GOS 1586030

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_607
Annotathon code: GOS_1586030
Sample :
  • GPS :31°10'30n; 64°19'27.6w
  • Sargasso Sea: Sargasso Sea, Station 11 - Bermuda (UK)
  • Open Ocean (-5m, 20.5°C, 0.1-0.8 microns)
Authors
Team : UNIL-2010
Username : nlapique
Annotated on : 2010-05-05 15:59:39
  • Lapique Nicolas

Synopsis

  • Taxonomy: Burkholderia cepacia complex (NCBI info)
    Rank: species group - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 87882
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Betaproteobacteria - Order: Burkholderiales
    Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Burkholderiaceae; Burkholderia; Burkholderia cepacia complex;

Genomic Sequence

>JCVI_READ_607 GOS_1586030 Genomic DNA
TGCGAAGCCGCCGTGCGAATCGTTGACCCACACCGCCTGCGCGCCGCCCATGAACGCGCCTTCGATCGCTGCGTTCGCCTCGGCGGTCATCCAGCGGCGC
GCGCGCTCGTATTCCGGATTGCCGGCGCGCGTCTGCTCGGTGGCGAATACGCCGGCAACGCCTTCGATGTCGGTTGAAATCAGGATCTTCATGACTGGAT
AAGACGTCCTTCGTGGCCTTCGTTGAACAGGCGATCGAGGTCGGGCACCGCATCGCGCAGCGATTGCCGCACGTGGCCGTCGCGCCCGGCCACCGTCACG
GCCTGCAGCAGCGCGTCGGCGATCGCATGCTCGACGCTTTCGGCCGCGGCCATGAACAGCGGATCGAGCGCCGCGTCGGCGACGAGGGCCGGCAGCGCGA
TGGTCGATGCGTCGTGCGCGATCGTATATGCAGTGGAAAATGCGAGCGCGATGTCGCCGCTGCCGTGCCCGTAGACCGAGCCCGTGCGAGCCAGCCCCGC
ACCTGCGCGGCGCGCGAGCCGCGACAATTGCCGCGCGTCGAGCGGCGCGTCGGTAGCCAGCAGCAGGATGATCGATCCTTGCTCCGGCGGCGCCACATGC
GCGGCCTCGGCCGCACGCCGTTGCGCGACGATGCGCCCGACCGGCACGCCGCCGAGCGTCAGCATCGGCAGCCGGCCGAAATTCGCGAGCACGAGCGCGC
CGACCGTATAGGGCCGCCCCGCCGCGACGGCAACGCGCGACGCCGAACCGATCCCGCCCTTCAGGTCGAAGCTCGACATCCCGCGCCCGGCGCCCACCGC
GCCGCGTGCGACGTCGCGCGACGCCGCGCGGCACGCGTCGTCGTAATGCGCGGCCGTAACCGCGAACGCCTGGATATCGTTCAGATAGCCGTCGTTGCAC
TCGAACACGAGCGGGGTTGACGGTCGACCAGTCGCGGCCCGATCCGCGATTCGCCGCGATCGCCGCGCGGATCTGCGCCTGCGCGACGGCACCGACGCCA
AA

Translation

[2 - 811/1002]   indirect strand
>GOS_1586030 Translation [2-811   indirect strand]
LASVPSRRRRSARRSRRIADRAATGRPSTPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSSFDLKGGIGSASRVAVAAGRPYTV
GALVLANFGRLPMLTLGGVPVGRIVAQRRAAEAAHVAPPEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDAST
IALPALVADAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPDLDRLFNEGHEGRLIQS

[ Warning ] 5' incomplete: does not start with a Methionine

Annotator commentaries

The prediction domain and the blast confirmed that "GOS_1586030" encode partially for a Peptidase S58, DmpA. We have shown that certainly a frameshift mutation, an insertion of cystein, appears at the position 86 on the reverse strand of "GOS_1586030", but because this frameshift mutation appears at the beginning of the sequence, it has a small effect on the following analysis, and I chosed to conserve the original sequence. The tree I performed from the blast results is perfectly consistent with the phylogenic data, and one can confirm that "GOS_1586030" come from Burkholderia cepacia complex clade.

ORF finding

PROTOCOL

1)SMS ORFinder/ direct strand/ frames 1,2 & 3/'any codon' initiation/'standard 1' genetic code

2)SMS ORFinder/ indirect strand/ frames 1,2 & 3/'any codon' initiation/'standard 1' genetic code


RESULTS ANALYSIS


10 ORFs are found with SMS ORFinder, and I think it is to arbitrary to chose the longer one, hence I performed a blast on all the sequences in order to evaluate which ORF seems to encode for a protein. Surprisingly 2 different ORFs on the reverse strand match with 2 different known proteins. We know that the same region of the prokaryotic genome can encode for different protein according to which open reading frame is chosen, and one could think that the sequence "GOS_1586030" could really encode partially for 2 different proteins. Because one can annotate only one sequence, the sequence with the best blast e-value has been chosen, which is on reading frame 2 on the reverse strand.



>ORF number 1 in reading frame 2 on the reverse strand extends from base 2 to base 814.

TTGGCGTCGGTGCCGTCGCGCAGGCGCAGATCCGCGCGGCGATCGCGGCGAATCGCGGAT

CGGGCCGCGACTGGTCGACCGTCAACCCCGCTCGTGTTCGAGTGCAACGACGGCTATCTG

AACGATATCCAGGCGTTCGCGGTTACGGCCGCGCATTACGACGACGCGTGCCGCGCGGCG

TCGCGCGACGTCGCACGCGGCGCGGTGGGCGCCGGGCGCGGGATGTCGAGCTTCGACCTG

AAGGGCGGGATCGGTTCGGCGTCGCGCGTTGCCGTCGCGGCGGGGCGGCCCTATACGGTC

GGCGCGCTCGTGCTCGCGAATTTCGGCCGGCTGCCGATGCTGACGCTCGGCGGCGTGCCG

GTCGGGCGCATCGTCGCGCAACGGCGTGCGGCCGAGGCCGCGCATGTGGCGCCGCCGGAG

CAAGGATCGATCATCCTGCTGCTGGCTACCGACGCGCCGCTCGACGCGCGGCAATTGTCG

CGGCTCGCGCGCCGCGCAGGTGCGGGGCTGGCTCGCACGGGCTCGGTCTACGGGCACGGC

AGCGGCGACATCGCGCTCGCATTTTCCACTGCATATACGATCGCGCACGACGCATCGACC

ATCGCGCTGCCGGCCCTCGTCGCCGACGCGGCGCTCGATCCGCTGTTCATGGCCGCGGCC

GAAAGCGTCGAGCATGCGATCGCCGACGCGCTGCTGCAGGCCGTGACGGTGGCCGGGCGC

GACGGCCACGTGCGGCAATCGCTGCGCGATGCGGTGCCCGACCTCGATCGCCTGTTCAAC

GAAGGCCACGAAGGACGTCTTATCCAGTCATGA


>Translation of ORF number 1 in reading frame 2 on the reverse strand.

LASVPSRRRRSARRSRRIADRAATGRPSTPLVFECNDGYLNDIQAFAVTAAHYDDACRAA

SRDVARGAVGAGRGMSSFDLKGGIGSASRVAVAAGRPYTVGALVLANFGRLPMLTLGGVP

VGRIVAQRRAAEAAHVAPPEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHG

SGDIALAFSTAYTIAHDASTIALPALVADAALDPLFMAAAESVEHAIADALLQAVTVAGR

DGHVRQSLRDAVPDLDRLFNEGHEGRLIQS*


Although the sequence has a very good E-value, the beginning of the protein sequence of "GOS_1586030" has no similarities with the beginning of the sequence match with the blast, which is very surprising because the introns are very rare, and even absent in prokaryote. A nucleotide blast with the previous sequence show that the beginning of the sequence is well aligned from the beginning to the end, but I was able to identify an insertion which seems to shift the frameshift (see blast section). Indeed the cytosine (C) at the position 86 is certainly an insertion and if one remove this cytosine and one read "GOS_1586030" in reading frame 1 on the reverse strand, the protein sequence is almost perfectly aligned from the beginning to the end with the best hit sequence match with blast (see blast section).

Here is the sequence without the cysteine at the position 86:

FGVGAVAQAQIRAAIAANRGSGRDWSTVNPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSSFDLKGGIGSASRVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGRIVAQRRAAEAAHVAPPEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPALVADAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPDLDRLFNEGHEGRLIQS


RAW RESULTS
>ORF number 1 in reading frame 1 on the direct strand extends from base 178 to base 474.
AATCAGGATCTTCATGACTGGATAAGACGTCCTTCGTGGCCTTCGTTGAACAGGCGATCG
AGGTCGGGCACCGCATCGCGCAGCGATTGCCGCACGTGGCCGTCGCGCCCGGCCACCGTC
ACGGCCTGCAGCAGCGCGTCGGCGATCGCATGCTCGACGCTTTCGGCCGCGGCCATGAAC
AGCGGATCGAGCGCCGCGTCGGCGACGAGGGCCGGCAGCGCGATGGTCGATGCGTCGTGC
GCGATCGTATATGCAGTGGAAAATGCGAGCGCGATGTCGCCGCTGCCGTGCCCGTAG

>Translation of ORF number 1 in reading frame 1 on the direct strand.
NQDLHDWIRRPSWPSLNRRSRSGTASRSDCRTWPSRPATVTACSSASAIACSTLSAAAMN
SGSSAASATRAGSAMVDASCAIVYAVENASAMSPLPCP*

>ORF number 2 in reading frame 1 on the direct strand extends from base 475 to base 711.
ACCGAGCCCGTGCGAGCCAGCCCCGCACCTGCGCGGCGCGCGAGCCGCGACAATTGCCGC
GCGTCGAGCGGCGCGTCGGTAGCCAGCAGCAGGATGATCGATCCTTGCTCCGGCGGCGCC
ACATGCGCGGCCTCGGCCGCACGCCGTTGCGCGACGATGCGCCCGACCGGCACGCCGCCG
AGCGTCAGCATCGGCAGCCGGCCGAAATTCGCGAGCACGAGCGCGCCGACCGTATAG

>Translation of ORF number 2 in reading frame 1 on the direct strand.
TEPVRASPAPARRASRDNCRASSGASVASSRMIDPCSGGATCAASAARRCATMRPTGTPP
SVSIGSRPKFASTSAPTV*

>ORF number 1 in reading frame 2 on the direct strand extends from base 2 to base 202.
GCGAAGCCGCCGTGCGAATCGTTGACCCACACCGCCTGCGCGCCGCCCATGAACGCGCCT
TCGATCGCTGCGTTCGCCTCGGCGGTCATCCAGCGGCGCGCGCGCTCGTATTCCGGATTG
CCGGCGCGCGTCTGCTCGGTGGCGAATACGCCGGCAACGCCTTCGATGTCGGTTGAAATC
AGGATCTTCATGACTGGATAA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
AKPPCESLTHTACAPPMNAPSIAAFASAVIQRRARSYSGLPARVCSVANTPATPSMSVEI
RIFMTG*

>ORF number 2 in reading frame 2 on the direct strand extends from base 356 to base 556.
ACAGCGGATCGAGCGCCGCGTCGGCGACGAGGGCCGGCAGCGCGATGGTCGATGCGTCGT
GCGCGATCGTATATGCAGTGGAAAATGCGAGCGCGATGTCGCCGCTGCCGTGCCCGTAGA
CCGAGCCCGTGCGAGCCAGCCCCGCACCTGCGCGGCGCGCGAGCCGCGACAATTGCCGCG
CGTCGAGCGGCGCGTCGGTAG

>Translation of ORF number 2 in reading frame 2 on the direct strand.
TADRAPRRRRGPAARWSMRRARSYMQWKMRARCRRCRARRPSPCEPAPHLRGARAATIAA
RRAARR*

>ORF number 3 in reading frame 2 on the direct strand extends from base 572 to base 859.
TCGATCCTTGCTCCGGCGGCGCCACATGCGCGGCCTCGGCCGCACGCCGTTGCGCGACGA
TGCGCCCGACCGGCACGCCGCCGAGCGTCAGCATCGGCAGCCGGCCGAAATTCGCGAGCA
CGAGCGCGCCGACCGTATAGGGCCGCCCCGCCGCGACGGCAACGCGCGACGCCGAACCGA
TCCCGCCCTTCAGGTCGAAGCTCGACATCCCGCGCCCGGCGCCCACCGCGCCGCGTGCGA
CGTCGCGCGACGCCGCGCGGCACGCGTCGTCGTAATGCGCGGCCGTAA

>Translation of ORF number 3 in reading frame 2 on the direct strand.
SILAPAAPHARPRPHAVARRCARPARRRASASAAGRNSRARARRPYRAAPPRRQRATPNR
SRPSGRSSTSRARRPPRRVRRRATPRGTRRRNARP*

>ORF number 1 in reading frame 3 on the direct strand extends from base 195 to base 920.
CTGGATAAGACGTCCTTCGTGGCCTTCGTTGAACAGGCGATCGAGGTCGGGCACCGCATC
GCGCAGCGATTGCCGCACGTGGCCGTCGCGCCCGGCCACCGTCACGGCCTGCAGCAGCGC
GTCGGCGATCGCATGCTCGACGCTTTCGGCCGCGGCCATGAACAGCGGATCGAGCGCCGC
GTCGGCGACGAGGGCCGGCAGCGCGATGGTCGATGCGTCGTGCGCGATCGTATATGCAGT
GGAAAATGCGAGCGCGATGTCGCCGCTGCCGTGCCCGTAGACCGAGCCCGTGCGAGCCAG
CCCCGCACCTGCGCGGCGCGCGAGCCGCGACAATTGCCGCGCGTCGAGCGGCGCGTCGGT
AGCCAGCAGCAGGATGATCGATCCTTGCTCCGGCGGCGCCACATGCGCGGCCTCGGCCGC
ACGCCGTTGCGCGACGATGCGCCCGACCGGCACGCCGCCGAGCGTCAGCATCGGCAGCCG
GCCGAAATTCGCGAGCACGAGCGCGCCGACCGTATAGGGCCGCCCCGCCGCGACGGCAAC
GCGCGACGCCGAACCGATCCCGCCCTTCAGGTCGAAGCTCGACATCCCGCGCCCGGCGCC
CACCGCGCCGCGTGCGACGTCGCGCGACGCCGCGCGGCACGCGTCGTCGTAATGCGCGGC
CGTAACCGCGAACGCCTGGATATCGTTCAGATAGCCGTCGTTGCACTCGAACACGAGCGG
GGTTGA

>Translation of ORF number 1 in reading frame 3 on the direct strand.
LDKTSFVAFVEQAIEVGHRIAQRLPHVAVAPGHRHGLQQRVGDRMLDAFGRGHEQRIERR
VGDEGRQRDGRCVVRDRICSGKCERDVAAAVPVDRARASQPRTCAAREPRQLPRVERRVG
SQQQDDRSLLRRRHMRGLGRTPLRDDAPDRHAAERQHRQPAEIREHERADRIGPPRRDGN
ARRRTDPALQVEARHPAPGAHRAACDVARRRAARVVVMRGRNRERLDIVQIAVVALEHER
G*

>ORF number 1 in reading frame 1 on the reverse strand extends from base 1 to base 1002.
TTTGGCGTCGGTGCCGTCGCGCAGGCGCAGATCCGCGCGGCGATCGCGGCGAATCGCGGA
TCGGGCCGCGACTGGTCGACCGTCAACCCCGCTCGTGTTCGAGTGCAACGACGGCTATCT
GAACGATATCCAGGCGTTCGCGGTTACGGCCGCGCATTACGACGACGCGTGCCGCGCGGC
GTCGCGCGACGTCGCACGCGGCGCGGTGGGCGCCGGGCGCGGGATGTCGAGCTTCGACCT
GAAGGGCGGGATCGGTTCGGCGTCGCGCGTTGCCGTCGCGGCGGGGCGGCCCTATACGGT
CGGCGCGCTCGTGCTCGCGAATTTCGGCCGGCTGCCGATGCTGACGCTCGGCGGCGTGCC
GGTCGGGCGCATCGTCGCGCAACGGCGTGCGGCCGAGGCCGCGCATGTGGCGCCGCCGGA
GCAAGGATCGATCATCCTGCTGCTGGCTACCGACGCGCCGCTCGACGCGCGGCAATTGTC
GCGGCTCGCGCGCCGCGCAGGTGCGGGGCTGGCTCGCACGGGCTCGGTCTACGGGCACGG
CAGCGGCGACATCGCGCTCGCATTTTCCACTGCATATACGATCGCGCACGACGCATCGAC
CATCGCGCTGCCGGCCCTCGTCGCCGACGCGGCGCTCGATCCGCTGTTCATGGCCGCGGC
CGAAAGCGTCGAGCATGCGATCGCCGACGCGCTGCTGCAGGCCGTGACGGTGGCCGGGCG
CGACGGCCACGTGCGGCAATCGCTGCGCGATGCGGTGCCCGACCTCGATCGCCTGTTCAA
CGAAGGCCACGAAGGACGTCTTATCCAGTCATGAAGATCCTGATTTCAACCGACATCGAA
GGCGTTGCCGGCGTATTCGCCACCGAGCAGACGCGCGCCGGCAATCCGGAATACGAGCGC
GCGCGCCGCTGGATGACCGCCGAGGCGAACGCAGCGATCGAAGGCGCGTTCATGGGCGGC
GCGCAGGCGGTGTGGGTCAACGATTCGCACGGCGGCTTCGCA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
FGVGAVAQAQIRAAIAANRGSGRDWSTVNPARVRVQRRLSERYPGVRGYGRALRRRVPRG
VARRRTRRGGRRARDVELRPEGRDRFGVARCRRGGAALYGRRARAREFRPAADADARRRA
GRAHRRATACGRGRACGAAGARIDHPAAGYRRAARRAAIVAARAPRRCGAGSHGLGLRAR
QRRHRARIFHCIYDRARRIDHRAAGPRRRRGARSAVHGRGRKRRACDRRRAAAGRDGGRA
RRPRAAIAARCGARPRSPVQRRPRRTSYPVMKILISTDIEGVAGVFATEQTRAGNPEYER
ARRWMTAEANAAIEGAFMGGAQAVWVNDSHGGFA

>ORF number 1 in reading frame 2 on the reverse strand extends from base 2 to base 814.
TTGGCGTCGGTGCCGTCGCGCAGGCGCAGATCCGCGCGGCGATCGCGGCGAATCGCGGAT
CGGGCCGCGACTGGTCGACCGTCAACCCCGCTCGTGTTCGAGTGCAACGACGGCTATCTG
AACGATATCCAGGCGTTCGCGGTTACGGCCGCGCATTACGACGACGCGTGCCGCGCGGCG
TCGCGCGACGTCGCACGCGGCGCGGTGGGCGCCGGGCGCGGGATGTCGAGCTTCGACCTG
AAGGGCGGGATCGGTTCGGCGTCGCGCGTTGCCGTCGCGGCGGGGCGGCCCTATACGGTC
GGCGCGCTCGTGCTCGCGAATTTCGGCCGGCTGCCGATGCTGACGCTCGGCGGCGTGCCG
GTCGGGCGCATCGTCGCGCAACGGCGTGCGGCCGAGGCCGCGCATGTGGCGCCGCCGGAG
CAAGGATCGATCATCCTGCTGCTGGCTACCGACGCGCCGCTCGACGCGCGGCAATTGTCG
CGGCTCGCGCGCCGCGCAGGTGCGGGGCTGGCTCGCACGGGCTCGGTCTACGGGCACGGC
AGCGGCGACATCGCGCTCGCATTTTCCACTGCATATACGATCGCGCACGACGCATCGACC
ATCGCGCTGCCGGCCCTCGTCGCCGACGCGGCGCTCGATCCGCTGTTCATGGCCGCGGCC
GAAAGCGTCGAGCATGCGATCGCCGACGCGCTGCTGCAGGCCGTGACGGTGGCCGGGCGC
GACGGCCACGTGCGGCAATCGCTGCGCGATGCGGTGCCCGACCTCGATCGCCTGTTCAAC
GAAGGCCACGAAGGACGTCTTATCCAGTCATGA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
LASVPSRRRRSARRSRRIADRAATGRPSTPLVFECNDGYLNDIQAFAVTAAHYDDACRAA
SRDVARGAVGAGRGMSSFDLKGGIGSASRVAVAAGRPYTVGALVLANFGRLPMLTLGGVP
VGRIVAQRRAAEAAHVAPPEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHG
SGDIALAFSTAYTIAHDASTIALPALVADAALDPLFMAAAESVEHAIADALLQAVTVAGR
DGHVRQSLRDAVPDLDRLFNEGHEGRLIQS*

>ORF number 1 in reading frame 3 on the reverse strand extends from base 345 to base 707.
CGCTCGGCGGCGTGCCGGTCGGGCGCATCGTCGCGCAACGGCGTGCGGCCGAGGCCGCGC
ATGTGGCGCCGCCGGAGCAAGGATCGATCATCCTGCTGCTGGCTACCGACGCGCCGCTCG
ACGCGCGGCAATTGTCGCGGCTCGCGCGCCGCGCAGGTGCGGGGCTGGCTCGCACGGGCT
CGGTCTACGGGCACGGCAGCGGCGACATCGCGCTCGCATTTTCCACTGCATATACGATCG
CGCACGACGCATCGACCATCGCGCTGCCGGCCCTCGTCGCCGACGCGGCGCTCGATCCGC
TGTTCATGGCCGCGGCCGAAAGCGTCGAGCATGCGATCGCCGACGCGCTGCTGCAGGCCG
TGA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
RSAACRSGASSRNGVRPRPRMWRRRSKDRSSCCWLPTRRSTRGNCRGSRAAQVRGWLARA
RSTGTAAATSRSHFPLHIRSRTTHRPSRCRPSSPTRRSIRCSWPRPKASSMRSPTRCCRP
*

>ORF number 2 in reading frame 3 on the reverse strand extends from base 708 to base 1001.
CGGTGGCCGGGCGCGACGGCCACGTGCGGCAATCGCTGCGCGATGCGGTGCCCGACCTCG
ATCGCCTGTTCAACGAAGGCCACGAAGGACGTCTTATCCAGTCATGAAGATCCTGATTTC
AACCGACATCGAAGGCGTTGCCGGCGTATTCGCCACCGAGCAGACGCGCGCCGGCAATCC
GGAATACGAGCGCGCGCGCCGCTGGATGACCGCCGAGGCGAACGCAGCGATCGAAGGCGC
GTTCATGGGCGGCGCGCAGGCGGTGTGGGTCAACGATTCGCACGGCGGCTTCGC

>Translation of ORF number 2 in reading frame 3 on the reverse strand.
RWPGATATCGNRCAMRCPTSIACSTKATKDVLSSHEDPDFNRHRRRCRRIRHRADARRQS
GIRARAPLDDRRGERSDRRRVHGRRAGGVGQRFARRLR

Multiple Alignement

PROTOCOL

Use "MUSCLE" to perform an alignment with BLOSUM62 matrix on Phylogeny.fr


RESULTS ANALYSIS

All the sequences used for the generation of the phylogenetic tree show a very good alignement, hence all the sequences are related and can be used to do a tree.

RAW RESULTS

>Polaromonas_sp._JS666
-----------MLRHLLPHIGSLPPGPRNAITDVAGVTVGHCTLDAHEVQTGVTVVCPHGGDLFRDRVPAAAVVLNGFGK
SVGLVQVEELGVLETPIALTNTFSVAPVAEAQIRQCIAANPETGRSLPTVNPLVFECNDGFLNDIQRMAVTGQHYLQACA
QAGTDVEEGSVGAGRGMSSFGLKGGIGTASRRVPAPGGGEHTVGALVLANYGRLPQLVMAGQALGARLASQLAGP-----
----LALEADEPEKGSIILLIATDAPLDARQLRRLALRAGAGLARTGSVFGHGSGDIALAFSTAYTVPQQTDR-PMPAVA
MLHDGLIDPLFQAVADSTEQAIVHALCCARAVTGRNGHHRKALADLLPDGAAPTHPQTP------

>Bordetella_petrii_DSM_12804
----------MHTQSILPRIGALPAGPLDAISDVRGVTVGHHTLAQGPLQTGVTVVRPHPGDAYRDKVPAAAAVLNGFGK
SIGLVQVQELGVLETPLALTNTFGVGTVANAQIRAAVAANPAIGREWPTVNPLVFECNDGYLNDIQALAVQEDHYAQALA
AADARFAQGSVGAGRGMSSFSLKGGIGSASRIAQIQPGLRYTVGALVLANFGRLPSLTIAGRPFGRELARMQDQG-----
----QAAEAARPEQGSIILLLATDAPLDARQLRRLALRAGAGLARTGSVFGHGSGDIALAFSTAYTVPHLAER-GMPAVV
LLHETRIDPLFEAAAEAAEQAIVAALWHAESVSGRDGHRRACIREAAPQWREWLARTEL------

>Burkholderia_pseudomallei_BCC215
--------------------------------------------------------------------------------
--------------------------------------------------------------------------------
--------------------------------------------------------------------------------
----------PPEQGSIIMLVATDAPLSSRQLKRVALRAAVGLARTGSVYGHGSGDIALAFSTAYTVPHDAERVSLPA--
LVADAALDPLFAAAADSVEQAIVDALWRATRVTGRDGHTRRALRDAAPELERWLRAARAGA----

>Burkholderia_multivorans_CGD2M
------------MRTVPRWNGALPAGPRDSIADVPGVTVGHCTLDDGAVQTGVTVVKPHAGDLYRSKVPAGAAVINGFGK
SVGLVQVDELGTLDTPIALTNTFGVGTVAQAQIRAAVAANPQVGRDWPTVNPLVFECNDGYLNDLHAFAIAPAHYDAACA
AASREVARGAVGAGRGMSCFDLKGGIGSASRVAIAA-ERPYTVGALVLANFGRLPMLTLGGVPVGRIVAARQA-------
----AGEPVAPPEQGSIIMLVATDAPLDARQLSRLARRAAAGLARTGSVYGHGSGDIALAFSTAYTIAHDADYVALPA--
LVADAALDPLFMAAADSVERAIADALLQAVTVVGRDGHVRRALRDAVPDLDRLLNEGPT--TIQR

>Burkholderia_cenocepacia_PC184
-----------M-------QRRLPERHPG--------------------------VRCHRRALRR---------------
-------------------------------RMRRSERRATSHGARW---------------------------------
-----------GAGRGMSCFDLKGGIGSASRVAVAA-GRPYTVGALVLANFGRLPMLTLGGVPLGRIVAQRRA------A
----EAVHAAPPEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPA--
LVADAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQALRDAVPDLDRLFNEDNEGHLTQS

>Burkholderia_vietnamiensis_G4
------------MAGVPMWSATLPAGPRGTLADVPGVTVGHATLAAGDVQTGVTVVKPHAGDLYRSKVPAGAAVINGFGK
SVGLVQVDELGTLETPIALTNTFGVGVLANAQIRAAIAQNPQIGRDWPTVNPLVFECNDGYLNDIQAFAVTAAHYDAACL
SASRDFARGAVGAGRGMSCFDLKGGIGSASRVAVAA-GRPYTVGALVLANFGRLPMLTLAGVPVGCIVAQRRAVSCVSRA
----QATDATAPEQGSIIVLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDLALAFSTAYTIAHDASTVSLPA--
LVADAALDPLFMAAAESVEHAIVDALLQAVTVTGRDGHVRQSLRDAVNDLDRLFGGQDDGLPTRS

>My_sequence
-------------------LASVPSRRRRS--------------------------------------------------
------------------------------ARRSRRIADRAATGRP---STPLVFECNDGYLNDIQAFAVTAAHYDDACR
AASRDVARGAVGAGRGMSSFDLKGGIGSASRVAVAA-GRPYTVGALVLANFGRLPMLTLGGVPVGRIVAQRRAA------
----EAAHVAPPEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPA--
LVADAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPDLDRLFNEGHEGRLIQS

>Burkholderia_sp._383
------------MRIAPMWTATLPAGPRGTIADVPGVTVGHCTLDAGNVQTGVTVVKPHPGDVYRSKVPAGAAVINGFGK
SVGLVQVDELGTLDTPIALTNTFGVGAVAQAQIRAAIAANPQVGRDWSTVNPLVFECNDGYLNDIQAFAVTAAHYDDACR
AASRDVARGAVGAGRGMSSFDLKGGIGSASRVAVAA-GRPYTVGALVLANFGRLPMLTLGGVPVGQIVAQRRAA------
----EAAHAAPPEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPA--
LVADAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPDLDRLFNEGHEGRLTQS

>Burkholderia_cenocepacia_AU_1054
------------MRPAPMWMATLPAGPRGTIADVPGVTVGHCTLDAGSVQTGVTVVKPHPGDVYRSKVPAGAAVINGFGK
SVGLVQVDELGTLDTPVALTNTFGVGAVAQAQIRAAIAANPRVGRDWSTVNPLVFECNDGYLNDIQAFAVTAAHYDDACR
AASRDVARGAVGAGRGMSCFDLKGGIGSASRVAVAA-GRPYTVGALVLANFGRLPMLTLGGVPLGRIVAQRRAA------
----EAARAAPPEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPA--
LVADAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQALRDAVPDLDRLFNEDNEGHPTQS

>Burkholderia_cenocepacia_MC0-3
------------MRAAPMWTATLPAGPRGTIADVPGVTVGHCTLDAGSVQTGVTVVKPHPGDVYRSKVPAGAAVINGFGK
SVGLVQVDELGTLDTPIALTHTFAVGAIAQAQIRAAIAANPRIGRDWSTVNPLVFECNDGYLNDIQAFAVTAAHYDDACR
AASRDVARGAVGAGRGMSCFDLKGGIGSASRVAVAA-GRPYTVGALVLANFGRLPMLTLGGVPLGRIVAQRRAA------
----EAARAAPPEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPA--
LVADAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQALRDAVPDLDRLFHEDNEGHLTQS

>Burkholderia_cenocepacia_J2315
------------MRAAPMWTATLPAGPRGTIADVPGVTVGHCTLDAGNVQTGVTVVKPHPGDVYRSKVPAGAAVINGFGK
SVGLVQVDELGTLDTPIALTNTFGVGAVAQAQIRAAIAANPRIGRDWSTVNPLVFECNDGYLNDIQAFAVTAAHYDDACR
AASRDVARGAVGAGRGMSCFDLKGGIGSASRVAVAA-GRPYTVGALVLANFGRLPMLTLGGVPLGRIVAQRRAA------
----EAAHAAPPEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPA--
LVADAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQALRDAVPDLDRLFNEDNEGRSTQS

>Burkholderia_ambifaria_MC40-6
------------MHAVPMWAATLPAGPRGTIADVPGVTVGHATLDADDVQTGVTVVKPHPGDLYRSKVPAGAAVINGFGK
SVGLVQVDELGTLDTPIALTNTFGVGAIAHAQIRAAIANNPQIGRDWPTVNPLVFECNDGYLNDIQAFAVTAAHYDDACR
TAARDFARGAVGAGRGMSCFDLKGGIGSASRVVVAA-GRPYTVGALVLANFGRLPMLTLGGVPLGRVVAQQRAA------
----AAAQAAAPEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASSVALPA--
LVADAALDPLFMAAAESVEHAIADALLQAVTVVGRDGHVRQSLRDAVPDLERLFNDDYEGRHIPS

>Burkholderia_ambifaria_IOP40-10
------------MRAVPMWTATLPAGPRGTIADVPGVTVGHATLDAGDVQTGVTVVKPHPGDLYRSKVPAGAAVINGFGK
SVGLVQVDELGTLDTPIALTNTFGVGAIAQAQIRAAIANNPQIGRDWSTVNPLVFECNDGYLNDIQAFAVTAAHYDDACR
TAARDFARGAVGAGRGMSCFDLKGGIGSASRVAVAA-GRPYTVGALVLANFGRLPMLTLGGVPLGRIVAQRHAA------
----AAAQAAAPEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASSVALPA--
LVADAALDPLFMAAAESVEHAIADALLQAVTVVGRDGHVRQSLRDAVPDLERLFNDDNEGRHIPS

>Burkholderia_ambifaria_AMMD
------------MRAVPMWAATLPAGPRGTIADVPGVTVGHATLDAGDVQTGVTVVKPHPGDLYRSKVPAGAAVINGFGK
SVGLMQVDELGTLDTPIALTNTFGVGAIAQAQIRAAIANNPQIGRDWSTVNPLVFECNDGYLNDIQAFAVTAAHYDDACR
TAARDFARGAVGAGRGMSCFDLKGGIGSASRVAVAA-GRPYTVGALVLANFGRLPMLTLGGVPLGRVVAQRHAA------
----AAAQAAAPEQGSIILLLAIDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTLALPA--
LVADAALDPLFMAAAESVEHAIADALLQAVTVVGRDGHVRQSLRDAVPDLERLFNDDNEGRHIPS

>Burkholderia_phymatum_STM815
-----------MSALPMPHIGVLPAGALG-TIADVAGVTVGHSTIDNGAVQTGVTVIRPHRDDPYLRKVPAAASVINGFGK
SIGLVQVEELGVLETPIALTNTFGIAAVAQAQIRAATASNPQVGREWPTVNPLVFECNDGYLNDIQALAVEGKHYEAALD
SSAPDFKRGSVGAGRGMSCFDLKGGIGSASRVVKVA-SSDLTVGALVLANFGRLPMLTIDGMPIGRELAQR---------
----RRATEAKPEQGSIIMIVATDAPLDARQLKRLSMRAAAGLARTGSVYGHGSGDIALAFSTAWTVPHDDDFIATPP--
LVSDARLDPLFHACADSVEQAIVDALWSAATVTGRDAHTRLSLHDAVPDLERLLKQRTT------

>Burkholderia_phytofirmans_PsJN
--------MNSSELQNAPHIGTLPGGPLGTIADVQGVTVGHCTLDAGAVQTGVTVIRPHDGDPFLAKVPAAASVINGFGK
SIGLVQVEELGTLETPIALTNTFGVSAVAQAQIRAAIRANPRIGREWSTVNPLVFECNDGYLNDIQALAVTAQHFDDAYA
AASANVASGSVGAGRGMSCFDMKGGIGNASRVVGVA-NRSYTVGALVLANFGRLTMLTVDGTPLGRMLAERAAKAAKVAK
AAS-SATLAMKAEQGSIIMIVATDAPLDARQLKRLSLRAAAGLARTGSVYGHGSGDIALAFSTAYTVPHGADFITLPP--
LLADERLDPLFRACADSVEQAILDTLWSAVSVTGRDAHQRLSLRDCVPDLAQLLERTR-------

>Burkholderia_sp._CCGE1001
--MSSIEAYDSRGSASAPHIGVLPSGPLNSIADVEGVSVGHCTLAEGAIQTGVSVIRPHPGDPFIDKVPAAASVINGFGK
SVGLVQVEEVGTLETPIALTNTFGVAAVAQAQIRAAIRADSRIGRAWPTVNPLVFECNDGYLNDIQALAIGEQHFNDAYA
AASTMVAGGSVGAGRGMSCFDLKGGIGNASRVVRAA-GHDYTVGALVLANFGRLPMLVIDGHAAGRMLAERAANAKGAAA
ANSHSAAQTANPEQGSIIMIVATDAPLDARQLKRLSLRAAAGLARTGSVYGHGSGDIALAFSTAYTVPHLAEYIELPP--
LLADHHMDPLFRACADSVEQAILDALWSAQSVTGRDGHRRLSLRESVPDLAQLLKHTS-------

>Burkholderia_graminis_C4D1M
--MSSMQSQPSQADNNAPHIGTLPSGALGTIADVEGVTVGHCTLAEGALQTGVTVIRPHADDPFVDKVPAAVSVINGFGK
SVGLVQIDELGTLETPIALTNTFGVAAVAQAQIRAAINANPGIGREWPTVNPLVFECNDGYLNDIQALAIGEQHFNDAYA
AAGTKVASGSVGAGRGMSCFDLKGGIGTASRVVSVA-GREYVVGALALANFGRLPMLVVDGHPVGRILAERAAKAK----
----ADADATKPEQGSIIMIVATDAPLDARQLKRLSLRAAAGLARTGSVYGHGSGDIALAFSTAYTVPHLAQYIALPP--
LVADQCMDPLFRACADSVEQAILDALWSAQSVTGRDGHRRLSLRESVPDLAHLLKQSP-------

>Burkholderia_sp._CCGE1002
-----MSMGNHHSAERAPHIGTLPAGALGTIADVEGVSVGHCTLAEGALQTGVTVIRPHRGDPFVEKVPAAASVINGFGK
SVGLVQLDELGTLETPIALTNTFGVAALAQAQIRAAIRANPRIGREWSTVNPLVFECNDGYLNDIQALVVTEQHFNEAFD
AASSDVASGAVGAGRGMSCFDLKGGIGTASRVVSAA-GRDYIVGALVLANFGRLPMLTIDGTPLGRVLAERAAA------
----ANASCDKPEQGSIIMIVATDAPLDARQLKRLSLRAAAGLARTGSVYGHGSGDIALAFSTAYTVPHGADFVALPP--
LVADHCLDPLFRACADSVEQAIVDALWSAESVTGRDGHRRLSLRDSVPDLAQLLRNSAR------

>Cupriavidus_metallidurans_CH34
MAPSARIEHKSSTMMDIPVIGTLPVGPRNAITDVAGVTVGHCTLADGACQTGVTVIRPHAGNVYREKVPAAATVLNGFGK
SIGLVQVDELGVMETPIALTNTFSVGALAQAQIRAAIAENPEIGRAWPTVNPLVFECNDGYLNDIQAMAVQGMHYDSALA
AASVDVAQGAVGAGRGMSSFGVKGGIGTASRI-----AGGYTVGALVLSNFGTPDSLIYGGRLLGAALAG----------
----QLRQEIVPEKGSIIMIVATDAPLDARQLGRLSLRAGAGLARTGSVFGHGSGDIALAFSTAYTVPHLAD-VPMPAVQ
MVHETRLDPLFRAAADSVEQAIVNALWHGETVHGRDGHTRRALRELLQELMA-------------

>Ralstonia_pickettii_12D
------------MPLSLPHIGALPAGARDSISDVAGVTVGHATIAGGDIQTGVTVVRPHAGDPFLDKVPAASVVLNGFGK
SIGLVQVDELGVLETPIALTNTFAVGAVAQAQIRQAVAANPQIGRAWSTVNPLVFECNDGYLNDLQAFAVQDVHYDAAYA
AAAQAFEQGAVGAGRGMSSFGVKGGIGSASRVVTLADGAQRTVGALVLSNFGVTKNLTLGGRNVGAELASA---------
----LAAVTPEPEKGSIIMLLATDAPLDARQLRRLALRAGAGLARTGSVFGHGSGDIALAFSTAYTVPHEGAR-AMPAVA
MTHESHLDPLFQAAADSVEQAIVHALFRATAVTGRDGHTRRALTELI

Protein Domains

PROTOCOL

InterPro, default parameter are EBI


RESULTS ANALYSIS


The superfamily, Gene3D and HMMPfam algorithms predict with an excellent Evalue a domain from DmpA (L-aminopeptidase D-Ala-esterase/amidase) peptidase family S58.

RAW RESULTS
Sequence_1	0A9849B3B1FB1D35	270	superfamily	SSF56266	DmpA/ArgJ-like	10	266	3.3e-68	T	05-May-2010	IPR016117	Peptidase S58 DmpA/arginine biosynthesis protein ArgJ	
Sequence_1	0A9849B3B1FB1D35	270	Gene3D	G3DSA:3.60.70.12	no description	30	248	4.4e-64	T	05-May-2010	IPR005321	Peptidase S58, DmpA	
Sequence_1	0A9849B3B1FB1D35	270	HMMPfam	PF03576	Peptidase_S58	21	248	4.4e-82	T	05-May-2010	IPR005321	Peptidase S58, DmpA	

Phylogeny

PROTOCOL

Phylogeny.fr / PhyML method / no bootstrap / default substitution model / out group: bacteria from other clade than Burkholderia cepacia complex


RESULTS ANALYSIS

The phylogenetic tree of the gene of the peptidase S58 DmpA family, is perfectly consistent with what we know about about bacteria phylogeny, the Burkholderia form an independant cluster and more specifically the Burkholderia cepacia complex form an independant cluster. Despite the sequence "GOS_1586030" has a very high identity with Burkholderia_sp._383, the tree can not cluster the sequence with Burkholderia_sp._383 with a very high certainy, but we can say with an high certainty that "GOS_1586030" Burkholderia cepacia complex clade.

The additional tree was performed with the same sequences but without the cystein at the position 86, and we get exactly the same result.

RAW RESULTS
                                                                                                   ------0.05----
 
                          +------------------Burkholderia_pseudomallei_BCC215
                          |
                          |                                 +Burkholderia_multivorans_CGD2M
                          |                                 |
                       +--+                                 |                   +My_sequence
                       |  |                                 |                   |
                       |  |                                 |                   |Burkholderia_sp._383
                       |  |                                 |                   |
                       |  +---------------------------------+                 +-+
                       |                                    |                 | |----------Burkholderia_vietnamiensis_G4
                       |                                    |                 | |
                       |                                    |                 | |  +Burkholderia_ambifaria_IOP40-10
                       |                                    |                 | +--+
                       |                                    |                 |    |Burkholderia_ambifaria_MC40-6
                       |                                    +-----------------+    |
                       |                                                      |    +--Burkholderia_ambifaria_AMMD
                       |                                                      |
                       |                                                      |Burkholderia_cenocepacia_J2315
 +---------------------+                                                      |
 |                     |                                                      |Burkholderia_cenocepacia_PC184
 |                     |                                                      |
 |                     |                                                      |Burkholderia_cenocepacia_AU_1054
 |                     |                                                      |
 |                     |                                                      |
 |                     |                                                      +Burkholderia_cenocepacia_MC0-3
 |                     |
 |                     |                                                   +-----Burkholderia_sp._CCGE1001
 |                     |                                      +------------+
 |                     |                             +--------+            +---Burkholderia_graminis_C4D1M
 |                     |                             |        |
 |                     |                   +---------+        +Burkholderia_sp._CCGE1002
 |                     |                   |         |
 |                     +-------------------+         +------------------Burkholderia_phytofirmans_PsJN
 |                                         |
 |                                         +-------------------Burkholderia_phymatum_STM815
 |
 |
 |                          +--------------------------------------------------------------Polaromonas_sp._JS666
 |       +------------------+
 |       |                  +----------Ralstonia_pickettii_12D
 +-------+
         |         +------------------Cupriavidus_metallidurans_CH34
         +---------+
                   +----------------------------------------------------Bordetella_petrii_DSM_12804

Taxonomy report

PROTOCOL

Take the taxonomy report from the result of NCBI blast


RESULTS ANALYSIS

The tree performed from the blast results shows that the majority of the sequences matched belong to the beta-proteobacteria, and Burkholderia species are especially overrepresented. To verify this results I performed a first tree, select all the sequences of Burkholderia as ingroup and sequences from Beta-proteobacteria which are not belonging to Burkholderia as outgroup. The sequence "GOS_1586030" seems to be cluster with a specific clade of Burkholderia, the Burkholderia cepacia complex, thus I took as ingroup the species from Burkholderia cepacia complex and as outgroup other species of Burkholderia and other beta-proteobacteria with a good Evalue.


Ingroug:

-Burkholderia sp. 383 [Burkholderia cepacia complex]

-Burkholderia cenocepacia MC0-3 [Burkholderia cepacia complex]

- Burkholderia cenocepacia AU 1054 [Burkholderia cepacia complex]

- Burkholderia cenocepacia HI2424 [Burkholderia cepacia complex]

- Burkholderia cenocepacia J2315 [Burkholderia cepacia complex]

-Burkholderia cenocepacia PC184 [Burkholderia cepacia complex]

-Burkholderia ambifaria IOP40-10 [Burkholderia cepacia complex]

-Burkholderia ambifaria AMMD [Burkholderia cepacia complex]

- Burkholderia ambifaria MC40-6 [Burkholderia cepacia complex]

-Burkholderia vietnamiensis G4 [Burkholderia cepacia complex]

-Burkholderia multivorans CGD2M [Burkholderia cepacia complex]



Outgroup:

- Burkholderia sp. CCGE1002 [Burkholderia

-Burkholderia sp. H160 [Burkholderia]

-Burkholderia xenovorans LB400 [Burkholderia]

-Burkholderia graminis C4D1M [Burkholderia]

-Burkholderia sp. CCGE1001 [Burkholderia]

-Burkholderia phytofirmans PsJN [Burkholderia

-Burkholderia pseudomallei BCC215 [Burkholderia]

-Burkholderia pseudomallei 1106b [Burkholderia]

-Cupriavidus metallidurans CH34 [Cupriavidus]

-Ralstonia pickettii 12D [Ralstonia]

-Acidovorax citrulli AAC00-1 [Comamonadaceae]

- Bordetella petrii DSM 12804 [Alcaligenaceae]

RAW RESULTS
cellular organisms ...................................................   293 hits  135 orgs [root]
. Bacteria ...........................................................   271 hits  125 orgs 
. . Proteobacteria ...................................................   234 hits  106 orgs 
. . . Burkholderiales ................................................   113 hits   54 orgs [Betaproteobacteria]
. . . . Burkholderiaceae .............................................    89 hits   40 orgs 
. . . . . Burkholderia ...............................................    69 hits   30 orgs 
. . . . . . Burkholderia cepacia complex .............................    30 hits   14 orgs 
. . . . . . . Burkholderia sp. 383 ...................................     2 hits    1 orgs 
. . . . . . . Burkholderia cenocepacia ...............................    10 hits    5 orgs 
. . . . . . . . Burkholderia cenocepacia MC0-3 .......................     2 hits    1 orgs 
. . . . . . . . Burkholderia cenocepacia AU 1054 .....................     2 hits    1 orgs 
. . . . . . . . Burkholderia cenocepacia HI2424 ......................     2 hits    1 orgs 
. . . . . . . . Burkholderia cenocepacia J2315 .......................     2 hits    1 orgs 
. . . . . . . . Burkholderia cenocepacia PC184 .......................     2 hits    1 orgs 
. . . . . . . Burkholderia ambifaria .................................     6 hits    3 orgs 
. . . . . . . . Burkholderia ambifaria IOP40-10 ......................     2 hits    1 orgs 
. . . . . . . . Burkholderia ambifaria AMMD ..........................     2 hits    1 orgs 
. . . . . . . . Burkholderia ambifaria MC40-6 ........................     2 hits    1 orgs 
. . . . . . . Burkholderia vietnamiensis G4 ..........................     2 hits    1 orgs [Burkholderia vietnamiensis]
. . . . . . . Burkholderia multivorans ...............................    10 hits    4 orgs 
. . . . . . . . Burkholderia multivorans CGD2M .......................     2 hits    1 orgs 
. . . . . . . . Burkholderia multivorans CGD2 ........................     2 hits    1 orgs 
. . . . . . . . Burkholderia multivorans CGD1 ........................     2 hits    1 orgs 
. . . . . . . . Burkholderia multivorans ATCC 17616 ..................     4 hits    1 orgs 
. . . . . . Burkholderia sp. CCGE1002 ................................     2 hits    1 orgs 
. . . . . . Burkholderia phymatum STM815 .............................     2 hits    1 orgs [Burkholderia phymatum]
. . . . . . Burkholderia sp. CCGE1003 ................................     2 hits    1 orgs 
. . . . . . Burkholderia sp. H160 ....................................     2 hits    1 orgs 
. . . . . . Burkholderia xenovorans LB400 ............................     2 hits    1 orgs [Burkholderia xenovorans]
. . . . . . Burkholderia graminis C4D1M ..............................     2 hits    1 orgs [Burkholderia graminis]
. . . . . . Burkholderia sp. CCGE1001 ................................     2 hits    1 orgs 
. . . . . . Burkholderia phytofirmans PsJN ...........................     2 hits    1 orgs [Burkholderia phytofirmans]
. . . . . . pseudomallei group .......................................    23 hits    8 orgs 
. . . . . . . Burkholderia oklahomensis EO147 ........................     1 hits    1 orgs [Burkholderia oklahomensis]
. . . . . . . Burkholderia pseudomallei ..............................    22 hits    7 orgs 
. . . . . . . . Burkholderia pseudomallei BCC215 .....................     1 hits    1 orgs 
. . . . . . . . Burkholderia pseudomallei S13 ........................     4 hits    1 orgs 
. . . . . . . . Burkholderia pseudomallei 1106a ......................     4 hits    1 orgs 
. . . . . . . . Burkholderia pseudomallei 1106b ......................     4 hits    1 orgs 
. . . . . . . . Burkholderia pseudomallei 1710b ......................     4 hits    1 orgs 
. . . . . . . . Burkholderia pseudomallei 1710a ......................     4 hits    1 orgs 
. . . . . . . . Burkholderia pseudomallei B7210 ......................     1 hits    1 orgs 
. . . . . Cupriavidus ................................................     8 hits    4 orgs 
. . . . . . Cupriavidus metallidurans CH34 ...........................     2 hits    1 orgs [Cupriavidus metallidurans]
. . . . . . Ralstonia eutropha JMP134 ................................     2 hits    1 orgs [Cupriavidus pinatubonensis]
. . . . . . Ralstonia eutropha H16 ...................................     2 hits    1 orgs [Cupriavidus necator]
. . . . . . Cupriavidus taiwanensis ..................................     2 hits    1 orgs 
. . . . . Ralstonia ..................................................    12 hits    6 orgs 
. . . . . . Ralstonia pickettii ......................................     4 hits    2 orgs 
. . . . . . . Ralstonia pickettii 12D ................................     2 hits    1 orgs 
. . . . . . . Ralstonia pickettii 12J ................................     2 hits    1 orgs 
. . . . . . Ralstonia solanacearum ...................................     8 hits    4 orgs 
. . . . . . . Ralstonia solanacearum GMI1000 .........................     2 hits    1 orgs 
. . . . . . . Ralstonia solanacearum UW551 ...........................     2 hits    1 orgs 
. . . . . . . Ralstonia solanacearum IPO1609 .........................     2 hits    1 orgs 
. . . . . . . Ralstonia solanacearum MolK2 ...........................     2 hits    1 orgs 
. . . . Comamonadaceae ...............................................    12 hits    6 orgs 
. . . . . Polaromonas sp. JS666 ......................................     2 hits    1 orgs [Polaromonas]
. . . . . Rhodoferax ferrireducens T118 ..............................     2 hits    1 orgs [Rhodoferax; Rhodoferax ferrireducens]
. . . . . Acidovorax .................................................     4 hits    2 orgs 
. . . . . . Acidovorax citrulli AAC00-1 ..............................     2 hits    1 orgs [Acidovorax citrulli]
. . . . . . Acidovorax avenae subsp. avenae ATCC 19860 ...............     2 hits    1 orgs [Acidovorax avenae; Acidovorax avenae subsp. avenae]
. . . . . Verminephrobacter eiseniae EF01-2 ..........................     2 hits    1 orgs [Verminephrobacter; Verminephrobacter eiseniae]
. . . . . Variovorax paradoxus S110 ..................................     2 hits    1 orgs [Variovorax; Variovorax paradoxus]
. . . . Alcaligenaceae ...............................................    12 hits    8 orgs 
. . . . . Bordetella .................................................    10 hits    7 orgs 
. . . . . . Bordetella petrii ........................................     2 hits    2 orgs 
. . . . . . . Bordetella petrii DSM 12804 ............................     1 hits    1 orgs 
. . . . . . Bordetella pertussis Tohama I ............................     2 hits    1 orgs [Bordetella pertussis]
. . . . . . Bordetella bronchiseptica RB50 ...........................     2 hits    1 orgs [Bordetella bronchiseptica]
. . . . . . Bordetella parapertussis .................................     2 hits    2 orgs 
. . . . . . . Bordetella parapertussis 12822 .........................     1 hits    1 orgs 
. . . . . . Bordetella avium 197N ....................................     2 hits    1 orgs [Bordetella avium]
. . . . . Achromobacter piechaudii ATCC 43553 ........................     2 hits    1 orgs [Achromobacter; Achromobacter piechaudii]
. . . Alphaproteobacteria ............................................   102 hits   42 orgs 
. . . . Rhizobiales ..................................................    92 hits   37 orgs 
. . . . . Methylobacterium radiotolerans JCM 2831 ....................     2 hits    1 orgs [Methylobacteriaceae; Methylobacterium; Methylobacterium radiotolerans]
. . . . . Azorhizobium caulinodans ORS 571 ...........................     2 hits    1 orgs [Xanthobacteraceae; Azorhizobium; Azorhizobium caulinodans]
. . . . . Brucellaceae ...............................................    86 hits   34 orgs 
. . . . . . Ochrobactrum .............................................     4 hits    2 orgs 
. . . . . . . Ochrobactrum anthropi ATCC 49188 .......................     2 hits    1 orgs [Ochrobactrum anthropi]
. . . . . . . Ochrobactrum intermedium LMG 3301 ......................     2 hits    1 orgs [Ochrobactrum intermedium]
. . . . . . Brucella .................................................    82 hits   32 orgs 
. . . . . . . Brucella suis ..........................................    12 hits    5 orgs 
. . . . . . . . Brucella suis 1330 ...................................     2 hits    1 orgs 
. . . . . . . . Brucella suis bv. 3 str. 686 .........................     3 hits    1 orgs 
. . . . . . . . Brucella suis bv. 4 str. 40 ..........................     2 hits    1 orgs 
. . . . . . . . Brucella suis ATCC 23445 .............................     2 hits    1 orgs [Brucella suis bv. 2]
. . . . . . . . Brucella suis bv. 5 str. 513 .........................     3 hits    1 orgs 
. . . . . . . Brucella canis ATCC 23365 ..............................     2 hits    1 orgs [Brucella canis]
. . . . . . . Brucella neotomae 5K33 .................................     3 hits    1 orgs [Brucella neotomae]
. . . . . . . Brucella melitensis ....................................    14 hits    5 orgs 
. . . . . . . . Brucella melitensis bv. 1 ............................     7 hits    2 orgs 
. . . . . . . . . Brucella melitensis bv. 1 str. 16M .................     4 hits    1 orgs 
. . . . . . . . . Brucella melitensis bv. 1 str. Rev.1 ...............     3 hits    1 orgs 
. . . . . . . . Brucella melitensis bv. 2 ............................     4 hits    2 orgs 
. . . . . . . . . Brucella melitensis ATCC 23457 .....................     2 hits    1 orgs 
. . . . . . . . . Brucella melitensis bv. 2 str. 63/9 ................     2 hits    1 orgs 
. . . . . . . . Brucella melitensis bv. 3 str. Ether .................     3 hits    1 orgs [Brucella melitensis bv. 3]
. . . . . . . Brucella abortus .......................................    22 hits    9 orgs 
. . . . . . . . Brucella abortus bv. 1 str. 9-941 ....................     2 hits    1 orgs [Brucella abortus bv. 1]
. . . . . . . . Brucella melitensis biovar Abortus 2308 ..............     2 hits    1 orgs 
. . . . . . . . Brucella abortus S19 .................................     2 hits    1 orgs 
. . . . . . . . Brucella abortus str. 2308 A .........................     2 hits    1 orgs 
. . . . . . . . Brucella abortus bv. 6 str. 870 ......................     3 hits    1 orgs 
. . . . . . . . Brucella abortus bv. 2 str. 86/8/59 ..................     3 hits    1 orgs [Brucella abortus bv. 2]
. . . . . . . . Brucella abortus bv. 4 str. 292 ......................     3 hits    1 orgs [Brucella abortus bv. 4]
. . . . . . . . Brucella abortus bv. 9 str. C68 ......................     3 hits    1 orgs 
. . . . . . . . Brucella abortus NCTC 8038 ...........................     2 hits    1 orgs 
. . . . . . . Brucella ovis ATCC 25840 ...............................     2 hits    1 orgs [Brucella ovis]
. . . . . . . Brucella ceti ..........................................    11 hits    4 orgs 
. . . . . . . . Brucella ceti str. Cudo ..............................     2 hits    1 orgs 
. . . . . . . . Brucella ceti M644/93/1 ..............................     3 hits    1 orgs 
. . . . . . . . Brucella ceti M13/05/1 ...............................     3 hits    1 orgs 
. . . . . . . . Brucella ceti B1/94 ..................................     3 hits    1 orgs 
. . . . . . . Brucella pinnipedialis .................................     9 hits    3 orgs 
. . . . . . . . Brucella pinnipedialis M163/99/10 ....................     3 hits    1 orgs 
. . . . . . . . Brucella pinnipedialis B2/94 .........................     3 hits    1 orgs 
. . . . . . . . Brucella pinnipedialis M292/94/1 .....................     3 hits    1 orgs 
. . . . . . . Brucella microti CCM 4915 ..............................     2 hits    1 orgs [Brucella microti]
. . . . . . . Brucella sp. F5/99 .....................................     3 hits    1 orgs 
. . . . . . . Brucella sp. NVSL 07-0026 ..............................     2 hits    1 orgs 
. . . . . Mesorhizobium loti MAFF303099 ..............................     2 hits    1 orgs [Phyllobacteriaceae; Mesorhizobium; Mesorhizobium loti]
. . . . Rhodobacteraceae .............................................     6 hits    3 orgs [Rhodobacterales]
. . . . . Labrenzia ..................................................     4 hits    2 orgs 
. . . . . . Labrenzia alexandrii DFL-11 ..............................     2 hits    1 orgs [Labrenzia alexandrii]
. . . . . . Labrenzia aggregata IAM 12614 ............................     2 hits    1 orgs [Labrenzia aggregata]
. . . . . Pseudovibrio sp. JE062 .....................................     2 hits    1 orgs [Pseudovibrio]
. . . . Azospirillum sp. B510 ........................................     2 hits    1 orgs [Rhodospirillales; Rhodospirillaceae; Azospirillum]
. . . . alpha proteobacterium BAL199 .................................     2 hits    1 orgs [unclassified Alphaproteobacteria; unclassified Alphaproteobacteria (miscellaneous)]
. . . Gammaproteobacteria ............................................    19 hits   10 orgs 
. . . . Enterobacteriaceae ...........................................    17 hits    9 orgs [Enterobacteriales]
. . . . . Dickeya ....................................................     6 hits    3 orgs 
. . . . . . Dickeya dadantii .........................................     4 hits    2 orgs 
. . . . . . . Dickeya dadantii Ech703 ................................     2 hits    1 orgs 
. . . . . . . Dickeya dadantii Ech586 ................................     2 hits    1 orgs 
. . . . . . Dickeya zeae Ech1591 .....................................     2 hits    1 orgs [Dickeya zeae]
. . . . . Pectobacterium .............................................     7 hits    4 orgs 
. . . . . . Pectobacterium wasabiae WPP163 ...........................     2 hits    1 orgs [Pectobacterium wasabiae]
. . . . . . Pectobacterium atrosepticum SCRI1043 .....................     2 hits    1 orgs [Pectobacterium atrosepticum]
. . . . . . Pectobacterium carotovorum ...............................     3 hits    2 orgs 
. . . . . . . Pectobacterium carotovorum subsp. carotovorum PC1 ......     2 hits    1 orgs [Pectobacterium carotovorum subsp. carotovorum]
. . . . . . . Pectobacterium carotovorum subsp. brasiliensis PBR1692 .     1 hits    1 orgs [Pectobacterium carotovorum subsp. brasiliensis]
. . . . . Pantoea ....................................................     4 hits    2 orgs 
. . . . . . Pantoea ananatis LMG 20103 ...............................     2 hits    1 orgs [Pantoea ananatis]
. . . . . . Pantoea sp. At-9b ........................................     2 hits    1 orgs 
. . . . Marinomonas sp. MED121 .......................................     2 hits    1 orgs [Oceanospirillales; Oceanospirillaceae; Marinomonas]
. . Firmicutes .......................................................    24 hits   13 orgs 
. . . Clostridiales ..................................................    10 hits    6 orgs [Clostridia]
. . . . Clostridiaceae ...............................................     4 hits    2 orgs 
. . . . . Alkaliphilus metalliredigens QYMF ..........................     2 hits    1 orgs [Alkaliphilus; Alkaliphilus metalliredigens]
. . . . . Clostridium sp. 7_2_43FAA ..................................     2 hits    1 orgs [Clostridium]
. . . . Faecalibacterium prausnitzii .................................     6 hits    4 orgs [Ruminococcaceae; Faecalibacterium]
. . . . . Faecalibacterium prausnitzii M21/2 .........................     2 hits    1 orgs 
. . . . . Faecalibacterium prausnitzii A2-165 ........................     2 hits    1 orgs 
. . . . . Faecalibacterium prausnitzii SL3/3 .........................     1 hits    1 orgs 
. . . . . Faecalibacterium prausnitzii L2-6 ..........................     1 hits    1 orgs 
. . . Bacilli ........................................................    14 hits    7 orgs 
. . . . Lactobacillales ..............................................     6 hits    3 orgs 
. . . . . Oenococcus oeni ............................................     4 hits    2 orgs [Leuconostocaceae; Oenococcus]
. . . . . . Oenococcus oeni ATCC BAA-1163 ............................     2 hits    1 orgs 
. . . . . . Oenococcus oeni PSU-1 ....................................     2 hits    1 orgs 
. . . . . Lactobacillus brevis subsp. gravesensis ATCC 27305 .........     2 hits    1 orgs [Lactobacillaceae; Lactobacillus; Lactobacillus brevis; Lactobacillus brevis subsp. gravesensis]
. . . . Bacillaceae ..................................................     8 hits    4 orgs [Bacillales]
. . . . . Geobacillus ................................................     6 hits    3 orgs 
. . . . . . Geobacillus kaustophilus HTA426 ..........................     2 hits    1 orgs [Geobacillus kaustophilus]
. . . . . . Geobacillus sp. Y412MC52 .................................     2 hits    1 orgs 
. . . . . . Geobacillus sp. Y412MC61 .................................     2 hits    1 orgs 
. . . . . Bacillus cellulosilyticus DSM 2522 .........................     2 hits    1 orgs [Bacillus; Bacillus cellulosilyticus]
. . Synergistaceae ...................................................     6 hits    3 orgs [Synergistetes; Synergistia; Synergistales]
. . . Dethiosulfovibrio peptidovorans DSM 11002 ......................     2 hits    1 orgs [Dethiosulfovibrio; Dethiosulfovibrio peptidovorans]
. . . Pyramidobacter piscolens W5455 .................................     2 hits    1 orgs [Pyramidobacter; Pyramidobacter piscolens]
. . . Jonquetella anthropi E3_33 E1 ..................................     2 hits    1 orgs [Jonquetella; Jonquetella anthropi]
. . Fusobacterium ....................................................     3 hits    2 orgs [Fusobacteria; Fusobacteria (class); Fusobacteriales; Fusobacteriaceae]
. . . Fusobacterium varium ATCC 27725 ................................     2 hits    1 orgs [Fusobacterium varium]
. . . Fusobacterium ulcerans ATCC 49185 ..............................     1 hits    1 orgs [Fusobacterium ulcerans]
. . Sphaerobacter thermophilus DSM 20745 .............................     4 hits    1 orgs [Chloroflexi; Thermomicrobia (class); Sphaerobacteridae; Sphaerobacterales; Sphaerobacterineae; Sphaerobacteraceae; Sphaerobacter; Sphaerobacter thermophilus]
. Thermococcaceae ....................................................    22 hits   10 orgs [Archaea; Euryarchaeota; Thermococci; Thermococcales]
. . Pyrococcus .......................................................    10 hits    4 orgs 
. . . Pyrococcus furiosus DSM 3638 ...................................     2 hits    1 orgs [Pyrococcus furiosus]
. . . Pyrococcus horikoshii ..........................................     6 hits    2 orgs 
. . . . Pyrococcus horikoshii OT3 ....................................     2 hits    1 orgs 
. . . Pyrococcus abyssi GE5 ..........................................     2 hits    1 orgs [Pyrococcus abyssi]
. . Thermococcus .....................................................    12 hits    6 orgs 
. . . Thermococcus barophilus MP .....................................     2 hits    1 orgs [Thermococcus barophilus]
. . . Thermococcus kodakarensis KOD1 .................................     2 hits    1 orgs [Thermococcus kodakarensis]
. . . Thermococcus gammatolerans EJ3 .................................     2 hits    1 orgs [Thermococcus gammatolerans]
. . . Thermococcus onnurineus NA1 ....................................     2 hits    1 orgs [Thermococcus onnurineus]
. . . Thermococcus sibiricus MM 739 ..................................     2 hits    1 orgs [Thermococcus sibiricus]
. . . Thermococcus sp. AM4 ...........................................     2 hits    1 orgs 

BLAST

PROTOCOL

BLASTp versus NR, NCBI default parameters

BLASTn versus NR, NCBI default parameters


RESULTS ANALYSIS


We see with the Blastn that the cysteine at position 86 is really likely to be an insertion. Indeed when one translate this sequence without the cysteine at the position 86 the alignement is very good all along the sequence. In the original sequence, we can see despite the frameshift mutation at the beginning, the sequence match with some sequences with a very good Evalue. The first hits show an almost perfect alignment, consequently one can say that this sequence certainly belong to Burkholderia. All the sequences match with the blast belong to the peptidase S58 DmpA family, which is a confirmation of the preotein prediction domain.



RAW RESULTS

>gb|CP000152.1| Burkholderia sp. 383 chromosome 2, complete sequence
Length=3587082

 Features in this part of subject sequence:
   D-aminopeptidase DppA. Metallo peptidase. MEROPS family M55
   aminopeptidase DmpA. Serine peptidase. MEROPS family S58

 Score = 1219 bits (660),  Expect = 0.0
 Identities = 764/814 (93%), Gaps = 7/814 (0%)
 Strand=Plus/Minus

Query  3        GGCGTCGGTGCCGTCGCGCAGGCGCAGATCCGCGCGGCGATCGCGGCGAAT-CGCGGA-T  60
                |||||||| || ||||||||||||||||| ||||||||||||||||| ||| |||  | |
Sbjct  2133908  GGCGTCGGCGCGGTCGCGCAGGCGCAGATTCGCGCGGCGATCGCGGCCAATCCGC-AAGT  2133850

Query  61       CGGGCCGCGACTGGTCGACCGTCAACCCCGCTCGTGTTCGAGTGCAACGACGGCTATCTG  120
                | ||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||
Sbjct  2133849  C-GGCCGCGACTGGTCGACCGTCAA-CCCGCTCGTGTTCGAGTGCAACGACGGCTATCTG  2133792

Query  121      AACGATATCCAGGCGTTCGCGGTTacggccgcgcattacgacgacgcgtgccgcgcggcg  180
                ||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||| 
Sbjct  2133791  AACGATATCCAGGCGTTCGCGGTCACGGCCGCGCATTACGACGACGCGTGCCGCGCGGCA  2133732

Query  181      tcgcgcgacgtcgcacgcggcgcggtgggcgccgggcgcggGATGTCGAGCTTCGACCTG  240
                ||||| ||||||||||| |||||||||||||| |||||||||||||||||||||||||||
Sbjct  2133731  TCGCGTGACGTCGCACGTGGCGCGGTGGGCGCTGGGCGCGGGATGTCGAGCTTCGACCTG  2133672

Query  241      AAGGGCGGGATCGGTTCGGCGTCGCGCGTTGCCGTCGCGGCGGGGCGGCCCTATACGGTC  300
                || ||||||||||||||||||||||| || || || ||||| ||||||||||||||||||
Sbjct  2133671  AAAGGCGGGATCGGTTCGGCGTCGCGTGTCGCTGTTGCGGCCGGGCGGCCCTATACGGTC  2133612

Query  301      GGCGCGCTCGTGCTCGCGAATTTCGGCCGGCTGCCGATGCTGACGCTCGGCGGCGTGCCG  360
                ||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||
Sbjct  2133611  GGCGCGCTCGTGCTCGCGAATTTCGGCCGGCTGCCGATGTTGACGCTCGGCGGCGTGCCG  2133552

Query  361      GTCGGGC-GCATCGTCGCGCAACGGCGTGCGGCCGAGGCCGCGCATGTGGCGCCGCCGGA  419
                ||||||| | ||||||||||||||||| || |||||||||||||||| ||| ||||| ||
Sbjct  2133551  GTCGGGCAG-ATCGTCGCGCAACGGCGCGCAGCCGAGGCCGCGCATGCGGCACCGCCCGA  2133493

Query  420      GCAAGGATCGATCATCCTGCTGCTGGCTACCGAcgcgccgctcgacgcgcggcaattgtc  479
                ||| || |||||||||||| ||||||| ||||||||||||||||| || |||||| ||||
Sbjct  2133492  GCAGGGCTCGATCATCCTGTTGCTGGCCACCGACGCGCCGCTCGATGCACGGCAACTGTC  2133433

Query  480      gcggctcgcgcgccgcgcAGGTGCGGGGCTGGCTCGCACGGGCTCGGTCTACGGGCACGG  539
                |||||||||||| ||||| |||||||||||||| |||||||||||||| |||||||||||
Sbjct  2133432  GCGGCTCGCGCGTCGCGCGGGTGCGGGGCTGGCCCGCACGGGCTCGGTTTACGGGCACGG  2133373

Query  540      CAGCGGCGACATCGCGCTCGCATTTTCCACTGCATATACGATCGCGCACGACGCATCGAC  599
                |||||||||||||||||||||||||||||| ||||| |||||||||||||||||||||||
Sbjct  2133372  CAGCGGCGACATCGCGCTCGCATTTTCCACCGCATACACGATCGCGCACGACGCATCGAC  2133313

Query  600      CATCGCGCTGCCGGCCCTCGTCGCCGACGCGGCGCTCGATCCGCTGTTCATGGCCGCGGC  659
                ||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||
Sbjct  2133312  CATCGCGCTGCCGGCCCTCGTCGCCGATGCGGCGCTCGATCCGCTGTTCATGGCCGCGGC  2133253

Query  660      CGAAAGCGTCGAGCATGCGATCGCCGACGCGCTGCTGCAGGCCGTGACGGTGGCCGGGCG  719
                |||||| |||||||| || || ||||||||||||||||||||||||||||||||||||||
Sbjct  2133252  CGAAAGTGTCGAGCACGCCATTGCCGACGCGCTGCTGCAGGCCGTGACGGTGGCCGGGCG  2133193

Query  720      CGACGGCCACGTGCGGCAATCGCTGCGCGATGCGGTGCCCGACCTCGATCGCCTGTTCAA  779
                |||||||||||||||||||||||||||||| ||||||||||| |||||||||||||||||
Sbjct  2133192  CGACGGCCACGTGCGGCAATCGCTGCGCGACGCGGTGCCCGATCTCGATCGCCTGTTCAA  2133133

Query  780      CGAAGGCCACGAAGGACGTCTTATCCAGTCATGA  813
                ||||||||||||||||||||||| ||||||||||
Sbjct  2133132  CGAAGGCCACGAAGGACGTCTTACCCAGTCATGA  2133099


Aligenement of the protein sequence without the cysteine at the position 86.
>ref|YP_372622.1| aminopeptidase DmpA [Burkholderia sp. 383]
 gb|ABB11978.1| aminopeptidase DmpA. Serine peptidase. MEROPS family S58 [Burkholderia 
sp. 383]
Length=360

 Score =  460 bits (1184),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 264/270 (97%), Positives = 265/270 (98%), Gaps = 0/270 (0%)

Query  1    FGVGAVAQAQIRAAIAANRGSGRDWSTVNPLVFECNDGYLNDIQAFAVTAAHYDDACRAA  60
            FGVGAVAQAQIRAAIAAN   GRDWSTVNPLVFECNDGYLNDIQAFAVTAAHYDDACRAA
Sbjct  91   FGVGAVAQAQIRAAIAANPQVGRDWSTVNPLVFECNDGYLNDIQAFAVTAAHYDDACRAA  150

Query  61   SRDVARGAVGAGRGMSSFDLKGGIGSASRVAVAAGRPYTVGALVLANFGRLPMLTLGGVP  120
            SRDVARGAVGAGRGMSSFDLKGGIGSASRVAVAAGRPYTVGALVLANFGRLPMLTLGGVP
Sbjct  151  SRDVARGAVGAGRGMSSFDLKGGIGSASRVAVAAGRPYTVGALVLANFGRLPMLTLGGVP  210

Query  121  VGRIVAQRRAAEAAHVAPPEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHG  180
            VG+IVAQRRAAEAAH APPEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHG
Sbjct  211  VGQIVAQRRAAEAAHAAPPEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHG  270

Query  181  SGDIALAFSTAYTIAHDASTIALPALVADAALDPLFMAAAESVEHAIADALLQAVTVAGR  240
            SGDIALAFSTAYTIAHDASTIALPALVADAALDPLFMAAAESVEHAIADALLQAVTVAGR
Sbjct  271  SGDIALAFSTAYTIAHDASTIALPALVADAALDPLFMAAAESVEHAIADALLQAVTVAGR  330

Query  241  DGHVRQSLRDAVPDLDRLFNEGHEGRLIQS  270
            DGHVRQSLRDAVPDLDRLFNEGHEGRL QS
Sbjct  331  DGHVRQSLRDAVPDLDRLFNEGHEGRLTQS  360


Aligenement of the original protein sequence /(with the cysteine at the position 86).


>ref|YP_372622.1| aminopeptidase DmpA [Burkholderia sp. 383]
 gb|ABB11978.1| aminopeptidase DmpA. Serine peptidase. MEROPS family S58 [Burkholderia 
sp. 383]
Length=360

 Score =  467 bits (1201),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 238/242 (98%), Positives = 239/242 (98%), Gaps = 0/242 (0%)

Query  29   TPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSSFDLKGGIGSAS  88
             PLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSSFDLKGGIGSAS
Sbjct  119  NPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSSFDLKGGIGSAS  178

Query  89   RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGRIVAQRRAAEAAHVAPPEQGSIILLL  148
            RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVG+IVAQRRAAEAAH APPEQGSIILLL
Sbjct  179  RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGQIVAQRRAAEAAHAAPPEQGSIILLL  238

Query  149  ATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPALVA  208
            ATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPALVA
Sbjct  239  ATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPALVA  298

Query  209  DAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPDLDRLFNEGHEGRLI  268
            DAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPDLDRLFNEGHEGRL 
Sbjct  299  DAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPDLDRLFNEGHEGRLT  358

Query  269  QS  270
            QS
Sbjct  359  QS  360


>ref|YP_001776995.1| peptidase S58 DmpA [Burkholderia cenocepacia MC0-3]
 gb|ACA92505.1| peptidase S58 DmpA [Burkholderia cenocepacia MC0-3]
Length=360

 Score =  431 bits (1107),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)

Query  29   TPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSSFDLKGGIGSAS  88
             PLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMS FDLKGGIGSAS
Sbjct  119  NPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSCFDLKGGIGSAS  178

Query  89   RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGRIVAQRRAAEAAHVAPPEQGSIILLL  148
            RVAVAAGRPYTVGALVLANFGRLPMLTLGGVP+GRIVAQRRAAEAA  APPEQGSIILLL
Sbjct  179  RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPLGRIVAQRRAAEAARAAPPEQGSIILLL  238

Query  149  ATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPALVA  208
            ATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPALVA
Sbjct  239  ATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPALVA  298

Query  209  DAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPDLDRLFNEGHEGRLI  268
            DAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQ+LRDAVPDLDRLF+E +EG L 
Sbjct  299  DAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQALRDAVPDLDRLFHEDNEGHLT  358

Query  269  QS  270
            QS
Sbjct  359  QS  360


>ref|YP_624059.1| peptidase S58, DmpA [Burkholderia cenocepacia AU 1054]
 ref|YP_837795.1| peptidase S58, DmpA [Burkholderia cenocepacia HI2424]
 gb|ABF79086.1| aminopeptidase DmpA. Serine peptidase. MEROPS family S58 [Burkholderia 
cenocepacia AU 1054]
 gb|ABK10902.1| aminopeptidase DmpA. Serine peptidase. MEROPS family S58 [Burkholderia 
cenocepacia HI2424]
Length=360

 Score =  430 bits (1106),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 234/242 (96%), Gaps = 0/242 (0%)

Query  29   TPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSSFDLKGGIGSAS  88
             PLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMS FDLKGGIGSAS
Sbjct  119  NPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSCFDLKGGIGSAS  178

Query  89   RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGRIVAQRRAAEAAHVAPPEQGSIILLL  148
            RVAVAAGRPYTVGALVLANFGRLPMLTLGGVP+GRIVAQRRAAEAA  APPEQGSIILLL
Sbjct  179  RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPLGRIVAQRRAAEAARAAPPEQGSIILLL  238

Query  149  ATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPALVA  208
            ATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPALVA
Sbjct  239  ATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPALVA  298

Query  209  DAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPDLDRLFNEGHEGRLI  268
            DAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQ+LRDAVPDLDRLFNE +EG   
Sbjct  299  DAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQALRDAVPDLDRLFNEDNEGHPT  358

Query  269  QS  270
            QS
Sbjct  359  QS  360


>ref|YP_002233911.1| putative peptidase [Burkholderia cenocepacia J2315]
 emb|CAR55152.1| putative peptidase [Burkholderia cenocepacia J2315]
Length=360

 Score =  423 bits (1087),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 236/242 (97%), Gaps = 0/242 (0%)

Query  29   TPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSSFDLKGGIGSAS  88
             PLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMS FDLKGGIGSAS
Sbjct  119  NPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSCFDLKGGIGSAS  178

Query  89   RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGRIVAQRRAAEAAHVAPPEQGSIILLL  148
            RVAVAAGRPYTVGALVLANFGRLPMLTLGGVP+GRIVAQRRAAEAAH APPEQGSIILLL
Sbjct  179  RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPLGRIVAQRRAAEAAHAAPPEQGSIILLL  238

Query  149  ATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPALVA  208
            ATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPALVA
Sbjct  239  ATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPALVA  298

Query  209  DAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPDLDRLFNEGHEGRLI  268
            DAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQ+LRDAVPDLDRLFNE +EGR  
Sbjct  299  DAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQALRDAVPDLDRLFNEDNEGRST  358

Query  269  QS  270
            QS
Sbjct  359  QS  360


>ref|ZP_02889941.1| peptidase S58 DmpA [Burkholderia ambifaria IOP40-10]
 gb|EDT04470.1| peptidase S58 DmpA [Burkholderia ambifaria IOP40-10]
Length=360

 Score =  417 bits (1073),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 222/242 (91%), Positives = 229/242 (94%), Gaps = 0/242 (0%)

Query  29   TPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSSFDLKGGIGSAS  88
             PLVFECNDGYLNDIQAFAVTAAHYDDACR A+RD ARGAVGAGRGMS FDLKGGIGSAS
Sbjct  119  NPLVFECNDGYLNDIQAFAVTAAHYDDACRTAARDFARGAVGAGRGMSCFDLKGGIGSAS  178

Query  89   RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGRIVAQRRAAEAAHVAPPEQGSIILLL  148
            RVAVAAGRPYTVGALVLANFGRLPMLTLGGVP+GRIVAQR AA AA  A PEQGSIILLL
Sbjct  179  RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPLGRIVAQRHAAAAAQAAAPEQGSIILLL  238

Query  149  ATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPALVA  208
            ATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDAS++ALPALVA
Sbjct  239  ATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASSVALPALVA  298

Query  209  DAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPDLDRLFNEGHEGRLI  268
            DAALDPLFMAAAESVEHAIADALLQAVTV GRDGHVRQSLRDAVPDL+RLFN+ +EGR I
Sbjct  299  DAALDPLFMAAAESVEHAIADALLQAVTVVGRDGHVRQSLRDAVPDLERLFNDDNEGRHI  358

Query  269  QS  270
             S
Sbjct  359  PS  360


>ref|YP_775462.1| peptidase S58, DmpA [Burkholderia ambifaria AMMD]
 gb|ABI89128.1| aminopeptidase DmpA. Serine peptidase. MEROPS family S58 [Burkholderia 
ambifaria AMMD]
Length=360

 Score =  416 bits (1069),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 221/242 (91%), Positives = 228/242 (94%), Gaps = 0/242 (0%)

Query  29   TPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSSFDLKGGIGSAS  88
             PLVFECNDGYLNDIQAFAVTAAHYDDACR A+RD ARGAVGAGRGMS FDLKGGIGSAS
Sbjct  119  NPLVFECNDGYLNDIQAFAVTAAHYDDACRTAARDFARGAVGAGRGMSCFDLKGGIGSAS  178

Query  89   RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGRIVAQRRAAEAAHVAPPEQGSIILLL  148
            RVAVAAGRPYTVGALVLANFGRLPMLTLGGVP+GR+VAQR AA AA  A PEQGSIILLL
Sbjct  179  RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPLGRVVAQRHAAAAAQAAAPEQGSIILLL  238

Query  149  ATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPALVA  208
            A DAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDAST+ALPALVA
Sbjct  239  AIDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTLALPALVA  298

Query  209  DAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPDLDRLFNEGHEGRLI  268
            DAALDPLFMAAAESVEHAIADALLQAVTV GRDGHVRQSLRDAVPDL+RLFN+ +EGR I
Sbjct  299  DAALDPLFMAAAESVEHAIADALLQAVTVVGRDGHVRQSLRDAVPDLERLFNDDNEGRHI  358

Query  269  QS  270
             S
Sbjct  359  PS  360


>ref|YP_001810736.1| peptidase S58 DmpA [Burkholderia ambifaria MC40-6]
 gb|ACB66520.1| peptidase S58 DmpA [Burkholderia ambifaria MC40-6]
Length=360

 Score =  410 bits (1053),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 225/256 (87%), Positives = 236/256 (92%), Gaps = 3/256 (1%)

Query  18   IADRAATGR--PS-TPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRG  74
            IA+    GR  P+  PLVFECNDGYLNDIQAFAVTAAHYDDACR A+RD ARGAVGAGRG
Sbjct  105  IANNPQIGRDWPTVNPLVFECNDGYLNDIQAFAVTAAHYDDACRTAARDFARGAVGAGRG  164

Query  75   MSSFDLKGGIGSASRVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGRIVAQRRAAEAA  134
            MS FDLKGGIGSASRV VAAGRPYTVGALVLANFGRLPMLTLGGVP+GR+VAQ+RAA AA
Sbjct  165  MSCFDLKGGIGSASRVVVAAGRPYTVGALVLANFGRLPMLTLGGVPLGRVVAQQRAAAAA  224

Query  135  HVAPPEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTI  194
              A PEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTI
Sbjct  225  QAAAPEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTI  284

Query  195  AHDASTIALPALVADAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPD  254
            AHDAS++ALPALVADAALDPLFMAAAESVEHAIADALLQAVTV GRDGHVRQSLRDAVPD
Sbjct  285  AHDASSVALPALVADAALDPLFMAAAESVEHAIADALLQAVTVVGRDGHVRQSLRDAVPD  344

Query  255  LDRLFNEGHEGRLIQS  270
            L+RLFN+ +EGR I S
Sbjct  345  LERLFNDDYEGRHIPS  360


>ref|YP_001117145.1| aminopeptidase DmpA [Burkholderia vietnamiensis G4]
 gb|ABO57680.1| aminopeptidase DmpA. Serine peptidase. MEROPS family S58 [Burkholderia 
vietnamiensis G4]
Length=366

 Score =  403 bits (1036),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 211/243 (86%), Positives = 218/243 (89%), Gaps = 6/243 (2%)

Query  29   TPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSSFDLKGGIGSAS  88
             PLVFECNDGYLNDIQAFAVTAAHYD AC +ASRD ARGAVGAGRGMS FDLKGGIGSAS
Sbjct  119  NPLVFECNDGYLNDIQAFAVTAAHYDAACLSASRDFARGAVGAGRGMSCFDLKGGIGSAS  178

Query  89   RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGRIVAQRRA------AEAAHVAPPEQG  142
            RVAVAAGRPYTVGALVLANFGRLPMLTL GVPVG IVAQRRA      A+A     PEQG
Sbjct  179  RVAVAAGRPYTVGALVLANFGRLPMLTLAGVPVGCIVAQRRAVSCVSRAQATDATAPEQG  238

Query  143  SIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIA  202
            SII+LLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGD+ALAFSTAYTIAHDAST++
Sbjct  239  SIIVLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDLALAFSTAYTIAHDASTVS  298

Query  203  LPALVADAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPDLDRLFNEG  262
            LPALVADAALDPLFMAAAESVEHAI DALLQAVTV GRDGHVRQSLRDAV DLDRLF   
Sbjct  299  LPALVADAALDPLFMAAAESVEHAIVDALLQAVTVTGRDGHVRQSLRDAVNDLDRLFGGQ  358

Query  263  HEG  265
             +G
Sbjct  359  DDG  361


>ref|ZP_04941925.1| Peptidase S58 [Burkholderia cenocepacia PC184]
 gb|EAY65096.1| Peptidase S58 [Burkholderia cenocepacia PC184]
Length=238

 Score =  369 bits (947),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 192/201 (95%), Positives = 195/201 (97%), Gaps = 0/201 (0%)

Query  70   GAGRGMSSFDLKGGIGSASRVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGRIVAQRR  129
            GAGRGMS FDLKGGIGSASRVAVAAGRPYTVGALVLANFGRLPMLTLGGVP+GRIVAQRR
Sbjct  38   GAGRGMSCFDLKGGIGSASRVAVAAGRPYTVGALVLANFGRLPMLTLGGVPLGRIVAQRR  97

Query  130  AAEAAHVAPPEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFS  189
            AAEA H APPEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFS
Sbjct  98   AAEAVHAAPPEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFS  157

Query  190  TAYTIAHDASTIALPALVADAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLR  249
            TAYTIAHDASTIALPALVADAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQ+LR
Sbjct  158  TAYTIAHDASTIALPALVADAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQALR  217

Query  250  DAVPDLDRLFNEGHEGRLIQS  270
            DAVPDLDRLFNE +EG L QS
Sbjct  218  DAVPDLDRLFNEDNEGHLTQS  238


>ref|ZP_03569704.1| peptidase S58, DmpA [Burkholderia multivorans CGD2M]
 ref|ZP_03576345.1| peptidase S58, DmpA [Burkholderia multivorans CGD2]
 gb|EEE09688.1| peptidase S58, DmpA [Burkholderia multivorans CGD2]
 gb|EEE15611.1| peptidase S58, DmpA [Burkholderia multivorans CGD2M]
Length=357

 Score =  363 bits (933),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 204/234 (87%), Positives = 215/234 (91%), Gaps = 1/234 (0%)

Query  29   TPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSSFDLKGGIGSAS  88
             PLVFECNDGYLND+ AFA+  AHYD AC AASR+VARGAVGAGRGMS FDLKGGIGSAS
Sbjct  119  NPLVFECNDGYLNDLHAFAIAPAHYDAACAAASREVARGAVGAGRGMSCFDLKGGIGSAS  178

Query  89   RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGRIVAQRRAAEAAHVAPPEQGSIILLL  148
            RVA+AA RPYTVGALVLANFGRLPMLTLGGVPVGRIVA R+AA    VAPPEQGSII+L+
Sbjct  179  RVAIAAERPYTVGALVLANFGRLPMLTLGGVPVGRIVAARQAA-GEPVAPPEQGSIIMLV  237

Query  149  ATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPALVA  208
            ATDAPLDARQLSRLARRA AGLARTGSVYGHGSGDIALAFSTAYTIAHDA  +ALPALVA
Sbjct  238  ATDAPLDARQLSRLARRAAAGLARTGSVYGHGSGDIALAFSTAYTIAHDADYVALPALVA  297

Query  209  DAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPDLDRLFNEG  262
            DAALDPLFMAAA+SVE AIADALLQAVTV GRDGHVR++LRDAVPDLDRL NEG
Sbjct  298  DAALDPLFMAAADSVERAIADALLQAVTVVGRDGHVRRALRDAVPDLDRLLNEG  351


>ref|ZP_03585724.1| peptidase S58, DmpA [Burkholderia multivorans CGD1]
 gb|EEE00316.1| peptidase S58, DmpA [Burkholderia multivorans CGD1]
Length=357

 Score =  363 bits (933),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 205/234 (87%), Positives = 215/234 (91%), Gaps = 1/234 (0%)

Query  29   TPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSSFDLKGGIGSAS  88
             PLVFECNDGYLND+ AFA+  AHYD AC AASR+VARGAVGAGRGMS FDLKGGIGSAS
Sbjct  119  NPLVFECNDGYLNDLHAFAIAPAHYDAACAAASREVARGAVGAGRGMSCFDLKGGIGSAS  178

Query  89   RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGRIVAQRRAAEAAHVAPPEQGSIILLL  148
            RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGR VA R+AA    VA PEQGSII+L+
Sbjct  179  RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGRTVAARQAA-GEPVARPEQGSIIMLV  237

Query  149  ATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPALVA  208
            ATDAPLDARQLSRLARRA AGLARTGSVYGHGSGDIALAFSTAYTIAHDA  +ALPALVA
Sbjct  238  ATDAPLDARQLSRLARRAAAGLARTGSVYGHGSGDIALAFSTAYTIAHDADYVALPALVA  297

Query  209  DAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPDLDRLFNEG  262
            DAALDPLFMAAA+SVEHAIADALLQAVTV GRDGHVR++LRDAVPDLDRL NEG
Sbjct  298  DAALDPLFMAAADSVEHAIADALLQAVTVVGRDGHVRRALRDAVPDLDRLLNEG  351


>ref|YP_001584395.1| peptidase S58 DmpA [Burkholderia multivorans ATCC 17616]
 ref|YP_001948479.1| D-aminopeptidase [Burkholderia multivorans ATCC 17616]
 gb|ABX18103.1| peptidase S58 DmpA [Burkholderia multivorans ATCC 17616]
 dbj|BAG45943.1| D-aminopeptidase [Burkholderia multivorans ATCC 17616]
Length=357

 Score =  361 bits (927),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 203/234 (86%), Positives = 215/234 (91%), Gaps = 1/234 (0%)

Query  29   TPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSSFDLKGGIGSAS  88
             PLVFECNDGYLND+ AFA+  AHYD AC AASR+VARGAVGAGRGMS FDLKGGIGSAS
Sbjct  119  NPLVFECNDGYLNDLHAFAIAPAHYDAACAAASREVARGAVGAGRGMSCFDLKGGIGSAS  178

Query  89   RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGRIVAQRRAAEAAHVAPPEQGSIILLL  148
            RVA+AAGRPYTVGALVLANFGRLPMLTLGGVPVGRIVA R+AA    V  PEQGSII+L+
Sbjct  179  RVAIAAGRPYTVGALVLANFGRLPMLTLGGVPVGRIVAARQAA-GEPVVRPEQGSIIMLV  237

Query  149  ATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPALVA  208
            ATDAPLDARQLSRLARRA AGLARTGSVYGHGSGDIALAFSTAYTIAHDA  +ALPALVA
Sbjct  238  ATDAPLDARQLSRLARRAAAGLARTGSVYGHGSGDIALAFSTAYTIAHDAHYVALPALVA  297

Query  209  DAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPDLDRLFNEG  262
            DAALDPLFMAAA+SVE+AIADALLQAVTV GRDGHVR++LRDAVPDLDRL NEG
Sbjct  298  DAALDPLFMAAADSVEYAIADALLQAVTVVGRDGHVRRALRDAVPDLDRLLNEG  351


>ref|ZP_06227909.1| aminopeptidase DmpA [Burkholderia sp. CCGE1002]
 gb|ADG16423.1| peptidase S58 DmpA [Burkholderia sp. CCGE1002]
Length=361

 Score =  317 bits (813),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 172/251 (68%), Positives = 194/251 (77%), Gaps = 3/251 (1%)

Query  9    RRSARRSRRIADRAATGRPSTPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGA  68
            R + R + RI    +T     PLVFECNDGYLNDIQA  VT  H+++A  AAS DVA GA
Sbjct  109  RAAIRANPRIGREWST---VNPLVFECNDGYLNDIQALVVTEQHFNEAFDAASSDVASGA  165

Query  69   VGAGRGMSSFDLKGGIGSASRVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGRIVAQR  128
            VGAGRGMS FDLKGGIG+ASRV  AAGR Y VGALVLANFGRLPMLT+ G P+GR++A+R
Sbjct  166  VGAGRGMSCFDLKGGIGTASRVVSAAGRDYIVGALVLANFGRLPMLTIDGTPLGRVLAER  225

Query  129  RAAEAAHVAPPEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAF  188
             AA  A    PEQGSII+++ATDAPLDARQL RL+ RA AGLARTGSVYGHGSGDIALAF
Sbjct  226  AAAANASCDKPEQGSIIMIVATDAPLDARQLKRLSLRAAAGLARTGSVYGHGSGDIALAF  285

Query  189  STAYTIAHDASTIALPALVADAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSL  248
            STAYT+ H A  +ALP LVAD  LDPLF A A+SVE AI DAL  A +V GRDGH R SL
Sbjct  286  STAYTVPHGADFVALPPLVADHCLDPLFRACADSVEQAIVDALWSAESVTGRDGHRRLSL  345

Query  249  RDAVPDLDRLF  259
            RD+VPDL +L 
Sbjct  346  RDSVPDLAQLL  356


>ref|YP_001860388.1| peptidase S58 DmpA [Burkholderia phymatum STM815]
 gb|ACC73342.1| peptidase S58 DmpA [Burkholderia phymatum STM815]
Length=352

 Score =  316 bits (809),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 162/233 (69%), Positives = 181/233 (77%), Gaps = 3/233 (1%)

Query  29   TPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSSFDLKGGIGSAS  88
             PLVFECNDGYLNDIQA AV   HY+ A  +++ D  RG+VGAGRGMS FDLKGGIGSAS
Sbjct  120  NPLVFECNDGYLNDIQALAVEGKHYEAALDSSAPDFKRGSVGAGRGMSCFDLKGGIGSAS  179

Query  89   RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGRIVAQRRAAEAAHVAPPEQGSIILLL  148
            RV   A    TVGALVLANFGRLPMLT+ G+P+GR +AQRR A  A    PEQGSII+++
Sbjct  180  RVVKVASSDLTVGALVLANFGRLPMLTIDGMPIGRELAQRRRATEAK---PEQGSIIMIV  236

Query  149  ATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPALVA  208
            ATDAPLDARQL RL+ RA AGLARTGSVYGHGSGDIALAFSTA+T+ HD   IA P LV+
Sbjct  237  ATDAPLDARQLKRLSMRAAAGLARTGSVYGHGSGDIALAFSTAWTVPHDDDFIATPPLVS  296

Query  209  DAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPDLDRLFNE  261
            DA LDPLF A A+SVE AI DAL  A TV GRD H R SL DAVPDL+RL  +
Sbjct  297  DARLDPLFHACADSVEQAIVDALWSAATVTGRDAHTRLSLHDAVPDLERLLKQ  349


>ref|ZP_06465037.1| aminopeptidase DmpA [Burkholderia sp. CCGE1003]
 gb|EFD37159.1| aminopeptidase DmpA [Burkholderia sp. CCGE1003]
Length=374

 Score =  314 bits (805),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 163/243 (67%), Positives = 183/243 (75%), Gaps = 10/243 (4%)

Query  29   TPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSSFDLKGGIGSAS  88
             PLVFECNDGYLNDIQA AV   HY+DAC AAS  VA G+VGAGRGMS FDLKGGIG+AS
Sbjct  130  NPLVFECNDGYLNDIQALAVDEQHYNDACAAASTSVASGSVGAGRGMSCFDLKGGIGNAS  189

Query  89   RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGRIVAQR----------RAAEAAHVAP  138
            RV  AAGR YTVGA+VLANFGRLPML + G PVGR++AQR           A E A    
Sbjct  190  RVVQAAGREYTVGAMVLANFGRLPMLVIDGHPVGRVLAQRAATAGAQPSAHAVELAGRTK  249

Query  139  PEQGSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDA  198
            PEQGSII+++AT+APLD RQL RL+ RA AGLARTGSVYGHGSGDIALAFSTAYT+ H A
Sbjct  250  PEQGSIIMIVATNAPLDTRQLKRLSLRAAAGLARTGSVYGHGSGDIALAFSTAYTVPHLA  309

Query  199  STIALPALVADAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPDLDRL  258
              + LP LVAD  +DPLF A A+SVE AI DAL  A +V GRDGH R SL ++VPDL +L
Sbjct  310  QYVELPPLVADQCMDPLFRACADSVEQAILDALWSAESVTGRDGHQRLSLCESVPDLAQL  369

Query  259  FNE  261
               
Sbjct  370  LEH  372


>ref|ZP_03265904.1| peptidase S58 DmpA [Burkholderia sp. H160]
 gb|EEA02459.1| peptidase S58 DmpA [Burkholderia sp. H160]
Length=362

 Score =  310 bits (795),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 167/235 (71%), Positives = 184/235 (78%), Gaps = 4/235 (1%)

Query  29   TPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSSFDLKGGIGSAS  88
             PLVFECNDGYLNDIQA AVT  H++DA  AA RDVA GAVGAGRGMS FDLKGGIG+AS
Sbjct  123  NPLVFECNDGYLNDIQALAVTERHFNDALEAAGRDVASGAVGAGRGMSCFDLKGGIGTAS  182

Query  89   RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGRIVAQRRAAEAAHV----APPEQGSI  144
            RV  AAGR Y VGALVLANFGRLPMLT+ G P+GR +A+R A   A        PEQGSI
Sbjct  183  RVVNAAGRDYIVGALVLANFGRLPMLTIDGAPLGRTLAERAAMANAAAGATAGKPEQGSI  242

Query  145  ILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALP  204
            I+++AT+APLDARQL RL+ RA AGLARTGSVYGHGSGDIALAFSTAYT+ H A  +ALP
Sbjct  243  IMIIATNAPLDARQLKRLSLRAAAGLARTGSVYGHGSGDIALAFSTAYTVPHGADFVALP  302

Query  205  ALVADAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPDLDRLF  259
             LVAD  LDPLF A A+SVE AI DAL  A +V GRDGH R SLRD+VPDL  L 
Sbjct  303  PLVADHCLDPLFRACADSVEQAILDALWSAESVTGRDGHRRLSLRDSVPDLVELL  357


>ref|YP_560147.1| aminopeptidase DmpA [Burkholderia xenovorans LB400]
 gb|ABE32095.1| Aminopeptidase DmpA [Burkholderia xenovorans LB400]
Length=364

 Score =  308 bits (788),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 167/239 (69%), Positives = 187/239 (78%), Gaps = 7/239 (2%)

Query  29   TPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSSFDLKGGIGSAS  88
             PLVFECNDGYLNDIQA AVTA H+DDA  AA  DVA G+VGAGRGMS FDLKGGIG+AS
Sbjct  123  NPLVFECNDGYLNDIQALAVTARHFDDAYAAAGPDVAGGSVGAGRGMSCFDLKGGIGNAS  182

Query  89   RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGRIVAQR-RAAEAAHV------APPEQ  141
            RV  AAGR YTVGALVLANFGRLPMLT+ G+P+GR +A+R   AEAA +        PEQ
Sbjct  183  RVVSAAGRSYTVGALVLANFGRLPMLTIDGMPLGRALAERADNAEAAALLSATPATQPEQ  242

Query  142  GSIILLLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTI  201
            GSII+++ATDAPLDARQL RL+ RA AGLARTGSVYGHGSGDIALAFSTAYT+ H A  +
Sbjct  243  GSIIMIVATDAPLDARQLRRLSLRAAAGLARTGSVYGHGSGDIALAFSTAYTVPHGADFV  302

Query  202  ALPALVADAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPDLDRLFN  260
             LP LVAD  LDPLF A A+SVE AI DAL +A +V GR G  R SL D+VPDL +L  
Sbjct  303  TLPPLVADERLDPLFRACADSVEQAILDALWRAASVTGRAGRRRLSLHDSVPDLAQLLK  361


>ref|ZP_02884761.1| peptidase S58 DmpA [Burkholderia graminis C4D1M]
 gb|EDT09555.1| peptidase S58 DmpA [Burkholderia graminis C4D1M]
Length=365

 Score =  307 bits (786),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 161/235 (68%), Positives = 180/235 (76%), Gaps = 2/235 (0%)

Query  29   TPLVFECNDGYLNDIQAFAVTAAHYDDACRAASRDVARGAVGAGRGMSSFDLKGGIGSAS  88
             PLVFECNDGYLNDIQA A+   H++DA  AA   VA G+VGAGRGMS FDLKGGIG+AS
Sbjct  129  NPLVFECNDGYLNDIQALAIGEQHFNDAYAAAGTKVASGSVGAGRGMSCFDLKGGIGTAS  188

Query  89   RVAVAAGRPYTVGALVLANFGRLPMLTLGGVPVGRIVAQRRAAEAAHV--APPEQGSIIL  146
            RV   AGR Y VGAL LANFGRLPML + G PVGRI+A+R A   A      PEQGSII+
Sbjct  189  RVVSVAGREYVVGALALANFGRLPMLVVDGHPVGRILAERAAKAKADADATKPEQGSIIM  248

Query  147  LLATDAPLDARQLSRLARRAGAGLARTGSVYGHGSGDIALAFSTAYTIAHDASTIALPAL  206
            ++ATDAPLDARQL RL+ RA AGLARTGSVYGHGSGDIALAFSTAYT+ H A  IALP L
Sbjct  249  IVATDAPLDARQLKRLSLRAAAGLARTGSVYGHGSGDIALAFSTAYTVPHLAQYIALPPL  308

Query  207  VADAALDPLFMAAAESVEHAIADALLQAVTVAGRDGHVRQSLRDAVPDLDRLFNE  261
            VAD  +DPLF A A+SVE AI DAL  A +V GRDGH R SLR++VPDL  L  +
Sbjct  309  VADQCMDPLFRACADSVEQAILDALWSAQSVTGRDGHRRLSLRESVPDLAHLLKQ  363