GOS 1585030

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1092343577682
Annotathon code: GOS_1585030
Sample :
  • GPS :0°12'0s; 90°50'7w
  • Galapagos Islands: North James Bay, Santigo Island - Ecuador
  • Coastal (-2.1m, 26.2°C, 0.1-0.8 microns)
Authors
Team : UNIL-2010
Username : cmikhail
Annotated on : 2010-05-05 15:58:46
  • Mikhail Cyril

Synopsis

  • Taxonomy: Bacteria (NCBI info)
    Rank: superkingdom - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 2
    Kingdom: Bacteria - Phylum: - Class: - Order:
    Bacteria;

Genomic Sequence

>JCVI_READ_1092343577682 GOS_1585030 Genomic DNA
AAAGCAAACCTGGCAAAACAAGCAAAGACAAAAAAACGTTTTTCATATAAATCTCCTCTATGTGTAAGATACTACTATATTTAGGTATTTATATGTTTAA
AATATAGTAATATTTTATGAAACTATTAAAAAATGAACGAAGCAAAAAATTTAATTGATAAATGGCATGAAGTTCTTGGGAGTGATGATCCCAAATTATT
AGAGAACATCATTTCAGAAGATGCTGTGTTTTCATCGCCTGTGGTTTTTACTCCAATGGAGGGTAAAAATATAACGATGATGTATCTTCATGCTGCCGGT
CAGTCCTTTAATATGGAAAAGTTTAAATATACAAAAGAAATTCATGATGGGATGAATTCTGTTTTAGAGTTTGAAACTTATATCGATGATATATCCGTTA
ACGGAGTCGATATTATTGAATGGAATGAAGACGGCAAAATTTGCAACTTTAAGGTCATGATCAGGCCTTTTAAAGCTGTTCAAAAAGTTCAAGAAAAAAT
GATAGCTGCTTTGGAAAGTCTTAGTTAGCTTTTATCTTTGGGTCTTGATTCATTAACAACTAATTCTCTTCCATCAACTTCAGTTCCGTTTAATGCTTCG
ATAGCAGCCTCAGCTCCATCACTCATTTCAACAAAACCAAAGCCTCTTGAACGACCAGTTGCTCTGTCTGTAATAATTTTTGCAGAAGTGACTGTTCCGT
GTTCTGCAAAAACGTTCTCTAGATCTTGGTCTGTTAATCCCCAAGAAATATTTCCGACATATATATTCATTAATTTATCCTAAGTGAGAAAATGCAATCT
TACATTAAATATATCAATAATAGTAAAAAACTTTTAACTTTATTTAATTTATCCATATTTATACATTAATATAATTTAATGGAAGTTAATTGGGTTGTTA
TAGGCTGGATTATTGACATGATTTT

Translation

[147 - 398/925]   indirect strand
>GOS_1585030 Translation [147-398   indirect strand]
DKLMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEAAIEALNGTEVDGRELVVNESRPKDKS

[ Warning ] 5' incomplete: does not start with a Methionine

Annotator commentaries

We found three different ORF. One was non-coding and the smaller one was the one that have the better hits. We then analyse the function with the ORF on reading frame 3 in the reverse strand and we do the phylogeny study with the more long one.

When we blast our sequence, we see that our sequence is probably coding for RNA binding protein.


The phylogeny will be done with the ORF number 1 in reading frame 1 on the direct strand, because it is more long and that give us a best precision in the phylogeny results. If it is done with the ORF number 1 in reading frame 3 on the reverse strand due to the small number of aminoacid that we have. It give us reults that are not very interessant. It tell us only that this sequence come from a bacteria.

We see that our sequence have some predisposition to transfer horizontal process.

But it seems that our sequence belong to a bacteria, that is probably a proteobacteria, but we can not be sure of that.

It also appears that it is not a beta proteobacteria, but we don't know. It is interesting to see that this sequence that visibly codes for a protein that binds RNA, is also subject to a lot of horizontal transfer. It could be a protein that help to degrade the RNA of virus, that try to infect bacteria. And then confer them a resistance to virus.


ORF finding

PROTOCOL

a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'universal' genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'universal' genetic code



RESULTS ANALYSIS


The longest ORF that we find is the one in the reading frame 1 on direct strand, but the domain is note as unintegrated and the NCBI blast is also not very sure because it tell us that this is an hypothetical protein. And when we do this research with the ORF on reading frame 3 in the reverse strand it give us some domain and also the blast give us some hits with a function that are coherent with the domain that we found.

We will then use this last ORF for the rest of the annotation and if we have some problems in the taxonomy study, we could use the longest ORF to find the taxonomy.


>ORF number 1 in reading frame 3 on the reverse strand extends from base 147 to base 401.

GATAAATTAATGAATATATATGTCGGAAATATTTCTTGGGGATTAACAGACCAAGATCTA

GAGAACGTTTTTGCAGAACACGGAACAGTCACTTCTGCAAAAATTATTACAGACAGAGCA

ACTGGTCGTTCAAGAGGCTTTGGTTTTGTTGAAATGAGTGATGGAGCTGAGGCTGCTATC

GAAGCATTAAACGGAACTGAAGTTGATGGAAGAGAATTAGTTGTTAATGAATCAAGACCC

AAAGATAAAAGCTAA


>Translation of ORF number 1 in reading frame 3 on the reverse strand.

DKLMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEAAI

EALNGTEVDGRELVVNESRPKDKS*




RAW RESULTS
a)
>ORF number 1 in reading frame 1 on the direct strand extends from base 130 to base 528.
AAAATGAACGAAGCAAAAAATTTAATTGATAAATGGCATGAAGTTCTTGGGAGTGATGAT
CCCAAATTATTAGAGAACATCATTTCAGAAGATGCTGTGTTTTCATCGCCTGTGGTTTTT
ACTCCAATGGAGGGTAAAAATATAACGATGATGTATCTTCATGCTGCCGGTCAGTCCTTT
AATATGGAAAAGTTTAAATATACAAAAGAAATTCATGATGGGATGAATTCTGTTTTAGAG
TTTGAAACTTATATCGATGATATATCCGTTAACGGAGTCGATATTATTGAATGGAATGAA
GACGGCAAAATTTGCAACTTTAAGGTCATGATCAGGCCTTTTAAAGCTGTTCAAAAAGTT
CAAGAAAAAATGATAGCTGCTTTGGAAAGTCTTAGTTAG

>Translation of ORF number 1 in reading frame 1 on the direct strand.
KMNEAKNLIDKWHEVLGSDDPKLLENIISEDAVFSSPVVFTPMEGKNITMMYLHAAGQSF
NMEKFKYTKEIHDGMNSVLEFETYIDDISVNGVDIIEWNEDGKICNFKVMIRPFKAVQKV
QEKMIAALESLS*

>ORF number 2 in reading frame 1 on the direct strand extends from base 529 to base 783.
CTTTTATCTTTGGGTCTTGATTCATTAACAACTAATTCTCTTCCATCAACTTCAGTTCCG
TTTAATGCTTCGATAGCAGCCTCAGCTCCATCACTCATTTCAACAAAACCAAAGCCTCTT
GAACGACCAGTTGCTCTGTCTGTAATAATTTTTGCAGAAGTGACTGTTCCGTGTTCTGCA
AAAACGTTCTCTAGATCTTGGTCTGTTAATCCCCAAGAAATATTTCCGACATATATATTC
ATTAATTTATCCTAA

>Translation of ORF number 2 in reading frame 1 on the direct strand.
LLSLGLDSLTTNSLPSTSVPFNASIAASAPSLISTKPKPLERPVALSVIIFAEVTVPCSA
KTFSRSWSVNPQEIFPTYIFINLS*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

b)
No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 147 to base 401.
GATAAATTAATGAATATATATGTCGGAAATATTTCTTGGGGATTAACAGACCAAGATCTA
GAGAACGTTTTTGCAGAACACGGAACAGTCACTTCTGCAAAAATTATTACAGACAGAGCA
ACTGGTCGTTCAAGAGGCTTTGGTTTTGTTGAAATGAGTGATGGAGCTGAGGCTGCTATC
GAAGCATTAAACGGAACTGAAGTTGATGGAAGAGAATTAGTTGTTAATGAATCAAGACCC
AAAGATAAAAGCTAA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
DKLMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEAAI
EALNGTEVDGRELVVNESRPKDKS*



Multiple Alignement

Marc est d'accord


PROTOCOL

a)Clustal format with the same protocols (muscle) as before

b)G-blocks


RESULTS ANALYSIS

The alignement seem to be fine, there are two long domain that are conserved and there is no aberrent sequence that are aligned

RAW RESULTS

a)
CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


gi|7806594      ------------------------MTNAALHLQPAVAQSLDKWHAMIER--KDF-GALES
gi|2065597      ------------------------MTHPPLNVHPAVAKSLDAWHAMVER--KDF-GALES
gi|1707326      ------------------------MTHSPLNVHPAVAKSLDAWHAMVER--KDF-GTLES
gi|1070224      ------------------------MTHSPLNVHPAVAKSLDAWHAMVER--KDF-GTLES
gi|2542457      -------------MFHPTTLLETAMTHSPLNVHPAVAKSLDAWHAMVER--KDF-GALES
gi|2623725      ----------------MPFSRPYKFNRTIKMTLATTQISIKKWHQMLET--NDM-SILND
gi|2946504      ------------------------------MTIDTTKRALEKWHQMINT--GDL-ANLND
gi|2269542      ------------------------------MTIDTTKRALEKWHQMINT--GDL-ANLND
gi|2605503      ------------------------------MTLETTKQSLEKWHHMVKS--NDL-SNLND
gi|1696336      ------------------------------MTLEITKQSLEKWHHMIQS--NDL-SNLND
gi|1841583      ------------------------------MTLEITKQSLEKWHHMIQS--NDL-SNLND
gi|2605548      ------------------------------MTLEITKQSLEKWHYMIQS--NDL-SNLND
gi|1697957      ------------------------------MTLEITKQSLEKWHYMIQS--NDL-SNLND
gi|2395039      ------------------------------MTLEITKQSLEKWHHMIQS--NDL-SNLND
gi|1930775      ------------------------------MTLEITKQSLEKWHHMIQS--NDL-SNLND
gi|1266419      ---------------------------------------------MIQS--NDL-SNLND
gi|2622792      ------------------------------MALETTKQSLEKWHHMIQA--GNL-SDLND
gi|2936079      ------------------------------MTLETTKQSLEKWHEMVQA--GNL-SELND
gi|2553181      ------------------------------MILTTTQQAIQAWHQMLCS--RDM-SVLDE
gi|2623752      ------------------------------MTIENTRKSIARWHEMLET--RDM-SVLNE
gi|2623702      ------------------------------MSLATTKQALVRWHDMVTT--RDM-SILNE
gi|1879269      -----------------------MPQPIPQTLNAPAQATLEAWHAMLDS--GNM-DDLDR
gi|1754853      -----------------------MTQPIPAGLAAPARATLGAWHAMLES--GDL-DALDM
gi|8374913      -----------------------MIQPIPAALAPTAQATLAAWHAMLQS--GDL-DALDT
gi|9431070      ---------------------MRRHDMNAAGLSPAAAKTLATWHDLLAR--NAM-EELDP
gi|7353941      MLPFTRQCNWLHSFNNLPTSRTRRPPPMNAALIPNAQPTLAAWHEMLAT--HSF-EGLGE
gi|1166941      --------------------------MTTTNLIPAAQASLEAWHQMLAN--GSM-AGLDA
gi|2542829      ---------------------------------MTSHAVIQRWHEIVAA--KDP-SKLHD
gi|1195034      -----------------------------------MTTAFDSWIKMMEV--GNH-EGLWE
gi|2545045      --------------------------------MAQYSDHLSLWLSGLEG--ADKYKVLNQ
gi|2545155      ------------------------------------MNTLQRWHDMVLK--QNH-DGVSD
gi|1194747      ----------------------------------------------MKG--ELP-GGLDE
gi|1148002      -----------------------MSGSKHTIPLTGLSPNTQAWLDWMLT-DHSA-DGLSG
gi|2542951      ---------------------------------MTEQTNMTRWMEWIEK-DHSP-AGLSA
gi|2544726      -------------------------------MSTNYSENLQKWLDMLEG-GKDL-AKLSA
my_sequenc      -------------------------------KMNEAKNLIDKWHEVLGS--DDP-KLLEN
gi|2544295      ------------------------------------MANIDAWHAVVKS--QDR-KALND
gi|1971046      ------------------------------------MTVIDRWHSVVRT--RDR-AALAG
gi|1491852      ---------------------------------MSAEKGLARWYEVIEN--GSLPAELAA
gi|8570980      --------------------------------MSSAAKGLANWHAVIEG--GSTRDALAQ
gi|8537543      --------------------------------MTSTNPGLAKWHDYMENHEGSA-EGLKQ
                                                              :          :  

gi|7806594      IVHPDAVFRSPMAFKPYGPAPALLLALRTVITILQ---------------D--FTYYRQF
gi|2065597      IVHPDAVFRSPMAFKPYGPAPALLMALRTVITILD---------------N--FTYHRQF
gi|1707326      IVHPDATFRSPMAFKPYGPAPALLMALRTVITFLE---------------N--FTYHRQF
gi|1070224      IVHPDATFRSPMAFKPYGPAPALLMALRTVITILE---------------N--FTYHRQF
gi|2542457      IVHPDATFRSPMAFKPYGPAPALLMALRTVITILD---------------N--FTYHRQF
gi|2623725      LLADEVVFRSPVAYKPYEGKQVVFFILTNVIQVFQ---------------D--FTYHREF
gi|2946504      LLAEDVVFRSPVAYKPYEGKQVVFFILTNVIQVFE---------------N--FTYHREF
gi|2269542      LLAEDVVFRSPVAYKPYEGKQVVFFILTNVIQVFE---------------N--FTYHREF
gi|2605503      LLADEVVFRSPVAYKPYEGRQVVFFILTNVIQVFQ---------------N--FTYHREF
gi|1696336      LLADEVVFRSPVAYKPYEGRQVVFFILTNVIQVFQ---------------N--FTYHREF
gi|1841583      LLADEVVFRSPVAYKPYEGRQVVFFILTNVIQVFQ---------------N--FTYHREF
gi|2605548      LLADEVVFRSPVAYKPYEGRQVVFFILTNVIQVFQ---------------N--FTYHREF
gi|1697957      LLADEVVFRSPVAYKPYEGRQVVFFILTNVIQVFQ---------------N--FTYHREF
gi|2395039      LLADEVIFHSPVAYKPYEGRQVVFFILTNVIQVFQ---------------N--FTYHREF
gi|1930775      LLADEVVFHSPVAYKPYEGRQVVFFILTNVIQVFQ---------------N--FTYHREF
gi|1266419      LLADEVVFHSPVAYKPYEGRQVVFFILTNVIQVFQ---------------N--FTYHREF
gi|2622792      LLANEVVFRSPVAHKPYEGRQVVFFILSNVIQVFQ---------------D--FTYHREF
gi|2936079      LLADEVVFRSPVAYKPYEGKQVVFFILTNVIQVFE---------------D--FTYHREF
gi|2553181      LLDEQVIFRSPVAFNPYEGKTVVRFILTNVIEIFE---------------D--FTYHREF
gi|2623752      LLAEEVVFRSPVAFQPYPGKQVVFFILTNVIQVFE---------------N--FTYHREF
gi|2623702      LLAEDVVFRSPVAFNPYPGKQVVFFILSNVIQVFE---------------N--FTYHREF
gi|1879269      LFADEVVFRSPVAHTPYPGRTATTLVLRTVNTVFE---------------D--FKYHRSF
gi|1754853      LFAEDVVFRSPVAHTPYPGRNAAALVLRTVVTVFE---------------A--FRYHRGF
gi|8374913      LFAENVVFRSPVAHTPYPGRAATLLVLRTVNTVSE---------------D--FRYHRGF
gi|9431070      LLSDSIVFRSPVAHTPYPGRAAIKLVLKTVNTVFK---------------N--FTYHRTF
gi|7353941      IMADDVVFRSPVAHTPYPGRAAIVLVLTTVNQVFQ---------------E--FRYHRSF
gi|1166941      IVADEVVFRSPVAHTPYPGRAAIGLVLTTVNQVFQ---------------D--FRYHRSF
gi|2542829      WLAEDCCFWSPVIHTPQQGRAITMFYLSAAFGVLG--------------PK--LRYVREW
gi|1195034      LLDPDCVFWSPIVHTPQEGRPISHAYLSAAGHVFK---------------DG-FHYTRTA
gi|2545045      ILADDCVFYSPVMHTLQKGKQLTFLYLASAFTVLL--------------KEGKFRYCRIL
gi|2545155      LLTEDCVFLSPVVHTPQVGREITALYLTGAMNVF----------------NETFHYTKEV
gi|1194747      LLHDDCVFCSPVVFTPQKGKALTKLYLSAAGNTFNTTDNKVHQEGLVMSAESSFRYSKEV
gi|1148002      ILAENVVFKSPVVHTPQEGKAITMAYLLAAGETLG---------------NDDFRYTRLF
gi|2542951      LLHDDAVMISPVVHTPQKGKMITMAYLMAAGQTIG---------------NDTFKYTRTF
gi|2544726      MIAKDCVFYSPVVHTPQRGQQITVMYLYGAAQVLG--------------VNTSFKYVRIL
my_sequenc      IISEDAVFSSPVVFTPMEGKNITMMYLHAAGQSFN---------------MEKFKYTKEI
gi|2544295      LIADQAVFHSPLVHTPQVGKPITTAYLTAAMHVLA---------------NDSFRYVREI
gi|1971046      MIAEGAVFESPVVHTPQQGKAITVKYLESALEVLN---------------NETFRYLGEW
gi|1491852      IIHEDTAFHSPVVHSPQKGRDLVVAYLSAAGQTLG---------------NDSFTYIREL
gi|8570980      IIREDAVFHSPVVHTPQEGRAIVVAYLAAAGQTLG---------------NDTFHYLREV
gi|8537543      VLHEDCVFHSPVVHTPQRGRPIVTAYLMAAAGTLG---------------QGDFQYVREM
                 .     : **: .            *  .                       : *    

gi|7806594      VTDDGKSVVLEFSAAVGDKALKGIDMIRFDDEGRIVEFEVMIRPFNALQALGTEMGARLA
gi|2065597      VTDDGKSVVLEFGATVGDKALKGIDMIRFDDDGRIVEFEVMVRPFNALQALGAEMGARLG
gi|1707326      ATDDGKSVVLEFGATIGDKALKGIDMIRFDDDGRIVEFEVMIRPFNALQALGAEMGARLG
gi|1070224      ATDDGKSVVLEFGATIGDKALKGIDMIRFDDDGRIVDFEVMIRPFNALQALGAEMGARLG
gi|2542457      ATDDGKSVVLEFGATIGDKALKGIDMIRFDDDGRIVEFEVMIRPFNALQALGAEMGARLG
gi|2623725      FTEDGENVVLEFSANVSGKSLKGIDMIRFNDRGQIIDFEVMIRPMSGLAALAEQMGQRIA
gi|2946504      YTEDGANVVLEFSADVSGKSLKGIDMIRFNAQGKIIDFEVMIRPMSGLAALAEQMGARFA
gi|2269542      YTEDGANVVLEFSADVSGKSLKGIDMIRFNAQGKIIDFEVMIRPMSGLAVLAEQMGARFA
gi|2605503      YTEDGKNVVLEFSANVGDKSLKGIDMIRFNEQGKIIDFEVMIRPMSGLAALAEQMGIRIA
gi|1696336      YTEDGENVVLEFSANVGDKSLKGIDMIRFNEQGKIIDFEVMIRPMSGLAALAEQMGIRIA
gi|1841583      YTENGENVVLEFSANVGDKSLKGIDMIRFNEQGKIIDFEVMIRPLSGLAALAEQMGIRIA
gi|2605548      YTEDGENVVLEFSADVGDKSLKGIDMIRFNEQGKIVDFEVMIRPMSGLAALAEQMGIRIA
gi|1697957      YTEDGENIVLEFSADVGDKSLKGIDMIRFNEQGKIVDFEVMIRPMSGLAALAEQMGIRIA
gi|2395039      YTEDGENVVLEFSANVGDKSLKGIDMIRFNEQGKIVDFEVMIRPMSGLAALAEQMGIRIA
gi|1930775      YTEDGENVVLEFSADVGDKSLKGIDMIRFNEQGKIVDFEVMIRPMSGLAALAEQMGIRIA
gi|1266419      YTEDGENVVLEFSADVGDKSLKGIDMIRFNEQGKIVDFEVMIRPMSGLAALAEQMGIRIA
gi|2622792      YTEDGENVVLEFSANVSGKSLKGIDMIRFNEQGKIIDFEVMIRPMSGLAALAEQMGIRIA
gi|2936079      YTEDGENVVLEFSANVSGKSLKGIDMIRFNEQGKIIDFEVMIRPMSGLAALAEQMGIRIA
gi|2553181      YTEDGHNVVLEFSAHVGEKQLKGIDMIRFNEQGKIVDFEVMIRPKSGLEALAAQMRQRMA
gi|2623752      ISEDGNNVVLEFSANVGDKKLKGVDMIQFNEEGQMIDFEVMIRPKSGLEALAVQMGQRMQ
gi|2623702      FTEDGLSVVLEFSANVGEKKLKGIDMIRFNEQGQIVDFEVMIRPKSGLEALAVQMGQRMA
gi|1879269      ATDDGASVVLEFSANVSGKALKGIDMIRFNAAGKIVEFEVMVRPATGLQALGAAMGAKLG
gi|1754853      ATDDGASVVLEFSAAVAGKSLKGIDMIRFDADGKIIEFEVMVRPATGLQALGAAMGAKLG
gi|8374913      ATDDGASVVLEFSASVAGRSLKGIDMIRFDADGKIVEFEVMVRPATGLQALGAAMGAKLG
gi|9431070      ATADGLGVVLEFSAEVDGKALKGIDMLRFDQAGKIEEFEVMVRPMSGLQALGAAMGAKLA
gi|7353941      ASEDGHSVVLEFSAQVDGKQLKGIDMIRFDAQGKIAEFEVMIRPLSGLQALGAAMGARLA
gi|1166941      VSEDGHSVVLEFSAAVDGKALKGIDMIRFDDAGRIAEFEVMVRPRSGLEALAAAMGARLA
gi|2542829      --VGPSDAVLEFETQVDDVIVNGVDMIHWNEAGLVTEFKVMIRPLKAIGVVQEKMATMLA
gi|1195034      --IDGDYGVFEFECAMDGIKVNGVDIITLKEN-LIIEFKVMVRPLKAINMVHQKMMAMLQ
gi|2545045      --EQGHDAVLEFETEIDGIHINGVDMMTFNEAGQITEFKVMLRPLKALEKVRALMMAELE
gi|2545155      VTEE--HAVLEFECTVDGILINGVDIISFADDGRICEFRVMVRPLQAMQMLHGKMAAMLE
gi|1194747      --ASGNHAVLEFESEIDGKYINGVDIITWDDDGKIIEFKVMVRPLQAVNMLHQKMQAMLE
gi|1148002      --DCGDKAVLEFETIMDGILVNGVDMIEWNADGQIVDFKVMVRPLKAIQMVHAAMGAMLA
gi|2542951      --DCGDKAVLEFETEMNGIHVNGIDMIEWNEDGLITEFKVMIRPLKAVNMVHAEMGKMLE
gi|2544726      --DCGDNAVLEFETEIDGIFINGVDMIHWNEEGLIDDFKVMLRPLKAVTMVQAKMAEMLE
my_sequenc      --HDGMNSVLEFETYIDDISVNGVDIIEWNEDGKICNFKVMIRPFKAVQKVQEKMIAALE
gi|2544295      --NDGQHSVLEFALELDGIAVNGVDMIEWDTDGKIIDFKVMIRPYKAIEVVRTNMAAMLE
gi|1971046      --RAERSAVLEFACEIEGITINGVDMIWWDEAGRIVRFKVMIRPLKAINLLHRLMGEKLA
gi|1491852      --VDGENACLEFTAEMDGIHVNG---------------SILSASTRTA------------
gi|8570980      --ADGDTAVLEFACEMEGIKVNGIDMITFDEEGMIKDFKVMVRPLKAVNKVWEMMGRQLG
gi|8537543      --ADGNHALLEFTTTMDGIHVNGIDLMTFDEDGMITDFKVMVRPLKAVNKVWEQMAAMLE
                         :**   :    ::*                ::  .                

gi|7806594      QQLPAFKIGS-
gi|2065597      QQLPAFKTGG-
gi|1707326      QQLPAFKTGG-
gi|1070224      QQLPAFKTGG-
gi|2542457      QQLPAFKTGG-
gi|2623725      QYQAT------
gi|2946504      KYQSNSSK---
gi|2269542      QYQSNSSK---
gi|2605503      QFKPQ------
gi|1696336      QFKPQ------
gi|1841583      QFKPQ------
gi|2605548      QFKPQ------
gi|1697957      QFKPQ------
gi|2395039      QFKPQ------
gi|1930775      QFKPQ------
gi|1266419      QFKPQ------
gi|2622792      QFQPQ------
gi|2936079      KFQPQ------
gi|2553181      AFMPPAH----
gi|2623752      SFQAKT-----
gi|2623702      TFAPQAG----
gi|1879269      DKLGLLKAGA-
gi|1754853      DQLGRLKTGA-
gi|8374913      DQAGLLKAGA-
gi|9431070      SQKHVLAGQD-
gi|7353941      SQKQVLTGAA-
gi|1166941      SQKDVLTGAA-
gi|2542829      QSRELSGVG--
gi|1195034      ETKG-------
gi|2545045      AAKSA------
gi|2545155      VLKSAPEARAS
gi|1194747      VMKK-------
gi|1148002      KMKAGA-----
gi|2542951      AMKASRSG---
gi|2544726      ALKAPAKTAG-
my_sequenc      SLS--------
gi|2544295      KLG--------
gi|1971046      AAR--------
gi|1491852      -----------
gi|8570980      KAKAD------
gi|8537543      KQKV


b)
Gblocks 0.91b Results

Processed file: input.fasta
Number of sequences: 41
Alignment assumed to be: Protein
New number of positions: 46 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
gi|78065949|ref  ------------------------MTNAALHLQPAVAQSLDKWHAMIER--KDF-GALES
gi|206559703|re  ------------------------MTHPPLNVHPAVAKSLDAWHAMVER--KDF-GALES
gi|170732674|re  ------------------------MTHSPLNVHPAVAKSLDAWHAMVER--KDF-GTLES
gi|107022419|re  ------------------------MTHSPLNVHPAVAKSLDAWHAMVER--KDF-GTLES
gi|254245712|re  -------------MFHPTTLLETAMTHSPLNVHPAVAKSLDAWHAMVER--KDF-GALES
gi|262372538|re  ----------------MPFSRPYKFNRTIKMTLATTQISIKKWHQMLET--NDM-SILND
gi|294650469|re  ------------------------------MTIDTTKRALEKWHQMINT--GDL-ANLND
gi|226954265|re  ------------------------------MTIDTTKRALEKWHQMINT--GDL-ANLND
gi|260550315|re  ------------------------------MTLETTKQSLEKWHHMVKS--NDL-SNLND
gi|169633627|re  ------------------------------MTLEITKQSLEKWHHMIQS--NDL-SNLND
gi|184158334|re  ------------------------------MTLEITKQSLEKWHHMIQS--NDL-SNLND
gi|260554824|re  ------------------------------MTLEITKQSLEKWHYMIQS--NDL-SNLND
gi|169795761|re  ------------------------------MTLEITKQSLEKWHYMIQS--NDL-SNLND
gi|239503981|re  ------------------------------MTLEITKQSLEKWHHMIQS--NDL-SNLND
gi|193077505|gb  ------------------------------MTLEITKQSLEKWHHMIQS--NDL-SNLND
gi|126641949|re  ---------------------------------------------MIQS--NDL-SNLND
gi|262279290|re  ------------------------------MALETTKQSLEKWHHMIQA--GNL-SDLND
gi|293607910|re  ------------------------------MTLETTKQSLEKWHEMVQA--GNL-SELND
gi|255318127|re  ------------------------------MILTTTQQAIQAWHQMLCS--RDM-SVLDE
gi|262375250|re  ------------------------------MTIENTRKSIARWHEMLET--RDM-SVLNE
gi|262370250|re  ------------------------------MSLATTKQALVRWHDMVTT--RDM-SILNE
gi|187926982|re  -----------------------MPQPIPQTLNAPAQATLEAWHAMLDS--GNM-DDLDR
gi|17548538|ref  -----------------------MTQPIPAGLAAPARATLGAWHAMLES--GDL-DALDM
gi|83749135|ref  -----------------------MIQPIPAALAPTAQATLAAWHAMLQS--GDL-DALDT
gi|94310701|ref  ---------------------MRRHDMNAAGLSPAAAKTLATWHDLLAR--NAM-EELDP
gi|73539415|ref  MLPFTRQCNWLHSFNNLPTSRTRRPPPMNAALIPNAQPTLAAWHEMLAT--HSF-EGLGE
gi|116694179|re  --------------------------MTTTNLIPAAQASLEAWHQMLAN--GSM-AGLDA
gi|254282925|re  ---------------------------------MTSHAVIQRWHEIVAA--KDP-SKLHD
gi|119503455|re  -----------------------------------MTTAFDSWIKMMEV--GNH-EGLWE
gi|254504571|re  --------------------------------MAQYSDHLSLWLSGLEG--ADKYKVLNQ
gi|254515525|re  ------------------------------------MNTLQRWHDMVLK--QNH-DGVSD
gi|119474760|re  ----------------------------------------------MKG--ELP-GGLDE
gi|114800214|re  -----------------------MSGSKHTIPLTGLSPNTQAWLDWMLT-DHSA-DGLSG
gi|254295180|re  ---------------------------------MTEQTNMTRWMEWIEK-DHSP-AGLSA
gi|254472602|re  -------------------------------MSTNYSENLQKWLDMLEG-GKDL-AKLSA
my_sequence      -------------------------------KMNEAKNLIDKWHEVLGS--DDP-KLLEN
gi|254429545|re  ------------------------------------MANIDAWHAVVKS--QDR-KALND
gi|197104656|re  ------------------------------------MTVIDRWHSVVRT--RDR-AALAG
gi|149185264|re  ---------------------------------MSAEKGLARWYEVIEN--GSLPAELAA
gi|85709805|ref  --------------------------------MSSAAKGLANWHAVIEG--GSTRDALAQ
gi|85375433|ref  --------------------------------MTSTNPGLAKWHDYMENHEGSA-EGLKQ
                                                                          ###


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
gi|78065949|ref  IVHPDAVFRSPMAFKPYGPAPALLLALRTVITILQ---------------D--FTYYRQF
gi|206559703|re  IVHPDAVFRSPMAFKPYGPAPALLMALRTVITILD---------------N--FTYHRQF
gi|170732674|re  IVHPDATFRSPMAFKPYGPAPALLMALRTVITFLE---------------N--FTYHRQF
gi|107022419|re  IVHPDATFRSPMAFKPYGPAPALLMALRTVITILE---------------N--FTYHRQF
gi|254245712|re  IVHPDATFRSPMAFKPYGPAPALLMALRTVITILD---------------N--FTYHRQF
gi|262372538|re  LLADEVVFRSPVAYKPYEGKQVVFFILTNVIQVFQ---------------D--FTYHREF
gi|294650469|re  LLAEDVVFRSPVAYKPYEGKQVVFFILTNVIQVFE---------------N--FTYHREF
gi|226954265|re  LLAEDVVFRSPVAYKPYEGKQVVFFILTNVIQVFE---------------N--FTYHREF
gi|260550315|re  LLADEVVFRSPVAYKPYEGRQVVFFILTNVIQVFQ---------------N--FTYHREF
gi|169633627|re  LLADEVVFRSPVAYKPYEGRQVVFFILTNVIQVFQ---------------N--FTYHREF
gi|184158334|re  LLADEVVFRSPVAYKPYEGRQVVFFILTNVIQVFQ---------------N--FTYHREF
gi|260554824|re  LLADEVVFRSPVAYKPYEGRQVVFFILTNVIQVFQ---------------N--FTYHREF
gi|169795761|re  LLADEVVFRSPVAYKPYEGRQVVFFILTNVIQVFQ---------------N--FTYHREF
gi|239503981|re  LLADEVIFHSPVAYKPYEGRQVVFFILTNVIQVFQ---------------N--FTYHREF
gi|193077505|gb  LLADEVVFHSPVAYKPYEGRQVVFFILTNVIQVFQ---------------N--FTYHREF
gi|126641949|re  LLADEVVFHSPVAYKPYEGRQVVFFILTNVIQVFQ---------------N--FTYHREF
gi|262279290|re  LLANEVVFRSPVAHKPYEGRQVVFFILSNVIQVFQ---------------D--FTYHREF
gi|293607910|re  LLADEVVFRSPVAYKPYEGKQVVFFILTNVIQVFE---------------D--FTYHREF
gi|255318127|re  LLDEQVIFRSPVAFNPYEGKTVVRFILTNVIEIFE---------------D--FTYHREF
gi|262375250|re  LLAEEVVFRSPVAFQPYPGKQVVFFILTNVIQVFE---------------N--FTYHREF
gi|262370250|re  LLAEDVVFRSPVAFNPYPGKQVVFFILSNVIQVFE---------------N--FTYHREF
gi|187926982|re  LFADEVVFRSPVAHTPYPGRTATTLVLRTVNTVFE---------------D--FKYHRSF
gi|17548538|ref  LFAEDVVFRSPVAHTPYPGRNAAALVLRTVVTVFE---------------A--FRYHRGF
gi|83749135|ref  LFAENVVFRSPVAHTPYPGRAATLLVLRTVNTVSE---------------D--FRYHRGF
gi|94310701|ref  LLSDSIVFRSPVAHTPYPGRAAIKLVLKTVNTVFK---------------N--FTYHRTF
gi|73539415|ref  IMADDVVFRSPVAHTPYPGRAAIVLVLTTVNQVFQ---------------E--FRYHRSF
gi|116694179|re  IVADEVVFRSPVAHTPYPGRAAIGLVLTTVNQVFQ---------------D--FRYHRSF
gi|254282925|re  WLAEDCCFWSPVIHTPQQGRAITMFYLSAAFGVLG--------------PK--LRYVREW
gi|119503455|re  LLDPDCVFWSPIVHTPQEGRPISHAYLSAAGHVFK---------------DG-FHYTRTA
gi|254504571|re  ILADDCVFYSPVMHTLQKGKQLTFLYLASAFTVLL--------------KEGKFRYCRIL
gi|254515525|re  LLTEDCVFLSPVVHTPQVGREITALYLTGAMNVF----------------NETFHYTKEV
gi|119474760|re  LLHDDCVFCSPVVFTPQKGKALTKLYLSAAGNTFNTTDNKVHQEGLVMSAESSFRYSKEV
gi|114800214|re  ILAENVVFKSPVVHTPQEGKAITMAYLLAAGETLG---------------NDDFRYTRLF
gi|254295180|re  LLHDDAVMISPVVHTPQKGKMITMAYLMAAGQTIG---------------NDTFKYTRTF
gi|254472602|re  MIAKDCVFYSPVVHTPQRGQQITVMYLYGAAQVLG--------------VNTSFKYVRIL
my_sequence      IISEDAVFSSPVVFTPMEGKNITMMYLHAAGQSFN---------------MEKFKYTKEI
gi|254429545|re  LIADQAVFHSPLVHTPQVGKPITTAYLTAAMHVLA---------------NDSFRYVREI
gi|197104656|re  MIAEGAVFESPVVHTPQQGKAITVKYLESALEVLN---------------NETFRYLGEW
gi|149185264|re  IIHEDTAFHSPVVHSPQKGRDLVVAYLSAAGQTLG---------------NDSFTYIREL
gi|85709805|ref  IIREDAVFHSPVVHTPQEGRAIVVAYLAAAGQTLG---------------NDTFHYLREV
gi|85375433|ref  VLHEDCVFHSPVVHTPQRGRPIVTAYLMAAAGTLG---------------QGDFQYVREM
                 ###########################                                 


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
gi|78065949|ref  VTDDGKSVVLEFSAAVGDKALKGIDMIRFDDEGRIVEFEVMIRPFNALQALGTEMGARLA
gi|206559703|re  VTDDGKSVVLEFGATVGDKALKGIDMIRFDDDGRIVEFEVMVRPFNALQALGAEMGARLG
gi|170732674|re  ATDDGKSVVLEFGATIGDKALKGIDMIRFDDDGRIVEFEVMIRPFNALQALGAEMGARLG
gi|107022419|re  ATDDGKSVVLEFGATIGDKALKGIDMIRFDDDGRIVDFEVMIRPFNALQALGAEMGARLG
gi|254245712|re  ATDDGKSVVLEFGATIGDKALKGIDMIRFDDDGRIVEFEVMIRPFNALQALGAEMGARLG
gi|262372538|re  FTEDGENVVLEFSANVSGKSLKGIDMIRFNDRGQIIDFEVMIRPMSGLAALAEQMGQRIA
gi|294650469|re  YTEDGANVVLEFSADVSGKSLKGIDMIRFNAQGKIIDFEVMIRPMSGLAALAEQMGARFA
gi|226954265|re  YTEDGANVVLEFSADVSGKSLKGIDMIRFNAQGKIIDFEVMIRPMSGLAVLAEQMGARFA
gi|260550315|re  YTEDGKNVVLEFSANVGDKSLKGIDMIRFNEQGKIIDFEVMIRPMSGLAALAEQMGIRIA
gi|169633627|re  YTEDGENVVLEFSANVGDKSLKGIDMIRFNEQGKIIDFEVMIRPMSGLAALAEQMGIRIA
gi|184158334|re  YTENGENVVLEFSANVGDKSLKGIDMIRFNEQGKIIDFEVMIRPLSGLAALAEQMGIRIA
gi|260554824|re  YTEDGENVVLEFSADVGDKSLKGIDMIRFNEQGKIVDFEVMIRPMSGLAALAEQMGIRIA
gi|169795761|re  YTEDGENIVLEFSADVGDKSLKGIDMIRFNEQGKIVDFEVMIRPMSGLAALAEQMGIRIA
gi|239503981|re  YTEDGENVVLEFSANVGDKSLKGIDMIRFNEQGKIVDFEVMIRPMSGLAALAEQMGIRIA
gi|193077505|gb  YTEDGENVVLEFSADVGDKSLKGIDMIRFNEQGKIVDFEVMIRPMSGLAALAEQMGIRIA
gi|126641949|re  YTEDGENVVLEFSADVGDKSLKGIDMIRFNEQGKIVDFEVMIRPMSGLAALAEQMGIRIA
gi|262279290|re  YTEDGENVVLEFSANVSGKSLKGIDMIRFNEQGKIIDFEVMIRPMSGLAALAEQMGIRIA
gi|293607910|re  YTEDGENVVLEFSANVSGKSLKGIDMIRFNEQGKIIDFEVMIRPMSGLAALAEQMGIRIA
gi|255318127|re  YTEDGHNVVLEFSAHVGEKQLKGIDMIRFNEQGKIVDFEVMIRPKSGLEALAAQMRQRMA
gi|262375250|re  ISEDGNNVVLEFSANVGDKKLKGVDMIQFNEEGQMIDFEVMIRPKSGLEALAVQMGQRMQ
gi|262370250|re  FTEDGLSVVLEFSANVGEKKLKGIDMIRFNEQGQIVDFEVMIRPKSGLEALAVQMGQRMA
gi|187926982|re  ATDDGASVVLEFSANVSGKALKGIDMIRFNAAGKIVEFEVMVRPATGLQALGAAMGAKLG
gi|17548538|ref  ATDDGASVVLEFSAAVAGKSLKGIDMIRFDADGKIIEFEVMVRPATGLQALGAAMGAKLG
gi|83749135|ref  ATDDGASVVLEFSASVAGRSLKGIDMIRFDADGKIVEFEVMVRPATGLQALGAAMGAKLG
gi|94310701|ref  ATADGLGVVLEFSAEVDGKALKGIDMLRFDQAGKIEEFEVMVRPMSGLQALGAAMGAKLA
gi|73539415|ref  ASEDGHSVVLEFSAQVDGKQLKGIDMIRFDAQGKIAEFEVMIRPLSGLQALGAAMGARLA
gi|116694179|re  VSEDGHSVVLEFSAAVDGKALKGIDMIRFDDAGRIAEFEVMVRPRSGLEALAAAMGARLA
gi|254282925|re  --VGPSDAVLEFETQVDDVIVNGVDMIHWNEAGLVTEFKVMIRPLKAIGVVQEKMATMLA
gi|119503455|re  --IDGDYGVFEFECAMDGIKVNGVDIITLKEN-LIIEFKVMVRPLKAINMVHQKMMAMLQ
gi|254504571|re  --EQGHDAVLEFETEIDGIHINGVDMMTFNEAGQITEFKVMLRPLKALEKVRALMMAELE
gi|254515525|re  VTEE--HAVLEFECTVDGILINGVDIISFADDGRICEFRVMVRPLQAMQMLHGKMAAMLE
gi|119474760|re  --ASGNHAVLEFESEIDGKYINGVDIITWDDDGKIIEFKVMVRPLQAVNMLHQKMQAMLE
gi|114800214|re  --DCGDKAVLEFETIMDGILVNGVDMIEWNADGQIVDFKVMVRPLKAIQMVHAAMGAMLA
gi|254295180|re  --DCGDKAVLEFETEMNGIHVNGIDMIEWNEDGLITEFKVMIRPLKAVNMVHAEMGKMLE
gi|254472602|re  --DCGDNAVLEFETEIDGIFINGVDMIHWNEEGLIDDFKVMLRPLKAVTMVQAKMAEMLE
my_sequence      --HDGMNSVLEFETYIDDISVNGVDIIEWNEDGKICNFKVMIRPFKAVQKVQEKMIAALE
gi|254429545|re  --NDGQHSVLEFALELDGIAVNGVDMIEWDTDGKIIDFKVMIRPYKAIEVVRTNMAAMLE
gi|197104656|re  --RAERSAVLEFACEIEGITINGVDMIWWDEAGRIVRFKVMIRPLKAINLLHRLMGEKLA
gi|149185264|re  --VDGENACLEFTAEMDGIHVNG---------------SILSASTRTA------------
gi|85709805|ref  --ADGDTAVLEFACEMEGIKVNGIDMITFDEEGMIKDFKVMVRPLKAVNKVWEMMGRQLG
gi|85375433|ref  --ADGNHALLEFTTTMDGIHVNGIDLMTFDEDGMITDFKVMVRPLKAVNKVWEQMAAMLE
                        ################                                     


                        190
                 =========+=
gi|78065949|ref  QQLPAFKIGS-
gi|206559703|re  QQLPAFKTGG-
gi|170732674|re  QQLPAFKTGG-
gi|107022419|re  QQLPAFKTGG-
gi|254245712|re  QQLPAFKTGG-
gi|262372538|re  QYQAT------
gi|294650469|re  KYQSNSSK---
gi|226954265|re  QYQSNSSK---
gi|260550315|re  QFKPQ------
gi|169633627|re  QFKPQ------
gi|184158334|re  QFKPQ------
gi|260554824|re  QFKPQ------
gi|169795761|re  QFKPQ------
gi|239503981|re  QFKPQ------
gi|193077505|gb  QFKPQ------
gi|126641949|re  QFKPQ------
gi|262279290|re  QFQPQ------
gi|293607910|re  KFQPQ------
gi|255318127|re  AFMPPAH----
gi|262375250|re  SFQAKT-----
gi|262370250|re  TFAPQAG----
gi|187926982|re  DKLGLLKAGA-
gi|17548538|ref  DQLGRLKTGA-
gi|83749135|ref  DQAGLLKAGA-
gi|94310701|ref  SQKHVLAGQD-
gi|73539415|ref  SQKQVLTGAA-
gi|116694179|re  SQKDVLTGAA-
gi|254282925|re  QSRELSGVG--
gi|119503455|re  ETKG-------
gi|254504571|re  AAKSA------
gi|254515525|re  VLKSAPEARAS
gi|119474760|re  VMKK-------
gi|114800214|re  KMKAGA-----
gi|254295180|re  AMKASRSG---
gi|254472602|re  ALKAPAKTAG-
my_sequence      SLS--------
gi|254429545|re  KLG--------
gi|197104656|re  AAR--------
gi|149185264|re  -----------
gi|85709805|ref  KAKAD------
gi|85375433|ref  KQKV-------
                            






Parameters used
Minimum Number Of Sequences For A Conserved Position: 21
Minimum Number Of Sequences For A Flanking Position: 35
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes


Flank positions of the 2 selected block(s)
Flanks: [58  87]  [128  143]  

New number of positions in input.fasta-gb:  46  (24% of the original 191 positions)



Protein Domains

PROTOCOL

Interpro: default protein at EBI


RESULTS ANALYSIS


We found that it is coherent and that our sequence is probably coding for RNA binding protein.


RAW RESULTS

Sequence_1	2A3B1C06DCC4533A	84	Gene3D	G3DSA:3.30.70.330	no description	5	82	5.9e-26	T	28-Apr-2010	IPR012677	Nucleotide-binding, alpha-beta plait	Molecular Function: nucleotide binding (GO:0000166)
Sequence_1	2A3B1C06DCC4533A	84	HMMSmart	SM00360	RRM	5	76	2.8e-27	T	28-Apr-2010	IPR000504	RNA recognition motif, RNP-1	Molecular Function: nucleic acid binding (GO:0003676)
Sequence_1	2A3B1C06DCC4533A	84	HMMPanther	PTHR10432:SF31	GLYCINE-RICH RNA-BINDING PROTEIN	4	81	1.2e-30	T	28-Apr-2010	IPR015465	RNA recognition motif, glycine rich protein	
Sequence_1	2A3B1C06DCC4533A	84	HMMPanther	PTHR10432	RNA-BINDING PROTEIN	4	81	1.2e-30	T	28-Apr-2010	NULL	NULL	
Sequence_1	2A3B1C06DCC4533A	84	superfamily	SSF54928	RNA-binding domain, RBD	5	81	2.6e-23	T	28-Apr-2010	NULL	NULL	
Sequence_1	2A3B1C06DCC4533A	84	HMMPfam	PF00076	RRM_1	6	73	1.5e-21	T	28-Apr-2010	IPR000504	RNA recognition motif, RNP-1	Molecular Function: nucleic acid binding (GO:0003676)
Sequence_1	2A3B1C06DCC4533A	84	ProfileScan	PS50102	RRM	4	80	18.223	T	28-Apr-2010	IPR000504	RNA recognition motif, RNP-1	Molecular Function: nucleic acid binding (GO:0003676)

Phylogeny

PROTOCOL

Phylogeny.fr / PhyML method / no bootstrap / default substitution model / out group:like defined before


RESULTS ANALYSIS

cf: explanantion in taxonomique box

RAW RESULTS

 
                        +Acinetobacter_baumannii_19606_gi_260554824
                        |
                        |-Acinetobacter_baumannii_AYE_gi_169795761
                       ++
                       ||+--Acinetobacter_baumannii_A900_gi_239503981
                       |||
                       |++Acinetobacter_baumannii_ATCC_17978_gi_193077505
                       | |
                       | +Acinetobacter_baumannii_ATCC_17978_gi_126641949
                       |
                       |Acinetobacter_baumannii_ACICU_gi_184158334
                       |
                       |Acinetobacter_sp._RUH2624_gi_260550315
                       |
                       |
                       |Acinetobacter_baumannii_SDF_gi_169633627
                       |
                      ++                                             +Burkholderia_cenocepacia_MC0-3_gi_170732674
                      ||                                             |
                      ||                                           +-+Burkholderia_cenocepacia_AU_1054_gi_107022419
                      ||                                           | |
                      ||                                        +--+ +Burkholderia_cenocepacia_PC184_gi_254245712
                      ||                                        |  |
                      ||   +------------------------------------+  +Burkholderia_cenocepacia_J2315_gi_206559703
                      ||   |                                    |
                      ||   |                                    +Burkholderia_sp._383_gi_78065949
                      |+---+
                     ++    |  +Acinetobacter_lwoffii_SH145_gi_262375250
                     ||    |  |
                     ||    +--+ +-----------Acinetobacter_radioresistens_SK82_gi_255318127
                     ||       +-+
                     ||         +-Acinetobacter_johnsonii_SH046_gi_262370250
                     ||
                     ||  +Acinetobacter_haemolyticus_ATCC_19194_gi_294650469
       +-------------+|--+
       |             ||  +Acinetobacter_sp._ATCC_27244_gi_226954265
       |             ||
       |             ||Acinetobacter_junii_SH205_gi_262372538
       |             ||
       |             |+Acinetobacter_sp._SH024_gi_293607910
    +--+             |
    |  |             +Acinetobacter_calcoaceticus_RUH2202_gi_262279290
    |  |
    |  |
    |  |   +Ralstonia_pickettii_12J_gi_187926982
 +--+  +---+
 |  |      |      +----Ralstonia_solanacearum_GMI1000_gi_17548538
 |  |      +------+
 |  |             +-----Ralstonia_solanacearum_UW551_gi_83749135
 |  |
 |  |------Ralstonia_metallidurans_CH34_gi_94310701
 |  |
 |  |  +------Ralstonia_eutropha_JMP134_gi_73539415
 |  +--+
 |     +---Ralstonia_eutropha_H16_gi_116694179
 |
 |                                    +------Labrenzia_alexandrii_DFL-11_gi_254504571
 |                                    |
 |                                    |      +------------gamma_proteobacterium_NOR5-3_gi_254515525
 |                                    |  +---+
 |                               +----+  |   +---------------gamma_proteobacterium_NOR51-B_gi_254282925
 |                               |    |  |
 |                               |    |  |      +------------------my_sequence
 |                               |    |  |    +-+
 |                               |    |  |    | +-------------Phenylobacterium_zucineum_HLK1_gi_197104656
 |                               |    +--+----+
 |                               |       |    +-----Pseudovibrio_sp._JE062_gi_254472602
 |                               |       |
 |                               |       |     +--------Hirschia_baltica_ATCC_49814_gi_254295180
 |                               |       |     |
 |                               |       |    ++
 |                               |       |    ||+---------------------marine_gamma_proteobacterium_HTCC2080_gi_119503455
 +-------------------------------+       |    |++
                                 |       |    | |     +------Erythrobacter_litoralis_HTCC2594_gi_85375433
                                 |       |    | +-----+
                                 |       +----+       |   +--------Erythrobacter_sp._SD-21_gi_149185264
                                 |            |       +---+
                                 |            |           +-------Erythrobacter_sp._NAP1_gi_85709805
                                 |            |
                                 |            |-------------------Alcanivorax_sp._DG881_gi_254429545
                                 |            |
                                 |            +----------Hyphomonas_neptunium_ATCC_15444_gi_114800214
                                 |
                                 +-----marine_gamma_proteobacterium_HTCC2143_gi_119474760

Taxonomy report

PROTOCOL

BLASTp versus NR, NCBI default parameters apart from "Number of descriptions_1000"

The raw results are on the ORF number 1 in reading frame 3 on the reverse strand, but the phylogeny are made with the ORF number 1 in reading frame 1 on the direct strand


The phylogeny will be done with the ORF number 1 in reading frame 1 on the direct strand, because it is more long and that give us a best precision in the phylogeny results. If it is done with the ORF number 1 in reading frame 3 on the reverse strand due to the small number of aminoacid that we have. It give us reults that are not very interessant. It tell us only that this sequence come from a bacteria.

It is very difficult to define an ingroup and an out group because our sequence is likely subject to horizontal transfers. We see that because even by doing some large tree, it is hard to define the place of our sequence. We present here a phylogenic tree based on only the proteobactrium that we find in the blast. Even here it is very complicated to see if this bacteria is a gamma- or a alpha-proteobacteria. We can then not isolate a monophylogenetic group to define our ingroup. And we see in the paper of "Gene Arrangements and Phylogeny in the Class Proteobacteria" from TAKASHI KUNISAWA1, that the gamma- and the beta- proteobacteria form a group together. Zhis seems not to be confirmed by our tree. This could be due to the lot of transfer that our sequence is subject to.




RESULTS ANALYSIS


in group: some gamma- and alpha proteobacteria

>gi|254429545|ref|ZP_05043252.1| hypothetical protein ADG881_2775 [Alcanivorax sp. DG881]

MANIDAWHAVVKSQDRKALNDLIADQAVFHSPLVHTPQVGKPITTAYLTAAMHVLANDSFRYVREINDGQ

HSVLEFALELDGIAVNGVDMIEWDTDGKIIDFKVMIRPYKAIEVVRTNMAAMLEKLG


>gi|254282925|ref|ZP_04957893.1| conserved hypothetical protein [gamma proteobacterium NOR51-B]

MTSHAVIQRWHEIVAAKDPSKLHDWLAEDCCFWSPVIHTPQQGRAITMFYLSAAFGVLGPKLRYVREWVG

PSDAVLEFETQVDDVIVNGVDMIHWNEAGLVTEFKVMIRPLKAIGVVQEKMATMLAQSRELSGVG


>gi|114800214|ref|YP_758810.1| hypothetical protein HNE_0076 [Hyphomonas neptunium ATCC 15444]

MSGSKHTIPLTGLSPNTQAWLDWMLTDHSADGLSGILAENVVFKSPVVHTPQEGKAITMAYLLAAGETLG

NDDFRYTRLFDCGDKAVLEFETIMDGILVNGVDMIEWNADGQIVDFKVMVRPLKAIQMVHAAMGAMLAKM

KAGA


>gi|254295180|ref|YP_003061203.1| hypothetical protein Hbal_2833 [Hirschia baltica ATCC 49814]

MTEQTNMTRWMEWIEKDHSPAGLSALLHDDAVMISPVVHTPQKGKMITMAYLMAAGQTIGNDTFKYTRTF

DCGDKAVLEFETEMNGIHVNGIDMIEWNEDGLITEFKVMIRPLKAVNMVHAEMGKMLEAMKASRSG


>gi|254472602|ref|ZP_05086001.1| conserved hypothetical protein [Pseudovibrio sp. JE062]

MSTNYSENLQKWLDMLEGGKDLAKLSAMIAKDCVFYSPVVHTPQRGQQITVMYLYGAAQVLGVNTSFKYV

RILDCGDNAVLEFETEIDGIFINGVDMIHWNEEGLIDDFKVMLRPLKAVTMVQAKMAEMLEALKAPAKTA

G


>gi|85709805|ref|ZP_01040870.1| hypothetical protein NAP1_13008 [Erythrobacter sp. NAP1]

MSSAAKGLANWHAVIEGGSTRDALAQIIREDAVFHSPVVHTPQEGRAIVVAYLAAAGQTLGNDTFHYLRE

VADGDTAVLEFACEMEGIKVNGIDMITFDEEGMIKDFKVMVRPLKAVNKVWEMMGRQLGKAKAD


>gi|254515525|ref|ZP_05127585.1| conserved hypothetical protein [gamma proteobacterium NOR5-3]

MNTLQRWHDMVLKQNHDGVSDLLTEDCVFLSPVVHTPQVGREITALYLTGAMNVFNETFHYTKEVVTEEH

AVLEFECTVDGILINGVDIISFADDGRICEFRVMVRPLQAMQMLHGKMAAMLEVLKSAPEARAS


>gi|197104656|ref|YP_002130033.1| hypothetical protein PHZ_c1190 [Phenylobacterium zucineum HLK1]

MTVIDRWHSVVRTRDRAALAGMIAEGAVFESPVVHTPQQGKAITVKYLESALEVLNNETFRYLGEWRAER

SAVLEFACEIEGITINGVDMIWWDEAGRIVRFKVMIRPLKAINLLHRLMGEKLAAAR


>gi|119474760|ref|ZP_01615113.1| hypothetical protein GP2143_13111 [marine gamma proteobacterium HTCC2143]

MKGELPGGLDELLHDDCVFCSPVVFTPQKGKALTKLYLSAAGNTFNTTDNKVHQEGLVMSAESSFRYSKE

VASGNHAVLEFESEIDGKYINGVDIITWDDDGKIIEFKVMVRPLQAVNMLHQKMQAMLEVMKK


>gi|85375433|ref|YP_459495.1| hypothetical protein ELI_13030 [Erythrobacter litoralis HTCC2594]

MTSTNPGLAKWHDYMENHEGSAEGLKQVLHEDCVFHSPVVHTPQRGRPIVTAYLMAAAGTLGQGDFQYVR

EMADGNHALLEFTTTMDGIHVNGIDLMTFDEDGMITDFKVMVRPLKAVNKVWEQMAAMLEKQKV


>gi|254504571|ref|ZP_05116722.1| hypothetical protein SADFL11_4610 [Labrenzia alexandrii DFL-11]

MAQYSDHLSLWLSGLEGADKYKVLNQILADDCVFYSPVMHTLQKGKQLTFLYLASAFTVLLKEGKFRYCR

ILEQGHDAVLEFETEIDGIHINGVDMMTFNEAGQITEFKVMLRPLKALEKVRALMMAELEAAKSA


>gi|149185264|ref|ZP_01863581.1| hypothetical protein ED21_19462 [Erythrobacter sp. SD-21]

MSAEKGLARWYEVIENGSLPAELAAIIHEDTAFHSPVVHSPQKGRDLVVAYLSAAGQTLGNDSFTYIREL

VDGENACLEFTAEMDGIHVNGSILSASTRTA


>gi|119503455|ref|ZP_01625538.1| hypothetical protein MGP2080_02910 [marine gamma proteobacterium HTCC2080]

MTTAFDSWIKMMEVGNHEGLWELLDPDCVFWSPIVHTPQEGRPISHAYLSAAGHVFKDGFHYTRTAIDGD

YGVFEFECAMDGIKVNGVDIITLKENLIIEFKVMVRPLKAINMVHQKMMAMLQETKG


outgroup:some proteobacteria

>gi|226954265|ref|ZP_03824729.1| NADH:flavin oxidoreductase/nadh oxidase [Acinetobacter sp. ATCC 27244]

MTIDTTKRALEKWHQMINTGDLANLNDLLAEDVVFRSPVAYKPYEGKQVVFFILTNVIQVFENFTYHREF

YTEDGANVVLEFSADVSGKSLKGIDMIRFNAQGKIIDFEVMIRPMSGLAVLAEQMGARFAQYQSNSSK



>gi|260550315|ref|ZP_05824527.1| NADH:flavin oxidoreductase/NADH oxidase [Acinetobacter sp. RUH2624]

MTLETTKQSLEKWHHMVKSNDLSNLNDLLADEVVFRSPVAYKPYEGRQVVFFILTNVIQVFQNFTYHREF

YTEDGKNVVLEFSANVGDKSLKGIDMIRFNEQGKIIDFEVMIRPMSGLAALAEQMGIRIAQFKPQ


>gi|169633627|ref|YP_001707363.1| hypothetical protein ABSDF2039 [Acinetobacter baumannii SDF]

MTLEITKQSLEKWHHMIQSNDLSNLNDLLADEVVFRSPVAYKPYEGRQVVFFILTNVIQVFQNFTYHREF

YTEDGENVVLEFSANVGDKSLKGIDMIRFNEQGKIIDFEVMIRPMSGLAALAEQMGIRIAQFKPQ


>gi|193077505|gb|ABO12331.2| hypothetical protein A1S_1904 [Acinetobacter baumannii ATCC 17978]

MTLEITKQSLEKWHHMIQSNDLSNLNDLLADEVVFHSPVAYKPYEGRQVVFFILTNVIQVFQNFTYHREF

YTEDGENVVLEFSADVGDKSLKGIDMIRFNEQGKIVDFEVMIRPMSGLAALAEQMGIRIAQFKPQ


>gi|239503981|ref|ZP_04663291.1| hypothetical protein AbauAB_16843 [Acinetobacter baumannii AB900]

MTLEITKQSLEKWHHMIQSNDLSNLNDLLADEVIFHSPVAYKPYEGRQVVFFILTNVIQVFQNFTYHREF

YTEDGENVVLEFSANVGDKSLKGIDMIRFNEQGKIVDFEVMIRPMSGLAALAEQMGIRIAQFKPQ


>gi|260554824|ref|ZP_05827045.1| NADH:flavin oxidoreductase/NADH oxidase [Acinetobacter baumannii ATCC 19606]

MTLEITKQSLEKWHYMIQSNDLSNLNDLLADEVVFRSPVAYKPYEGRQVVFFILTNVIQVFQNFTYHREF

YTEDGENVVLEFSADVGDKSLKGIDMIRFNEQGKIVDFEVMIRPMSGLAALAEQMGIRIAQFKPQ


>gi|169795761|ref|YP_001713554.1| hypothetical protein ABAYE1662 [Acinetobacter baumannii AYE]

MTLEITKQSLEKWHYMIQSNDLSNLNDLLADEVVFRSPVAYKPYEGRQVVFFILTNVIQVFQNFTYHREF

YTEDGENIVLEFSADVGDKSLKGIDMIRFNEQGKIVDFEVMIRPMSGLAALAEQMGIRIAQFKPQ


>gi|184158334|ref|YP_001846673.1| hypothetical protein ACICU_02014 [Acinetobacter baumannii ACICU]

MTLEITKQSLEKWHHMIQSNDLSNLNDLLADEVVFRSPVAYKPYEGRQVVFFILTNVIQVFQNFTYHREF

YTENGENVVLEFSANVGDKSLKGIDMIRFNEQGKIIDFEVMIRPLSGLAALAEQMGIRIAQFKPQ


>gi|255318127|ref|ZP_05359371.1| NADH:flavin oxidoreductase/nadh oxidase [Acinetobacter radioresistens SK82]

MILTTTQQAIQAWHQMLCSRDMSVLDELLDEQVIFRSPVAFNPYEGKTVVRFILTNVIEIFEDFTYHREF

YTEDGHNVVLEFSAHVGEKQLKGIDMIRFNEQGKIVDFEVMIRPKSGLEALAAQMRQRMAAFMPPAH


>gi|262375250|ref|ZP_06068483.1| NADH:flavin oxidoreductase/NADH oxidase [Acinetobacter lwoffii SH145]

MTIENTRKSIARWHEMLETRDMSVLNELLAEEVVFRSPVAFQPYPGKQVVFFILTNVIQVFENFTYHREF

ISEDGNNVVLEFSANVGDKKLKGVDMIQFNEEGQMIDFEVMIRPKSGLEALAVQMGQRMQSFQAKT


>gi|293607910|ref|ZP_06690213.1| conserved hypothetical protein [Acinetobacter sp. SH024]

MTLETTKQSLEKWHEMVQAGNLSELNDLLADEVVFRSPVAYKPYEGKQVVFFILTNVIQVFEDFTYHREF

YTEDGENVVLEFSANVSGKSLKGIDMIRFNEQGKIIDFEVMIRPMSGLAALAEQMGIRIAKFQPQ


>gi|262372538|ref|ZP_06065817.1| NADH:flavin oxidoreductase/NADH oxidase [Acinetobacter junii SH205]

MPFSRPYKFNRTIKMTLATTQISIKKWHQMLETNDMSILNDLLADEVVFRSPVAYKPYEGKQVVFFILTN

VIQVFQDFTYHREFFTEDGENVVLEFSANVSGKSLKGIDMIRFNDRGQIIDFEVMIRPMSGLAALAEQMG

QRIAQYQAT


>gi|17548538|ref|NP_521878.1| hypothetical protein RS05451 [Ralstonia solanacearum GMI1000]

MTQPIPAGLAAPARATLGAWHAMLESGDLDALDMLFAEDVVFRSPVAHTPYPGRNAAALVLRTVVTVFEA

FRYHRGFATDDGASVVLEFSAAVAGKSLKGIDMIRFDADGKIIEFEVMVRPATGLQALGAAMGAKLGDQL

GRLKTGA


>gi|262370250|ref|ZP_06063576.1| NADH flavin oxidoreductase/NADH oxidase [Acinetobacter johnsonii SH046]

MSLATTKQALVRWHDMVTTRDMSILNELLAEDVVFRSPVAFNPYPGKQVVFFILSNVIQVFENFTYHREF

FTEDGLSVVLEFSANVGEKKLKGIDMIRFNEQGQIVDFEVMIRPKSGLEALAVQMGQRMATFAPQAG


>gi|73539415|ref|YP_299782.1| hypothetical protein Reut_B5593 [Ralstonia eutropha JMP134]

MLPFTRQCNWLHSFNNLPTSRTRRPPPMNAALIPNAQPTLAAWHEMLATHSFEGLGEIMADDVVFRSPVA

HTPYPGRAAIVLVLTTVNQVFQEFRYHRSFASEDGHSVVLEFSAQVDGKQLKGIDMIRFDAQGKIAEFEV

MIRPLSGLQALGAAMGARLASQKQVLTGAA



>gi|262279290|ref|ZP_06057075.1| NADH:flavin oxidoreductase/NADH oxidase [Acinetobacter calcoaceticus RUH2202]

MALETTKQSLEKWHHMIQAGNLSDLNDLLANEVVFRSPVAHKPYEGRQVVFFILSNVIQVFQDFTYHREF

YTEDGENVVLEFSANVSGKSLKGIDMIRFNEQGKIIDFEVMIRPMSGLAALAEQMGIRIAQFQPQ


>gi|83749135|ref|ZP_00946139.1| Hypothetical Protein RRSL_00933 [Ralstonia solanacearum UW551]

MIQPIPAALAPTAQATLAAWHAMLQSGDLDALDTLFAENVVFRSPVAHTPYPGRAATLLVLRTVNTVSED

FRYHRGFATDDGASVVLEFSASVAGRSLKGIDMIRFDADGKIVEFEVMVRPATGLQALGAAMGAKLGDQA

GLLKAGA


>gi|107022419|ref|YP_620746.1| hypothetical protein Bcen_0864 [Burkholderia cenocepacia AU 1054]

MTHSPLNVHPAVAKSLDAWHAMVERKDFGTLESIVHPDATFRSPMAFKPYGPAPALLMALRTVITILENF

TYHRQFATDDGKSVVLEFGATIGDKALKGIDMIRFDDDGRIVDFEVMIRPFNALQALGAEMGARLGQQLP

AFKTGG


>gi|170732674|ref|YP_001764621.1| hypothetical protein Bcenmc03_1324 [Burkholderia cenocepacia MC0-3]

MTHSPLNVHPAVAKSLDAWHAMVERKDFGTLESIVHPDATFRSPMAFKPYGPAPALLMALRTVITFLENF

TYHRQFATDDGKSVVLEFGATIGDKALKGIDMIRFDDDGRIVEFEVMIRPFNALQALGAEMGARLGQQLP

AFKTGG


>gi|78065949|ref|YP_368718.1| hypothetical protein Bcep18194_A4478 [Burkholderia sp. 383]

MTNAALHLQPAVAQSLDKWHAMIERKDFGALESIVHPDAVFRSPMAFKPYGPAPALLLALRTVITILQDF

TYYRQFVTDDGKSVVLEFSAAVGDKALKGIDMIRFDDEGRIVEFEVMIRPFNALQALGTEMGARLAQQLP

AFKIGS


>gi|206559703|ref|YP_002230467.1| hypothetical protein BCAL1337 [Burkholderia cenocepacia J2315]

MTHPPLNVHPAVAKSLDAWHAMVERKDFGALESIVHPDAVFRSPMAFKPYGPAPALLMALRTVITILDNF

TYHRQFVTDDGKSVVLEFGATVGDKALKGIDMIRFDDDGRIVEFEVMVRPFNALQALGAEMGARLGQQLP

AFKTGG


>gi|254245712|ref|ZP_04939033.1| hypothetical protein BCPG_00429 [Burkholderia cenocepacia PC184]

MFHPTTLLETAMTHSPLNVHPAVAKSLDAWHAMVERKDFGALESIVHPDATFRSPMAFKPYGPAPALLMA

LRTVITILDNFTYHRQFATDDGKSVVLEFGATIGDKALKGIDMIRFDDDGRIVEFEVMIRPFNALQALGA

EMGARLGQQLPAFKTGG


>gi|187926982|ref|YP_001893327.1| protein of unknown function DUF1486 [Ralstonia pickettii 12J]

MPQPIPQTLNAPAQATLEAWHAMLDSGNMDDLDRLFADEVVFRSPVAHTPYPGRTATTLVLRTVNTVFED

FKYHRSFATDDGASVVLEFSANVSGKALKGIDMIRFNAAGKIVEFEVMVRPATGLQALGAAMGAKLGDKL

GLLKAGA


>gi|126641949|ref|YP_001084933.1| hypothetical protein A1S_1904 [Acinetobacter baumannii ATCC 17978]

MIQSNDLSNLNDLLADEVVFHSPVAYKPYEGRQVVFFILTNVIQVFQNFTYHREFYTEDGENVVLEFSAD

VGDKSLKGIDMIRFNEQGKIVDFEVMIRPMSGLAALAEQMGIRIAQFKPQ


>gi|116694179|ref|YP_728390.1| hypothetical protein H16_B0224 [Ralstonia eutropha H16]

MTTTNLIPAAQASLEAWHQMLANGSMAGLDAIVADEVVFRSPVAHTPYPGRAAIGLVLTTVNQVFQDFRY

HRSFVSEDGHSVVLEFSAAVDGKALKGIDMIRFDDAGRIAEFEVMVRPRSGLEALAAAMGARLASQKDVL

TGAA






RAW RESULTS
    * Help

Lineage Report

cellular organisms
. Bacteria              [bacteria]
. . unclassified Bacteria [bacteria]
. . . Candidatus Poribacteria sp. WGA-A3 -----------------------------  118  2 hits [bacteria]               RNP-1 like RNA-binding protein [Candidatus Poribacteria sp.
. . . bacterium S5 ...................................................   92  6 hits [bacteria]               RNP-1 like RNA-binding protein [bacterium S5] >gi|288328247
. . Planctomyces limnophilus DSM 3776 --------------------------------  115  4 hits [planctomycetes]         RRM domain-containing RNA-binding protein [Planctomyces lim
. . Victivallis vadensis ATCC BAA-548 ................................  112  6 hits [bacteria]               RNP-1 like RNA-binding protein [Victivallis vadensis ATCC B
. . Desulfomicrobium baculatum DSM 4028 ..............................  111  6 hits [d-proteobacteria]       RNP-1 like RNA-binding protein [Desulfomicrobium baculatum 
. . Gemmata obscuriglobus UQM 2246 ...................................  108  6 hits [planctomycetes]         RNA-binding protein [Gemmata obscuriglobus UQM 2246]
. . Desulfovibrio desulfuricans subsp. desulfuricans str. G20 ........  103  4 hits [d-proteobacteria]       RNA-binding region RNP-1 [Desulfovibrio desulfuricans subsp
. . Chitinophaga pinensis DSM 2588 ...................................  103  4 hits [CFB group bacteria]     RNP-1 like RNA-binding protein [Chitinophaga pinensis DSM 2
. . Chloroherpeton thalassium ATCC 35110 .............................  103  4 hits [green sulfur bacteria]  RNP-1  like RNA-binding protein [Chloroherpeton thalassium 
. . Desulfonatronospira thiodismutans ASO3-1 .........................  103  6 hits [d-proteobacteria]       RNP-1 like RNA-binding protein [Desulfonatronospira thiodis
. . Acaryochloris marina MBIC11017 ...................................  101 16 hits [cyanobacteria]          RNA-binding region [Acaryochloris marina MBIC11017] >gi|158
. . Flavobacteriaceae bacterium 3519-10 ..............................  101  2 hits [CFB group bacteria]     RNA-binding protein [Flavobacteriaceae bacterium 3519-10] >
. . Methylococcus capsulatus str. Bath ...............................   99  2 hits [g-proteobacteria]       RNA-binding protein [Methylococcus capsulatus str. Bath] >g
. . Arcobacter butzleri RM4018 .......................................   99  2 hits [e-proteobacteria]       RNA recognition motif-containing protein [Arcobacter butzle
. . Nautilia profundicola AmH ........................................   99  2 hits [e-proteobacteria]       RNA-binding protein [Nautilia profundicola AmH] >gi|2235892
. . Denitrovibrio acetiphilus DSM 12809 ..............................   98  6 hits [bacteria]               RNP-1 like RNA-binding protein [Denitrovibrio acetiphilus D
. . Candidatus Nitrospira defluvii ...................................   98  1 hit  [bacteria]               RNA-binding protein [Candidatus Nitrospira defluvii]
. . Prosthecochloris aestuarii DSM 271 ...............................   98  4 hits [green sulfur bacteria]  RNP-1 like RNA-binding protein [Prosthecochloris aestuarii 
. . Acidovorax citrulli AAC00-1 ......................................   97  6 hits [b-proteobacteria]       RNP-1-like RNA-binding protein [Acidovorax avenae subsp. ci
. . Chlorobium phaeobacteroides BS1 ..................................   97  4 hits [green sulfur bacteria]  RNP-1 like RNA-binding protein [Chlorobium phaeobacteroides
. . Crocosphaera watsonii WH 8501 ....................................   97  6 hits [cyanobacteria]          RNA-binding region RNP-1  (RNA recognition motif) [Crocosph
. . Raphidiopsis brookii D9 ..........................................   97  6 hits [cyanobacteria]          RNA-binding region protein RNP-1 [Raphidiopsis brookii D9] 
. . Lyngbya sp. PCC 8106 .............................................   97 10 hits [cyanobacteria]          RNA-binding region protein [Lyngbya sp. PCC 8106] >gi|11945
. . Dictyoglomus thermophilum H-6-12 .................................   97  4 hits [bacteria]               RNA-binding protein [Dictyoglomus thermophilum H-6-12] >gi|
. . Curvibacter putative symbiont of Hydra magnipapillata ............   96  2 hits [b-proteobacteria]       Glycine-rich RNA-binding protein GRP1A [Curvibacter putativ
. . Bacteroides ovatus SD CC 2a ......................................   96  6 hits [CFB group bacteria]     RNA-binding protein [Bacteroides ovatus SD CC 2a] >gi|29480
. . Bacteroides xylanisolvens SD CC 1b ...............................   96  6 hits [CFB group bacteria]     RNA-binding protein [Bacteroides ovatus SD CC 2a] >gi|29480
. . Dictyoglomus turgidum DSM 6724 ...................................   96  4 hits [bacteria]               RNP-1 like RNA-binding protein [Dictyoglomus turgidum DSM 6
. . Campylobacter rectus RM3267 ......................................   96  2 hits [e-proteobacteria]       RNA-binding region RNP-1 [Campylobacter rectus RM3267] >gi|
. . Gemmata sp. Wa1-1 ................................................   96  2 hits [planctomycetes]         unknown [Gemmata sp. Wa1-1]
. . Bacteroides ovatus SD CMC 3f .....................................   96  6 hits [CFB group bacteria]     conserved hypothetical protein [Bacteroides ovatus SD CMC 3
. . Blastopirellula marina DSM 3645 ..................................   96  2 hits [planctomycetes]         RNA-binding protein [Blastopirellula marina DSM 3645] >gi|8
. . Caminibacter mediatlanticus TB-2 .................................   96  2 hits [e-proteobacteria]       hypothetical protein CMTB2_06431 [Caminibacter mediatlantic
. . Bacteroides sp. D1 ...............................................   96  6 hits [CFB group bacteria]     conserved hypothetical protein [Bacteroides sp. D1] >gi|262
. . Bacteroides sp. 2_1_22 ...........................................   96  6 hits [CFB group bacteria]     conserved hypothetical protein [Bacteroides sp. D1] >gi|262
. . Rhodoferax ferrireducens T118 ....................................   95  2 hits [b-proteobacteria]       RNA-binding region RNP-1 [Rhodoferax ferrireducens T118] >g
. . Bacteroides ovatus ATCC 8483 .....................................   95  6 hits [CFB group bacteria]     hypothetical protein BACOVA_02523 [Bacteroides ovatus ATCC 
. . Bacteroides sp. 2_2_4 ............................................   95  6 hits [CFB group bacteria]     hypothetical protein BACOVA_02523 [Bacteroides ovatus ATCC 
. . Bacteroides sp. D2 ...............................................   95  3 hits [CFB group bacteria]     hypothetical protein BACOVA_02523 [Bacteroides ovatus ATCC 
. . Bacteroides fragilis 3_1_12 ......................................   95  4 hits [CFB group bacteria]     putative RNA-binding protein [Bacteroides fragilis 3_1_12]
. . Desulfovibrio piger ATCC 29098 ...................................   95  2 hits [d-proteobacteria]       hypothetical protein DESPIG_02938 [Desulfovibrio piger ATCC
. . Campylobacter fetus subsp. fetus 82-40 ...........................   95  2 hits [e-proteobacteria]       RNA-binding region RNP-1 [Campylobacter fetus subsp. fetus 
. . Methylibium petroleiphilum PM1 ...................................   95  2 hits [b-proteobacteria]       RNA-binding region RNP-1 [Methylibium petroleiphilum PM1] >
. . Parabacteroides johnsonii DSM 18315 ..............................   95  8 hits [CFB group bacteria]     hypothetical protein PRABACTJOHN_02504 [Parabacteroides joh
. . Bacteroides fragilis YCH46 .......................................   95  8 hits [CFB group bacteria]     putative RNA-binding protein RbpA [Bacteroides fragilis YCH
. . Bacteroides fragilis NCTC 9343 ...................................   95  8 hits [CFB group bacteria]     putative RNA-binding protein RbpA [Bacteroides fragilis YCH
. . Bacteroides sp. 3_2_5 ............................................   95  8 hits [CFB group bacteria]     putative RNA-binding protein RbpA [Bacteroides fragilis YCH
. . Bacteroides sp. 2_1_16 ...........................................   95  8 hits [CFB group bacteria]     putative RNA-binding protein RbpA [Bacteroides fragilis YCH
. . Delftia acidovorans SPH-1 ........................................   95  6 hits [b-proteobacteria]       RNP-1 like RNA-binding protein [Delftia acidovorans SPH-1] 
. . Dethiobacter alkaliphilus AHT 1 ..................................   95  2 hits [firmicutes]             RNP-1 like RNA-binding protein [Dethiobacter alkaliphilus A
. . Bacteroides caccae ATCC 43185 ....................................   95  6 hits [CFB group bacteria]     hypothetical protein BACCAC_00656 [Bacteroides caccae ATCC 
. . Desulfohalobium retbaense DSM 5692 ...............................   94  4 hits [d-proteobacteria]       RNP-1 like RNA-binding protein [Desulfohalobium retbaense D
. . Nitrosococcus oceani ATCC 19707 ..................................   94  2 hits [g-proteobacteria]       RNA-binding protein, RNP-1 [Nitrosococcus oceani ATCC 19707
. . Nitrosococcus oceani AFC27 .......................................   94  2 hits [g-proteobacteria]       RNA-binding protein, RNP-1 [Nitrosococcus oceani ATCC 19707
. . Campylobacter showae RM3277 ......................................   94  2 hits [e-proteobacteria]       RNA-binding region RNP-1 [Campylobacter showae RM3277] >gi|
. . Cyanothece sp. CCY0110 ...........................................   94  8 hits [cyanobacteria]          RNA-binding region RNP-1 [Cyanothece sp. CCY0110] >gi|12662
. . Rhodopirellula baltica SH 1 ......................................   94  2 hits [planctomycetes]         RNA-binding protein [Rhodopirellula baltica SH 1] >gi|32446
. . Arthrospira platensis str. Paraca ................................   94  3 hits [cyanobacteria]          RNA-binding region RNP-1 [Arthrospira platensis str. Paraca]
. . Parabacteroides merdae ATCC 43184 ................................   94  6 hits [CFB group bacteria]     hypothetical protein PARMER_03714 [Parabacteroides merdae A
. . bacterium Ellin514 ...............................................   94  8 hits [verrucomicrobia]        RNP-1 like RNA-binding protein [bacterium Ellin514] >gi|223
. . Sulfurospirillum deleyianum DSM 6946 .............................   93  2 hits [e-proteobacteria]       RNP-1 like RNA-binding protein [Sulfurospirillum deleyianum
. . Symbiobacterium thermophilum IAM 14863 ...........................   93  8 hits [firmicutes]             glycine-rich RNA-binding protein [Symbiobacterium thermophi
. . Arthrospira platensis NIES-39 ....................................   93  3 hits [cyanobacteria]          RNA-binding protein [Arthrospira platensis NIES-39]
. . Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)' ........   93  4 hits [spirochetes]            RNA-binding protein [Leptospira biflexa serovar Patoc strai
. . Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)' .........   93  4 hits [spirochetes]            RNA-binding protein [Leptospira biflexa serovar Patoc strai
. . Comamonas testosteroni CNB-2 .....................................   93  6 hits [b-proteobacteria]       RNA-binding protein RNP-3 [Comamonas testosteroni CNB-2] >g
. . Comamonas testosteroni KF-1 ......................................   93  6 hits [b-proteobacteria]       RNP-1 like RNA-binding protein [Comamonas testosteroni KF-1
. . Parabacteroides sp. D13 ..........................................   93  6 hits [CFB group bacteria]     conserved hypothetical protein [Parabacteroides sp. D13] >g
. . Acidovorax ebreus TPSY ...........................................   93  6 hits [b-proteobacteria]       RNP-1 like RNA-binding protein [Acidovorax ebreus TPSY] >gi
. . Acidovorax sp. JS42 ..............................................   93  6 hits [b-proteobacteria]       RNP-1 like RNA-binding protein [Acidovorax sp. JS42] >gi|12
. . Bacteroides vulgatus ATCC 8482 ...................................   93  6 hits [CFB group bacteria]     putative RNA-binding protein rbpA [Bacteroides vulgatus ATC
. . Bacteroides dorei DSM 17855 ......................................   93  6 hits [CFB group bacteria]     putative RNA-binding protein rbpA [Bacteroides vulgatus ATC
. . Bacteroides sp. 9_1_42FAA ........................................   93  4 hits [CFB group bacteria]     putative RNA-binding protein rbpA [Bacteroides vulgatus ATC
. . Bacteroides dorei 5_1_36/D4 ......................................   93  4 hits [CFB group bacteria]     putative RNA-binding protein rbpA [Bacteroides vulgatus ATC
. . Bacteroides sp. 4_3_47FAA ........................................   93  6 hits [CFB group bacteria]     putative RNA-binding protein rbpA [Bacteroides vulgatus ATC
. . Bacteroides sp. 3_1_33FAA ........................................   93  4 hits [CFB group bacteria]     putative RNA-binding protein rbpA [Bacteroides vulgatus ATC
. . Bacteroides vulgatus PC510 .......................................   93  6 hits [CFB group bacteria]     putative RNA-binding protein rbpA [Bacteroides vulgatus ATC
. . Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2 ....   93  2 hits [CFB group bacteria]     putative RNA-binding protein RbpA [Candidatus Azobacteroide
. . Bacteroides finegoldii DSM 17565 .................................   93  6 hits [CFB group bacteria]     RNA-binding protein [Bacteroides finegoldii DSM 17565] >gi|
. . Bacteroides cellulosilyticus DSM 14838 ...........................   93  8 hits [CFB group bacteria]     hypothetical protein BACCELL_04102 [Bacteroides cellulosily
. . Parabacteroides distasonis ATCC 8503 .............................   93  6 hits [CFB group bacteria]     putative RNA-binding protein rbpA [Parabacteroides distason
. . Bacteroides sp. 2_1_7 ............................................   93  3 hits [CFB group bacteria]     putative RNA-binding protein rbpA [Parabacteroides distason
. . Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 .   92  6 hits [d-proteobacteria]       RNP-1 like RNA-binding protein [Desulfovibrio desulfuricans
. . Cyanothece sp. ATCC 51142 ........................................   92 10 hits [cyanobacteria]          RNA-binding protein [Cyanothece sp. ATCC 51142] >gi|1716994
. . Chlorobium limicola DSM 245 ......................................   92  4 hits [green sulfur bacteria]  RNP-1 like RNA-binding protein [Chlorobium limicola DSM 245
. . Alistipes putredinis DSM 17216 ...................................   92  2 hits [CFB group bacteria]     hypothetical protein ALIPUT_01020 [Alistipes putredinis DSM
. . Campylobacter concisus 13826 .....................................   92  1 hit  [e-proteobacteria]       31 kDa ribonucleoprotein, (RNA-binding proteinRNP-T) (RNA-b
. . Synechococcus sp. PCC 7002 .......................................   92  4 hits [cyanobacteria]          RNA-binding protein [Synechococcus sp. PCC 7002] >gi|169885
. . Hahella chejuensis KCTC 2396 .....................................   92  4 hits [g-proteobacteria]       RNA-binding protein [Hahella chejuensis KCTC 2396] >gi|8363
. . Variovorax paradoxus S110 ........................................   92  4 hits [b-proteobacteria]       RNP-1 like RNA-binding protein [Variovorax paradoxus S110] 
. . Bacteroides intestinalis DSM 17393 ...............................   92  8 hits [CFB group bacteria]     hypothetical protein BACINT_01856 [Bacteroides intestinalis
. . Thermosinus carboxydivorans Nor1 .................................   92  2 hits [firmicutes]             RNP-1  like RNA-binding protein [Thermosinus carboxydivoran
. . Arthrospira maxima CS-328 ........................................   91  6 hits [cyanobacteria]          RNP-1 like RNA-binding protein [Arthrospira maxima CS-328] 
. . Bacteroides thetaiotaomicron VPI-5482 ............................   91  6 hits [CFB group bacteria]     putative RNA-binding protein rbpA [Bacteroides thetaiotaomi
. . Bacteroides sp. 1_1_6 ............................................   91  6 hits [CFB group bacteria]     putative RNA-binding protein rbpA [Bacteroides thetaiotaomi
. . Chlorobium tepidum TLS ...........................................   91  3 hits [green sulfur bacteria]  RNA-binding protein [Chlorobium tepidum TLS]
. . Nostoc punctiforme PCC 73102 .....................................   91  8 hits [cyanobacteria]          RNP-1 like RNA-binding protein [Nostoc punctiforme PCC 7310
. . Moorella thermoacetica ATCC 39073 ................................   91  2 hits [firmicutes]             RNA-binding region RNP-1 [Moorella thermoacetica ATCC 39073
. . Nitrosococcus halophilus Nc4 .....................................   91  4 hits [g-proteobacteria]       RNP-1 like RNA-binding protein [Nitrosococcus halophilus Nc
. . Candidatus Desulforudis audaxviator MP104C .......................   91  2 hits [firmicutes]             RNP1-like RNA-binding protein [Candidatus Desulforudis auda
. . Synechocystis sp. PCC 6803 .......................................   91  6 hits [cyanobacteria]          RNA-binding protein [Synechocystis sp. PCC 6803] >gi|165267
. . Nostoc sp. PCC 7120 ..............................................   91 18 hits [cyanobacteria]          RNA binding protein [Nostoc sp. PCC 7120] >gi|81859084|sp|Q
. . Anabaena variabilis ..............................................   91  7 hits [cyanobacteria]          RNA binding protein [Nostoc sp. PCC 7120] >gi|81859084|sp|Q
. . Bacteroides uniformis ATCC 8492 ..................................   91  6 hits [CFB group bacteria]     hypothetical protein BACUNI_01393 [Bacteroides uniformis AT
. . Bacteroides sp. D20 ..............................................   91  6 hits [CFB group bacteria]     hypothetical protein BACUNI_01393 [Bacteroides uniformis AT
. . Thermosynechococcus elongatus BP-1 ...............................   91  2 hits [cyanobacteria]          RNA-binding protein [Thermosynechococcus elongatus BP-1] >g
. . Cylindrospermopsis raciborskii CS-505 ............................   91  4 hits [cyanobacteria]          RNA-binding region protein RNP-1 [Cylindrospermopsis racibo
. . Allochromatium vinosum DSM 180 ...................................   91  6 hits [g-proteobacteria]       RNP-1 like RNA-binding protein [Allochromatium vinosum DSM 
. . 'Nostoc azollae' 0708 ............................................   91  8 hits [cyanobacteria]          RNP-1 like RNA-binding protein ['Nostoc azollae' 0708] >gi|
. . Anabaena variabilis ATCC 29413 ...................................   90 12 hits [cyanobacteria]          RNA-binding region RNP-1 [Anabaena variabilis ATCC 29413] >
. . Microcoleus chthonoplastes PCC 7420 ..............................   90  8 hits [cyanobacteria]          RNA-binding protein [Microcoleus chthonoplastes PCC 7420] >
. . Desulfovibrio salexigens DSM 2638 ................................   90  6 hits [d-proteobacteria]       RNP-1 like RNA-binding protein [Desulfovibrio salexigens DS
. . Leptothrix cholodnii SP-6 ........................................   90  2 hits [b-proteobacteria]       RNP-1 like RNA-binding protein [Leptothrix cholodnii SP-6] 
. . Acidovorax delafieldii 2AN .......................................   90  4 hits [b-proteobacteria]       RNP-1 like RNA-binding protein [Acidovorax delafieldii 2AN]
. . Heliobacterium modesticaldum Ice1 ................................   90  2 hits [firmicutes]             RNA binding protein [Heliobacterium modesticaldum Ice1] >gi
. . Trichodesmium erythraeum IMS101 ..................................   90  6 hits [cyanobacteria]          RNA-binding region RNP-1 [Trichodesmium erythraeum IMS101] 
. . Acidovorax avenae subsp. avenae ATCC 19860 .......................   90  4 hits [b-proteobacteria]       RNP-1 like RNA-binding protein [Acidovorax avenae subsp. av
. . Anabaena sp. .....................................................   90  1 hit  [cyanobacteria]          RNA-binding protein [Anabaena sp.]
. . Alistipes shahii WAL 8301 ........................................   90  1 hit  [CFB group bacteria]     RNA-binding proteins (RRM domain) [Alistipes shahii WAL 830
. . Desulfitobacterium hafniense DCB-2 ...............................   90  2 hits [firmicutes]             RNP-1 like RNA-binding protein [Desulfitobacterium hafniens
. . Desulfovibrio aespoeensis Aspo-2 .................................   90  8 hits [d-proteobacteria]       RNP-1 like RNA-binding protein [Desulfovibrio aespoeensis A
. . Synechococcus sp. PCC 7335 .......................................   90  6 hits [cyanobacteria]          RNA-binding protein, putative [Synechococcus sp. PCC 7335] 
. . Dichelobacter nodosus VCS1703A ...................................   90  2 hits [g-proteobacteria]       RNA recognition motif-containing protein [Dichelobacter nod
. . Polaromonas naphthalenivorans CJ2 ................................   90  8 hits [b-proteobacteria]       RNP-1 like RNA-binding protein [Polaromonas naphthalenivora
. . Pelotomaculum thermopropionicum SI ...............................   90  2 hits [firmicutes]             hypothetical protein PTH_0836 [Pelotomaculum thermopropioni
. . Polaromonas sp. JS666 ............................................   90  4 hits [b-proteobacteria]       RNA recognition motif-containing protein [Polaromonas sp. J
. . Chlorobium luteolum DSM 273 ......................................   89  4 hits [green sulfur bacteria]  RNA recognition motif-containing protein [Chlorobium luteol
. . Chryseobacterium gleum ATCC 35910 ................................   89  2 hits [CFB group bacteria]     probable RNA-binding protein [Chryseobacterium gleum ATCC 3
. . Flavobacterium psychrophilum JIP02/86 ............................   89  2 hits [CFB group bacteria]     putative RNA-binding protein RbpA [Flavobacterium psychroph
. . Leptospira interrogans serovar Lai str. 56601 ....................   89  4 hits [spirochetes]            RNA-binding protein [Leptospira interrogans serovar Lai str
. . Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130 ...   89  4 hits [spirochetes]            RNA-binding protein [Leptospira interrogans serovar Lai str
. . Leptospira borgpetersenii serovar Hardjo-bovis L550 ..............   89  4 hits [spirochetes]            RNA-binding protein [Leptospira interrogans serovar Lai str
. . Leptospira borgpetersenii serovar Hardjo-bovis JB197 .............   89  4 hits [spirochetes]            RNA-binding protein [Leptospira interrogans serovar Lai str
. . Chlorobium ferrooxidans DSM 13031 ................................   89  2 hits [green sulfur bacteria]  RNA-binding region RNP-1 (RNA recognition motif) [Chlorobiu
. . Pirellula staleyi DSM 6068 .......................................   89  4 hits [planctomycetes]         RNP-1 like RNA-binding protein [Pirellula staleyi DSM 6068]
. . Flavobacteria bacterium BAL38 ....................................   89  2 hits [CFB group bacteria]     RNA binding protein [Flavobacteria bacterium BAL38] >gi|126
. . Bacteroides stercoris ATCC 43183 .................................   89  4 hits [CFB group bacteria]     hypothetical protein BACSTE_03831 [Bacteroides stercoris AT
. . Bacteroides eggerthii DSM 20697 ..................................   89  4 hits [CFB group bacteria]     hypothetical protein BACSTE_03831 [Bacteroides stercoris AT
. . Chlorobium chlorochromatii CaD3 ..................................   89  2 hits [green sulfur bacteria]  RNA recognition motif-containing protein [Chlorobium chloro
. . Chlorobium phaeovibrioides DSM 265 ...............................   89  4 hits [green sulfur bacteria]  RNP-1 like RNA-binding protein [Prosthecochloris vibrioform
. . Verminephrobacter eiseniae EF01-2 ................................   89  4 hits [b-proteobacteria]       RNP-1 like RNA-binding protein [Verminephrobacter eiseniae 
. . Cyanothece sp. PCC 7425 ..........................................   88 10 hits [cyanobacteria]          RNP-1 like RNA-binding protein [Cyanothece sp. PCC 7425] >g
. . Cytophaga hutchinsonii ATCC 33406 ................................   88  2 hits [CFB group bacteria]     RNA binding protein [Cytophaga hutchinsonii ATCC 33406] >gi
. . Bdellovibrio bacteriovorus HD100 .................................   88  6 hits [d-proteobacteria]       putative RNA-binding protein [Bdellovibrio bacteriovorus HD
. . Nitrococcus mobilis Nb-231 .......................................   88  4 hits [g-proteobacteria]       RNA-binding protein [Nitrococcus mobilis Nb-231] >gi|887890
. . Ammonifex degensii KC4 ...........................................   88  2 hits [firmicutes]             RNP-1 like RNA-binding protein [Ammonifex degensii KC4] >gi
. . Bacteroides sp. 2_1_33B ..........................................   88  4 hits [CFB group bacteria]     RNA binding protein [Parabacteroides distasonis ATCC 8503] 
. . Nitratiruptor sp. SB155-2 ........................................   88  2 hits [e-proteobacteria]       RNA-binding protein RNP-1 [Nitratiruptor sp. SB155-2] >gi|1
. . Pelodictyon phaeoclathratiforme BU-1 .............................   87  4 hits [green sulfur bacteria]  RNP-1 like RNA-binding protein [Pelodictyon phaeoclathratif
. . Candidatus Solibacter usitatus Ellin6076 .........................   87  6 hits [bacteria]               RNP-1 like RNA-binding protein [Solibacter usitatus Ellin60
. . Porphyromonas gingivalis W83 .....................................   87  2 hits [CFB group bacteria]     RNA-binding protein [Porphyromonas gingivalis W83] >gi|1889
. . Porphyromonas gingivalis ATCC 33277 ..............................   87  2 hits [CFB group bacteria]     RNA-binding protein [Porphyromonas gingivalis W83] >gi|1889
. . Halothiobacillus neapolitanus c2 .................................   87  2 hits [g-proteobacteria]       RNP-1 like RNA-binding protein [Halothiobacillus neapolitan
. . Flavobacterium johnsoniae UW101 ..................................   87  2 hits [CFB group bacteria]     RNP-1 like RNA-binding protein [Flavobacterium johnsoniae U
. . Beggiatoa sp. PS .................................................   87  2 hits [g-proteobacteria]       RNA-binding protein [Beggiatoa sp. PS] >gi|152068596|gb|EDN
. . Chlorobium phaeobacteroides DSM 266 ..............................   87  4 hits [green sulfur bacteria]  RNP-1 like RNA-binding protein [Chlorobium phaeobacteroides
. . Gloeobacter violaceus PCC 7421 ...................................   87  2 hits [cyanobacteria]          RNA-binding protein [Gloeobacter violaceus PCC 7421] >gi|35
. . Desulfovibrio magneticus RS-1 ....................................   87  6 hits [d-proteobacteria]       RNA-binding protein [Desulfovibrio magneticus RS-1] >gi|239
. . Microcystis aeruginosa PCC 7806 ..................................   86  1 hit  [cyanobacteria]          rbpF/A2 [Microcystis aeruginosa PCC 7806]
. . Chthoniobacter flavus Ellin428 ...................................   86  4 hits [verrucomicrobia]        RNP-1 like RNA-binding protein [Chthoniobacter flavus Ellin
. . Coraliomargarita akajimensis DSM 45221 ...........................   86  2 hits [verrucomicrobia]        RNP-1 like RNA-binding protein [Coraliomargarita akajimensi
. . Desulfovibrio sp. FW1012B ........................................   86  8 hits [d-proteobacteria]       RNP-1 like RNA-binding protein [Desulfovibrio sp. FW1012B] 
. . Desulfovibrio vulgaris str. 'Miyazaki F' .........................   85  6 hits [d-proteobacteria]       RNP-1 like RNA-binding protein [Desulfovibrio vulgaris str.
. . Desulfotomaculum reducens MI-1 ...................................   85  2 hits [firmicutes]             RNP-1-like RNA-binding protein [Desulfotomaculum reducens M
. . Cyanothece sp. PCC 7424 ..........................................   85  4 hits [cyanobacteria]          RNP-1 like RNA-binding protein [Cyanothece sp. PCC 7424] >g
. . Verrucomicrobium spinosum DSM 4136 ...............................   85  1 hit  [verrucomicrobia]        RNA-binding region RNP-1 [Verrucomicrobium spinosum DSM 413
. . Cyanothece sp. PCC 8801 ..........................................   85  4 hits [cyanobacteria]          RNP-1 like RNA-binding protein [Cyanothece sp. PCC 8801] >g
. . Cyanothece sp. PCC 8802 ..........................................   85  4 hits [cyanobacteria]          RNP-1 like RNA-binding protein [Cyanothece sp. PCC 8801] >g
. . Porphyromonas endodontalis ATCC 35406 ............................   85  2 hits [CFB group bacteria]     RNA-binding protein [Porphyromonas endodontalis ATCC 35406]
. . Microcystis aeruginosa NIES-843 ..................................   85  2 hits [cyanobacteria]          RNA-binding region protein [Microcystis aeruginosa NIES-843
. . Porphyromonas uenonis 60-3 .......................................   84  2 hits [CFB group bacteria]     31 kDa ribonucleoprotein [Porphyromonas uenonis 60-3] >gi|2
. . Cardiobacterium hominis ATCC 15826 ...............................   84  2 hits [g-proteobacteria]       RNA-binding protein [Cardiobacterium hominis ATCC 15826] >g
. . Blattabacterium sp. (Periplaneta americana) str. BPLAN ...........   84  2 hits [CFB group bacteria]     RNP-1 RNA-binding protein [Blattabacterium sp. (Periplaneta
. . Candidatus Kuenenia stuttgartiensis ..............................   83  1 hit  [planctomycetes]         rna binding protein [Candidatus Kuenenia stuttgartiensis]
. . Candidatus Koribacter versatilis Ellin345 ........................   83  2 hits [bacteria]               RNA-binding protein, RNP-1 [Candidatus Koribacter versatili
. . Synechococcus elongatus PCC 6301 .................................   83  3 hits [cyanobacteria]          ss-DNA binding protein 12RNP2 precursor [Synechococcus elon
. . Prevotella bergensis DSM 17361 ...................................   83  2 hits [CFB group bacteria]     RNA-binding protein [Prevotella bergensis DSM 17361] >gi|27
. . Blattabacterium sp. (Blattella germanica) str. Bge ...............   83  2 hits [CFB group bacteria]     putative RNA-binding protein [Blattabacterium sp. (Blattell
. . Helicobacter cinaedi CCUG 18818 ..................................   83  1 hit  [e-proteobacteria]       hypothetical protein HcinC1_04807 [Helicobacter cinaedi CCU
. . Synechococcus sp. ................................................   83  2 hits [cyanobacteria]          12RNP2 protein - Synechococcus sp. (PCC 6301) >gi|961511|db
. . Synechococcus elongatus PCC 7942 .................................   83  3 hits [cyanobacteria]          12RNP2 protein - Synechococcus sp. (PCC 6301) >gi|961511|db
. . Aeromonas salmonicida subsp. salmonicida A449 ....................   82  2 hits [g-proteobacteria]       RNA-binding protein [Aeromonas salmonicida subsp. salmonici
. . Aeromonas hydrophila subsp. hydrophila ATCC 7966 .................   82  2 hits [g-proteobacteria]       RNA-binding protein [Aeromonas hydrophila subsp. hydrophila
. . Chlorobaculum parvum NCIB 8327 ...................................   82  4 hits [green sulfur bacteria]  RNP-1 like RNA-binding protein [Chlorobaculum parvum NCIB 8
. . Cyanothece sp. PCC 7822 ..........................................   82  4 hits [cyanobacteria]          RNP-1 like RNA-binding protein [Cyanothece sp. PCC 7822] >g
. . Methylacidiphilum infernorum V4 ..................................   82  2 hits [verrucomicrobia]        RNA-binding protein (RRM domain) [Methylacidiphilum inferno
. . Nodularia spumigena CCY9414 ......................................   82  2 hits [cyanobacteria]          RNA-binding region protein [Nodularia spumigena CCY9414] >g
. . Streptomyces hygroscopicus ATCC 53653 ............................   82  1 hit  [high GC Gram+]          RNA-binding protein [Streptomyces hygroscopicus ATCC 53653]
. . Desulfovibrio vulgaris str. Hildenborough ........................   82  6 hits [d-proteobacteria]       RNA-binding protein [Desulfovibrio vulgaris subsp. vulgaris
. . Desulfovibrio vulgaris DP4 .......................................   82  6 hits [d-proteobacteria]       RNA-binding protein [Desulfovibrio vulgaris subsp. vulgaris
. . Desulfovibrio vulgaris RCH1 ......................................   82  6 hits [d-proteobacteria]       RNA-binding protein [Desulfovibrio vulgaris subsp. vulgaris
. . Synechococcus sp. JA-2-3B'a(2-13) ................................   82  2 hits [cyanobacteria]          putative RNA-binding protein [Synechococcus sp. JA-2-3B'a(2
. . Desulfotomaculum acetoxidans DSM 771 .............................   81  2 hits [firmicutes]             RNP-1 like RNA-binding protein [Desulfotomaculum acetoxidan
. . Chloroflexus aurantiacus J-10-fl .................................   81  2 hits [GNS bacteria]           RNP-1 like RNA-binding protein [Chloroflexus aurantiacus J-
. . Chloroflexus sp. Y-400-fl ........................................   81  2 hits [GNS bacteria]           RNP-1 like RNA-binding protein [Chloroflexus aurantiacus J-
. . Dyadobacter fermentans DSM 18053 .................................   81  2 hits [CFB group bacteria]     RNP-1 like RNA-binding protein [Dyadobacter fermentans DSM 
. . Syntrophobacter fumaroxidans MPOB ................................   81  2 hits [d-proteobacteria]       RNP-1 like RNA-binding protein [Syntrophobacter fumaroxidan
. . Helicobacter hepaticus ATCC 51449 ................................   80  2 hits [e-proteobacteria]       hypothetical protein HH0319 [Helicobacter hepaticus ATCC 51
. . cyanobacterium UCYN-A ............................................   80  2 hits [cyanobacteria]          RRM domain-containing RNA-binding protein [cyanobacterium U
. . Synechococcus sp. JA-3-3Ab .......................................   80  2 hits [cyanobacteria]          putative RNA-binding protein [Synechococcus sp. JA-3-3Ab] >
. . Chloroflexus aggregans DSM 9485 ..................................   80  2 hits [GNS bacteria]           RNP-1 like RNA-binding protein [Chloroflexus aggregans DSM 
. . Bacteroides fragilis .............................................   79  1 hit  [CFB group bacteria]     RNA binding protein [Bacteroides fragilis]
. . Carboxydothermus hydrogenoformans Z-2901 .........................   79  2 hits [firmicutes]             RNA-binding protein [Carboxydothermus hydrogenoformans Z-29
. . Haliangium ochraceum DSM 14365 ...................................   78  2 hits [d-proteobacteria]       RNP-1 like RNA-binding protein [Haliangium ochraceum DSM 14
. . Mariprofundus ferrooxydans PV-1 ..................................   77  2 hits [proteobacteria]         RNA-binding region RNP-1 (RNA recognition motif) [Mariprofu
. . Synechococcus sp. RCC307 .........................................   77  2 hits [cyanobacteria]          RNA-binding protein [Synechococcus sp. RCC307] >gi|14785048
. Hydra magnipapillata -----------------------------------------------   96  2 hits [hydrozoans]             PREDICTED: similar to cp31AHv protein [Hydra magnipapillata]
. Pisum sativum (peas) ...............................................   89  4 hits [eudicots]               ribonucleoprotein [Pisum sativum] >gi|10179830|gb|AAG13900.
. Nicotiana sylvestris ...............................................   87 19 hits [eudicots]               RecName: Full=31 kDa ribonucleoprotein, chloroplastic; Flag
. Populus trichocarpa (black cottonwood) .............................   87 26 hits [eudicots]               predicted protein [Populus trichocarpa] >gi|118486956|gb|AB
. Nicotiana tabacum (tobacco) ........................................   87  3 hits [eudicots]               RecName: Full=28 kDa ribonucleoprotein, chloroplastic; Shor
. Mesembryanthemum crystallinum ......................................   86  4 hits [eudicots]               chloroplast RNA binding protein [Mesembryanthemum crystalli
. Persea americana ...................................................   86  4 hits [flowering plants]       RNA-binding protein precursor [Persea americana]
. Sorghum bicolor (milo) .............................................   84 24 hits [monocots]               hypothetical protein SORBIDRAFT_02g011330 [Sorghum bicolor]
. Vitis vinifera (wine grape) ........................................   84 14 hits [eudicots]               unnamed protein product [Vitis vinifera]
. Nematostella vectensis .............................................   84  2 hits [sea anemones]           hypothetical protein NEMVEDRAFT_v1g47988 [Nematostella vect
. Spinacia oleracea ..................................................   84  4 hits [eudicots]               RecName: Full=28 kDa ribonucleoprotein, chloroplastic; Shor
. Ricinus communis ...................................................   84  8 hits [eudicots]               ribonucleoprotein, chloroplast, putative [Ricinus communis]
. Zea mays (maize) ...................................................   83 70 hits [monocots]               nucleic acid binding protein1 [Zea mays] >gi|168526|gb|AAA3
. Lilium longiflorum .................................................   83  2 hits [monocots]               GRSF [Lilium longiflorum]
. Arabidopsis thaliana (thale-cress) .................................   83 84 hits [eudicots]               CP29; RNA binding / poly(U) binding [Arabidopsis thaliana] 
. Oryza sativa Japonica Group (Japanese rice) ........................   83 58 hits [monocots]               Os09g0565200 [Oryza sativa (japonica cultivar-group)] >gi|5
. Oryza sativa Indica Group (Indian rice) ............................   83 14 hits [monocots]               Os09g0565200 [Oryza sativa (japonica cultivar-group)] >gi|5
. Hordeum vulgare (barley) ...........................................   83  1 hit  [monocots]               RecName: Full=Glycine-rich RNA-binding protein blt801; AltN
. Hordeum vulgare subsp. vulgare (barley) ............................   83  6 hits [monocots]               RecName: Full=Glycine-rich RNA-binding protein blt801; AltN
. Ostreococcus tauri .................................................   83  2 hits [green algae]            Ps16 protein (ISS) [Ostreococcus tauri]
. Physcomitrella patens subsp. patens ................................   82 12 hits [mosses]                 predicted protein [Physcomitrella patens subsp. patens] >gi
. Triticum aestivum (common wheat) ...................................   82  5 hits [monocots]               glycine-rich RNA-binding protein [Triticum aestivum]
. Glycine max (soybeans) .............................................   82  6 hits [eudicots]               RNA-binding protein [Glycine max]
. Picea sitchensis ...................................................   82  9 hits [conifers]               unknown [Picea sitchensis]
. Nicotiana plumbaginifolia (leadwort-leaved tobacco) ................   82  8 hits [eudicots]               RecName: Full=31 kDa ribonucleoprotein, chloroplastic; AltN
. Ostreococcus lucimarinus CCE9901 ...................................   81  4 hits [green algae]            predicted protein [Ostreococcus lucimarinus CCE9901] >gi|14
. Micromonas pusilla CCMP1545 ........................................   81  2 hits [green algae]            predicted protein [Micromonas pusilla CCMP1545]
. Lolium perenne (perennial ryegrass) ................................   80  1 hit  [monocots]               glycine-rich RNA-binding protein [Lolium perenne]
. Micromonas sp. RCC299 ..............................................   80  4 hits [green algae]            predicted protein [Micromonas sp. RCC299] >gi|226516486|gb|
. Daucus carota (Queen Anne's lace) ..................................   79  3 hits [eudicots]               RecName: Full=Glycine-rich RNA-binding protein >gi|18347|em
. Gibberella zeae PH-1 ...............................................   78  1 hit  [ascomycetes]            hypothetical protein FG11064.1 [Gibberella zeae PH-1]
. Cryptococcus neoformans var. neoformans JEC21 ......................   78  4 hits [basidiomycetes]         glycine-rich RNA binding protein [Cryptococcus neoformans v
. Cryptococcus neoformans var. neoformans B-3501A ....................   78  2 hits [basidiomycetes]         glycine-rich RNA binding protein [Cryptococcus neoformans v
. Solanum tuberosum (potatoes) .......................................   78  2 hits [eudicots]               single-stranded DNA binding protein precursor [Solanum tube
. Catharanthus roseus (chula) ........................................   78  2 hits [eudicots]               putative glycine-rich RNA binding protein 1 [Catharanthus r
. Capsicum annuum ....................................................   77  1 hit  [eudicots]               RNA-binding protein RZ-1 [Capsicum annuum]
. Nicotiana glutinosa ................................................   77  1 hit  [eudicots]               RNA-binding protein [Nicotiana glutinosa]
. Entamoeba histolytica HM-1:IMSS ....................................   77  2 hits [eukaryotes]             RNA recognition motif domain containing protein [Entamoeba 
. Solanum commersonii ................................................   77  1 hit  [eudicots]               SGRP-1 [Solanum commersonii]
. Rumex obtusifolius .................................................   77  1 hit  [eudicots]               putative glycine rich protein [Rumex obtusifolius]
. Verticillium albo-atrum VaMs.102 ...................................   77  2 hits [ascomycetes]            gar2 [Verticillium albo-atrum VaMs.102]
. Chorispora bungeana ................................................   77  1 hit  [eudicots]               putative glycine-rich RNA-binding protein [Chorispora bunge
. Mesostigma viride ..................................................   77  2 hits [green plants]           chloroplast single strand DNA binding protein [Mesostigma v
. Populus trichocarpa x Populus deltoides ............................   77  2 hits [eudicots]               unknown [Populus trichocarpa x Populus deltoides]
. Branchiostoma floridae .............................................   77  2 hits [lancelets]              hypothetical protein BRAFLDRAFT_71461 [Branchiostoma florid

BLAST

PROTOCOL

a)

BLASTp versus Swissprot, NCBI default parameters

b)

BLASTp versus NR, NCBI default parameters apart from "Number of descriptions_1000"


RESULTS ANALYSIS

We obtain better E-value with the blast vs NR. It seems taht our sequence is coding for a RNP-1 like RNA-binding protein

RAW RESULTS
a)
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q9WX37.3|RBPE_ANASP  RecName: Full=Putative RNA-binding pro...  91.3    1e-18
sp|Q9WX39.3|RBPF_ANASP  RecName: Full=Putative RNA-binding pro...  89.7    3e-18
sp|Q57014.3|RBPA_SYNY3  RecName: Full=Putative RNA-binding pro...  89.4    5e-18
sp|Q44554.3|RBPB_ANASP  RecName: Full=Putative RNA-binding pro...  89.0    6e-18
sp|P19683.1|ROC4_NICSY  RecName: Full=31 kDa ribonucleoprotein...  87.8    1e-17
sp|P19682.1|ROC3_NICSY  RecName: Full=28 kDa ribonucleoprotein...  87.8    2e-17
sp|P28644.1|ROC1_SPIOL  RecName: Full=28 kDa ribonucleoprotein...  84.3    2e-16
sp|Q43349.2|ROC2_ARATH  RecName: Full=29 kDa ribonucleoprotein...  83.6    3e-16
sp|Q43472.1|GRP_HORVU  RecName: Full=Glycine-rich RNA-binding ...  83.2    3e-16
sp|P49314.1|ROC2_NICPL  RecName: Full=31 kDa ribonucleoprotein...  82.0    8e-16
sp|Q08937.1|ROC2_NICSY  RecName: Full=29 kDa ribonucleoprotein...  82.0    8e-16
sp|Q44556.3|RBPD_ANASP  RecName: Full=Putative RNA-binding pro...  81.6    1e-15
sp|Q04836.1|ROC3_ARATH  RecName: Full=31 kDa ribonucleoprotein...  81.3    1e-15
sp|Q9ZUU4.1|ROC1_ARATH  RecName: Full=Ribonucleoprotein At2g37...  80.5    2e-15
sp|Q03878.1|GRP1_DAUCA  RecName: Full=Glycine-rich RNA-binding...  79.7    5e-15
sp|P49313.1|ROC1_NICPL  RecName: Full=30 kDa ribonucleoprotein...  78.6    9e-15
sp|P10979.1|GRPA_MAIZE  RecName: Full=Glycine-rich RNA-binding...  78.6    1e-14
sp|Q08935.1|ROC1_NICSY  RecName: Full=29 kDa ribonucleoprotein...  78.2    1e-14
sp|Q03250.1|GRP7_ARATH  RecName: Full=Glycine-rich RNA-binding...  78.2    1e-14
sp|P49310.1|GRP1_SINAL  RecName: Full=Glycine-rich RNA-binding...  76.6    3e-14
sp|Q03251.1|GRP8_ARATH  RecName: Full=Glycine-rich RNA-binding...  76.6    3e-14
sp|Q9SVM8.1|GRP2_ARATH  RecName: Full=Glycine-rich RNA-binding...  76.3    5e-14
sp|Q44560.3|RBPA_ANASP  RecName: Full=Putative RNA-binding pro...  75.9    7e-14
sp|Q05966.1|GRP10_BRANA  RecName: Full=Glycine-rich RNA-bindin...  75.1    1e-13
sp|Q99070.1|GRP2_SORBI  RecName: Full=Glycine-rich RNA-binding...  74.7    1e-13
sp|P19684.1|ROC5_NICSY  RecName: Full=33 kDa ribonucleoprotein...  74.7    1e-13
sp|P49311.1|GRP2_SINAL  RecName: Full=Glycine-rich RNA-binding...  73.6    3e-13
sp|P42731.1|PABP2_ARATH  RecName: Full=Polyadenylate-binding p...  68.9    7e-12
sp|P82277.1|RRP2_SPIOL  RecName: Full=30S ribosomal protein 2,...  67.0    2e-11
sp|Q14011.1|CIRBP_HUMAN  RecName: Full=Cold-inducible RNA-bind...  66.6    4e-11
sp|Q8C7E9.2|CSTFT_MOUSE  RecName: Full=Cleavage stimulation fa...  65.9    6e-11
sp|P60826.1|CIRBP_CRIGR  RecName: Full=Cold-inducible RNA-bind...  65.9    6e-11
sp|Q9H0L4.1|CSTFT_HUMAN  RecName: Full=Cleavage stimulation fa...  65.5    9e-11
sp|Q9IBD1.2|CELF3_DANRE  RecName: Full=CUGBP Elav-like family ...  64.7    1e-10
sp|Q8HXM1.1|CSTF2_BOVIN  RecName: Full=Cleavage stimulation fa...  64.7    1e-10
sp|Q91579.2|CEL3A_XENLA  RecName: Full=CUGBP Elav-like family ...  64.7    1e-10
sp|Q5RDA3.1|CSTF2_PONAB  RecName: Full=Cleavage stimulation fa...  64.3    2e-10
sp|Q2GSX8.1|PABP_CHAGB  RecName: Full=Polyadenylate-binding pr...  64.3    2e-10
sp|P33240.1|CSTF2_HUMAN  RecName: Full=Cleavage stimulation fa...  64.3    2e-10
sp|Q08E07.1|CELF3_BOVIN  RecName: Full=CUGBP Elav-like family ...  64.3    2e-10
sp|Q8CIN6.1|CELF3_MOUSE  RecName: Full=CUGBP Elav-like family ...  64.3    2e-10
sp|Q9DED4.1|CIRBB_XENLA  RecName: Full=Cold-inducible RNA-bind...  64.3    2e-10
sp|Q5SZQ8.1|CELF3_HUMAN  RecName: Full=CUGBP Elav-like family ...  64.3    2e-10
sp|Q8BIQ5.2|CSTF2_MOUSE  RecName: Full=Cleavage stimulation fa...  64.3    2e-10
sp|P39697.2|RT19_ARATH  RecName: Full=40S ribosomal protein S1...  64.3    2e-10
sp|Q7ZWM3.1|CEL3B_XENLA  RecName: Full=CUGBP Elav-like family ...  63.2    3e-10
sp|Q5RC80.1|RBM39_PONAB  RecName: Full=RNA-binding protein 39;...  63.2    4e-10
sp|Q14498.2|RBM39_HUMAN  RecName: Full=RNA-binding protein 39;...  63.2    4e-10
sp|Q8VH51.1|RBM39_MOUSE  RecName: Full=RNA-binding protein 39;...  63.2    4e-10
sp|Q28IQ9.1|CIRBP_XENTR  RecName: Full=Cold-inducible RNA-bind...  63.2    4e-10
sp|Q1DXH0.1|PABP_COCIM  RecName: Full=Polyadenylate-binding pr...  62.4    7e-10
sp|Q99069.1|GRP1_SORBI  RecName: Full=Glycine-rich RNA-binding...  62.0    8e-10
sp|P27476.1|NSR1_YEAST  RecName: Full=Nuclear localization seq...  62.0    8e-10
sp|Q9PTX2.1|CIRBP_RANCA  RecName: Full=Cold-inducible RNA-bind...  62.0    8e-10
sp|A4QUF0.1|PABP_MAGGR  RecName: Full=Polyadenylate-binding pr...  60.8    2e-09
sp|A1D4K4.1|PABP_NEOFI  RecName: Full=Polyadenylate-binding pr...  60.8    2e-09
sp|Q8N6W0.1|CELF5_HUMAN  RecName: Full=CUGBP Elav-like family ...  60.5    2e-09
sp|Q4WK03.1|PABP_ASPFU  RecName: Full=Polyadenylate-binding pr...  60.5    3e-09
sp|P0CB38.1|PAB4L_HUMAN  RecName: Full=Polyadenylate-binding p...  60.5    3e-09
sp|Q5R8F7.1|PABP1_PONAB  RecName: Full=Polyadenylate-binding p...  60.5    3e-09
sp|P11940.2|PABP1_HUMAN  RecName: Full=Polyadenylate-binding p...  60.5    3e-09
sp|Q0U1G2.3|PABP_PHANO  RecName: Full=Polyadenylate-binding pr...  60.1    4e-09
sp|Q6DEY7.1|EPAB_XENTR  RecName: Full=Embryonic polyadenylate-...  59.7    4e-09
sp|Q6DIV4.1|RBM38_XENTR  RecName: Full=RNA-binding protein 38;...  59.7    4e-09
sp|P29341.1|PABP1_MOUSE  RecName: Full=Polyadenylate-binding p...  59.7    4e-09
sp|Q96J87.1|CELF6_HUMAN  RecName: Full=CUGBP Elav-like family ...  59.7    4e-09
sp|Q9EPH8.1|PABP1_RAT  RecName: Full=Polyadenylate-binding pro...  59.7    5e-09
sp|Q9H361.2|PABP3_HUMAN  RecName: Full=Polyadenylate-binding p...  59.7    5e-09
sp|Q7JGR2.1|PABP5_MACMU  RecName: Full=Polyadenylate-binding p...  59.7    5e-09
sp|Q96DU9.1|PABP5_HUMAN  RecName: Full=Polyadenylate-binding p...  59.3    5e-09
sp|A0JM51.1|CELF5_XENTR  RecName: Full=CUGBP Elav-like family ...  59.3    5e-09
sp|O93235.2|CIRBA_XENLA  RecName: Full=Cold-inducible RNA-bind...  59.3    5e-09
sp|Q6PFR5.1|TRA2A_MOUSE  RecName: Full=Transformer-2 protein h...  59.3    6e-09
sp|Q13595.1|TRA2A_HUMAN  RecName: Full=Transformer-2 protein h...  59.3    6e-09
sp|Q7TN33.1|CELF6_MOUSE  RecName: Full=CUGBP Elav-like family ...  58.9    7e-09
sp|Q6GR16.1|EPABB_XENLA  RecName: Full=Embryonic polyadenylate...  58.9    7e-09
sp|Q6DGV1.1|CELF4_DANRE  RecName: Full=CUGBP Elav-like family ...  58.9    8e-09
sp|Q9H0Z9.2|RBM38_HUMAN  RecName: Full=RNA-binding protein 38;...  58.5    9e-09
sp|Q5ZJX4.1|RBM38_CHICK  RecName: Full=RNA-binding protein 38;...  58.5    9e-09
sp|Q9P3U1.2|YKX5_SCHPO  RecName: Full=Uncharacterized RNA-bind...  58.5    9e-09
sp|Q98SP8.2|EPABA_XENLA  RecName: Full=Embryonic polyadenylate...  58.5    1e-08
sp|P21187.3|PABP_DROME  RecName: Full=Polyadenylate-binding pr...  58.5    1e-08
sp|Q9I8B3.1|RB24B_XENLA  RecName: Full=RNA-binding protein 24-...  58.5    1e-08
sp|Q5ZMA3.2|RBM24_CHICK  RecName: Full=RNA-binding protein 24;...  58.5    1e-08
sp|Q6GQD3.1|RB24A_XENLA  RecName: Full=RNA-binding protein 24-...  58.2    1e-08
sp|Q7S6N6.1|PABP_NEUCR  RecName: Full=Polyadenylate-binding pr...  58.2    1e-08
sp|Q6P8A7.1|RBM24_XENTR  RecName: Full=RNA-binding protein 24;...  58.2    1e-08
sp|P52912.1|TIA1_MOUSE  RecName: Full=Nucleolysin TIA-1; AltNa...  58.2    1e-08
sp|O89086.1|RBM3_MOUSE  RecName: Full=Putative RNA-binding pro...  57.8    1e-08
sp|P31483.3|TIA1_HUMAN  RecName: Full=Nucleolysin TIA-1 isofor...  57.8    1e-08
sp|P98179.1|RBM3_HUMAN  RecName: Full=Putative RNA-binding pro...  57.8    1e-08
sp|Q9BX46.1|RBM24_HUMAN  RecName: Full=RNA-binding protein 24;...  57.8    2e-08
sp|Q7T3I7.2|RBM38_XENLA  RecName: Full=RNA-binding protein 38;...  57.8    2e-08
sp|Q6CSV3.1|PABP_KLULA  RecName: Full=Polyadenylate-binding pr...  57.8    2e-08
sp|P41891.2|GAR2_SCHPO  RecName: Full=Protein gar2                 57.4    2e-08
sp|B4PIS2.1|SHEP_DROYA  RecName: Full=Protein alan shepard         57.4    2e-08
sp|B4HUE4.1|SHEP_DROSE  RecName: Full=Protein alan shepard         57.4    2e-08
sp|B3NGA1.1|SHEP_DROER  RecName: Full=Protein alan shepard         57.4    2e-08
sp|Q8MSV2.1|SHEP_DROME  RecName: Full=Protein alan shepard         57.4    2e-08
sp|P20965.3|PABPA_XENLA  RecName: Full=Polyadenylate-binding p...  57.4    2e-08

ALIGNMENTS
>sp|Q9WX37.3|RBPE_ANASP RecName: Full=Putative RNA-binding protein rbpE
Length=99

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/82 (54%), Positives = 62/82 (75%), Gaps = 2/82 (2%)

Query  4   MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGA--EAAIE  61
           M+IYVGN+S+ +T  DL  VF+E+G+VT  ++ TDR TGR RGFGFVEM   A  +AAI+
Sbjct  1   MSIYVGNLSYSVTQDDLTKVFSEYGSVTRVQLPTDRETGRVRGFGFVEMESSAAEDAAIQ  60

Query  62  ALNGTEVDGRELVVNESRPKDK  83
           AL+G E  GR L VN++RP+++
Sbjct  61  ALDGAEWMGRVLKVNKARPREE  82


>sp|Q9WX39.3|RBPF_ANASP RecName: Full=Putative RNA-binding protein rbpF
Length=105

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/81 (55%), Positives = 60/81 (74%), Gaps = 2/81 (2%)

Query  4   MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAE--AAIE  61
           M+IYVGN+S+ +T +D+ NVFAE+G+V    + TDR TGR RGF FVEM   AE  AAIE
Sbjct  1   MSIYVGNLSYEVTQEDISNVFAEYGSVKRVVLPTDRETGRLRGFAFVEMGSDAEETAAIE  60

Query  62  ALNGTEVDGRELVVNESRPKD  82
            L+G E  GR+L VN+++PK+
Sbjct  61  GLDGAEWMGRDLKVNKAKPKE  81


>sp|Q57014.3|RBPA_SYNY3 RecName: Full=Putative RNA-binding protein rbpA
Length=101

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 62/81 (76%), Gaps = 2/81 (2%)

Query  4   MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAE--AAIE  61
           M+IYVGN+S+ +++ DL  VFAE+G+V   ++ TDR TGR RGFGFVE+   AE  AAIE
Sbjct  1   MSIYVGNLSYDVSEADLTAVFAEYGSVKRVQLPTDRETGRMRGFGFVELEADAEETAAIE  60

Query  62  ALNGTEVDGRELVVNESRPKD  82
           AL+G E  GR+L VN+++P++
Sbjct  61  ALDGAEWMGRDLKVNKAKPRE  81


>sp|Q44554.3|RBPB_ANASP RecName: Full=Putative RNA-binding protein rbpB
Length=103

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 61/81 (75%), Gaps = 2/81 (2%)

Query  4   MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAE--AAIE  61
           M+IYVGN+S+ +T++ L  VFAE+G+V   ++  DR TGR RGFGFVEM   AE  AAIE
Sbjct  1   MSIYVGNLSYDVTEESLNAVFAEYGSVKRVQLPVDRETGRVRGFGFVEMGSDAEETAAIE  60

Query  62  ALNGTEVDGRELVVNESRPKD  82
           AL+G E  GR+L VN+++P++
Sbjct  61  ALDGAEWMGRDLKVNKAKPRE  81


>sp|P19683.1|ROC4_NICSY RecName: Full=31 kDa ribonucleoprotein, chloroplastic; Flags: 
Precursor
Length=315

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/73 (57%), Positives = 52/73 (71%), Gaps = 2/73 (2%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIEAL  63
            IYVGNI WG+ D  LE +F+EHG V SA+++ DR TGRSRGFGFV M+  AE   AI  L
Sbjct  232  IYVGNIPWGIDDARLEQLFSEHGKVVSARVVYDRETGRSRGFGFVTMASEAEMSDAIANL  291

Query  64   NGTEVDGRELVVN  76
            +G  +DGR + VN
Sbjct  292  DGQSLDGRTIRVN  304


 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 2/75 (2%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEAL  63
            ++VGN+ + +  + L  +F + G V  A++I +R T +SRGFGFV MS  + AE A+E  
Sbjct  138  LFVGNLPYDVDSEGLARLFEQAGVVEIAEVIYNRDTDQSRGFGFVTMSTVEEAEKAVEMY  197

Query  64   NGTEVDGRELVVNES  78
            N  +V+GR L VN++
Sbjct  198  NRYDVNGRLLTVNKA  212


>sp|P19682.1|ROC3_NICSY RecName: Full=28 kDa ribonucleoprotein, chloroplastic; Short=28RNP; 
Flags: Precursor
Length=276

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 55/80 (68%), Gaps = 4/80 (5%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIEAL  63
            IYVGNI W + D  LE VF+EHG V SA+++ DR +GRSRGFGFV MS  AE   AI  L
Sbjct  193  IYVGNIPWDIDDARLEQVFSEHGKVVSARVVFDRESGRSRGFGFVTMSSEAEMSEAIANL  252

Query  64   NGTEVDGRELVVN--ESRPK  81
            +G  +DGR + VN  E RP+
Sbjct  253  DGQTLDGRTIRVNAAEERPR  272


 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 51/78 (65%), Gaps = 2/78 (2%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEAL  63
            ++VGN+ + +  + L  +F + G V  A++I +R T RSRGFGFV MS  + A+ A+E  
Sbjct  99   LFVGNLPYDIDSEGLAQLFQQAGVVEIAEVIYNRETDRSRGFGFVTMSTVEEADKAVELY  158

Query  64   NGTEVDGRELVVNESRPK  81
            +  +++GR L VN++ P+
Sbjct  159  SQYDLNGRLLTVNKAAPR  176


>sp|P28644.1|ROC1_SPIOL RecName: Full=28 kDa ribonucleoprotein, chloroplastic; Short=28RNP
Length=233

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 56/82 (68%), Gaps = 4/82 (4%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIE  61
              +YVGN+ W +    LE +F+EHG V SA++++DR TGRSRGFGFV MS  +E   AI 
Sbjct  149  CRVYVGNLPWDVDTSRLEQLFSEHGKVVSARVVSDRETGRSRGFGFVTMSSESEVNDAIA  208

Query  62   ALNGTEVDGRELVVN--ESRPK  81
            AL+G  +DGR + VN  E RP+
Sbjct  209  ALDGQTLDGRAVRVNVAEERPR  230


 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 53/79 (67%), Gaps = 2/79 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEA  62
             ++VGN+ + +  + L  +F   G V  A++I +R T RSRGFGFV MS  + AE A+E 
Sbjct  56   KLFVGNLPYDVDSEKLAGIFDAAGVVEIAEVIYNRETDRSRGFGFVTMSTVEEAEKAVEL  115

Query  63   LNGTEVDGRELVVNESRPK  81
            LNG ++DGR+L VN++ P+
Sbjct  116  LNGYDMDGRQLTVNKAAPR  134


>sp|Q43349.2|ROC2_ARATH RecName: Full=29 kDa ribonucleoprotein, chloroplastic; AltName: 
Full=RNA-binding protein cp29; Flags: Precursor
Length=342

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 56/78 (71%), Gaps = 2/78 (2%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIEAL  63
            +YVGN+SWG+ D  LEN+F E G V  A++I DR +GRS+GFGFV +S   E   AI +L
Sbjct  259  LYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSL  318

Query  64   NGTEVDGRELVVNESRPK  81
            NG ++DGR++ V+E+  +
Sbjct  319  NGADLDGRQIRVSEAEAR  336


 Score = 58.5 bits (140),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 35/82 (42%), Positives = 47/82 (57%), Gaps = 2/82 (2%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIE  61
            + ++VGN+S+ +    L  +F   G V   ++I D+ TGRSRGFGFV MS     EAA +
Sbjct  99   LKLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQ  158

Query  62   ALNGTEVDGRELVVNESRPKDK  83
              NG E +GR L VN   P  K
Sbjct  159  QFNGYEFEGRPLRVNAGPPPPK  180


>sp|Q43472.1|GRP_HORVU RecName: Full=Glycine-rich RNA-binding protein blt801; AltName: 
Full=Low temperature-responsive RNA-binding protein
Length=161

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/78 (48%), Positives = 54/78 (69%), Gaps = 2/78 (2%)

Query  6   IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEAL  63
            +VG + W   DQ L+N F+++G V  +KIITDR TGRSRGFGFV  +  +    AIEA+
Sbjct  8   CFVGGLRWATDDQSLQNAFSKYGDVIDSKIITDRETGRSRGFGFVTFASDEAMRQAIEAM  67

Query  64  NGTEVDGRELVVNESRPK  81
           NG ++DGR + VNE++ +
Sbjct  68  NGQDLDGRNITVNEAQSR  85


>sp|P49314.1|ROC2_NICPL RecName: Full=31 kDa ribonucleoprotein, chloroplastic; AltName: 
Full=CP-RBP31; Flags: Precursor
Length=292

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 4/85 (4%)

Query  1    DKLMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--  58
            D    +YVGN+SWG+ D  L+ +F+E G V  AK++ DR +GRSRGFGFV  S   E   
Sbjct  205  DSSNRVYVGNLSWGVDDLALKELFSEQGNVVDAKVVYDRDSGRSRGFGFVTYSSAKEVND  264

Query  59   AIEALNGTEVDGRELVVN--ESRPK  81
            AI++LNG ++DGR + V+  E RP+
Sbjct  265  AIDSLNGIDLDGRSIRVSAAEERPR  289


 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 2/75 (2%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIE  61
            + ++VGN+ + +    L  +F   G V   ++I D+ +GRSRGFGFV MS  +  EAA +
Sbjct  88   LKLFVGNLPFSVDSAALAGLFERAGNVEIVEVIYDKLSGRSRGFGFVTMSTKEEVEAAEQ  147

Query  62   ALNGTEVDGRELVVN  76
              NG E+DGR + VN
Sbjct  148  QFNGYEIDGRAIRVN  162


>sp|Q08937.1|ROC2_NICSY RecName: Full=29 kDa ribonucleoprotein B, chloroplastic; AltName: 
Full=CP29B; Flags: Precursor
Length=291

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 4/85 (4%)

Query  1    DKLMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--  58
            D    +YVGN+SWG+ D  L+ +F+E G V  AK++ DR +GRSRGFGFV  S   E   
Sbjct  204  DSSNRVYVGNLSWGVDDLALKELFSEQGNVVDAKVVYDRDSGRSRGFGFVTYSSSKEVND  263

Query  59   AIEALNGTEVDGRELVVN--ESRPK  81
            AI++LNG ++DGR + V+  E RP+
Sbjct  264  AIDSLNGVDLDGRSIRVSAAEERPR  288


 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 46/75 (61%), Gaps = 2/75 (2%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIE  61
            + ++VGN+ + +    L  +F   G V   ++I D+ TGRSRGFGFV MS  +  EAA +
Sbjct  87   LKLFVGNLPFSVDSAALAGLFERAGNVEMVEVIYDKLTGRSRGFGFVTMSTKEEVEAAEQ  146

Query  62   ALNGTEVDGRELVVN  76
              NG E+DGR + VN
Sbjct  147  QFNGYEIDGRAIRVN  161


>sp|Q44556.3|RBPD_ANASP RecName: Full=Putative RNA-binding protein rbpD
Length=94

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/81 (50%), Positives = 58/81 (71%), Gaps = 2/81 (2%)

Query  4   MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAE--AAIE  61
           M IYVGN+S+  T+ DL+ VFA++G V    + TDR TGR RGF FVEM++ A+  AAI 
Sbjct  1   MTIYVGNLSYRATEADLKAVFADYGEVKRVVLPTDRETGRMRGFAFVEMNEDAQEDAAIT  60

Query  62  ALNGTEVDGRELVVNESRPKD  82
            L+G E  GR+L VN+++P++
Sbjct  61  ELDGAEWMGRQLRVNKAKPRE  81


>sp|Q04836.1|ROC3_ARATH RecName: Full=31 kDa ribonucleoprotein, chloroplastic; AltName: 
Full=RNA-binding protein RNP-T; AltName: Full=RNA-binding 
protein 1/2/3; Short=AtRBP33; AltName: Full=RNA-binding protein 
cp31; Flags: Precursor
Length=329

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 56/87 (64%), Gaps = 4/87 (4%)

Query  1    DKLMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAE--A  58
            +    +YVGN+ W + +  LE +F+EHG V  A+++ DR TGRSRGFGFV MSD  E   
Sbjct  241  EPAFRVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNE  300

Query  59   AIEALNGTEVDGRELVVN--ESRPKDK  83
            AI AL+G  ++GR + VN  E RP  +
Sbjct  301  AISALDGQNLEGRAIRVNVAEERPPRR  327


 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 53/78 (67%), Gaps = 2/78 (2%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEAL  63
            ++VGN+++ +  Q L  +F + GTV  A++I +R T +SRGFGFV MS  D AE A+E  
Sbjct  152  LFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDEAETAVEKF  211

Query  64   NGTEVDGRELVVNESRPK  81
            N  +++GR L VN++ P+
Sbjct  212  NRYDLNGRLLTVNKAAPR  229


>sp|Q9ZUU4.1|ROC1_ARATH RecName: Full=Ribonucleoprotein At2g37220, chloroplastic; Flags: 
Precursor
Length=289

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 58/82 (70%), Gaps = 4/82 (4%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIEAL  63
            +YVGN+SWG+ D  LE++F+E G V  A++I DR +GRS+GFGFV      E   AI++L
Sbjct  206  VYVGNLSWGVDDMALESLFSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSL  265

Query  64   NGTEVDGRELVVN--ESRPKDK  83
            +G ++DGR++ V+  E+RP  +
Sbjct  266  DGADLDGRQIRVSEAEARPPRR  287


 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 48/82 (58%), Gaps = 2/82 (2%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGA--EAAIE  61
            + ++VGN+ + +    L  +F   G V   ++I D+ TGRSRGFGFV MS  +  EAA +
Sbjct  91   LKLFVGNLPFNVDSAQLAQLFESAGNVEMVEVIYDKITGRSRGFGFVTMSSVSEVEAAAQ  150

Query  62   ALNGTEVDGRELVVNESRPKDK  83
              NG E+DGR L VN   P  K
Sbjct  151  QFNGYELDGRPLRVNAGPPPPK  172


>sp|Q03878.1|GRP1_DAUCA RecName: Full=Glycine-rich RNA-binding protein
Length=157

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 50/77 (64%), Gaps = 2/77 (2%)

Query  6   IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEAL  63
            +VG ++W   D+ LE  F++ G +T +KII DR TGRSRGFGFV   D      AIE +
Sbjct  8   CFVGGLAWATNDESLEQAFSQFGDITDSKIINDRETGRSRGFGFVTFKDEKSMRDAIEGM  67

Query  64  NGTEVDGRELVVNESRP  80
           NG E+DGR + VNE++ 
Sbjct  68  NGQELDGRNITVNEAQS  84


>sp|P49313.1|ROC1_NICPL RecName: Full=30 kDa ribonucleoprotein, chloroplastic; AltName: 
Full=CP-RBP30; Flags: Precursor
Length=279

 Score = 78.6 bits (192),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 56/82 (68%), Gaps = 4/82 (4%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIEAL  63
            +YVGN++WG+    LE +F+E G V  AK++ DR +GRSRGFGFV  S   E   AIE+L
Sbjct  196  VYVGNLAWGVDQDALETLFSEQGKVVDAKVVYDRDSGRSRGFGFVTYSSAEEVNNAIESL  255

Query  64   NGTEVDGRELVVN--ESRPKDK  83
            +G +++GR + V+  E+RP  +
Sbjct  256  DGVDLNGRAIRVSPAEARPPRR  277


 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/82 (43%), Positives = 48/82 (58%), Gaps = 2/82 (2%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIE  61
            + I+VGN+ +      L  +F   G V   ++I D+ TGRSRGFGFV MS  +  EAA +
Sbjct  87   LKIFVGNLLFSADSAALAELFERAGNVEMVEVIYDKLTGRSRGFGFVTMSSKEEVEAACQ  146

Query  62   ALNGTEVDGRELVVNESRPKDK  83
              NG E+DGR L VN   P +K
Sbjct  147  QFNGYELDGRALRVNSGPPPEK  168


>sp|P10979.1|GRPA_MAIZE RecName: Full=Glycine-rich RNA-binding, abscisic acid-inducible 
protein
Length=157

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/77 (46%), Positives = 53/77 (68%), Gaps = 2/77 (2%)

Query  6   IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEAL  63
            +VG ++W  +++ LEN FA +G +  +K+ITDR TGRSRGFGFV  S  +    AIE +
Sbjct  10  CFVGGLAWATSNESLENAFASYGEILDSKVITDRETGRSRGFGFVTFSSENSMLDAIENM  69

Query  64  NGTEVDGRELVVNESRP  80
           NG E+DGR + VN+++ 
Sbjct  70  NGKELDGRNITVNQAQS  86


>sp|Q08935.1|ROC1_NICSY RecName: Full=29 kDa ribonucleoprotein A, chloroplastic; AltName: 
Full=CP29A; Flags: Precursor
Length=273

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 56/82 (68%), Gaps = 4/82 (4%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIEAL  63
            +YVGN++WG+    LE +F+E G V  AK++ DR +GRSRGFGFV  S   E   AIE+L
Sbjct  190  VYVGNLAWGVDQDALETLFSEQGKVVDAKVVYDRDSGRSRGFGFVTYSSAEEVNNAIESL  249

Query  64   NGTEVDGRELVVN--ESRPKDK  83
            +G +++GR + V+  E+RP  +
Sbjct  250  DGVDLNGRAIRVSPAEARPPRR  271


 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/82 (43%), Positives = 48/82 (58%), Gaps = 2/82 (2%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIE  61
            + I+VGN+ +      L  +F   G V   ++I D+ TGRSRGFGFV MS  +  EAA +
Sbjct  87   LKIFVGNLPFSADSAALAELFERAGNVEMVEVIYDKLTGRSRGFGFVTMSSKEEVEAACQ  146

Query  62   ALNGTEVDGRELVVNESRPKDK  83
              NG E+DGR L VN   P +K
Sbjct  147  QFNGYELDGRALRVNSGPPPEK  168


>sp|Q03250.1|GRP7_ARATH RecName: Full=Glycine-rich RNA-binding protein 7
Length=176

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/76 (48%), Positives = 51/76 (67%), Gaps = 2/76 (2%)

Query  6   IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEAL  63
            +VG ++W   D+ LE  FA++G V  +KII DR TGRSRGFGFV   D    + AIE +
Sbjct  10  CFVGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGM  69

Query  64  NGTEVDGRELVVNESR  79
           NG ++DGR + VNE++
Sbjct  70  NGQDLDGRSITVNEAQ  85


>sp|P49310.1|GRP1_SINAL RecName: Full=Glycine-rich RNA-binding protein GRP1A
Length=166

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 51/76 (67%), Gaps = 2/76 (2%)

Query  6   IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEAL  63
            +VG ++W   D+ LE  F+++G V  +KII DR TGRSRGFGFV   D    + AIE +
Sbjct  10  CFVGGLAWATDDRALETAFSQYGEVLDSKIINDRETGRSRGFGFVTFKDEKSMKDAIEGM  69

Query  64  NGTEVDGRELVVNESR  79
           NG ++DGR + VNE++
Sbjct  70  NGQDLDGRSITVNEAQ  85


>sp|Q03251.1|GRP8_ARATH RecName: Full=Glycine-rich RNA-binding protein 8; AltName: Full=Protein 
CCR1
Length=169

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (65%), Gaps = 2/76 (2%)

Query  6   IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEAL  63
            +VG ++W   D+DL+  F++ G V  +KII DR +GRSRGFGFV   D      AIE +
Sbjct  8   CFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEM  67

Query  64  NGTEVDGRELVVNESR  79
           NG E+DGR + VNE++
Sbjct  68  NGKELDGRVITVNEAQ  83


>sp|Q9SVM8.1|GRP2_ARATH RecName: Full=Glycine-rich RNA-binding protein 2, mitochondrial; 
Short=AtGRP2; Flags: Precursor
Length=158

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 55/85 (64%), Gaps = 6/85 (7%)

Query  2    KLMN--IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAE  57
            +LM+  +++G +SWG  D  L + FA  G V  AK+I DR TGRSRGFGFV  +D   A 
Sbjct  31   RLMSTKLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAAT  90

Query  58   AAIEALNGTEVDGRELVVNES--RP  80
            AAI  ++G E++GR + VN +  RP
Sbjct  91   AAISEMDGKELNGRHIRVNPANDRP  115


>sp|Q44560.3|RBPA_ANASP RecName: Full=Putative RNA-binding protein rbpA
Length=102

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 58/81 (71%), Gaps = 2/81 (2%)

Query  4   MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIE  61
           M+IYVGN+S+ +T   L  VFAE+GTV   ++ TDR TG+ RGFGFVEM       AAIE
Sbjct  1   MSIYVGNLSYEVTQDTLSAVFAEYGTVKRVQLPTDRETGQPRGFGFVEMGSEAEEAAAIE  60

Query  62  ALNGTEVDGRELVVNESRPKD  82
           AL+G E  GR+L VN+++P++
Sbjct  61  ALDGAEWMGRDLKVNKAKPRE  81


>sp|Q05966.1|GRP10_BRANA RecName: Full=Glycine-rich RNA-binding protein 10
Length=169

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/77 (46%), Positives = 50/77 (64%), Gaps = 2/77 (2%)

Query  6   IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEAL  63
            +VG ++W   D +LE  F++ G V  +KII DR TGRSRGFGFV   D    + AI+ +
Sbjct  8   CFVGGLAWATGDAELERTFSQFGEVIDSKIINDRETGRSRGFGFVTFKDEKSMKDAIDEM  67

Query  64  NGTEVDGRELVVNESRP  80
           NG E+DGR + VNE++ 
Sbjct  68  NGKELDGRTITVNEAQS  84


>sp|Q99070.1|GRP2_SORBI RecName: Full=Glycine-rich RNA-binding protein 2
Length=168

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/77 (46%), Positives = 49/77 (63%), Gaps = 2/77 (2%)

Query  6   IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIEAL  63
            +VG ++W   ++ LE  FA  G V  +K+ITDR TGRSRGFGFV  S       AIE +
Sbjct  10  CFVGGLAWATNNETLEQAFANFGQVIDSKVITDRETGRSRGFGFVTFSSEQSMLDAIENM  69

Query  64  NGTEVDGRELVVNESRP  80
           NG E+DGR + VN+++ 
Sbjct  70  NGKELDGRNITVNQAQS  86


>sp|P19684.1|ROC5_NICSY RecName: Full=33 kDa ribonucleoprotein, chloroplastic; Flags: 
Precursor
Length=324

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 50/78 (64%), Gaps = 2/78 (2%)

Query  1    DKLMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEA  58
            D    +YV N+SW LT Q L + FA+     SAK+I DR++GRSRGFGF+  S  +   +
Sbjct  214  DSPHKLYVANLSWALTSQGLRDAFADQPGFMSAKVIYDRSSGRSRGFGFITFSSAEAMNS  273

Query  59   AIEALNGTEVDGRELVVN  76
            A++ +N  E++GR L +N
Sbjct  274  ALDTMNEVELEGRPLRLN  291


 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 46/73 (63%), Gaps = 2/73 (2%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIEAL  63
            +YVGN+ + +T   L  +FAE GTV + +I+ DR T RSRGF FV M    EA  AI   
Sbjct  116  LYVGNLPFSMTSSQLSEIFAEAGTVANVEIVYDRVTDRSRGFAFVTMGSVEEAKEAIRLF  175

Query  64   NGTEVDGRELVVN  76
            +G++V GR + VN
Sbjct  176  DGSQVGGRTVKVN  188


>sp|P49311.1|GRP2_SINAL RecName: Full=Glycine-rich RNA-binding protein GRP2A
Length=169

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (44%), Positives = 50/76 (65%), Gaps = 2/76 (2%)

Query  6   IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEAL  63
            +VG ++W   ++ LE  F++ G +  +KII DR TGRSRGFGFV   D    + AIE +
Sbjct  10  CFVGGLAWATDERSLETAFSQFGELVDSKIINDRETGRSRGFGFVTFKDEKSMKDAIEGM  69

Query  64  NGTEVDGRELVVNESR  79
           NG ++DGR + VNE++
Sbjct  70  NGQDLDGRSITVNEAQ  85


>sp|P42731.1|PABP2_ARATH RecName: Full=Polyadenylate-binding protein 2; Short=Poly(A)-binding 
protein 2; Short=PABP-2
Length=629

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 36/84 (42%), Positives = 54/84 (64%), Gaps = 3/84 (3%)

Query  2    KLMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAA  59
            K  N+YV N++   TD DL+N F E+G +TSA ++ D   G+S+GFGFV  E +D A  A
Sbjct  213  KFTNVYVKNLAESTTDDDLKNAFGEYGKITSAVVMKD-GEGKSKGFGFVNFENADDAARA  271

Query  60   IEALNGTEVDGRELVVNESRPKDK  83
            +E+LNG + D +E  V  ++ K +
Sbjct  272  VESLNGHKFDDKEWYVGRAQKKSE  295


 Score = 48.9 bits (115),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 49/80 (61%), Gaps = 3/80 (3%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIEA  62
            N+YV N+   ++D+ L+ +F+  GTVTS+K++ D   G S+G GFV  +   EA  A+  
Sbjct  319  NLYVKNLDPSISDEKLKEIFSPFGTVTSSKVMRD-PNGTSKGSGFVAFATPEEATEAMSQ  377

Query  63   LNGTEVDGRELVVNESRPKD  82
            L+G  ++ + L V  ++ K+
Sbjct  378  LSGKMIESKPLYVAIAQRKE  397


 Score = 46.6 bits (109),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 46/73 (63%), Gaps = 3/73 (4%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEA  62
            NI++ N+   +  + L + F+  G + S K+  D ++G+S+G+GFV+ +  + A+ AIE 
Sbjct  125  NIFIKNLDESIDHKALHDTFSSFGNIVSCKVAVD-SSGQSKGYGFVQYANEESAQKAIEK  183

Query  63   LNGTEVDGRELVV  75
            LNG  ++ +++ V
Sbjct  184  LNGMLLNDKQVYV  196


 Score = 46.6 bits (109),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 44/73 (60%), Gaps = 2/73 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIEA  62
            ++YVG++ + +TD  L + F + GTV + ++  D  T RS G+G+V  ++  +A  AI+ 
Sbjct  37   SLYVGDLDFNVTDSQLFDAFGQMGTVVTVRVCRDLVTRRSLGYGYVNFTNPQDAARAIQE  96

Query  63   LNGTEVDGRELVV  75
            LN   + G+ + V
Sbjct  97   LNYIPLYGKPIRV  109


>sp|P82277.1|RRP2_SPIOL RecName: Full=30S ribosomal protein 2, chloroplastic; AltName: 
Full=Plastid-specific 30S ribosomal protein 2; Short=PSRP-2; 
Flags: Precursor
Length=260

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 2/73 (2%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEAL  63
            +YVGNI   L + +L  +  EHG +  A+++ D+ +GRSR FGFV M   + A A IE L
Sbjct  86   LYVGNIPRNLNNDELRTIVEEHGAIEIAEVMYDKYSGRSRRFGFVTMKTVEDANAVIEKL  145

Query  64   NGTEVDGRELVVN  76
            N TE+ GR++ VN
Sbjct  146  NDTEIGGRKIKVN  158


 Score = 58.9 bits (141),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 51/75 (68%), Gaps = 2/75 (2%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEAL  63
            +Y+GN++  +T++ L++ F+E G V  AK+     T +S GFGFV  S  +  EAAI+AL
Sbjct  186  VYIGNLAKTVTNELLKDFFSEKGKVLGAKVQRTPGTSKSNGFGFVSFSSEEEVEAAIQAL  245

Query  64   NGTEVDGRELVVNES  78
            N + ++G+++ VN++
Sbjct  246  NNSVLEGQKIRVNKA  260


>sp|Q14011.1|CIRBP_HUMAN RecName: Full=Cold-inducible RNA-binding protein; AltName: Full=Glycine-rich 
RNA-binding protein CIRP; AltName: Full=A18 
hnRNP
 sp|Q5RF83.1|CIRBP_PONAB RecName: Full=Cold-inducible RNA-binding protein; AltName: Full=Glycine-rich 
RNA-binding protein CIRP
Length=172

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 52/75 (69%), Gaps = 2/75 (2%)

Query  6   IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAAIEAL  63
           ++VG +S+   +Q LE VF+++G ++   ++ DR T RSRGFGFV  E  D A+ A+ A+
Sbjct  8   LFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAM  67

Query  64  NGTEVDGRELVVNES  78
           NG  VDGR++ V+++
Sbjct  68  NGKSVDGRQIRVDQA  82


>sp|Q8C7E9.2|CSTFT_MOUSE RecName: Full=Cleavage stimulation factor subunit 2 tau variant; 
AltName: Full=Cleavage stimulation factor 64 kDa subunit 
tau variant; Short=CSTF 64 kDa subunit tau variant; AltName: 
Full=TauCstF-64; AltName: Full=CF-1 64 kDa subunit tau variant
Length=632

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 55/84 (65%), Gaps = 3/84 (3%)

Query  3   LMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAI  60
           L +++VGNI +  T++ L+++F+E G+V S +++ DR TG+ +G+GF E  D   A +A+
Sbjct  15  LRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETALSAM  74

Query  61  EALNGTEVDGRELVV-NESRPKDK  83
             LNG E  GR L V N +  K+K
Sbjct  75  RNLNGREFSGRALRVDNAASEKNK  98


>sp|P60826.1|CIRBP_CRIGR RecName: Full=Cold-inducible RNA-binding protein; AltName: Full=Glycine-rich 
RNA-binding protein CIRP; AltName: Full=A18 
hnRNP
 sp|P60825.1|CIRBP_RAT RecName: Full=Cold-inducible RNA-binding protein; AltName: Full=Glycine-rich 
RNA-binding protein CIRP; AltName: Full=A18 
hnRNP
 sp|P60824.1|CIRBP_MOUSE RecName: Full=Cold-inducible RNA-binding protein; AltName: Full=Glycine-rich 
RNA-binding protein CIRP; AltName: Full=A18 
hnRNP
Length=172

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 52/75 (69%), Gaps = 2/75 (2%)

Query  6   IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAAIEAL  63
           ++VG +S+   +Q LE VF+++G ++   ++ DR T RSRGFGFV  E  D A+ A+ A+
Sbjct  8   LFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAM  67

Query  64  NGTEVDGRELVVNES  78
           NG  VDGR++ V+++
Sbjct  68  NGKSVDGRQIRVDQA  82


>sp|Q9H0L4.1|CSTFT_HUMAN RecName: Full=Cleavage stimulation factor subunit 2 tau variant; 
AltName: Full=Cleavage stimulation factor 64 kDa subunit 
tau variant; Short=CSTF 64 kDa subunit tau variant; AltName: 
Full=TauCstF-64; AltName: Full=CF-1 64 kDa subunit tau variant
Length=616

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 55/84 (65%), Gaps = 3/84 (3%)

Query  3   LMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAI  60
           L +++VGNI +  T++ L+++F+E G+V S +++ DR TG+ +G+GF E  D   A +A+
Sbjct  15  LRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETALSAM  74

Query  61  EALNGTEVDGRELVV-NESRPKDK  83
             LNG E  GR L V N +  K+K
Sbjct  75  RNLNGREFSGRALRVDNAASEKNK  98


>sp|Q9IBD1.2|CELF3_DANRE RecName: Full=CUGBP Elav-like family member 3; Short=CELF-3; 
AltName: Full=CUG-BP- and ETR-3-like factor 3; AltName: Full=Bruno-like 
protein 1; AltName: Full=RNA-binding protein BRUNOL-1; 
AltName: Full=ELAV-type RNA-binding protein 1; Short=ETR-1; 
AltName: Full=Trinucleotide repeat-containing gene 4 
protein
Length=452

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 2/80 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEA  62
            NI++ ++    TD ++  +F   G V SAK+  DRAT +S+ FGFV   +   A+AAI+A
Sbjct  368  NIFIYHLPQEFTDSEMLQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQA  427

Query  63   LNGTEVDGRELVVNESRPKD  82
            +NG ++  + L V   RPKD
Sbjct  428  MNGFQIGMKRLKVQLKRPKD  447


 Score = 37.0 bits (84),  Expect = 0.032, Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query  4   MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEAAIEAL  63
           + +++G I   L ++DL+ +F + G +    +I D+ TG  +G  F+      E+A++A 
Sbjct  7   IKLFIGQIPRNLEEKDLKPIFEQFGKIYELTVIKDKYTGMHKGCAFLTYC-ARESALKAQ  65

Query  64  NG  65
           N 
Sbjct  66  NA  67


 Score = 34.3 bits (77),  Expect = 0.19, Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAE--AAIEAL  63
            ++VG +   L+D D+  +F   G++    ++     G S+G  FV+    AE  AAI AL
Sbjct  96   LFVGMLGKQLSDADVRKMFEPFGSIEECTVLRG-PDGASKGCAFVKYQSNAEAQAAISAL  154

Query  64   NGT  66
            +G+
Sbjct  155  HGS  157


>sp|Q8HXM1.1|CSTF2_BOVIN RecName: Full=Cleavage stimulation factor subunit 2; AltName: 
Full=Cleavage stimulation factor 64 kDa subunit; Short=CSTF 
64 kDa subunit; Short=CstF-64; AltName: Full=CF-1 64 kDa subunit
Length=572

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 54/84 (64%), Gaps = 3/84 (3%)

Query  3   LMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAI  60
           L +++VGNI +  T++ L+++F+E G V S +++ DR TG+ +G+GF E  D   A +A+
Sbjct  15  LRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAM  74

Query  61  EALNGTEVDGRELVV-NESRPKDK  83
             LNG E  GR L V N +  K+K
Sbjct  75  RNLNGREFSGRALRVDNAASEKNK  98


>sp|Q91579.2|CEL3A_XENLA RecName: Full=CUGBP Elav-like family member 3-A; Short=CELF-3A; 
AltName: Full=CUG-BP- and ETR-3-like factor 3-A; AltName: 
Full=Bruno-like protein 1-A; AltName: Full=RNA-binding protein 
BRUNOL-1-A; AltName: Full=ELAV-type RNA-binding protein 
1-A; Short=ETR-1-A; AltName: Full=Trinucleotide repeat-containing 
gene 4 protein A
Length=462

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 2/80 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEA  62
            NI++ ++    TD ++  +F   G V SAK+  DRAT +S+ FGFV   +   A+AAI+A
Sbjct  378  NIFIYHLPQEFTDSEILQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPGSAQAAIQA  437

Query  63   LNGTEVDGRELVVNESRPKD  82
            +NG ++  + L V   RPKD
Sbjct  438  MNGFQIGMKRLKVQLKRPKD  457


 Score = 35.0 bits (79),  Expect = 0.11, Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query  4   MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEAAIEA  62
           + +++G I   L ++DL+ +F + G +    +I D+ TG  +G  F+      E+A++A
Sbjct  7   IKLFIGQIPRNLDEKDLKPIFEQFGKIYELTVIKDKFTGMHKGCAFLTYC-ARESALKA  64


 Score = 31.6 bits (70),  Expect = 1.2, Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDG--AEAAIEAL  63
            ++VG +    TD+D+  +F   G +    ++     G S+G  FV+      A+AAI AL
Sbjct  97   LFVGMLGKQQTDEDVRRMFEPFGNIDECTVLRG-PDGTSKGCAFVKFQTHTEAQAAINAL  155

Query  64   NGT  66
            +G+
Sbjct  156  HGS  158


>sp|Q5RDA3.1|CSTF2_PONAB RecName: Full=Cleavage stimulation factor subunit 2; AltName: 
Full=Cleavage stimulation factor 64 kDa subunit; Short=CSTF 
64 kDa subunit; Short=CstF-64; AltName: Full=CF-1 64 kDa subunit
Length=577

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 54/84 (64%), Gaps = 3/84 (3%)

Query  3   LMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAI  60
           L +++VGNI +  T++ L+++F+E G V S +++ DR TG+ +G+GF E  D   A +A+
Sbjct  15  LRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAM  74

Query  61  EALNGTEVDGRELVV-NESRPKDK  83
             LNG E  GR L V N +  K+K
Sbjct  75  RNLNGREFSGRALRVDNAASEKNK  98


>sp|Q2GSX8.1|PABP_CHAGB RecName: Full=Polyadenylate-binding protein, cytoplasmic and 
nuclear; Short=Poly(A)-binding protein; Short=PABP; AltName: 
Full=Polyadenylate tail-binding protein
Length=783

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 52/79 (65%), Gaps = 3/79 (3%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEA  62
            NIYV NIS   TD++  ++FA++G VTS+ +  D + G+SRGFGFV  +  + A  A+E 
Sbjct  247  NIYVKNISLEATDEEFRDLFAKYGDVTSSSLARD-SEGKSRGFGFVNFTTHECAAKAVEE  305

Query  63   LNGTEVDGRELVVNESRPK  81
            LNG E  G++L V  ++ K
Sbjct  306  LNGKEFRGQDLYVGRAQKK  324


 Score = 42.4 bits (98),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 4/70 (5%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV---EMSDGAEAAIE  61
            ++YVG +   +T+  L  +F++ G+V S ++  D  T RS G+ +V     SDG E A+E
Sbjct  66   SLYVGELDPSVTEAMLFELFSQIGSVASIRVCRDTITRRSLGYAYVNYNSTSDG-EKALE  124

Query  62   ALNGTEVDGR  71
             LN T + GR
Sbjct  125  ELNYTLIKGR  134


 Score = 41.2 bits (95),  Expect = 0.002, Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 52/125 (41%), Gaps = 46/125 (36%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRAT----------------------  41
            +N+Y+ N++  + D  L  +F+E+G +TSAK++ D  T                      
Sbjct  349  VNLYIKNLADDIDDDKLRQMFSEYGPITSAKVMRDAVTEGSAEEETEGKDKENKKEGEQA  408

Query  42   ----------------------GRSRGFGFVEMS--DGAEAAIEALNGTEVDGRELVVNE  77
                                  G+S+GFGFV  S  D A  A+  +N   ++G+ L V  
Sbjct  409  AEAEGEAEGAEKKTEKKGDRRLGKSKGFGFVCFSNPDDATKAVAEMNQRMIEGKPLYVAL  468

Query  78   SRPKD  82
            ++ KD
Sbjct  469  AQRKD  473


>sp|P33240.1|CSTF2_HUMAN RecName: Full=Cleavage stimulation factor subunit 2; AltName: 
Full=Cleavage stimulation factor 64 kDa subunit; Short=CSTF 
64 kDa subunit; Short=CstF-64; AltName: Full=CF-1 64 kDa subunit
Length=577

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 54/84 (64%), Gaps = 3/84 (3%)

Query  3   LMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAI  60
           L +++VGNI +  T++ L+++F+E G V S +++ DR TG+ +G+GF E  D   A +A+
Sbjct  15  LRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAM  74

Query  61  EALNGTEVDGRELVV-NESRPKDK  83
             LNG E  GR L V N +  K+K
Sbjct  75  RNLNGREFSGRALRVDNAASEKNK  98


>sp|Q08E07.1|CELF3_BOVIN RecName: Full=CUGBP Elav-like family member 3; Short=CELF-3; 
AltName: Full=CUG-BP- and ETR-3-like factor 3; AltName: Full=Bruno-like 
protein 1; AltName: Full=RNA-binding protein BRUNOL-1; 
AltName: Full=ELAV-type RNA-binding protein 1; Short=ETR-1; 
AltName: Full=Trinucleotide repeat-containing gene 4 
protein
Length=461

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 2/80 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEA  62
            NI++ ++    TD ++  +F   G V SAK+  DRAT +S+ FGFV   +   A+AAI+A
Sbjct  377  NIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQA  436

Query  63   LNGTEVDGRELVVNESRPKD  82
            +NG ++  + L V   RPKD
Sbjct  437  MNGFQIGMKRLKVQLKRPKD  456


 Score = 34.3 bits (77),  Expect = 0.20, Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 2/63 (3%)

Query  4   MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVE--MSDGAEAAIE  61
           + ++VG I   L ++DL+ +F + G +    +I D+ TG  +G  F+     D A  A  
Sbjct  7   IKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQS  66

Query  62  ALN  64
           AL+
Sbjct  67  ALH  69


 Score = 30.8 bits (68),  Expect = 2.1, Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 3/63 (4%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAE--AAIEAL  63
            ++VG +    TD+D+  +F   GT+    ++     G S+G  FV+    AE  AAI  L
Sbjct  97   LFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRG-PDGTSKGCAFVKFQTHAEAQAAINTL  155

Query  64   NGT  66
            + +
Sbjct  156  HSS  158


>sp|Q8CIN6.1|CELF3_MOUSE RecName: Full=CUGBP Elav-like family member 3; Short=CELF-3; 
AltName: Full=CUG-BP- and ETR-3-like factor 3; AltName: Full=Bruno-like 
protein 1; AltName: Full=RNA-binding protein BRUNOL-1; 
AltName: Full=ELAV-type RNA-binding protein 1; Short=ETR-1; 
AltName: Full=Trinucleotide repeat-containing gene 4 
protein
Length=465

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 2/80 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEA  62
            NI++ ++    TD ++  +F   G V SAK+  DRAT +S+ FGFV   +   A+AAI+A
Sbjct  381  NIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQA  440

Query  63   LNGTEVDGRELVVNESRPKD  82
            +NG ++  + L V   RPKD
Sbjct  441  MNGFQIGMKRLKVQLKRPKD  460


 Score = 34.3 bits (77),  Expect = 0.20, Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 2/63 (3%)

Query  4   MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVE--MSDGAEAAIE  61
           + ++VG I   L ++DL+ +F + G +    +I D+ TG  +G  F+     D A  A  
Sbjct  7   IKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQS  66

Query  62  ALN  64
           AL+
Sbjct  67  ALH  69


 Score = 30.8 bits (68),  Expect = 2.1, Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 3/63 (4%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAE--AAIEAL  63
            ++VG +    TD+D+  +F   GT+    ++     G S+G  FV+    AE  AAI  L
Sbjct  96   LFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRG-PDGTSKGCAFVKFQTHAEAQAAINTL  154

Query  64   NGT  66
            + +
Sbjct  155  HSS  157


>sp|Q9DED4.1|CIRBB_XENLA RecName: Full=Cold-inducible RNA-binding protein B; AltName: 
Full=Cold-inducible RNA-binding protein 2; Short=xCIRP2; AltName: 
Full=Glycine-rich RNA-binding protein CIRP-B
Length=166

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 52/75 (69%), Gaps = 2/75 (2%)

Query  6   IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAAIEAL  63
           +++G +++   ++ LE VF+++G ++   ++ DR T RSRGFGFV  E  D A+ A+ A+
Sbjct  7   LFIGGLNFDTNEESLEQVFSKYGQISEVVVVKDRETKRSRGFGFVTFENPDDAKDAMMAM  66

Query  64  NGTEVDGRELVVNES  78
           NG  VDGR++ V+++
Sbjct  67  NGKAVDGRQIRVDQA  81


>sp|Q5SZQ8.1|CELF3_HUMAN RecName: Full=CUGBP Elav-like family member 3; Short=CELF-3; 
AltName: Full=CUG-BP- and ETR-3-like factor 3; AltName: Full=Bruno-like 
protein 1; AltName: Full=RNA-binding protein BRUNOL-1; 
AltName: Full=ELAV-type RNA-binding protein 1; Short=ETR-1; 
AltName: Full=Trinucleotide repeat-containing gene 4 
protein; AltName: Full=Expanded repeat domain protein CAG/CTG 
4; AltName: Full=CAG repeat protein 4
Length=465

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 2/80 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEA  62
            NI++ ++    TD ++  +F   G V SAK+  DRAT +S+ FGFV   +   A+AAI+A
Sbjct  381  NIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQA  440

Query  63   LNGTEVDGRELVVNESRPKD  82
            +NG ++  + L V   RPKD
Sbjct  441  MNGFQIGMKRLKVQLKRPKD  460


 Score = 34.3 bits (77),  Expect = 0.20, Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 2/63 (3%)

Query  4   MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVE--MSDGAEAAIE  61
           + ++VG I   L ++DL+ +F + G +    +I D+ TG  +G  F+     D A  A  
Sbjct  7   IKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQS  66

Query  62  ALN  64
           AL+
Sbjct  67  ALH  69


 Score = 30.8 bits (68),  Expect = 2.1, Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 3/63 (4%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAE--AAIEAL  63
            ++VG +    TD+D+  +F   GT+    ++     G S+G  FV+    AE  AAI  L
Sbjct  97   LFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRG-PDGTSKGCAFVKFQTHAEAQAAINTL  155

Query  64   NGT  66
            + +
Sbjct  156  HSS  158


>sp|Q8BIQ5.2|CSTF2_MOUSE RecName: Full=Cleavage stimulation factor subunit 2; AltName: 
Full=Cleavage stimulation factor 64 kDa subunit; Short=CSTF 
64 kDa subunit; Short=CstF-64; AltName: Full=CF-1 64 kDa subunit
Length=580

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 54/84 (64%), Gaps = 3/84 (3%)

Query  3   LMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAI  60
           L +++VGNI +  T++ L+++F+E G V S +++ DR TG+ +G+GF E  D   A +A+
Sbjct  15  LRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAM  74

Query  61  EALNGTEVDGRELVV-NESRPKDK  83
             LNG E  GR L V N +  K+K
Sbjct  75  RNLNGREFSGRALRVDNAASEKNK  98


>sp|P39697.2|RT19_ARATH RecName: Full=40S ribosomal protein S19, mitochondrial; Flags: 
Precursor
Length=212

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 50/76 (65%), Gaps = 2/76 (2%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEM--SDGAEAAIEAL  63
            +Y+G +S G  +  L++ F+    VT A+++T++ TGRSRG+GFV     D A +AI A+
Sbjct  33   LYIGGLSPGTDEHSLKDAFSSFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSAISAM  92

Query  64   NGTEVDGRELVVNESR  79
            NG E++G  + VN ++
Sbjct  93   NGQELNGFNISVNVAK  108


>sp|Q7ZWM3.1|CEL3B_XENLA RecName: Full=CUGBP Elav-like family member 3-B; Short=CELF3-B; 
AltName: Full=CUG-BP- and ETR-3-like factor 3-B; AltName: 
Full=Bruno-like protein 1-B; AltName: Full=RNA-binding protein 
BRUNOL-1-B; AltName: Full=ELAV-type RNA-binding protein 
1-B; Short=ETR-1-B; AltName: Full=Trinucleotide repeat-containing 
gene 4 protein B
Length=462

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 49/80 (61%), Gaps = 2/80 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEA  62
            NI++ ++    TD ++  +F   G V SAK+  DRAT +S+ FGFV   +   A+AAI++
Sbjct  378  NIFIYHLPQEFTDSEILQMFLPFGNVISAKVFVDRATNQSKCFGFVSFDNPGSAQAAIQS  437

Query  63   LNGTEVDGRELVVNESRPKD  82
            +NG ++  + L V   RPKD
Sbjct  438  MNGFQIGMKRLKVQLKRPKD  457


 Score = 35.0 bits (79),  Expect = 0.11, Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query  4   MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEAAIEA  62
           + +++G I   L ++DL+ +F + G +    +I D+ TG  +G  F+      E+A++A
Sbjct  7   IKLFIGQIPRNLDEKDLKPIFEQFGKIYELTVIKDKFTGMHKGCAFLTYC-ARESALKA  64


 Score = 31.6 bits (70),  Expect = 1.1, Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDG--AEAAIEAL  63
            ++VG +    TD+D+  +F   G +    ++     G S+G  FV+      A+AAI AL
Sbjct  97   LFVGMLGKQQTDEDVRRMFETFGNIDECTVLRG-PDGTSKGCAFVKFQTHTEAQAAINAL  155

Query  64   NGT  66
            +G+
Sbjct  156  HGS  158


>sp|Q5RC80.1|RBM39_PONAB RecName: Full=RNA-binding protein 39; AltName: Full=RNA-binding 
motif protein 39
Length=524

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 47/74 (63%), Gaps = 2/74 (2%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDG--AEAAIE  61
            M +YVG++ + +T+  L  +F   G + S +++ D  TGRS+G+GF+  SD   A+ A+E
Sbjct  250  MRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALE  309

Query  62   ALNGTEVDGRELVV  75
             LNG E+ GR + V
Sbjct  310  QLNGFELAGRPMKV  323


 Score = 40.4 bits (93),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEAAIE-ALN  64
            ++   ++  +  +DLE  F+  G V   ++I+DR + RS+G  +VE  D +   +   L 
Sbjct  155  VFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLT  214

Query  65   GTEVDGRELVVNESR  79
            G  V G  ++V  S+
Sbjct  215  GQRVLGVPIIVQASQ  229


>sp|Q14498.2|RBM39_HUMAN RecName: Full=RNA-binding protein 39; AltName: Full=RNA-binding 
motif protein 39; AltName: Full=RNA-binding region-containing 
protein 2; AltName: Full=Hepatocellular carcinoma protein 
1; AltName: Full=Splicing factor HCC1
Length=530

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 47/74 (63%), Gaps = 2/74 (2%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDG--AEAAIE  61
            M +YVG++ + +T+  L  +F   G + S +++ D  TGRS+G+GF+  SD   A+ A+E
Sbjct  250  MRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALE  309

Query  62   ALNGTEVDGRELVV  75
             LNG E+ GR + V
Sbjct  310  QLNGFELAGRPMKV  323


 Score = 40.4 bits (93),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEAAIE-ALN  64
            ++   ++  +  +DLE  F+  G V   ++I+DR + RS+G  +VE  D +   +   L 
Sbjct  155  VFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLT  214

Query  65   GTEVDGRELVVNESR  79
            G  V G  ++V  S+
Sbjct  215  GQRVLGVPIIVQASQ  229


>sp|Q8VH51.1|RBM39_MOUSE RecName: Full=RNA-binding protein 39; AltName: Full=RNA-binding 
motif protein 39; AltName: Full=RNA-binding region-containing 
protein 2; AltName: Full=Coactivator of activating protein 
1 and estrogen receptors; Short=Coactivator of AP-1 and 
ERs; AltName: Full=Transcription coactivator CAPER
Length=530

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 47/74 (63%), Gaps = 2/74 (2%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDG--AEAAIE  61
            M +YVG++ + +T+  L  +F   G + S +++ D  TGRS+G+GF+  SD   A+ A+E
Sbjct  250  MRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALE  309

Query  62   ALNGTEVDGRELVV  75
             LNG E+ GR + V
Sbjct  310  QLNGFELAGRPMKV  323


 Score = 41.2 bits (95),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEAAIE-ALN  64
            ++   ++  +  +DLE  F+  G V   ++I+DR + RSRG  +VE  D +   +   L 
Sbjct  155  VFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSRGIAYVEFVDVSSVRLAIGLT  214

Query  65   GTEVDGRELVVNESR  79
            G  V G  ++V  S+
Sbjct  215  GQRVLGVPIIVQASQ  229


>sp|Q28IQ9.1|CIRBP_XENTR RecName: Full=Cold-inducible RNA-binding protein; AltName: Full=Glycine-rich 
RNA-binding protein CIRP
Length=166

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 52/75 (69%), Gaps = 2/75 (2%)

Query  6   IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAAIEAL  63
           ++VG +++  T++ LE VF+++G V    ++ DR + RSRGFGFV  E  + A+ A+ A+
Sbjct  8   LFVGGLNFETTEESLEQVFSKYGQVAEVVVVKDRESKRSRGFGFVTFENPEDAKDAMMAM  67

Query  64  NGTEVDGRELVVNES  78
           NG  VDGR++ V+++
Sbjct  68  NGKSVDGRQIRVDQA  82


>sp|Q1DXH0.1|PABP_COCIM RecName: Full=Polyadenylate-binding protein, cytoplasmic and 
nuclear; Short=Poly(A)-binding protein; Short=PABP; AltName: 
Full=Polyadenylate tail-binding protein
Length=768

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 50/79 (63%), Gaps = 2/79 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEA  62
            N+YV NI    T+++  ++F + G +TSA +  D  +G+SRGFGFV  +  D A AA+EA
Sbjct  237  NVYVKNIDQDTTEEEFRDLFEKFGEITSATLARDAESGKSRGFGFVNFTSHDNAAAAVEA  296

Query  63   LNGTEVDGRELVVNESRPK  81
            LN  +  G++L V  ++ K
Sbjct  297  LNDKDFKGQKLYVGRAQKK  315


 Score = 36.2 bits (82),  Expect = 0.048, Method: Composition-based stats.
 Identities = 33/133 (24%), Positives = 52/133 (39%), Gaps = 54/133 (40%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRAT----------------------  41
            +N+Y+ N+S  + D+ L  +F+ +GT+TSAK++ D A                       
Sbjct  340  VNLYIKNLSDDIDDEKLRELFSSYGTITSAKVMRDFAPESTSDSEKEAKKDSKEPETKEE  399

Query  42   ------------------------------GRSRGFGFVEMS--DGAEAAIEALNGTEVD  69
                                          G+S+GFGFV  S  D A  A+  +N   V 
Sbjct  400  EPKDEAGDNAENKDNKENKAESKKSEKKPLGKSKGFGFVCFSSPDEASKAVTEMNQRMVH  459

Query  70   GRELVVNESRPKD  82
            G+ L V  ++ KD
Sbjct  460  GKPLYVALAQRKD  472


>sp|Q99069.1|GRP1_SORBI RecName: Full=Glycine-rich RNA-binding protein 1
Length=142

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (66%), Gaps = 2/63 (3%)

Query  20  LENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEALNGTEVDGRELVVNE  77
           L + F+ +G V  +KII DR T RSRGFGFV  S  +   +AIE +NG E+DGR + VNE
Sbjct  3   LHSAFSTYGEVLESKIILDRETQRSRGFGFVTFSTEEAMRSAIEGMNGKELDGRNITVNE  62

Query  78  SRP  80
           ++ 
Sbjct  63  AQS  65


>sp|P27476.1|NSR1_YEAST RecName: Full=Nuclear localization sequence-binding protein; 
AltName: Full=p67
Length=414

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 45/70 (64%), Gaps = 2/70 (2%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDG--AEAAIEAL  63
            I+VG +SW + D+ L+  F   G V  A++I +R T RSRG+G+V+  +   AE AI+ +
Sbjct  170  IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEM  229

Query  64   NGTEVDGREL  73
             G E+DGR +
Sbjct  230  QGKEIDGRPI  239


 Score = 53.1 bits (126),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 48/78 (61%), Gaps = 2/78 (2%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEAL  63
            +++GN+S+      +  +FA+HG V S +I T   T + +GFG+V+ S  + A+ A++AL
Sbjct  269  LFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDAL  328

Query  64   NGTEVDGRELVVNESRPK  81
             G  +D R + ++ S P+
Sbjct  329  QGEYIDNRPVRLDFSSPR  346


>sp|Q9PTX2.1|CIRBP_RANCA RecName: Full=Cold-inducible RNA-binding protein; Short=BFCIRP; 
AltName: Full=Glycine-rich RNA-binding protein CIRP
Length=164

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 50/75 (66%), Gaps = 2/75 (2%)

Query  6   IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAAIEAL  63
           ++VG +S+   +Q LE VF+++G +    ++ DR T RSRGFGFV  E  + A+ A+  +
Sbjct  8   LFVGGLSFDTDEQCLETVFSKYGQIQEVVVVKDRETKRSRGFGFVTFENCEDAKDAMAGM  67

Query  64  NGTEVDGRELVVNES  78
           NG  VDGR++ V+++
Sbjct  68  NGKTVDGRQIRVDQA  82


>sp|A4QUF0.1|PABP_MAGGR RecName: Full=Polyadenylate-binding protein, cytoplasmic and 
nuclear; Short=Poly(A)-binding protein; Short=PABP; AltName: 
Full=Polyadenylate tail-binding protein
Length=762

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 49/79 (62%), Gaps = 2/79 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEA  62
            NIYV NI+  +TD +   +F ++G VTS+ +  D+ TG+SRGFGFV  +  + A  A++ 
Sbjct  243  NIYVKNINPEVTDDEFRTLFEKYGDVTSSSLARDQETGKSRGFGFVNFTSHEDASKAVQE  302

Query  63   LNGTEVDGRELVVNESRPK  81
            LN  E  G+ L V  ++ K
Sbjct  303  LNEKEFHGQNLYVGRAQKK  321


 Score = 44.3 bits (103),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 44/79 (55%), Gaps = 3/79 (3%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAAIEA  62
            N+++ N+   + ++ L + FA  G + S K+  D   G S+G+GFV  E  + A  AI+ 
Sbjct  150  NVFIKNLDVAIDNKALHDTFAAFGNILSCKVAQDE-NGNSKGYGFVHYETDEAASQAIKH  208

Query  63   LNGTEVDGRELVVNESRPK  81
            +NG  ++ +++ V    PK
Sbjct  209  VNGMLLNEKKVYVGHHIPK  227


 Score = 41.2 bits (95),  Expect = 0.002, Method: Composition-based stats.
 Identities = 24/69 (34%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGA--EAAIEA  62
            ++YVG +   +T+  L  +F++ G+V S ++  D  T RS G+ +V  +  A  E A+E 
Sbjct  62   SLYVGELDPSVTEAMLFELFSQIGSVASIRVCRDAVTRRSLGYAYVNYNTTADGEKALEE  121

Query  63   LNGTEVDGR  71
            LN T + GR
Sbjct  122  LNYTLIKGR  130


 Score = 33.5 bits (75),  Expect = 0.34, Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 25/38 (65%), Gaps = 0/38 (0%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRAT  41
            +N+Y+ N+   + D+ L  +F+E G +TSAK++ D  T
Sbjct  346  VNLYIKNLDDEVDDEKLRQLFSEFGPITSAKVMRDSIT  383


>sp|A1D4K4.1|PABP_NEOFI RecName: Full=Polyadenylate-binding protein, cytoplasmic and 
nuclear; Short=Poly(A)-binding protein; Short=PABP; AltName: 
Full=Polyadenylate tail-binding protein
Length=751

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 51/79 (64%), Gaps = 3/79 (3%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEA  62
            N+Y+ NI   +TD++   +F + G +TSA +  D+  G+SRGFGFV  S  D A+AA++ 
Sbjct  234  NVYIKNIDQEVTDEEFRKMFEKFGEITSATLSRDQ-EGKSRGFGFVNFSTHDSAQAAVDE  292

Query  63   LNGTEVDGRELVVNESRPK  81
            +N  E+ G++L V  ++ K
Sbjct  293  MNDKEIKGQKLYVGRAQKK  311


 Score = 40.4 bits (93),  Expect = 0.003, Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 52/125 (41%), Gaps = 46/125 (36%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRAT----------------------  41
            +N+YV N++  + D+ L  +F+  GT+TSAK++ D  T                      
Sbjct  336  VNLYVKNLTDDVDDEKLRELFSPFGTITSAKVMRDTVTAGETSESEKEKESNKENEKEGE  395

Query  42   ----------------------GRSRGFGFVEMS--DGAEAAIEALNGTEVDGRELVVNE  77
                                  G+S+GFGFV  S  D A  A+  +N   V+G+ L V  
Sbjct  396  EKTEEKPKESEEEAKKTEKKILGKSKGFGFVCFSSPDEASKAVTEMNQRMVNGKPLYVAL  455

Query  78   SRPKD  82
            ++ KD
Sbjct  456  AQRKD  460


>sp|Q8N6W0.1|CELF5_HUMAN RecName: Full=CUGBP Elav-like family member 5; Short=CELF-5; 
AltName: Full=CUG-BP- and ETR-3-like factor 5; AltName: Full=Bruno-like 
protein 5; AltName: Full=RNA-binding protein BRUNOL-5
Length=485

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 48/80 (60%), Gaps = 2/80 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEA  62
            N+++ ++     D +L  +F   G + S+K+  DRAT +S+ FGFV   +   A+AAI+A
Sbjct  401  NLFIYHLPQEFGDTELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQA  460

Query  63   LNGTEVDGRELVVNESRPKD  82
            +NG ++  + L V   RPKD
Sbjct  461  MNGFQIGMKRLKVQLKRPKD  480


 Score = 30.8 bits (68),  Expect = 1.9, Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEAAIEA  62
            + ++VG I   L ++DL+ +F + G +    ++ D  TG  +G  F+      ++AI+A
Sbjct  45   IKLFVGQIPRHLDEKDLKPLFEQFGRIYELTVLKDPYTGMHKGCAFLTYC-ARDSAIKA  102


>sp|Q4WK03.1|PABP_ASPFU RecName: Full=Polyadenylate-binding protein, cytoplasmic and 
nuclear; Short=Poly(A)-binding protein; Short=PABP; AltName: 
Full=Polyadenylate tail-binding protein
Length=753

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 51/79 (64%), Gaps = 3/79 (3%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEA  62
            N+Y+ NI   +TD++   +F + G +TSA +  D+  G+SRGFGFV  S  D A+AA++ 
Sbjct  234  NVYIKNIDQEVTDEEFRKMFEKFGEITSATLSRDQ-EGKSRGFGFVNFSTHDSAQAAVDE  292

Query  63   LNGTEVDGRELVVNESRPK  81
            +N  E+ G++L V  ++ K
Sbjct  293  MNDKEIKGQKLYVGRAQKK  311


 Score = 39.3 bits (90),  Expect = 0.006, Method: Composition-based stats.
 Identities = 33/127 (25%), Positives = 52/127 (40%), Gaps = 48/127 (37%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRAT----------------------  41
            +N+YV N++  + D+ L  +F+  GT+TSAK++ D  T                      
Sbjct  336  VNLYVKNLTDDVDDEKLRELFSPFGTITSAKVMRDTVTTGETSESEKEKEKESNKENEKE  395

Query  42   ------------------------GRSRGFGFVEMS--DGAEAAIEALNGTEVDGRELVV  75
                                    G+S+GFGFV  S  D A  A+  +N   V+G+ L V
Sbjct  396  GEEKTEEKPKESEEEPKKTEKKILGKSKGFGFVCFSSPDEASKAVTEMNQRMVNGKPLYV  455

Query  76   NESRPKD  82
              ++ KD
Sbjct  456  ALAQRKD  462


>sp|P0CB38.1|PAB4L_HUMAN RecName: Full=Polyadenylate-binding protein 4-like; Short=Poly(A)-binding 
protein 4-like; Short=PABP-4-like
Length=370

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 53/79 (67%), Gaps = 3/79 (3%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEM--SDGAEAAIEA  62
            N+Y+ N    + D+ L++VF+++G   S K++TD ++G+S+GFGFV     + A+ A+E 
Sbjct  191  NVYIKNFGGDMDDERLKDVFSKYGKTLSVKVMTD-SSGKSKGFGFVSFDSHEAAKKAVEE  249

Query  63   LNGTEVDGRELVVNESRPK  81
            +NG +++G+ + V  ++ K
Sbjct  250  MNGRDINGQLIFVGRAQKK  268


 Score = 38.1 bits (87),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 41/73 (56%), Gaps = 4/73 (5%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEA  62
            N+++ N+   + ++ L   F+  G + S+K+++D     S+G+ FV   +   A+ AIE 
Sbjct  99   NVFIKNLDKSIDNKTLYEHFSAFGKILSSKVMSDDQG--SKGYAFVHFQNQSAADRAIEE  156

Query  63   LNGTEVDGRELVV  75
            +NG  + G ++ V
Sbjct  157  MNGKLLKGCKVFV  169


>sp|Q5R8F7.1|PABP1_PONAB RecName: Full=Polyadenylate-binding protein 1; Short=Poly(A)-binding 
protein 1; Short=PABP-1
Length=636

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 53/82 (64%), Gaps = 3/82 (3%)

Query  2    KLMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAA  59
            +  N+Y+ N    + D+ L+++F + G   S K++TD  +G+S+GFGFV  E  + A+ A
Sbjct  189  EFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDE-SGKSKGFGFVSFERHEDAQKA  247

Query  60   IEALNGTEVDGRELVVNESRPK  81
            ++ +NG E++G+++ V  ++ K
Sbjct  248  VDEMNGKELNGKQIYVGRAQKK  269


 Score = 54.3 bits (129),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 50/82 (60%), Gaps = 4/82 (4%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIE  61
            +N+YV N+  G+ D+ L   F+  GT+TSAK++ +   GRS+GFGFV  S   EA  A+ 
Sbjct  294  VNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMME--GGRSKGFGFVCFSSPEEATKAVT  351

Query  62   ALNGTEVDGRELVVNESRPKDK  83
             +NG  V  + L V  ++ K++
Sbjct  352  EMNGRIVATKPLYVALAQRKEE  373


 Score = 46.6 bits (109),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 42/79 (53%), Gaps = 0/79 (0%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEAAIEALN  64
            NI++ N+   + ++ L + F+  G + S K++ D    +  GF   E  + AE AIE +N
Sbjct  100  NIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMN  159

Query  65   GTEVDGRELVVNESRPKDK  83
            G  ++ R++ V   + + +
Sbjct  160  GMLLNDRKVFVGRFKSRKE  178


>sp|P11940.2|PABP1_HUMAN RecName: Full=Polyadenylate-binding protein 1; Short=Poly(A)-binding 
protein 1; Short=PABP-1
 sp|P61286.1|PABP1_BOVIN RecName: Full=Polyadenylate-binding protein 1; Short=Poly(A)-binding 
protein 1; Short=PABP-1
Length=636

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 53/82 (64%), Gaps = 3/82 (3%)

Query  2    KLMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAA  59
            +  N+Y+ N    + D+ L+++F + G   S K++TD  +G+S+GFGFV  E  + A+ A
Sbjct  189  EFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDE-SGKSKGFGFVSFERHEDAQKA  247

Query  60   IEALNGTEVDGRELVVNESRPK  81
            ++ +NG E++G+++ V  ++ K
Sbjct  248  VDEMNGKELNGKQIYVGRAQKK  269


 Score = 54.3 bits (129),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 50/82 (60%), Gaps = 4/82 (4%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIE  61
            +N+YV N+  G+ D+ L   F+  GT+TSAK++ +   GRS+GFGFV  S   EA  A+ 
Sbjct  294  VNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMME--GGRSKGFGFVCFSSPEEATKAVT  351

Query  62   ALNGTEVDGRELVVNESRPKDK  83
             +NG  V  + L V  ++ K++
Sbjct  352  EMNGRIVATKPLYVALAQRKEE  373


 Score = 46.6 bits (109),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 42/79 (53%), Gaps = 0/79 (0%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEAAIEALN  64
            NI++ N+   + ++ L + F+  G + S K++ D    +  GF   E  + AE AIE +N
Sbjct  100  NIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMN  159

Query  65   GTEVDGRELVVNESRPKDK  83
            G  ++ R++ V   + + +
Sbjct  160  GMLLNDRKVFVGRFKSRKE  178


>sp|Q0U1G2.3|PABP_PHANO RecName: Full=Polyadenylate-binding protein, cytoplasmic and 
nuclear; Short=Poly(A)-binding protein; Short=PABP; AltName: 
Full=Polyadenylate tail-binding protein
Length=744

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 3/79 (3%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEM--SDGAEAAIEA  62
            NIYV NI   +TD+D   +F +HG +TSA I  D   G+SRGFGFV     + A  A++ 
Sbjct  230  NIYVKNIDLDVTDEDFRELFEKHGDITSASIARDD-QGKSRGFGFVNYIRHEAAAVAVDH  288

Query  63   LNGTEVDGRELVVNESRPK  81
            LN  E  G++L V  ++ K
Sbjct  289  LNDIEFKGQKLYVGRAQKK  307


 Score = 44.3 bits (103),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 46/81 (56%), Gaps = 3/81 (3%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAAIEA  62
            N+++ N+   + ++ L + FA  G + S K+  D   G S+G+GFV  E ++ A  AI+ 
Sbjct  137  NVFIKNLDHAIDNKALHDTFAAFGNILSCKVAQDE-LGNSKGYGFVHYETAEAANNAIKH  195

Query  63   LNGTEVDGRELVVNESRPKDK  83
            +NG  ++ +++ V    PK +
Sbjct  196  VNGMLLNEKKVFVGHHIPKKE  216


 Score = 33.9 bits (76),  Expect = 0.26, Method: Composition-based stats.
 Identities = 32/133 (24%), Positives = 54/133 (40%), Gaps = 54/133 (40%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIIT--------------------------  37
            +N+Y+ N++  + D+ L ++F   GT+TSAK+I                           
Sbjct  332  VNLYIKNLNDDVDDEKLRDMFTPFGTITSAKVILRDEEKKDEEEKEVKEEKKEDEKKEDE  391

Query  38   ------------------DRAT--------GRSRGFGFVEMSDGAEA--AIEALNGTEVD  69
                              D+ T        G+S+GFGFV  S+  EA  A+  +N   ++
Sbjct  392  EAKEGSSSEQNGEDTKAGDKVTIKGEKKILGKSKGFGFVCFSNPDEATKAVTEMNQKMIE  451

Query  70   GRELVVNESRPKD  82
            G+ L V  ++ KD
Sbjct  452  GKPLYVALAQRKD  464


>sp|Q6DEY7.1|EPAB_XENTR RecName: Full=Embryonic polyadenylate-binding protein; Short=Embryonic 
poly(A)-binding protein; Short=ePABP
Length=629

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 47/82 (57%), Gaps = 3/82 (3%)

Query  2    KLMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--A  59
            +  N+Y+ N    + D+ L  +F+  G   S K++ D  TGRSRGFGFV   +  EA  A
Sbjct  189  EFTNVYIKNFGEDMDDKRLREIFSAFGNTLSVKVMMDD-TGRSRGFGFVNYGNHEEAQKA  247

Query  60   IEALNGTEVDGRELVVNESRPK  81
            +  +NG EV+GR + V  ++ +
Sbjct  248  VSEMNGKEVNGRMIYVGRAQKR  269


 Score = 55.1 bits (131),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 50/82 (60%), Gaps = 4/82 (4%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIE  61
            +N+YV N+  G+ D  L   F+ +GT+TSAK++T+   G S+GFGFV  S   EA  A+ 
Sbjct  294  VNLYVKNLDDGIDDDRLRKEFSPYGTITSAKVMTE--GGHSKGFGFVCFSSPEEATKAVT  351

Query  62   ALNGTEVDGRELVVNESRPKDK  83
             +NG  V  + L V  ++ K++
Sbjct  352  EMNGRIVSTKPLYVALAQRKEE  373


 Score = 44.3 bits (103),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 40/77 (51%), Gaps = 0/77 (0%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEAAIEALN  64
            N+++ N+   + ++ L + F+  G + S K++ D    R  GF   E  + A  AI+ +N
Sbjct  100  NVFIKNLDESIDNKALYDTFSAFGNILSCKVVCDEHGSRGYGFVHFETQEAANRAIQTMN  159

Query  65   GTEVDGRELVVNESRPK  81
            G  ++ R++ V   + +
Sbjct  160  GMLLNDRKVFVGHFKSR  176


>sp|Q6DIV4.1|RBM38_XENTR RecName: Full=RNA-binding protein 38; AltName: Full=RNA-binding 
motif protein 38
Length=219

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (56%), Gaps = 3/76 (3%)

Query  3   LMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAI  60
              I+VG + +  TD  L   F   G +  A +ITDR TG+SRG+GFV MSD   AE A 
Sbjct  10  FTKIFVGGLPYHTTDASLRKYFEVFGDIDEAVVITDRQTGKSRGYGFVTMSDRAAAERAC  69

Query  61  EALNGTEVDGRELVVN  76
           +  N   +DGR+  VN
Sbjct  70  KDPNPI-IDGRKANVN  84


>sp|P29341.1|PABP1_MOUSE RecName: Full=Polyadenylate-binding protein 1; Short=Poly(A)-binding 
protein 1; Short=PABP-1
Length=636

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 52/82 (63%), Gaps = 3/82 (3%)

Query  2    KLMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAA  59
            +  N+Y+ N    + D+ L+ +F + G   S K++TD  +G+S+GFGFV  E  + A+ A
Sbjct  189  EFTNVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDE-SGKSKGFGFVSFERHEDAQKA  247

Query  60   IEALNGTEVDGRELVVNESRPK  81
            ++ +NG E++G+++ V  ++ K
Sbjct  248  VDEMNGKELNGKQIYVGRAQKK  269


 Score = 54.3 bits (129),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 50/82 (60%), Gaps = 4/82 (4%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIE  61
            +N+YV N+  G+ D+ L   F+  GT+TSAK++ +   GRS+GFGFV  S   EA  A+ 
Sbjct  294  VNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMME--GGRSKGFGFVCFSSPEEATKAVT  351

Query  62   ALNGTEVDGRELVVNESRPKDK  83
             +NG  V  + L V  ++ K++
Sbjct  352  EMNGRIVATKPLYVALAQRKEE  373


 Score = 46.2 bits (108),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 39/71 (54%), Gaps = 0/71 (0%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEAAIEALN  64
            NI++ N+   + ++ L + F+  G + S K++ D    +  GF   E  + AE AIE +N
Sbjct  100  NIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMN  159

Query  65   GTEVDGRELVV  75
            G  ++ R++ V
Sbjct  160  GMLLNDRKVFV  170


>sp|Q96J87.1|CELF6_HUMAN RecName: Full=CUGBP Elav-like family member 6; Short=CELF-6; 
AltName: Full=CUG-BP- and ETR-3-like factor 6; AltName: Full=Bruno-like 
protein 6; AltName: Full=RNA-binding protein BRUNOL-6
Length=481

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 46/80 (57%), Gaps = 2/80 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEA  62
            N+++ ++     D +L   F   G V SAK+  DRAT +S+ FGFV   +   A+ AI+A
Sbjct  397  NLFIYHLPQEFGDAELIQTFLPFGAVVSAKVFVDRATNQSKCFGFVSFDNPTSAQTAIQA  456

Query  63   LNGTEVDGRELVVNESRPKD  82
            +NG ++  + L V   RPKD
Sbjct  457  MNGFQIGMKRLKVQLKRPKD  476


 Score = 40.4 bits (93),  Expect = 0.003, Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 2/63 (3%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVE--MSDGAEAAIE  61
            + ++VG I  GL +QDL+ +F E G +    ++ DR TG  +G  F+     D A  A  
Sbjct  46   IKLFVGQIPRGLDEQDLKPLFEEFGRIYELTVLKDRLTGLHKGCAFLTYCARDSALKAQS  105

Query  62   ALN  64
            AL+
Sbjct  106  ALH  108


>sp|Q9EPH8.1|PABP1_RAT RecName: Full=Polyadenylate-binding protein 1; Short=Poly(A)-binding 
protein 1; Short=PABP-1
Length=636

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 52/82 (63%), Gaps = 3/82 (3%)

Query  2    KLMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAA  59
            +  N+Y+ N    + D+ L+ +F + G   S K++TD  +G+S+GFGFV  E  + A+ A
Sbjct  189  EFTNVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDE-SGKSKGFGFVSFERHEDAQKA  247

Query  60   IEALNGTEVDGRELVVNESRPK  81
            ++ +NG E++G+++ V  ++ K
Sbjct  248  VDEMNGKELNGKQIYVGRAQKK  269


 Score = 54.3 bits (129),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 50/82 (60%), Gaps = 4/82 (4%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIE  61
            +N+YV N+  G+ D+ L   F+  GT+TSAK++ +   GRS+GFGFV  S   EA  A+ 
Sbjct  294  VNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMME--GGRSKGFGFVCFSSPEEATKAVT  351

Query  62   ALNGTEVDGRELVVNESRPKDK  83
             +NG  V  + L V  ++ K++
Sbjct  352  EMNGRIVATKPLYVALAQRKEE  373


 Score = 46.6 bits (109),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 42/79 (53%), Gaps = 0/79 (0%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEAAIEALN  64
            NI++ N+   + ++ L + F+  G + S K++ D    +  GF   E  + AE AIE +N
Sbjct  100  NIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMN  159

Query  65   GTEVDGRELVVNESRPKDK  83
            G  ++ R++ V   + + +
Sbjct  160  GMLLNDRKVFVGRFKSRKE  178


>sp|Q9H361.2|PABP3_HUMAN RecName: Full=Polyadenylate-binding protein 3; Short=Poly(A)-binding 
protein 3; Short=PABP-3; AltName: Full=Testis-specific 
poly(A)-binding protein
Length=631

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 52/79 (65%), Gaps = 3/79 (3%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAAIEA  62
            N+Y+ N    + D+ L+++F + G   S K++TD  +G+S+GFGFV  E  + A+ A++ 
Sbjct  192  NVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDE-SGKSKGFGFVSFERHEDAQKAVDE  250

Query  63   LNGTEVDGRELVVNESRPK  81
            +NG E++G+++ V  ++ K
Sbjct  251  MNGKELNGKQIYVGRAQKK  269


 Score = 55.5 bits (132),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 52/84 (61%), Gaps = 4/84 (4%)

Query  2    KLMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--A  59
            +++N+YV N+  G+ D+ L   F+  GT+TSAK++ +   GRS+GFGFV  S   EA  A
Sbjct  292  QVVNLYVKNLDDGIDDERLRKAFSPFGTITSAKVMME--GGRSKGFGFVCFSSPEEATKA  349

Query  60   IEALNGTEVDGRELVVNESRPKDK  83
            +  +NG  V  + L V  ++ K++
Sbjct  350  VTEMNGRIVATKPLYVALAQRKEE  373


 Score = 43.9 bits (102),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 42/79 (53%), Gaps = 0/79 (0%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEAAIEALN  64
            NI+V N+   + ++ L +  +  G + S  ++ D    +  GF   E  + AE AI+ +N
Sbjct  100  NIFVKNLDKSINNKALYDTVSAFGNILSCNVVCDENGSKGYGFVHFETHEAAERAIKKMN  159

Query  65   GTEVDGRELVVNESRPKDK  83
            G  ++GR++ V + + + +
Sbjct  160  GMLLNGRKVFVGQFKSRKE  178


>sp|Q7JGR2.1|PABP5_MACMU RecName: Full=Polyadenylate-binding protein 5; Short=Poly(A)-binding 
protein 5; Short=PABP-5
Length=382

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (61%), Gaps = 3/81 (3%)

Query  3    LMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAAI  60
              N++V NI   + D+ L+ +F E+G   S K+I D A+G+S+GFGFV  E  + A+ A+
Sbjct  198  FTNVFVKNIGDDIDDEKLKELFCEYGPTESVKVIRD-ASGKSKGFGFVRYETHEAAQKAV  256

Query  61   EALNGTEVDGRELVVNESRPK  81
              L+G  +DG+ L V  ++ K
Sbjct  257  LDLHGKSIDGKVLYVGRAQKK  277


 Score = 40.4 bits (93),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 4/72 (5%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIEAL  63
            IY+ N+   + D+ L+  F+  G+++ AK++ +   G+ +GFG V  S   EA  A++ +
Sbjct  304  IYIKNLDETINDEKLKEEFSSFGSISRAKVMME--VGQGKGFGVVCFSSFEEATKAVDEM  361

Query  64   NGTEVDGRELVV  75
            NG  V  + L V
Sbjct  362  NGRVVGSKPLHV  373


 Score = 37.0 bits (84),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 39/73 (53%), Gaps = 4/73 (5%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIEA  62
            NI++ N+   + ++ L  +F+  G + S K++ D     S+G+ +V     A A  AI  
Sbjct  107  NIFIKNLDKSIDNRALFYLFSAFGNILSCKVVCD--DNGSKGYAYVHFDSLAAANRAIWH  164

Query  63   LNGTEVDGRELVV  75
            +NG  ++ R++ V
Sbjct  165  MNGVRLNNRQVYV  177


>sp|Q96DU9.1|PABP5_HUMAN RecName: Full=Polyadenylate-binding protein 5; Short=Poly(A)-binding 
protein 5; Short=PABP-5
 sp|P60047.1|PABP5_GORGO RecName: Full=Polyadenylate-binding protein 5; Short=Poly(A)-binding 
protein 5; Short=PABP-5
 sp|P60048.1|PABP5_HYLLA RecName: Full=Polyadenylate-binding protein 5; Short=Poly(A)-binding 
protein 5; Short=PABP-5
 sp|P60049.1|PABP5_PANTR RecName: Full=Polyadenylate-binding protein 5; Short=Poly(A)-binding 
protein 5; Short=PABP-5
 sp|P60050.1|PABP5_PONPY RecName: Full=Polyadenylate-binding protein 5; Short=Poly(A)-binding 
protein 5; Short=PABP-5
Length=382

 Score = 59.3 bits (142),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (61%), Gaps = 3/81 (3%)

Query  3    LMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAAI  60
              N++V NI   + D+ L+ +F E+G   S K+I D A+G+S+GFGFV  E  + A+ A+
Sbjct  198  FTNVFVKNIGDDIDDEKLKELFCEYGPTESVKVIRD-ASGKSKGFGFVRYETHEAAQKAV  256

Query  61   EALNGTEVDGRELVVNESRPK  81
              L+G  +DG+ L V  ++ K
Sbjct  257  LDLHGKSIDGKVLYVGRAQKK  277


 Score = 40.0 bits (92),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 4/72 (5%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIEAL  63
            IY+ N+   + D+ L+  F+  G+++ AK++ +   G+ +GFG V  S   EA  A++ +
Sbjct  304  IYIKNLDETINDEKLKEEFSSFGSISRAKVMME--VGQGKGFGVVCFSSFEEATKAVDEM  361

Query  64   NGTEVDGRELVV  75
            NG  V  + L V
Sbjct  362  NGRIVGSKPLHV  373


 Score = 37.0 bits (84),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 39/73 (53%), Gaps = 4/73 (5%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIEA  62
            NI++ N+   + ++ L  +F+  G + S K++ D     S+G+ +V     A A  AI  
Sbjct  107  NIFIKNLDKSIDNRALFYLFSAFGNILSCKVVCD--DNGSKGYAYVHFDSLAAANRAIWH  164

Query  63   LNGTEVDGRELVV  75
            +NG  ++ R++ V
Sbjct  165  MNGVRLNNRQVYV  177


>sp|A0JM51.1|CELF5_XENTR RecName: Full=CUGBP Elav-like family member 5; Short=CELF-5; 
AltName: Full=CUG-BP- and ETR-3-like factor 5; AltName: Full=Bruno-like 
protein 5; AltName: Full=RNA-binding protein BRUNOL-5
Length=486

 Score = 59.3 bits (142),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 48/82 (58%), Gaps = 2/82 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEA  62
            N+++ ++     D +L  +F   G + S+K+  DRAT +S+ FGFV   +   A+ AI+A
Sbjct  402  NLFIYHLPQEFGDNELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPSSAQTAIQA  461

Query  63   LNGTEVDGRELVVNESRPKDKS  84
            +NG ++  + L V   RPKD +
Sbjct  462  MNGFQIGMKRLKVQLKRPKDTT  483


 Score = 35.0 bits (79),  Expect = 0.11, Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEAAIEA  62
            + ++VG I   L ++DL+ +F + G +    ++ DR TG  +G  F+      ++AI+A
Sbjct  47   IKLFVGQIPRNLEEKDLKPLFEQFGKIYELTVLKDRYTGMHKGCAFLTYC-ARDSAIKA  104


 Score = 34.7 bits (78),  Expect = 0.14, Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 39/64 (60%), Gaps = 3/64 (4%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAE--AAIEAL  63
            ++VG +S   +++++ ++F   G++    ++     G S+G  FV+ S  AE  AAI+AL
Sbjct  137  LFVGMLSKQQSEEEVTSMFQAFGSIEECSVLRG-PDGSSKGCAFVKFSSHAEAQAAIQAL  195

Query  64   NGTE  67
            +G++
Sbjct  196  HGSQ  199


>sp|O93235.2|CIRBA_XENLA RecName: Full=Cold-inducible RNA-binding protein A; AltName: 
Full=Cold-inducible RNA-binding protein 1; Short=XCIRP-1; AltName: 
Full=Cold-inducible RNA-binding protein; Short=XCIRP; 
AltName: Full=Glycine-rich RNA-binding protein CIRP-A
Length=166

 Score = 59.3 bits (142),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 49/75 (65%), Gaps = 2/75 (2%)

Query  6   IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAAIEAL  63
           +++G +++   +  LE  F ++G ++   ++ DR T RSRGFGFV  E  D A+ A+ A+
Sbjct  7   LFIGGLNFETNEDCLEQAFTKYGRISEVVVVKDRETKRSRGFGFVTFENVDDAKDAMMAM  66

Query  64  NGTEVDGRELVVNES  78
           NG  VDGR++ V+++
Sbjct  67  NGKSVDGRQIRVDQA  81


>sp|Q6PFR5.1|TRA2A_MOUSE RecName: Full=Transformer-2 protein homolog alpha; Short=TRA-2 
alpha; Short=TRA2-alpha; AltName: Full=Transformer-2 protein 
homolog A
Length=281

 Score = 59.3 bits (142),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 46/73 (63%), Gaps = 2/73 (2%)

Query  8    VGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAAIEALNG  65
            V  +S   T++DL  VF+ +G ++   ++ D+ TGRSRGF FV  E  D ++ A+E  NG
Sbjct  121  VFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANG  180

Query  66   TEVDGRELVVNES  78
             E+DGR + V+ S
Sbjct  181  MELDGRRIRVDYS  193


>sp|Q13595.1|TRA2A_HUMAN RecName: Full=Transformer-2 protein homolog alpha; Short=TRA-2 
alpha; Short=TRA2-alpha; AltName: Full=Transformer-2 protein 
homolog A
Length=282

 Score = 59.3 bits (142),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 46/73 (63%), Gaps = 2/73 (2%)

Query  8    VGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAAIEALNG  65
            V  +S   T++DL  VF+ +G ++   ++ D+ TGRSRGF FV  E  D ++ A+E  NG
Sbjct  123  VFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANG  182

Query  66   TEVDGRELVVNES  78
             E+DGR + V+ S
Sbjct  183  MELDGRRIRVDYS  195


>sp|Q7TN33.1|CELF6_MOUSE RecName: Full=CUGBP Elav-like family member 6; Short=CELF-6; 
AltName: Full=CUG-BP- and ETR-3-like factor 6; AltName: Full=Bruno-like 
protein 6; AltName: Full=RNA-binding protein BRUNOL-6
Length=460

 Score = 58.9 bits (141),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 46/80 (57%), Gaps = 2/80 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEA  62
            N+++ ++     D +L   F   G V SAK+  DRAT +S+ FGFV   +   A+ AI+A
Sbjct  376  NLFIYHLPQEFGDAELIQTFLPFGAVVSAKVFVDRATNQSKCFGFVSFDNPTSAQTAIQA  435

Query  63   LNGTEVDGRELVVNESRPKD  82
            +NG ++  + L V   RPKD
Sbjct  436  MNGFQIGMKRLKVQLKRPKD  455


 Score = 39.7 bits (91),  Expect = 0.004, Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 2/63 (3%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVE--MSDGAEAAIE  61
            + ++VG I  GL +QDL+ +F E G +    ++ DR TG  +G  F+     D A  A  
Sbjct  46   IKLFVGQIPRGLDEQDLKPLFEEFGRIYELTVLKDRLTGLHKGCAFLTYCARDSALKAQS  105

Query  62   ALN  64
            AL+
Sbjct  106  ALH  108


>sp|Q6GR16.1|EPABB_XENLA RecName: Full=Embryonic polyadenylate-binding protein B; Short=Embryonic 
poly(A)-binding protein B; Short=ePABP-B; Short=ePAB-B; 
AltName: Full=XePABP-B
Length=629

 Score = 58.9 bits (141),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 48/82 (58%), Gaps = 3/82 (3%)

Query  2    KLMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--A  59
            +  N+Y+ N    + D+ L+ +F+  G   S K++ D  +GRSRGFGFV   +  EA  A
Sbjct  189  EFTNVYIKNFGEDMDDKRLKEIFSAFGNTLSVKVMMDN-SGRSRGFGFVNYGNHEEAQKA  247

Query  60   IEALNGTEVDGRELVVNESRPK  81
            +  +NG EV+GR + V  ++ +
Sbjct  248  VTEMNGKEVNGRMVYVGRAQKR  269


 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 49/82 (59%), Gaps = 4/82 (4%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIE  61
            +N+YV N+  G+ D  L   F+ +GT+TS K++T+   G S+GFGFV  S   EA  A+ 
Sbjct  294  VNLYVKNLDDGIDDDRLRKEFSPYGTITSTKVMTE--GGHSKGFGFVCFSSPEEATKAVT  351

Query  62   ALNGTEVDGRELVVNESRPKDK  83
             +NG  V  + L V  ++ K++
Sbjct  352  EMNGRIVSTKPLYVALAQRKEE  373


 Score = 43.1 bits (100),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 40/77 (51%), Gaps = 0/77 (0%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEAAIEALN  64
            N+++ N+   + ++ L + F+  G + S K++ D    R  GF   E  + A  AI+ +N
Sbjct  100  NVFIKNLDDSIDNKALYDTFSAFGDILSCKVVCDEYGSRGYGFVHFETQEAANRAIQTMN  159

Query  65   GTEVDGRELVVNESRPK  81
            G  ++ R++ V   + +
Sbjct  160  GMLLNDRKVFVGHFKSR  176


>sp|Q6DGV1.1|CELF4_DANRE RecName: Full=CUGBP Elav-like family member 4; Short=CELF-4; 
AltName: Full=CUG-BP- and ETR-3-like factor 4; AltName: Full=Bruno-like 
protein 4; AltName: Full=RNA-binding protein BRUNOL-4
Length=520

 Score = 58.9 bits (141),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 48/80 (60%), Gaps = 2/80 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEA  62
            N+++ ++     D +L  +F   G V S+K+  DRAT +S+ FGFV   +   A+AAI++
Sbjct  436  NLFIYHLPQEFGDGELMQMFLPFGNVISSKVFVDRATNQSKCFGFVSFDNPGSAQAAIQS  495

Query  63   LNGTEVDGRELVVNESRPKD  82
            +NG ++  + L V   RPKD
Sbjct  496  MNGFQIGMKRLKVQLKRPKD  515


 Score = 35.4 bits (80),  Expect = 0.088, Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEAAIEA  62
            + +++G I   L ++DL  +F E G +    ++ DR TG  +G  F+      E+A++A
Sbjct  47   IKLFIGQIPRNLDEKDLRPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYC-ARESALKA  104


>sp|Q9H0Z9.2|RBM38_HUMAN RecName: Full=RNA-binding protein 38; AltName: Full=RNA-binding 
motif protein 38; AltName: Full=RNA-binding region-containing 
protein 1; AltName: Full=HSRNASEB; AltName: Full=ssDNA-binding 
protein SEB4; AltName: Full=CLL-associated antigen KW-5
Length=239

 Score = 58.5 bits (140),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 43/76 (56%), Gaps = 3/76 (3%)

Query  3    LMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAI  60
               I+VG + +  TD  L   F   G +  A +ITDR TG+SRG+GFV M+D   AE A 
Sbjct  33   FTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERAC  92

Query  61   EALNGTEVDGRELVVN  76
            +  N   +DGR+  VN
Sbjct  93   KDPNPI-IDGRKANVN  107


>sp|Q5ZJX4.1|RBM38_CHICK RecName: Full=RNA-binding protein 38; AltName: Full=RNA-binding 
motif protein 38
Length=215

 Score = 58.5 bits (140),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 43/76 (56%), Gaps = 3/76 (3%)

Query  3   LMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAI  60
              I+VG + +  TD  L   F   G +  A +ITDR TG+SRG+GFV M+D   AE A 
Sbjct  10  FTKIFVGGLPYHTTDSSLRKYFEVFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERAC  69

Query  61  EALNGTEVDGRELVVN  76
           +  N   +DGR+  VN
Sbjct  70  KDPNPI-IDGRKANVN  84


>sp|Q9P3U1.2|YKX5_SCHPO RecName: Full=Uncharacterized RNA-binding protein C328.05
Length=468

 Score = 58.5 bits (140),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 3/70 (4%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEAA--IEAL  63
            IYVGN+ W  +D++L ++F + G+V  A+I  +  TGRS+GFG V+  +  +AA  IE L
Sbjct  316  IYVGNLPWATSDRNLLDLFTDIGSVIRARIAYE-PTGRSKGFGVVQFENENDAASSIEKL  374

Query  64   NGTEVDGREL  73
            NG    GR L
Sbjct  375  NGYRYGGRPL  384


 Score = 45.1 bits (105),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 41/72 (56%), Gaps = 7/72 (9%)

Query  10   NISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIEALNGTE  67
            N+ W    QDL+++F + G+V  A I  ++  GRSRG G V MS   EA  AI+ L+ T+
Sbjct  193  NVRW----QDLKDLFRQAGSVIRADIQMNQE-GRSRGIGIVVMSSMKEAMHAIQMLHNTD  247

Query  68   VDGRELVVNESR  79
              GR L V   R
Sbjct  248  FMGRTLEVRLDR  259


 Score = 36.2 bits (82),  Expect = 0.046, Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 43/79 (54%), Gaps = 3/79 (3%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIEAL  63
            +YVGN+S+ +   +L+    + G V + +I+ +   G S+G   +E S   EA  AI+ L
Sbjct  68   VYVGNLSYQVRWFELKEFMGQVGNVLNCEIL-NLPNGLSKGCAIIEYSTAEEARTAIKTL  126

Query  64   NGTEVDGRELVVNESRPKD  82
            +  +  GR + + E R ++
Sbjct  127  SNQKFMGRLVYIREDREQN  145


>sp|Q98SP8.2|EPABA_XENLA RecName: Full=Embryonic polyadenylate-binding protein A; Short=Embryonic 
poly(A)-binding protein A; Short=ePABP-A; Short=ePAB-A; 
AltName: Full=XePABP-A
Length=629

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 3/82 (3%)

Query  2    KLMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--A  59
            +  N+Y+ N    + D+ L  +F+  G   S K++ D  +GRSRGFGFV   +  EA  A
Sbjct  189  EFTNVYIKNFGEDMDDKRLREIFSAFGNTLSVKVMMDD-SGRSRGFGFVNYGNHEEAQKA  247

Query  60   IEALNGTEVDGRELVVNESRPK  81
            +  +NG EV+GR + V  ++ +
Sbjct  248  VSEMNGKEVNGRMIYVGRAQKR  269


 Score = 53.9 bits (128),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 49/82 (59%), Gaps = 4/82 (4%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIE  61
            +N+YV N+  G+ D  L   F  +GT+TSAK++T+   G S+GFGFV  S   EA  A+ 
Sbjct  294  VNLYVKNLDDGIDDDRLRKEFLPYGTITSAKVMTE--GGHSKGFGFVCFSSPEEATKAVT  351

Query  62   ALNGTEVDGRELVVNESRPKDK  83
             +NG  V  + L V  ++ K++
Sbjct  352  EMNGRIVSTKPLYVALAQRKEE  373


 Score = 43.9 bits (102),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 40/77 (51%), Gaps = 0/77 (0%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEAAIEALN  64
            N+++ N+   + ++ L + F+  G + S K++ D    R  GF   E  + A  AI+ +N
Sbjct  100  NVFIKNLDESIDNKALYDTFSAFGNILSCKVVCDEHGSRGYGFVHFETHEAANRAIQTMN  159

Query  65   GTEVDGRELVVNESRPK  81
            G  ++ R++ V   + +
Sbjct  160  GMLLNDRKVFVGHFKSR  176


>sp|P21187.3|PABP_DROME RecName: Full=Polyadenylate-binding protein; Short=Poly(A)-binding 
protein; Short=PABP
Length=634

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 53/80 (66%), Gaps = 4/80 (5%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAAIEA  62
            N+YV N +    D+ L+  F  +G +TS K+++ +  G+S+GFGFV  E ++ AEAA++A
Sbjct  184  NVYVKNFTEDFDDEKLKEFFEPYGKITSYKVMS-KEDGKSKGFGFVAFETTEAAEAAVQA  242

Query  63   LNGTEV-DGRELVVNESRPK  81
            LNG ++ +G+ L V  ++ K
Sbjct  243  LNGKDMGEGKSLYVARAQKK  262


 Score = 53.9 bits (128),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 50/82 (60%), Gaps = 3/82 (3%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIE  61
            +N+YV N+   + D  L   F+ +G +TSAK++TD   GRS+GFGFV  +  +EA  A+ 
Sbjct  287  VNLYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDE-EGRSKGFGFVCFNAASEATCAVT  345

Query  62   ALNGTEVDGRELVVNESRPKDK  83
             LNG  V  + L V  ++ K++
Sbjct  346  ELNGRVVGSKPLYVALAQRKEE  367


 Score = 46.2 bits (108),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 48/81 (59%), Gaps = 3/81 (3%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAAIEA  62
            N+++ N+   + ++ + + F+  G + S K+ TD   G S+G+GFV  E  + A  +I+ 
Sbjct  91   NVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATDE-KGNSKGYGFVHFETEEAANTSIDK  149

Query  63   LNGTEVDGRELVVNESRPKDK  83
            +NG  ++G+++ V +  P+ +
Sbjct  150  VNGMLLNGKKVYVGKFIPRKE  170


>sp|Q9I8B3.1|RB24B_XENLA RecName: Full=RNA-binding protein 24-B; AltName: Full=RNA-binding 
motif protein 24-B; AltName: Full=MTR-1a
Length=224

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 3/74 (4%)

Query  5   NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEA  62
            I+VG + +  TD  L   F   G +  A +ITDR TG+SRG+GFV M+D   AE A + 
Sbjct  12  KIFVGGLPYHTTDSSLRKYFEVFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKD  71

Query  63  LNGTEVDGRELVVN  76
            N   +DGR+  VN
Sbjct  72  PNPI-IDGRKANVN  84


>sp|Q5ZMA3.2|RBM24_CHICK RecName: Full=RNA-binding protein 24; AltName: Full=RNA-binding 
motif protein 24
Length=225

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 3/74 (4%)

Query  5   NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEA  62
            I+VG + +  TD  L   F   G +  A +ITDR TG+SRG+GFV M+D   AE A + 
Sbjct  12  KIFVGGLPYHTTDSSLRKYFEVFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKD  71

Query  63  LNGTEVDGRELVVN  76
            N   +DGR+  VN
Sbjct  72  PNPI-IDGRKANVN  84


>sp|Q6GQD3.1|RB24A_XENLA RecName: Full=RNA-binding protein 24-A; AltName: Full=RNA-binding 
motif protein 24-A; AltName: Full=RRM domain-containing 
protein SEB-4; Short=SEB-4; AltName: Full=Xseb-4
Length=225

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 3/74 (4%)

Query  5   NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEA  62
            I+VG + +  TD  L   F   G +  A +ITDR TG+SRG+GFV M+D   AE A + 
Sbjct  12  KIFVGGLPYHTTDSSLRKYFEVFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKD  71

Query  63  LNGTEVDGRELVVN  76
            N   +DGR+  VN
Sbjct  72  PNPI-IDGRKANVN  84


>sp|Q7S6N6.1|PABP_NEUCR RecName: Full=Polyadenylate-binding protein, cytoplasmic and 
nuclear; Short=Poly(A)-binding protein; Short=PABP; AltName: 
Full=Polyadenylate tail-binding protein
Length=764

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 51/79 (64%), Gaps = 3/79 (3%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEA  62
            N+YV NI+  +TD++   +FA+ G VTS+ +  D+  G+SRGFGFV  +  + A  A++ 
Sbjct  242  NVYVKNINNEVTDEEFRELFAKFGEVTSSSLARDQ-EGKSRGFGFVNFTTHEAAAQAVDE  300

Query  63   LNGTEVDGRELVVNESRPK  81
            LNG +  G++L V  ++ K
Sbjct  301  LNGKDFRGQDLYVGRAQKK  319


 Score = 44.7 bits (104),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 44/79 (55%), Gaps = 3/79 (3%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAAIEA  62
            NI++ N+   + ++ L + FA  G + S K+  D   G S+G+GFV  E  + A  AI+ 
Sbjct  149  NIFIKNLDAAIDNKALHDTFAAFGNILSCKVAQDEH-GNSKGYGFVHYETDEAASQAIKH  207

Query  63   LNGTEVDGRELVVNESRPK  81
            +NG  ++ +++ V    PK
Sbjct  208  VNGMLLNEKKVYVGHHIPK  226


 Score = 43.1 bits (100),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 51/121 (42%), Gaps = 42/121 (34%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITD-------------------------  38
            +N+Y+ N+   + D  L  +F+E+G +TSAK++ D                         
Sbjct  344  VNLYIKNLGDDVDDDKLRAMFSEYGPITSAKVMRDSLIEGSEEKDEKDKENKKEGETKEE  403

Query  39   ---------------RATGRSRGFGFVEMS--DGAEAAIEALNGTEVDGRELVVNESRPK  81
                           R  G+S+GFGFV  S  D A  A+  +N   VDG+ L V  ++ K
Sbjct  404  EQNEGSEKKTEKKGDRKLGKSKGFGFVCFSNPDDATKAVTEMNQRMVDGKPLYVALAQRK  463

Query  82   D  82
            D
Sbjct  464  D  464


 Score = 41.6 bits (96),  Expect = 0.001, Method: Composition-based stats.
 Identities = 24/69 (34%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGA--EAAIEA  62
            ++YVG +   +T+  L  +F++ G+V S ++  D  T RS G+ +V  +  A  E A+E 
Sbjct  61   SLYVGELDPSVTEAMLFELFSQIGSVASIRVCRDAVTRRSLGYAYVNYNTTADGEKALEE  120

Query  63   LNGTEVDGR  71
            LN T + GR
Sbjct  121  LNYTLIKGR  129


>sp|Q6P8A7.1|RBM24_XENTR RecName: Full=RNA-binding protein 24; AltName: Full=RNA-binding 
motif protein 24
Length=226

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 3/74 (4%)

Query  5   NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEA  62
            I+VG + +  TD  L   F   G +  A +ITDR TG+SRG+GFV M+D   AE A + 
Sbjct  12  KIFVGGLPYHTTDSSLRKYFEVFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKD  71

Query  63  LNGTEVDGRELVVN  76
            N   +DGR+  VN
Sbjct  72  PNPI-IDGRKANVN  84


>sp|P52912.1|TIA1_MOUSE RecName: Full=Nucleolysin TIA-1; AltName: Full=RNA-binding protein 
TIA-1
Length=386

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 49/74 (66%), Gaps = 2/74 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEA  62
            +++VG++S  +T +D++  FA  G ++ A+++ D ATG+S+G+GFV   +   AE AI+ 
Sbjct  107  HVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQ  166

Query  63   LNGTEVDGRELVVN  76
            + G  + GR++  N
Sbjct  167  MGGQWLGGRQIRTN  180


 Score = 39.3 bits (90),  Expect = 0.006, Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 8/67 (11%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEAL  63
            +Y G ++ GLT+Q +   F+  G +   ++  D      +G+ FV  S  + A  AI ++
Sbjct  216  VYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPD------KGYSFVRFSSHESAAHAIVSV  269

Query  64   NGTEVDG  70
            NGT ++G
Sbjct  270  NGTTIEG  276


 Score = 33.5 bits (75),  Expect = 0.33, Method: Composition-based stats.
 Identities = 29/86 (33%), Positives = 49/86 (56%), Gaps = 9/86 (10%)

Query  6   IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEAL  63
           +YVGN+S  +T+  +  +F++ G   + K+I D  T  +  + FVE  +   A AA+ A+
Sbjct  9   LYVGNLSRDVTEALILQLFSQIGPCKNCKMIMD--TAGNDPYCFVEFHEHRHAAAALAAM  66

Query  64  NGTEVDGRELVVN-----ESRPKDKS  84
           NG ++ G+E+ VN      S+ KD S
Sbjct  67  NGRKIMGKEVKVNWATTPSSQKKDTS  92


>sp|O89086.1|RBM3_MOUSE RecName: Full=Putative RNA-binding protein 3; AltName: Full=RNA-binding 
motif protein 3
Length=153

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 48/75 (64%), Gaps = 2/75 (2%)

Query  6   IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIEAL  63
           ++VG +++   +Q LE+ F+  G ++   ++ DR T RSRGFGF+  ++   A  A+ A+
Sbjct  8   LFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASDAMRAM  67

Query  64  NGTEVDGRELVVNES  78
           NG  +DGR++ V+ +
Sbjct  68  NGESLDGRQIRVDHA  82


>sp|P31483.3|TIA1_HUMAN RecName: Full=Nucleolysin TIA-1 isoform p40; AltName: Full=p40-TIA-1; 
AltName: Full=RNA-binding protein TIA-1; Contains: 
RecName: Full=Nucleolysin TIA-1 isoform p15; AltName: Full=p15-TIA-1
Length=386

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 49/74 (66%), Gaps = 2/74 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEA  62
            +++VG++S  +T +D++  FA  G ++ A+++ D ATG+S+G+GFV   +   AE AI+ 
Sbjct  107  HVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQ  166

Query  63   LNGTEVDGRELVVN  76
            + G  + GR++  N
Sbjct  167  MGGQWLGGRQIRTN  180


 Score = 37.7 bits (86),  Expect = 0.015, Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 8/67 (11%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEAL  63
            +Y G ++ GLT+Q +   F+  G +   ++  D      +G+ FV  +  + A  AI ++
Sbjct  216  VYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPD------KGYSFVRFNSHESAAHAIVSV  269

Query  64   NGTEVDG  70
            NGT ++G
Sbjct  270  NGTTIEG  276


 Score = 33.5 bits (75),  Expect = 0.37, Method: Composition-based stats.
 Identities = 29/86 (33%), Positives = 49/86 (56%), Gaps = 9/86 (10%)

Query  6   IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEAL  63
           +YVGN+S  +T+  +  +F++ G   + K+I D  T  +  + FVE  +   A AA+ A+
Sbjct  9   LYVGNLSRDVTEALILQLFSQIGPCKNCKMIMD--TAGNDPYCFVEFHEHRHAAAALAAM  66

Query  64  NGTEVDGRELVVN-----ESRPKDKS  84
           NG ++ G+E+ VN      S+ KD S
Sbjct  67  NGRKIMGKEVKVNWATTPSSQKKDTS  92


>sp|P98179.1|RBM3_HUMAN RecName: Full=Putative RNA-binding protein 3; AltName: Full=RNA-binding 
motif protein 3; AltName: Full=RNPL
Length=157

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 48/75 (64%), Gaps = 2/75 (2%)

Query  6   IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIEAL  63
           ++VG +++   +Q LE+ F+  G ++   ++ DR T RSRGFGF+  ++   A  A+ A+
Sbjct  8   LFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAM  67

Query  64  NGTEVDGRELVVNES  78
           NG  +DGR++ V+ +
Sbjct  68  NGESLDGRQIRVDHA  82


>sp|Q9BX46.1|RBM24_HUMAN RecName: Full=RNA-binding protein 24; AltName: Full=RNA-binding 
motif protein 24; AltName: Full=RNA-binding region-containing 
protein 6
Length=236

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 3/74 (4%)

Query  5   NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEA  62
            I+VG + +  TD  L   F   G +  A +ITDR TG+SRG+GFV M+D   AE A + 
Sbjct  12  KIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKD  71

Query  63  LNGTEVDGRELVVN  76
            N   +DGR+  VN
Sbjct  72  PNPI-IDGRKANVN  84


>sp|Q7T3I7.2|RBM38_XENLA RecName: Full=RNA-binding protein 38; AltName: Full=RNA-binding 
motif protein 38; AltName: Full=RNA-binding protein XSeb4R
Length=214

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 42/76 (55%), Gaps = 3/76 (3%)

Query  3   LMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAI  60
              I+VG + +  TD  L   F   G +  A +ITDR T +SRG+GFV MSD   AE A 
Sbjct  10  FTKIFVGGLPYHTTDASLRKYFEVFGDIDEAVVITDRQTAKSRGYGFVTMSDRAAAERAC  69

Query  61  EALNGTEVDGRELVVN  76
           +  N   +DGR+  VN
Sbjct  70  KDPNPI-IDGRKANVN  84


>sp|Q6CSV3.1|PABP_KLULA RecName: Full=Polyadenylate-binding protein, cytoplasmic and 
nuclear; Short=Poly(A)-binding protein; Short=PABP; AltName: 
Full=Polyadenylate tail-binding protein
Length=592

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 46/79 (58%), Gaps = 3/79 (3%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEA  62
            NIYV NI    TD++ E +F+++G + SA +  D A G+ +GFGFV   D   A  A+E 
Sbjct  232  NIYVKNIDVETTDEEFEQLFSQYGEIVSAALEKD-AEGKPKGFGFVNFVDHNAAAKAVEE  290

Query  63   LNGTEVDGRELVVNESRPK  81
            LNG E   + L V  ++ K
Sbjct  291  LNGKEFKSQALYVGRAQKK  309


 Score = 50.8 bits (120),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 3/79 (3%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIEA  62
            NI++ N+   + ++ L   F+  G V S K+  D   G SRGFGFV   + ++A  AIEA
Sbjct  139  NIFIKNLHPAIDNKALHETFSTFGEVLSCKVALDE-NGNSRGFGFVHFKEESDAKDAIEA  197

Query  63   LNGTEVDGRELVVNESRPK  81
            +NG  ++G E+ V    PK
Sbjct  198  VNGMLMNGLEVYVAMHVPK  216


 Score = 49.7 bits (117),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 3/81 (3%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDGAEA--AIE  61
            +N+++ N+   + D+ L+  FA +GT+TSA+++ D+  G S+GFGFV  S   EA  A+ 
Sbjct  334  VNLFIKNLDDSIDDEKLKEEFAPYGTITSARVMRDQ-EGNSKGFGFVCFSSPEEATKAMT  392

Query  62   ALNGTEVDGRELVVNESRPKD  82
              N   V G+ L V  ++ KD
Sbjct  393  EKNQQIVAGKPLYVAIAQRKD  413


 Score = 42.4 bits (98),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSD--GAEAAIEA  62
            ++YVG +   +T+  L +VF+  G ++S ++  D  T  S G+ +V  +D    + AI+ 
Sbjct  51   SLYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGKKAIQE  110

Query  63   LNGTEVDGR  71
            LN  E++GR
Sbjct  111  LNYAEINGR  119


>sp|P41891.2|GAR2_SCHPO RecName: Full=Protein gar2
Length=500

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 51/80 (63%), Gaps = 2/80 (2%)

Query  4    MNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEM-SDGAEAAIEA  62
              ++VG +SW + DQ L   F E+GT+  A++I D  +GRS+G+G+V+  +  A  A  A
Sbjct  263  CTVFVGRLSWNVDDQWLGQEFEEYGTIVGARVIMDGQSGRSKGYGYVDFETPEAAKAAVA  322

Query  63   LNGT-EVDGRELVVNESRPK  81
             NGT E+DGR + ++ S P+
Sbjct  323  ANGTKEIDGRMVNLDLSNPR  342


 Score = 54.7 bits (130),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%), Gaps = 3/78 (3%)

Query  6    IYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEAL  63
            ++VGN+S+  T+ DL   F   G + S ++ TD  +GR +GFG+V  S  D A+  +E +
Sbjct  368  VFVGNLSFNATEDDLSTAFGGCGDIQSIRLPTDPQSGRLKGFGYVTFSDIDSAKKCVE-M  426

Query  64   NGTEVDGRELVVNESRPK  81
            NG  + GR   ++ S P+
Sbjct  427  NGHFIAGRPCRLDFSTPR  444


>sp|B4PIS2.1|SHEP_DROYA RecName: Full=Protein alan shepard
Length=582

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 2/80 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDG--AEAAIEA  62
            N+Y+  +  G TD+DL N+ A++GT+ S K I D+ T + +G+GFV+      AE A++ 
Sbjct  232  NLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKG  291

Query  63   LNGTEVDGRELVVNESRPKD  82
            L G  V  +     E  P +
Sbjct  292  LQGKGVQAQMAKQQEQDPTN  311


 Score = 41.6 bits (96),  Expect = 0.001, Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEA  62
            N+Y+ N+     + DLE + +++G V S +I+ D+    S+G GF  M   +  E  I+ 
Sbjct  311  NLYIANLPPHFKETDLEAMLSKYGQVVSTRILRDQQM-NSKGVGFARMESREKCEQIIQM  369

Query  63   LNGTEVDG  70
             NG  + G
Sbjct  370  FNGNTIPG  377


>sp|B4HUE4.1|SHEP_DROSE RecName: Full=Protein alan shepard
Length=579

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 2/80 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDG--AEAAIEA  62
            N+Y+  +  G TD+DL N+ A++GT+ S K I D+ T + +G+GFV+      AE A++ 
Sbjct  232  NLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKG  291

Query  63   LNGTEVDGRELVVNESRPKD  82
            L G  V  +     E  P +
Sbjct  292  LQGKGVQAQMAKQQEQDPTN  311


 Score = 41.6 bits (96),  Expect = 0.001, Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEA  62
            N+Y+ N+     + DLE + +++G V S +I+ D+    S+G GF  M   +  E  I+ 
Sbjct  311  NLYIANLPPHFKETDLEAMLSKYGQVVSTRILRDQQM-NSKGVGFARMESREKCEQIIQM  369

Query  63   LNGTEVDG  70
             NG  + G
Sbjct  370  FNGNTIPG  377


>sp|B3NGA1.1|SHEP_DROER RecName: Full=Protein alan shepard
Length=582

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 2/80 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDG--AEAAIEA  62
            N+Y+  +  G TD+DL N+ A++GT+ S K I D+ T + +G+GFV+      AE A++ 
Sbjct  232  NLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKG  291

Query  63   LNGTEVDGRELVVNESRPKD  82
            L G  V  +     E  P +
Sbjct  292  LQGKGVQAQMAKQQEQDPTN  311


 Score = 41.6 bits (96),  Expect = 0.001, Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEA  62
            N+Y+ N+     + DLE + +++G V S +I+ D+    S+G GF  M   +  E  I+ 
Sbjct  311  NLYIANLPPHFKETDLEAMLSKYGQVVSTRILRDQQM-NSKGVGFARMESREKCEQIIQM  369

Query  63   LNGTEVDG  70
             NG  + G
Sbjct  370  FNGNTIPG  377


>sp|Q8MSV2.1|SHEP_DROME RecName: Full=Protein alan shepard
Length=578

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 2/80 (2%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMSDG--AEAAIEA  62
            N+Y+  +  G TD+DL N+ A++GT+ S K I D+ T + +G+GFV+      AE A++ 
Sbjct  232  NLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKG  291

Query  63   LNGTEVDGRELVVNESRPKD  82
            L G  V  +     E  P +
Sbjct  292  LQGKGVQAQMAKQQEQDPTN  311


 Score = 41.6 bits (96),  Expect = 0.001, Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query  5    NIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFVEMS--DGAEAAIEA  62
            N+Y+ N+     + DLE + +++G V S +I+ D+    S+G GF  M   +  E  I+ 
Sbjct  311  NLYIANLPPHFKETDLEAMLSKYGQVVSTRILRDQQM-NSKGVGFARMESREKCEQIIQM  369

Query  63   LNGTEVDG  70
             NG  + G
Sbjct  370  FNGNTIPG  377


>sp|P20965.3|PABPA_XENLA RecName: Full=Polyadenylate-binding protein 1-A; Short=Poly(A)-binding 
protein 1-A; Short=PABP-1-A; Short=xPABP1-A; AltName: 
Full=Cytoplasmic poly(A)-binding protein 1-A
Length=633

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 51/82 (62%), Gaps = 3/82 (3%)

Query  2    KLMNIYVGNISWGLTDQDLENVFAEHGTVTSAKIITDRATGRSRGFGFV--EMSDGAEAA  59
            +  N+Y+ N    + D+ L+ +F ++G   S K++TD   G+S+GFGFV  E  + A+ A
Sbjct  189  EFTNVYIKNFGDDMNDERLKEMFGKYGPALSVKVMTDD-NGKSKGFGFVSFERHEDAQKA  247

Query  60   IEALNGTEVDGRELVVNESRPK  81
            ++ +NG +++G+ + V  ++ K
Sbjct  248  VDEMNGKDMNGKSMFVGRAQKK  269



  Database: Non-redundant SwissProt sequences
    Posted date:  Apr 27, 2010  5:44 PM
  Number of letters in database: 160,576,090
  Number of sequences in database:  433,734

Lambda     K      H
   0.319    0.136    0.389 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 433734
Number of Hits to DB: 275862
Number of extensions: 8863
Number of successful extensions: 51
Number of sequences better than 100: 10
Number of HSP's better than 100 without gapping: 0
Number of HSP's gapped: 48
Number of HSP's successfully gapped: 17
Length of query: 85
Length of database: 160576090
Length adjustment: 56
Effective length of query: 29
Effective length of database: 136286986
Effective search space: 3952322594
Effective search space used: 3952322594
T: 11
A: 40
X1: 16 (7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (20.4 bits)
S2: 54 (25.4 bits)


b)
BLASTP 2.2.23+
Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro
A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and
David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new
generation of protein database search programs", Nucleic
Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Stephen
F. Altschul, John C. Wootton, E. Michael Gertz, Richa
Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and
Yi-Kuo Yu (2005) "Protein database searches using
compositionally adjusted substitution matrices", FEBS J.
272:5101-5109.


RID: XGGE0NJ501S


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
           10,926,906 sequences; 3,720,791,775 total letters
Query=  Translation of ORF number 1 in reading frame 3 on the reverse strand.
Length=85


                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_06386469.1|  RNP-1 like RNA-binding protein [Candidatus...   118    2e-25
ref|ZP_04428885.1|  RRM domain-containing RNA-binding protein ...   115    2e-24
ref|ZP_06242498.1|  RNP-1 like RNA-binding protein [Victivalli...   112    2e-23
ref|YP_003157337.1|  RNP-1 like RNA-binding protein [Desulfomi...   111    2e-23
ref|ZP_02733249.1|  RNA-binding protein [Gemmata obscuriglobus...   108    1e-22
ref|YP_387289.1|  RNA-binding region RNP-1 [Desulfovibrio desu...   103    5e-21
ref|ZP_02735120.1|  RNA-binding protein [Gemmata obscuriglobus...   103    5e-21
ref|YP_003122024.1|  RNP-1 like RNA-binding protein [Chitinoph...   103    6e-21
ref|YP_003158594.1|  RNP-1 like RNA-binding protein [Desulfomi...   103    7e-21
ref|YP_001996504.1|  RNP-1  like RNA-binding protein [Chlorohe...   103    8e-21
ref|ZP_03735979.1|  RNP-1 like RNA-binding protein [Desulfonat...   103    8e-21
ref|ZP_03739220.1|  RNP-1 like RNA-binding protein [Desulfonat...   103    8e-21
ref|ZP_02734871.1|  RNA-binding region RNP-1 [Gemmata obscurig...   102    1e-20
ref|YP_001514932.1|  RNA-binding region [Acaryochloris marina ...   101    3e-20
ref|YP_003095916.1|  RNA-binding protein [Flavobacteriaceae ba...   101    3e-20
ref|ZP_03735999.1|  RNP-1 like RNA-binding protein [Desulfonat...   101    3e-20
ref|ZP_02736789.1|  RNA-binding protein [Gemmata obscuriglobus...  99.8    8e-20
ref|YP_113486.1|  RNA-binding protein [Methylococcus capsulatu...  99.8    9e-20
ref|YP_001489013.1|  RNA recognition motif-containing protein ...  99.8    9e-20
ref|YP_002607731.1|  RNA-binding protein [Nautilia profundicol...  99.4    1e-19
ref|YP_003503685.1|  RNP-1 like RNA-binding protein [Denitrovi...  99.0    2e-19
gb|ACE75641.1|  RNA-binding protein [Candidatus Nitrospira def...  99.0    2e-19
ref|YP_002015909.1|  RNP-1 like RNA-binding protein [Prostheco...  98.2    2e-19
ref|YP_970494.1|  RNP-1-like RNA-binding protein [Acidovorax a...  97.8    4e-19
ref|YP_001959801.1|  RNP-1 like RNA-binding protein [Chlorobiu...  97.4    4e-19
ref|ZP_00518171.1|  RNA-binding region RNP-1  (RNA recognition...  97.4    4e-19
ref|ZP_06304341.1|  RNA-binding region protein RNP-1 [Raphidio...  97.1    5e-19
ref|ZP_01623650.1|  RNA-binding region protein [Lyngbya sp. PC...  97.1    5e-19
ref|YP_002250013.1|  RNA-binding protein [Dictyoglomus thermop...  97.1    6e-19
emb|CBA30701.1|  Glycine-rich RNA-binding protein GRP1A [Curvi...  96.7    7e-19
ref|YP_003504005.1|  RNP-1 like RNA-binding protein [Denitrovi...  96.7    7e-19
ref|ZP_06724872.1|  RNA-binding protein [Bacteroides ovatus SD...  96.7    7e-19
ref|YP_002352319.1|  RNP-1 like RNA-binding protein [Dictyoglo...  96.7    7e-19
ref|ZP_03609908.1|  RNA-binding region RNP-1 [Campylobacter re...  96.7    8e-19
gb|AAX07503.1|  unknown [Gemmata sp. Wa1-1]                        96.7    8e-19
ref|ZP_06616856.1|  conserved hypothetical protein [Bacteroide...  96.7    8e-19
ref|ZP_01090592.1|  RNA-binding protein [Blastopirellula marin...  96.3    9e-19
ref|ZP_01872208.1|  hypothetical protein CMTB2_06431 [Caminiba...  96.3    9e-19
ref|XP_002165384.1|  PREDICTED: similar to cp31AHv protein [Hy...  96.3    9e-19
ref|ZP_04543772.1|  conserved hypothetical protein [Bacteroide...  96.3    1e-18
ref|YP_525452.1|  RNA-binding region RNP-1 [Rhodoferax ferrire...  95.9    1e-18
ref|ZP_02065541.1|  hypothetical protein BACOVA_02523 [Bactero...  95.9    1e-18
ref|ZP_05283833.1|  putative RNA-binding protein [Bacteroides ...  95.9    1e-18
ref|ZP_03312999.1|  hypothetical protein DESPIG_02938 [Desulfo...  95.9    1e-18
ref|YP_892397.1|  RNA-binding region RNP-1 [Campylobacter fetu...  95.9    1e-18
ref|YP_001022993.1|  RNA-binding region RNP-1 [Methylibium pet...  95.9    1e-18
ref|YP_003158860.1|  RNP-1 like RNA-binding protein [Desulfomi...  95.5    2e-18
ref|YP_387671.1|  RNA-binding region RNP-1 [Desulfovibrio desu...  95.5    2e-18
ref|ZP_03476830.1|  hypothetical protein PRABACTJOHN_02504 [Pa...  95.1    2e-18
ref|YP_101358.1|  putative RNA-binding protein RbpA [Bacteroid...  95.1    2e-18
ref|YP_001564663.1|  RNP-1 like RNA-binding protein [Delftia a...  95.1    2e-18
ref|ZP_03729149.1|  RNP-1 like RNA-binding protein [Dethiobact...  95.1    2e-18
ref|ZP_02736544.1|  RNA-binding region RNP-1 [Gemmata obscurig...  95.1    2e-18
ref|ZP_01959061.1|  hypothetical protein BACCAC_00656 [Bactero...  95.1    2e-18
ref|YP_003198353.1|  RNP-1 like RNA-binding protein [Desulfoha...  94.7    3e-18
ref|YP_344746.1|  RNA-binding protein, RNP-1 [Nitrosococcus oc...  94.7    3e-18
ref|ZP_05363645.1|  RNA-binding region RNP-1 [Campylobacter sh...  94.7    3e-18
emb|CBA30852.1|  Putative RNA-binding protein rbpB [Curvibacte...  94.4    3e-18
ref|ZP_01729212.1|  RNA-binding region RNP-1 [Cyanothece sp. C...  94.4    3e-18
ref|NP_869435.1|  RNA-binding protein [Rhodopirellula baltica ...  94.4    3e-18
ref|ZP_06384172.1|  RNA-binding region RNP-1 [Arthrospira plat...  94.4    3e-18
emb|CBK65835.1|  RNA-binding proteins (RRM domain) [Bacteriode...  94.4    4e-18
ref|YP_001567060.1|  RNP-1 like RNA-binding protein [Delftia a...  94.4    4e-18
ref|ZP_02033679.1|  hypothetical protein PARMER_03714 [Parabac...  94.4    4e-18
ref|ZP_03630257.1|  RNP-1 like RNA-binding protein [bacterium ...  94.4    4e-18
ref|YP_003305311.1|  RNP-1 like RNA-binding protein [Sulfurosp...  94.0    4e-18
ref|YP_076997.1|  glycine-rich RNA-binding protein [Symbiobact...  94.0    4e-18
dbj|BAI88981.1|  RNA-binding protein [Arthrospira platensis NI...  94.0    5e-18
ref|YP_001840469.1|  RNA-binding protein [Leptospira biflexa s...  94.0    5e-18
ref|YP_075594.1|  glycine-rich RNA-binding protein [Symbiobact...  93.6    6e-18
ref|YP_003280762.1|  RNA-binding protein RNP-3 [Comamonas test...  93.6    6e-18
ref|ZP_03541838.1|  RNP-1 like RNA-binding protein [Comamonas ...  93.6    7e-18
ref|XP_002165659.1|  PREDICTED: similar to predicted protein [...  93.6    7e-18
ref|ZP_05545276.1|  conserved hypothetical protein [Parabacter...  93.6    7e-18
ref|YP_002554911.1|  RNP-1 like RNA-binding protein [Acidovora...  93.6    7e-18
ref|YP_988305.1|  RNP-1 like RNA-binding protein [Acidovorax s...  93.2    7e-18
ref|YP_001297783.1|  putative RNA-binding protein rbpA [Bacter...  93.2    8e-18
ref|YP_002309208.1|  putative RNA-binding protein RbpA [Candid...  93.2    8e-18
ref|ZP_05416250.1|  RNA-binding protein [Bacteroides finegoldi...  93.2    8e-18
ref|ZP_03679739.1|  hypothetical protein BACCELL_04102 [Bacter...  93.2    9e-18
ref|YP_001302325.1|  putative RNA-binding protein rbpA [Paraba...  93.2    9e-18
ref|ZP_03545941.1|  RNP-1 like RNA-binding protein [Comamonas ...  92.8    1e-17
ref|ZP_06402725.1|  RNP-1 like RNA-binding protein [bacterium ...  92.8    1e-17
ref|YP_002480594.1|  RNP-1 like RNA-binding protein [Desulfovi...  92.8    1e-17
ref|YP_003280761.1|  RNA-binding protein RNP-2 [Comamonas test...  92.8    1e-17
ref|YP_001804515.1|  RNA-binding protein [Cyanothece sp. ATCC ...  92.4    1e-17
ref|YP_001944122.1|  RNP-1 like RNA-binding protein [Chlorobiu...  92.4    1e-17
ref|ZP_02424886.1|  hypothetical protein ALIPUT_01020 [Alistip...  92.4    1e-17
gb|EAT99377.3|  31 kDa ribonucleoprotein, (RNA-binding protein...  92.4    1e-17
ref|YP_001734875.1|  RNA-binding protein [Synechococcus sp. PC...  92.4    2e-17
ref|ZP_03545942.1|  RNP-1 like RNA-binding protein [Comamonas ...  92.4    2e-17
ref|YP_431779.1|  RNA-binding protein [Hahella chejuensis KCTC...  92.0    2e-17
ref|YP_002942248.1|  RNP-1 like RNA-binding protein [Variovora...  92.0    2e-17
ref|ZP_03014283.1|  hypothetical protein BACINT_01856 [Bactero...  92.0    2e-17
ref|ZP_01622783.1|  RNA binding protein [Lyngbya sp. PCC 8106]...  92.0    2e-17
ref|ZP_01665891.1|  RNP-1  like RNA-binding protein [Thermosin...  92.0    2e-17
ref|ZP_03629929.1|  RNP-1 like RNA-binding protein [bacterium ...  92.0    2e-17
ref|ZP_03275736.1|  RNP-1 like RNA-binding protein [Arthrospir...  91.7    2e-17
ref|ZP_05281341.1|  putative RNA-binding protein [Bacteroides ...  91.7    2e-17
ref|NP_810800.1|  putative RNA-binding protein rbpA [Bacteroid...  91.7    2e-17
gb|AAY51685.1|  RNA-binding protein [Chlorobium tepidum TLS]       91.7    2e-17
ref|YP_001865891.1|  RNP-1 like RNA-binding protein [Nostoc pu...  91.7    2e-17
ref|YP_429438.1|  RNA-binding region RNP-1 [Moorella thermoace...  91.7    3e-17
ref|YP_003525756.1|  RNP-1 like RNA-binding protein [Nitrosoco...  91.7    3e-17
ref|YP_001717992.1|  RNP1-like RNA-binding protein [Candidatus...  91.7    3e-17
ref|NP_440917.1|  RNA-binding protein [Synechocystis sp. PCC 6...  91.3    3e-17
ref|NP_486817.1|  RNA binding protein [Nostoc sp. PCC 7120] >s...  91.3    3e-17
ref|ZP_02069976.1|  hypothetical protein BACUNI_01393 [Bactero...  91.3    3e-17
ref|NP_683045.1|  RNA-binding protein [Thermosynechococcus elo...  91.3    3e-17
ref|ZP_06308517.1|  RNA-binding region protein RNP-1 [Cylindro...  91.3    3e-17
ref|YP_003442298.1|  RNP-1 like RNA-binding protein [Allochrom...  91.3    4e-17
ref|ZP_03768489.1|  RNP-1 like RNA-binding protein ['Nostoc az...  91.3    4e-17
ref|ZP_02071919.1|  hypothetical protein BACUNI_03361 [Bactero...  90.9    4e-17
ref|YP_320548.1|  RNA-binding region RNP-1 [Anabaena variabili...  90.9    4e-17
ref|ZP_05024154.1|  RNA-binding protein [Microcoleus chthonopl...  90.9    4e-17
ref|YP_002991163.1|  RNP-1 like RNA-binding protein [Desulfovi...  90.9    4e-17
ref|YP_001789226.1|  RNP-1 like RNA-binding protein [Leptothri...  90.9    4e-17
ref|ZP_01619758.1|  RNA-binding region protein [Lyngbya sp. PC...  90.9    4e-17
ref|ZP_04764426.1|  RNP-1 like RNA-binding protein [Acidovorax...  90.9    5e-17
ref|ZP_03276711.1|  RNP-1 like RNA-binding protein [Arthrospir...  90.9    5e-17
ref|YP_002479083.1|  RNP-1 like RNA-binding protein [Desulfovi...  90.9    5e-17
dbj|BAA77714.1|  RNA-binding protein [Anabaena variabilis]         90.5    5e-17
ref|YP_001681240.1|  RNA binding protein [Heliobacterium modes...  90.5    5e-17
ref|NP_809697.1|  putative RNA-binding protein [Bacteroides th...  90.5    5e-17
ref|YP_724138.1|  RNA-binding region RNP-1 [Trichodesmium eryt...  90.5    5e-17
ref|ZP_06208536.1|  RNP-1 like RNA-binding protein [Acidovorax...  90.5    6e-17
gb|AAA17426.1|  RNA-binding protein [Anabaena sp.]                 90.5    6e-17
ref|NP_486127.1|  RNA-binding protein RbpA2 [Nostoc sp. PCC 71...  90.5    6e-17
emb|CBK63664.1|  RNA-binding proteins (RRM domain) [Alistipes ...  90.5    6e-17
ref|YP_002460772.1|  RNP-1 like RNA-binding protein [Desulfito...  90.5    6e-17
ref|ZP_06233725.1|  RNP-1 like RNA-binding protein [Desulfovib...  90.1    6e-17
ref|ZP_05038681.1|  RNA-binding protein, putative [Synechococc...  90.1    6e-17
ref|YP_973086.1|  RNP-1-like RNA-binding protein [Acidovorax a...  90.1    6e-17
ref|YP_001209360.1|  RNA recognition motif-containing protein ...  90.1    6e-17
ref|YP_984316.1|  RNP-1 like RNA-binding protein [Polaromonas ...  90.1    6e-17
ref|ZP_06383755.1|  RNA binding protein [Arthrospira platensis...  90.1    6e-17
ref|YP_002947158.1|  RNP-1 like RNA-binding protein [Variovora...  90.1    6e-17
ref|YP_322501.1|  RNA-binding region RNP-1 [Anabaena variabili...  90.1    6e-17
emb|CAA63557.1|  RNA-binding protein [Anabaena variabilis]         90.1    6e-17
ref|YP_001211386.1|  hypothetical protein PTH_0836 [Pelotomacu...  90.1    7e-17
ref|ZP_04544341.1|  conserved hypothetical protein [Bacteroide...  90.1    7e-17
ref|YP_003198615.1|  RNP-1 like RNA-binding protein [Desulfoha...  90.1    7e-17
ref|ZP_06402726.1|  RNP-1 like RNA-binding protein [bacterium ...  90.1    7e-17
ref|YP_551668.1|  RNA recognition motif-containing protein [Po...  90.1    7e-17
ref|YP_099449.1|  putative RNA-binding protein [Bacteroides fr...  90.1    8e-17
ref|NP_488723.1|  RNA-binding protein [Nostoc sp. PCC 7120] >g...  89.7    8e-17
emb|CAA74889.1|  ribonucleoprotein [Pisum sativum] >gb|AAG1390...  89.7    8e-17
ref|YP_320649.1|  RNA-binding region RNP-1 [Anabaena variabili...  89.7    8e-17
ref|NP_486351.1|  RNA-binding protein [Nostoc sp. PCC 7120] >s...  89.7    8e-17
ref|YP_374928.1|  RNA recognition motif-containing protein [Ch...  89.7    9e-17
ref|ZP_03850389.1|  probable RNA-binding protein [Chryseobacte...  89.7    9e-17
ref|YP_001295273.1|  putative RNA-binding protein RbpA [Flavob...  89.7    9e-17
ref|YP_973589.1|  RNP-1 like RNA-binding protein [Polaromonas ...  89.7    9e-17
gb|AAX07506.1|  unknown [Gemmata sp. Wa1-1]                        89.7    1e-16
ref|NP_712101.1|  RNA-binding protein [Leptospira interrogans ...  89.7    1e-16
ref|YP_001864476.1|  RNP-1 like RNA-binding protein [Nostoc pu...  89.4    1e-16
ref|ZP_03680264.1|  hypothetical protein BACCELL_04634 [Bacter...  89.4    1e-16
ref|ZP_01386107.1|  RNA-binding region RNP-1 (RNA recognition ...  89.4    1e-16
ref|ZP_05028242.1|  RNA-binding protein, putative [Microcoleus...  89.4    1e-16
ref|ZP_05029852.1|  RNA-binding protein, putative [Microcoleus...  89.4    1e-16
ref|YP_003372394.1|  RNP-1 like RNA-binding protein [Pirellula...  89.4    1e-16
ref|YP_002554910.1|  RNP-1 like RNA-binding protein [Acidovora...  89.4    1e-16
ref|NP_442740.1|  RNA binding protein [Synechocystis sp. PCC 6...  89.4    1e-16
ref|ZP_03628155.1|  RNP-1 like RNA-binding protein [bacterium ...  89.4    1e-16
ref|ZP_01734183.1|  RNA binding protein [Flavobacteria bacteri...  89.4    1e-16
ref|ZP_04764427.1|  RNP-1 like RNA-binding protein [Acidovorax...  89.4    1e-16
ref|ZP_01621470.1|  RNA-binding region protein [Lyngbya sp. PC...  89.4    1e-16
ref|ZP_02437554.1|  hypothetical protein BACSTE_03831 [Bactero...  89.4    1e-16
ref|YP_379849.1|  RNA recognition motif-containing protein [Ch...  89.4    1e-16
ref|YP_001130407.1|  RNP-1 like RNA-binding protein [Prostheco...  89.4    1e-16
ref|YP_001567059.1|  RNP-1 like RNA-binding protein [Delftia a...  89.4    1e-16
ref|YP_994959.1|  RNP-1 like RNA-binding protein [Verminephrob...  89.4    1e-16
ref|YP_001520710.1|  RNA-binding protein [Acaryochloris marina...  89.0    1e-16
ref|NP_486968.1|  RNA-binding protein [Nostoc sp. PCC 7120] >r...  89.0    2e-16
ref|ZP_06244118.1|  RNP-1 like RNA-binding protein [Victivalli...  89.0    2e-16
ref|YP_002485371.1|  RNP-1 like RNA-binding protein [Cyanothec...  89.0    2e-16
ref|YP_724137.1|  RNA-binding region RNP-1 [Trichodesmium eryt...  89.0    2e-16
ref|ZP_06403583.1|  RNP-1 like RNA-binding protein [bacterium ...  88.6    2e-16
ref|YP_679005.1|  RNA binding protein [Cytophaga hutchinsonii ...  88.6    2e-16
ref|ZP_06208537.1|  RNP-1 like RNA-binding protein [Acidovorax...  88.6    2e-16
ref|YP_988304.1|  RNP-1 like RNA-binding protein [Acidovorax s...  88.6    2e-16
ref|YP_994960.1|  RNP-1 like RNA-binding protein [Verminephrob...  88.6    2e-16
ref|ZP_02433920.1|  hypothetical protein BACSTE_00134 [Bactero...  88.6    2e-16
ref|NP_968295.1|  putative RNA-binding protein [Bdellovibrio b...  88.6    2e-16
ref|ZP_01128871.1|  RNA-binding protein [Nitrococcus mobilis N...  88.2    2e-16
ref|YP_973085.1|  RNP-1-like RNA-binding protein [Acidovorax a...  88.2    2e-16
ref|ZP_03014705.1|  hypothetical protein BACINT_02283 [Bactero...  88.2    3e-16
ref|YP_003238213.1|  RNP-1 like RNA-binding protein [Ammonifex...  88.2    3e-16
ref|ZP_03766566.1|  RNP-1 like RNA-binding protein ['Nostoc az...  88.2    3e-16
ref|ZP_03460897.1|  hypothetical protein BACEGG_03720 [Bactero...  88.2    3e-16
ref|YP_001302593.1|  RNA binding protein [Parabacteroides dist...  88.2    3e-16
ref|YP_001355749.1|  RNA-binding protein RNP-1 [Nitratiruptor ...  88.2    3e-16
ref|YP_002018924.1|  RNP-1 like RNA-binding protein [Pelodicty...  87.8    3e-16
sp|P19683.1|ROC4_NICSY  RecName: Full=31 kDa ribonucleoprotein...  87.8    3e-16
ref|YP_822290.1|  RNP-1 like RNA-binding protein [Solibacter u...  87.8    3e-16
ref|ZP_02064554.1|  hypothetical protein BACOVA_01523 [Bactero...  87.8    4e-16
ref|YP_973884.1|  RNP-1 like RNA-binding protein [Polaromonas ...  87.8    4e-16
ref|YP_827004.1|  RNP-1 like RNA-binding protein [Solibacter u...  87.8    4e-16
ref|NP_904912.1|  RNA-binding protein [Porphyromonas gingivali...  87.8    4e-16
ref|XP_002298568.1|  predicted protein [Populus trichocarpa] >...  87.8    4e-16
sp|P19682.1|ROC3_NICSY  RecName: Full=28 kDa ribonucleoprotein...  87.8    4e-16
ref|ZP_05024107.1|  RNA-binding protein, putative [Microcoleus...  87.8    4e-16
ref|YP_003262921.1|  RNP-1 like RNA-binding protein [Halothiob...  87.4    4e-16
ref|YP_001193654.1|  RNP-1 like RNA-binding protein [Flavobact...  87.4    4e-16
ref|ZP_05037313.1|  RNA-binding protein, putative [Synechococc...  87.4    4e-16
ref|ZP_02002958.1|  RNA-binding protein [Beggiatoa sp. PS] >gb...  87.4    5e-16
ref|YP_911730.1|  RNP-1 like RNA-binding protein [Chlorobium p...  87.4    5e-16
ref|YP_100003.1|  putative RNA-binding protein [Bacteroides fr...  87.0    5e-16
ref|NP_925476.1|  RNA-binding protein [Gloeobacter violaceus P...  87.0    5e-16
ref|ZP_03477372.1|  hypothetical protein PRABACTJOHN_03053 [Pa...  87.0    5e-16
ref|YP_002952453.1|  RNA-binding protein [Desulfovibrio magnet...  87.0    6e-16
ref|YP_982163.1|  RNP-1 like RNA-binding protein [Polaromonas ...  87.0    6e-16
ref|ZP_03299856.1|  hypothetical protein BACDOR_01223 [Bactero...  87.0    6e-16
ref|YP_002482080.1|  RNP-1 like RNA-binding protein [Cyanothec...  87.0    6e-16
ref|ZP_06232817.1|  RNP-1 like RNA-binding protein [Desulfovib...  86.7    7e-16
ref|YP_001840154.1|  RNA-binding protein [Leptospira biflexa s...  86.7    7e-16
ref|ZP_06741196.1|  conserved hypothetical protein [Bacteroide...  86.7    7e-16
ref|ZP_05286181.1|  RNA binding protein [Bacteroides sp. 2_1_7...  86.7    8e-16
ref|YP_001297875.1|  putative RNA-binding protein [Bacteroides...  86.7    8e-16
emb|CAO89166.1|  rbpF/A2 [Microcystis aeruginosa PCC 7806]         86.7    8e-16
ref|XP_002321649.1|  predicted protein [Populus trichocarpa] >...  86.7    8e-16
ref|ZP_03131691.1|  RNP-1 like RNA-binding protein [Chthonioba...  86.7    8e-16
ref|YP_003548384.1|  RNP-1 like RNA-binding protein [Coralioma...  86.7    8e-16
ref|ZP_02030442.1|  hypothetical protein PARMER_00413 [Parabac...  86.7    8e-16
ref|ZP_05281803.1|  putative RNA-binding protein [Bacteroides ...  86.3    9e-16
ref|YP_001302062.1|  RNA binding protein [Parabacteroides dist...  86.3    9e-16
ref|YP_987174.1|  RNP-1 like RNA-binding protein [Acidovorax s...  86.3    1e-15
dbj|BAG09558.1|  chloroplast RNA binding protein [Mesembryanth...  86.3    1e-15
ref|ZP_06368972.1|  RNP-1 like RNA-binding protein [Desulfovib...  86.3    1e-15
ref|ZP_05281445.1|  RNA binding protein [Bacteroides fragilis ...  86.3    1e-15
emb|CAD18921.1|  RNA-binding protein precursor [Persea americana]  86.3    1e-15
ref|YP_721592.1|  RNA-binding region RNP-1 [Trichodesmium eryt...  85.9    1e-15
ref|YP_003370041.1|  RNP-1 like RNA-binding protein [Pirellula...  85.9    1e-15
ref|YP_002437369.1|  RNP-1 like RNA-binding protein [Desulfovi...  85.9    1e-15
ref|YP_001113853.1|  RNP-1-like RNA-binding protein [Desulfoto...  85.9    1e-15
ref|ZP_04429015.1|  RRM domain-containing RNA-binding protein ...  85.9    1e-15
ref|YP_002376975.1|  RNP-1 like RNA-binding protein [Cyanothec...  85.9    1e-15
ref|ZP_02927528.1|  RNA-binding region RNP-1 [Verrucomicrobium...  85.9    1e-15
ref|YP_002371735.1|  RNP-1 like RNA-binding protein [Cyanothec...  85.9    1e-15
ref|YP_547481.1|  RNA recognition motif-containing protein [Po...  85.9    1e-15
ref|YP_001802430.1|  RNA-binding protein [Cyanothece sp. ATCC ...  85.5    2e-15
ref|ZP_01962049.1|  hypothetical protein BACCAC_03695 [Bactero...  85.5    2e-15
ref|ZP_00514042.1|  RNA-binding region RNP-1  (RNA recognition...  85.5    2e-15
ref|ZP_06304159.1|  RNA-binding region protein RNP-1 [Raphidio...  85.5    2e-15
ref|ZP_01731286.1|  RNA binding protein [Cyanothece sp. CCY011...  85.5    2e-15
ref|YP_431499.1|  RNA-binding protein [Hahella chejuensis KCTC...  85.5    2e-15
ref|NP_967340.1|  RNA-binding protein [Bdellovibrio bacteriovo...  85.5    2e-15
ref|ZP_04388979.1|  RNA-binding protein [Porphyromonas endodon...  85.5    2e-15
ref|ZP_04844448.1|  conserved hypothetical protein [Bacteroide...  85.5    2e-15
ref|NP_661038.1|  RNA-binding protein [Chlorobium tepidum TLS]...  85.1    2e-15
ref|YP_002485203.1|  RNP-1 like RNA-binding protein [Cyanothec...  85.1    2e-15
ref|YP_002434479.1|  RNP-1 like RNA-binding protein [Desulfovi...  85.1    2e-15
ref|YP_001516937.1|  RNA-binding protein [Acaryochloris marina...  85.1    2e-15
ref|YP_001659601.1|  RNA-binding region protein [Microcystis a...  85.1    2e-15
ref|ZP_03764457.1|  RNP-1 like RNA-binding protein ['Nostoc az...  84.7    3e-15
ref|XP_002461966.1|  hypothetical protein SORBIDRAFT_02g011330...  84.7    3e-15
ref|ZP_00517451.1|  RNA-binding region RNP-1  (RNA recognition...  84.7    3e-15
ref|ZP_04056246.1|  31 kDa ribonucleoprotein [Porphyromonas ue...  84.7    3e-15
ref|ZP_05706470.1|  RNA-binding protein [Cardiobacterium homin...  84.7    3e-15
ref|YP_002018274.1|  RNP-1 like RNA-binding protein [Pelodicty...  84.7    3e-15
ref|YP_075100.1|  glycine-rich RNA-binding protein [Symbiobact...  84.7    3e-15
ref|ZP_06232597.1|  RNP-1 like RNA-binding protein [Desulfovib...  84.7    3e-15
emb|CBI34828.1|  unnamed protein product [Vitis vinifera]          84.3    3e-15
ref|YP_002371281.1|  RNP-1 like RNA-binding protein [Cyanothec...  84.3    3e-15
ref|ZP_05038164.1|  RNA-binding protein, putative [Synechococc...  84.3    3e-15
ref|ZP_02031835.1|  hypothetical protein PARMER_01843 [Parabac...  84.3    3e-15
ref|YP_099548.1|  RNA binding protein [Bacteroides fragilis YC...  84.3    4e-15
ref|XP_001621815.1|  hypothetical protein NEMVEDRAFT_v1g47988 ...  84.3    4e-15
sp|P28644.1|ROC1_SPIOL  RecName: Full=28 kDa ribonucleoprotein...  84.3    4e-15
ref|YP_001869081.1|  RNP-1 like RNA-binding protein [Nostoc pu...  84.3    4e-15
ref|XP_002281642.1|  PREDICTED: hypothetical protein [Vitis vi...  84.3    4e-15
ref|YP_003505230.1|  RNP-1 like RNA-binding protein [Denitrovi...  84.3    4e-15
ref|XP_002511286.1|  ribonucleoprotein, chloroplast, putative ...  84.3    4e-15
ref|YP_003442278.1|  RNP-1 like RNA-binding protein [Allochrom...  84.3    4e-15
emb|CAA41023.1|  28kD RNA binding protein [Spinacia oleracea]      84.3    4e-15
ref|YP_003257184.1|  RNP-1 RNA-binding protein [Blattabacteriu...  84.3    4e-15
emb|CAJ72202.1|  rna binding protein [Candidatus Kuenenia stut...  84.0    5e-15
ref|NP_001105347.1|  nucleic acid binding protein1 [Zea mays] ...  84.0    5e-15
ref|YP_002251463.1|  RNA-binding region RNP-1 [Dictyoglomus th...  84.0    5e-15
ref|ZP_01620654.1|  RNA-binding region [Lyngbya sp. PCC 8106] ...  84.0    5e-15
ref|ZP_01732073.1|  RNA-binding region RNP-1 [Cyanothece sp. C...  84.0    5e-15
ref|XP_002270233.1|  PREDICTED: hypothetical protein [Vitis vi...  84.0    5e-15
ref|YP_002353647.1|  RNP-1 like RNA-binding protein [Dictyoglo...  84.0    5e-15
ref|ZP_03301360.1|  hypothetical protein BACDOR_02742 [Bactero...  84.0    6e-15
ref|YP_002434623.1|  RNP-1 like RNA-binding protein [Desulfovi...  83.6    6e-15
ref|ZP_03015914.1|  hypothetical protein BACINT_03513 [Bactero...  83.6    6e-15
ref|YP_001300497.1|  putative RNA-binding protein [Bacteroides...  83.6    6e-15
gb|ABF60862.1|  GRSF [Lilium longiflorum]                          83.6    6e-15
ref|NP_190914.1|  CP29; RNA binding / poly(U) binding [Arabido...  83.6    6e-15
dbj|BAA06518.1|  RNA-binding protein cp29 [Arabidopsis thaliana]   83.6    6e-15
ref|YP_589330.1|  RNA-binding protein, RNP-1 [Candidatus Korib...  83.6    7e-15
dbj|BAA06519.1|  RNA-binding protein cp29 [Arabidopsis thaliana]   83.6    7e-15
ref|YP_003444709.1|  RNP-1 like RNA-binding protein [Allochrom...  83.6    7e-15
dbj|BAA04177.1|  ss-DNA binding protein 12RNP2 precursor [Syne...  83.6    7e-15
ref|NP_001063946.1|  Os09g0565200 [Oryza sativa (japonica cult...  83.6    7e-15
ref|ZP_06241696.1|  RNP-1 like RNA-binding protein [Victivalli...  83.6    7e-15
ref|ZP_06006737.1|  RNA-binding protein [Prevotella bergensis ...  83.6    7e-15
gb|AAA33039.1|  RNA-binding protein [Mesembryanthemum crystall...  83.2    8e-15
ref|ZP_06232238.1|  RNP-1 like RNA-binding protein [Desulfovib...  83.2    8e-15
sp|Q43472.1|GRP_HORVU  RecName: Full=Glycine-rich RNA-binding ...  83.2    8e-15
ref|YP_002992666.1|  RNP-1 like RNA-binding protein [Desulfovi...  83.2    8e-15
ref|XP_002318093.1|  predicted protein [Populus trichocarpa] >...  83.2    9e-15
ref|YP_003283841.1|  putative RNA-binding protein [Blattabacte...  83.2    9e-15
ref|YP_076669.1|  glycine-rich RNA-binding protein [Symbiobact...  83.2    9e-15
ref|XP_002461076.1|  hypothetical protein SORBIDRAFT_02g040260...  83.2    9e-15
emb|CAL55275.1|  Ps16 protein (ISS) [Ostreococcus tauri]           83.2    9e-15
ref|ZP_03658240.1|  hypothetical protein HcinC1_04807 [Helicob...  83.2    1e-14
pir||S41505  12RNP2 protein - Synechococcus sp. (PCC 6301) >db...  83.2    1e-14
ref|YP_001141576.1|  RNA-binding protein [Aeromonas salmonicid...  82.8    1e-14
ref|YP_856326.1|  RNA-binding protein [Aeromonas hydrophila su...  82.8    1e-14
ref|YP_002991990.1|  RNP-1 like RNA-binding protein [Desulfovi...  82.8    1e-14
ref|YP_172807.1|  RRM type RNA-binding protein [Synechococcus ...  82.8    1e-14
ref|XP_001767211.1|  predicted protein [Physcomitrella patens ...  82.8    1e-14
dbj|BAF30986.1|  glycine-rich RNA-binding protein [Triticum ae...  82.8    1e-14
ref|YP_001998642.1|  RNP-1 like RNA-binding protein [Chlorobac...  82.8    1e-14
ref|YP_002375983.1|  RNP-1 like RNA-binding protein [Cyanothec...  82.8    1e-14
gb|EAZ04802.1|  hypothetical protein OsI_26976 [Oryza sativa I...  82.8    1e-14
ref|NP_001060364.1|  Os07g0631900 [Oryza sativa (japonica cult...  82.8    1e-14
ref|ZP_03152994.1|  RNP-1 like RNA-binding protein [Cyanothece...  82.8    1e-14
ref|YP_001938945.1|  RNA-binding protein (RRM domain) [Methyla...  82.8    1e-14
gb|ACF22879.1|  RNA-binding protein [Glycine max]                  82.4    1e-14
gb|ACU23305.1|  unknown [Glycine max]                              82.4    1e-14
ref|YP_798880.1|  RNA-binding protein [Leptospira borgpetersen...  82.4    1e-14
ref|ZP_01630631.1|  RNA-binding region protein [Nodularia spum...  82.4    2e-14
ref|ZP_05515880.1|  RNA-binding protein [Streptomyces hygrosco...  82.4    2e-14
gb|ABR25700.1|  chloroplast 28 kDa ribonucleoprotein [Oryza sa...  82.4    2e-14
ref|YP_002014834.1|  RNP-1 like RNA-binding protein [Prostheco...  82.4    2e-14
ref|YP_011428.1|  RNA-binding protein [Desulfovibrio vulgaris ...  82.0    2e-14
gb|ABR26075.1|  chloroplast 29 kDa ribonucleoprotein [Oryza sa...  82.0    2e-14
gb|ABK24055.1|  unknown [Picea sitchensis]                         82.0    2e-14
sp|P49314.1|ROC2_NICPL  RecName: Full=31 kDa ribonucleoprotein...  82.0    2e-14
sp|Q08937.1|ROC2_NICSY  RecName: Full=29 kDa ribonucleoprotein...  82.0    2e-14
ref|YP_476563.1|  putative RNA-binding protein [Synechococcus ...  82.0    2e-14
ref|ZP_05414847.1|  RNA-binding protein [Bacteroides finegoldi...  82.0    2e-14
ref|NP_967322.1|  RNA-binding protein [Bdellovibrio bacteriovo...  82.0    2e-14
gb|AAA27362.1|  RNA-binding protein [Synechococcus sp.]            82.0    2e-14
ref|YP_003192663.1|  RNP-1 like RNA-binding protein [Desulfoto...  81.6    2e-14
ref|XP_001418624.1|  predicted protein [Ostreococcus lucimarin...  81.6    2e-14
dbj|BAA06521.1|  RNA-binding protein cp31 [Arabidopsis thaliana]   81.6    2e-14
ref|YP_003526842.1|  RNP-1 like RNA-binding protein [Nitrosoco...  81.6    2e-14
ref|NP_199836.1|  31 kDa ribonucleoprotein, chloroplast, putat...  81.6    2e-14
dbj|BAA06520.1|  RNA-binding protein cp31 [Arabidopsis thaliana]   81.6    2e-14
emb|CAA06469.1|  cp31AHv protein [Hordeum vulgare subsp. vulgare]  81.6    2e-14
gb|EEH53124.1|  predicted protein [Micromonas pusilla CCMP1545]    81.6    2e-14
ref|NP_001149184.1|  LOC100282806 [Zea mays] >gb|ACG34487.1| r...  81.6    2e-14
emb|CAA43420.1|  RNA binding protein [Arabidopsis thaliana]        81.6    2e-14
ref|YP_001995070.1|  RNP-1  like RNA-binding protein [Chlorohe...  81.6    3e-14
gb|AAA18380.1|  RNA-binding protein 3 [Arabidopsis thaliana]       81.6    3e-14
ref|YP_001633707.1|  RNP-1 like RNA-binding protein [Chlorofle...  81.6    3e-14
ref|ZP_02737335.1|  RNA-binding protein [Gemmata obscuriglobus...  81.6    3e-14
dbj|BAA22411.1|  Ps16 protein [Triticum aestivum]                  81.6    3e-14
emb|CBI14910.1|  unnamed protein product [Vitis vinifera]          81.6    3e-14
ref|YP_002480501.1|  RNP-1 like RNA-binding protein [Desulfovi...  81.6    3e-14
ref|NP_488062.1|  RNA-binding protein [Nostoc sp. PCC 7120] >r...  81.6    3e-14
ref|ZP_05417208.1|  RNA-binding protein [Bacteroides finegoldi...  81.6    3e-14
ref|ZP_06383003.1|  RNA-binding protein [Arthrospira platensis...  81.6    3e-14
ref|YP_001997715.1|  RNP-1 like RNA-binding protein [Chlorobac...  81.6    3e-14
ref|YP_001801564.1|  RNA-binding protein [Cyanothece sp. ATCC ...  81.6    3e-14
gb|ACU22730.1|  unknown [Glycine max]                              81.6    3e-14
ref|NP_194208.1|  RBP31 (31-KDA RNA BINDING PROTEIN); RNA bind...  81.3    3e-14
ref|ZP_03133505.1|  RNP-1 like RNA-binding protein [Chthonioba...  81.3    3e-14
gb|AAA18379.1|  RNA-binding protein 2 [Arabidopsis thaliana]       81.3    3e-14
ref|ZP_06306645.1|  RNA-binding region protein RNP-1 [Cylindro...  81.3    3e-14
ref|YP_003087360.1|  RNP-1 like RNA-binding protein [Dyadobact...  81.3    3e-14
ref|XP_002278832.1|  PREDICTED: hypothetical protein [Vitis vi...  81.3    3e-14
ref|ZP_06304906.1|  RNA-binding region protein RNP-1 [Raphidio...  81.3    3e-14
ref|ZP_03632265.1|  RNP-1 like RNA-binding protein [bacterium ...  81.3    3e-14
ref|YP_844222.1|  RNP-1 like RNA-binding protein [Syntrophobac...  81.3    3e-14
gb|AAK95304.1|AF410318_1  AT4g24770/F22K18_30 [Arabidopsis tha...  81.3    3e-14
ref|YP_011643.1|  RNA-binding protein [Desulfovibrio vulgaris ...  81.3    3e-14
ref|XP_001779557.1|  predicted protein [Physcomitrella patens ...  80.9    4e-14
gb|ADE77701.1|  unknown [Picea sitchensis]                         80.9    4e-14
ref|YP_001520755.1|  RNA-binding protein [Acaryochloris marina...  80.9    4e-14
ref|ZP_01961735.1|  hypothetical protein BACCAC_03375 [Bactero...  80.9    4e-14
gb|ABK25016.1|  unknown [Picea sitchensis]                         80.9    5e-14
gb|ABK24573.1|  unknown [Picea sitchensis]                         80.9    5e-14
dbj|BAF01690.1|  31 kDa RNA binding protein [Arabidopsis thali...  80.5    5e-14
ref|NP_001151728.1|  ribonucleoprotein A [Zea mays] >gb|ACG441...  80.5    5e-14
ref|NP_859850.1|  hypothetical protein HH0319 [Helicobacter he...  80.5    5e-14
dbj|BAE91897.1|  glycine-rich RNA-binding protein [Lolium pere...  80.5    5e-14
ref|NP_713938.1|  RNA-binding protein [Leptospira interrogans ...  80.5    5e-14
emb|CAN61133.1|  hypothetical protein [Vitis vinifera]             80.5    5e-14
ref|YP_001129687.1|  RNP-1 like RNA-binding protein [Prostheco...  80.5    5e-14
gb|AAM66970.1|  putative RNA-binding protein [Arabidopsis thal...  80.5    6e-14
ref|YP_001958570.1|  RNP-1 like RNA-binding protein [Chlorobiu...  80.5    6e-14
ref|NP_181259.1|  29 kDa ribonucleoprotein, chloroplast, putat...  80.5    6e-14
ref|ZP_03156081.1|  RNP-1 like RNA-binding protein [Cyanothece...  80.5    6e-14
ref|YP_001942178.1|  RNP-1 like RNA-binding protein [Chlorobiu...  80.5    6e-14
ref|ZP_03012468.1|  hypothetical protein BACINT_00014 [Bactero...  80.5    6e-14
ref|YP_003123991.1|  RNP-1 like RNA-binding protein [Chitinoph...  80.1    6e-14
ref|YP_003422129.1|  RRM domain-containing RNA-binding protein...  80.1    7e-14
ref|YP_473991.1|  putative RNA-binding protein [Synechococcus ...  80.1    7e-14
ref|YP_001519831.1|  RNA-binding protein [Acaryochloris marina...  80.1    7e-14
ref|YP_002461512.1|  RNP-1 like RNA-binding protein [Chlorofle...  80.1    7e-14
ref|XP_002501222.1|  predicted protein [Micromonas sp. RCC299]...  80.1    7e-14
ref|YP_002481009.1|  RNP-1 like RNA-binding protein [Cyanothec...  80.1    8e-14
emb|CAA11893.1|  cp31BHv [Hordeum vulgare subsp. vulgare]          80.1    8e-14
ref|YP_002954849.1|  RNA-binding protein [Desulfovibrio magnet...  79.7    9e-14
gb|AAL09839.1|  RNA binding protein [Bacteroides fragilis]         79.7    9e-14
ref|XP_002326357.1|  predicted protein [Populus trichocarpa] >...  79.7    9e-14
gb|EAZ07975.1|  hypothetical protein OsI_30233 [Oryza sativa I...  79.7    9e-14
ref|NP_001062481.1|  Os08g0557100 [Oryza sativa (japonica cult...  79.7    9e-14
ref|XP_001770702.1|  predicted protein [Physcomitrella patens ...  79.7    9e-14
ref|ZP_03276207.1|  RNP-1 like RNA-binding protein [Arthrospir...  79.7    1e-13
ref|YP_374021.1|  RNA recognition motif-containing protein [Ch...  79.7    1e-13
ref|YP_001864636.1|  RNP-1 like RNA-binding protein [Nostoc pu...  79.7    1e-13
ref|NP_812751.1|  putative RNA-binding protein rbpA [Bacteroid...  79.7    1e-13
dbj|BAD09079.1|  nucleic acid-binding protein-like [Oryza sati...  79.7    1e-13
ref|XP_001769446.1|  predicted protein [Physcomitrella patens ...  79.7    1e-13
ref|YP_913081.1|  RNP-1 like RNA-binding protein [Chlorobium p...  79.7    1e-13
ref|NP_001142375.1|  hypothetical protein LOC100274547 [Zea ma...  79.7    1e-13
ref|NP_001150149.1|  LOC100283778 [Zea mays] >gb|ACG24633.1| g...  79.7    1e-13
ref|YP_002481863.1|  RNP-1 like RNA-binding protein [Cyanothec...  79.7    1e-13
sp|Q03878.1|GRP1_DAUCA  RecName: Full=Glycine-rich RNA-binding...  79.7    1e-13
emb|CAD18922.1|  RNA-binding protein precursor [Persea americana]  79.3    1e-13
gb|ACN30953.1|  unknown [Zea mays]                                 79.3    1e-13
ref|NP_001132731.1|  hypothetical protein LOC100194217 [Zea ma...  79.3    1e-13
ref|ZP_06369404.1|  RNP-1 like RNA-binding protein [Desulfovib...  79.3    1e-13
ref|ZP_01126486.1|  RNA-binding protein [Nitrococcus mobilis N...  79.3    1e-13
gb|ACG40707.1|  glycine-rich RNA-binding protein 2 [Zea mays]      79.3    1e-13
ref|XP_002459459.1|  hypothetical protein SORBIDRAFT_02g004930...  79.3    1e-13
ref|YP_359251.1|  RNA-binding protein [Carboxydothermus hydrog...  79.3    1e-13
dbj|BAF24395.2|  Os08g0557100 [Oryza sativa Japonica Group]        79.3    1e-13
ref|XP_002462099.1|  hypothetical protein SORBIDRAFT_02g018650...  79.3    1e-13
ref|XP_002519525.1|  ribonucleoprotein, chloroplast, putative ...  79.0    1e-13
ref|XP_391240.1|  hypothetical protein FG11064.1 [Gibberella z...  79.0    1e-13
ref|YP_003267833.1|  RNP-1 like RNA-binding protein [Haliangiu...  79.0    1e-13
ref|XP_002456834.1|  hypothetical protein SORBIDRAFT_03g043760...  79.0    2e-13
ref|YP_001521523.1|  RNA-binding protein [Acaryochloris marina...  79.0    2e-13
ref|YP_828732.1|  RNP-1 like RNA-binding protein [Solibacter u...  79.0    2e-13
gb|AAK01176.1|  RNA-binding protein [Triticum aestivum]            79.0    2e-13
ref|XP_571981.1|  glycine-rich RNA binding protein [Cryptococc...  78.6    2e-13
ref|NP_001149519.1|  glycine-rich RNA-binding protein 8 [Zea m...  78.6    2e-13
gb|ACR38140.1|  unknown [Zea mays]                                 78.6    2e-13
sp|P49313.1|ROC1_NICPL  RecName: Full=30 kDa ribonucleoprotein...  78.6    2e-13
ref|XP_571982.1|  glycine-rich RNA binding protein [Cryptococc...  78.6    2e-13
ref|XP_002323470.1|  predicted protein [Populus trichocarpa] >...  78.6    2e-13
ref|NP_001151562.1|  glycine-rich RNA-binding protein 2 [Zea m...  78.6    2e-13
gb|ACG41989.1|  glycine-rich RNA-binding protein 2 [Zea mays]      78.6    2e-13
gb|ACF84263.1|  unknown [Zea mays]                                 78.6    2e-13
sp|P10979.1|GRPA_MAIZE  RecName: Full=Glycine-rich RNA-binding...  78.6    2e-13
ref|YP_002951546.1|  RNA-binding protein [Desulfovibrio magnet...  78.2    2e-13
sp|Q08935.1|ROC1_NICSY  RecName: Full=29 kDa ribonucleoprotein...  78.2    3e-13
ref|ZP_06369990.1|  RNP-1 like RNA-binding protein [Desulfovib...  78.2    3e-13
ref|XP_002444599.1|  hypothetical protein SORBIDRAFT_07g024400...  78.2    3e-13
gb|AAL39067.1|AF389431_1  single-stranded DNA binding protein ...  78.2    3e-13
ref|NP_001051823.1|  Os03g0836200 [Oryza sativa (japonica cult...  78.2    3e-13
gb|AAF31402.1|  putative glycine-rich RNA binding protein 1 [C...  78.2    3e-13
ref|XP_002465205.1|  hypothetical protein SORBIDRAFT_01g034120...  78.2    3e-13
ref|YP_001733538.1|  RNA-binding protein [Synechococcus sp. PC...  78.2    3e-13
emb|CAA88558.1|  glycine rich protein, RNA binding protein [Ho...  78.2    3e-13
dbj|BAH56965.1|  AT2G21660 [Arabidopsis thaliana]                  78.2    3e-13
ref|YP_001516352.1|  RNA-binding protein [Acaryochloris marina...  78.2    3e-13
ref|NP_850017.1|  CCR2 (COLD, CIRCADIAN RHYTHM, AND RNA BINDIN...  78.2    3e-13
gb|AAM62447.1|  glycine-rich RNA binding protein 7 [Arabidopsi...  78.2    3e-13
ref|NP_179760.1|  CCR2 (COLD, CIRCADIAN RHYTHM, AND RNA BINDIN...  78.2    3e-13
gb|ACX71299.1|  RNA-binding protein RZ-1 [Capsicum annuum]         77.8    3e-13
gb|ACR36437.1|  unknown [Zea mays]                                 77.8    3e-13
gb|ACD03270.1|  glycine-rich RNA-binding protein [Nicotiana ta...  77.8    3e-13
gb|AAC50020.1|  RNA-binding protein [Nicotiana glutinosa]          77.8    3e-13
dbj|BAA03742.1|  RNA-binding glycine-rich protein-1b [Nicotian...  77.8    4e-13
ref|ZP_01726288.1|  RNA-binding region RNP-1 [Cyanothece sp. C...  77.8    4e-13
ref|XP_657084.1|  RNA recognition motif domain containing prot...  77.8    4e-13
ref|NP_001148607.1|  ribonucleoprotein A [Zea mays] >gb|ACG322...  77.8    4e-13
emb|CAA73034.1|  SGRP-1 [Solanum commersonii]                      77.8    4e-13
gb|AAF31403.1|AF200322_1  putative glycine-rich RNA binding pr...  77.8    4e-13
emb|CAD29693.1|  putative glycine rich protein [Rumex obtusifo...  77.8    4e-13
ref|YP_010476.1|  RNA-binding protein [Desulfovibrio vulgaris ...  77.8    4e-13
ref|NP_001062760.1|  Os09g0279500 [Oryza sativa (japonica cult...  77.8    4e-13
gb|EEY18737.1|  gar2 [Verticillium albo-atrum VaMs.102]            77.8    4e-13
gb|AAA75104.1|  single-stranded nucleic acid binding protein [...  77.4    4e-13
gb|ACG32421.1|  glycine-rich RNA-binding protein 2 [Zea mays]      77.4    5e-13
ref|ZP_03765841.1|  RNP-1 like RNA-binding protein ['Nostoc az...  77.4    5e-13
ref|NP_001151678.1|  glycine-rich RNA-binding protein 7 [Zea m...  77.4    5e-13
gb|EAZ08415.1|  hypothetical protein OsI_30679 [Oryza sativa I...  77.4    5e-13
ref|ZP_01451555.1|  RNA-binding region RNP-1 (RNA recognition ...  77.4    5e-13
ref|YP_001227335.1|  RNA-binding protein [Synechococcus sp. RC...  77.4    5e-13
gb|EEC81644.1|  hypothetical protein OsI_25179 [Oryza sativa I...  77.4    5e-13
ref|YP_001803358.1|  RNA-binding protein [Cyanothece sp. ATCC ...  77.4    5e-13
ref|ZP_06369394.1|  RNP-1 like RNA-binding protein [Desulfovib...  77.4    5e-13
ref|ZP_02071570.1|  hypothetical protein BACUNI_03010 [Bactero...  77.4    5e-13
gb|ABK22248.1|  unknown [Picea sitchensis]                         77.4    5e-13
ref|XP_002264127.1|  PREDICTED: hypothetical protein [Vitis vi...  77.0    6e-13
gb|ACG31231.1|  glycine-rich RNA-binding protein 2 [Zea mays] ...  77.0    6e-13
ref|NP_001105572.1|  glycine-rich RNA binding protein [Zea may...  77.0    6e-13
gb|ACJ04160.1|  putative glycine-rich RNA-binding protein [Cho...  77.0    6e-13
ref|XP_002314019.1|  predicted protein [Populus trichocarpa] >...  77.0    6e-13
gb|AAM16009.1|  glycine-rich RNA binding protein [Zea mays] >g...  77.0    6e-13
gb|AAM16023.1|  glycine-rich RNA binding protein [Zea mays] >g...  77.0    6e-13
gb|ABD58896.1|  chloroplast single strand DNA binding protein ...  77.0    6e-13
gb|ACF80971.1|  unknown [Zea mays]                                 77.0    6e-13
gb|ABK96373.1|  unknown [Populus trichocarpa x Populus deltoides]  77.0    6e-13
gb|AAM16013.1|  glycine-rich RNA binding protein [Zea mays]        77.0    6e-13
gb|AAM16010.1|  glycine-rich RNA binding protein [Zea mays]        77.0    6e-13
gb|AAM16002.1|  glycine-rich RNA binding protein [Zea mays]        77.0    6e-13
ref|YP_001804750.1|  RNA-binding protein [Cyanothece sp. ATCC ...  77.0    6e-13
ref|XP_002607583.1|  hypothetical protein BRAFLDRAFT_71461 [Br...  77.0    6e-13
gb|AAM16007.1|  glycine-rich RNA binding protein [Zea mays]        77.0    7e-13
gb|AAM16021.1|  glycine-rich RNA binding protein [Zea mays]        77.0    7e-13
ref|NP_849524.1|  GR-RBP8; RNA binding / nucleic acid binding ...  77.0    7e-13
ref|YP_003271136.1|  RNP-1 like RNA-binding protein [Haliangiu...  77.0    7e-13
gb|ACS94937.1|  putative glycine-rich RNA-binding protein [Tam...  77.0    7e-13
gb|AAM16012.1|  glycine-rich RNA binding protein [Zea mays]        77.0    7e-13
gb|ACJ85252.1|  unknown [Medicago truncatula]                      76.6    7e-13
dbj|BAA12064.1|  RNA-binding protein RZ-1 [Nicotiana sylvestri...  76.6    7e-13
sp|P49310.1|GRP1_SINAL  RecName: Full=Glycine-rich RNA-binding...  76.6    7e-13
ref|YP_003168754.1|  RNP-1 like RNA-binding protein [Candidatu...  76.6    7e-13
gb|AAM16019.1|  glycine-rich RNA binding protein [Zea mays]        76.6    7e-13
gb|ABW70168.1|  putative glycine-rich RNA-binding protein 2 [B...  76.6    7e-13
ref|ZP_05035181.1|  RNA-binding protein, putative [Synechococc...  76.6    7e-13
gb|AAM16011.1|  glycine-rich RNA binding protein [Zea mays]        76.6    7e-13
gb|AAM15999.1|  glycine-rich RNA binding protein [Zea mays] >g...  76.6    7e-13
ref|XP_384017.1|  hypothetical protein FG03841.1 [Gibberella z...  76.6    7e-13
gb|ACU13140.1|  unknown [Glycine max]                              76.6    8e-13
gb|AAM16003.1|  glycine-rich RNA binding protein [Zea mays]        76.6    8e-13
gb|AAM16000.1|  glycine-rich RNA binding protein [Zea mays]        76.6    8e-13
ref|YP_477403.1|  putative RNA-binding protein [Synechococcus ...  76.6    8e-13
ref|XP_002327166.1|  predicted protein [Populus trichocarpa] >...  76.6    8e-13
ref|NP_849523.1|  GR-RBP8; RNA binding / nucleic acid binding ...  76.6    8e-13
ref|NP_195637.1|  GR-RBP8; RNA binding / nucleic acid binding ...  76.6    8e-13
gb|ACG35271.1|  glycine-rich RNA-binding protein 2 [Zea mays]      76.6    8e-13
ref|XP_001880463.1|  predicted protein [Laccaria bicolor S238N...  76.6    8e-13
ref|XP_001779537.1|  predicted protein [Physcomitrella patens ...  76.6    8e-13
gb|ABB87126.1|  putative glycine-rich RNA binding protein-like...  76.6    8e-13
ref|XP_002305429.1|  predicted protein [Populus trichocarpa] >...  76.6    9e-13
ref|NP_001150604.1|  glycine-rich RNA-binding protein 7 [Zea m...  76.6    9e-13
ref|YP_002462940.1|  RNP-1 like RNA-binding protein [Chlorofle...  76.3    9e-13
ref|NP_001132163.1|  hypothetical protein LOC100193584 [Zea ma...  76.3    9e-13
ref|ZP_03724758.1|  RNP-1 like RNA-binding protein [Opitutacea...  76.3    1e-12
ref|NP_001066827.1|  Os12g0502200 [Oryza sativa (japonica cult...  76.3    1e-12
emb|CAA49174.1|  glycine-rich RNA-binding protein [Arabidopsis...  76.3    1e-12
ref|YP_003422152.1|  RRM domain-containing RNA-binding protein...  76.3    1e-12
ref|XP_001769447.1|  predicted protein [Physcomitrella patens ...  76.3    1e-12
ref|YP_001618346.1|  putative RNA-binding protein [Sorangium c...  76.3    1e-12
gb|ACG34122.1|  ribonucleoprotein [Zea mays]                       76.3    1e-12
gb|ACO71288.1|  cp31BHv [Triticum aestivum]                        76.3    1e-12
ref|NP_001078385.1|  GR-RBP2 (GLYCINE-RICH RNA-BINDING PROTEIN...  76.3    1e-12
ref|NP_849377.1|  GR-RBP2 (GLYCINE-RICH RNA-BINDING PROTEIN 2)...  76.3    1e-12
ref|NP_193121.1|  GR-RBP2 (GLYCINE-RICH RNA-BINDING PROTEIN 2)...  76.3    1e-12
ref|XP_001757165.1|  predicted protein [Physcomitrella patens ...  76.3    1e-12
emb|CAA05727.1|  AtGRP2 [Arabidopsis thaliana]                     76.3    1e-12
dbj|BAC00787.1|  glycine-rich RNA-binding protein [Physcomitre...  76.3    1e-12
ref|XP_001736605.1|  cold-inducible RNA-binding protein [Entam...  76.3    1e-12
ref|XP_001760899.1|  predicted protein [Physcomitrella patens ...  76.3    1e-12
gb|ACA50486.1|  glycine-rich RNA binding protein [Oryza sativa...  75.9    1e-12
ref|NP_001130287.1|  hypothetical protein LOC100191381 [Zea ma...  75.9    1e-12
gb|EAY84004.1|  hypothetical protein OsI_39235 [Oryza sativa I...  75.9    1e-12
ref|NP_001078386.1|  GR-RBP2 (GLYCINE-RICH RNA-BINDING PROTEIN...  75.9    1e-12
gb|EAY83219.1|  hypothetical protein OsI_38428 [Oryza sativa I...  75.9    1e-12
ref|ZP_01631143.1|  RNA-binding region protein [Nodularia spum...  75.9    1e-12
ref|ZP_01810792.1|  RNP-1  like RNA-binding protein [candidate...  75.9    1e-12
ref|YP_001635462.1|  RNP-1 like RNA-binding protein [Chlorofle...  75.9    1e-12
gb|EEC75898.1|  hypothetical protein OsI_12955 [Oryza sativa I...  75.9    1e-12
gb|AAA20897.1|  RNA-binding protein [Chlorogloeopsis sp.]          75.9    1e-12
ref|NP_001140942.1|  hypothetical protein LOC100273020 [Zea ma...  75.9    1e-12
ref|ZP_01471551.1|  RNA-binding region RNP-1 (RNA recognition ...  75.9    1e-12
emb|CBI39142.1|  unnamed protein product [Vitis vinifera]          75.9    1e-12
ref|NP_001050870.1|  Os03g0670700 [Oryza sativa (japonica cult...  75.9    1e-12
emb|CAC83314.1|  glycine rich RNA binding protein [Oryza sativ...  75.9    2e-12
dbj|BAA03741.1|  RNA-binding glycine-rich protein-1a [Nicotian...  75.9    2e-12
ref|NP_484784.1|  RNA-binding protein [Nostoc sp. PCC 7120] >r...  75.9    2e-12
ref|XP_001730695.1|  hypothetical protein MGL_2149 [Malassezia...  75.5    2e-12
ref|XP_001760393.1|  predicted protein [Physcomitrella patens ...  75.5    2e-12
gb|ABK22994.1|  unknown [Picea sitchensis]                         75.5    2e-12
ref|ZP_01470284.1|  RNA-binding protein RbpD [Synechococcus sp...  75.5    2e-12
ref|XP_002487897.1|  nucleolin protein Nsr1, putative [Talarom...  75.5    2e-12
gb|ACN31562.1|  unknown [Zea mays]                                 75.5    2e-12
emb|CAA89058.1|  putative glycine rich RNA binding protein [So...  75.5    2e-12
emb|CAA41253.1|  33 kd chloroplast ribonucleoprotein [Nicotian...  75.5    2e-12
gb|AAB63581.1|  glycine-rich RNA binding protein 1 [Pelargoniu...  75.5    2e-12
emb|CBI38714.1|  unnamed protein product [Vitis vinifera]          75.5    2e-12
ref|XP_001694459.1|  glycine-rich RNA-binding protein [Chlamyd...  75.5    2e-12
gb|AAB65412.1|  glycine-rich protein [Oryza sativa Indica Group]   75.5    2e-12
emb|CBI32594.1|  unnamed protein product [Vitis vinifera]          75.5    2e-12
ref|ZP_01727976.1|  RNA-binding region RNP-1 [Cyanothece sp. C...  75.1    2e-12
dbj|BAA03743.1|  RNA-binding gricine-rich protein-1c [Nicotian...  75.1    2e-12
ref|XP_001877216.1|  predicted protein [Laccaria bicolor S238N...  75.1    2e-12
gb|EEY62307.1|  conserved hypothetical protein [Phytophthora i...  75.1    2e-12
ref|XP_001771291.1|  predicted protein [Physcomitrella patens ...  75.1    2e-12
gb|ABK26841.1|  unknown [Picea sitchensis]                         75.1    2e-12
ref|YP_002952538.1|  RNA-binding protein [Desulfovibrio magnet...  75.1    2e-12
ref|XP_002284230.1|  PREDICTED: similar to Os03g0670700 [Vitis...  75.1    2e-12
ref|XP_001779556.1|  predicted protein [Physcomitrella patens ...  75.1    2e-12
ref|YP_074838.1|  glycine-rich RNA-binding protein [Symbiobact...  75.1    2e-12
emb|CAC86462.1|  glycin-rich RNA binding protein [Polytomella ...  75.1    2e-12
gb|ABK22250.1|  unknown [Picea sitchensis]                         75.1    2e-12
gb|AAC61786.1|  glycine-rich RNA-binding protein [Euphorbia es...  75.1    2e-12
ref|NP_189025.1|  GRP4 (GLYCINE-RICH RNA-BINDING PROTEIN 4); R...  75.1    2e-12
ref|XP_002313795.1|  predicted protein [Populus trichocarpa] >...  75.1    2e-12
ref|XP_001820925.1|  hypothetical protein [Aspergillus oryzae ...  75.1    2e-12
ref|NP_190806.1|  CP33; RNA binding [Arabidopsis thaliana] >db...  75.1    2e-12
sp|Q05966.1|GRP10_BRANA  RecName: Full=Glycine-rich RNA-bindin...  75.1    3e-12
gb|AAM63053.1|  glycine-rich RNA binding protein, putative [Ar...  75.1    3e-12
ref|YP_376032.1|  RNA-binding region RNP-1 [Synechococcus sp. ...  75.1    3e-12
gb|ABG22105.1|  Glycine-rich RNA-binding protein GRP1A, putati...  75.1    3e-12
gb|AAG23220.1|  glycine-rich RNA-binding protein [Sorghum bico...  75.1    3e-12
ref|ZP_00516750.1|  RNA-binding region RNP-1  (RNA recognition...  74.7    3e-12
gb|ABK96349.1|  unknown [Populus trichocarpa x Populus deltoides]  74.7    3e-12
gb|ABK92779.1|  unknown [Populus trichocarpa] >gb|ABK92791.1| ...  74.7    3e-12
dbj|BAF34340.1|  putative glycine-rich RNA-binding protein [Di...  74.7    3e-12
ref|ZP_03300953.1|  hypothetical protein BACDOR_02324 [Bactero...  74.7    3e-12
gb|ABF98117.1|  retrotransposon protein, putative, Ty1-copia s...  74.7    3e-12
gb|AAT85299.1|  glycine-rich RNA-binding protein, putative [Or...  74.7    3e-12
emb|CAA05728.1|  OsGRP1 [Oryza sativa (japonica cultivar-group)]   74.7    3e-12
ref|NP_001067344.1|  Os12g0632000 [Oryza sativa (japonica cult...  74.7    3e-12
ref|YP_002370595.1|  RNP-1 like RNA-binding protein [Cyanothec...  74.7    3e-12
sp|Q99070.1|GRP2_SORBI  RecName: Full=Glycine-rich RNA-binding...  74.7    3e-12
ref|ZP_06309055.1|  RNA-binding region protein RNP-1 [Cylindro...  74.7    3e-12
ref|ZP_03157650.1|  RNP-1 like RNA-binding protein [Cyanothece...  74.7    3e-12
dbj|BAA06523.1|  RNA-binding protein cp33 [Arabidopsis thaliana]   74.7    3e-12
gb|ABH07505.1|  glycine-rich RNA-binding protein [Nicotiana at...  74.7    3e-12
dbj|BAA22083.1|  RNA binding protein [Nicotiana sylvestris]        74.7    3e-12
ref|XP_001770275.1|  predicted protein [Physcomitrella patens ...  74.7    3e-12
ref|ZP_01693505.1|  RNA-binding protein, RNP-1 [Microscilla ma...  74.7    3e-12
dbj|BAA11089.1|  RGP-3 [Nicotiana sylvestris]                      74.7    3e-12
ref|YP_475096.1|  putative RNA-binding protein [Synechococcus ...  74.7    3e-12
gb|AAF31404.1|AF200323_1  putative glycine-rich RNA-binding pr...  74.7    3e-12
gb|AAM16006.1|  glycine-rich RNA binding protein [Zea mays]        74.7    3e-12
sp|P19684.1|ROC5_NICSY  RecName: Full=33 kDa ribonucleoprotein...  74.7    3e-12
ref|YP_007892.1|  nucleic acid-binding protein [Candidatus Pro...  74.7    3e-12
gb|ACR36732.1|  unknown [Zea mays]                                 74.3    3e-12
gb|ACL54717.1|  unknown [Zea mays]                                 74.3    3e-12
gb|ACG28088.1|  glycine-rich RNA-binding protein 2 [Zea mays]      74.3    3e-12
gb|ACG26657.1|  glycine-rich RNA-binding protein 2 [Zea mays] ...  74.3    3e-12
ref|YP_001521497.1|  RNA-binding protein [Acaryochloris marina...  74.3    3e-12
dbj|BAC00786.1|  glycine-rich RNA-binding protein [Physcomitre...  74.3    4e-12
gb|AAX07527.1|  unknown [Prosthecobacter dejongeii]                74.3    4e-12
gb|AAB66885.1|  glycine-rich protein [Oryza sativa Japonica Gr...  74.3    4e-12
gb|ACN25391.1|  unknown [Zea mays]                                 74.3    4e-12
gb|AAL32533.1|  ubiquitin / ribosomal protein CEP52 [Arabidops...  74.3    4e-12
ref|YP_926076.1|  RNA-binding protein [Shewanella amazonensis ...  74.3    4e-12
emb|CBI23720.1|  unnamed protein product [Vitis vinifera]          74.3    4e-12
pir||S41504  12RNP1 protein - Synechococcus sp. (PCC 6301)         74.3    4e-12
ref|YP_003122581.1|  RNP-1 like RNA-binding protein [Chitinoph...  74.3    4e-12
ref|YP_399698.1|  RNA-binding region RNP-1 [Synechococcus elon...  74.3    4e-12
gb|AAM16015.1|  glycine-rich RNA binding protein [Zea mays] >g...  74.3    4e-12
gb|AAM16005.1|  glycine-rich RNA binding protein [Zea mays]        74.3    4e-12
ref|XP_002293195.1|  predicted protein [Thalassiosira pseudona...  74.3    5e-12
gb|EAY90218.1|  hypothetical protein OsI_11785 [Oryza sativa I...  74.3    5e-12
ref|NP_001050221.1|  Os03g0376600 [Oryza sativa (japonica cult...  73.9    5e-12
ref|NP_001059075.1|  Os07g0187300 [Oryza sativa (japonica cult...  73.9    5e-12
emb|CAO88919.1|  unnamed protein product [Microcystis aerugino...  73.9    5e-12
gb|AAC61787.1|  glycine-rich RNA-binding protein [Euphorbia es...  73.9    5e-12
ref|XP_002640522.1|  Hypothetical protein CBG18684 [Caenorhabd...  73.9    5e-12
ref|XP_002526922.1|  glycine-rich RNA-binding protein, putativ...  73.9    5e-12
emb|CAC80549.1|  glycine-rich RNA-binding protein [Ricinus com...  73.9    5e-12
emb|CBE69175.1|  RNP-1 like RNA-binding protein (modular prote...  73.9    5e-12
ref|YP_001522078.1|  RNA-binding protein [Acaryochloris marina...  73.9    5e-12
ref|YP_001298723.1|  putative RNA-binding protein [Bacteroides...  73.9    5e-12
gb|AAM16014.1|  glycine-rich RNA binding protein [Zea mays]        73.9    5e-12
ref|ZP_02925073.1|  RNA-binding region RNP-1 [Verrucomicrobium...  73.9    5e-12
emb|CAO88917.1|  unnamed protein product [Microcystis aerugino...  73.9    5e-12
ref|YP_001940222.1|  RNA-binding protein, RRM domain [Methylac...  73.9    5e-12
ref|YP_001618059.1|  RNA recognition motif-containing protein ...  73.9    5e-12
gb|ACJ11730.1|  glycine-rich RNA-binding protein [Gossypium hi...  73.9    6e-12
gb|AAA81023.1|  CEBP-1 [Dianthus caryophyllus]                     73.6    6e-12
ref|YP_171560.1|  RRM type RNA-binding protein [Synechococcus ...  73.6    6e-12
sp|P49311.1|GRP2_SINAL  RecName: Full=Glycine-rich RNA-binding...  73.6    6e-12
dbj|BAA92156.1|  glycine-rich RNA-binding protein [Citrus unshiu]  73.6    7e-12
gb|AAM16016.1|  glycine-rich RNA binding protein [Zea mays]        73.6    7e-12
gb|ACU16273.1|  unknown [Glycine max]                              73.6    7e-12
ref|YP_001817832.1|  RNP-1 like RNA-binding protein [Opitutus ...  73.6    7e-12
gb|ABR17219.1|  unknown [Picea sitchensis]                         73.6    7e-12
gb|ABA40453.1|  RNA binding protein-like protein [Solanum tube...  73.6    7e-12
gb|AAB71417.1|  glycine-rich RNA-binding protein PsGRBP [Pisum...  73.6    7e-12
ref|XP_002510185.1|  polyadenylate-binding protein, putative [...  73.2    8e-12
ref|NP_001045195.1|  Os01g0916600 [Oryza sativa (japonica cult...  73.2    8e-12
dbj|BAA05170.1|  RNA-binding glycine rich protein [Nicotiana s...  73.2    9e-12
gb|AAD28176.1|AF109917_1  glycine-rich RNA-binding protein [Pi...  73.2    9e-12
ref|XP_002640523.1|  Hypothetical protein CBG18685 [Caenorhabd...  73.2    9e-12
ref|XP_002442600.1|  hypothetical protein SORBIDRAFT_08g022740...  73.2    9e-12
ref|XP_002179267.1|  predicted protein [Phaeodactylum tricornu...  73.2    9e-12
gb|ACU23808.1|  unknown [Glycine max]                              73.2    9e-12
ref|ZP_05789594.1|  RNA-binding region RNP-1 [Synechococcus sp...  73.2    1e-11
ref|ZP_01629737.1|  RNA-binding region [Nodularia spumigena CC...  73.2    1e-11
gb|ABK21879.1|  unknown [Picea sitchensis]                         72.8    1e-11
ref|YP_001225237.1|  RNA-binding protein [Synechococcus sp. WH...  72.8    1e-11
ref|YP_267104.1|  RNA-binding protein [Colwellia psychrerythra...  72.8    1e-11
ref|NP_493029.1|  hypothetical protein R06C1.4 [Caenorhabditis...  72.8    1e-11
ref|XP_002640530.1|  Hypothetical protein CBG18692 [Caenorhabd...  72.8    1e-11
ref|YP_002379591.1|  RNP-1 like RNA-binding protein [Cyanothec...  72.4    1e-11
ref|YP_380351.1|  RNA recognition motif-containing protein [Sy...  72.4    1e-11
ref|ZP_01469061.1|  RNA-binding region RNP-1 [Synechococcus sp...  72.4    1e-11
ref|NP_893493.1|  RNA-binding protein RbpD [Prochlorococcus ma...  72.4    1e-11
ref|XP_002301171.1|  predicted protein [Populus trichocarpa] >...  72.4    1e-11
ref|NP_001150574.1|  glycine-rich RNA-binding protein 7 [Zea m...  72.4    1e-11
ref|XP_002285469.1|  PREDICTED: hypothetical protein [Vitis vi...  72.4    1e-11
emb|CAH25380.1|  putative glycine-rich RNA-binding protein [Gu...  72.4    1e-11
ref|ZP_01124405.1|  RNA-binding protein RbpD [Synechococcus sp...  72.4    1e-11
gb|ACR34909.1|  unknown [Zea mays]                                 72.4    1e-11
gb|ACU18482.1|  unknown [Glycine max]                              72.4    2e-11
ref|YP_730260.1|  putative RNA-binding protein [Synechococcus ...  72.4    2e-11
gb|AAB63589.1|  glycine-rich RNA-binding protein [Oryza sativa...  72.4    2e-11
ref|YP_001520730.1|  RNA-binding protein [Acaryochloris marina...  72.4    2e-11
ref|ZP_01910335.1|  RNA-binding protein [Plesiocystis pacifica...  72.4    2e-11
ref|XP_002522811.1|  glyc