GOS 1743020

From Metagenes
Jump to: navigation, search
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_651
Annotathon code: GOS_1743020
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : UCBL-MIV-2010
Username : thomas_gervaise
Annotated on : 2010-06-26 10:54:20
  • Gervaise thomas

Contents

Synopsis

  • Taxonomy: Proteobacteria (NCBI info)
    Rank: phylum - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 1224
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: - Order:
    Bacteria; Proteobacteria;

Genomic Sequence

>JCVI_READ_651 GOS_1743020 Genomic DNA
TACGGATGAAGAGTAATCTTTAACCAAAGCGATAACCGATTAGGCTTAGCAAATCAGGATCTGTTTGCATAAAGTGAAGACCATCTTTAGCCGGTTACTC
GTTAAATGCTTTTCCTGTTCGGCGCTATCAATGGGGTGCGTCTTCCCACTGTTGGCGTCGACCGCTCCCATTGCAAGCCACACCCAACCGCAGGCTGCGC
AGCTATCTCCGTCGTTTGCTCAAATGAGCCCCGAATCGCCGATTGATGGCCAAAATAATCCCAACTCTGTTTATGCCTTTGGCAGTTATCTTGGCACGGG
TGTGTATCGGGCCGCCGATCAAAATGCCACTGTGGTGAGCATTCCCTTAAGCTTTGATTTCTTAAAGGACGAAAGTAGTCAAACTTGGCTGCGTCTACCC
TTATCCTTCGGTTTTTTTGACTACTTAGCTAAAGATATTACCGATGGTGAATTGCCTTCCTCGGTCGGCACTATGACGATGACGCCAGGCATAGAGCATC
ATTGGCAGGCAACGGCAAACACGCGGATGGAAGCCTATCTGGATGTGGGCTTTGGGACGAATTTCGATACCGATGCGAATGTGGCGATTTTAGCCTCGGG
CGTGAGTAGCTTGTATGATTTCAGCCTGGCGGGTGAAGACAGCGTTTGGGTGTCGA

Translation

[131 - 655/656]   direct strand
>GOS_1743020 Translation [131-655   direct strand]
MGCVFPLLASTAPIASHTQPQAAQLSPSFAQMSPESPIDGQNNPNSVYAFGSYLGTGVYRAADQNATVVSIPLSFDFLKDESSQTWLRLPLSFGFFDYLA
KDITDGELPSSVGTMTMTPGIEHHWQATANTRMEAYLDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSVWVS
[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

Avec ORF Finder, après reflexion, on s'est intéressé à l'ORF la plus longue et qui commence par une méthionine, elle se situe sur le brin direct (ORF de 175 AA).

De plus, il existe des protéines homologues avec BLAST.

On peut donc affirmer que cette séquence est codante.


Nous avons aligné notre séquence contre la banque NR, on obtient plusieurs homologues qui s'alignent sur 100% de la séquences. Les scores sont élevés et les E-value très faibles (<0), les 1er semblent correspondre aux Gamma-Proteobacteria.

On décide de construire deux groupes de la façon suivante

Groupe d'étude: proteobacteria

Groupe extérieur: autres bacteria (_non proteobacteria: Bacteria, Cyanobacteria)


Avec MUSCLE,




les arbres phylogenetique obtennus sont relativement cohérent avec la phylogenie de référence : la séquence inconnue se situent à l'intérieur du groupe d'étude (proteobacteria). L'arbre semble respecter les relations de parenté conventionnelle entre les différents groupes taxonomiques de la phylogénie de référence.

Les arbres semblent également relativement cohérents entre les deux méthodes BioNJ et PhyML.


La séquence métagénomique semble s'intégrer dans le groupe taxonimique des proteobacteria.


On obtient ainsi :

Proteobacteria

Rang: phylum - Code Génétique: Bacterial and Plant Plastid - Identifiant NCBI: 1224

Règne: Bacteria - Division: Proteobacteria - Classe: - Ordre:

Bacteria; Proteobacteria;










ORF finding

PROTOCOLE:


a) SMS ORFinder / sens direct / cadres 1, 2 & 3 / min 60 AA / initiation 'any codon' / code génétique 'universel'


b) SMS ORFinder / sens indirect / cadres 1, 2 & 3 / min 60 AA / initiation 'any codon' / code génétique 'universel'


c) SMS ORFinder / sens direct / cadres 1, 2 & 3 / min 60 AA / initiation 'ATG' / code génétique 'universel'



ANALYSE DES RÉSULTATS:

Le logiciel SMS ORF Finder touve 1 ORF sur le brin direct et 1 ORF sur le brin reverse.

On obtient selon les protocoles :

a) ORF a 222 AA (direct)

b) ORF a 108 AA (indirect)

c) ORF a 175 AA (direct,initiation 'ATG')


On s'intéresse à l'ORF la plus longue qui se situe sur le brin direct (l'ORF de 222 AA ne commence pas par une méthionine, elle commence à la base 50 et devrait donc contenir la méthionine initiale car l'ORF est complète en 5').

Avec ORF Finder, on recherche alors les ORF commençant par une méthionine, et on retrouve l'ORF sur le brin direct de 175 AA.

C'est celle que l'on choisit puisqu'il s'agit de la séquence la plus longue et étant supérieure à 150 AA, il paraît extrêmement improbable qu'il s'agisse d'un faux positif.

De plus, il existe des protéines homologues (voir rubrique BLAST) qui s'alignent sur 100% de la séquence avec des E-value faible (largement inférieure à 1e-4)

On peut donc affirmer que cette séquence est codante.


Le calcul du poids moléculaire n'est pas pertinent car la protéine est partielle

(incomplète en 3')


RÉSULTATS BRUTS:

a) sens direct

>ORF number 1 in reading frame 2 on the direct strand extends from base 50 to base 655.
CAAATCAGGATCTGTTTGCATAAAGTGAAGACCATCTTTAGCCGGTTACTCGTTAAATGC
TTTTCCTGTTCGGCGCTATCAATGGGGTGCGTCTTCCCACTGTTGGCGTCGACCGCTCCC
ATTGCAAGCCACACCCAACCGCAGGCTGCGCAGCTATCTCCGTCGTTTGCTCAAATGAGC
CCCGAATCGCCGATTGATGGCCAAAATAATCCCAACTCTGTTTATGCCTTTGGCAGTTAT
CTTGGCACGGGTGTGTATCGGGCCGCCGATCAAAATGCCACTGTGGTGAGCATTCCCTTA
AGCTTTGATTTCTTAAAGGACGAAAGTAGTCAAACTTGGCTGCGTCTACCCTTATCCTTC
GGTTTTTTTGACTACTTAGCTAAAGATATTACCGATGGTGAATTGCCTTCCTCGGTCGGC
ACTATGACGATGACGCCAGGCATAGAGCATCATTGGCAGGCAACGGCAAACACGCGGATG
GAAGCCTATCTGGATGTGGGCTTTGGGACGAATTTCGATACCGATGCGAATGTGGCGATT
TTAGCCTCGGGCGTGAGTAGCTTGTATGATTTCAGCCTGGCGGGTGAAGACAGCGTTTGG
GTGTCG

>Translation of ORF number 1 in reading frame 2 on the direct strand.
QIRICLHKVKTIFSRLLVKCFSCSALSMGCVFPLLASTAPIASHTQPQAAQLSPSFAQMS
PESPIDGQNNPNSVYAFGSYLGTGVYRAADQNATVVSIPLSFDFLKDESSQTWLRLPLSF
GFFDYLAKDITDGELPSSVGTMTMTPGIEHHWQATANTRMEAYLDVGFGTNFDTDANVAI
LASGVSSLYDFSLAGEDSVWVS

No ORFs were found in reading frame 3.


b) sens indirect

>ORF number 1 in reading frame 1 on the reverse strand extends from base 229 to base 555.
CTAAGTAGTCAAAAAAACCGAAGGATAAGGGTAGACGCAGCCAAGTTTGACTACTTTCGT
CCTTTAAGAAATCAAAGCTTAAGGGAATGCTCACCACAGTGGCATTTTGATCGGCGGCCC
GATACACACCCGTGCCAAGATAACTGCCAAAGGCATAAACAGAGTTGGGATTATTTTGGC
CATCAATCGGCGATTCGGGGCTCATTTGAGCAAACGACGGAGATAGCTGCGCAGCCTGCG
GTTGGGTGTGGCTTGCAATGGGAGCGGTCGACGCCAACAGTGGGAAGACGCACCCCATTG
ATAGCGCCGAACAGGAAAAGCATTTAA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
LSSQKNRRIRVDAAKFDYFRPLRNQSLRECSPQWHFDRRPDTHPCQDNCQRHKQSWDYFG
HQSAIRGSFEQTTEIAAQPAVGCGLQWERSTPTVGRRTPLIAPNRKSI*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.


c) initiation 'ATG'

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 131 to base 655.
ATGGGGTGCGTCTTCCCACTGTTGGCGTCGACCGCTCCCATTGCAAGCCACACCCAACCG
CAGGCTGCGCAGCTATCTCCGTCGTTTGCTCAAATGAGCCCCGAATCGCCGATTGATGGC
CAAAATAATCCCAACTCTGTTTATGCCTTTGGCAGTTATCTTGGCACGGGTGTGTATCGG
GCCGCCGATCAAAATGCCACTGTGGTGAGCATTCCCTTAAGCTTTGATTTCTTAAAGGAC
GAAAGTAGTCAAACTTGGCTGCGTCTACCCTTATCCTTCGGTTTTTTTGACTACTTAGCT
AAAGATATTACCGATGGTGAATTGCCTTCCTCGGTCGGCACTATGACGATGACGCCAGGC
ATAGAGCATCATTGGCAGGCAACGGCAAACACGCGGATGGAAGCCTATCTGGATGTGGGC
TTTGGGACGAATTTCGATACCGATGCGAATGTGGCGATTTTAGCCTCGGGCGTGAGTAGC
TTGTATGATTTCAGCCTGGCGGGTGAAGACAGCGTTTGGGTGTCG

>Translation of ORF number 1 in reading frame 2 on the direct strand.
MGCVFPLLASTAPIASHTQPQAAQLSPSFAQMSPESPIDGQNNPNSVYAFGSYLGTGVYR
AADQNATVVSIPLSFDFLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTMTPG
IEHHWQATANTRMEAYLDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSVWVS

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOLE:


Phylogeny.fr / Multiple Alignement : MUSCLE / Alignement curation : Gblocks / Construction of phylogenetic tree / Maximum Likehood PhyML / Visualisation of phylogenetic tree : TreeDyn / Run workflow : step by step



ANALYSE DES RÉSULTATS:


Les alignements multiples effectués avec différentes méthodes sont équivalents.


Les résultats présentent a la fois des régions conservées convaincantes, en accord avec les domaines protéiques présumés de notre ORF et ceux des ses homologues les plus proches donnés par Blastp, et beaucoup de mutations.


Les séquences ne sont pas identiques et n'ont pas la même longueur.


Notre ORF semble s'aligner correctement avec ses homologues présumés.

RÉSULTATS BRUTS:

CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


LentiArane      ----------------------------------------MKKILLFIFLLFSINIKADY
ColwePsych      -----------------------------------------MKPIMVIVLMLFSFI----
SheAmaSB2B      ---------------------------------MDAPIALKPARIFAILLLSSPCVAQQA
SheDeOs217      ------------------------MTSLLAF------IQSNTNKISFLAFITGWAWTA--
ShewaBO155      -----------MSHFFSRLPLCLSLTCLVFLSIIPAVFANSASPANTFTPATLTSASQAN
ShewaBO195      -----------MSHFFSRLPLCLSLTCLVFLSIVPAVFANSESPANTFTPATLTSASQAN
ShewaBO223      -----------MSHFFSRLPLCLSLTCLVLLSIVPAVFANSASPANTFTPATLTSASQAN
ShewaW31_g      -------------------MSAWLLGSLIP---------NVTLAQAYLSEQDFIPSSPTS
ShewaPu200      -------------------MSAWLLGSLIP---------NVTLAQVYLSEQDFIPSSPTN
ShewaMR1_g      MCLRKLNITFSRLLVNVYSISALSLGIMFPLLASSSPISN----QTVLGTQSSQTFAKIS
GOS_174302      ------------------------MGCVFPLLASTAPIASHTQPQA---AQLSPSFAQMS
ShewaANA3       ------------------------MGCVFPLLASTAPIVSHTQPQA---AQLSQSFAQMS
ShewaMR7_g      ------------------------MGCVFPLLASTAPIASHSTSQSVLTAQYPQSFAQMS
ShewaMR4_g      ------------------------MGSVFPLLASTTPIASHSTSQSVLTAQSPQSFAQMS
ShewaFrigi      -------------MMMKQGQNIPLIGSSLFDYLRFMSVTCRFTLMILLIVYSSITYAELT
SheWo51908      ------------------------------------MVLNKSLFICLSLLFLSSSI----
SheSeEB3_g      ------------------------------------MVLNKTCSIFISILFFSSSV----
SheBeKT99       -------------------------MCLELKKLRVSELTRYLYGMVLYMVLKSVLIALTL
ShewaViola      ------------------------------------------------------------
ShePiWP3_g      -------------------------------------MMALVRSLSVLLLLFIPPV----
SheHalEB4       --------------------------------------MARLRYLSISPLLFILPA----
ShePe345_g      --------------------------------------MSRLRYLALLLPLFSPHV----
                                                                            

LentiArane      P-----------------------------PA-VHYAFGNYLGSGVYEVSGEQAFLMRIP
ColwePsych      ---------------------VMSVEAEDIEP-VHYAYANYLGSGIYQTTGQNASLISMP
SheAmaSB2B      P-----------------------------DV-SHYAFANYLGSGIYSSAGDSAAVVNIP
SheDeOs217      ---------------------EAATEVTTKDA-SHYAFANYLGSGVYRTSEQSAAVLNIP
ShewaBO155      DAGLPVDPVSISHVPSSNANGSNPIESSSNPN-SVYAFGSYLGTGVYRAANQNATVVSIP
ShewaBO195      DAGVSVDPVSISHVPSSNANGSNPIELSSNPN-SVYAFGSYLGTGVYRAANQNATVVSIP
ShewaBO223      DAGVSVDPVSISHVPSSNANGSNPIESSSNPN-SVYAFGSYLGTGVYRAANQNATVVSIP
ShewaW31_g      N--------------------HLAAENQSNPN-SVYAFGSYLGTGVYRAAEQNATVVSVP
ShewaPu200      N--------------------HLAAENQSNPN-SVYAFGSYLGTGVYRAAEQNATVVSVP
ShewaMR1_g      P--------------------EMPIDDKNNPN-SVYAFGSYLGTGIYRAAEQNATIVSIP
GOS_174302      P--------------------ESPIDGQNNPN-SVYAFGSYLGTGVYRAADQNATVVSIP
ShewaANA3       P--------------------ESPIDGQNNPN-SVYAFGSYLGTGVYRAADQNATVVSIP
ShewaMR7_g      P--------------------ESPVDGQNNPN-SVYAFGSYLGTGVYRAADQNATVVSIP
ShewaMR4_g      P--------------------ESPVDGQNNPN-SVYAFGSYLGTGVYRAAEQNATVVSIP
ShewaFrigi      P--------------------TTPPELITEPDASHYAFANYLGSGVYRTSGQSAAVANIP
SheWo51908      --------------------------QAEEDF-THYAFANYLGSGLYRTSGQNTTVVNMP
SheSeEB3_g      --------------------------YSEDDF-THYAFANYLGSGLYRTSGQNATVVNLP
SheBeKT99       L--------------------GSFSVDAEEDF-THYAFANYLGSGIYQTSGQNATVVNIP
ShewaViola      -------------------------------------------------------MVNIP
ShePiWP3_g      --------------------------NAETDY-SHYAFANYLGSGVYQTSGQNATVVNIP
SheHalEB4       --------------------------HSETDY-SHYAFANYLGSGLYRTAGQNATVANIP
ShePe345_g      ------------------------MAETEVDY-SHYAFANYLGSGIYRTSGQNTTVANIP
                                                                       :  :*

LentiArane      FAYKF-QEDGEGLRLRLPVNVGIYNW---SITDTEAPDSINVGSFIPGIEYRHRVNERFS
ColwePsych      FSYELGHEGKTTYGLRLPVSVGFFDFELGDLPNLDLPDSVGTVTFTPGIAFNYQYSKDWF
SheAmaSB2B      LSFDIESSSEHSLLLRMPLSLGFFNYNWDELPEGDFPDAVGTVTVTPGIEYHWRASPNLK
SheDeOs217      LKHELADWSDSKLMLRLPISLGFFNYDFKDFPSGDIPTGVGTMVMTPGVEYHWKGQNRWR
ShewaBO155      LSFDLKKDSGSQTWLRLPISFGFFDYLAKDITEGELPSSIGTMTITPGFEHHWQASENTR
ShewaBO195      LSFDLKKDSGSQTWLRLPISFGFFDYLAKDITEGELPSSIGTMTITPGFEHHWQASENTR
ShewaBO223      LSFDLKKDSGSQTWLRLPISFGFFDYLAKDITEGELPSSIGTMTITPGFEHHWQASENTR
ShewaW31_g      LSFDFQKDNDSQTWLRLPLSFGFFDYLAQDLTEGEFPSSVGTMTVTPGIEHHWQASENTR
ShewaPu200      LSFDFQKDNDSQTWLRLPLSFGFFDYLAQDLTEGEFPSSVGTMTVTPGVEHHWQASENTR
ShewaMR1_g      LVFDFLKEESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTMTPGIEHHWQATINTR
GOS_174302      LSFDFLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTMTPGIEHHWQATANTR
ShewaANA3       LSFDFLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTMTPGIEHHWQATANTR
ShewaMR7_g      LSFDFLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTMTPGIEHHWQATVNTR
ShewaMR4_g      LSFEFLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTMTPGIEHHWQATANTR
ShewaFrigi      MGFVLDSTDDYLLKLRFTASFGFFDYSFNDLPQGSIPNSVGTITLTPGLEYHWLVDDKLT
SheWo51908      MSFELWQDDTDSLTLRTPVSLGFFNFKWDDLPEGELPSSVGTFTFTPGVEYRTRTAENHE
SheSeEB3_g      FSFELQQNDTETLMLRAPVSLGFFNFKWSDVPEGDLPSSVGTATFTPGIEYRVRTSERYE
SheBeKT99       ISFELYNNDTESLTLRTPLSLGFFNFKWSDLPDGDLPSSVGTMTITPGLEYRLRTSEDHE
ShewaViola      VSFDLYNNDTESLILRTPISLGFFNFKWSDLPEGDLPSSVGTMTITPGIEYRIRTSEHHE
ShePiWP3_g      LSFELQRSETESLVLRTPISLGFFNFTWSDIPDGDFPDSVGTATFTPGIEYRVKTTDTHE
SheHalEB4       ISFDLQRSETESLVLKTPVSMGFFNFTWRDLPEGEFPSSVGTLTVTPGLEYRIKTSDTHE
ShePe345_g      ISFDLMRSEDESLVLNTPVSLGFFNFTWSDLPEGEFPSSVGTLTVTPGVEYRVKTSETHE
                . . :         *. . ..*::::   .... . * .:..  . **. ..        

LentiArane      VEPFFDLGYAHDFDNSENTLVTAVG--SAFKFQFGDELQHWWVNRITYAKARSEDDNAES
ColwePsych      IESYIDLGYGRNLTTNKGVSIHSSGVSALYHFDIKNYDAI-WANRLYYARYDGNGYDAKD
SheAmaSB2B      METYLDIGFGHNFSDNSNVGILSAGISTLYSFGSETYQPL-WVSRFYSAGYRSIQSGSEE
SheDeOs217      YESYVDLGFGYNFSNENQVAIFSMGISALYDMDWPDYSPT-WVNRLYYAGYRNKLDHNTE
ShewaBO155      MEGYLDIGFGTNFDKNDNVAIIASGISSLYDFTLAGQDAV-WVSRLRFAGYSEHYGKFAD
ShewaBO195      MEGYLDIGFGTNFDKNDNVAIIASGISSLYDFTLAGQDAV-WVSRLRFAGYSEHYGKFAD
ShewaBO223      MEGYLDIGFGTNFDKNDNVAIIASGISSLYDFTLAGQDAV-WVSRLRFAGYSEHYGKFAD
ShewaW31_g      MEAYFDVGFGTNFDTSENVAILATGISTLYDFTLGGEESV-WVSRLHFAGYSERLGHLTD
ShewaPu200      MEAYFDVGFGTNFDTSENVAILATGISTLYDFTLGGEESV-WVSRLHFAGYSERVGHLTD
ShewaMR1_g      MEAYLDVGFGTNFDTDTNVAILASGISTLYDFTLAGEDSV-WVSRLRFAGYSEQVGELTD
GOS_174302      MEAYLDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSV-WVS----------------
ShewaANA3       MEAYLDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSV-WVSRLRFAGYSERVGKLTD
ShewaMR7_g      MEAYLDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSV-WVSRLRFAGYSERVGKLTD
ShewaMR4_g      MEAYLDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSV-WVSRLRFAGYSERVGKLTD
ShewaFrigi      LESYVDLGYGHNFSTYSHVGVFSTGVSALYKLDAPLFTPV-WVNRIYYAGYQSNQNDSTE
SheWo51908      FQAYFDLGYGKNLNSGDHVAIISGGVSSLLELEYKQSAPV-WVNRLYFAGYQSFDGSQAE
SheSeEB3_g      FQSYFDLGYGKNFTSGTNVAIMSAGVSSLLDLEFKQTRPR-WVNRLYFAGYRSFGGEQKE
SheBeKT99       FQTYVDLGYGTNFTSGTHVAIYSAGVSSLLDLELRQSAPV-WVNRLFFAGYASFDGTQSE
ShewaViola      FQTYFDLGYGNNFTTGTNVGILSAGVSSLLDFELKQADPV-WVNRLFFAGYTSFDGKQSE
ShePiWP3_g      FQTYADLGFGTNTTNGNDVIIYSAGMSSLLDFELRETDPV-WVNRIFFAGYNSLDDAQSE
SheHalEB4       FQTYADLGFGTNFTNSNDVIIYSAGMSSLLDFELGDSDPV-WVNRIFFAGYSTLHDGSSE
ShePe345_g      FQTYADLGFGTNFTNGNDVAIYSAGMSSLLDFELGDTSPV-WVNRVFFAGYTTLNDNSSE
                 : : *:*:. :      . : : *  :   :         *..                

LentiArane      TLTFWQTGIDLE--TPLEGSFFDYDFNLATYAMTRVYFDNFSLEADDP-----EKDVDVR
ColwePsych      SYAAIQLGIDMG--LPLQYQVFGYPFQPRFFATAFWYFSEVDFLTPRTRSFDEEDNVTLT
SheAmaSB2B      HYSALTSGVESG--LGWGFSAWERQMEPRLFVAMHWYFGRGELADEF------VGALFGE
SheDeOs217      SFSALSSGIESG--LNQQWLWGDVAFEPRLFLGANWYFDKLKFSSVT------KADTFTN
ShewaBO155      QFAVLQTGVDLG--LAPRWQWWDLQVQPRIFAVGYWYFNELRFISEI------EQDTIVS
ShewaBO195      QFAVLQTGVDLG--LAPRWQWWDLQVQPRIFAVGYWYFNELRFISEI------EQDTIVS
ShewaBO223      QFAVLQTGVDLG--LAPRWQWWDLQVQPRIFAVGYWYFNELRFISEI------EQDTIVS
ShewaW31_g      QFAVLQTGIDIG--LSPRWQWQNIQVQPRLFVLGYWYFNALNFSSDS------EQDTVVS
ShewaPu200      QFAVLQTGIDIG--LSPRWQWQNIQVQPRLFVLGYWYFNALNFSSDS------EQDTVVS
ShewaMR1_g      QFAVLQTGVDIG--LSPRWQWLNIQMQPRLFAVGYWYFNELDFSQDA------EDETIVS
GOS_174302      ------------------------------------------------------------
ShewaANA3       QFAVLQTGVDIG--LSPRWQWLNIQMQPRVFAVGYWYFNELDFSQNA------EDETIVS
ShewaMR7_g      QFAVLQSGVDIG--LSPRWQWLNIQMQPRVFAVGYWYFNELDFSQDA------ENETIVS
ShewaMR4_g      QFAVLQSGVDIG--LSPRWQWLNIQMQPRVFAVGYWYFNELDFSQDA------ENETIVS
ShewaFrigi      GYSVFKTGVDFG--VNYDWQWKDVRVEPRFFIAGHWYFDKLKFVTPV------GNDVLTS
SheWo51908      TYSAIQSGFDIGTDIHWRWDWLGVDVEPRVFAVGYWYFDKLRFATPF------GDDVLVS
SheSeEB3_g      TYSALQSGIDIGTDIHWRWNWLGVDVEPRVFAVGYWYFDKLKIATPF------GEDVLVS
SheBeKT99       TYSALQSGIDIGTNMHWRWDLLGVDVEPRVFVTGYWYFDKLRFATPF------GEDVLVS
ShewaViola      TYSAIQSGIDIGTDIHWRWDWLGVDVEPRVFAVGYWYFDKLRFAMPF------GEDVLVS
ShePiWP3_g      TYSAIQSGVDIG--TNYHFQVADVGIEPRFFVAGYWYFDKLRFVTPF------EEDVLVT
SheHalEB4       TYSAVQSGVDIG--TNLHFQLGGVDMEPRFFAAGYWYFDRLKFTTPF------EEDVLVA
ShePe345_g      TYSAVQSGVDIG--TNFYFQVKGVEIEPRFFVAGYWYFDRLKFTTPF------EEDVLVS
                                                                            

LentiArane      QTYEGGFSFKLKEK-----WKFKFLEIGRVGFGYQFGDGFDLYKVFVNLAI
ColwePsych      NSVEFGFTLKFAKT-----IGYSWAGIERLGLSYRYSKNFSAFRLLFSFPI
SheAmaSB2B      STLELGLSLVFDKP-----LEFEVVSIERVGFSYSKAGGEDVWRVFFSHPL
SheDeOs217      YSVELGFSLLFTQP-----VGWEYLNIKRAGLSYQVGEGLRVIKFHLDFPL
ShewaBO155      GSYEAGFSLAFSKP-----LGGELLGVDRIGFSYRRGDGLNIWRLMFSFPI
ShewaBO195      GSYEAGFSLAFSKP-----LGGELLGVDRIGFSYRRGDGLNIWRLMFSFPI
ShewaBO223      GSYEAGFSLAFSKP-----LGGELLGVDRIGFSYRRGDGLNIWRLMFSFPI
ShewaW31_g      GSYELGATFAFSKP-----IGADLLSIDRIGLSYRTGDGLSIWRLLFSFPI
ShewaPu200      GSYELGATFAFSKP-----IGADLLSIDRIGLSYRTGDGLSIWRLLFSFPI
ShewaMR1_g      GSYEFGATLAFSKP-----LGGDLLGVDRIGISYRTGDGLNIWRLLFSFPI
GOS_174302      ---------------------------------------------------
ShewaANA3       GSYEFGATLAFAKP-----LGGDLLGIDRIGISYRTGDGLNIWRLLFSFPI
ShewaMR7_g      GSYEIGATLAFSKP-----LGGELLGIDRIGISYRTGDGLNIWRLLFSFPI
ShewaMR4_g      GSYEIGATLAFSKP-----LGGELLGIDRIGISYRTGDGLNIWRLLFSFPI
ShewaFrigi      YTYEVGTTLAFSKPINFSAIGLDSVEIEHFGLSYQVGGGLKVWRLIFEFPL
SheWo51908      HSLEVGATLAFSKP-----ILWEWMGIDRLGLSVRAGDGVQVWRLIFEFPI
SheSeEB3_g      NSLEVGATLAFSKP-----ILWEWMGIDRLGLSVRAGDGVQAWRLIFEFPI
SheBeKT99       NSLEVGATLAFSKP-----ILWDWMGIDRLGLSVRAGDGVKVWRLIFEFPI
ShewaViola      NSLEVGATLAFSKP-----IFWEWMGIDRLGLSVRAGDGIKAWRLLFEFPI
ShePiWP3_g      NSLEAGITLAFSKP-----IGWDLFNMSRFGISYRAGDGVQVWRLIFDFPI
SheHalEB4       NSFEAGITLAFSKP-----IGWDLVNIDRFGISYRAGDGVEVWRLIFEFPL
ShePe345_g      NSYEVGMTFAFSKP-----VGWDLVNIERFGLSYRAGDGIEVWRLIFEFPI
                                                                   


-----------------------------------------------------------------------
//////////////////////////////////////////////////////////////////////
-----------------------------------------------------------------------


Gblocks 0.91b Results

Processed file: input.fasta
Number of sequences: 22
Alignment assumed to be: Protein
New number of positions: 81 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
LentiArane_gi|1  ----------------------------------------MKKILLFIFLLFSINIKADY
ColwePsych_gi|7  -----------------------------------------MKPIMVIVLMLFSFI----
SheAmaSB2B_gi|1  ---------------------------------MDAPIALKPARIFAILLLSSPCVAQQA
SheDeOs217_gi|9  ------------------------MTSLLAF------IQSNTNKISFLAFITGWAWTA--
ShewaBO155_gi|1  -----------MSHFFSRLPLCLSLTCLVFLSIIPAVFANSASPANTFTPATLTSASQAN
ShewaBO195_gi|1  -----------MSHFFSRLPLCLSLTCLVFLSIVPAVFANSESPANTFTPATLTSASQAN
ShewaBO223_gi|2  -----------MSHFFSRLPLCLSLTCLVLLSIVPAVFANSASPANTFTPATLTSASQAN
ShewaW31_gi|120  -------------------MSAWLLGSLIP---------NVTLAQAYLSEQDFIPSSPTS
ShewaPu200_gi|1  -------------------MSAWLLGSLIP---------NVTLAQVYLSEQDFIPSSPTN
ShewaMR1_gi|243  MCLRKLNITFSRLLVNVYSISALSLGIMFPLLASSSPISN----QTVLGTQSSQTFAKIS
GOS_1743020_Tra  ------------------------MGCVFPLLASTAPIASHTQPQA---AQLSPSFAQMS
ShewaANA3_gi|11  ------------------------MGCVFPLLASTAPIVSHTQPQA---AQLSQSFAQMS
ShewaMR7_gi|114  ------------------------MGCVFPLLASTAPIASHSTSQSVLTAQYPQSFAQMS
ShewaMR4_gi|113  ------------------------MGSVFPLLASTTPIASHSTSQSVLTAQSPQSFAQMS
ShewaFrigi_gi|1  -------------MMMKQGQNIPLIGSSLFDYLRFMSVTCRFTLMILLIVYSSITYAELT
SheWo51908_gi|1  ------------------------------------MVLNKSLFICLSLLFLSSSI----
SheSeEB3_gi|157  ------------------------------------MVLNKTCSIFISILFFSSSV----
SheBeKT99_gi|16  -------------------------MCLELKKLRVSELTRYLYGMVLYMVLKSVLIALTL
ShewaViola_gi|2  ------------------------------------------------------------
ShePiWP3_gi|212  -------------------------------------MMALVRSLSVLLLLFIPPV----
SheHalEB4_gi|16  --------------------------------------MARLRYLSISPLLFILPA----
ShePe345_gi|157  --------------------------------------MSRLRYLALLLPLFSPHV----
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
LentiArane_gi|1  P-----------------------------PA-VHYAFGNYLGSGVYEVSGEQAFLMRIP
ColwePsych_gi|7  ---------------------VMSVEAEDIEP-VHYAYANYLGSGIYQTTGQNASLISMP
SheAmaSB2B_gi|1  P-----------------------------DV-SHYAFANYLGSGIYSSAGDSAAVVNIP
SheDeOs217_gi|9  ---------------------EAATEVTTKDA-SHYAFANYLGSGVYRTSEQSAAVLNIP
ShewaBO155_gi|1  DAGLPVDPVSISHVPSSNANGSNPIESSSNPN-SVYAFGSYLGTGVYRAANQNATVVSIP
ShewaBO195_gi|1  DAGVSVDPVSISHVPSSNANGSNPIELSSNPN-SVYAFGSYLGTGVYRAANQNATVVSIP
ShewaBO223_gi|2  DAGVSVDPVSISHVPSSNANGSNPIESSSNPN-SVYAFGSYLGTGVYRAANQNATVVSIP
ShewaW31_gi|120  N--------------------HLAAENQSNPN-SVYAFGSYLGTGVYRAAEQNATVVSVP
ShewaPu200_gi|1  N--------------------HLAAENQSNPN-SVYAFGSYLGTGVYRAAEQNATVVSVP
ShewaMR1_gi|243  P--------------------EMPIDDKNNPN-SVYAFGSYLGTGIYRAAEQNATIVSIP
GOS_1743020_Tra  P--------------------ESPIDGQNNPN-SVYAFGSYLGTGVYRAADQNATVVSIP
ShewaANA3_gi|11  P--------------------ESPIDGQNNPN-SVYAFGSYLGTGVYRAADQNATVVSIP
ShewaMR7_gi|114  P--------------------ESPVDGQNNPN-SVYAFGSYLGTGVYRAADQNATVVSIP
ShewaMR4_gi|113  P--------------------ESPVDGQNNPN-SVYAFGSYLGTGVYRAAEQNATVVSIP
ShewaFrigi_gi|1  P--------------------TTPPELITEPDASHYAFANYLGSGVYRTSGQSAAVANIP
SheWo51908_gi|1  --------------------------QAEEDF-THYAFANYLGSGLYRTSGQNTTVVNMP
SheSeEB3_gi|157  --------------------------YSEDDF-THYAFANYLGSGLYRTSGQNATVVNLP
SheBeKT99_gi|16  L--------------------GSFSVDAEEDF-THYAFANYLGSGIYQTSGQNATVVNIP
ShewaViola_gi|2  -------------------------------------------------------MVNIP
ShePiWP3_gi|212  --------------------------NAETDY-SHYAFANYLGSGVYQTSGQNATVVNIP
SheHalEB4_gi|16  --------------------------HSETDY-SHYAFANYLGSGLYRTAGQNATVANIP
ShePe345_gi|157  ------------------------MAETEVDY-SHYAFANYLGSGIYRTSGQNTTVANIP
                                                                             


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
LentiArane_gi|1  FAYKF-QEDGEGLRLRLPVNVGIYNW---SITDTEAPDSINVGSFIPGIEYRHRVNERFS
ColwePsych_gi|7  FSYELGHEGKTTYGLRLPVSVGFFDFELGDLPNLDLPDSVGTVTFTPGIAFNYQYSKDWF
SheAmaSB2B_gi|1  LSFDIESSSEHSLLLRMPLSLGFFNYNWDELPEGDFPDAVGTVTVTPGIEYHWRASPNLK
SheDeOs217_gi|9  LKHELADWSDSKLMLRLPISLGFFNYDFKDFPSGDIPTGVGTMVMTPGVEYHWKGQNRWR
ShewaBO155_gi|1  LSFDLKKDSGSQTWLRLPISFGFFDYLAKDITEGELPSSIGTMTITPGFEHHWQASENTR
ShewaBO195_gi|1  LSFDLKKDSGSQTWLRLPISFGFFDYLAKDITEGELPSSIGTMTITPGFEHHWQASENTR
ShewaBO223_gi|2  LSFDLKKDSGSQTWLRLPISFGFFDYLAKDITEGELPSSIGTMTITPGFEHHWQASENTR
ShewaW31_gi|120  LSFDFQKDNDSQTWLRLPLSFGFFDYLAQDLTEGEFPSSVGTMTVTPGIEHHWQASENTR
ShewaPu200_gi|1  LSFDFQKDNDSQTWLRLPLSFGFFDYLAQDLTEGEFPSSVGTMTVTPGVEHHWQASENTR
ShewaMR1_gi|243  LVFDFLKEESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTMTPGIEHHWQATINTR
GOS_1743020_Tra  LSFDFLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTMTPGIEHHWQATANTR
ShewaANA3_gi|11  LSFDFLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTMTPGIEHHWQATANTR
ShewaMR7_gi|114  LSFDFLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTMTPGIEHHWQATVNTR
ShewaMR4_gi|113  LSFEFLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTMTPGIEHHWQATANTR
ShewaFrigi_gi|1  MGFVLDSTDDYLLKLRFTASFGFFDYSFNDLPQGSIPNSVGTITLTPGLEYHWLVDDKLT
SheWo51908_gi|1  MSFELWQDDTDSLTLRTPVSLGFFNFKWDDLPEGELPSSVGTFTFTPGVEYRTRTAENHE
SheSeEB3_gi|157  FSFELQQNDTETLMLRAPVSLGFFNFKWSDVPEGDLPSSVGTATFTPGIEYRVRTSERYE
SheBeKT99_gi|16  ISFELYNNDTESLTLRTPLSLGFFNFKWSDLPDGDLPSSVGTMTITPGLEYRLRTSEDHE
ShewaViola_gi|2  VSFDLYNNDTESLILRTPISLGFFNFKWSDLPEGDLPSSVGTMTITPGIEYRIRTSEHHE
ShePiWP3_gi|212  LSFELQRSETESLVLRTPISLGFFNFTWSDIPDGDFPDSVGTATFTPGIEYRVKTTDTHE
SheHalEB4_gi|16  ISFDLQRSETESLVLKTPVSMGFFNFTWRDLPEGEFPSSVGTLTVTPGLEYRIKTSDTHE
ShePe345_gi|157  ISFDLMRSEDESLVLNTPVSLGFFNFTWSDLPEGEFPSSVGTLTVTPGVEYRVKTSETHE
                               ############   ###############################


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
LentiArane_gi|1  VEPFFDLGYAHDFDNSENTLVTAVG--SAFKFQFGDELQHWWVNRITYAKARSEDDNAES
ColwePsych_gi|7  IESYIDLGYGRNLTTNKGVSIHSSGVSALYHFDIKNYDAI-WANRLYYARYDGNGYDAKD
SheAmaSB2B_gi|1  METYLDIGFGHNFSDNSNVGILSAGISTLYSFGSETYQPL-WVSRFYSAGYRSIQSGSEE
SheDeOs217_gi|9  YESYVDLGFGYNFSNENQVAIFSMGISALYDMDWPDYSPT-WVNRLYYAGYRNKLDHNTE
ShewaBO155_gi|1  MEGYLDIGFGTNFDKNDNVAIIASGISSLYDFTLAGQDAV-WVSRLRFAGYSEHYGKFAD
ShewaBO195_gi|1  MEGYLDIGFGTNFDKNDNVAIIASGISSLYDFTLAGQDAV-WVSRLRFAGYSEHYGKFAD
ShewaBO223_gi|2  MEGYLDIGFGTNFDKNDNVAIIASGISSLYDFTLAGQDAV-WVSRLRFAGYSEHYGKFAD
ShewaW31_gi|120  MEAYFDVGFGTNFDTSENVAILATGISTLYDFTLGGEESV-WVSRLHFAGYSERLGHLTD
ShewaPu200_gi|1  MEAYFDVGFGTNFDTSENVAILATGISTLYDFTLGGEESV-WVSRLHFAGYSERVGHLTD
ShewaMR1_gi|243  MEAYLDVGFGTNFDTDTNVAILASGISTLYDFTLAGEDSV-WVSRLRFAGYSEQVGELTD
GOS_1743020_Tra  MEAYLDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSV-WVS----------------
ShewaANA3_gi|11  MEAYLDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSV-WVSRLRFAGYSERVGKLTD
ShewaMR7_gi|114  MEAYLDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSV-WVSRLRFAGYSERVGKLTD
ShewaMR4_gi|113  MEAYLDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSV-WVSRLRFAGYSERVGKLTD
ShewaFrigi_gi|1  LESYVDLGYGHNFSTYSHVGVFSTGVSALYKLDAPLFTPV-WVNRIYYAGYQSNQNDSTE
SheWo51908_gi|1  FQAYFDLGYGKNLNSGDHVAIISGGVSSLLELEYKQSAPV-WVNRLYFAGYQSFDGSQAE
SheSeEB3_gi|157  FQSYFDLGYGKNFTSGTNVAIMSAGVSSLLDLEFKQTRPR-WVNRLYFAGYRSFGGEQKE
SheBeKT99_gi|16  FQTYVDLGYGTNFTSGTHVAIYSAGVSSLLDLELRQSAPV-WVNRLFFAGYASFDGTQSE
ShewaViola_gi|2  FQTYFDLGYGNNFTTGTNVGILSAGVSSLLDFELKQADPV-WVNRLFFAGYTSFDGKQSE
ShePiWP3_gi|212  FQTYADLGFGTNTTNGNDVIIYSAGMSSLLDFELRETDPV-WVNRIFFAGYNSLDDAQSE
SheHalEB4_gi|16  FQTYADLGFGTNFTNSNDVIIYSAGMSSLLDFELGDSDPV-WVNRIFFAGYSTLHDGSSE
ShePe345_gi|157  FQTYADLGFGTNFTNGNDVAIYSAGMSSLLDFELGDTSPV-WVNRVFFAGYTTLNDNSSE
                 #########################  #############                    


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
LentiArane_gi|1  TLTFWQTGIDLE--TPLEGSFFDYDFNLATYAMTRVYFDNFSLEADDP-----EKDVDVR
ColwePsych_gi|7  SYAAIQLGIDMG--LPLQYQVFGYPFQPRFFATAFWYFSEVDFLTPRTRSFDEEDNVTLT
SheAmaSB2B_gi|1  HYSALTSGVESG--LGWGFSAWERQMEPRLFVAMHWYFGRGELADEF------VGALFGE
SheDeOs217_gi|9  SFSALSSGIESG--LNQQWLWGDVAFEPRLFLGANWYFDKLKFSSVT------KADTFTN
ShewaBO155_gi|1  QFAVLQTGVDLG--LAPRWQWWDLQVQPRIFAVGYWYFNELRFISEI------EQDTIVS
ShewaBO195_gi|1  QFAVLQTGVDLG--LAPRWQWWDLQVQPRIFAVGYWYFNELRFISEI------EQDTIVS
ShewaBO223_gi|2  QFAVLQTGVDLG--LAPRWQWWDLQVQPRIFAVGYWYFNELRFISEI------EQDTIVS
ShewaW31_gi|120  QFAVLQTGIDIG--LSPRWQWQNIQVQPRLFVLGYWYFNALNFSSDS------EQDTVVS
ShewaPu200_gi|1  QFAVLQTGIDIG--LSPRWQWQNIQVQPRLFVLGYWYFNALNFSSDS------EQDTVVS
ShewaMR1_gi|243  QFAVLQTGVDIG--LSPRWQWLNIQMQPRLFAVGYWYFNELDFSQDA------EDETIVS
GOS_1743020_Tra  ------------------------------------------------------------
ShewaANA3_gi|11  QFAVLQTGVDIG--LSPRWQWLNIQMQPRVFAVGYWYFNELDFSQNA------EDETIVS
ShewaMR7_gi|114  QFAVLQSGVDIG--LSPRWQWLNIQMQPRVFAVGYWYFNELDFSQDA------ENETIVS
ShewaMR4_gi|113  QFAVLQSGVDIG--LSPRWQWLNIQMQPRVFAVGYWYFNELDFSQDA------ENETIVS
ShewaFrigi_gi|1  GYSVFKTGVDFG--VNYDWQWKDVRVEPRFFIAGHWYFDKLKFVTPV------GNDVLTS
SheWo51908_gi|1  TYSAIQSGFDIGTDIHWRWDWLGVDVEPRVFAVGYWYFDKLRFATPF------GDDVLVS
SheSeEB3_gi|157  TYSALQSGIDIGTDIHWRWNWLGVDVEPRVFAVGYWYFDKLKIATPF------GEDVLVS
SheBeKT99_gi|16  TYSALQSGIDIGTNMHWRWDLLGVDVEPRVFVTGYWYFDKLRFATPF------GEDVLVS
ShewaViola_gi|2  TYSAIQSGIDIGTDIHWRWDWLGVDVEPRVFAVGYWYFDKLRFAMPF------GEDVLVS
ShePiWP3_gi|212  TYSAIQSGVDIG--TNYHFQVADVGIEPRFFVAGYWYFDKLRFVTPF------EEDVLVT
SheHalEB4_gi|16  TYSAVQSGVDIG--TNLHFQLGGVDMEPRFFAAGYWYFDRLKFTTPF------EEDVLVA
ShePe345_gi|157  TYSAVQSGVDIG--TNFYFQVKGVEIEPRFFVAGYWYFDRLKFTTPF------EEDVLVS
                                                                             


                        310       320       330       340       350
                 =========+=========+=========+=========+=========+=
LentiArane_gi|1  QTYEGGFSFKLKEK-----WKFKFLEIGRVGFGYQFGDGFDLYKVFVNLAI
ColwePsych_gi|7  NSVEFGFTLKFAKT-----IGYSWAGIERLGLSYRYSKNFSAFRLLFSFPI
SheAmaSB2B_gi|1  STLELGLSLVFDKP-----LEFEVVSIERVGFSYSKAGGEDVWRVFFSHPL
SheDeOs217_gi|9  YSVELGFSLLFTQP-----VGWEYLNIKRAGLSYQVGEGLRVIKFHLDFPL
ShewaBO155_gi|1  GSYEAGFSLAFSKP-----LGGELLGVDRIGFSYRRGDGLNIWRLMFSFPI
ShewaBO195_gi|1  GSYEAGFSLAFSKP-----LGGELLGVDRIGFSYRRGDGLNIWRLMFSFPI
ShewaBO223_gi|2  GSYEAGFSLAFSKP-----LGGELLGVDRIGFSYRRGDGLNIWRLMFSFPI
ShewaW31_gi|120  GSYELGATFAFSKP-----IGADLLSIDRIGLSYRTGDGLSIWRLLFSFPI
ShewaPu200_gi|1  GSYELGATFAFSKP-----IGADLLSIDRIGLSYRTGDGLSIWRLLFSFPI
ShewaMR1_gi|243  GSYEFGATLAFSKP-----LGGDLLGVDRIGISYRTGDGLNIWRLLFSFPI
GOS_1743020_Tra  ---------------------------------------------------
ShewaANA3_gi|11  GSYEFGATLAFAKP-----LGGDLLGIDRIGISYRTGDGLNIWRLLFSFPI
ShewaMR7_gi|114  GSYEIGATLAFSKP-----LGGELLGIDRIGISYRTGDGLNIWRLLFSFPI
ShewaMR4_gi|113  GSYEIGATLAFSKP-----LGGELLGIDRIGISYRTGDGLNIWRLLFSFPI
ShewaFrigi_gi|1  YTYEVGTTLAFSKPINFSAIGLDSVEIEHFGLSYQVGGGLKVWRLIFEFPL
SheWo51908_gi|1  HSLEVGATLAFSKP-----ILWEWMGIDRLGLSVRAGDGVQVWRLIFEFPI
SheSeEB3_gi|157  NSLEVGATLAFSKP-----ILWEWMGIDRLGLSVRAGDGVQAWRLIFEFPI
SheBeKT99_gi|16  NSLEVGATLAFSKP-----ILWDWMGIDRLGLSVRAGDGVKVWRLIFEFPI
ShewaViola_gi|2  NSLEVGATLAFSKP-----IFWEWMGIDRLGLSVRAGDGIKAWRLLFEFPI
ShePiWP3_gi|212  NSLEAGITLAFSKP-----IGWDLFNMSRFGISYRAGDGVQVWRLIFDFPI
SheHalEB4_gi|16  NSFEAGITLAFSKP-----IGWDLVNIDRFGISYRAGDGVEVWRLIFEFPL
ShePe345_gi|157  NSYEVGMTFAFSKP-----VGWDLVNIERFGLSYRAGDGIEVWRLIFEFPI
                                                                    






Parameters used
Minimum Number Of Sequences For A Conserved Position: 12
Minimum Number Of Sequences For A Flanking Position: 19
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes


Flank positions of the 3 selected block(s)
Flanks: [135  146]  [150  205]  [208  220]  

New number of positions in input.fasta-gb:  81  (23% of the original 351 positions)




Protein Domains

PROTOCOLE:


a) INTERPRO, paramètres par défaut


b) PROSITE, paramètres par défaut


c) PFam, paramètres par défaut



ANALYSE DES RÉSULTATS:



Avec ces logiciels, on constate l'absence de domaines protéiques conservés.

RÉSULTATS BRUTS:


a) No hits reported.

b) no hit!

c) [No hits in Pfam] 

Phylogeny

PROTOCOLE:


a) Phylogeny.fr / méthode PhyML/ pas de bootstrap / default substitution model / groupe extérieur : a-proteobacteria et b-proteobacteria


b) Phylogeny.fr / méthode BioNJ/ pas de bootstrap / default substitution model / groupe extérieur : a-proteobacteria et b-proteobacteria


ANALYSE DES RÉSULTATS:


- Les arbres sont cohérent avec la phylogenie de référence : la séquence inconnue se situe à l'intérieur du groupe d'étude (proteobacteria). L'arbre respecte les relations de parenté conventionnelle entre les différents groupes taxonomiques de la phylogénie de référence.

On observe deux groupes frères de gamma-proteobacteria.



- Les arbres sont cohérents entre les deux méthodes.




- La séquence métagénomique semble s'intégrer dans le groupe taxonimique des proteobacteria.


RÉSULTATS BRUTS:

a) PhyML

                                                                                                          ----0.2---
 
                        +ShewaW31_gi_120599359_ref_YP_963933.1_hypothetical_protein_Sputw
                     +--+
                     |  +ShewaPu200_gi_124548268_ref_ZP_01706986.1_conserved_hypothetical
                     |
                     |       +ShewaBO155_gi_126173901_ref_YP_001050050.1_hypothetical_protein
           +---------+       |
           |         |       |ShewaBO195_gi_160874808_ref_YP_001554124.1_hypothetical_protein
           |         |+------+
           |         ||      |
           |         ||      +ShewaBO223_gi_217973851_ref_YP_002358602.1_hypothetical_protein
           |         ++
           |          |   +-ShewaMR1_gi_24374359_ref_NP_718402.1_hypothetical_protein_SO_283
           |          |   |
           |          +---++ShewaMR7_gi_114047999_ref_YP_738549.1_hypothetical_protein_Shewm
           |              ||
           |              ++ShewaMR4_gi_113970772_ref_YP_734565.1_hypothetical_protein_Shewm
           |               |
           |               |GOS_1743020_Traduction_131-655_sens_direct
           |               |
           |               +ShewaANA3_gi_117921040_ref_YP_870232.1_hypothetical_protein_Shew
 +---------+
 |         |                                        +---SheHalEB4_gi_167624606_ref_YP_001674900.1_hypothetical_protein_S
 |         |                                        |
 |         |                                    +---+
 |         |                            +-------+   +---ShePe345_gi_157962436_ref_YP_001502470.1_hypothetical_protein_Sp
 |         |                            |       |
 |         |                         +--+       +------ShePiWP3_gi_212635931_ref_YP_002312456.1_hypothetical_protein_sw
 |         |                         |  |
 |         |                         |  +----SheBeKT99_gi_163751124_ref_ZP_02158354.1_hypothetical_protein_KT
 |         |                      +--+
 |         |                      |  |  +----------SheWo51908_gi_170727385_ref_YP_001761411.1_hypothetical_protein
 |         |      +---------------+  +--+
 |         |      |               |     +------SheSeEB3_gi_157374743_ref_YP_001473343.1_hypothetical_protein_Ss
 |         |      |               |
 |         |      |               +ShewaViola_gi_294141697_ref_YP_003557675.1_hypothetical_protein
 |         +------+
 |                | +---------------SheAmaSB2B_gi_119774415_ref_YP_927155.1_hypothetical_protein_Sam
 |                | |
 |                +-+
 |                  |   +----------------------------ColwePsych_gi_71282095_ref_YP_269928.1_hypothetical_protein_CPS
 |                  +---+
 |                      |     +--------------------SheDeOs217_gi_91792805_ref_YP_562456.1_hypothetical_protein_Sden
 |                      +-----+
 |                            +----------------------ShewaFrigi_gi_114563607_ref_YP_751120.1_hypothetical_protein_Sfr
 |
 +------------------------------------------------------LentiArane_gi_149200495_ref_ZP_01877508.1_hypothetical_protein_L


b) BioNJ

                                           +--------------------SheAmaSB2B_gi_119774415_ref_YP_927155.1_hypothetical_protein_Sam
                   |
                  ++  +-------------------------------ColwePsych_gi_71282095_ref_YP_269928.1_hypothetical_protein_CPS
                  ||  |
                  |+--+       +-----------------------SheDeOs217_gi_91792805_ref_YP_562456.1_hypothetical_protein_Sden
                  |   +-------+
                  |           +-------------------------ShewaFrigi_gi_114563607_ref_YP_751120.1_hypothetical_protein_Sfr
                  |
                  |
               +--+                    +----------SheWo51908_gi_170727385_ref_YP_001761411.1_hypothetical_protein
               |  |                 +--+
               |  |                ++  +----------SheSeEB3_gi_157374743_ref_YP_001473343.1_hypothetical_protein_Ss
               |  |                ||
               |  |              +-++-------SheBeKT99_gi_163751124_ref_ZP_02158354.1_hypothetical_protein_KT
               |  |              | |
               |  |              | +----ShewaViola_gi_294141697_ref_YP_003557675.1_hypothetical_protein
               |  +--------------+
               |                 |      +---------ShePiWP3_gi_212635931_ref_YP_002312456.1_hypothetical_protein_sw
               |                 |      |
               |                 +------+ +-----SheHalEB4_gi_167624606_ref_YP_001674900.1_hypothetical_protein_S
               |                        +-+
               |                          +---ShePe345_gi_157962436_ref_YP_001502470.1_hypothetical_protein_Sp
               |
 +-------------+
 |             |                   +ShewaMR4_gi_113970772_ref_YP_734565.1_hypothetical_protein_Shewm
 |             |                   |
 |             |                   |GOS_1743020_Traduction_131-655_sens_direct
 |             |                   |
 |             |                  ++ShewaANA3_gi_117921040_ref_YP_870232.1_hypothetical_protein_Shew
 |             |                  ||
 |             |              +---++ShewaMR7_gi_114047999_ref_YP_738549.1_hypothetical_protein_Shewm
 |             |              |   |
 |             |              |   +-ShewaMR1_gi_24374359_ref_NP_718402.1_hypothetical_protein_SO_283
 |             |            +-+
 |             |            | |        +ShewaBO155_gi_126173901_ref_YP_001050050.1_hypothetical_protein
 |             |            | |        |
 |             |            | |        |ShewaBO195_gi_160874808_ref_YP_001554124.1_hypothetical_protein
 |             |            | +--------+
 |             +------------+          |
 |                          |          +ShewaBO223_gi_217973851_ref_YP_002358602.1_hypothetical_protein
 |                          |
 |                          |    +ShewaW31_gi_120599359_ref_YP_963933.1_hypothetical_protein_Sputw
 |                          +----+
 |                               +-ShewaPu200_gi_124548268_ref_ZP_01706986.1_conserved_hypothetical
 |
 +------------------------------------------------------LentiArane_gi_149200495_ref_ZP_01877508.1_hypothetical_protein_L

Taxonomy report

PROTOCOLE:



a)BLASTp de l'ORF de 175 AA contre NR (NCBI)

Search database Non-redundant protein sequences (nr) using Blastp (protein-protein BLAST)


b)BLASTp contre SP (NCBI)

Search database SwissProt protein sequences (sp) using Blastp (protein-protein BLAST)



ANALYSE DES RÉSULTATS:


valeur seuil de score : 34.7


valeur seuil de e-value : 0.0001


Groupe d'étude: proteobacteria


ref|YP_870232.1| ShewaspANA-3 4e-96 Shewanella sp. ANA-3 [g-proteobacteria]

ref|YP_738549.1| ShewaspMR-7 1e-90 Shewanella sp. MR-7 [g-proteobacteria]

ref|YP_734565.1| ShewaspMR-4 1e-88 Shewanella sp. MR-4 [g-proteobacteria]

ref|NP_718402.1| ShewaspMR-1 2e-80 Shewanella oneidensis MR-1 [g-proteobacteria]

ref|YP_002358602.1| ShewabaOS223 9e-64 Shewanella baltica OS223 [g-proteobacteria]

ref|YP_001365862.1| ShewabaOS155 1e-63 Shewanella baltica OS185 [g-proteobacteria]

ref|YP_001050050.1| ShewabaOS155 1e-63 Shewanella baltica OS155 [g-proteobacteria]

ref|YP_963933.1| 2e-63 Shewanella sp. W3-18-1 [g-proteobacteria]

ref|YP_001183068.1| 2e-63 Shewanella putrefaciens CN-32 [g-proteobacteria]

ref|YP_001554124.1| 2e-63 Shewanella baltica OS195 [g-proteobacteria]

ref|ZP_01706986.1| 2e-63 Shewanella putrefaciens 200 [g-proteobacteria]

ref|YP_927155.1| 6e-34 Shewanella amazonensis SB2B [g-proteobacteria]

ref|YP_001674900.1| 5e-30 Shewanella halifaxensis HAW-EB4 [g-proteobacteria]

ref|ZP_02158354.1| 9e-30 Shewanella benthica KT99 [g-proteobacteria]

ref|YP_562456.1| 1e-29 Shewanella denitrificans OS217 [g-proteobacteria]

ref|YP_001502470.1| 6e-29 Shewanella pealeana ATCC 700345 [g-proteobacteria]

ref|YP_002312456.1| 1e-28 Shewanella piezotolerans WP3 [g-proteobacteria]

ref|YP_001473343.1| 1e-27 Shewanella sediminis HAW-EB3 [g-proteobacteria]

ref|YP_001761411.1| 2e-27 Shewanella woodyi ATCC 51908 [g-proteobacteria]

ref|YP_751120.1| 3e-27 Shewanella frigidimarina NCIMB 400 [g-proteobacteria]

ref|YP_269928.1| 3e-25 Colwellia psychrerythraea 34H [g-proteobacteria]

ref|YP_003557675.1| 5e-23 Shewanella violacea DSS12 [g-proteobacteria]



Groupe extérieur: autre bacteria : bacteria


ref|ZP_01877508.1| 2e-13 Lentisphaera araneosa HTCC2155 [bacteria]


Pour constituer nôtre groupe extérieure, nous sommes dans une situation délicate car les composants de ce groupe extérieur sont censé être des homologues or pour qu'ils soient vraisemblablement des homologues, il faut que leur E-value soient relativement faible (<0.0001 en principe). Or dans ce cas, nous remarquons que la seule protéine homologue (hormis les gamma-proteobacteria) qui s'aligne avec une E-value conséquente (2e-13) est Lentisphaera araneosa qui appartient à la famille des bacteria.

On choisit de réaliser l'alignement multiple avec ce seul homologue dans le groupe extérieur, les cyannobacterias suivantes affichant des E-value peu pertinentes.



RÉSULTATS BRUTS:

a)

Lineage Report

cellular organisms
. Bacteria           [bacteria]
. . Proteobacteria     [proteobacteria]
. . . Alteromonadales    [g-proteobacteria]
. . . . Shewanella         [g-proteobacteria]
. . . . . Shewanella sp. ANA-3 ---------------  353 2 hits [g-proteobacteria]    hypothetical protein Shewana3_2599 [Shewanella sp. ANA-3] >
. . . . . Shewanella sp. MR-7 ................  335 2 hits [g-proteobacteria]    hypothetical protein Shewmr7_2507 [Shewanella sp. MR-7] >gi
. . . . . Shewanella sp. MR-4 ................  328 2 hits [g-proteobacteria]    hypothetical protein Shewmr4_2437 [Shewanella sp. MR-4] >gi
. . . . . Shewanella oneidensis MR-1 .........  301 2 hits [g-proteobacteria]    hypothetical protein SO_2830 [Shewanella oneidensis MR-1] >
. . . . . Shewanella baltica OS223 ...........  246 2 hits [g-proteobacteria]    hypothetical protein Sbal223_2689 [Shewanella baltica OS223
. . . . . Shewanella baltica OS185 ...........  246 2 hits [g-proteobacteria]    hypothetical protein Shew185_1654 [Shewanella baltica OS185
. . . . . Shewanella baltica OS155 ...........  245 2 hits [g-proteobacteria]    hypothetical protein Sbal_1669 [Shewanella baltica OS155] >
. . . . . Shewanella sp. W3-18-1 .............  245 2 hits [g-proteobacteria]    hypothetical protein Sputw3181_2555 [Shewanella sp. W3-18-1
. . . . . Shewanella putrefaciens CN-32 ......  245 2 hits [g-proteobacteria]    hypothetical protein Sputw3181_2555 [Shewanella sp. W3-18-1
. . . . . Shewanella baltica OS195 ...........  244 2 hits [g-proteobacteria]    hypothetical protein Sbal195_1691 [Shewanella baltica OS195
. . . . . Shewanella putrefaciens 200 ........  244 2 hits [g-proteobacteria]    conserved hypothetical protein [Shewanella putrefaciens 200
. . . . . Shewanella amazonensis SB2B ........  147 2 hits [g-proteobacteria]    hypothetical protein Sama_1278 [Shewanella amazonensis SB2B
. . . . . Shewanella halifaxensis HAW-EB4 ....  134 2 hits [g-proteobacteria]    hypothetical protein Shal_2688 [Shewanella halifaxensis HAW
. . . . . Shewanella benthica KT99 ...........  133 2 hits [g-proteobacteria]    hypothetical protein KT99_09753 [Shewanella benthica KT99] 
. . . . . Shewanella denitrificans OS217 .....  132 2 hits [g-proteobacteria]    hypothetical protein Sden_1448 [Shewanella denitrificans OS
. . . . . Shewanella pealeana ATCC 700345 ....  130 2 hits [g-proteobacteria]    hypothetical protein Spea_2615 [Shewanella pealeana ATCC 70
. . . . . Shewanella piezotolerans WP3 .......  129 2 hits [g-proteobacteria]    hypothetical protein swp_3161 [Shewanella piezotolerans WP3
. . . . . Shewanella sediminis HAW-EB3 .......  126 2 hits [g-proteobacteria]    hypothetical protein Ssed_1604 [Shewanella sediminis HAW-EB
. . . . . Shewanella woodyi ATCC 51908 .......  125 2 hits [g-proteobacteria]    hypothetical protein Swoo_3045 [Shewanella woodyi ATCC 5190
. . . . . Shewanella frigidimarina NCIMB 400 .  124 2 hits [g-proteobacteria]    hypothetical protein Sfri_2437 [Shewanella frigidimarina NC
. . . . . Shewanella violacea DSS12 ..........  110 2 hits [g-proteobacteria]    hypothetical protein SVI_2926 [Shewanella violacea DSS12] >
. . . . Colwellia psychrerythraea 34H --------  118 2 hits [g-proteobacteria]    hypothetical protein CPS_3238 [Colwellia psychrerythraea 34
. . . . Marinobacter algicola DG893 ..........   34 2 hits [g-proteobacteria]    ABC-type amino acid transport/signal transduction system, p
. . . Burkholderia sp. Ch1-1 -----------------   34 2 hits [b-proteobacteria]    integrase family protein [Burkholderia sp. Ch1-1] >gi|29588
. . Lentisphaera araneosa HTCC2155 -----------   78 2 hits [bacteria]            hypothetical protein LNTAR_21870 [Lentisphaera araneosa HTC
. . Nostoc punctiforme PCC 73102 .............   38 2 hits [cyanobacteria]       two component AraC family transcriptional regulator [Nostoc
. . Cyanothece sp. PCC 7425 ..................   37 2 hits [cyanobacteria]       response regulator receiver protein [Cyanothece sp. PCC 742
. . Synechococcus sp. PCC 7002 ...............   36 2 hits [cyanobacteria]       two-component hybrid sensor and regulator [Synechococcus sp
. . Acaryochloris marina MBIC11017 ...........   35 2 hits [cyanobacteria]       two-component response regulator [Acaryochloris marina MBIC
. . Nodularia spumigena CCY9414 ..............   34 2 hits [cyanobacteria]       two-component response regulator [Nodularia spumigena CCY94
. . Dialister invisus DSM 15470 ..............   34 2 hits [firmicutes]          putative NAD+ synthetase [Dialister invisus DSM 15470] >gi|
. . Parabacteroides merdae ATCC 43184 ........   33 2 hits [CFB group bacteria]  hypothetical protein PARMER_01946 [Parabacteroides merdae A
. . unidentified eubacterium SCB49 ...........   33 2 hits [CFB group bacteria]  transcriptional regulator [unidentified eubacterium SCB49] 
. . Spirosoma linguale DSM 74 ................   33 2 hits [CFB group bacteria]  hypothetical protein Slin_3200 [Spirosoma linguale DSM 74] 
. Halogeometricum borinquense DSM 11551 ------   34 2 hits [euryarchaeotes]      precorrin-6y C5,15-methyltransferase (decarboxylating), Cbi
. Mus musculus (mouse) .......................   34 2 hits [rodents]             unnamed protein product [Mus musculus]
. Paramecium tetraurelia strain d4-2 .........   33 1 hit  [ciliates]            hypothetical protein [Paramecium tetraurelia strain d4-2] >
. Paramecium tetraurelia .....................   33 1 hit  [ciliates]            hypothetical protein [Paramecium tetraurelia strain d4-2] >
. Candida dubliniensis CD36 ..................   33 2 hits [ascomycetes]         DNA-directed RNA polymerase II subunit, putative [Candida d
. Penicillium aethiopicum ....................   33 1 hit  [ascomycetes]         unknown [Penicillium aethiopicum]

------------------------------------------------------------------------------------------------------------------

b)

Lineage Report

cellular organisms
. Fungi/Metazoa group [eukaryotes]
. . Coelomata           [animals]
. . . Euarchontoglires    [placentals]
. . . . Mus musculus (mouse) ------------------   33 2 hits [rodents]           RecName: Full=UPF0580 protein C15orf58 homolog
. . . . Microcebus murinus (grey mouse lemur) .   30 1 hit  [primates]          RecName: Full=Cortactin-binding protein 2; Short=CortBP2
. . . Drosophila pseudoobscura pseudoobscura --   30 1 hit  [flies]             RecName: Full=F-box/SPRY domain-containing protein 1 >gi|25
. . . Drosophila persimilis ...................   30 1 hit  [flies]             RecName: Full=F-box/SPRY domain-containing protein 1 >gi|25
. . Saccharomyces cerevisiae (yeast) ----------   32 2 hits [ascomycetes]       RecName: Full=Serine/threonine-protein phosphatase PP-Z1
. Shewanella denitrificans OS217 --------------   32 1 hit  [g-proteobacteria]  RecName: Full=tRNA 5-methylaminomethyl-2-thiouridine biosyn
. Alcanivorax borkumensis SK2 .................   31 1 hit  [g-proteobacteria]  RecName: Full=Acetyl-coenzyme A carboxylase carboxyl transf
. Geobacter bemidjiensis Bem ..................   31 1 hit  [d-proteobacteria]  RecName: Full=Acetyl-coenzyme A carboxylase carboxyl transf
. Proteus mirabilis HI4320 ....................   30 1 hit  [enterobacteria]    RecName: Full=Acetyl-coenzyme A carboxylase carboxyl transf
. Sodalis glossinidius str. 'morsitans' .......   30 1 hit  [enterobacteria]    RecName: Full=Acetyl-coenzyme A carboxylase carboxyl transf
. Novosphingobium aromaticivorans DSM 12444 ...   30 1 hit  [a-proteobacteria]  RecName: Full=Acetyl-coenzyme A carboxylase carboxyl transf

BLAST

PROTOCOLE:


a) BLASTp de l'ORF de 175 AA contre NR (NCBI)

Search database Non-redundant protein sequences (nr) using Blastp (protein-protein BLAST)


b) BLASTp contre SP (NCBI)

Search database Non-redundant SwissProt sequences (sp) using Blastp (protein-protein BLAST)



ANALYSE DES RÉSULTATS:


Nous avons aligné notre séquence contre la banque de données Swissprot et NR.

Contre NR, on obtient plusieurs homologues qui s'alignent sur 100% de la séquence. Les scores sont élevés et les E-value très faibles (<1e-4 jusqu'à une vingtaine d'alignements), ce qui implique que les scores sont significativement élevé.


Les 1er semblent correspondre aux Gamma-Proteobacteria.


Contre SwissProt, les résultats sont moins nombreux et moins intéressants.

Cela est du au fait que le calcul de la E-value prend en compte la taille de la base de données et que Swissprot est plus petite que nr. C'est donc plus difficile d'y trouver un alignement avec un tel score par hasard.

RÉSULTATS BRUTS:

a)
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|YP_870232.1|  hypothetical protein Shewana3_2599 [Shewanel...   353    4e-96
ref|YP_738549.1|  hypothetical protein Shewmr7_2507 [Shewanell...   335    1e-90
ref|YP_734565.1|  hypothetical protein Shewmr4_2437 [Shewanell...   328    1e-88
ref|NP_718402.1|  hypothetical protein SO_2830 [Shewanella one...   301    2e-80
ref|YP_002358602.1|  hypothetical protein Sbal223_2689 [Shewan...   246    9e-64
ref|YP_001365862.1|  hypothetical protein Shew185_1654 [Shewan...   246    1e-63
ref|YP_001050050.1|  hypothetical protein Sbal_1669 [Shewanell...   245    1e-63
ref|YP_963933.1|  hypothetical protein Sputw3181_2555 [Shewane...   245    2e-63
ref|YP_001554124.1|  hypothetical protein Sbal195_1691 [Shewan...   244    2e-63
ref|ZP_01706986.1|  conserved hypothetical protein [Shewanella...   244    2e-63
ref|YP_927155.1|  hypothetical protein Sama_1278 [Shewanella a...   147    6e-34
ref|YP_001674900.1|  hypothetical protein Shal_2688 [Shewanell...   134    5e-30
ref|ZP_02158354.1|  hypothetical protein KT99_09753 [Shewanell...   133    9e-30
ref|YP_562456.1|  hypothetical protein Sden_1448 [Shewanella d...   132    1e-29
ref|YP_001502470.1|  hypothetical protein Spea_2615 [Shewanell...   130    6e-29
ref|YP_002312456.1|  hypothetical protein swp_3161 [Shewanella...   129    1e-28
ref|YP_001473343.1|  hypothetical protein Ssed_1604 [Shewanell...   126    1e-27
ref|YP_001761411.1|  hypothetical protein Swoo_3045 [Shewanell...   125    2e-27
ref|YP_751120.1|  hypothetical protein Sfri_2437 [Shewanella f...   124    3e-27
ref|YP_269928.1|  hypothetical protein CPS_3238 [Colwellia psy...   118    3e-25
ref|YP_003557675.1|  hypothetical protein SVI_2926 [Shewanella...   110    5e-23
ref|ZP_01877508.1|  hypothetical protein LNTAR_21870 [Lentisph...  78.6    2e-13
ref|YP_001866593.1|  two component AraC family transcriptional...  38.9    0.21 
ref|YP_002481336.1|  response regulator receiver protein [Cyan...  37.7    0.44 
ref|YP_001734795.1|  two-component hybrid sensor and regulator...  37.0    0.92 
ref|YP_001518239.1|  two-component response regulator [Acaryoc...  35.0    3.1  
ref|ZP_03998820.1|  precorrin-6y C5,15-methyltransferase (deca...  34.7    4.0  
ref|ZP_01630503.1|  two-component response regulator [Nodulari...  34.7    4.2  
ref|ZP_06845592.1|  integrase family protein [Burkholderia sp....  34.7    4.5  
dbj|BAC39476.1|  unnamed protein product [Mus musculus]            34.3    4.9  
ref|ZP_01893246.1|  ABC-type amino acid transport/signal trans...  34.3    5.4  
ref|ZP_05733260.1|  putative NAD+ synthetase [Dialister invisu...  34.3    6.0  
ref|ZP_02031938.1|  hypothetical protein PARMER_01946 [Parabac...  33.9    6.2  
ref|XP_001426989.1|  hypothetical protein [Paramecium tetraure...  33.9    6.8  
ref|XP_002422523.1|  DNA-directed RNA polymerase II subunit, p...  33.9    7.5  
ref|ZP_01889978.1|  transcriptional regulator [unidentified eu...  33.9    7.8  
dbj|BAE25508.1|  unnamed protein product [Mus musculus]            33.5    8.1  
gb|ADI24961.1|  unknown [Penicillium aethiopicum]                  33.5    8.6  
ref|YP_003388010.1|  hypothetical protein Slin_3200 [Spirosoma...  33.5    9.5  

ALIGNMENTS
>ref|YP_870232.1| hypothetical protein Shewana3_2599 [Shewanella sp. ANA-3]
 gb|ABK48826.1| conserved hypothetical protein [Shewanella sp. ANA-3]
Length=289

 Score =  353 bits (906),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 173/175 (98%), Positives = 173/175 (98%), Gaps = 0/175 (0%)

Query  1    MGCVFPLLASTAPIASHTQPQAAQLSPSFAQMSPESPIDGQNNPNSVYAFGSYLGTGVYR  60
            MGCVFPLLASTAPI SHTQPQAAQLS SFAQMSPESPIDGQNNPNSVYAFGSYLGTGVYR
Sbjct  1    MGCVFPLLASTAPIVSHTQPQAAQLSQSFAQMSPESPIDGQNNPNSVYAFGSYLGTGVYR  60

Query  61   AADQNATVVSIPLSFDFLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTMTPG  120
            AADQNATVVSIPLSFDFLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTMTPG
Sbjct  61   AADQNATVVSIPLSFDFLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTMTPG  120

Query  121  IEHHWQATANTRMEAYLDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSVWVS  175
            IEHHWQATANTRMEAYLDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSVWVS
Sbjct  121  IEHHWQATANTRMEAYLDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSVWVS  175


>ref|YP_738549.1| hypothetical protein Shewmr7_2507 [Shewanella sp. MR-7]
 gb|ABI43492.1| conserved hypothetical protein [Shewanella sp. MR-7]
Length=292

 Score =  335 bits (859),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 169/178 (94%), Gaps = 3/178 (1%)

Query  1    MGCVFPLLASTAPIASHTQPQA---AQLSPSFAQMSPESPIDGQNNPNSVYAFGSYLGTG  57
            MGCVFPLLASTAPIASH+  Q+   AQ   SFAQMSPESP+DGQNNPNSVYAFGSYLGTG
Sbjct  1    MGCVFPLLASTAPIASHSTSQSVLTAQYPQSFAQMSPESPVDGQNNPNSVYAFGSYLGTG  60

Query  58   VYRAADQNATVVSIPLSFDFLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTM  117
            VYRAADQNATVVSIPLSFDFLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTM
Sbjct  61   VYRAADQNATVVSIPLSFDFLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTM  120

Query  118  TPGIEHHWQATANTRMEAYLDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSVWVS  175
            TPGIEHHWQAT NTRMEAYLDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSVWVS
Sbjct  121  TPGIEHHWQATVNTRMEAYLDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSVWVS  178


>ref|YP_734565.1| hypothetical protein Shewmr4_2437 [Shewanella sp. MR-4]
 gb|ABI39508.1| conserved hypothetical protein [Shewanella sp. MR-4]
Length=292

 Score =  328 bits (841),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 163/178 (91%), Positives = 168/178 (94%), Gaps = 3/178 (1%)

Query  1    MGCVFPLLASTAPIASHTQPQA---AQLSPSFAQMSPESPIDGQNNPNSVYAFGSYLGTG  57
            MG VFPLLAST PIASH+  Q+   AQ   SFAQMSPESP+DGQNNPNSVYAFGSYLGTG
Sbjct  1    MGSVFPLLASTTPIASHSTSQSVLTAQSPQSFAQMSPESPVDGQNNPNSVYAFGSYLGTG  60

Query  58   VYRAADQNATVVSIPLSFDFLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTM  117
            VYRAA+QNATVVSIPLSF+FLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTM
Sbjct  61   VYRAAEQNATVVSIPLSFEFLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTM  120

Query  118  TPGIEHHWQATANTRMEAYLDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSVWVS  175
            TPGIEHHWQATANTRMEAYLDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSVWVS
Sbjct  121  TPGIEHHWQATANTRMEAYLDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSVWVS  178


>ref|NP_718402.1| hypothetical protein SO_2830 [Shewanella oneidensis MR-1]
 gb|AAN55846.1|AE015721_9 hypothetical protein SO_2830 [Shewanella oneidensis MR-1]
Length=312

 Score =  301 bits (771),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 161/175 (92%), Gaps = 1/175 (0%)

Query  1    MGCVFPLLASTAPIASHTQPQAAQLSPSFAQMSPESPIDGQNNPNSVYAFGSYLGTGVYR  60
            +G +FPLLAS++PI++ T     Q S +FA++SPE PID +NNPNSVYAFGSYLGTG+YR
Sbjct  25   LGIMFPLLASSSPISNQT-VLGTQSSQTFAKISPEMPIDDKNNPNSVYAFGSYLGTGIYR  83

Query  61   AADQNATVVSIPLSFDFLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTMTPG  120
            AA+QNAT+VSIPL FDFLK+ESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTMTPG
Sbjct  84   AAEQNATIVSIPLVFDFLKEESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTMTPG  143

Query  121  IEHHWQATANTRMEAYLDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSVWVS  175
            IEHHWQAT NTRMEAYLDVGFGTNFDTD NVAILASG+S+LYDF+LAGEDSVWVS
Sbjct  144  IEHHWQATINTRMEAYLDVGFGTNFDTDTNVAILASGISTLYDFTLAGEDSVWVS  198


>ref|YP_002358602.1| hypothetical protein Sbal223_2689 [Shewanella baltica OS223]
 gb|ACK47179.1| conserved hypothetical protein [Shewanella baltica OS223]
Length=325

 Score =  246 bits (627),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 113/140 (80%), Positives = 129/140 (92%), Gaps = 0/140 (0%)

Query  36   SPIDGQNNPNSVYAFGSYLGTGVYRAADQNATVVSIPLSFDFLKDESSQTWLRLPLSFGF  95
            +PI+  +NPNSVYAFGSYLGTGVYRAA+QNATVVSIPLSFD  KD  SQTWLRLP+SFGF
Sbjct  72   NPIESSSNPNSVYAFGSYLGTGVYRAANQNATVVSIPLSFDLKKDSGSQTWLRLPISFGF  131

Query  96   FDYLAKDITDGELPSSVGTMTMTPGIEHHWQATANTRMEAYLDVGFGTNFDTDANVAILA  155
            FDYLAKDIT+GELPSS+GTMT+TPG EHHWQA+ NTRME YLD+GFGTNFD + NVAI+A
Sbjct  132  FDYLAKDITEGELPSSIGTMTITPGFEHHWQASENTRMEGYLDIGFGTNFDKNDNVAIIA  191

Query  156  SGVSSLYDFSLAGEDSVWVS  175
            SG+SSLYDF+LAG+D+VWVS
Sbjct  192  SGISSLYDFTLAGQDAVWVS  211


>ref|YP_001365862.1| hypothetical protein Shew185_1654 [Shewanella baltica OS185]
 gb|ABS07799.1| conserved hypothetical protein [Shewanella baltica OS185]
Length=325

 Score =  246 bits (627),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/140 (80%), Positives = 129/140 (92%), Gaps = 0/140 (0%)

Query  36   SPIDGQNNPNSVYAFGSYLGTGVYRAADQNATVVSIPLSFDFLKDESSQTWLRLPLSFGF  95
            +PI+  +NPNSVYAFGSYLGTGVYRAA+QNATVVSIPLSFD  KD  SQTWLRLP+SFGF
Sbjct  72   NPIESSSNPNSVYAFGSYLGTGVYRAANQNATVVSIPLSFDLKKDSGSQTWLRLPISFGF  131

Query  96   FDYLAKDITDGELPSSVGTMTMTPGIEHHWQATANTRMEAYLDVGFGTNFDTDANVAILA  155
            FDYLAKDIT+GELPSS+GTMT+TPG EHHWQA+ NTRME YLD+GFGTNFD + NVAI+A
Sbjct  132  FDYLAKDITEGELPSSIGTMTITPGFEHHWQASENTRMEGYLDIGFGTNFDKNDNVAIIA  191

Query  156  SGVSSLYDFSLAGEDSVWVS  175
            SG+SSLYDF+LAG+D+VWVS
Sbjct  192  SGISSLYDFTLAGQDAVWVS  211


>ref|YP_001050050.1| hypothetical protein Sbal_1669 [Shewanella baltica OS155]
 gb|ABN61181.1| conserved hypothetical protein [Shewanella baltica OS155]
Length=325

 Score =  245 bits (626),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/140 (80%), Positives = 129/140 (92%), Gaps = 0/140 (0%)

Query  36   SPIDGQNNPNSVYAFGSYLGTGVYRAADQNATVVSIPLSFDFLKDESSQTWLRLPLSFGF  95
            +PI+  +NPNSVYAFGSYLGTGVYRAA+QNATVVSIPLSFD  KD  SQTWLRLP+SFGF
Sbjct  72   NPIESSSNPNSVYAFGSYLGTGVYRAANQNATVVSIPLSFDLKKDSGSQTWLRLPISFGF  131

Query  96   FDYLAKDITDGELPSSVGTMTMTPGIEHHWQATANTRMEAYLDVGFGTNFDTDANVAILA  155
            FDYLAKDIT+GELPSS+GTMT+TPG EHHWQA+ NTRME YLD+GFGTNFD + NVAI+A
Sbjct  132  FDYLAKDITEGELPSSIGTMTITPGFEHHWQASENTRMEGYLDIGFGTNFDKNDNVAIIA  191

Query  156  SGVSSLYDFSLAGEDSVWVS  175
            SG+SSLYDF+LAG+D+VWVS
Sbjct  192  SGISSLYDFTLAGQDAVWVS  211


>ref|YP_963933.1| hypothetical protein Sputw3181_2555 [Shewanella sp. W3-18-1]
 ref|YP_001183068.1| hypothetical protein Sputcn32_1544 [Shewanella putrefaciens CN-32]
 gb|ABM25379.1| conserved hypothetical protein [Shewanella sp. W3-18-1]
 gb|ABP75269.1| conserved hypothetical protein [Shewanella putrefaciens CN-32]
Length=288

 Score =  245 bits (625),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 139/172 (80%), Gaps = 5/172 (2%)

Query  7    LLASTAPIASHTQPQAAQLSPSFAQMSPES---PIDGQNNPNSVYAFGSYLGTGVYRAAD  63
            LL S  P  + T  QA      F   SP S     + Q+NPNSVYAFGSYLGTGVYRAA+
Sbjct  5    LLGSLIP--NVTLAQAYLSEQDFIPSSPTSNHLAAENQSNPNSVYAFGSYLGTGVYRAAE  62

Query  64   QNATVVSIPLSFDFLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTMTPGIEH  123
            QNATVVS+PLSFDF KD  SQTWLRLPLSFGFFDYLA+D+T+GE PSSVGTMT+TPGIEH
Sbjct  63   QNATVVSVPLSFDFQKDNDSQTWLRLPLSFGFFDYLAQDLTEGEFPSSVGTMTVTPGIEH  122

Query  124  HWQATANTRMEAYLDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSVWVS  175
            HWQA+ NTRMEAY DVGFGTNFDT  NVAILA+G+S+LYDF+L GE+SVWVS
Sbjct  123  HWQASENTRMEAYFDVGFGTNFDTSENVAILATGISTLYDFTLGGEESVWVS  174


>ref|YP_001554124.1| hypothetical protein Sbal195_1691 [Shewanella baltica OS195]
 gb|ABX48864.1| conserved hypothetical protein [Shewanella baltica OS195]
Length=325

 Score =  244 bits (624),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/140 (80%), Positives = 129/140 (92%), Gaps = 0/140 (0%)

Query  36   SPIDGQNNPNSVYAFGSYLGTGVYRAADQNATVVSIPLSFDFLKDESSQTWLRLPLSFGF  95
            +PI+  +NPNSVYAFGSYLGTGVYRAA+QNATVVSIPLSFD  KD  SQTWLRLP+SFGF
Sbjct  72   NPIELSSNPNSVYAFGSYLGTGVYRAANQNATVVSIPLSFDLKKDSGSQTWLRLPISFGF  131

Query  96   FDYLAKDITDGELPSSVGTMTMTPGIEHHWQATANTRMEAYLDVGFGTNFDTDANVAILA  155
            FDYLAKDIT+GELPSS+GTMT+TPG EHHWQA+ NTRME YLD+GFGTNFD + NVAI+A
Sbjct  132  FDYLAKDITEGELPSSIGTMTITPGFEHHWQASENTRMEGYLDIGFGTNFDKNDNVAIIA  191

Query  156  SGVSSLYDFSLAGEDSVWVS  175
            SG+SSLYDF+LAG+D+VWVS
Sbjct  192  SGISSLYDFTLAGQDAVWVS  211


>ref|ZP_01706986.1| conserved hypothetical protein [Shewanella putrefaciens 200]
 gb|EAY52671.1| conserved hypothetical protein [Shewanella putrefaciens 200]
Length=288

 Score =  244 bits (624),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 134/159 (84%), Gaps = 6/159 (3%)

Query  23   AQLSPSFAQMSPESPI------DGQNNPNSVYAFGSYLGTGVYRAADQNATVVSIPLSFD  76
            AQ+  S     P SP       + Q+NPNSVYAFGSYLGTGVYRAA+QNATVVS+PLSFD
Sbjct  16   AQVYLSEQDFIPSSPTNNHLAAENQSNPNSVYAFGSYLGTGVYRAAEQNATVVSVPLSFD  75

Query  77   FLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTMTPGIEHHWQATANTRMEAY  136
            F KD  SQTWLRLPLSFGFFDYLA+D+T+GE PSSVGTMT+TPG+EHHWQA+ NTRMEAY
Sbjct  76   FQKDNDSQTWLRLPLSFGFFDYLAQDLTEGEFPSSVGTMTVTPGVEHHWQASENTRMEAY  135

Query  137  LDVGFGTNFDTDANVAILASGVSSLYDFSLAGEDSVWVS  175
             DVGFGTNFDT  NVAILA+G+S+LYDF+L GE+SVWVS
Sbjct  136  FDVGFGTNFDTSENVAILATGISTLYDFTLGGEESVWVS  174


                                                              
b)

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q3TLS3.2|CO058_MOUSE  RecName: Full=UPF0580 protein C15orf5...  33.1    0.84 
sp|Q8BMK0.2|CCD21_MOUSE  RecName: Full=Coiled-coil domain-cont...  32.7    1.1  
sp|P26570.4|PPZ1_YEAST  RecName: Full=Serine/threonine-protein...  32.3    1.2  
sp|Q12P60.1|MNMC_SHEDO  RecName: Full=tRNA 5-methylaminomethyl...  32.3    1.3  
sp|Q0VPJ1.1|ACCD_ALCBS  RecName: Full=Acetyl-coenzyme A carbox...  31.6    2.2  
sp|P32381.1|ARP2_YEAST  RecName: Full=Actin-related protein 2;...  31.6    2.3  
sp|B5EAK5.1|ACCD_GEOBB  RecName: Full=Acetyl-coenzyme A carbox...  31.6    2.4  
sp|B4EZF5.1|ACCD_PROMH  RecName: Full=Acetyl-coenzyme A carbox...  30.8    3.9  
sp|Q2QL82.1|CTTB2_MICMU  RecName: Full=Cortactin-binding prote...  30.4    4.6  
sp|Q2NSI3.1|ACCD_SODGM  RecName: Full=Acetyl-coenzyme A carbox...  30.4    5.1  
sp|Q2G8S9.1|ACCD_NOVAD  RecName: Full=Acetyl-coenzyme A carbox...  30.0    6.3  
sp|Q290L5.1|FBSP1_DROPS  RecName: Full=F-box/SPRY domain-conta...  30.0    7.1  

ALIGNMENTS
>sp|Q3TLS3.2|CO058_MOUSE RecName: Full=UPF0580 protein C15orf58 homolog
Length=386

 Score = 33.1 bits (74),  Expect = 0.84, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 44/100 (44%), Gaps = 7/100 (7%)

Query  39   DGQNNPNSVYAFGSYLGTGVYRAADQNATVVSIPLSFDFLKDESSQTWLRLPLSFGFFDY  98
            + Q  P+ VY     +G  V    D  + V ++PLS  F  D + ++  R  L  G F Y
Sbjct  22   EKQGIPDFVYGQEDLVGKEVQWPRDSPSAVDTVPLS-RF--DSALRSAWRQRLELGLFRY  78

Query  99   LAKDITDGELPSSVG---TMTMTPGIEHHW-QATANTRME  134
              +D+    LP SVG    + +  GI+    Q   + R E
Sbjct  79   RLEDLQTQILPGSVGFVAQLNIERGIQRRRPQNIRSVRQE  118


>sp|Q8BMK0.2|CCD21_MOUSE RecName: Full=Coiled-coil domain-containing protein 21
Length=761

 Score = 32.7 bits (73),  Expect = 1.1, Method: Composition-based stats.
 Identities = 27/87 (31%), Positives = 36/87 (41%), Gaps = 9/87 (10%)

Query  10   STAPIASHTQPQAAQLSPSFAQMSPESPIDGQNNPNSVYAFGSYL--GTGVYRAADQNAT  67
            S  PI SH     A + PS    SP  P    + P+S     S L  G G+ R  D  A 
Sbjct  78   SFQPIKSHITIPTAHVMPSTLGASPAKPNSAPSGPSSAKLPLSGLTEGVGMTRNGDFGAV  137

Query  68   VVSIPLSFDFL-------KDESSQTWL  87
              S  L+ DF+       ++ S Q+W 
Sbjct  138  KRSPGLARDFMYLPSAAGENGSQQSWF  164


>sp|P26570.4|PPZ1_YEAST RecName: Full=Serine/threonine-protein phosphatase PP-Z1
Length=692

 Score = 32.3 bits (72),  Expect = 1.2, Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 0/37 (0%)

Query  10   STAPIASHTQPQAAQLSPSFAQMSPESPIDGQNNPNS  46
            ST+  +S+    AA L PS  QM P+SPI   NN ++
Sbjct  116  STSRRSSYNTKAAADLPPSMIQMEPKSPILKTNNSST  152


>sp|Q12P60.1|MNMC_SHEDO RecName: Full=tRNA 5-methylaminomethyl-2-thiouridine biosynthesis 
bifunctional protein mnmC; Short=tRNA mnm(5)s(2)U biosynthesis 
bifunctional protein; Includes: RecName: Full=tRNA (mnm(5)s(2)U34)-methyltransferase; 
Includes: RecName: Full=FAD-dependent 
cmnm(5)s(2)U34 oxidoreductase
Length=754

 Score = 32.3 bits (72),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 49/113 (43%), Gaps = 3/113 (2%)

Query  7    LLASTAPIASHTQPQAAQLSPSFAQMSPESPIDGQ-NNPNSVYAFGSYLGTGVYRAADQN  65
            +LAS A I +  Q QA Q+S    Q+S   P  G+    N+V     YL           
Sbjct  534  VLASGASITAFEQTQALQMSGFRGQVS-HVPSKGELAKLNTVICANGYLTPAFNSTHCVG  592

Query  66   ATVVSIPLSFDFLKDESSQTWLRLPLSFGFFDYLAKDITDGELPSSVGTMTMT  118
            A+ V  P   DF  DE ++   ++  SF   ++  +DI   +  + VG   +T
Sbjct  593  ASYVKDPEHLDFCSDEQAENGQKMQQSFPNLEW-PQDIDVSDRNARVGVRMVT  644


>sp|Q0VPJ1.1|ACCD_ALCBS RecName: Full=Acetyl-coenzyme A carboxylase carboxyl transferase 
subunit beta; Short=Acetyl-CoA carboxylase carboxyltransferase 
subunit beta; Short=ACCase subunit beta
Length=293

 Score = 31.6 bits (70),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 19/35 (54%), Gaps = 0/35 (0%)

Query  114  TMTMTPGIEHHWQATANTRMEAYLDVGFGTNFDTD  148
             M + P  +HH + +A  R++ +LD G  T   T+
Sbjct  48   NMDVCPKCDHHLRISARRRLKLFLDEGVQTEIGTE  82


>sp|P32381.1|ARP2_YEAST RecName: Full=Actin-related protein 2; AltName: Full=Actin-like 
protein ARP2; Short=Actin-like protein 2
Length=391

 Score = 31.6 bits (70),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 4/69 (5%)

Query  40   GQNNPNSVYAFGSYLGTGVYRAADQNATVVSIPLSFDFLKDESSQTWLRLPLSFGFFDYL  99
            G+N P+  Y F S +G  + RA ++ +  V+ PL    + DE+S+    L +S+   + +
Sbjct  22   GENFPD--YTFPSIVGRPILRAEERAS--VATPLKDIMIGDEASEVRSYLQISYPMENGI  77

Query  100  AKDITDGEL  108
             K+ TD EL
Sbjct  78   IKNWTDMEL  86


>sp|B5EAK5.1|ACCD_GEOBB RecName: Full=Acetyl-coenzyme A carboxylase carboxyl transferase 
subunit beta; Short=Acetyl-CoA carboxylase carboxyltransferase 
subunit beta; Short=ACCase subunit beta
Length=282

 Score = 31.6 bits (70),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 0/32 (0%)

Query  115  MTMTPGIEHHWQATANTRMEAYLDVGFGTNFD  146
            + + P   HH++ ++  R+E  LD G  T FD
Sbjct  45   LNVCPKCNHHYRVSSKKRLELLLDEGSFTEFD  76


>sp|B4EZF5.1|ACCD_PROMH RecName: Full=Acetyl-coenzyme A carboxylase carboxyl transferase 
subunit beta; Short=Acetyl-CoA carboxylase carboxyltransferase 
subunit beta; Short=ACCase subunit beta
Length=320

 Score = 30.8 bits (68),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 10/34 (29%), Positives = 19/34 (55%), Gaps = 0/34 (0%)

Query  115  MTMTPGIEHHWQATANTRMEAYLDVGFGTNFDTD  148
            + + P  +HH + +A  R+E +LD G  T   ++
Sbjct  45   LEVCPKCDHHMRISARRRLETFLDTGSTTELGSE  78


>sp|Q2QL82.1|CTTB2_MICMU RecName: Full=Cortactin-binding protein 2; Short=CortBP2
Length=1647

 Score = 30.4 bits (67),  Expect = 4.6, Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 27/72 (37%), Gaps = 0/72 (0%)

Query  5    FPLLASTAPIASHTQPQAAQLSPSFAQMSPESPIDGQNNPNSVYAFGSYLGTGVYRAADQ  64
             P   + AP ++   P AA L P+ +  SP +P   Q   N       +   G     DQ
Sbjct  388  LPSSTAPAPGSAAQSPVAAALGPAHSAQSPCTPAPAQPGLNPRVQAARFRFQGNANDPDQ  447

Query  65   NATVVSIPLSFD  76
            N      P S D
Sbjct  448  NGNTTQSPPSRD  459


>sp|Q2NSI3.1|ACCD_SODGM RecName: Full=Acetyl-coenzyme A carboxylase carboxyl transferase 
subunit beta; Short=Acetyl-CoA carboxylase carboxyltransferase 
subunit beta; Short=ACCase subunit beta
Length=306

 Score = 30.4 bits (67),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 10/34 (29%), Positives = 19/34 (55%), Gaps = 0/34 (0%)

Query  115  MTMTPGIEHHWQATANTRMEAYLDVGFGTNFDTD  148
            + + P  +HH + TA  R+ A+LD G  +   ++
Sbjct  45   LEVCPKCDHHMRMTARARLHAFLDKGSESELGSE  78



Personal tools