoris ATCC 19254]
	149 	149 	84% 	5e-34	
YP_497192.1 	
DNA gyrase subunit A [Novosphingobium aromaticivorans DSM 12444] >gb|ABD26358.1| DNA gyrase subunit A [Novosphingobium aromaticivorans DSM 12444]
	149 	149 	84% 	6e-34	Gene info linked to YP_497192.1
YP_002744352.1 	
topoisomerase IV subunit A [Streptococcus equi subsp. zooepidemicus] >emb|CAW99003.1| topoisomerase IV subunit A [Streptococcus equi subsp. zooepidemicus]
	149 	149 	81% 	6e-34	Gene info linked to YP_002744352.1
BAF33489.1 	
DNA gyrase subunit A [Listonella anguillarum]
	149 	149 	87% 	6e-34	
ABA63601.1 	
gyrase subunit A [Clostridium perfringens]
	149 	149 	53% 	6e-34	
ZP_01042654.1 	
DNA gyrase subunit A [Idiomarina baltica OS145] >gb|EAQ32398.1| DNA gyrase subunit A [Idiomarina baltica OS145]
	149 	149 	85% 	6e-34	
ABA63431.1 	
gyrase subunit A [Clostridium perfringens] >gb|ABA63502.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63510.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63512.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63516.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63584.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63612.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63613.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63639.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63640.1| gyrase subunit A [Clostridium perfringens]
	149 	149 	53% 	6e-34	
ABA63565.1 	
gyrase subunit A [Clostridium perfringens]
	149 	149 	53% 	6e-34	
ZP_04646001.1 	
DNA topoisomerase IV, A subunit [Lactobacillus jensenii 269-3] >ref|ZP_05865311.1| DNA topoisomerase IV, A subunit [Lactobacillus jensenii SJ-7A-US] >ref|ZP_06337665.1| DNA topoisomerase IV, A subunit [Lactobacillus jensenii 208-1] >ref|ZP_07812635.1| DNA topoisomerase IV, A subunit [Lactobacillus jensenii 1153] >gb|EEQ24029.1| DNA topoisomerase IV, A subunit [Lactobacillus jensenii 269-3] >gb|EEQ68513.1| DNA topoisomerase IV, A subunit [Lactobacillus jensenii 1153] >gb|EEX27496.1| DNA topoisomerase IV, A subunit [Lactobacillus jensenii SJ-7A-US] >gb|EFA95823.1| DNA topoisomerase IV, A subunit [Lactobacillus jensenii 208-1]
	149 	149 	82% 	6e-34	
YP_003696393.1 	
DNA gyrase, A subunit [Arcanobacterium haemolyticum DSM 20595] >gb|ADH91774.1| DNA gyrase, A subunit [Arcanobacterium haemolyticum DSM 20595]
	149 	149 	85% 	7e-34	Gene info linked to YP_003696393.1
YP_505474.1 	
DNA gyrase subunit A [Anaplasma phagocytophilum HZ] >gb|ABD44015.1| DNA gyrase, A subunit [Anaplasma phagocytophilum HZ]
	149 	149 	82% 	7e-34	Gene info linked to YP_505474.1
ABA63490.1 	
gyrase subunit A [Clostridium perfringens] >gb|ABA63491.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63492.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63493.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63494.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63495.1| gyrase subunit A [Clostridium perfringens]
	149 	149 	53% 	7e-34	
NP_874114.1 	
DNA gyrase subunit A [Haemophilus ducreyi 35000HP] >gb|AAP96503.1| DNA gyrase subunit A [Haemophilus ducreyi 35000HP]
	149 	149 	85% 	7e-34	Gene info linked to NP_874114.1
ZP_05737126.1 	
DNA topoisomerase IV, A subunit [Granulicatella adiacens ATCC 49175] >gb|EEW37876.1| DNA topoisomerase IV, A subunit [Granulicatella adiacens ATCC 49175]
	149 	149 	81% 	7e-34	
ADX72771.1 	
DNA topoisomerase IV subunit A [Arthrobacter phenanthrenivorans Sphe3]
	149 	149 	83% 	7e-34	
ZP_08047055.1 	
DNA topoisomerase IV, A subunit [Streptococcus sp. C150] >gb|EFX54630.1| DNA topoisomerase IV, A subunit [Streptococcus sp. C150]
	148 	148 	87% 	8e-34	
YP_003314373.1 	
DNA topoisomerase IV subunit A [Sanguibacter keddieii DSM 10542] >gb|ACZ21539.1| DNA topoisomerase IV subunit A [Sanguibacter keddieii DSM 10542]
	148 	148 	82% 	8e-34	Gene info linked to YP_003314373.1
ZP_03926317.1 	
possible DNA topoisomerase (ATP-hydrolyzing) [Actinomyces urogenitalis DSM 15434] >gb|EEH66820.1| possible DNA topoisomerase (ATP-hydrolyzing) [Actinomyces urogenitalis DSM 15434]
	148 	148 	82% 	9e-34	
YP_002562209.1 	
DNA gyrase subunit A [Streptococcus uberis 0140J] >emb|CAR41948.1| DNA gyrase subunit A [Streptococcus uberis 0140J]
	148 	148 	83% 	9e-34	Gene info linked to YP_002562209.1
YP_004068547.1 	
DNA gyrase, subunit A, type II topoisomerase [Pseudoalteromonas sp. SM9913] >gb|ADT68396.1| DNA gyrase, subunit A, type II topoisomerase [Pseudoalteromonas sp. SM9913]
	148 	148 	85% 	9e-34	Gene info linked to YP_004068547.1
ADX45889.1 	
DNA gyrase, A subunit [Acidovorax avenae subsp. avenae ATCC 19860]
	148 	148 	80% 	9e-34	
ABA63435.1 	
gyrase subunit A [Clostridium perfringens] >gb|ABA63436.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63438.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63443.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63444.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63445.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63446.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63449.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63452.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63453.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63454.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63473.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63488.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63489.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63534.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63535.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63540.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63541.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63557.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63575.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63603.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63604.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63624.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63627.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63635.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63636.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63659.1| gyrase subunit A [Clostridium perfringens]
	148 	148 	53% 	9e-34	
ZP_03544335.1 	
DNA gyrase, A subunit [Comamonas testosteroni KF-1] >gb|EED68621.1| DNA gyrase, A subunit [Comamonas testosteroni KF-1]
	148 	148 	82% 	1e-33	
ZP_07045856.1 	
DNA gyrase subunit A [Comamonas testosteroni S44] >gb|EFI60516.1| DNA gyrase subunit A [Comamonas testosteroni S44]
	148 	148 	82% 	1e-33	
YP_003277473.1 	
DNA gyrase, A subunit [Comamonas testosteroni CNB-2] >gb|ACY32177.1| DNA gyrase, A subunit [Comamonas testosteroni CNB-2]
	148 	148 	82% 	1e-33	Gene info linked to YP_003277473.1
YP_548629.1 	
DNA gyrase subunit A [Polaromonas sp. JS666] >gb|ABE43731.1| DNA gyrase subunit A [Polaromonas sp. JS666]
	148 	148 	58% 	1e-33	Gene info linked to YP_548629.1
YP_004130224.1 	
DNA gyrase subunit A [Taylorella equigenitalis MCE9] >gb|ADU92081.1| DNA gyrase subunit A [Taylorella equigenitalis MCE9]
	148 	148 	82% 	1e-33	Gene info linked to YP_004130224.1
ADQ62652.1 	
DNA topoisomerase IV (Subunit C) [Streptococcus thermophilus ND03]
	148 	148 	87% 	1e-33	
YP_139110.1 	
DNA topoisomerase IV subunit A [Streptococcus thermophilus LMG 18311] >ref|YP_141000.1| DNA topoisomerase IV subunit A [Streptococcus thermophilus CNRZ1066] >gb|AAV60295.1| DNA topoisomerase IV (subunit C) [Streptococcus thermophilus LMG 18311] >gb|AAV62185.1| DNA topoisomerase IV (subunit C) [Streptococcus thermophilus CNRZ1066]
	148 	148 	87% 	1e-33	Gene info linked to YP_139110.1
YP_820097.1 	
DNA topoisomerase IV subunit A [Streptococcus thermophilus LMD-9] >gb|ABJ65901.1| DNA topoisomerase IV subunit A [Streptococcus thermophilus LMD-9]
	148 	148 	87% 	1e-33	Gene info linked to YP_820097.1
ZP_05920128.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Pasteurella dagmatis ATCC 43325] >gb|EEX50366.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Pasteurella dagmatis ATCC 43325]
	148 	148 	85% 	1e-33	
YP_003326511.1 	
DNA topoisomerase [Xylanimonas cellulosilytica DSM 15894] >gb|ACZ30953.1| DNA topoisomerase (ATP-hydrolyzing) [Xylanimonas cellulosilytica DSM 15894]
	148 	148 	82% 	1e-33	Gene info linked to YP_003326511.1
YP_001474040.1 	
DNA topoisomerase (ATP-hydrolyzing) [Shewanella sediminis HAW-EB3] >gb|ABV36912.1| DNA topoisomerase (ATP-hydrolyzing) [Shewanella sediminis HAW-EB3]
	148 	148 	83% 	1e-33	Gene info linked to YP_001474040.1
CBY13219.1 	
unnamed protein product [Oikopleura dioica]
	148 	148 	96% 	1e-33	
ABA63658.1 	
gyrase subunit A [Clostridium perfringens]
	147 	147 	53% 	1e-33	
ABA63429.1 	
gyrase subunit A [Clostridium perfringens] >gb|ABA63430.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63432.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63434.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63437.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63439.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63440.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63441.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63442.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63447.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63448.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63450.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63451.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63455.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63456.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63457.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63458.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63459.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63460.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63461.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63462.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63463.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63464.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63465.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63466.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63467.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63468.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63469.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63470.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63471.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63472.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63474.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63475.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63476.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63477.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63479.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63480.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63481.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63482.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63483.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63484.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63485.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63486.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63496.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63497.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63498.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63499.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63500.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63501.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63504.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63505.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63507.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63508.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63509.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63515.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63517.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63518.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63519.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63520.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63521.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63522.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63523.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63524.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63525.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63526.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63528.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63531.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63533.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63536.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63537.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63538.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63539.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63542.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63544.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63545.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63546.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63547.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63548.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63549.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63550.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63551.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63552.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63553.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63554.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63555.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63556.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63558.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63559.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63560.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63561.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63562.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63563.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63564.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63566.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63567.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63568.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63569.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63570.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63571.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63572.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63573.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63574.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63576.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63577.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63578.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63579.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63580.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63581.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63582.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63583.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63585.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63586.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63587.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63588.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63589.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63590.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63591.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63592.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63593.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63594.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63595.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63596.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63597.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63598.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63599.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63600.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63602.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63605.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63606.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63607.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63608.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63609.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63610.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63611.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63614.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63615.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63616.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63617.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63618.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63619.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63620.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63621.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63622.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63625.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63626.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63628.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63629.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63630.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63631.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63632.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63633.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63634.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63637.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63638.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63641.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63642.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63643.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63644.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63645.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63646.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63647.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63648.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63649.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63650.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63651.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63652.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63653.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63654.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63655.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63656.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63657.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63660.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63661.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63662.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63663.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63664.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63665.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63666.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63667.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63668.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63669.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63670.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63671.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63672.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63673.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63674.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63675.1| gyrase subunit A [Clostridium perfringens]
	147 	147 	53% 	1e-33	
BAJ31191.1 	
putative type II topoisomerase [Kitasatospora setae KM-6054]
	147 	147 	88% 	1e-33	
ABA63503.1 	
gyrase subunit A [Clostridium perfringens] >gb|ABA63511.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63513.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63514.1| gyrase subunit A [Clostridium perfringens]
	147 	147 	53% 	1e-33	
AAB87144.1 	
topoisomerase II subunit A [Thermotoga maritima MSB8]
	147 	147 	96% 	1e-33	
YP_971614.1 	
DNA gyrase subunit A [Acidovorax avenae subsp. citrulli AAC00-1] >gb|ABM33840.1| DNA gyrase subunit A [Acidovorax citrulli AAC00-1]
	147 	147 	80% 	1e-33	Gene info linked to YP_971614.1
YP_253468.1 	
DNA topoisomerase IV subunit A [Staphylococcus haemolyticus JCSC1435] >dbj|BAE04862.1| topoisomerase IV subunit A [Staphylococcus haemolyticus JCSC1435]
	147 	147 	88% 	1e-33	Gene info linked to YP_253468.1
YP_002123509.1 	
DNA topoisomerase IV subunit A [Streptococcus equi subsp. zooepidemicus MGCS10565] >gb|ACG62496.1| topoisomerase IV subunit A ParC [Streptococcus equi subsp. zooepidemicus MGCS10565]
	147 	147 	81% 	1e-33	Gene info linked to YP_002123509.1
NP_228890.1 	
DNA gyrase, subunit A [Thermotoga maritima MSB8] >sp|O33926.2|GYRA_THEMA RecName: Full=DNA gyrase subunit A; AltName: Full=Topoisomerase II subunit A >gb|AAD36161.1|AE001768_10 DNA gyrase, subunit A [Thermotoga maritima MSB8]
	147 	147 	96% 	1e-33	Gene info linked to NP_228890.1
ZP_06609549.1 	
DNA gyrase, A subunit [Actinomyces odontolyticus F0309] >gb|EFF79099.1| DNA gyrase, A subunit [Actinomyces odontolyticus F0309]
	147 	147 	84% 	1e-33	
ZP_07276937.1 	
DNA gyrase, A subunit [Streptomyces sp. AA4] >gb|EFL05306.1| DNA gyrase, A subunit [Streptomyces sp. AA4]
	147 	147 	83% 	2e-33	
YP_002315794.1 	
DNA topoisomerase IV subunit A [Anoxybacillus flavithermus WK1] >gb|ACJ33809.1| DNA topoisomerase IV subunit A [Anoxybacillus flavithermus WK1]
	147 	147 	82% 	2e-33	Gene info linked to YP_002315794.1
AAQ19684.1 	
topoisomerase IV subunit A [Staphylococcus haemolyticus]
	147 	147 	88% 	2e-33	
YP_942551.1 	
DNA gyrase, A subunit [Psychromonas ingrahamii 37] >gb|ABM02952.1| DNA gyrase subunit A [Psychromonas ingrahamii 37]
	147 	147 	83% 	2e-33	Gene info linked to YP_942551.1
ZP_02044590.1 	
hypothetical protein ACTODO_01464 [Actinomyces odontolyticus ATCC 17982] >gb|EDN81002.1| hypothetical protein ACTODO_01464 [Actinomyces odontolyticus ATCC 17982]
	147 	147 	84% 	2e-33	
ZP_02156186.1 	
DNA gyrase, A subunit [Shewanella benthica KT99] >gb|EDQ02199.1| DNA gyrase, A subunit [Shewanella benthica KT99]
	147 	147 	83% 	2e-33	
ZP_07248890.1 	
DNA topoisomerase IV subunit A [Streptococcus suis 05HAS68]
	147 	147 	88% 	2e-33	
ZP_05556512.1 	
DNA topoisomerase IV, A subunit [Lactobacillus jensenii 27-2-CHN] >ref|ZP_05861462.1| DNA topoisomerase IV, A subunit [Lactobacillus jensenii 115-3-CHN] >ref|ZP_06337682.1| DNA topoisomerase IV, A subunit [Lactobacillus jensenii 208-1] >ref|ZP_06923383.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus jensenii JV-V16] >gb|EEU21373.1| DNA topoisomerase IV, A subunit [Lactobacillus jensenii 27-2-CHN] >gb|EEX24244.1| DNA topoisomerase IV, A subunit [Lactobacillus jensenii 115-3-CHN] >gb|EFA95791.1| DNA topoisomerase IV, A subunit [Lactobacillus jensenii 208-1] >gb|EFH29412.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus jensenii JV-V16]
	147 	147 	82% 	2e-33	
ZP_07342844.1 	
DNA gyrase, A subunit [Burkholderiales bacterium 1_1_47] >gb|EFL83398.1| DNA gyrase, A subunit [Burkholderiales bacterium 1_1_47]
	147 	147 	83% 	2e-33	
CBK70376.1 	
DNA topoisomerase IV subunit A [Bifidobacterium longum subsp. longum F8]
	147 	147 	82% 	2e-33	
ABA63433.1 	
gyrase subunit A [Clostridium perfringens] >gb|ABA63478.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63487.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63527.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63529.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63530.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63532.1| gyrase subunit A [Clostridium perfringens] >gb|ABA63543.1| gyrase subunit A [Clostridium perfringens]
	147 	147 	53% 	2e-33	
YP_004124537.1 	
DNA gyrase, A subunit [Candidatus Blochmannia vafer str. BVAF] >gb|ADV33863.1| DNA gyrase, A subunit [Candidatus Blochmannia vafer str. BVAF]
	147 	147 	85% 	2e-33	Gene info linked to YP_004124537.1
ZP_03624483.1 	
DNA topoisomerase IV, A subunit [Streptococcus suis 89/1591] >gb|EEF65294.1| DNA topoisomerase IV, A subunit [Streptococcus suis 89/1591]
	147 	147 	88% 	2e-33	
YP_001200325.1 	
DNA topoisomerase IV subunit A [Streptococcus suis 98HAH33] >ref|YP_003024701.1| topoisomerase IV subunit A [Streptococcus suis SC84] >gb|ABP91925.1| Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Streptococcus suis 98HAH33] >emb|CAZ51459.1| topoisomerase IV subunit A [Streptococcus suis SC84]
	147 	147 	88% 	2e-33	Gene info linked to YP_001200325.1
ZP_07906451.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Lactobacillus iners ATCC 55195] >gb|EFU78535.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Lactobacillus iners ATCC 55195]
	147 	147 	85% 	2e-33	
YP_001739749.1 	
DNA gyrase, A subunit [Thermotoga sp. RQ2] >gb|ACB10066.1| DNA gyrase, A subunit [Thermotoga sp. RQ2]
	147 	147 	96% 	2e-33	Gene info linked to YP_001739749.1
YP_001198130.1 	
DNA topoisomerase IV subunit A [Streptococcus suis 05ZYH33] >gb|ABP89730.1| Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Streptococcus suis 05ZYH33]
	147 	147 	88% 	2e-33	Gene info linked to YP_001198130.1
YP_003299232.1 	
DNA topoisomerase [Thermomonospora curvata DSM 43183] >gb|ACY97194.1| DNA topoisomerase (ATP-hydrolyzing) [Thermomonospora curvata DSM 43183]
	147 	147 	83% 	2e-33	Gene info linked to YP_003299232.1
YP_003026602.1 	
topoisomerase IV subunit A [Streptococcus suis P1/7] >ref|YP_003028853.1| topoisomerase IV subunit A [Streptococcus suis BM407] >dbj|BAH47277.1| topoisomerase IV subunit A [Streptococcus suis] >emb|CAZ55975.1| topoisomerase IV subunit A [Streptococcus suis BM407] >emb|CAR45533.1| topoisomerase IV subunit A [Streptococcus suis P1/7] >gb|ADE31210.1| topoisomerase IV, subunit A [Streptococcus suis GZ1] >gb|ADV69936.1| topoisomerase IV subunit A [Streptococcus suis JS14]
	147 	147 	88% 	2e-33	Gene info linked to YP_003026602.1
YP_003601619.1 	
DNA topoisomerase iv, a subunit [Lactobacillus crispatus ST1] >emb|CBL50594.1| DNA topoisomerase IV, A subunit [Lactobacillus crispatus ST1]
	147 	147 	99% 	3e-33	Gene info linked to YP_003601619.1
YP_004219440.1 	
DNA gyrase, A subunit [Acidobacterium sp. MP5ACTX9] >gb|ADW70660.1| DNA gyrase, A subunit [Acidobacterium sp. MP5ACTX9]
	147 	147 	97% 	3e-33	Gene info linked to YP_004219440.1
ZP_07699656.1 	
DNA topoisomerase IV, A subunit [Lactobacillus iners LactinV 09V1-c] >gb|EFO67293.1| DNA topoisomerase IV, A subunit [Lactobacillus iners LactinV 09V1-c]
	147 	147 	85% 	3e-33	
YP_001245241.1 	
DNA gyrase, A subunit [Thermotoga petrophila RKU-1] >gb|ABQ47665.1| DNA gyrase subunit A [Thermotoga petrophila RKU-1]
	147 	147 	96% 	3e-33	Gene info linked to YP_001245241.1
YP_003347166.1 	
DNA gyrase, A subunit [Thermotoga naphthophila RKU-10] >gb|ADA67752.1| DNA gyrase, A subunit [Thermotoga naphthophila RKU-10]
	147 	147 	96% 	3e-33	Gene info linked to YP_003347166.1
YP_095446.1 	
DNA gyrase, subunit A, type II topoisomerase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gb|AAU27499.1| DNA gyrase, A subunit [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
	147 	147 	82% 	3e-33	Gene info linked to YP_095446.1
ABA63623.1 	
gyrase subunit A [Clostridium perfringens]
	147 	147 	53% 	3e-33	
YP_003484763.1 	
topoisomerase IV subunit A [Streptococcus mutans NN2025] >dbj|BAH87871.1| topoisomerase IV subunit A [Streptococcus mutans NN2025]
	146 	146 	87% 	3e-33	Gene info linked to YP_003484763.1
ZP_08080140.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Lactobacillus ruminis ATCC 25644] >gb|EFZ35347.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Lactobacillus ruminis ATCC 25644]
	146 	146 	88% 	3e-33	
YP_983013.1 	
DNA gyrase subunit A [Polaromonas naphthalenivorans CJ2] >gb|ABM38092.1| DNA gyrase subunit A [Polaromonas naphthalenivorans CJ2]
	146 	146 	58% 	4e-33	Gene info linked to YP_983013.1
ZP_07464409.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus gallolyticus subsp. gallolyticus TX20005] >gb|EFM29597.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus gallolyticus subsp. gallolyticus TX20005]
	146 	146 	82% 	4e-33	
ZP_04011516.1 	
DNA topoisomerase [Lactobacillus ultunensis DSM 16047] >gb|EEJ71992.1| DNA topoisomerase [Lactobacillus ultunensis DSM 16047]
	146 	146 	88% 	4e-33	
YP_436098.1 	
DNA gyrase subunit A [Hahella chejuensis KCTC 2396] >gb|ABC31673.1| DNA gyrase, A subunit [Hahella chejuensis KCTC 2396]
	146 	146 	83% 	4e-33	Gene info linked to YP_436098.1
NP_721584.1 	
DNA topoisomerase IV subunit A [Streptococcus mutans UA159] >gb|AAN58890.1|AE014957_3 topoisomerase IV, subunit A [Streptococcus mutans UA159]
	146 	146 	87% 	4e-33	Gene info linked to NP_721584.1
CBW99663.1 	
DNA gyrase, subunit A, type II topoisomerase [Legionella pneumophila 130b]
	146 	146 	82% 	4e-33	
ZP_02029638.1 	
hypothetical protein BIFADO_02096 [Bifidobacterium adolescentis L2-32] >gb|EDN81971.1| hypothetical protein BIFADO_02096 [Bifidobacterium adolescentis L2-32]
	146 	146 	82% 	4e-33	
CBX19918.1 	
gyrase A [Clostridium perfringens]
	146 	146 	52% 	4e-33	
YP_909870.1 	
DNA topoisomerase IV subunit A [Bifidobacterium adolescentis ATCC 15703] >dbj|BAF39788.1| DNA gyrase subunit A [Bifidobacterium adolescentis ATCC 15703]
	146 	146 	82% 	4e-33	Gene info linked to YP_909870.1
ZP_01873351.1 	
DNA gyrase subunit A [Lentisphaera araneosa HTCC2155] >gb|EDM28955.1| DNA gyrase subunit A [Lentisphaera araneosa HTCC2155]
	146 	146 	85% 	5e-33	
YP_123696.1 	
DNA gyrase, subunit A, type II topoisomerase [Legionella pneumophila str. Paris] >emb|CAH12523.1| DNA gyrase, subunit A, type II topoisomerase [Legionella pneumophila str. Paris]
	146 	146 	82% 	5e-33	Gene info linked to YP_123696.1
ZP_06622570.1 	
DNA topoisomerase IV, A subunit [Turicibacter sanguinis PC909] >gb|EFF63095.1| DNA topoisomerase IV, A subunit [Turicibacter sanguinis PC909]
	145 	145 	88% 	5e-33	
ZP_01916526.1 	
DNA gyrase subunit A [Limnobacter sp. MED105] >gb|EDM82254.1| DNA gyrase subunit A [Limnobacter sp. MED105]
	145 	145 	59% 	6e-33	
ZP_07909518.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Mobiluncus curtisii subsp. holmesii ATCC 35242] >gb|EFU82190.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Mobiluncus curtisii subsp. holmesii ATCC 35242]
	145 	145 	82% 	6e-33	
ZP_07908360.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Mobiluncus curtisii ATCC 51333] >gb|EFU80025.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Mobiluncus curtisii ATCC 51333]
	145 	145 	82% 	6e-33	
YP_804456.1 	
DNA topoisomerase IV subunit A [Pediococcus pentosaceus ATCC 25745] >gb|ABJ68014.1| DNA topoisomerase IV subunit A [Pediococcus pentosaceus ATCC 25745]
	145 	145 	83% 	6e-33	Gene info linked to YP_804456.1
ZP_07371341.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Mobiluncus curtisii subsp. curtisii ATCC 35241] >gb|EFL94600.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Mobiluncus curtisii subsp. curtisii ATCC 35241]
	145 	145 	82% 	6e-33	
YP_193998.1 	
DNA topoisomerase IV subunit A [Lactobacillus acidophilus NCFM] >ref|ZP_04021851.1| DNA topoisomerase IV subunit A [Lactobacillus acidophilus ATCC 4796] >gb|AAV42967.1| DNA topoisomerase IV subunit C [Lactobacillus acidophilus NCFM] >gb|EEJ75486.1| DNA topoisomerase IV subunit A [Lactobacillus acidophilus ATCC 4796]
	145 	145 	99% 	6e-33	Gene info linked to YP_193998.1
YP_003430401.1 	
DNA topoisomerase IV subunit A [Streptococcus gallolyticus UCN34] >emb|CBI13470.1| DNA topoisomerase IV subunit A [Streptococcus gallolyticus UCN34]
	145 	145 	82% 	6e-33	Gene info linked to YP_003430401.1
YP_126718.1 	
DNA gyrase, subunit A, type II topoisomerase [Legionella pneumophila str. Lens] >emb|CAH15608.1| DNA gyrase, subunit A, type II topoisomerase [Legionella pneumophila str. Lens]
	145 	145 	82% 	6e-33	Gene info linked to YP_126718.1
ZP_03996555.1 	
DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus crispatus JV-V01] >ref|ZP_05548724.1| DNA topoisomerase IV, A subunit [Lactobacillus crispatus 125-2-CHN] >ref|ZP_05555835.1| DNA topoisomerase IV subunit A [Lactobacillus crispatus MV-1A-US] >ref|ZP_06019406.1| DNA topoisomerase IV, A subunit [Lactobacillus crispatus MV-3A-US] >gb|EEJ69360.1| DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus crispatus JV-V01] >gb|EEU19857.1| DNA topoisomerase IV, A subunit [Lactobacillus crispatus 125-2-CHN] >gb|EEU27797.1| DNA topoisomerase IV subunit A [Lactobacillus crispatus MV-1A-US] >gb|EEX29873.1| DNA topoisomerase IV, A subunit [Lactobacillus crispatus MV-3A-US]
	145 	145 	99% 	6e-33	
ZP_06626653.1 	
DNA topoisomerase IV, A subunit [Lactobacillus crispatus 214-1] >gb|EFD99792.1| DNA topoisomerase IV, A subunit [Lactobacillus crispatus 214-1]
	145 	145 	99% 	6e-33	
YP_001395526.1 	
DNA topoisomerase IV subunit A [Clostridium kluyveri DSM 555] >ref|YP_002472347.1| hypothetical protein CKR_1882 [Clostridium kluyveri NBRC 12016] >gb|EDK34155.1| GyrA2 [Clostridium kluyveri DSM 555] >dbj|BAH06933.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
	145 	145 	80% 	7e-33	Gene info linked to YP_001395526.1
ZP_07879399.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Actinomyces sp. oral taxon 180 str. F0310] >gb|EFU62090.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Actinomyces sp. oral taxon 180 str. F0310]
	145 	145 	84% 	7e-33	
ZP_03628626.1 	
DNA gyrase, A subunit [bacterium Ellin514] >gb|EEF61018.1| DNA gyrase, A subunit [bacterium Ellin514]
	145 	145 	96% 	7e-33	
ZP_03940485.1 	
DNA topoisomerase [Lactobacillus brevis subsp. gravesensis ATCC 27305] >gb|EEI70155.1| DNA topoisomerase [Lactobacillus brevis subsp. gravesensis ATCC 27305]
	145 	145 	86% 	7e-33	
NP_295636.1 	
DNA gyrase, subunit A [Deinococcus radiodurans R1] >gb|AAF11467.1|AE002030_6 DNA gyrase, subunit A [Deinococcus radiodurans R1]
	145 	145 	85% 	8e-33	Gene info linked to NP_295636.1
YP_001361296.1 	
DNA topoisomerase (ATP-hydrolyzing) [Kineococcus radiotolerans SRS30216] >gb|ABS03032.1| DNA topoisomerase (ATP-hydrolyzing) [Kineococcus radiotolerans SRS30216]
	145 	145 	82% 	8e-33	Gene info linked to YP_001361296.1
YP_814814.1 	
DNA topoisomerase IV subunit A [Lactobacillus gasseri ATCC 33323] >ref|ZP_04644617.1| DNA topoisomerase IV, A subunit [Lactobacillus gasseri 202-4] >ref|ZP_06260520.1| DNA topoisomerase IV, A subunit [Lactobacillus gasseri 224-1] >ref|ZP_07712112.1| DNA topoisomerase IV, A subunit [Lactobacillus gasseri MV-22] >gb|ABJ60376.1| DNA topoisomerase IV subunit A [Lactobacillus gasseri ATCC 33323] >gb|EEQ25377.1| DNA topoisomerase IV, A subunit [Lactobacillus gasseri 202-4] >gb|EFB63280.1| DNA topoisomerase IV, A subunit [Lactobacillus gasseri 224-1] >gb|EFQ46209.1| DNA topoisomerase IV, A subunit [Lactobacillus gasseri MV-22]
	145 	145 	83% 	8e-33	Gene info linked to YP_814814.1
ZP_07731790.1 	
DNA topoisomerase IV, A subunit [Lactobacillus iners LEAF 3008A-a] >gb|EFQ51000.1| DNA topoisomerase IV, A subunit [Lactobacillus iners LEAF 3008A-a]
	145 	145 	85% 	8e-33	
ZP_06188739.1 	
DNA gyrase A subunit [Legionella longbeachae D-4968] >ref|YP_003455276.1| DNA gyrase, subunit A, type II topoisomerase [Legionella longbeachae NSW150] >gb|EEZ94677.1| DNA gyrase A subunit [Legionella longbeachae D-4968] >emb|CBJ12179.1| DNA gyrase, subunit A, type II topoisomerase [Legionella longbeachae NSW150]
	145 	145 	82% 	9e-33	
ZP_05393680.1 	
DNA topoisomerase (ATP-hydrolyzing) [Clostridium carboxidivorans P7] >ref|ZP_06856322.1| DNA gyrase/topoisomerase IV, A subunit [Clostridium carboxidivorans P7] >gb|EET85848.1| DNA topoisomerase (ATP-hydrolyzing) [Clostridium carboxidivorans P7] >gb|EFG86498.1| DNA gyrase/topoisomerase IV, A subunit [Clostridium carboxidivorans P7]
	145 	145 	96% 	9e-33	
ZP_07466494.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus bovis ATCC 700338] >gb|EFM27276.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus bovis ATCC 700338]
	145 	145 	82% 	9e-33	
3LPX_A 	
Chain A, Crystal Structure Of Gyra >pdb|3LPX|B Chain B, Crystal Structure Of Gyra
	145 	145 	82% 	9e-33	
ZP_05751722.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Lactobacillus helveticus DSM 20075] >gb|EEW68819.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Lactobacillus helveticus DSM 20075]
	145 	145 	88% 	1e-32	
ZP_07989320.1 	
DNA gyrase subunit A [Corynebacterium variabile DSM 44702]
	145 	145 	87% 	1e-32	
YP_001250155.1 	
DNA gyrase subunit A [Legionella pneumophila str. Corby] >ref|YP_003618697.1| DNA gyrase, subunit A, type II topoisomerase [Legionella pneumophila 2300/99 Alcoy] >gb|ABQ54809.1| DNA gyrase, subunit A, type II topoisomerase [Legionella pneumophila str. Corby] >gb|ADG24745.1| DNA gyrase, subunit A, type II topoisomerase [Legionella pneumophila 2300/99 Alcoy]
	145 	145 	82% 	1e-32	Gene info linked to YP_001250155.1
XP_002951147.1 	
hypothetical protein VOLCADRAFT_91671 [Volvox carteri f. nagariensis] >gb|EFJ47676.1| hypothetical protein VOLCADRAFT_91671 [Volvox carteri f. nagariensis]
	145 	145 	72% 	1e-32	UniGene info linked to XP_002951147.1Gene info linked to XP_002951147.1
YP_003100067.1 	
DNA topoisomerase (ATP-hydrolyzing) [Actinosynnema mirum DSM 43827] >gb|ACU36221.1| DNA topoisomerase (ATP-hydrolyzing) [Actinosynnema mirum DSM 43827]
	144 	144 	83% 	1e-32	Gene info linked to YP_003100067.1
YP_001577547.1 	
DNA topoisomerase IV subunit A [Lactobacillus helveticus DPC 4571] >gb|ABX27256.1| DNA topoisomerase IV subunit A [Lactobacillus helveticus DPC 4571]
	144 	144 	88% 	1e-32	Gene info linked to YP_001577547.1
YP_003652984.1 	
DNA topoisomerase [Thermobispora bispora DSM 43833] >gb|ADG89091.1| DNA topoisomerase (ATP-hydrolyzing) [Thermobispora bispora DSM 43833]
	144 	144 	83% 	1e-32	Gene info linked to YP_003652984.1
ZP_03726320.1 	
DNA topoisomerase (ATP-hydrolyzing) [Opitutaceae bacterium TAV2] >gb|EEG19652.1| DNA topoisomerase (ATP-hydrolyzing) [Opitutaceae bacterium TAV2]
	144 	144 	82% 	1e-32	
NP_950751.1 	
DNA gyrase alpha subunit [Onion yellows phytoplasma OY-M] >dbj|BAD04584.1| DNA gyrase alpha subunit [Onion yellows phytoplasma OY-M]
	144 	144 	97% 	1e-32	Gene info linked to NP_950751.1
ZP_03943494.1 	
DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus buchneri ATCC 11577] >gb|EEI18630.1| DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus buchneri ATCC 11577]
	144 	144 	86% 	1e-32	
ZP_04187258.1 	
DNA topoisomerase 4 subunit A [Bacillus cereus AH1271] >gb|EEL80984.1| DNA topoisomerase 4 subunit A [Bacillus cereus AH1271]
	144 	144 	81% 	1e-32	
YP_003011234.1 	
DNA gyrase, A subunit [Paenibacillus sp. JDR-2] >gb|ACT01148.1| DNA gyrase, A subunit [Paenibacillus sp. JDR-2]
	144 	144 	82% 	1e-32	Gene info linked to YP_003011234.1
YP_269051.1 	
DNA gyrase, A subunit [Colwellia psychrerythraea 34H] >gb|AAZ25958.1| DNA gyrase, A subunit [Colwellia psychrerythraea 34H]
	144 	144 	82% 	1e-32	Gene info linked to YP_269051.1
YP_004226312.1 	
type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Microbacterium testaceum StLB037] >dbj|BAJ76432.1| type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Microbacterium testaceum StLB037]
	144 	144 	82% 	1e-32	Gene info linked to YP_004226312.1
ZP_03387087.1 	
DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Typhi str. M223]
	144 	144 	66% 	1e-32	
ZP_03372771.1 	
DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Typhi str. E98-2068]
	144 	144 	66% 	1e-32	
ZP_03742351.1 	
hypothetical protein BIFPSEUDO_02921 [Bifidobacterium pseudocatenulatum DSM 20438] >gb|EEG70955.1| hypothetical protein BIFPSEUDO_02921 [Bifidobacterium pseudocatenulatum DSM 20438]
	144 	144 	82% 	1e-32	
ADX70130.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Lactobacillus helveticus H10]
	144 	144 	88% 	1e-32	
YP_004095208.1 	
DNA topoisomerase IV, A subunit [Bacillus cellulosilyticus DSM 2522] >gb|ADU30477.1| DNA topoisomerase IV, A subunit [Bacillus cellulosilyticus DSM 2522]
	144 	144 	83% 	2e-32	Gene info linked to YP_004095208.1
YP_002507749.1 	
DNA gyrase, A subunit [Clostridium cellulolyticum H10] >gb|ACL77769.1| DNA gyrase, A subunit [Clostridium cellulolyticum H10]
	144 	144 	82% 	2e-32	Gene info linked to YP_002507749.1
ABV03204.1 	
GyrA [Chlamydia trachomatis]
	144 	144 	66% 	2e-32	
YP_001219141.1 	
DNA gyrase subunit A GyrA [Candidatus Vesicomyosocius okutanii HA] >dbj|BAF61417.1| DNA gyrase subunit A GyrA [Candidatus Vesicomyosocius okutanii HA]
	144 	144 	84% 	2e-32	Gene info linked to YP_001219141.1
ZP_07735592.1 	
DNA topoisomerase IV, A subunit [Lactobacillus iners LEAF 2053A-b] >gb|EFQ47288.1| DNA topoisomerase IV, A subunit [Lactobacillus iners LEAF 2053A-b]

	144 	144 	85% 	2e-32	
YP_001311389.1 	
DNA topoisomerase IV subunit A [Clostridium beijerinckii NCIMB 8052] >gb|ABR36433.1| DNA topoisomerase (ATP-hydrolyzing) [Clostridium beijerinckii NCIMB 8052]
	144 	144 	95% 	2e-32	Gene info linked to YP_001311389.1
YP_003562999.1 	
DNA topoisomerase IV subunit A [Bacillus megaterium QM B1551] >gb|ADE69565.1| DNA topoisomerase IV, subunit A [Bacillus megaterium QM B1551]
	144 	144 	82% 	2e-32	Gene info linked to YP_003562999.1
ZP_04657321.1 	
DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191]
	144 	144 	66% 	2e-32	
ZP_08058815.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus cristatus ATCC 51100] >gb|EFX53705.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus cristatus ATCC 51100]
	144 	144 	84% 	2e-32	
YP_003597728.1 	
DNA topoisomerase IV subunit A [Bacillus megaterium DSM 319] >gb|ADF39378.1| DNA topoisomerase IV, subunit A [Bacillus megaterium DSM 319]
	144 	144 	82% 	2e-32	Gene info linked to YP_003597728.1
ZP_03954636.1 	
DNA topoisomerase, ATP-hydrolyzing [Lactobacillus hilgardii ATCC 8290] >gb|EEI23574.1| DNA topoisomerase, ATP-hydrolyzing [Lactobacillus hilgardii ATCC 8290]
	144 	144 	86% 	2e-32	
YP_001450523.1 	
DNA topoisomerase IV subunit A [Streptococcus gordonii str. Challis substr. CH1] >gb|ABV10189.1| DNA topoisomerase IV, A subunit [Streptococcus gordonii str. Challis substr. CH1]
	144 	144 	84% 	2e-32	Gene info linked to YP_001450523.1
ZP_06060591.1 	
DNA topoisomerase IV subunit A [Streptococcus sp. 2_1_36FAA] >gb|EEY79775.1| DNA topoisomerase IV subunit A [Streptococcus sp. 2_1_36FAA]
	144 	144 	84% 	2e-32	
YP_003556817.1 	
DNA gyrase subunit A [Shewanella violacea DSS12] >dbj|BAJ02039.1| DNA gyrase, A subunit [Shewanella violacea DSS12]
	144 	144 	83% 	2e-32	Gene info linked to YP_003556817.1
ZP_07895825.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Enterococcus italicus DSM 15952] >gb|EFU73972.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Enterococcus italicus DSM 15952]
	144 	144 	88% 	2e-32	
ZP_07732986.1 	
DNA topoisomerase IV, A subunit [Lactobacillus iners LEAF 2062A-h1] >ref|ZP_07734265.1| DNA topoisomerase IV, A subunit [Lactobacillus iners LEAF 2052A-d] >gb|EFQ48711.1| DNA topoisomerase IV, A subunit [Lactobacillus iners LEAF 2052A-d] >gb|EFQ49832.1| DNA topoisomerase IV, A subunit [Lactobacillus iners LEAF 2062A-h1]
	143 	143 	85% 	3e-32	
ZP_08087180.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus sanguinis VMC66] >gb|EFX93738.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus sanguinis VMC66]
	143 	143 	84% 	3e-32	
ZP_04447743.1 	
hypothetical protein BIFANG_02724 [Bifidobacterium angulatum DSM 20098] >gb|EEP21364.1| hypothetical protein BIFANG_02724 [Bifidobacterium angulatum DSM 20098]
	143 	143 	82% 	3e-32	
ZP_02920271.1 	
hypothetical protein STRINF_01148 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gb|EDT47355.1| hypothetical protein STRINF_01148 [Streptococcus infantarius subsp. infantarius ATCC BAA-102]
	143 	143 	84% 	3e-32	
NP_789209.1 	
DNA topoisomerase IV subunit A [Tropheryma whipplei TW08/27] >emb|CAD66947.1| DNA gyrase subunit A [Tropheryma whipplei TW08/27]
	143 	143 	82% 	3e-32	Gene info linked to NP_789209.1
NP_787619.1 	
DNA topoisomerase IV subunit A [Tropheryma whipplei str. Twist] >gb|AAO44588.1| DNA gyrase subunit A-like protein [Tropheryma whipplei str. Twist]
	143 	143 	82% 	3e-32	Gene info linked to NP_787619.1
ZP_04175635.1 	
DNA topoisomerase 4 subunit A [Bacillus cereus AH1273] >gb|EEL92687.1| DNA topoisomerase 4 subunit A [Bacillus cereus AH1273]
	143 	143 	81% 	3e-32	
ZP_06385584.1 	
DNA gyrase, subunit A [Candidatus Poribacteria sp. WGA-A3] >gb|EFC35016.1| DNA gyrase, subunit A [Candidatus Poribacteria sp. WGA-A3]
	143 	143 	49% 	3e-32	
CBX19907.1 	
gyrase A [Clostridium perfringens]
	143 	143 	51% 	3e-32	
YP_001920143.1 	
DNA topoisomerase IV subunit A [Clostridium botulinum E3 str. Alaska E43] >gb|ACD51370.1| DNA gyrase subunit A [Clostridium botulinum E3 str. Alaska E43]
	143 	143 	83% 	3e-32	Gene info linked to YP_001920143.1
ZP_07698094.1 	
DNA topoisomerase IV, A subunit [Lactobacillus iners LactinV 11V1-d] >ref|ZP_07703703.1| DNA topoisomerase IV, A subunit [Lactobacillus iners SPIN 2503V10-D] >gb|EFO66196.1| DNA topoisomerase IV, A subunit [Lactobacillus iners LactinV 11V1-d] >gb|EFO71848.1| DNA topoisomerase IV, A subunit [Lactobacillus iners SPIN 2503V10-D]
	143 	143 	85% 	3e-32	
ZP_07729311.1 	
DNA topoisomerase IV, A subunit [Lactobacillus oris PB013-T2-3] >gb|EFQ53653.1| DNA topoisomerase IV, A subunit [Lactobacillus oris PB013-T2-3]
	143 	143 	88% 	3e-32	
YP_280160.1 	
DNA topoisomerase IV subunit A [Streptococcus pyogenes MGAS6180] >gb|AAX71805.1| topoisomerase IV subunit A [Streptococcus pyogenes MGAS6180]
	143 	143 	81% 	3e-32	Gene info linked to YP_280160.1
ZP_00365752.1 	
COG0188: Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Streptococcus pyogenes M49 591]
	143 	143 	81% 	3e-32	
ZP_06196456.1 	
DNA topoisomerase IV, A subunit [Pediococcus acidilactici 7_4] >ref|ZP_07367301.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Pediococcus acidilactici DSM 20284] >gb|EFA26845.1| DNA topoisomerase IV, A subunit [Pediococcus acidilactici 7_4] >gb|EFL96369.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Pediococcus acidilactici DSM 20284]
	143 	143 	88% 	3e-32	
ZP_07708341.1 	
DNA topoisomerase IV subunit A [Bacillus sp. m3-13]
	143 	143 	82% 	3e-32	
YP_003497575.1 	
DNA topoisomerase II, A subunit [Deferribacter desulfuricans SSM1] >dbj|BAI81819.1| DNA topoisomerase II, A subunit [Deferribacter desulfuricans SSM1]
	143 	143 	82% 	3e-32	Gene info linked to YP_003497575.1
YP_002746616.1 	
topoisomerase IV subunit A [Streptococcus equi subsp. equi 4047] >emb|CAW94138.1| topoisomerase IV subunit A [Streptococcus equi subsp. equi 4047]
	143 	143 	81% 	3e-32	Gene info linked to YP_002746616.1
NP_464812.1 	
DNA topoisomerase IV subunit A [Listeria monocytogenes EGD-e] >ref|ZP_03670075.1| DNA topoisomerase IV subunit A [Listeria monocytogenes FSL R2-561] >ref|ZP_05234611.1| DNA topoisomerase IV subunit A [Listeria monocytogenes 10403S] >ref|YP_003413537.1| DNA topoisomerase IV subunit A [Listeria monocytogenes 08-5578] >ref|YP_003416582.1| DNA topoisomerase IV subunit A [Listeria monocytogenes 08-5923] >emb|CAC99365.1| parC [Listeria monocytogenes EGD-e] >gb|AAM48489.1| DNA topoisomerase IV subunit A [Listeria monocytogenes] >gb|ADB68175.1| DNA topoisomerase IV subunit A [Listeria monocytogenes 08-5578] >gb|ADB71220.1| DNA topoisomerase IV subunit A [Listeria monocytogenes 08-5923]
	143 	143 	87% 	3e-32	Gene info linked to NP_464812.1
ZP_00234808.1 	
DNA topoisomerase IV, A subunit [Listeria monocytogenes str. 1/2a F6854] >ref|ZP_05258472.1| DNA topoisomerase IV subunit A [Listeria monocytogenes J0161] >ref|ZP_05261973.1| DNA topoisomerase IV [Listeria monocytogenes J2818] >ref|ZP_05267985.1| DNA topoisomerase IV [Listeria monocytogenes F6900] >gb|EAL05344.1| DNA topoisomerase IV, A subunit [Listeria monocytogenes str. 1/2a F6854] >gb|EEW21486.1| DNA topoisomerase IV [Listeria monocytogenes F6900] >gb|EFF98258.1| DNA topoisomerase IV [Listeria monocytogenes J2818]
	143 	143 	87% 	4e-32	
YP_596500.1 	
DNA topoisomerase IV subunit A [Streptococcus pyogenes MGAS9429] >ref|YP_600380.1| DNA topoisomerase IV subunit A [Streptococcus pyogenes MGAS2096] >gb|ABF31956.1| topoisomerase IV subunit A [Streptococcus pyogenes MGAS9429] >gb|ABF35836.1| Topoisomerase IV subunit A [Streptococcus pyogenes MGAS2096]
	143 	143 	81% 	4e-32	Gene info linked to YP_596500.1
YP_003242379.1 	
DNA topoisomerase IV subunit A [Paenibacillus sp. Y412MC10] >gb|ACX64572.1| DNA topoisomerase IV, A subunit [Paenibacillus sp. Y412MC10]
	143 	143 	82% 	4e-32	Gene info linked to YP_003242379.1
YP_001035180.1 	
DNA topoisomerase IV subunit A [Streptococcus sanguinis SK36] >gb|ABN44630.1| ParC, putative [Streptococcus sanguinis SK36]
	143 	143 	84% 	4e-32	Gene info linked to YP_001035180.1
YP_001128645.1 	
DNA topoisomerase IV subunit A [Streptococcus pyogenes str. Manfredo] >ref|YP_002285731.1| DNA topoisomerase IV subunit A [Streptococcus pyogenes NZ131] >emb|CAM30421.1| topoisomerase IV subunit A [Streptococcus pyogenes str. Manfredo] >gb|ACI61036.1| Topoisomerase IV subunit A [Streptococcus pyogenes NZ131]
	143 	143 	81% 	4e-32	Gene info linked to YP_001128645.1
YP_003719603.1 	
DNA topoisomerase [Mobiluncus curtisii ATCC 43063] >gb|ADI68109.1| DNA topoisomerase (ATP-hydrolyzing) [Mobiluncus curtisii ATCC 43063]
	143 	143 	82% 	4e-32	Gene info linked to YP_003719603.1
ZP_01785129.1 	
DNA gyrase subunit A [Haemophilus influenzae 22.1-21] >gb|EDJ88556.1| DNA gyrase subunit A [Haemophilus influenzae 22.1-21]
	143 	143 	85% 	4e-32	
ZP_06557130.1 	
parC protein [Listeria monocytogenes FSL J2-071] >gb|EFD89832.1| parC protein [Listeria monocytogenes FSL J2-071]
	143 	143 	87% 	4e-32	
NP_607110.1 	
DNA topoisomerase IV subunit A [Streptococcus pyogenes MGAS8232] >sp|Q8P1B3.1|PARC_STRP8 RecName: Full=DNA topoisomerase 4 subunit A; AltName: Full=Topoisomerase IV subunit A >gb|AAL97609.1| DNA topoisomerase IV subunit C [Streptococcus pyogenes MGAS8232]
	143 	143 	81% 	4e-32	Gene info linked to NP_607110.1
ZP_00785704.1 	
DNA topoisomerase IV, A subunit [Streptococcus agalactiae COH1] >gb|EAO75554.1| DNA topoisomerase IV, A subunit [Streptococcus agalactiae COH1]
	143 	143 	86% 	4e-32	
YP_002757997.1 	
DNA gyrase-like protein (subunit A) [Listeria monocytogenes Clip81459] >ref|ZP_05229653.1| DNA topoisomerase IV subunit A [Listeria monocytogenes FSL J1-194] >ref|ZP_05387797.1| DNA topoisomerase IV subunit A [Listeria monocytogenes FSL J1-175] >ref|ZP_07075308.1| DNA topoisomerase IV, A subunit [Listeria monocytogenes FSL N1-017] >emb|CAS05061.1| Putative DNA gyrase-like protein (subunit A) [Listeria monocytogenes serotype 4b str. CLIP 80459] >gb|EFG01651.1| DNA topoisomerase IV subunit A [Listeria monocytogenes FSL J1-194] >gb|EFK41070.1| DNA topoisomerase IV, A subunit [Listeria monocytogenes FSL N1-017]
	143 	143 	87% 	4e-32	Gene info linked to YP_002757997.1
ZP_03669170.1 	
DNA topoisomerase IV subunit A [Listeria monocytogenes Finland 1988]
	143 	143 	87% 	4e-32	
ZP_05265755.1 	
DNA topoisomerase IV subunit A [Listeria monocytogenes HPB2262] >gb|EFF95984.1| DNA topoisomerase IV subunit A [Listeria monocytogenes HPB2262]
	143 	143 	87% 	4e-32	
YP_456450.1 	
DNA gyrase subunit A [Aster yellows witches'-broom phytoplasma AYWB] >gb|ABC65371.1| DNA gyrase subunit A [Aster yellows witches'-broom phytoplasma AYWB]
	143 	143 	97% 	4e-32	Gene info linked to YP_456450.1
YP_013903.1 	
DNA topoisomerase IV subunit A [Listeria monocytogenes str. 4b F2365] >gb|AAT04080.1| DNA topoisomerase IV, A subunit [Listeria monocytogenes serotype 4b str. F2365]
	143 	143 	87% 	4e-32	Gene info linked to YP_013903.1
NP_735672.1 	
DNA topoisomerase IV subunit A [Streptococcus agalactiae NEM316] >ref|YP_329856.1| DNA topoisomerase IV subunit A [Streptococcus agalactiae A909] >ref|ZP_00788994.1| DNA topoisomerase IV, A subunit [Streptococcus agalactiae 515] >dbj|BAB62880.1| DNA topoisomerase IV subunit C [Streptococcus agalactiae] >emb|CAD46887.1| Unknown [Streptococcus agalactiae NEM316] >gb|ABA45009.1| DNA topoisomerase IV, A subunit [Streptococcus agalactiae A909] >gb|EAO72191.1| DNA topoisomerase IV, A subunit [Streptococcus agalactiae 515]
	143 	143 	86% 	4e-32	Gene info linked to NP_735672.1
EFY02821.1 	
DNA topoisomerase IV subunit A [Streptococcus dysgalactiae subsp. dysgalactiae ATCC 27957]
	142 	142 	81% 	4e-32	
EFV97475.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus agalactiae ATCC 13813]
	142 	142 	86% 	4e-32	
ZP_07670459.1 	
DNA topoisomerase IV, A subunit [Erysipelotrichaceae bacterium 3_1_53] >gb|EFP62582.1| DNA topoisomerase IV, A subunit [Erysipelotrichaceae bacterium 3_1_53]
	142 	142 	82% 	4e-32	
YP_002350248.1 	
DNA topoisomerase IV, A subunit [Listeria monocytogenes HCC23] >gb|ACK39634.1| DNA topoisomerase IV, A subunit [Listeria monocytogenes HCC23] >emb|CAR84045.1| DNA topoisomerase IV, A subunit [Listeria monocytogenes L99]
	142 	142 	87% 	4e-32	Gene info linked to YP_002350248.1
ZP_00782988.1 	
DNA topoisomerase IV, A subunit [Streptococcus agalactiae H36B] >gb|EAO78269.1| DNA topoisomerase IV, A subunit [Streptococcus agalactiae H36B]
	142 	142 	86% 	4e-32	
ZP_05743537.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Lactobacillus iners DSM 13335] >ref|ZP_07267578.1| DNA topoisomerase IV subunit A [Lactobacillus iners AB-1] >gb|EEW52514.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Lactobacillus iners DSM 13335]
	142 	142 	83% 	4e-32	
ZP_06243833.1 	
DNA gyrase, A subunit [Victivallis vadensis ATCC BAA-548] >gb|EFB00400.1| DNA gyrase, A subunit [Victivallis vadensis ATCC BAA-548]
	142 	142 	96% 	4e-32	
NP_688162.1 	
DNA topoisomerase IV subunit A [Streptococcus agalactiae 2603V/R] >gb|AAN00035.1|AE014244_12 DNA topoisomerase IV, A subunit [Streptococcus agalactiae 2603V/R]
	142 	142 	86% 	5e-32	Gene info linked to NP_688162.1
ZP_00788533.1 	
DNA topoisomerase IV, A subunit [Streptococcus agalactiae CJB111] >gb|EAO72713.1| DNA topoisomerase IV, A subunit [Streptococcus agalactiae CJB111]
	142 	142 	86% 	5e-32	
ADA70033.1 	
DNA gyrase subunit A [Bacillus sp. NK-2]
	142 	142 	41% 	5e-32	
YP_002469819.1 	
DNA topoisomerase IV subunit A [Bifidobacterium animalis subsp. lactis AD011] >gb|ACL29243.1| DNA gyrase subunit A [Bifidobacterium animalis subsp. lactis AD011]
	142 	142 	82% 	5e-32	Gene info linked to YP_002469819.1
YP_001557421.1 	
DNA topoisomerase (ATP-hydrolyzing) [Clostridium phytofermentans ISDg] >gb|ABX40682.1| DNA topoisomerase (ATP-hydrolyzing) [Clostridium phytofermentans ISDg]
	142 	142 	84% 	5e-32	Gene info linked to YP_001557421.1
ZP_00781631.1 	
DNA topoisomerase IV, A subunit [Streptococcus agalactiae 18RS21] >gb|EAO61774.1| DNA topoisomerase IV, A subunit [Streptococcus agalactiae 18RS21]
	142 	142 	86% 	5e-32	
YP_001884983.1 	
DNA topoisomerase IV subunit A [Clostridium botulinum B str. Eklund 17B] >gb|ACD22815.1| DNA gyrase subunit A [Clostridium botulinum B str. Eklund 17B]
	142 	142 	96% 	5e-32	Gene info linked to YP_001884983.1
ZP_04290390.1 	
DNA topoisomerase 4 subunit A [Bacillus cereus R309803] >gb|EEK77773.1| DNA topoisomerase 4 subunit A [Bacillus cereus R309803]
	142 	142 	81% 	5e-32	
YP_947533.1 	
DNA topoisomerase IV subunit A [Arthrobacter aurescens TC1] >gb|ABM09518.1| putative DNA gyrase subunit A [Arthrobacter aurescens TC1]
	142 	142 	83% 	5e-32	Gene info linked to YP_947533.1
ABZ09590.1 	
putative DNA gyrase/topoisomerase IV, subunit A [uncultured marine microorganism HF4000_APKG8D23]
	142 	142 	96% 	5e-32	
ZP_07899634.1 	
DNA topoisomerase IV, A subunit [Paenibacillus vortex V453] >gb|EFU41479.1| DNA topoisomerase IV, A subunit [Paenibacillus vortex V453]
	142 	142 	82% 	5e-32	
YP_602298.1 	
DNA topoisomerase IV subunit A [Streptococcus pyogenes MGAS10750] >gb|ABF37754.1| Topoisomerase IV subunit A [Streptococcus pyogenes MGAS10750]
	142 	142 	81% 	5e-32	Gene info linked to YP_602298.1
ABU54855.1 	
GyrA [Bacillus licheniformis]
	142 	142 	41% 	5e-32	
YP_003464443.1 	
DNA topoisomerase IV, A subunit [Listeria seeligeri serovar 1/2b str. SLCC3954] >emb|CBH27357.1| DNA topoisomerase IV, A subunit [Listeria seeligeri serovar 1/2b str. SLCC3954]
	142 	142 	87% 	5e-32	Gene info linked to YP_003464443.1
YP_598380.1 	
DNA topoisomerase IV subunit A [Streptococcus pyogenes MGAS10270] >gb|ABF33836.1| Topoisomerase IV subunit A [Streptococcus pyogenes MGAS10270]
	142 	142 	81% 	5e-32	Gene info linked to YP_598380.1
YP_060047.1 	
DNA topoisomerase IV subunit A [Streptococcus pyogenes MGAS10394] >gb|AAT86864.1| Topoisomerase IV subunit A [Streptococcus pyogenes MGAS10394]
	142 	142 	81% 	5e-32	Gene info linked to YP_060047.1
ZP_06644862.1 	
DNA topoisomerase IV, A subunit [Erysipelotrichaceae bacterium 5_2_54FAA] >gb|EFE46987.1| DNA topoisomerase IV, A subunit [Erysipelotrichaceae bacterium 5_2_54FAA]
	142 	142 	82% 	6e-32	
YP_264825.1 	
DNA gyrase subunit A [Psychrobacter arcticus 273-4] >gb|AAZ19391.1| DNA gyrase subunit A [Psychrobacter arcticus 273-4]
	142 	142 	83% 	6e-32	Gene info linked to YP_264825.1
NP_802490.1 	
DNA topoisomerase IV subunit A [Streptococcus pyogenes SSI-1] >dbj|BAC64323.1| putative DNA topoisomerase IV, subunit C [Streptococcus pyogenes SSI-1]

	142 	142 	81% 	6e-32	Gene info linked to NP_802490.1
ZP_06754860.1 	
DNA gyrase, A subunit [Simonsiella muelleri ATCC 29453] >gb|EFG30120.1| DNA gyrase, A subunit [Simonsiella muelleri ATCC 29453]
	142 	142 	90% 	6e-32	
YP_002996882.1 	
DNA topoisomerase IV subunit A [Streptococcus dysgalactiae subsp. equisimilis GGS_124] >dbj|BAH81668.1| topoisomerase IV subunit [Streptococcus dysgalactiae subsp. equisimilis GGS_124]
	142 	142 	81% 	6e-32	Gene info linked to YP_002996882.1
YP_001410305.1 	
DNA gyrase, A subunit [Fervidobacterium nodosum Rt17-B1] >gb|ABS60648.1| DNA gyrase, A subunit [Fervidobacterium nodosum Rt17-B1]
	142 	142 	73% 	6e-32	Gene info linked to YP_001410305.1
YP_750814.1 	
DNA gyrase, A subunit [Shewanella frigidimarina NCIMB 400] >gb|ABI71976.1| DNA gyrase subunit A [Shewanella frigidimarina NCIMB 400]
	142 	142 	83% 	6e-32	Gene info linked to YP_750814.1
YP_198235.1 	
DNA gyrase subunit A [Wolbachia endosymbiont strain TRS of Brugia malayi] >gb|AAW70993.1| DNA gyrase, topoisomerase II A subunit, GyrA [Wolbachia endosymbiont strain TRS of Brugia malayi]
	142 	142 	82% 	6e-32	Gene info linked to YP_198235.1
ZP_05850713.1 	
DNA gyrase, A subunit [Haemophilus influenzae NT127] >gb|EEW77933.1| DNA gyrase, A subunit [Haemophilus influenzae NT127]
	142 	142 	85% 	6e-32	
ZP_06806984.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Aerococcus viridans ATCC 11563] >gb|EFG50581.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Aerococcus viridans ATCC 11563]
	142 	142 	88% 	6e-32	
ZP_07460780.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus pyogenes ATCC 10782] >gb|EFM33321.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus pyogenes ATCC 10782]
	142 	142 	81% 	6e-32	
YP_580985.1 	
DNA gyrase, A subunit [Psychrobacter cryohalolentis K5] >gb|ABE75501.1| DNA gyrase subunit A [Psychrobacter cryohalolentis K5]
	142 	142 	83% 	6e-32	Gene info linked to YP_580985.1
ABV03205.1 	
GyrA [Chlamydia trachomatis]
	142 	142 	66% 	6e-32	
Q5XCJ9.2 	
RecName: Full=DNA topoisomerase 4 subunit A; AltName: Full=Topoisomerase IV subunit A
	142 	142 	81% 	6e-32	
NP_269105.1 	
DNA topoisomerase IV subunit A [Streptococcus pyogenes M1 GAS] >sp|Q9L7Q4.1|PARC_STRP1 RecName: Full=DNA topoisomerase 4 subunit A; AltName: Full=Topoisomerase IV subunit A >gb|AAF63267.1| DNA topoisomerase IV subunit C [Streptococcus pyogenes] >gb|AAK33826.1| putative DNA topoisomerase IV (subunit C) [Streptococcus pyogenes M1 GAS]
	142 	142 	81% 	6e-32	Gene info linked to NP_269105.1
YP_282075.1 	
DNA topoisomerase IV subunit A [Streptococcus pyogenes MGAS5005] >ref|NP_664429.2| DNA topoisomerase IV subunit A [Streptococcus pyogenes MGAS315] >sp|Q8K7U6.2|PARC_STRP3 RecName: Full=DNA topoisomerase 4 subunit A; AltName: Full=Topoisomerase IV subunit A >gb|AAZ51330.1| topoisomerase IV subunit A [Streptococcus pyogenes MGAS5005]
	142 	142 	81% 	6e-32	Gene info linked to YP_282075.1
BAE53572.1 	
gyrase alpha subunit [Thermoplasma acidophilum]
	142 	142 	81% 	6e-32	
ADX24699.1 	
DNA topoisomerase IV subunit A [Streptococcus dysgalactiae subsp. equisimilis ATCC 12394]
	142 	142 	81% 	7e-32	
ABU96681.1 	
topoisomerase IV subunit [Streptococcus dysgalactiae subsp. equisimilis] >gb|ABU96682.1| topoisomerase IV subunit [Streptococcus dysgalactiae subsp. equisimilis]
	142 	142 	81% 	7e-32	
ZP_01786672.1 	
DNA gyrase subunit A [Haemophilus influenzae R3021] >gb|EDJ91023.1| DNA gyrase subunit A [Haemophilus influenzae R3021]
	142 	142 	85% 	7e-32	
ZP_05110810.1 	
DNA gyrase, subunit A, type II topoisomerase [Legionella drancourtii LLAP12] >gb|EET11490.1| DNA gyrase, subunit A, type II topoisomerase [Legionella drancourtii LLAP12]
	142 	142 	82% 	7e-32	
ZP_03925834.1 	
DNA topoisomerase (ATP-hydrolyzing) [Actinomyces coleocanis DSM 15436] >gb|EEH63448.1| DNA topoisomerase (ATP-hydrolyzing) [Actinomyces coleocanis DSM 15436]
	142 	142 	82% 	7e-32	
AAM79232.1 	
putative DNA topoisomerase IV subunit C [Streptococcus pyogenes MGAS315]
	142 	142 	81% 	7e-32	Gene info linked to AAM79232.1
ZP_01794443.1 	
DNA gyrase subunit A [Haemophilus influenzae PittII] >gb|EDK11716.1| DNA gyrase subunit A [Haemophilus influenzae PittII] >gb|ADO80802.1| DNA gyrase subunit A [Haemophilus influenzae R2866]
	142 	142 	85% 	7e-32	
ABU96683.1 	
topoisomerase IV subunit [Streptococcus dysgalactiae subsp. equisimilis]
	142 	142 	81% 	7e-32	
YP_003856124.1 	
DNA gyrase subunit A [Mycoplasma hyorhinis HUB-1] >gb|ADM21586.1| DNA gyrase subunit A [Mycoplasma hyorhinis HUB-1]
	142 	142 	83% 	7e-32	Gene info linked to YP_003856124.1
YP_147603.1 	
DNA topoisomerase IV subunit A [Geobacillus kaustophilus HTA426] >dbj|BAD76035.1| DNA topoisomerase IV subunit A [Geobacillus kaustophilus HTA426]
	142 	142 	83% 	7e-32	Gene info linked to YP_147603.1
ZP_07724867.1 	
DNA topoisomerase IV, A subunit [Streptococcus downei F0415] >gb|EFQ57976.1| DNA topoisomerase IV, A subunit [Streptococcus downei F0415]
	142 	142 	86% 	7e-32	
NP_439419.1 	
DNA gyrase subunit A [Haemophilus influenzae Rd KW20] >ref|ZP_05849000.1| DNA gyrase, A subunit [Haemophilus influenzae RdAW] >sp|P43700.1|GYRA_HAEIN RecName: Full=DNA gyrase subunit A >gb|AAC22917.1| DNA gyrase, subunit A (gyrA) [Haemophilus influenzae Rd KW20] >gb|EEW76151.1| DNA gyrase, A subunit [Haemophilus influenzae RdAW]
	142 	142 	85% 	7e-32	GEO profiles info linked to NP_439419.1Gene info linked to NP_439419.1
ZP_07057884.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus gasseri JV-V03] >gb|EFJ70197.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Lactobacillus gasseri JV-V03]
	142 	142 	83% 	8e-32	
YP_003947220.1 	
DNA topoisomerase iv, a subunit [Paenibacillus polymyxa SC2] >gb|ADO56979.1| DNA topoisomerase IV, A subunit [Paenibacillus polymyxa SC2]
	142 	142 	88% 	8e-32	Gene info linked to YP_003947220.1
ZP_04853816.1 	
DNA topoisomerase IV, A subunit [Paenibacillus sp. oral taxon 786 str. D14] >gb|EES72143.1| DNA topoisomerase IV, A subunit [Paenibacillus sp. oral taxon 786 str. D14]
	142 	142 	82% 	8e-32	
ZP_03323779.1 	
hypothetical protein BIFCAT_00551 [Bifidobacterium catenulatum DSM 16992] >gb|EEB21593.1| hypothetical protein BIFCAT_00551 [Bifidobacterium catenulatum DSM 16992]
	142 	142 	82% 	8e-32	
YP_003253632.1 	
DNA topoisomerase IV, A subunit [Geobacillus sp. Y412MC61] >ref|YP_003671364.1| DNA topoisomerase IV, A subunit [Geobacillus sp. C56-T3] >ref|YP_004132265.1| DNA topoisomerase IV, A subunit [Geobacillus sp. Y412MC52] >gb|ACX79150.1| DNA topoisomerase IV, A subunit [Geobacillus sp. Y412MC61] >gb|ADI26787.1| DNA topoisomerase IV, A subunit [Geobacillus sp. C56-T3] >gb|ADU94122.1| DNA topoisomerase IV, A subunit [Geobacillus sp. Y412MC52]
	142 	142 	83% 	8e-32	Gene info linked to YP_003253632.1
ZP_04301791.1 	
DNA topoisomerase 4 subunit A [Bacillus cereus MM3] >gb|EEK66404.1| DNA topoisomerase 4 subunit A [Bacillus cereus MM3]
	142 	142 	81% 	8e-32	
YP_849501.1 	
DNA topoisomerase IV subunit A [Listeria welshimeri serovar 6b str. SLCC5334] >emb|CAK20722.1| DNA topoisomerase IV, A subunit [Listeria welshimeri serovar 6b str. SLCC5334]
	141 	141 	87% 	9e-32	Gene info linked to YP_849501.1
YP_001375490.1 	
DNA topoisomerase IV subunit A [Bacillus cereus subsp. cytotoxis NVH 391-98] >gb|ABS22495.1| DNA topoisomerase IV, A subunit [Bacillus cytotoxicus NVH 391-98]
	141 	141 	81% 	9e-32	Gene info linked to YP_001375490.1
YP_001279775.1 	
DNA gyrase, A subunit [Psychrobacter sp. PRwf-1] >gb|ABQ93825.1| DNA gyrase subunit A [Psychrobacter sp. PRwf-1]
	141 	141 	83% 	1e-31	Gene info linked to YP_001279775.1
YP_003293147.1 	
DNA topoisomerase IV subunit A [Lactobacillus johnsonii FI9785] >emb|CAX66880.1| DNA topoisomerase IV subunit A [Lactobacillus johnsonii FI9785]
	141 	141 	82% 	1e-31	Gene info linked to YP_003293147.1
ZP_04208479.1 	
DNA topoisomerase 4 subunit A [Bacillus cereus Rock4-18] >ref|ZP_04228989.1| DNA topoisomerase 4 subunit A [Bacillus cereus Rock3-29] >ref|ZP_04234800.1| DNA topoisomerase 4 subunit A [Bacillus cereus Rock3-28] >ref|ZP_04246439.1| DNA topoisomerase 4 subunit A [Bacillus cereus Rock1-3] >gb|EEL21921.1| DNA topoisomerase 4 subunit A [Bacillus cereus Rock1-3] >gb|EEL33536.1| DNA topoisomerase 4 subunit A [Bacillus cereus Rock3-28] >gb|EEL39404.1| DNA topoisomerase 4 subunit A [Bacillus cereus Rock3-29] >gb|EEL59923.1| DNA topoisomerase 4 subunit A [Bacillus cereus Rock4-18]
	141 	141 	81% 	1e-31	
ZP_07452532.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Mobiluncus mulieris ATCC 35239] >gb|EFM45799.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Mobiluncus mulieris ATCC 35239]
	141 	141 	82% 	1e-31	
YP_001158523.1 	
DNA topoisomerase IV subunit A [Salinispora tropica CNB-440] >gb|ABP54145.1| DNA topoisomerase IV subunit A [Salinispora tropica CNB-440]
	141 	141 	83% 	1e-31	Gene info linked to YP_001158523.1
YP_002960573.1 	
DNA gyrase subunit A [Mycoplasma conjunctivae HRC/581] >emb|CAT04731.1| DNA gyrase subunit A [Mycoplasma conjunctivae]
	141 	141 	66% 	1e-31	Gene info linked to YP_002960573.1
NP_394514.1 	
DNA gyrase subunit A [Thermoplasma acidophilum DSM 1728] >emb|CAC12182.1| DNA gyrase, subunit A (gyrA) related protein [Thermoplasma acidophilum]
	141 	141 	81% 	1e-31	Gene info linked to NP_394514.1
CBX19912.1 	
gyrase A [Clostridium perfringens]
	141 	141 	50% 	1e-31	
YP_002966762.1 	
DNA gyrase subunit A [Methylobacterium extorquens AM1] >gb|ACS43421.1| DNA gyrase subunit A [Methylobacterium extorquens AM1]
	141 	141 	82% 	1e-31	Gene info linked to YP_002966762.1
YP_003401157.1 	
DNA gyrase, A subunit [Archaeoglobus profundus DSM 5631] >gb|ADB58484.1| DNA gyrase, A subunit [Archaeoglobus profundus DSM 5631]
	141 	141 	96% 	1e-31	Gene info linked to YP_003401157.1
ZP_04007798.1 	
DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus johnsonii ATCC 33200] >gb|EEJ59523.1| DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus johnsonii ATCC 33200]
	141 	141 	82% 	1e-31	
ZP_06806029.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Brevibacterium mcbrellneri ATCC 49030] >gb|EFG47263.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Brevibacterium mcbrellneri ATCC 49030]
	141 	141 	83% 	1e-31	
ABU96678.1 	
topoisomerase IV subunit [Streptococcus dysgalactiae subsp. equisimilis] >gb|ABU96679.1| topoisomerase IV subunit [Streptococcus dysgalactiae subsp. equisimilis] >gb|ABU96680.1| topoisomerase IV subunit [Streptococcus dysgalactiae subsp. equisimilis]
	141 	141 	81% 	1e-31	
ZP_03363789.1 	
DNA gyrase subunit A [Salmonella enterica subsp. enterica serovar Typhi str. E98-0664]
	141 	141 	58% 	1e-31	
ZP_06184225.1 	
DNA gyrase subunit A [Mobiluncus mulieris 28-1] >gb|EEZ91116.1| DNA gyrase subunit A [Mobiluncus mulieris 28-1]
	141 	141 	82% 	1e-31	
NP_348255.1 	
DNA topoisomerase IV subunit A [Clostridium acetobutylicum ATCC 824] >gb|AAK79595.1|AE007672_2 DNA gyrase A subunit [Clostridium acetobutylicum ATCC 824]
	141 	141 	85% 	1e-31	Gene info linked to NP_348255.1
ZP_04169940.1 	
DNA topoisomerase 4 subunit A [Bacillus mycoides DSM 2048] >ref|ZP_04263213.1| DNA topoisomerase 4 subunit A [Bacillus cereus BDRD-ST196] >ref|ZP_04296038.1| DNA topoisomerase 4 subunit A [Bacillus cereus AH621] >gb|EEK72239.1| DNA topoisomerase 4 subunit A [Bacillus cereus AH621] >gb|EEL05043.1| DNA topoisomerase 4 subunit A [Bacillus cereus BDRD-ST196] >gb|EEL98308.1| DNA topoisomerase 4 subunit A [Bacillus mycoides DSM 2048]
	141 	141 	81% 	1e-31	
ZP_07638153.1 	
DNA gyrase/topoisomerase IV, A subunit [Mobiluncus mulieris FB024-16] >gb|EFN93367.1| DNA gyrase/topoisomerase IV, A subunit [Mobiluncus mulieris FB024-16]
	141 	141 	82% 	1e-31	
ZP_01790114.1 	
DNA gyrase subunit A [Haemophilus influenzae PittAA] >gb|EDK08378.1| DNA gyrase subunit A [Haemophilus influenzae PittAA]
	141 	141 	85% 	1e-31	
YP_062005.1 	
DNA topoisomerase IV subunit A [Leifsonia xyli subsp. xyli str. CTCB07] >gb|AAT88900.1| DNA gyrase subunit A [Leifsonia xyli subsp. xyli str. CTCB07]
	141 	141 	82% 	1e-31	Gene info linked to YP_062005.1
YP_249318.1 	
DNA gyrase subunit A [Haemophilus influenzae 86-028NP] >ref|ZP_04465474.1| DNA gyrase subunit A [Haemophilus influenzae 6P18H1] >gb|AAX88658.1| DNA gyrase subunit A [Haemophilus influenzae 86-028NP] >gb|EEP47492.1| DNA gyrase subunit A [Haemophilus influenzae 6P18H1]
	141 	141 	85% 	1e-31	Gene info linked to YP_249318.1

YP_001646087.1 	
DNA topoisomerase IV subunit A [Bacillus weihenstephanensis KBAB4] >gb|ABY44459.1| DNA topoisomerase IV, A subunit [Bacillus weihenstephanensis KBAB4]
	141 	141 	81% 	1e-31	Gene info linked to YP_001646087.1
ZP_07823790.1 	
DNA topoisomerase IV, A subunit [Streptococcus pseudoporcinus SPIN 20026] >gb|EFR44620.1| DNA topoisomerase IV, A subunit [Streptococcus pseudoporcinus SPIN 20026]
	141 	141 	89% 	1e-31	
YP_004138637.1 	
DNA gyrase (type II topoisomerase), subunit A [Haemophilus influenzae F3047] >emb|CBY86960.1| DNA gyrase (type II topoisomerase), subunit A [Haemophilus influenzae F3047]
	141 	141 	85% 	1e-31	Gene info linked to YP_004138637.1
ZP_03993641.1 	
DNA topoisomerase (ATP-hydrolyzing) [Mobiluncus mulieris ATCC 35243] >gb|EEJ54006.1| DNA topoisomerase (ATP-hydrolyzing) [Mobiluncus mulieris ATCC 35243]
	141 	141 	82% 	1e-31	
CBW29606.1 	
DNA gyrase (type II topoisomerase), subunit A [Haemophilus influenzae 10810]
	141 	141 	85% 	1e-31	
ZP_01792536.1 	
DNA gyrase subunit A [Haemophilus influenzae PittHH] >gb|EDK09890.1| DNA gyrase subunit A [Haemophilus influenzae PittHH]
	141 	141 	85% 	2e-31	
YP_003810264.1 	
DNA gyrase (topoisomerase II) A subunit [gamma proteobacterium HdN1] >emb|CBL44607.1| DNA gyrase (topoisomerase II) A subunit [gamma proteobacterium HdN1]
	141 	141 	81% 	2e-31	Gene info linked to YP_003810264.1
ZP_04466941.1 	
DNA gyrase subunit A [Haemophilus influenzae 7P49H1] >gb|EEP46042.1| DNA gyrase subunit A [Haemophilus influenzae 7P49H1]
	140 	140 	85% 	2e-31	
YP_001290607.1 	
DNA gyrase subunit A [Haemophilus influenzae PittEE] >ref|YP_004135153.1| DNA gyrase (type ii topoisomerase), subunit a [Haemophilus influenzae F3031] >gb|ABQ98224.1| DNA gyrase subunit A [Haemophilus influenzae PittEE] >emb|CBY80818.1| DNA gyrase (type II topoisomerase), subunit A [Haemophilus influenzae F3031]
	140 	140 	85% 	2e-31	Gene info linked to YP_001290607.1
NP_965027.1 	
DNA topoisomerase IV subunit A [Lactobacillus johnsonii NCC 533] >gb|AAS08993.1| topoisomerase IV subunit A [Lactobacillus johnsonii NCC 533]
	140 	140 	82% 	2e-31	Gene info linked to NP_965027.1
YP_004032002.1 	
DNA topoisomerase IV subunit A [Lactobacillus amylovorus GRL 1112] >gb|ADQ59207.1| DNA topoisomerase IV subunit A [Lactobacillus amylovorus GRL 1112]
	140 	140 	99% 	2e-31	Gene info linked to YP_004032002.1
ABV03206.1 	
GyrA [Chlamydia trachomatis]
	140 	140 	66% 	2e-31	
YP_278441.1 	
DNA gyrase subunit A [Mycoplasma synoviae 53] >gb|AAZ43730.1| DNA gyrase subunit A [Mycoplasma synoviae 53]
	140 	140 	82% 	2e-31	Gene info linked to YP_278441.1
YP_895991.1 	
DNA topoisomerase IV subunit A [Bacillus thuringiensis str. Al Hakam] >gb|ABK86484.1| DNA topoisomerase IV subunit A [Bacillus thuringiensis str. Al Hakam]
	140 	140 	85% 	2e-31	Gene info linked to YP_895991.1
ZP_05656364.1 	
topoisomerase IV A subunit [Enterococcus casseliflavus EC20] >gb|EEV39697.1| topoisomerase IV A subunit [Enterococcus casseliflavus EC20]
	140 	140 	82% 	2e-31	
EFR84776.1 	
DNA topoisomerase IV, A subunit [Listeria monocytogenes FSL F2-208]
	140 	140 	87% 	2e-31	
ZP_03111789.1 	
DNA topoisomerase IV, A subunit [Bacillus cereus 03BB108] >ref|YP_002750956.1| DNA topoisomerase IV, A subunit [Bacillus cereus 03BB102] >ref|ZP_04313004.1| DNA topoisomerase 4 subunit A [Bacillus cereus BGSC 6E1] >gb|EDX63261.1| DNA topoisomerase IV, A subunit [Bacillus cereus 03BB108] >gb|ACO27176.1| DNA topoisomerase IV, A subunit [Bacillus cereus 03BB102] >gb|EEK55190.1| DNA topoisomerase 4 subunit A [Bacillus cereus BGSC 6E1]
	140 	140 	85% 	2e-31	
YP_003871006.1 	
Topoisomerase IV subunit A [Paenibacillus polymyxa E681] >gb|ADM70468.1| Topoisomerase IV subunit A [Paenibacillus polymyxa E681]
	140 	140 	82% 	2e-31	Gene info linked to YP_003871006.1
YP_002881946.1 	
DNA topoisomerase (ATP-hydrolyzing) [Beutenbergia cavernae DSM 12333] >gb|ACQ80184.1| DNA topoisomerase (ATP-hydrolyzing) [Beutenbergia cavernae DSM 12333]
	140 	140 	83% 	2e-31	Gene info linked to YP_002881946.1
EFR90963.1 	
DNA topoisomerase IV, A subunit [Listeria innocua FSL S4-378]
	140 	140 	87% 	2e-31	
EFR94061.1 	
DNA topoisomerase IV, A subunit [Listeria innocua FSL J1-023]
	140 	140 	87% 	2e-31	
ZP_02949608.1 	
DNA gyrase subunit A [Clostridium butyricum 5521] >ref|ZP_04526880.1| DNA gyrase subunit A [Clostridium butyricum E4 str. BoNT E BL5262] >gb|EDT75239.1| DNA gyrase subunit A [Clostridium butyricum 5521] >gb|EEP55649.1| DNA gyrase subunit A [Clostridium butyricum E4 str. BoNT E BL5262]
	140 	140 	82% 	2e-31	
ZP_08040940.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus equinus ATCC 9812] >gb|EFW89414.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Streptococcus equinus ATCC 9812]
	140 	140 	82% 	2e-31	
ZP_04823686.1 	
DNA gyrase subunit A [Clostridium botulinum E1 str. 'BoNT E Beluga'] >gb|EES50971.1| DNA gyrase subunit A [Clostridium botulinum E1 str. 'BoNT E Beluga']
	140 	140 	83% 	2e-31	
ZP_05647471.1 	
topoisomerase IV A subunit [Enterococcus casseliflavus EC30] >ref|ZP_05653799.1| topoisomerase IV A subunit [Enterococcus casseliflavus EC10] >gb|EEV30804.1| topoisomerase IV A subunit [Enterococcus casseliflavus EC30] >gb|EEV37132.1| topoisomerase IV A subunit [Enterococcus casseliflavus EC10]
	140 	140 	82% 	2e-31	
ZP_07870598.1 	
DNA topoisomerase IV, A subunit [Listeria marthii FSL S4-120] >gb|EFR87899.1| DNA topoisomerase IV, A subunit [Listeria marthii FSL S4-120]
	140 	140 	87% 	3e-31	
NP_777797.1 	
DNA gyrase subunit A [Buchnera aphidicola str. Bp (Baizongia pistaciae)] >sp|Q89AS3.1|GYRA_BUCBP RecName: Full=DNA gyrase subunit A >gb|AAO26902.1| DNA gyrase subunit A [Buchnera aphidicola str. Bp (Baizongia pistaciae)]
	140 	140 	87% 	3e-31	Gene info linked to NP_777797.1
ZP_03236341.1 	
DNA topoisomerase IV, A subunit [Bacillus cereus H3081.97] >ref|YP_002531107.1| DNA topoisomerase iv subunit a [Bacillus cereus Q1] >gb|EDZ57724.1| DNA topoisomerase IV, A subunit [Bacillus cereus H3081.97] >gb|ACM13818.1| DNA topoisomerase IV, subunit A [Bacillus cereus Q1]
	140 	140 	85% 	3e-31	
ZP_03101459.1 	
DNA topoisomerase IV, A subunit [Bacillus cereus W] >ref|YP_002452557.1| DNA topoisomerase IV, A subunit [Bacillus cereus AH820] >ref|ZP_04091684.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1] >ref|ZP_04109505.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar monterrey BGSC 4AJ1] >ref|ZP_04252320.1| DNA topoisomerase 4 subunit A [Bacillus cereus 95/8201] >gb|EDX57081.1| DNA topoisomerase IV, A subunit [Bacillus cereus W] >gb|ACK90860.1| DNA topoisomerase IV, A subunit [Bacillus cereus AH820] >gb|EEL16040.1| DNA topoisomerase 4 subunit A [Bacillus cereus 95/8201] >gb|EEM58785.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar monterrey BGSC 4AJ1] >gb|EEM76568.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1]
	140 	140 	85% 	3e-31	
ZP_07873659.1 	
DNA topoisomerase IV, A subunit [Listeria ivanovii FSL F6-596] >gb|EFR97103.1| DNA topoisomerase IV, A subunit [Listeria ivanovii FSL F6-596]
	140 	140 	87% 	3e-31	
ZP_04223717.1 	
DNA topoisomerase 4 subunit A [Bacillus cereus Rock3-42] >gb|EEL44623.1| DNA topoisomerase 4 subunit A [Bacillus cereus Rock3-42]
	140 	140 	85% 	3e-31	
NP_979913.1 	
DNA topoisomerase IV subunit A [Bacillus cereus ATCC 10987] >ref|YP_002339566.1| DNA topoisomerase IV subunit A [Bacillus cereus AH187] >ref|ZP_04268767.1| DNA topoisomerase 4 subunit A [Bacillus cereus BDRD-ST26] >gb|AAS42521.1| DNA topoisomerase IV, A subunit [Bacillus cereus ATCC 10987] >gb|ACJ81437.1| DNA topoisomerase IV, A subunit [Bacillus cereus AH187] >gb|EEK99568.1| DNA topoisomerase 4 subunit A [Bacillus cereus BDRD-ST26]
	140 	140 	85% 	3e-31	Gene info linked to NP_979913.1
NP_845921.1 	
DNA topoisomerase IV subunit A [Bacillus anthracis str. Ames] >ref|YP_020291.1| DNA topoisomerase IV subunit A [Bacillus anthracis str. 'Ames Ancestor'] >ref|YP_029648.1| DNA topoisomerase IV subunit A [Bacillus anthracis str. Sterne] >ref|YP_037676.1| DNA topoisomerase IV subunit A [Bacillus thuringiensis serovar konkukian str. 97-27] >ref|YP_084889.1| DNA topoisomerase IV subunit A [Bacillus cereus E33L] >ref|ZP_00393834.1| COG0188: Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Bacillus anthracis str. A2012] >ref|ZP_02215653.1| DNA topoisomerase IV, A subunit [Bacillus anthracis str. A0488] >ref|ZP_02394760.1| DNA topoisomerase IV, A subunit [Bacillus anthracis str. A0442] >ref|ZP_02398859.1| DNA topoisomerase IV, A subunit [Bacillus anthracis str. A0193] >ref|ZP_02879676.1| DNA topoisomerase IV, A subunit [Bacillus anthracis str. A0465] >ref|ZP_02898551.1| DNA topoisomerase IV, A subunit [Bacillus anthracis str. A0389] >ref|ZP_02934963.1| DNA topoisomerase IV, A subunit [Bacillus anthracis str. A0174] >ref|ZP_03017587.1| DNA topoisomerase IV, A subunit [Bacillus anthracis Tsiankovskii-I] >ref|ZP_03105747.1| DNA topoisomerase IV, A subunit [Bacillus cereus NVH0597-99] >ref|YP_002813581.1| DNA topoisomerase IV, A subunit [Bacillus anthracis str. CDC 684] >ref|ZP_04097699.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1] >ref|ZP_04324424.1| DNA topoisomerase 4 subunit A [Bacillus cereus m1293] >ref|YP_002867789.1| DNA topoisomerase IV, A subunit [Bacillus anthracis str. A0248] >ref|ZP_05150022.1| DNA topoisomerase IV subunit A [Bacillus anthracis str. CNEVA-9066] >ref|ZP_05187852.1| DNA topoisomerase IV subunit A [Bacillus anthracis str. A1055] >ref|ZP_05196339.1| DNA topoisomerase IV subunit A [Bacillus anthracis str. Western North America USA6153] >ref|ZP_05202484.1| DNA topoisomerase IV subunit A [Bacillus anthracis str. Kruger B] >ref|ZP_05204990.1| DNA topoisomerase IV subunit A [Bacillus anthracis str. Vollum] >ref|ZP_05211252.1| DNA topoisomerase IV subunit A [Bacillus anthracis str. Australia 94] >ref|YP_003793294.1| DNA topoisomerase IV subunit A [Bacillus anthracis CI] >gb|AAP27407.1| DNA topoisomerase IV, A subunit [Bacillus anthracis str. Ames] >gb|AAT32766.1| DNA topoisomerase IV, A subunit [Bacillus anthracis str. 'Ames Ancestor'] >gb|AAT55699.1| DNA topoisomerase IV, A subunit [Bacillus anthracis str. Sterne] >gb|AAT60490.1| DNA topoisomerase IV, subunit A [Bacillus thuringiensis serovar konkukian str. 97-27] >gb|AAU16959.1| DNA topoisomerase IV, subunit A [Bacillus cereus E33L] >gb|EDR18739.1| DNA topoisomerase IV, A subunit [Bacillus anthracis str. A0488] >gb|EDR86849.1| DNA topoisomerase IV, A subunit [Bacillus anthracis str. A0193] >gb|EDR90913.1| DNA topoisomerase IV, A subunit [Bacillus anthracis str. A0442] >gb|EDS95792.1| DNA topoisomerase IV, A subunit [Bacillus anthracis str. A0389] >gb|EDT18393.1| DNA topoisomerase IV, A subunit [Bacillus anthracis str. A0465] >gb|EDT67237.1| DNA topoisomerase IV, A subunit [Bacillus anthracis str. A0174] >gb|EDV17947.1| DNA topoisomerase IV, A subunit [Bacillus anthracis Tsiankovskii-I] >gb|EDX69444.1| DNA topoisomerase IV, A subunit [Bacillus cereus NVH0597-99] >gb|ACP15518.1| DNA topoisomerase IV, A subunit [Bacillus anthracis str. CDC 684] >gb|EEK43879.1| DNA topoisomerase 4 subunit A [Bacillus cereus m1293] >gb|EEM70569.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1] >gb|ACQ47281.1| DNA topoisomerase IV, A subunit [Bacillus anthracis str. A0248] >gb|ADK06156.1| DNA topoisomerase IV subunit A [Bacillus cereus biovar anthracis str. CI]
	140 	140 	85% 	3e-31	Gene info linked to NP_845921.1
YP_002562337.1 	
DNA topoisomerase IV subunit A [Streptococcus uberis 0140J] >emb|CAR42255.1| topoisomerase IV subunit A [Streptococcus uberis 0140J]
	140 	140 	88% 	3e-31	Gene info linked to YP_002562337.1
ZP_00240925.1 	
DNA topoisomerase IV, A subunit [Bacillus cereus G9241] >gb|EAL11467.1| DNA topoisomerase IV, A subunit [Bacillus cereus G9241]
	140 	140 	85% 	3e-31	
ZP_04079796.1 	
DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1] >ref|ZP_04146815.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1] >ref|ZP_04285249.1| DNA topoisomerase 4 subunit A [Bacillus cereus ATCC 4342] >gb|EEK82980.1| DNA topoisomerase 4 subunit A [Bacillus cereus ATCC 4342] >gb|EEM21452.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1] >gb|EEM88502.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1]
	140 	140 	85% 	3e-31	
EFS03408.1 	
DNA topoisomerase IV, A subunit [Listeria seeligeri FSL S4-171]
	140 	140 	87% 	3e-31	
CBW16027.1 	
DNA gyrase (type II topoisomerase), subunit A [Haemophilus parainfluenzae T3T1]
	140 	140 	85% 	3e-31	
NP_470662.1 	
DNA topoisomerase IV subunit A [Listeria innocua Clip11262] >emb|CAC96557.1| parC [Listeria innocua Clip11262]
	140 	140 	87% 	3e-31	Gene info linked to NP_470662.1
ZP_05746282.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Lactobacillus antri DSM 16041] >gb|EEW53171.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Lactobacillus antri DSM 16041]
	139 	139 	88% 	3e-31	
ZP_03390403.1 	
DNA gyrase, A subunit [Capnocytophaga sputigena Capno] >gb|EEB66463.1| DNA gyrase, A subunit [Capnocytophaga sputigena Capno]
	139 	139 	82% 	3e-31	
ZP_02621577.1 	
DNA gyrase subunit A [Clostridium botulinum C str. Eklund] >gb|EDS77374.1| DNA gyrase subunit A [Clostridium botulinum C str. Eklund]
	139 	139 	96% 	4e-31	
ZP_07716471.1 	
DNA topoisomerase IV subunit A [Aeromicrobium marinum DSM 15272] >gb|EFQ84198.1| DNA topoisomerase IV subunit A [Aeromicrobium marinum DSM 15272]
	139 	139 	84% 	4e-31	
ZP_04450304.1 	
hypothetical protein GCWU000282_01539 [Catonella morbi ATCC 51271] >gb|EEP22703.1| hypothetical protein GCWU000282_01539 [Catonella morbi ATCC 51271]
	139 	139 	89% 	4e-31	
ADO96200.1 	
DNA gyrase subunit A [Haemophilus influenzae R2846]
	139 	139 	85% 	4e-31	
YP_527620.1 	
DNA gyrase subunit A [Saccharophagus degradans 2-40] >gb|ABD81408.1| DNA gyrase subunit A [Saccharophagus degradans 2-40]
	139 	139 	85% 	4e-31	Gene info linked to YP_527620.1
ZP_05915028.1 	
DNA topoisomerase IV subunit A [Brevibacterium linens BL2]
	139 	139 	83% 	5e-31	
YP_001975706.1 	
DNA gyrase, A subunit [Wolbachia endosymbiont of Culex quinquefasciatus Pel] >ref|ZP_03334552.1| DNA gyrase, A subunit [Wolbachia endosymbiont of Culex quinquefasciatus JHB] >emb|CAQ55061.1| DNA gyrase, A subunit [Wolbachia endosymbiont of Culex quinquefasciatus Pel] >gb|EEB56335.1| DNA gyrase, A subunit [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
	139 	139 	82% 	5e-31	Gene info linked to YP_001975706.1
YP_088050.1 	
DNA gyrase subunit A [Mannheimia succiniciproducens MBEL55E] >gb|AAU37465.1| GyrA protein [Mannheimia succiniciproducens MBEL55E]
	139 	139 	85% 	5e-31	Gene info linked to YP_088050.1
YP_916329.1 	
DNA topoisomerase IV subunit A [Paracoccus denitrificans PD1222] >gb|ABL70633.1| DNA topoisomerase IV subunit A [Paracoccus denitrificans PD1222]
	139 	139 	81% 	6e-31	Gene info linked to YP_916329.1
ZP_00544673.1 	
DNA gyrase, subunit A [Ehrlichia chaffeensis str. Sapulpa] >ref|YP_507653.1| DNA gyrase subunit A [Ehrlichia chaffeensis str. Arkansas] >gb|EAM85965.1| DNA gyrase, subunit A [Ehrlichia chaffeensis str. Sapulpa] >gb|ABD44722.1| DNA gyrase, A subunit [Ehrlichia chaffeensis str. Arkansas]
	139 	139 	82% 	6e-31	
ABC66093.1 	
DNA gyrase subunit A [Bacillus sp. DAU101]
	139 	139 	41% 	7e-31	
ZP_05131517.1 	
DNA topoisomerase IV subunit A [Clostridium sp. 7_2_43FAA] >gb|EEH98411.1| DNA topoisomerase IV subunit A [Clostridium sp. 7_2_43FAA]
	139 	139 	85% 	7e-31	
XP_001609528.1 	
DNA gyrase A subunit [Babesia bovis T2Bo] >gb|EDO05960.1| DNA gyrase A subunit, putative [Babesia bovis]
	139 	139 	81% 	7e-31	Gene info linked to XP_001609528.1
YP_001345040.1 	
DNA gyrase subunit A [Actinobacillus succinogenes 130Z] >gb|ABR75105.1| DNA gyrase, A subunit [Actinobacillus succinogenes 130Z]
	138 	138 	85% 	8e-31	Gene info linked to YP_001345040.1
YP_003779090.1 	
DNA gyrase subunit A [Clostridium ljungdahlii DSM 13528] >gb|ADK13988.1| DNA gyrase subunit A [Clostridium ljungdahlii DSM 13528]
	138 	138 	82% 	8e-31	Gene info linked to YP_003779090.1
ZP_04873585.1 	
DNA gyrase, A subunit [Aciduliprofundum boonei T469] >ref|YP_003483192.1| DNA gyrase, A subunit [Aciduliprofundum boonei T469] >gb|EDY36902.1| DNA gyrase, A subunit [Aciduliprofundum boonei T469] >gb|ADD08630.1| DNA gyrase, A subunit [Aciduliprofundum boonei T469]
	138 	138 	96% 	8e-31	Gene info linked to ZP_04873585.1
NP_966914.1 	
DNA gyrase subunit A [Wolbachia endosymbiont of Drosophila melanogaster] >gb|AAS14848.1| DNA gyrase, A subunit [Wolbachia endosymbiont of Drosophila melanogaster]
	138 	138 	82% 	9e-31	Gene info linked to NP_966914.1
ZP_06163270.1 	
DNA gyrase/topoisomerase IV, A subunit [Actinomyces sp. oral taxon 848 str. F0332] >gb|EEZ77549.1| DNA gyrase/topoisomerase IV, A subunit [Actinomyces sp. oral taxon 848 str. F0332]
	138 	138 	83% 	1e-30	
ZP_07455904.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Bifidobacterium dentium ATCC 27679] >ref|ZP_07695533.1| DNA gyrase/topoisomerase IV, A subunit [Bifidobacterium dentium JCVIHMP022] >gb|EFM41980.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Bifidobacterium dentium ATCC 27679] >gb|EFO78206.1| DNA gyrase/topoisomerase IV, A subunit [Bifidobacterium dentium JCVIHMP022]
	138 	138 	82% 	1e-30	
ZP_02918456.1 	
hypothetical protein BIFDEN_01763 [Bifidobacterium dentium ATCC 27678] >ref|YP_003360836.1| DNA gyrase subunit A [Bifidobacterium dentium Bd1] >gb|EDT45924.1| hypothetical protein BIFDEN_01763 [Bifidobacterium dentium ATCC 27678] >gb|ADB10012.1| gyrA2 DNA gyrase subunit A [Bifidobacterium dentium Bd1]
	138 	138 	82% 	1e-30	
ZP_08094226.1 	
DNA topoisomerase IV subunit A [Planococcus donghaensis MPA1U2] >gb|EGA90190.1| DNA topoisomerase IV subunit A [Planococcus donghaensis MPA1U2]
	138 	138 	82% 	1e-30	
ZP_04279990.1 	
DNA topoisomerase 4 subunit A [Bacillus cereus m1550] >gb|EEK88234.1| DNA topoisomerase 4 subunit A [Bacillus cereus m1550]
	138 	138 	85% 	1e-30	
ZP_04274538.1 	
DNA topoisomerase 4 subunit A [Bacillus cereus BDRD-ST24] >ref|YP_003665801.1| DNA topoisomerase IV subunit A [Bacillus thuringiensis BMB171] >gb|EEK93677.1| DNA topoisomerase 4 subunit A [Bacillus cereus BDRD-ST24] >gb|ADH08081.1| DNA topoisomerase IV subunit A [Bacillus thuringiensis BMB171]
	138 	138 	85% 	1e-30	
ZP_03981252.1 	
DNA topoisomerase IV subunit A [Enterococcus faecium TX1330] >ref|ZP_06623382.1| DNA topoisomerase IV, A subunit [Enterococcus faecium PC4.1] >gb|EEI60643.1| DNA topoisomerase IV subunit A [Enterococcus faecium TX1330] >gb|EFF62296.1| DNA topoisomerase IV, A subunit [Enterococcus faecium PC4.1]
	138 	138 	88% 	1e-30	
ZP_03149598.1 	
DNA topoisomerase IV, A subunit [Geobacillus sp. G11MC16] >gb|EDY04330.1| DNA topoisomerase IV, A subunit [Geobacillus sp. G11MC16]
	138 	138 	83% 	1e-30	
ZP_07206814.1 	
DNA topoisomerase IV, A subunit [Lactobacillus salivarius ACS-116-V-Col5a] >gb|EFK79472.1| DNA topoisomerase IV, A subunit [Lactobacillus salivarius ACS-116-V-Col5a]
	138 	138 	88% 	1e-30	
ZP_00372302.1 	
DNA gyrase, A subunit [Wolbachia endosymbiont of Drosophila simulans] >gb|EAL60183.1| DNA gyrase, A subunit [Wolbachia endosymbiont of Drosophila simulans]
	138 	138 	82% 	1e-30	
ZP_07700069.1 	
DNA gyrase/topoisomerase IV, A subunit [Lactobacillus iners LactinV 03V1-b] >gb|EFO69721.1| DNA gyrase/topoisomerase IV, A subunit [Lactobacillus iners LactinV 03V1-b]
	138 	138 	69% 	1e-30	
ZP_05675827.1 	
DNA topoisomerase IV subunit A [Enterococcus faecium Com12] >gb|EEV59160.1| DNA topoisomerase IV subunit A [Enterococcus faecium Com12]
	137 	137 	88% 	1e-30	
YP_002368409.1 	
DNA topoisomerase IV subunit A [Bacillus cereus B4264] >gb|ACK62432.1| DNA topoisomerase IV, A subunit [Bacillus cereus B4264]
	137 	137 	85% 	1e-30	Gene info linked to YP_002368409.1
ZP_04066260.1 	
DNA topoisomerase 4 subunit A [Bacillus thuringiensis IBL 4222] >ref|ZP_04127544.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar sotto str. T04001] >gb|EEM40763.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar sotto str. T04001] >gb|EEN02018.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis IBL 4222]
	137 	137 	81% 	1e-30	
ZP_00742825.1 	
Topoisomerase IV subunit A [Bacillus thuringiensis serovar israelensis ATCC 35646] >gb|EAO52908.1| Topoisomerase IV subunit A [Bacillus thuringiensis serovar israelensis ATCC 35646]
	137 	137 	81% 	2e-30	
ZP_06341238.1 	
DNA topoisomerase IV, A subunit [Bulleidia extructa W1219] >gb|EFC06090.1| DNA topoisomerase IV, A subunit [Bulleidia extructa W1219]
	137 	137 	88% 	2e-30	
YP_003161373.1 	
DNA topoisomerase (ATP-hydrolyzing) [Jonesia denitrificans DSM 20603] >gb|ACV09070.1| DNA topoisomerase (ATP-hydrolyzing) [Jonesia denitrificans DSM 20603]
	137 	137 	83% 	2e-30	Gene info linked to YP_003161373.1
YP_002447101.1 	
DNA topoisomerase IV, A subunit [Bacillus cereus G9842] >gb|ACK97892.1| DNA topoisomerase IV, A subunit [Bacillus cereus G9842]
	137 	137 	81% 	2e-30	Gene info linked to YP_002447101.1
ZP_00373130.1 	
DNA gyrase, A subunit [Wolbachia endosymbiont of Drosophila ananassae] >gb|EAL59368.1| DNA gyrase, A subunit [Wolbachia endosymbiont of Drosophila ananassae]
	137 	137 	82% 	2e-30	
ZP_00049686.1 	
COG0188: Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Magnetospirillum magnetotacticum MS-1]
	137 	137 	77% 	2e-30	
YP_002727660.1 	
DNA gyrase, A subunit [Wolbachia sp. wRi] >gb|ACN95869.1| DNA gyrase, A subunit [Wolbachia sp. wRi]
	137 	137 	82% 	2e-30	Gene info linked to YP_002727660.1
ZP_08007243.1 	
hypothetical protein HMPREF1013_03858 [Bacillus sp. 2_A_57_CT2] >gb|EFV75798.1| hypothetical protein HMPREF1013_03858 [Bacillus sp. 2_A_57_CT2]
	137 	137 	82% 	2e-30	
YP_003688224.1 	
DNA gyrase subunit A (DNA topoisomerase (ATP-hydrolysing)) [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1] >emb|CBL56796.1| DNA gyrase subunit A (DNA topoisomerase (ATP-hydrolysing)) [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
	137 	137 	83% 	2e-30	Gene info linked to YP_003688224.1
YP_302881.1 	
DNA gyrase subunit A [Ehrlichia canis str. Jake] >gb|AAZ68283.1| DNA gyrase, subunit A [Ehrlichia canis str. Jake]
	137 	137 	82% 	2e-30	Gene info linked to YP_302881.1
ZP_08025685.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Actinomyces sp. oral taxon 178 str. F0338] >gb|EFW10731.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Actinomyces sp. oral taxon 178 str. F0338]
	137 	137 	83% 	2e-30	
ZP_05667333.1 	
DNA topoisomerase IV subunit A [Enterococcus faecium 1,141,733] >gb|EEV50666.1| DNA topoisomerase IV subunit A [Enterococcus faecium 1,141,733]
	137 	137 	88% 	2e-30	
ZP_07831047.1 	
DNA topoisomerase IV, A subunit [Clostridium sp. HGF2] >gb|EFR39499.1| DNA topoisomerase IV, A subunit [Clostridium sp. HGF2]
	137 	137 	82% 	2e-30	
YP_001125755.1 	
DNA topoisomerase IV subunit A [Geobacillus thermodenitrificans NG80-2] >gb|ABO67010.1| DNA topoisomerase IV A subunit [Geobacillus thermodenitrificans NG80-2]
	137 	137 	83% 	2e-30	Gene info linked to YP_001125755.1
ZP_01314893.1 	
hypothetical protein Wendoof_01000267 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24]
	137 	137 	82% 	2e-30	
ZP_04121455.1 	
DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar pakistani str. T13001] >ref|ZP_04192878.1| DNA topoisomerase 4 subunit A [Bacillus cereus AH676] >ref|ZP_04240579.1| DNA topoisomerase 4 subunit A [Bacillus cereus Rock1-15] >gb|EEL27668.1| DNA topoisomerase 4 subunit A [Bacillus cereus Rock1-15] >gb|EEL75367.1| DNA topoisomerase 4 subunit A [Bacillus cereus AH676] >gb|EEM46852.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar pakistani str. T13001]
	137 	137 	85% 	2e-30	
ZP_03959263.1 	
DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus vaginalis ATCC 49540] >gb|EEJ41151.1| DNA topoisomerase (ATP-hydrolyzing) [Lactobacillus vaginalis ATCC 49540]
	137 	137 	82% 	2e-30	
ZP_01174113.1 	
DNA topoisomerase IV subunit A [Bacillus sp. NRRL B-14911] >gb|EAR63173.1| DNA topoisomerase IV subunit A [Bacillus sp. NRRL B-14911]
	137 	137 	82% 	2e-30	
ZP_03788209.1 	
DNA gyrase subunit A [Wolbachia endosymbiont of Muscidifurax uniraptor] >gb|EEH11974.1| DNA gyrase subunit A [Wolbachia endosymbiont of Muscidifurax uniraptor]
	137 	137 	82% 	2e-30	
ZP_04085610.1 	
DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1] >ref|ZP_04115903.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar kurstaki str. T03a001] >gb|EEM52412.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar kurstaki str. T03a001] >gb|EEM82692.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1]
	137 	137 	85% 	2e-30	
ZP_03229675.1 	
DNA topoisomerase IV, A subunit [Bacillus cereus AH1134] >ref|ZP_04204321.1| DNA topoisomerase 4 subunit A [Bacillus cereus F65185] >ref|ZP_04213319.1| DNA topoisomerase 4 subunit A [Bacillus cereus Rock4-2] >ref|ZP_04307228.1| DNA topoisomerase 4 subunit A [Bacillus cereus 172560W] >ref|ZP_04318660.1| DNA topoisomerase 4 subunit A [Bacillus cereus ATCC 10876] >gb|EDZ52919.1| DNA topoisomerase IV, A subunit [Bacillus cereus AH1134] >gb|EEK49683.1| DNA topoisomerase 4 subunit A [Bacillus cereus ATCC 10876] >gb|EEK61038.1| DNA topoisomerase 4 subunit A [Bacillus cereus 172560W] >gb|EEL55003.1| DNA topoisomerase 4 subunit A [Bacillus cereus Rock4-2] >gb|EEL63984.1| DNA topoisomerase 4 subunit A [Bacillus cereus F65185]
	137 	137 	85% 	2e-30	
ZP_03053518.1 	
DNA topoisomerase IV, A subunit [Bacillus pumilus ATCC 7061] >gb|EDW23492.1| DNA topoisomerase IV, A subunit [Bacillus pumilus ATCC 7061]
	137 	137 	82% 	3e-30	
ZP_04008679.1 	
DNA topoisomerase IV subunit A [Lactobacillus salivarius ATCC 11741] >gb|EEJ74704.1| DNA topoisomerase IV subunit A [Lactobacillus salivarius ATCC 11741]
	137 	137 	88% 	3e-30	
ZP_06873502.1 	
DNA topoisomerase IV subunit A [Bacillus subtilis subsp. spizizenii ATCC 6633] >ref|YP_003866216.1| DNA topoisomerase IV subunit A [Bacillus subtilis subsp. spizizenii str. W23] >gb|EFG92906.1| DNA topoisomerase IV subunit A [Bacillus subtilis subsp. spizizenii ATCC 6633] >gb|ADM37907.1| DNA topoisomerase IV subunit A [Bacillus subtilis subsp. spizizenii str. W23]
	137 	137 	82% 	3e-30	
ZP_04073231.1 	
DNA topoisomerase 4 subunit A [Bacillus thuringiensis IBL 200] >ref|ZP_04103244.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar berliner ATCC 10792] >ref|ZP_04134181.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar thuringiensis str. T01001] >ref|ZP_04140471.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis Bt407] >gb|EEM27768.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis Bt407] >gb|EEM34057.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar thuringiensis str. T01001] >gb|EEM64987.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis serovar berliner ATCC 10792] >gb|EEM95012.1| DNA topoisomerase 4 subunit A [Bacillus thuringiensis IBL 200]
	137 	137 	81% 	3e-30	
AAV80736.1 	
gyrase subunit A [Bacillus sp. NRRL B-23959]
	137 	137 	39% 	3e-30	
YP_794979.1 	
DNA topoisomerase IV subunit A [Lactobacillus brevis ATCC 367] >gb|ABJ63948.1| DNA topoisomerase IV subunit A [Lactobacillus brevis ATCC 367]
	137 	137 	85% 	3e-30	Gene info linked to YP_794979.1
BAH66656.1 	
DNA topoisomerase IV subunit A [Lactobacillus brevis]
	136 	136 	85% 	3e-30	
NP_833328.1 	
DNA topoisomerase IV subunit A [Bacillus cereus ATCC 14579] >ref|ZP_04257844.1| DNA topoisomerase 4 subunit A [Bacillus cereus BDRD-Cer4] >gb|AAP10529.1| Topoisomerase IV subunit A [Bacillus cereus ATCC 14579] >gb|EEL10435.1| DNA topoisomerase 4 subunit A [Bacillus cereus BDRD-Cer4]
	136 	136 	85% 	3e-30	Gene info linked to NP_833328.1
AAV80734.1 	
gyrase subunit A [Bacillus sp. NRRL B-23964]
	136 	136 	39% 	3e-30	
YP_001536554.1 	
DNA topoisomerase IV subunit A [Salinispora arenicola CNS-205] >gb|ABV97563.1| DNA topoisomerase (ATP-hydrolyzing) [Salinispora arenicola CNS-205]
	136 	136 	83% 	3e-30	Gene info linked to YP_001536554.1
AAV80735.1 	
gyrase subunit A [Bacillus sp. NRRL B-23958]
	136 	136 	39% 	3e-30	
YP_001486948.1 	
DNA topoisomerase IV subunit A [Bacillus pumilus SAFR-032] >gb|ABV62388.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Bacillus pumilus SAFR-032]
	136 	136 	82% 	4e-30	Gene info linked to YP_001486948.1
ADJ78998.1 	
Topoisomerase IV subunit A [Lactobacillus salivarius CECT 5713]
	136 	136 	88% 	4e-30	
ZP_05965094.1 	
putative DNA gyrase subunit A [Bifidobacterium gallicum DSM 20093] >gb|EFA23412.1| putative DNA gyrase subunit A [Bifidobacterium gallicum DSM 20093]
	136 	136 	80% 	4e-30	
ZP_07577336.1 	
DNA gyrase, A subunit [Thermotogales bacterium mesG1.Ag.4.2] >gb|EFN47172.1| DNA gyrase, A subunit [Thermotogales bacterium mesG1.Ag.4.2]
	136 	136 	82% 	4e-30	
ZP_03984767.1 	
possible DNA topoisomerase IV subunit A [Enterococcus faecalis HH22] >gb|EEI57120.1| possible DNA topoisomerase IV subunit A [Enterococcus faecalis HH22]
	136 	136 	82% 	4e-30	
YP_535765.1 	
DNA topoisomerase IV subunit A [Lactobacillus salivarius UCC118] >gb|ABD99682.1| Topoisomerase IV subunit A [Lactobacillus salivarius UCC118]
	136 	136 	84% 	4e-30	Gene info linked to YP_535765.1
ZP_04783313.1 	
DNA topoisomerase (ATP-hydrolyzing) [Weissella paramesenteroides ATCC 33313] >gb|EER74499.1| DNA topoisomerase (ATP-hydrolyzing) [Weissella paramesenteroides ATCC 33313]
	136 	136 	83% 	5e-30	
YP_003142129.1 	
DNA gyrase, A subunit [Capnocytophaga ochracea DSM 7271] >gb|ACU93568.1| DNA gyrase, A subunit [Capnocytophaga ochracea DSM 7271]
	135 	135 	82% 	5e-30	Gene info linked to YP_003142129.1
XP_002526325.1 	
DNA gyrase subunit A, chloroplast/mitochondrial precursor, putative [Ricinus communis] >gb|EEF36061.1| DNA gyrase subunit A, chloroplast/mitochondrial precursor, putative [Ricinus communis]
	135 	135 	54% 	6e-30	Gene info linked to XP_002526325.1
ZP_03591545.1 	
DNA topoisomerase IV subunit A [Bacillus subtilis subsp. subtilis str. 168] >ref|ZP_03595825.1| DNA topoisomerase IV subunit A [Bacillus subtilis subsp. subtilis str. NCIB 3610] >ref|ZP_03600236.1| DNA topoisomerase IV subunit A [Bacillus subtilis subsp. subtilis str. JH642] >ref|ZP_03604510.1| DNA topoisomerase IV subunit A [Bacillus subtilis subsp. subtilis str. SMY] >ref|NP_389692.2| DNA topoisomerase IV subunit A [Bacillus subtilis subsp. subtilis str. 168] >sp|Q45066.2|PARC_BACSU RecName: Full=DNA topoisomerase 4 subunit A; AltName: Full=Topoisomerase IV subunit A >gb|AAB81615.1| ParC [Bacillus subtilis] >emb|CAB13693.2| subunit A of DNA topoisomerase IV [Bacillus subtilis subsp. subtilis str. 168]
	135 	135 	81% 	6e-30	Gene info linked to ZP_03591545.1PubChem BioAssay Info linked to ZP_03591545.1
ZP_07865876.1 	
DNA topoisomerase (ATP-hydrolyzing) subunit A [Capnocytophaga ochracea F0287] >gb|EFS98014.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Capnocytophaga ochracea F0287]
	135 	135 	82% 	6e-30	
BAI85496.1 	
DNA topoisomerase IV subunit A [Bacillus subtilis subsp. natto BEST195]
	135 	135 	81% 	6e-30	
CAA97607.1 	
GrlA [Bacillus subtilis subsp. subtilis str. 168]
	135 	135 	81% 	6e-30	
ABJ55986.1 	
DNA gyrase subunit A [Bacillus licheniformis]
	135 	135 	38% 	6e-30	
YP_196168.1 	
DNA gyrase subunit A [Ehrlichia ruminantium str. Gardel] >emb|CAI27694.1| DNA gyrase subunit A [Ehrlichia ruminantium str. Gardel]
	135 	135 	82% 	6e-30	Gene info linked to YP_196168.1
YP_180109.1 	
DNA gyrase subunit A [Ehrlichia ruminantium str. Welgevonden] >ref|YP_197122.1| DNA gyrase subunit A [Ehrlichia ruminantium str. Welgevonden] >emb|CAH57959.1| DNA gyrase subunit A [Ehrlichia ruminantium str. Welgevonden] >emb|CAI26740.1| DNA gyrase subunit A [Ehrlichia ruminantium str. Welgevonden]
	135 	135 	82% 	6e-30	Gene info linked to YP_180109.1
ZP_05678464.1 	
DNA topoisomerase IV subunit A [Enterococcus faecium Com15] >gb|EEV61797.1| DNA topoisomerase IV subunit A [Enterococcus faecium Com15]
	135 	135 	82% 	7e-30	
ZP_05669422.1 	
DNA topoisomerase IV subunit A [Enterococcus faecium 1,231,410] >gb|EEV52755.1| DNA topoisomerase IV subunit A [Enterococcus faecium 1,231,410]
	135 	135 	82% 	7e-30	
ZP_05714246.1 	
DNA topoisomerase IV subunit A [Enterococcus faecium DO]
	135 	135 	82% 	7e-30	
ZP_03683791.1 	
hypothetical protein CATMIT_02452 [Catenibacterium mitsuokai DSM 15897] >gb|EEF92890.1| hypothetical protein CATMIT_02452 [Catenibacterium mitsuokai DSM 15897]
	135 	135 	96% 	7e-30	
ZP_06681355.1 	
DNA topoisomerase IV, A subunit [Enterococcus faecium E980] >gb|EFF38954.1| DNA topoisomerase IV, A subunit [Enterococcus faecium E980]
	135 	135 	82% 	7e-30	
ZP_05657685.1 	
DNA topoisomerase IV subunit A [Enterococcus faecium 1,230,933] >ref|ZP_05671947.1| DNA topoisomerase IV subunit A [Enterococcus faecium 1,231,408] >ref|ZP_05831268.1| DNA topoisomerase IV subunit A [Enterococcus faecium C68] >gb|EEV41018.1| DNA topoisomerase IV subunit A [Enterococcus faecium 1,230,933] >gb|EEV55280.1| DNA topoisomerase IV subunit A [Enterococcus faecium 1,231,408] >gb|EEW63155.1| DNA topoisomerase IV subunit A [Enterococcus faecium C68]
	135 	135 	82% 	8e-30	
ZP_07845354.1 	
DNA topoisomerase IV, A subunit [Enterococcus faecium TX0133a04] >ref|ZP_07848831.1| DNA topoisomerase IV, A subunit [Enterococcus faecium TX0133C] >ref|ZP_07854834.1| DNA topoisomerase IV, A subunit [Enterococcus faecium TX0133A] >ref|ZP_07857256.1| DNA topoisomerase IV, A subunit [Enterococcus faecium TX0133B] >ref|ZP_07860926.1| DNA topoisomerase IV, A subunit [Enterococcus faecium TX0133a01] >gb|EFR68788.1| DNA topoisomerase IV, A subunit [Enterococcus faecium TX0133a01] >gb|EFR72454.1| DNA topoisomerase IV, A subunit [Enterococcus faecium TX0133B] >gb|EFR74919.1| DNA topoisomerase IV, A subunit [Enterococcus faecium TX0133A] >gb|EFR78067.1| DNA topoisomerase IV, A subunit [Enterococcus faecium TX0133C] >gb|EFS07199.1| DNA topoisomerase IV, A subunit [Enterococcus faecium TX0133a04]
	135 	135 	82% 	8e-30	
YP_003920493.1 	
subunit A of DNA topoisomerase IV [Bacillus amyloliquefaciens DSM 7] >emb|CBI43023.1| subunit A of DNA topoisomerase IV [Bacillus amyloliquefaciens DSM 7]
	135 	135 	81% 	9e-30	Gene info linked to YP_003920493.1
ZP_05660835.1 	
DNA topoisomerase IV subunit A [Enterococcus faecium 1,231,502] >gb|EEV44168.1| DNA topoisomerase IV subunit A [Enterococcus faecium 1,231,502]
	135 	135 	82% 	9e-30	
ZP_06675339.1 	
DNA topoisomerase IV, A subunit [Enterococcus faecium E1039] >ref|ZP_06677883.1| DNA topoisomerase IV, A subunit [Enterococcus faecium E1162] >ref|ZP_06679489.1| DNA topoisomerase IV, A subunit [Enterococcus faecium E1071] >gb|EFF20955.1| DNA topoisomerase IV, A subunit [Enterococcus faecium E1071] >gb|EFF31397.1| DNA topoisomerase IV, A subunit [Enterococcus faecium E1039] >gb|EFF34180.1| DNA topoisomerase IV, A subunit [Enterococcus faecium E1162]
	135 	135 	82% 	9e-30	
ZP_05664498.1 	
DNA topoisomerase IV subunit A [Enterococcus faecium 1,231,501] >gb|EEV47831.1| DNA topoisomerase IV subunit A [Enterococcus faecium 1,231,501]
	135 	135 	82% 	9e-30	
ZP_06701359.1 	
DNA topoisomerase IV, A subunit [Enterococcus faecium U0317] >ref|ZP_07852149.1| DNA topoisomerase IV, A subunit [Enterococcus faecium TX0082] >gb|EFF29306.1| DNA topoisomerase IV, A subunit [Enterococcus faecium U0317] >gb|EFS09423.1| DNA topoisomerase IV, A subunit [Enterococcus faecium TX0082]
	135 	135 	82% 	9e-30	
ZP_02962751.1 	
DNA topoisomerase IV subunit A [Bifidobacterium animalis subsp. lactis HN019] >ref|YP_002968514.1| DNA topoisomerase IV subunit A [Bifidobacterium animalis subsp. lactis Bl-04] >ref|YP_002970081.1| DNA topoisomerase IV subunit A [Bifidobacterium animalis subsp. lactis DSM 10140] >gb|EDT89628.1| DNA topoisomerase IV subunit A [Bifidobacterium animalis subsp. lactis HN019] >gb|ACS46452.1| DNA topoisomerase IV subunit A [Bifidobacterium animalis subsp. lactis Bl-04] >gb|ACS48019.1| DNA topoisomerase IV subunit A [Bifidobacterium animalis subsp. lactis DSM 10140] >gb|ADG33644.1| DNA topoisomerase IV subunit A [Bifidobacterium animalis subsp. lactis V9]
	135 	135 	81% 	1e-29	
ADC86111.1 	
DNA gyrase subunit A [Bifidobacterium animalis subsp. lactis BB-12]
	134 	134 	81% 	1e-29	
AAV80740.1 	
gyrase subunit A [Bacillus sp. NRRL B-23980]
	134 	134 	38% 	1e-29	
EFT89113.1 	
DNA topoisomerase IV, A subunit [Enterococcus faecalis TX2141]
	134 	134 	82% 	1e-29	
ZP_05566049.1 	
DNA topoisomerase IV subunit A [Enterococcus faecalis Merz96] >gb|EEU69006.1| DNA topoisomerase IV subunit A [Enterococcus faecalis Merz96]
	134 	134 	82% 	1e-29	
ZP_04438687.1 	
DNA topoisomerase (ATP-hydrolyzing) [Enterococcus faecalis ATCC 29200] >gb|EEN70871.1| DNA topoisomerase (ATP-hydrolyzing) [Enterococcus faecalis ATCC 29200] >gb|EFU02143.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0312]
	134 	134 	82% 	1e-29	
ZP_05573421.1 	
DNA topoisomerase IV subunit A [Enterococcus faecalis JH1] >ref|ZP_06747035.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis PC1.1] >gb|EEU74392.1| DNA topoisomerase IV subunit A [Enterococcus faecalis JH1] >gb|EFG19719.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis PC1.1]
	134 	134 	82% 	1e-29	
ZP_05593137.1 	
DNA topoisomerase IV subunit A [Enterococcus faecalis AR01/DG] >gb|EEU87931.1| DNA topoisomerase IV subunit A [Enterococcus faecalis ARO1/DG]
	134 	134 	82% 	1e-29	
EFT94503.1 	
DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0012]
	134 	134 	82% 	1e-29	
ZP_06628862.1 	
DNA topoisomerase IV, A subunit [Enterococcus faecalis R712] >ref|ZP_06634024.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis S613] >ref|ZP_07766576.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis DAPTO 512] >ref|ZP_07769050.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis DAPTO 516] >gb|EFE16973.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis R712] >gb|EFE18147.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis S613] >gb|EFQ09896.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis DAPTO 512] >gb|EFQ68032.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis DAPTO 516]
	134 	134 	82% 	1e-29	
ZP_05569247.1 	
DNA topoisomerase IV subunit A [Enterococcus faecalis HIP11704] >gb|EEU72204.1| DNA topoisomerase IV subunit A [Enterococcus faecalis HIP11704]
	134 	134 	82% 	1e-29	
ZP_04434497.1 	
DNA topoisomerase (ATP-hydrolyzing) [Enterococcus faecalis TX1322] >ref|ZP_07552252.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX4248] >ref|ZP_07556072.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX2134] >ref|ZP_07559101.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0860] >ref|ZP_07569111.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0109] >ref|ZP_07571816.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0411] >ref|ZP_07758794.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0470] >ref|ZP_07762537.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0635] >ref|ZP_07770443.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0102] >dbj|BAB69481.1| topoisomerase IV A subunit [Enterococcus faecalis] >gb|EEN75071.1| DNA topoisomerase (ATP-hydrolyzing) [Enterococcus faecalis TX1322] >gb|EFM66493.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0411] >gb|EFM69225.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0109] >gb|EFM74600.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0860] >gb|EFM77464.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX2134] >gb|EFM81116.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX4248] >gb|EFQ13796.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0102] >gb|EFQ16516.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0635] >gb|EFQ71890.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0470] >gb|EFT39149.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX2137] >gb|EFT41267.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX4000] >gb|EFT45950.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0017] >gb|EFT48959.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0027] >gb|EFT91330.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX4244] >gb|EFT96446.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0031] >gb|EFU08081.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX1302] >gb|EFU13003.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX1341] >gb|EFU16272.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX1346] >gb|EFU88008.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0309B] >gb|EFU89848.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0630] >gb|EFU92660.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0309A]
	134 	134 	82% 	1e-29	
ADX80218.1 	
DNA topoisomerase IV, A subunit [Enterococcus faecalis 62]
	134 	134 	82% 	1e-29	
EFU04404.1 	
DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0645]
	134 	134 	82% 	1e-29	
ZP_05599551.1 	
topoisomerase IV subunit A [Enterococcus faecalis X98] >gb|EEU94345.1| topoisomerase IV subunit A [Enterococcus faecalis X98]
	134 	134 	82% 	1e-29	
ZP_05475959.1 	
DNA topoisomerase IV subunit A [Enterococcus faecalis ATCC 4200] >gb|EEU17816.1| DNA topoisomerase IV subunit A [Enterococcus faecalis ATCC 4200]
	134 	134 	82% 	1e-29	
YP_001421385.1 	
DNA topoisomerase IV subunit A [Bacillus amyloliquefaciens FZB42] >gb|ABS74154.1| ParC [Bacillus amyloliquefaciens FZB42]
	134 	134 	81% 	1e-29	Gene info linked to YP_001421385.1
YP_003697117.1 	
DNA topoisomerase (ATP-hydrolyzing) [Arcanobacterium haemolyticum DSM 20595] >gb|ADH92498.1| DNA topoisomerase (ATP-hydrolyzing) [Arcanobacterium haemolyticum DSM 20595]
	134 	134 	82% 	1e-29	Gene info linked to YP_003697117.1
CBX19913.1 	
gyrase A [Clostridium perfringens]
	134 	134 	44% 	1e-29	
ZP_05576862.1 	
DNA topoisomerase IV subunit A [Enterococcus faecalis E1Sol] >gb|EEU77833.1| DNA topoisomerase IV subunit A [Enterococcus faecalis E1Sol]
	134 	134 	82% 	1e-29	
ZP_05426382.1 	
DNA topoisomerase IV subunit A [Enterococcus faecalis T2] >gb|EET99290.1| DNA topoisomerase IV subunit A [Enterococcus faecalis T2]
	134 	134 	82% 	1e-29	
NP_815327.1 	
DNA topoisomerase IV subunit A [Enterococcus faecalis V583] >ref|ZP_05423330.1| DNA topoisomerase IV subunit A [Enterococcus faecalis T1] >ref|ZP_05558545.1| topoisomerase IV A subunit [Enterococcus faecalis T8] >ref|ZP_05563200.1| DNA topoisomerase IV subunit A [Enterococcus faecalis DS5] >ref|ZP_05579494.1| DNA topoisomerase IV subunit A [Enterococcus faecalis Fly1] >ref|ZP_05581055.1| DNA topoisomerase IV subunit A [Enterococcus faecalis D6] >ref|ZP_05584295.1| DNA topoisomerase IV subunit A [Enterococcus faecalis CH188] >ref|ZP_05596339.1| DNA topoisomerase IV subunit A [Enterococcus faecalis T11] >ref|ZP_07106535.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TUSoD Ef11] >gb|AAO81397.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis V583] >gb|EET96238.1| DNA topoisomerase IV subunit A [Enterococcus faecalis T1] >gb|EEU26672.1| topoisomerase IV A subunit [Enterococcus faecalis T8] >gb|EEU66157.1| DNA topoisomerase IV subunit A [Enterococcus faecalis DS5] >gb|EEU80465.1| DNA topoisomerase IV subunit A [Enterococcus faecalis Fly1] >gb|EEU82026.1| DNA topoisomerase IV subunit A [Enterococcus faecalis D6] >gb|EEU85266.1| DNA topoisomerase IV subunit A [Enterococcus faecalis CH188] >gb|EEU91133.1| DNA topoisomerase IV subunit A [Enterococcus faecalis T11] >gb|EFK77237.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TUSoD Ef11]
	134 	134 	82% 	1e-29	Gene info linked to NP_815327.1
ZP_07554421.1 	
DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0855] >gb|EFM79184.1| DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0855]
	134 	134 	82% 	1e-29	
YP_004203741.1 	
DNA topoisomerase IV subunit A [Bacillus subtilis BSn5] >gb|ADV92714.1| DNA topoisomerase IV subunit A [Bacillus subtilis BSn5]
	134 	134 	80% 	1e-29	Gene info linked to YP_004203741.1
ZP_05922301.1 	
DNA topoisomerase IV subunit A [Enterococcus faecium TC 6] >ref|ZP_06445581.1| DNA topoisomerase IV, A subunit [Enterococcus faecium D344SRF] >gb|EEW65705.1| DNA topoisomerase IV subunit A [Enterococcus faecium TC 6] >gb|EFD10982.1| DNA topoisomerase IV, A subunit [Enterococcus faecium D344SRF]
	134 	134 	82% 	2e-29	
ZP_07054535.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Listeria grayi DSM 20601] >gb|EFI83416.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Listeria grayi DSM 20601]
	134 	134 	87% 	2e-29	
ZP_03991466.1 	
possible DNA topoisomerase (ATP-hydrolyzing) [Oribacterium sinus F0268] >gb|EEJ51345.1| possible DNA topoisomerase (ATP-hydrolyzing) [Oribacterium sinus F0268]
	134 	134 	63% 	2e-29	
EFT99719.1 	
DNA topoisomerase IV, A subunit [Enterococcus faecalis TX0043]
	134 	134 	82% 	2e-29	
ZP_06697119.1 	
DNA topoisomerase IV, A subunit [Enterococcus faecium E1679] >gb|EFF27490.1| DNA topoisomerase IV, A subunit [Enterococcus faecium E1679]
	134 	134 	82% 	2e-29	
ZP_06694704.1 	
DNA topoisomerase IV, A subunit [Enterococcus faecium E1636] >gb|EFF23885.1| DNA topoisomerase IV, A subunit [Enterococcus faecium E1636]
	134 	134 	82% 	2e-29	
YP_003342520.1 	
DNA topoisomerase [Streptosporangium roseum DSM 43021] >gb|ACZ89777.1| DNA topoisomerase (ATP-hydrolyzing) [Streptosporangium roseum DSM 43021]
	134 	134 	84% 	2e-29	Gene info linked to YP_003342520.1
YP_989154.1 	
DNA topoisomerase IV subunit A [Bartonella bacilliformis KC583] >gb|ABM45562.1| DNA topoisomerase IV, A subunit [Bartonella bacilliformis KC583]
	134 	134 	81% 	2e-29	Gene info linked to YP_989154.1
YP_002335351.1 	
DNA gyrase, A subunit [Thermosipho africanus TCF52B] >gb|ACJ76010.1| DNA gyrase, A subunit [Thermosipho africanus TCF52B]
	134 	134 	96% 	2e-29	Gene info linked to YP_002335351.1
YP_033769.1 	
DNA topoisomerase IV subunit A [Bartonella henselae str. Houston-1] >emb|CAF27771.1| Topoisomerase IV subunit a [Bartonella henselae str. Houston-1]
	134 	134 	77% 	2e-29	Gene info linked to YP_033769.1
ZP_08016847.1 	
DNA gyrase subunit A [Sutterella wadsworthensis 3_1_45B] >gb|EFW00858.1| DNA gyrase subunit A [Sutterella wadsworthensis 3_1_45B]
	134 	134 	81% 	2e-29	
YP_079226.1 	
DNA topoisomerase IV subunit A [Bacillus licheniformis ATCC 14580] >ref|YP_091643.1| DNA topoisomerase IV subunit A [Bacillus licheniformis ATCC 14580] >ref|ZP_07999838.1| ParC protein [Bacillus sp. BT1B_CT2] >gb|AAU23588.1| subunit of DNA topoisomerase IV [Bacillus licheniformis ATCC 14580] >gb|AAU40950.1| ParC [Bacillus licheniformis ATCC 14580] >gb|EFV73287.1| ParC protein [Bacillus sp. BT1B_CT2]
	134 	134 	82% 	2e-29	Gene info linked to YP_079226.1
YP_508495.1 	
DNA topoisomerase IV subunit A [Jannaschia sp. CCS1] >gb|ABD53470.1| DNA topoisomerase IV subunit A [Jannaschia sp. CCS1]
	134 	134 	85% 	2e-29	Gene info linked to YP_508495.1
EFU13797.1 	
DNA topoisomerase IV, A subunit [Enterococcus faecalis TX1342]
	134 	134 	82% 	2e-29	
ZP_05503129.1 	
DNA topoisomerase IV subunit A [Enterococcus faecalis T3] >gb|EEU23495.1| DNA topoisomerase IV subunit A [Enterococcus faecalis T3]
	134 	134 	82% 	2e-29	
ADQ57987.1 	
DNA gyrase subunit A [Haemophilus parasuis] >gb|ADQ57989.1| DNA gyrase subunit A [Haemophilus parasuis]
	134 	134 	58% 	2e-29	
ZP_04157940.1 	
DNA topoisomerase 4 subunit A [Bacillus mycoides Rock3-17] >ref|ZP_04163526.1| DNA topoisomerase 4 subunit A [Bacillus mycoides Rock1-4] >gb|EEM04761.1| DNA topoisomerase 4 subunit A [Bacillus mycoides Rock1-4] >gb|EEM10347.1| DNA topoisomerase 4 subunit A [Bacillus mycoides Rock3-17]
	134 	134 	81% 	2e-29	
ADQ57972.1 	
DNA gyrase subunit A [Haemophilus parasuis]
	134 	134 	58% 	2e-29	
ZP_04152225.1 	
DNA topoisomerase 4 subunit A [Bacillus pseudomycoides DSM 12442] >gb|EEM15951.1| DNA topoisomerase 4 subunit A [Bacillus pseudomycoides DSM 12442]
	134 	134 	81% 	2e-29	
YP_003576318.1 	
DNA topoisomerase IV subunit A [Rhodobacter capsulatus SB 1003] >gb|ADE83911.1| DNA topoisomerase IV, A subunit [Rhodobacter capsulatus SB 1003]
	134 	134 	82% 	2e-29	Gene info linked to YP_003576318.1
YP_003636789.1 	
DNA topoisomerase (ATP-hydrolyzing) [Cellulomonas flavigena DSM 20109] >gb|ADG74590.1| DNA topoisomerase (ATP-hydrolyzing) [Cellulomonas flavigena DSM 20109]
	134 	134 	83% 	2e-29	Gene info linked to YP_003636789.1
ADQ57973.1 	
DNA gyrase subunit A [Haemophilus parasuis] >gb|ADQ57979.1| DNA gyrase subunit A [Haemophilus parasuis] >gb|ADQ57986.1| DNA gyrase subunit A [Haemophilus parasuis] >gb|ADQ57988.1| DNA gyrase subunit A [Haemophilus parasuis] >gb|ADQ57990.1| DNA gyrase subunit A [Haemophilus parasuis]
	134 	134 	58% 	2e-29	
YP_004011749.1 	
DNA topoisomerase IV, A subunit [Rhodomicrobium vannielii ATCC 17100] >gb|ADP70650.1| DNA topoisomerase IV, A subunit [Rhodomicrobium vannielii ATCC 17100]
	134 	134 	90% 	2e-29	Gene info linked to YP_004011749.1
ADQ57976.1 	
DNA gyrase subunit A [Haemophilus parasuis]
	133 	133 	58% 	2e-29	
ADQ57974.1 	
DNA gyrase subunit A [Haemophilus parasuis]
	133 	133 	58% 	3e-29	
ADQ57975.1 	
DNA gyrase subunit A [Haemophilus parasuis] >gb|ADQ57978.1| DNA gyrase subunit A [Haemophilus parasuis] >gb|ADQ57980.1| DNA gyrase subunit A [Haemophilus parasuis] >gb|ADQ57981.1| DNA gyrase subunit A [Haemophilus parasuis] >gb|ADQ57982.1| DNA gyrase subunit A [Haemophilus parasuis] >gb|ADQ57983.1| DNA gyrase subunit A [Haemophilus parasuis] >gb|ADQ57985.1| DNA gyrase subunit A [Haemophilus parasuis] >gb|ADQ57991.1| DNA gyrase subunit A [Haemophilus parasuis] >gb|ADQ57992.1| DNA gyrase subunit A [Haemophilus parasuis]
	133 	133 	58% 	3e-29	
YP_003693564.1 	
DNA topoisomerase IV, A subunit [Starkeya novella DSM 506] >gb|ADH88945.1| DNA topoisomerase IV, A subunit [Starkeya novella DSM 506]
	133 	133 	73% 	3e-29	Gene info linked to YP_003693564.1
ZP_07818958.1 	
DNA topoisomerase IV, A subunit [Eremococcus coleocola ACS-139-V-Col8] >gb|EFR31334.1| DNA topoisomerase IV, A subunit [Eremococcus coleocola ACS-139-V-Col8]
	133 	133 	82% 	3e-29	
NP_785392.1 	
DNA topoisomerase IV subunit A [Lactobacillus plantarum WCFS1] >ref|YP_003063131.1| DNA topoisomerase IV subunit A [Lactobacillus plantarum JDM1] >ref|ZP_07077358.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Lactobacillus plantarum subsp. plantarum ATCC 14917] >ref|YP_003924785.1| DNA topoisomerase IV subunit A [Lactobacillus plantarum subsp. plantarum ST-III] >emb|CAD64241.1| topoisomerase IV, subunit A [Lactobacillus plantarum WCFS1] >gb|ACT62434.1| DNA topoisomerase IV subunit A [Lactobacillus plantarum JDM1] >gb|EFK30421.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Lactobacillus plantarum subsp. plantarum ATCC 14917] >gb|ADN98691.1| DNA topoisomerase IV subunit A [Lactobacillus plantarum subsp. plantarum ST-III]
	133 	133 	82% 	3e-29	Gene info linked to NP_785392.1
CAA63254.1 	
gyrA [Mycobacterium smegmatis]
	133 	133 	54% 	3e-29	
ZP_02077212.1 	
hypothetical protein EUBDOL_01006 [Eubacterium dolichum DSM 3991] >gb|EDP11087.1| hypothetical protein EUBDOL_01006 [Eubacterium dolichum DSM 3991]
	133 	133 	82% 	3e-29	
YP_003132710.1 	
DNA topoisomerase IV subunit A [Saccharomonospora viridis DSM 43017] >gb|ACU95883.1| DNA topoisomerase IV subunit A [Saccharomonospora viridis DSM 43017]
	133 	133 	83% 	3e-29	Gene info linked to YP_003132710.1
ZP_06752242.1 	
DNA gyrase, A subunit [Parascardovia denticolens F0305] >ref|ZP_07868417.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Parascardovia denticolens DSM 10105] >gb|EFG33455.1| DNA gyrase, A subunit [Parascardovia denticolens F0305] >gb|EFT83893.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Parascardovia denticolens DSM 10105]
	133 	133 	85% 	4e-29	
YP_001615094.1 	
DNA gyrase subunit A [Sorangium cellulosum 'So ce 56'] >emb|CAN94614.1| DNA gyrase subunit A [Sorangium cellulosum 'So ce 56']
	133 	133 	84% 	4e-29	Gene info linked to YP_001615094.1
NP_782359.1 	
DNA topoisomerase IV subunit A [Clostridium tetani E88] >gb|AAO36296.1| DNA gyrase subunit A [Clostridium tetani E88]
	132 	132 	95% 	5e-29	Gene info linked to NP_782359.1
ZP_03758656.1 	
hypothetical protein CLOSTASPAR_02673 [Clostridium asparagiforme DSM 15981] >gb|EEG55260.1| hypothetical protein CLOSTASPAR_02673 [Clostridium asparagiforme DSM 15981]
	132 	132 	81% 	5e-29	
CBI80825.1 	
topoisomerase IV subunit A [Bartonella sp. 1-1C]
	132 	132 	97% 	6e-29	
YP_001531571.1 	
DNA topoisomerase IV, A subunit [Dinoroseobacter shibae DFL 12] >gb|ABV91970.1| DNA topoisomerase IV, A subunit [Dinoroseobacter shibae DFL 12]
	132 	132 	80% 	6e-29	Gene info linked to YP_001531571.1
YP_810601.1 	
DNA topoisomerase IV subunit A [Oenococcus oeni PSU-1] >gb|ABJ56936.1| DNA topoisomerase IV subunit A [Oenococcus oeni PSU-1]
	132 	132 	90% 	6e-29	Gene info linked to YP_810601.1
ZP_02187021.1 	
Type IIA topoisomerase, A subunit [alpha proteobacterium BAL199] >gb|EDP66203.1| Type IIA topoisomerase, A subunit [alpha proteobacterium BAL199]
	132 	132 	79% 	6e-29	
ZP_02429116.1 	
hypothetical protein CLORAM_02538 [Clostridium ramosum DSM 1402] >gb|EDS17743.1| hypothetical protein CLORAM_02538 [Clostridium ramosum DSM 1402]
	132 	132 	86% 	6e-29	
CBJ21245.1 	
DNA gyrase subunit A [Bacillus amyloliquefaciens]
	132 	132 	37% 	7e-29	
AAV80738.1 	
gyrase subunit A [Bacillus sp. NRRL B-23973] >gb|AAV80739.1| gyrase subunit A [Bacillus sp. NRRL B-23976]
	132 	132 	37% 	7e-29	
AAV80737.1 	
gyrase subunit A [Bacillus sp. NRRL B-23977]
	132 	132 	37% 	7e-29	
AAV80741.1 	
gyrase subunit A [Bacillus sp. NRRL B-23954]
	132 	132 	37% 	7e-29	
CBJ16552.1 	
DNA gyrase subunit A [Bacillus amyloliquefaciens]
	132 	132 	37% 	7e-29	
ZP_04563406.1 	
DNA topoisomerase IV subunit A [Mollicutes bacterium D7] >gb|EEO34085.1| DNA topoisomerase IV subunit A [Coprobacillus sp. D7]
	132 	132 	86% 	7e-29	
CBI77762.1 	
topoisomerase IV subunit A [Bartonella rochalimae ATCC BAA-1498]
	132 	132 	97% 	8e-29	
AAV80733.1 	
gyrase subunit A [Bacillus sp. NRRL B-23936]
	132 	132 	37% 	8e-29	
ZP_07665527.1 	
DNA topoisomerase IV subunit A [Gardnerella vaginalis ATCC 14018] >ref|YP_003985724.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Gardnerella vaginalis ATCC 14019] >gb|ADP38701.1| DNA topoisomerase (ATP-hydrolyzing) subunit A [Gardnerella vaginalis ATCC 14019]
	132 	132 	81% 	9e-29	
ZP_06553613.1 	
hypothetical protein AWRIB429_1003 [Oenococcus oeni AWRIB429] >gb|EFD88583.1| hypothetical protein AWRIB429_1003 [Oenococcus oeni AWRIB429]
	132 	132 	90% 	9e-29	
AAK40035.1 	
DNA gyrase subunit A [Bacillus vallismortis]
	131 	131 	37% 	1e-28	
YP_457336.1 	
DNA topoisomerase IV subunit A [Erythrobacter litoralis HTCC2594] >gb|ABC62539.1| DNA topoisomeraseIV subunitA [Erythrobacter litoralis HTCC2594]
	131 	131 	80% 	1e-28	Gene info linked to YP_457336.1
ZP_08079058.1 	
DNA gyrase, A subunit [Succinatimonas hippei YIT 12066] >gb|EFY06501.1| DNA gyrase, A subunit [Succinatimonas hippei YIT 12066]
	131 	131 	83% 	1e-28	
YP_175484.1 	
DNA topoisomerase IV subunit A [Bacillus clausii KSM-K16] >dbj|BAD64523.1| DNA topoisomerase IIA subunit A [Bacillus clausii KSM-K16]
	131 	131 	83% 	1e-28	Gene info linked to YP_175484.1
ABJ55987.1 	
DNA gyrase subunit A [Bacillus subtilis subsp. spizizenii]
	131 	131 	38% 	1e-28	
YP_002130705.1 	
topoisomerase IV, subunit A [Phenylobacterium zucineum HLK1] >gb|ACG78276.1| topoisomerase IV, subunit A [Phenylobacterium zucineum HLK1]
	130 	130 	89% 	2e-28	Gene info linked to YP_002130705.1
ZP_04143388.1 	
DNA topoisomerase [Bacillus thuringiensis Bt407] >gb|EEM25620.1| DNA topoisomerase [Bacillus thuringiensis Bt407]
	130 	130 	82% 	2e-28	
YP_001877892.1 	
DNA gyrase, A subunit [Akkermansia muciniphila ATCC BAA-835] >gb|ACD05111.1| DNA gyrase, A subunit [Akkermansia muciniphila ATCC BAA-835]
	130 	130 	83% 	2e-28	Gene info linked to YP_001877892.1
YP_001222394.1 	
DNA topoisomerase IV subunit A [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >emb|CAN01703.1| putative topoisomerase II subunit A [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
	130 	130 	82% 	2e-28	Gene info linked to YP_001222394.1
ADQ57984.1 	
DNA gyrase subunit A [Haemophilus parasuis]
	130 	130 	58% 	2e-28	
AAV80728.1 	
gyrase subunit A [Bacillus subtilis]
	130 	130 	37% 	2e-28	
ZP_07755178.1 	
DNA topoisomerase (ATP-hydrolyzing) [Planctomyces brasiliensis DSM 5305] >gb|EFQ19167.1| DNA topoisomerase (ATP-hydrolyzing) [Planctomyces brasiliensis DSM 5305]
	130 	130 	82% 	2e-28	
AAV80726.1 	
gyrase subunit A [Bacillus subtilis] >gb|AAV80730.1| gyrase subunit A [Bacillus subtilis] >gb|AAV80731.1| gyrase subunit A [Bacillus subtilis]
	130 	130 	37% 	2e-28	
AAV80732.1 	
gyrase subunit A [Bacillus subtilis]
	130 	130 	37% 	2e-28	
AAV80725.1 	
gyrase subunit A [Bacillus subtilis]
	130 	130 	37% 	2e-28	
AAV80729.1 	
gyrase subunit A [Bacillus subtilis]
	130 	130 	37% 	2e-28	
AAV80727.1 	
gyrase subunit A [Bacillus subtilis]
	130 	130 	37% 	2e-28	
ZP_08082294.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Erysipelothrix rhusiopathiae ATCC 19414] >gb|EFY09679.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Erysipelothrix rhusiopathiae ATCC 19414]
	130 	130 	88% 	3e-28	
CBI79238.1 	
topoisomerase IV subunit A [Bartonella sp. AR 15-3]
	130 	130 	81% 	3e-28	
ABQ10651.1 	
DNA gyrase subunit A [Bacillus subtilis subsp. subtilis]
	130 	130 	37% 	3e-28	
AAK40026.1 	
DNA gyrase subunit A [Bacillus atrophaeus]
	130 	130 	37% 	3e-28	
AAK40033.1 	
DNA gyrase subunit A [Bacillus subtilis subsp. subtilis] >gb|AAK40034.1|AF272024_1 DNA gyrase subunit A [Bacillus subtilis subsp. subtilis]
	130 	130 	37% 	3e-28	
ZP_08011734.1 	
DNA topoisomerase IV subunit A [Coprobacillus sp. 29_1] >gb|EFW04286.1| DNA topoisomerase IV subunit A [Coprobacillus sp. 29_1]
	130 	130 	88% 	3e-28	
YP_001710357.1 	
DNA topoisomerase IV subunit A [Clavibacter michiganensis subsp. sepedonicus] >emb|CAQ01744.1| DNA gyrase subunit A [Clavibacter michiganensis subsp. sepedonicus]
	130 	130 	82% 	3e-28	Gene info linked to YP_001710357.1
ZP_05075921.1 	
DNA topoisomerase IV, A subunit [Rhodobacterales bacterium HTCC2083] >gb|EDZ43581.1| DNA topoisomerase IV, A subunit [Rhodobacteraceae bacterium HTCC2083]
	130 	130 	80% 	3e-28	
ZP_05113148.1 	
DNA topoisomerase IV, A subunit [Labrenzia alexandrii DFL-11] >gb|EEE43747.1| DNA topoisomerase IV, A subunit [Labrenzia alexandrii DFL-11]
	130 	130 	91% 	4e-28	
CBX19917.1 	
gyrase A [Clostridium perfringens]
	129 	129 	42% 	4e-28	
YP_003973300.1 	
DNA topoisomerase IV subunit A [Bacillus atrophaeus 1942] >gb|ADP32369.1| DNA topoisomerase IV subunit A [Bacillus atrophaeus 1942]
	129 	129 	82% 	4e-28	Gene info linked to YP_003973300.1
ZP_02184809.1 	
DNA topoisomerase IV subunit A [Carnobacterium sp. AT7] >gb|EDP68355.1| DNA topoisomerase IV subunit A [Carnobacterium sp. AT7]
	129 	129 	88% 	4e-28	
YP_002972137.1 	
DNA topoisomerase IV subunit A [Bartonella grahamii as4aup] >gb|ACS51448.1| DNA topoisomerase IV subunit A [Bartonella grahamii as4aup]
	129 	129 	97% 	4e-28	Gene info linked to YP_002972137.1
YP_002362428.1 	
DNA topoisomerase IV subunit A [Methylocella silvestris BL2] >gb|ACK51066.1| DNA topoisomerase IV, A subunit [Methylocella silvestris BL2]
	129 	129 	91% 	5e-28	Gene info linked to YP_002362428.1
ZP_01878626.1 	
DNA topoisomerase IV subunit A [Roseovarius sp. TM1035] >gb|EDM32729.1| DNA topoisomerase IV subunit A [Roseovarius sp. TM1035]
	129 	129 	85% 	5e-28	
YP_001814063.1 	
DNA topoisomerase IV, A subunit [Exiguobacterium sibiricum 255-15] >gb|ACB61046.1| DNA topoisomerase IV, A subunit [Exiguobacterium sibiricum 255-15]
	129 	129 	82% 	6e-28	Gene info linked to YP_001814063.1
ZP_05619410.1 	
DNA topoisomerase IV, A subunit [Enhydrobacter aerosaccus SK60] >gb|EEV23435.1| DNA topoisomerase IV, A subunit [Enhydrobacter aerosaccus SK60]
	129 	129 	82% 	6e-28	
YP_003938989.1 	
DNA gyrase subunit A [Bifidobacterium bifidum S17] >gb|ADO53415.1| DNA gyrase subunit A [Bifidobacterium bifidum S17]
	129 	129 	80% 	7e-28	Gene info linked to YP_003938989.1
ZP_01755390.1 	
DNA topoisomerase IV subunit A [Roseobacter sp. SK209-2-6] >gb|EBA16054.1| DNA topoisomerase IV subunit A [Roseobacter sp. SK209-2-6]
	129 	129 	80% 	7e-28	
YP_003855048.1 	
DNA topoisomerase IV subunit A [Parvularcula bermudensis HTCC2503] >gb|ADM09906.1| DNA topoisomerase IV subunit A [Parvularcula bermudensis HTCC2503]
	129 	129 	94% 	7e-28	Gene info linked to YP_003855048.1
CBJ21242.1 	
DNA gyrase subunit A [Bacillus amyloliquefaciens]
	129 	129 	36% 	7e-28	
ZP_03646701.1 	
DNA topoisomerase IV subunit A [Bifidobacterium bifidum NCIMB 41171] >ref|YP_003971344.1| DNA gyrase subunit A [Bifidobacterium bifidum PRL2010] >ref|ZP_07802726.1| DNA gyrase subunit A [Bifidobacterium bifidum NCIMB 41171] >gb|ADP36307.1| GyrA DNA gyrase subunit A [Bifidobacterium bifidum PRL2010] >gb|EFR50660.1| DNA gyrase subunit A [Bifidobacterium bifidum NCIMB 41171]
	129 	129 	80% 	7e-28	
ZP_02085435.1 	
hypothetical protein CLOBOL_02972 [Clostridium bolteae ATCC BAA-613] >gb|EDP16827.1| hypothetical protein CLOBOL_02972 [Clostridium bolteae ATCC BAA-613]
	129 	129 	82% 	8e-28	
AAV71141.1 	
GyrA [Bacillus amyloliquefaciens]
	128 	128 	36% 	8e-28	
YP_001209241.1 	
DNA gyrase subunit A [Dichelobacter nodosus VCS1703A] >gb|ABQ13927.1| DNA gyrase subunit A [Dichelobacter nodosus VCS1703A]
	128 	128 	83% 	8e-28	Gene info linked to YP_001209241.1
CBL42320.1 	
Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [butyrate-producing bacterium SS3/4]
	128 	128 	81% 	9e-28	
ADP93612.1 	
DNA gyrase subunit A [Clostridium perfringens]
	128 	128 	41% 	1e-27	
ZP_05088656.1 	
DNA topoisomerase IV, A subunit [Ruegeria sp. R11] >gb|EEB70348.1| DNA topoisomerase IV, A subunit [Ruegeria sp. R11]
	128 	128 	85% 	1e-27	
ADP93694.1 	
DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93695.1| DNA gyrase subunit A [Clostridium perfringens]
	128 	128 	41% 	1e-27	
ZP_06898105.1 	
DNA topoisomerase (ATP-hydrolyzing) ParC [Roseomonas cervicalis ATCC 49957] >gb|EFH10182.1| DNA topoisomerase (ATP-hydrolyzing) ParC [Roseomonas cervicalis ATCC 49957]
	128 	128 	91% 	1e-27	
NP_692615.1 	
DNA topoisomerase IV subunit A [Oceanobacillus iheyensis HTE831] >dbj|BAC13650.1| DNA topoisomerase IV subunit A [Oceanobacillus iheyensis HTE831]
	128 	128 	83% 	1e-27	Gene info linked to NP_692615.1
ADP93587.1 	
DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93588.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93589.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93590.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93593.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93596.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93597.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93598.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93599.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93600.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93601.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93602.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93603.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93604.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93605.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93606.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93608.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93611.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93613.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93614.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93616.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93617.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93618.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93619.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93620.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93624.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93625.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93626.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93627.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93628.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93632.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93633.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93634.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93635.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93637.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93638.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93639.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93640.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93641.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93642.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93643.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93644.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93645.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93646.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93647.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93648.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93649.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93650.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93651.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93652.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93653.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93654.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93655.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93656.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93657.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93658.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93659.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93660.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93661.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93662.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93663.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93665.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93666.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93668.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93669.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93670.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93671.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93672.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93674.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93675.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93677.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93679.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93682.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93683.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93684.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93687.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93688.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93689.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93690.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93692.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93693.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93696.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93697.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93698.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93699.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93706.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93707.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93709.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93710.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93711.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93712.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93713.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93714.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93716.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93717.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93718.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93719.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93720.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93721.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93722.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93723.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93724.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93725.1| DNA gyrase subunit A [Clostridium perfringens]
	127 	127 	41% 	1e-27	
ZP_04669433.1 	
conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA] >gb|EEQ56414.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
	127 	127 	81% 	2e-27	
AAV80743.1 	
gyrase subunit A [Bacillus sp. NRRL B-23970]
	127 	127 	36% 	2e-27	
YP_003964993.1 	
DNA topoisomerase IV subunit A [Ketogulonicigenium vulgare Y25] >gb|ADO43693.1| DNA topoisomerase IV subunit A [Ketogulonicigenium vulgare Y25]
	127 	127 	80% 	2e-27	Gene info linked to YP_003964993.1
AAV80744.1 	
gyrase subunit A [Bacillus sp. NRRL B-23982]
	127 	127 	36% 	2e-27	
AAV80746.1 	
gyrase subunit A [Bacillus sp. NRRL B-23956]
	127 	127 	36% 	2e-27	
YP_003896790.1 	
DNA topoisomerase IV subunit A [Halomonas elongata DSM 2581] >emb|CBV41605.1| DNA topoisomerase IV subunit A [Halomonas elongata DSM 2581]
	127 	127 	83% 	2e-27	Gene info linked to YP_003896790.1
ZP_05123185.1 	
DNA topoisomerase IV, A subunit [Rhodobacteraceae bacterium KLH11] >gb|EEE37817.1| DNA topoisomerase IV, A subunit [Rhodobacteraceae bacterium KLH11]
	127 	127 	80% 	2e-27	
ADP93591.1 	
DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93592.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93594.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93595.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93607.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93609.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93610.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93615.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93621.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93622.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93623.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93629.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93630.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93631.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93636.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93664.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93667.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93673.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93676.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93678.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93680.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93681.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93685.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93686.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93691.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93700.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93701.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93702.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93703.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93704.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93705.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93708.1| DNA gyrase subunit A [Clostridium perfringens] >gb|ADP93715.1| DNA gyrase subunit A [Clostridium perfringens]
	127 	127 	41% 	2e-27	
ZP_01545364.1 	
DNA topoisomerase IV subunit A [Stappia aggregata IAM 12614] >gb|EAV46207.1| DNA topoisomerase IV subunit A [Stappia aggregata IAM 12614]
	127 	127 	91% 	2e-27	
ZP_06156204.1 	
topoisomerase IV subunit A [Photobacterium damselae subsp. damselae CIP 102761] >gb|EEZ41901.1| topoisomerase IV subunit A [Photobacterium damselae subsp. damselae CIP 102761]
	127 	127 	83% 	2e-27	
ZP_05168848.1 	
DNA topoisomerase IV subunit A [Brucella pinnipedialis M163/99/10] >ref|ZP_05171682.1| DNA topoisomerase IV subunit A [Brucella pinnipedialis B2/94] >ref|ZP_05444977.1| DNA topoisomerase IV subunit A [Brucella pinnipedialis M292/94/1] >ref|ZP_05953684.1| DNA topoisomerase IV subunit A [Brucella pinnipedialis M163/99/10] >ref|ZP_05956610.1| DNA topoisomerase IV subunit A [Brucella pinnipedialis B2/94] >ref|ZP_06101007.1| DNA topoisomerase IV subunit A [Brucella pinnipedialis M292/94/1] >gb|EEY00133.1| DNA topoisomerase IV subunit A [Brucella pinnipedialis B2/94] >gb|EEY07010.1| DNA topoisomerase IV subunit A [Brucella pinnipedialis M163/99/10] >gb|EEZ30908.1| DNA topoisomerase IV subunit A [Brucella pinnipedialis M292/94/1]
	127 	127 	85% 	2e-27	
AAY22401.1 	
GyrA [Bacillus subtilis]
	127 	127 	36% 	2e-27	
YP_318526.1 	
DNA topoisomerase IV subunit A [Nitrobacter winogradskyi Nb-255] >gb|ABA05174.1| DNA topoisomerase IV subunit A [Nitrobacter winogradskyi Nb-255]
	127 	127 	81% 	3e-27	Gene info linked to YP_318526.1
YP_003373926.1 	
DNA gyrase/topoisomerase IV, A subunit [Gardnerella vaginalis 409-05] >gb|ADB13465.1| DNA gyrase/topoisomerase IV, A subunit [Gardnerella vaginalis 409-05]
	127 	127 	81% 	3e-27	Gene info linked to YP_003373926.1
ZP_07474672.1 	
DNA topoisomerase IV, A subunit [Brucella sp. BO2] >gb|EFM59343.1| DNA topoisomerase IV, A subunit [Brucella sp. BO2]
	127 	127 	80% 	3e-27	
ZP_05813061.1 	
DNA topoisomerase IV, A subunit [Mesorhizobium opportunistum WSM2075] >gb|EEW30671.1| DNA topoisomerase IV, A subunit [Mesorhizobium opportunistum WSM2075]
	127 	127 	81% 	3e-27	
BAE19969.1 	
topoisomerase IV subunit A [Photobacterium damselae subsp. piscicida]
	127 	127 	83% 	3e-27	
ZP_07476299.1 	
DNA topoisomerase IV, A subunit [Brucella sp. BO1] >gb|EFM57718.1| DNA topoisomerase IV, A subunit [Brucella sp. BO1]
	127 	127 	80% 	3e-27	
NP_540117.1 	
DNA topoisomerase IV subunit A [Brucella melitensis bv. 1 str. 16M] >ref|ZP_03785291.1| DNA topoisomerase IV, A subunit [Brucella ceti str. Cudo] >gb|AAL52381.1| topoisomerase iv subunit a [Brucella melitensis bv. 1 str. 16M] >gb|EEH14304.1| DNA topoisomerase IV, A subunit [Brucella ceti str. Cudo]
	127 	127 	85% 	3e-27	Gene info linked to NP_540117.1
NP_697768.1 	
DNA topoisomerase IV subunit A [Brucella suis 1330] >ref|YP_001592610.1| DNA topoisomerase IV subunit A [Brucella canis ATCC 23365] >ref|YP_001627430.1| DNA topoisomerase IV subunit A [Brucella suis ATCC 23445] >ref|YP_002732504.1| DNA topoisomerase IV subunit A [Brucella melitensis ATCC 23457] >ref|ZP_05155329.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 3 str. Tulya] >ref|ZP_05163358.1| DNA topoisomerase IV subunit A [Brucella suis bv. 5 str. 513] >ref|ZP_05165907.1| DNA topoisomerase IV subunit A [Brucella suis bv. 3 str. 686] >ref|ZP_05175683.1| DNA topoisomerase IV subunit A [Brucella ceti M644/93/1] >ref|ZP_05178882.1| DNA topoisomerase IV subunit A [Brucella ceti M13/05/1] >ref|ZP_05447347.1| DNA topoisomerase IV subunit A [Brucella melitensis bv. 1 str. Rev.1] >ref|ZP_05454155.1| DNA topoisomerase IV subunit A [Brucella melitensis bv. 3 str. Ether] >ref|ZP_05457253.1| DNA topoisomerase IV subunit A [Brucella ceti M490/95/1] >ref|ZP_05460307.1| DNA topoisomerase IV subunit A [Brucella ceti B1/94] >ref|ZP_05466754.1| DNA topoisomerase IV subunit A [Brucella melitensis bv. 2 str. 63/9] >ref|YP_003106695.1| DNA topoisomerase IV subunit A [Brucella microti CCM 4915] >ref|ZP_05755308.1| DNA topoisomerase IV subunit A [Brucella sp. F5/99] >ref|ZP_05834280.1| DNA topoisomerase IV subunit A [Brucella melitensis bv. 1 str. 16M] >ref|ZP_05837143.1| DNA topoisomerase IV subunit A [Brucella suis bv. 4 str. 40] >ref|ZP_05928041.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 3 str. Tulya] >ref|ZP_05933162.1| DNA topoisomerase IV subunit A [Brucella ceti M13/05/1] >ref|ZP_05936232.1| DNA topoisomerase IV subunit A [Brucella ceti B1/94] >ref|ZP_05960817.1| DNA topoisomerase IV subunit A [Brucella ceti M644/93/1] >ref|ZP_05995788.1| DNA topoisomerase IV subunit A [Brucella suis bv. 5 str. 513] >ref|ZP_05998447.1| DNA topoisomerase IV subunit A [Brucella suis bv. 3 str. 686] >ref|ZP_06001675.1| DNA topoisomerase IV subunit A [Brucella sp. F5/99] >ref|ZP_06103421.1| DNA topoisomerase IV subunit A [Brucella melitensis bv. 1 str. Rev.1] >ref|ZP_06107257.1| DNA topoisomerase IV subunit A [Brucella melitensis bv. 3 str. Ether] >ref|ZP_06110471.1| DNA topoisomerase IV subunit A [Brucella ceti M490/95/1] >ref|ZP_06792791.1| DNA topoisomerase IV [Brucella sp. NVSL 07-0026] >gb|AAN29683.1| DNA topoisomerase IV, A subunit [Brucella suis 1330] >gb|ABX61839.1| DNA topoisomerase IV, A subunit [Brucella canis ATCC 23365] >gb|ABY37860.1| DNA topoisomerase IV, A subunit [Brucella suis ATCC 23445] >gb|ACO00550.1| DNA topoisomerase IV, A subunit [Brucella melitensis ATCC 23457] >gb|ACU47746.1| DNA topoisomerase IV subunit A [Brucella microti CCM 4915] >gb|EEW88902.1| DNA topoisomerase IV subunit A [Brucella melitensis bv. 1 str. 16M] >gb|EEW91271.1| DNA topoisomerase IV subunit A [Brucella suis bv. 4 str. 40] >gb|EEX82228.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 3 str. Tulya] >gb|EEX87188.1| DNA topoisomerase IV subunit A [Brucella ceti B1/94] >gb|EEX90538.1| DNA topoisomerase IV subunit A [Brucella ceti M13/05/1] >gb|EEX97806.1| DNA topoisomerase IV subunit A [Brucella ceti M644/93/1] >gb|EEY25946.1| DNA topoisomerase IV subunit A [Brucella sp. F5/99] >gb|EEY29758.1| DNA topoisomerase IV subunit A [Brucella suis bv. 5 str. 513] >gb|EEY32417.1| DNA topoisomerase IV subunit A [Brucella suis bv. 3 str. 686] >gb|EEZ08372.1| DNA topoisomerase IV subunit A [Brucella ceti M490/95/1] >gb|EEZ11602.1| DNA topoisomerase IV subunit A [Brucella melitensis bv. 3 str. Ether] >gb|EEZ14223.1| DNA topoisomerase IV subunit A [Brucella melitensis bv. 1 str. Rev.1] >gb|EEZ18289.1| DNA topoisomerase IV subunit A [Brucella melitensis bv. 2 str. 63/9] >gb|EFG37706.1| DNA topoisomerase IV [Brucella sp. NVSL 07-0026]
	127 	127 	85% 	3e-27	Gene info linked to NP_697768.1
ZP_06977526.1 	
type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Gardnerella vaginalis 5-1] >gb|EFH71057.1| type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Gardnerella vaginalis 5-1]
	127 	127 	81% 	3e-27	
ZP_05451033.1 	
DNA topoisomerase IV subunit A [Brucella neotomae 5K33] >ref|ZP_05964068.1| DNA topoisomerase IV subunit A [Brucella neotomae 5K33] >gb|EEY04348.1| DNA topoisomerase IV subunit A [Brucella neotomae 5K33]
	127 	127 	85% 	3e-27	
ZP_05786757.1 	
DNA topoisomerase IV, A subunit [Silicibacter lacuscaerulensis ITI-1157] >gb|EEX09873.1| DNA topoisomerase IV, A subunit [Silicibacter lacuscaerulensis ITI-1157]
	127 	127 	80% 	3e-27	
YP_001833056.1 	
DNA topoisomerase IV subunit A [Beijerinckia indica subsp. indica ATCC 9039] >gb|ACB95567.1| DNA topoisomerase IV, A subunit [Beijerinckia indica subsp. indica ATCC 9039]
	126 	126 	91% 	3e-27	Gene info linked to YP_001833056.1
AAG23554.1 	
DNA gyrase subunit A [Carboxydothermus hydrogenoformans]
	126 	126 	46% 	3e-27	
ZP_01724599.1 	
DNA topoisomerase IV subunit A [Bacillus sp. B14905] >gb|EAZ84961.1| DNA topoisomerase IV subunit A [Bacillus sp. B14905]
	126 	126 	82% 	3e-27	
YP_004158946.1 	
topoisomerase IV subunit A [Bartonella clarridgeiae 73] >emb|CBI76368.1| topoisomerase IV subunit A [Bartonella clarridgeiae 73]
	126 	126 	80% 	3e-27	Gene info linked to YP_004158946.1
ZP_02533836.1 	
DNA gyrase subunit A [Endoriftia persephone 'Hot96_1+Hot96_2']
	126 	126 	43% 	4e-27	
ZP_01856357.1 	
type II DNA topoisomerase, A subunit [Planctomyces maris DSM 8797] >gb|EDL57770.1| type II DNA topoisomerase, A subunit [Planctomyces maris DSM 8797]
	126 	126 	81% 	4e-27	
ADV74760.1 	
gyrase subunit alpha [Bacillus subtilis subsp. subtilis]
	126 	126 	36% 	4e-27	
YP_002004233.1 	
DNA gyrase, alpha subunit [Candidatus Phytoplasma mali] >emb|CAP18383.1| DNA gyrase, alpha subunit [Candidatus Phytoplasma mali]
	126 	126 	97% 	4e-27	Gene info linked to YP_002004233.1
ZP_01047254.1 	
DNA topoisomerase IV subunit A [Nitrobacter sp. Nb-311A] >gb|EAQ34836.1| DNA topoisomerase IV subunit A [Nitrobacter sp. Nb-311A]
	126 	126 	81% 	4e-27	
ZP_01162298.1 	
DNA topoisomerase IV subunit A [Photobacterium sp. SKA34] >gb|EAR53942.1| DNA topoisomerase IV subunit A [Photobacterium sp. SKA34]
	126 	126 	83% 	4e-27	
YP_165980.1 	
DNA topoisomerase IV subunit A [Ruegeria pomeroyi DSS-3] >gb|AAV94032.1| DNA topoisomerase IV, A subunit [Ruegeria pomeroyi DSS-3]
	126 	126 	80% 	4e-27	Gene info linked to YP_165980.1
ZP_06862411.1 	
DNA topoisomerase IV subunit A [Citromicrobium bathyomarinum JL354]
	126 	126 	86% 	5e-27	
ZP_06834858.1 	
DNA topoisomerase IV subunit A [Gluconacetobacter hansenii ATCC 23769] >gb|EFG83936.1| DNA topoisomerase IV subunit A [Gluconacetobacter hansenii ATCC 23769]
	126 	126 	91% 	5e-27	
CBL02203.1 	
Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [Faecalibacterium prausnitzii SL3/3]
	126 	126 	83% 	5e-27	
ZP_05152272.1 	
DNA topoisomerase IV subunit A [Brucella abortus bv. 6 str. 870] >ref|ZP_05462804.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 9 str. C68] >ref|ZP_05866860.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 6 str. 870] >ref|ZP_05895155.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 9 str. C68] >gb|EEX61441.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 6 str. 870] >gb|EEX80138.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 9 str. C68]
	126 	126 	85% 	5e-27	
ZP_06931832.1 	
DNA topoisomerase IV, A subunit [Brucella abortus bv. 5 str. B3196] >gb|EFH34630.1| DNA topoisomerase IV, A subunit [Brucella abortus bv. 5 str. B3196]
	126 	126 	85% 	5e-27	
ZP_05078311.1 	
DNA topoisomerase IV, A subunit [Rhodobacterales bacterium Y4I] >gb|EDZ46290.1| DNA topoisomerase IV, A subunit [Rhodobacterales bacterium Y4I]
	126 	126 	80% 	5e-27	
ZP_01448653.1 	
DNA topoisomerase IV subunit A [alpha proteobacterium HTCC2255] >gb|EAU51045.1| DNA topoisomerase IV subunit A [alpha proteobacterium HTCC2255]
	126 	126 	72% 	5e-27	
YP_221500.1 	
DNA topoisomerase IV subunit A [Brucella abortus bv. 1 str. 9-941] >ref|YP_414210.1| DNA topoisomerase IV subunit A [Brucella melitensis biovar Abortus 2308] >ref|YP_001934724.1| DNA topoisomerase IV subunit A [Brucella abortus S19] >ref|ZP_05158981.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 2 str. 86/8/59] >ref|ZP_05188627.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 4 str. 292] >ref|ZP_05821279.1| DNA topoisomerase IV subunit A [Brucella abortus NCTC 8038] >ref|ZP_05870081.1| DNA topoisomerase IV subunit A [Brucella abortus bv. 4 str. 292] >ref|ZP_05873901.1| D