GOS 1526010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1000311
Annotathon code: GOS_1526010
Sample :
  • GPS :32°10'29.4n; 64°00'36.6w
  • Sargasso Sea: Sargasso Sea, Station 3 - Bermuda (UK)
  • Open Ocean (-5m, 19.8°C, 0.22-0.8 microns)
Authors
Team : Algarve
Username : Studygenes1
Annotated on : 2010-06-09 16:21:38
  • a31691 VascoManueldosSantosSilva
  • a33862 TiagoGuilhermeDosSantosInacioDeBrito1
  • a38198 JoseEduardoRodriguesEusebio1

Synopsis

  • Taxonomy: Psychroflexus torquis (NCBI info)
    Rank: species - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 57029
    Kingdom: Bacteria - Phylum: Bacteroidetes - Class: Flavobacteria - Order: Flavobacteriales
    Bacteria; Bacteroidetes; Flavobacteria; Flavobacteriales; Flavobacteriaceae; Psychroflexus;

Genomic Sequence

>JCVI_READ_1000311 GOS_1526010 Genomic DNA
TCTAATGCAATTATGGCAATTGCATTCAATAAAAAAATAATTCCTTTAGATGGAAATGTTGAAAGAATTTTAAAAAGAGTATTTTATTTAAAAAAAGAAA
AAGAAATTTCAAAAGAAAATTTACACCAAAAAAAAATGTTTTTTGGAGAAACAATTAGAGCTAGTGATTATGCTCAAGCTATAATGGAAATAGGTGCATT
AATCTGTAAACCATCCAACCCACTTTGTTATCAATGTCCTATCTCAACAAATTGCAAATCCTTAAAAAAAAATGACTTTGAAATAATTAAAATAAATAAA
TTTAATAAACAAAAGTTTTTTGAAGCAAATATTTTTCAAAATAAGCAGAATAATTACTATCTTTTAAAAAACAGAAAATTTAACTTTTTAAAAGATATGC
CTATATTCCCCATGAATGAGATACCTAAGACAAAATTTAAAAATCATTTAGGAAAAAGGATCAATATAAAAATGTCAAATATGGATATGAAAATTGCAAT
TAATATGAAAAATAATTTACCAGAAAATAGCGATGGATTTTTTATTAATGTTAAAGATTTAAGCAATTGGACTTTACCTTCGTTTACAAAGAAAATACTT
AATACTATCAAATAAATCAATGAAAAAAATTGCGATTATTGGTGGAGGGATATCAGGCTTATATTTTGCAAATCTTTTAAATAATGAAAAAGATATTGAA
TATAAAATATTTGAAAAAAAAGATAATTATAATTTCCTTGAAGGTTATGGAATTCAATTATCAGTAAATAGTATAAAATTATTAAATAGTATAGGATTTA
AAAATCTACCTGCATCTGAAGTTAGCTTTCCGTCAAAAGTGAATTTCATACAAGCAAATAATTCCAAAAAAATTTGCGATATAGACCTTACACAATTTTA
ATGATTATTCTAATAGATACACTACCTTAAAAAGATCAACATTATTAAAATTCTTATTTCAAAAC

Translation

[1 - 612/965]   direct strand
>GOS_1526010 Translation [1-612   direct strand]
SNAIMAIAFNKKIIPLDGNVERILKRVFYLKKEKEISKENLHQKKMFFGETIRASDYAQAIMEIGALICKPSNPLCYQCPISTNCKSLKKNDFEIIKINK
FNKQKFFEANIFQNKQNNYYLLKNRKFNFLKDMPIFPMNEIPKTKFKNHLGKRINIKMSNMDMKIAINMKNNLPENSDGFFINVKDLSNWTLPSFTKKIL
NTIK

[ Warning ] 5' incomplete: does not start with a Methionine

Annotator commentaries

The result show us some setbacks, we can say that we have some good results in the Blastp with the best having a score of 211 and a 6e-53 value, but then we have the MSA results that make us doubt about the fidelity of the results obtained in the lineage report, sure it is a CFB bacteria and sure there is a lot of them, but that confidence in this field is taken away by the 21% similarity results in the MSA, even so the tree seems to be by happy with these results showing us, with a value of 1 in the node of the Gos sequence, some good conclusions on what is the most similar organism that shares the better resemblance wit it and we have Psychroflexus torquis as it.

So it is the blastp, lineage report and tree saying that torquis is what we want, against the MSA, wich results are used to build the tree.

ORF finding

PROTOCOL


a)SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'Any codon' initiation / Standard (1) code

b)SMS ORFinder / reverse strand / frames 1, 2 & 3 / min 60 AA / 'Any codon' initiation / Standard (1) code -----------------------------------------------------------------------------------------------------

RESULTS ANALYSIS


Direct strand:


No ORFs were found in reading frame 3.


The choosen ORF, number 1 in reading frame 1, on the direct strand extends from base 1 to base 615 and codes a

proteic sequence of 204 aa.


>ORF number 1 in reading frame 1 on the direct strand extends from base 1 to base 615.

TCTAATGCAATTATGGCAATTGCATTCAATAAAAAAATAATTCCTTTAGATGGAAATGTT

GAAAGAATTTTAAAAAGAGTATTTTATTTAAAAAAAGAAAAAGAAATTTCAAAAGAAAAT

TTACACCAAAAAAAAATGTTTTTTGGAGAAACAATTAGAGCTAGTGATTATGCTCAAGCT

ATAATGGAAATAGGTGCATTAATCTGTAAACCATCCAACCCACTTTGTTATCAATGTCCT

ATCTCAACAAATTGCAAATCCTTAAAAAAAAATGACTTTGAAATAATTAAAATAAATAAA

TTTAATAAACAAAAGTTTTTTGAAGCAAATATTTTTCAAAATAAGCAGAATAATTACTAT

CTTTTAAAAAACAGAAAATTTAACTTTTTAAAAGATATGCCTATATTCCCCATGAATGAG

ATACCTAAGACAAAATTTAAAAATCATTTAGGAAAAAGGATCAATATAAAAATGTCAAAT

ATGGATATGAAAATTGCAATTAATATGAAAAATAATTTACCAGAAAATAGCGATGGATTT

TTTATTAATGTTAAAGATTTAAGCAATTGGACTTTACCTTCGTTTACAAAGAAAATACTT

AATACTATCAAATAA


>Translation of ORF number 1 in reading frame 1 on the direct strand.

SNAIMAIAFNKKIIPLDGNVERILKRVFYLKKEKEISKENLHQKKMFFGETIRASDYAQA

IMEIGALICKPSNPLCYQCPISTNCKSLKKNDFEIIKINKFNKQKFFEANIFQNKQNNYY

LLKNRKFNFLKDMPIFPMNEIPKTKFKNHLGKRINIKMSNMDMKIAINMKNNLPENSDGF

FINVKDLSNWTLPSFTKKILNTIK*


Reverse Strand:


ORF number 1 in reading frame 1 on the reverse strand extends from base 331 to base 522.No ORFs were found in reading frame 2.


No ORFs were found in reading frame 3.


The ORF was choosen based on is size and probably of being the one that is transcribed, if an organism has an ORF this size and uses it then it must have biological meaning, since is too expensive, in terms of energy, to use something that doesn't codifies something iomportant.It is situated in the reading frame 1 and in the direct strand, that could indicate good news since these marks are the most certain of being correct, it´s also a good ORF for is size, as described above, it´s a coding sequence, at least when the initiation codon is other than methionine.

We have found two Orfs in the direst strand and olny one in the inverse strand, this reforces the feeling that the ORF choosen by us, that is in this strand, is the rigth one.

RAW RESULTS

a)
>ORF number 1 in reading frame 1 on the direct strand extends from base 1 to base 615.
TCTAATGCAATTATGGCAATTGCATTCAATAAAAAAATAATTCCTTTAGATGGAAATGTT
GAAAGAATTTTAAAAAGAGTATTTTATTTAAAAAAAGAAAAAGAAATTTCAAAAGAAAAT
TTACACCAAAAAAAAATGTTTTTTGGAGAAACAATTAGAGCTAGTGATTATGCTCAAGCT
ATAATGGAAATAGGTGCATTAATCTGTAAACCATCCAACCCACTTTGTTATCAATGTCCT
ATCTCAACAAATTGCAAATCCTTAAAAAAAAATGACTTTGAAATAATTAAAATAAATAAA
TTTAATAAACAAAAGTTTTTTGAAGCAAATATTTTTCAAAATAAGCAGAATAATTACTAT
CTTTTAAAAAACAGAAAATTTAACTTTTTAAAAGATATGCCTATATTCCCCATGAATGAG
ATACCTAAGACAAAATTTAAAAATCATTTAGGAAAAAGGATCAATATAAAAATGTCAAAT
ATGGATATGAAAATTGCAATTAATATGAAAAATAATTTACCAGAAAATAGCGATGGATTT
TTTATTAATGTTAAAGATTTAAGCAATTGGACTTTACCTTCGTTTACAAAGAAAATACTT
AATACTATCAAATAA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
SNAIMAIAFNKKIIPLDGNVERILKRVFYLKKEKEISKENLHQKKMFFGETIRASDYAQA
IMEIGALICKPSNPLCYQCPISTNCKSLKKNDFEIIKINKFNKQKFFEANIFQNKQNNYY
LLKNRKFNFLKDMPIFPMNEIPKTKFKNHLGKRINIKMSNMDMKIAINMKNNLPENSDGF
FINVKDLSNWTLPSFTKKILNTIK*

>ORF number 1 in reading frame 2 on the direct strand extends from base 563 to base 901.
GCAATTGGACTTTACCTTCGTTTACAAAGAAAATACTTAATACTATCAAATAAATCAATG
AAAAAAATTGCGATTATTGGTGGAGGGATATCAGGCTTATATTTTGCAAATCTTTTAAAT
AATGAAAAAGATATTGAATATAAAATATTTGAAAAAAAAGATAATTATAATTTCCTTGAA
GGTTATGGAATTCAATTATCAGTAAATAGTATAAAATTATTAAATAGTATAGGATTTAAA
AATCTACCTGCATCTGAAGTTAGCTTTCCGTCAAAAGTGAATTTCATACAAGCAAATAAT
TCCAAAAAAATTTGCGATATAGACCTTACACAATTTTAA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
AIGLYLRLQRKYLILSNKSMKKIAIIGGGISGLYFANLLNNEKDIEYKIFEKKDNYNFLE
GYGIQLSVNSIKLLNSIGFKNLPASEVSFPSKVNFIQANNSKKICDIDLTQF*

No ORFs were found in reading frame 3.

b)

>ORF number 1 in reading frame 1 on the reverse strand extends from base 331 to base 522.
TCGCAATTTTTTTCATTGATTTATTTGATAGTATTAAGTATTTTCTTTGTAAACGAAGGT
AAAGTCCAATTGCTTAAATCTTTAACATTAATAAAAAATCCATCGCTATTTTCTGGTAAA
TTATTTTTCATATTAATTGCAATTTTCATATCCATATTTGACATTTTTATATTGATCCTT
TTTCCTAAATGA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
SQFFSLIYLIVLSIFFVNEGKVQLLKSLTLIKNPSLFSGKLFFILIAIFISIFDIFILIL
FPK*

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOL

Phylogeny.fr/"a la carte"/ Muscle/ out group:[chlamydias]



RESULTS ANALYSIS


Our sequence doesn´t have the initiation sequence and it seems to lack his stop codon, since it's impossible to determin the molecular mass of the protein in question. With a 21% of similarity between the sequences, that becomes obvious in the sixth list of results with many gaps to win correspondence in sequences, we can reafirm what we had said before and say that the MSA didn´t obtained good results, now we will see how much "damage" this data would do to the trees since this results are taken as a start point to meke the tree.

RAW RESULTS

CCLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


GOS_152601      ------------------------------------------------------------
Ps.to.ATCC      ------------------------------------------------------------
Can.P.amoe      ----------MSSSFPNEKLKKWFL-SSKRDLPWRQNPTPYAVWISEVMLQQTQVAVVIP
ChlD/UW-3/      --MIRTAFFQDKKCFPLEALRSWFL-ESKRSFPWRDSPTPYRVWVSEVMLQQTRAEVVVP
Chl.tracho      --MIRTAFFQDKECFPLEALRSWFL-ESKRSFPWRDSPTPYRVWVSEVMLQQTRAEVVVP
Chl434/Bu       --MIRTAFFQDKECFPLEALRSWFL-ESKRSFPWRDSPTPYRVWVSEVMLQQTRAEVVVP
Chl70_Out       --MIRTAFFQDKKCFPLEALRSWFL-ESKRSFPWRDSPTPYRVWVSEVMLQQTRAEVVVP
S.r.DSM_13      -------------------MLDWYD-THKRSMPWRETDDPYRIWVSEIMLQQTRVDTVRD
Chi.pi.DSM      -----------MKQFFTNALLEWNDNENTRSMPWKGEKDPYRIWLSEIILQQTRVEQGWA
Pr.ti.CRIS      MNDSMEHKDVISTNPFAVTLLKWFE-EYGRSLPWRETTDPYAIWLSEIILQQTRVQQGWE
M.m.ATCC_2      ----------MDKHLFANSILNWYA-KNKRDLPWRHTKDPYKIWLSEIILQQTRVKQGLP
Cap.g.ATCC      --------MKEQTTEIAVLLLTWYA-AHKRELPWRGAGNPYYIWLSEVILQQTRVAQGLP
L.bl.MED21      ------------MLNFSKKLIHWYL-QNKRELPWRQTKDPYRIWLSEIILQQTRVEQGMP
D.d.MED134      -------------MSFSNKLITWYL-EHKRDMPWRNTTHPYHIWLSEIILQQTRVAQGLP
F.ba.HTCC2      -------------MIFSQKILHWYA-QNKRNLPWRSTKDPYRIWLSEIMLQQTRVSQGLP
K.al.OT-1       -------------MNFSKEIIQWYF-QNKRDLPWRKTKDPYRIWLSEIMLQQTRVAQGLP
Po.irgensi      -------------MKFSNTLVYWYL-QNNRELPWRKSKNPYFIWLSEIMLQQTRVAQGLG
Po.s._MED1      -------------MKFSNTLIFWYL-QNKRDLPWRKTKNPYFIWLSEIMLQQTRVAQGLD
Cr.at.HTCC      ---------MQKDLNFSKILINWYL-KYKRDLPWRHTTDPYFIWLSEIMLQQTQVAQGLP
Z.pr.SM-A8      -------------MNFSKTLINWYL-KSRRELPWRETTNPYNIWLSEIMLQQTRIEQGLP
G.f.KT0803      -------------MVLSNRLTHWYL-QNKRDLPWRKTHEPYHIWLSEIMLQQTRIEQGLP
                                                                            

GOS_152601      ------------------------------------------------------------
Ps.to.ATCC      ----------------------------------------KSAIMINGKFGGTLPSNIED
Can.P.amoe      YFNRWMQAFPSIEALAIASLEEVIKAWEGLGYYSRARHLHQGAQYLVEHCQGELPADEKE
ChlD/UW-3/      YFLKWMERFPTLQDLAQARESDVVQLWEGLGYYSRARNLLAGARVITEIFGGEIPNDLAL
Chl.tracho      YFLKWMERFPTLQDLAQARESDVVQLWEGLGYYSRARNLLAGARVITEIFGGEIPNDLAL
Chl434/Bu       YFLKWMERFPTLQDLAQARESDVVQLWEGLGYYSRARNLLAGARVITEIFGGEIPNDLAL
Chl70_Out       YFLKWMERFPTLQDLAQARESDVVQLWEGLGYYSRARNLLAGARVITEIFGGEIPNDLAL
S.r.DSM_13      YYHRFLEAFPTVEALADADRDTVLKHWEGLGFYARARHLHTAAQHVVDEHDGTVPSTMDA
Chi.pi.DSM      YYEKFILNYPTVQELAAAPEEAVFRLWQGLGYYARCKNMLAAAKQIASQYHGHFPNTYET
Pr.ti.CRIS      YWERFMHRFPHVEDLAAATQDEVLRLWQGLGYYSRARHLHEAAKQVVAL--GHFPCTMSE
M.m.ATCC_2      YYQKFVETYPLVQDLASADEQNVLRLWQGLGYYSRARNLHTAAKFVHHERGGVFPESYQE
Cap.g.ATCC      YYQRFVEQFPTVEALAQAPEAQVLKVWQGLGYYSRAKNLQRAAQYITEELQGVFPSTYET
L.bl.MED21      YYFSFVETYPDVKALADAPEDDVLKLWQGLGYYSRARNLHATAKKVAYEHKGIFPDTYKE
D.d.MED134      YYIAFTEAFPTVQDLAQATEEEVLKLWQGLGYYSRGRNLHASAKMIVEEMDGVFPNTYEE
F.ba.HTCC2      YYLKFTEHFPTVNELAGASEEQVLKLWQGLGYYSRARNLHTTAKTVVNEYHGKFPNTYIE
K.al.OT-1       YYEKFTEAFPTVYDLANAEESQVLKLWQGLGYYSRARNLHYTAKDIVENYNGQFPSTYKA
Po.irgensi      YYLKFTSTFPTVFDLAKAEESTVLKMWQGLGYYSRARNLHFSAKHIAQELNGEFPTSYAE
Po.s._MED1      YYQKFTTNFPTVFDLANADESTVLKMWQGLGYYSRARNLHFSAKQIVSDFNGEFPSTFKD
Cr.at.HTCC      YYLKFTETYPTVFHLAKASQEEVLKNWQGLGYYSRARNLHETAKYVANERDGKFPEDYKG
Z.pr.SM-A8      YYNKFIAEFPSVFDLADASQDKVMKLWQGLGYYSRARNLHATAKHVAYELNGEFPKDYNG
G.f.KT0803      YYNKFIQAYPSVFDLANATPEEVLKLWQGLGYYSRARNLHETAKYVAFELNGKFPGTYKG
                                                                            

GOS_152601      -----------SNAIMAIAFNKKIIPLDGNVERILKRVFYLKKEKEISKENLHQKKMFFG
Ps.to.ATCC      LKSLPGVGDYTSTAIMAIAFNQKFIPLDGNVERILKRVLYLRSEKAISKENMQISKKFFG
Can.P.amoe      LKKIKGLGPYTIGAILSFAFHQKKAAVDGNVLRVLARYFQIEEDIAKTSTIKKLRDFAES
ChlD/UW-3/      LSSIKGIGSYTANAILAFAFKQKNPAVDGNVLRVMSRLFAIEESIDRMNTRREITGLCES
Chl.tracho      LSSIKGIGSYTANAILAFAFKQKNPAVDGNVLRVMSRLFAIEESIDRMNTRREITRLCES
Chl434/Bu       LSSIKGIGSYTANAILAFAFKQKNPAVDGNVLRVMSRLFAIEESIDRMNTRREITGLCES
Chl70_Out       LSSIKGIGSYTANAILAFAFKQKNPAVDGNVLRVMSRLFAIEESIDRMNTRREITGLCES
S.r.DSM_13      IKDLKGVGPYTAAAVLSIAYRKPHAVLDGNVTRVLSRVFAVDEDATTSAAEGHLRDLANE
Chi.pi.DSM      IQSLKGVGPYTSAAIASFAFNLPHAVLDGNVFRVLSRFFDIDTPIDTTAGKKQFTDLAQE
Pr.ti.CRIS      LKAMKGVGDYTAAAIGSIAFGLPVAVVDGNVYRVLSRYFGISTPINTTEGQKEFVDLAQS
M.m.ATCC_2      LLKMKGVGDYTASAIASFAYNEKVAVVDGNVFRVLARVFGIDTDIASHKGAKEFGALAKS
Cap.g.ATCC      LLKLKGVGEYTASAIASICYNEPKAVVDGNVYRVLSRIFDIDTPINTTEGAKYFKELAQE
L.bl.MED21      LKKLKGVGDYTASAIASICFDEAAAVVDGNVYRVLSRIFGIDTPINSTPGAKEFKALAQE
D.d.MED134      IKKLKGVGDYTASAIASICFNEPTAVVDGNVYRVLSRVYGIDTPINSTAGIKEFKALAQE
F.ba.HTCC2      LLKLKGVGDYTASAIASICFDEPEPVVDGNVYRVLSRYFGVDIPINGTKGVKYFKELAKE
K.al.OT-1       LLKLKGVGDYTASAIASICFDEVAPVVDGNVYRVLSRYFDIDTPINSTEGIKKFKELAFE
Po.irgensi      IIKLKGIGDYTASAIASICFNEPTAVVDGNVYRVLSRYFGIKTATNSASGIKEFKTLAQT
Po.s._MED1      IIKLKGVGDYTASAIASIAFNEPTAVVDGNVYRVLSRYFGINTPINSSKGIKEFKELAQS
Cr.at.HTCC      LLRLKGVGDYTASAIASICYNEPVAVVDGNVYRVLSRYFGIETPINSTKGIKEFKAMAEL
Z.pr.SM-A8      LLKLKGVGDYTASAIASISYKEPVAVVDGNVYRVLSRYFNIDTPINSTEGVKEFKALAME
G.f.KT0803      LLKLKGVGDYTASAIASICYNEPVAVVDGNVYRVLSRIFGIDTPINSAAGIKEFKLLAQE
                             *: ::.:      :**** *:: *   :                   

GOS_152601      --ETIRASDYAQAIMEIGALICKPSNPLCYQCPISTNCKSLKKN---DFEIIKINKFNKQ
Ps.to.ATCC      L--SERASDYAQAIMELGALVCRPTFPLCDKCPIRINCISYKRK---DFSLIKKTKKNKI
Can.P.amoe      ILPDEESWISSEALIELGATICS-RKAICQECPLKSNCQSYLHGLSDKLPIKTKAIKTQY
ChlD/UW-3/      LLPDQDPQVIAESFIELGARICK-KQPLCEQCPLRSFCTAYRQGTMEQYPVRNTRAAISR
Chl.tracho      LLPDQDPQVIAESFIELGARICK-KQPLCEQCPLRSFCTAYRQGTMEQYPVRNTRVAISR
Chl434/Bu       LLPDQDPQVIAESFIELGARICK-KQPLCEQCPLRSFCTAYRQGTMEQYPVRNTRAAISR
Chl70_Out       LLPDQDPQVIAESFIELGARICK-KQPLCEQCPLRSFCTAYRQGTMEQYPVRNTRAAISR
S.r.DSM_13      LLDPDRPGDFNQAMMELGALVCTPRTPHCDRCPLNAVCRAHDAGTEEDYPITPESEPVPH
Chi.pi.DSM      LLPHGKSASYNQSIMDFGAVVCKPQQPACKSCPLAAKCKGYQQGLTALLPVKSKKLVIKK
Pr.ti.CRIS      LLPTSAPSAYNQAIMDFGAIQCTPTSPRCLICPLADSCEALRSGKTAELPVKLRKLKIKK
M.m.ATCC_2      LLPDEHTDAYNQGIMEFGALQCTPQKPDCMYCPLQTHCVAYAQGKQKELPVKIKKIKVKH
Cap.g.ATCC      LLDKERAGEYNQAIMDFGALQCKPQSPDCESCILSAKCLAYHRKKVTQRPVKIAKIKPIH
L.bl.MED21      LIDEKDPATFNQAIMEFGATQCKPKNPYCLHCPFNEGCIAFQQGKISDLPVKKGKIKVRD
D.d.MED134      LIDENRPADFNQAIMEFGAIQCKPQNPYCLHCIYNHSCVALQQNKVSELPVKLKKTKVKH
F.ba.HTCC2      VMNVENIRDYNQGIMEFGAIQCAPKNPDCSVCPLNEGCVALKKNIIKELPIKINKTKIKN
K.al.OT-1       VVDHDDPANFNQAIMEFGAVQCKPQNPYCIICPLHESCEGLKNQRVDMLPVKLKKTKVKK
Po.irgensi      LIDPSQPGTYNQALMDFGALHCKPQNPLCVSCPFSDSCVALEKKLTKELPVKDKKIKVKK
Po.s._MED1      LIDKSQPGTFNQAIMDFGAIQCKPKKPFCMFCPFSESCVALQKNLIEVLPVKEKKVKVKK
Cr.at.HTCC      LLDENQPALFNQAIMEFGARHCKPKNPFCDTCPFSDSCKALQDDNVLSLPVKLKKTTIKK
Z.pr.SM-A8      LLDKKDPSNFNQALMEFGALQCKPKNPLCDSCPFNTSCLALKEDKIGDLPVKIKKGKIKN
G.f.KT0803      LLDKNDPATFNQAIMEFGALHCKPQKPKCEICPFNDSCLALKNDKIKELPVKLKKNKVKK
                           :.::::**  *    . *  *     * .          :         

GOS_152601      KFFEANIFQNKQNNYY---LLKNRKFNFLKDMPIFPMNEIPKTKFKNHLGKRINIKMSNM
Ps.to.ATCC      KYFEANIYMNENKLL----LVRNNKFNFLKNLLIFPMNEIDKSKFNSSPKVKTKIKISNI
Can.P.amoe      LYRAVAIVKCGDYFL----VKKGKKGEIMSDLYEFPFFEVSQEGITFKEL-QENIKLHWN
ChlD/UW-3/      LFRAVVIVLYKDQVL----MTKREEKEIMAGLYEFPYYQLPKEDCCDIEKITHLVQKDYG
Chl.tracho      LFRAVVIVLYKDQVL----MTKREEKEIMAGLYEFPYYQLPKEDCCDIEKITHLVQKDYG
Chl434/Bu       LFRAVVIVLYKDQVL----MTKREEKEIMAGLYEFPYYQLPKEDCCDIEKIIHLVQKDYG
Chl70_Out       LFRAVVIVLYKDQVL----MTKREEKEIMAGLYEFPYYQLPKEDCCDIEKITHLVQKDYG
S.r.DSM_13      EDIAVGLVFDDNDRLL---IQRRPDEGLLGGLWEFPGGKQEGDESMEAACRREVREELGV
Chi.pi.DSM      RYFYYLVLQHKENVY----IRKRTENDIWQNLHEFILIETPGPEDPGSLL-SSAAFKAVM
Pr.ti.CRIS      RHFSYIYLRCQGMTA----FHKRSAGDIWQGLWE-PLLIENADLP------VFSAPLSLI
M.m.ATCC_2      RYFHYLLFFYKNNGQTFVAMKQRGSQDIWGGLYDFWLEEQPKLLSAIDLLDVINLPQAQL
Cap.g.ATCC      RYFHYCVLKDSQGNTQ---LHKREAKDIWQGLYEFPLIEVKENTTEAQVIETIRAQYPHT
L.bl.MED21      RFFNYLIFITPDGQTM---LQQREGKGIWRGLFDFPLLETEKDLPEARFRESVNSLKITT
D.d.MED134      KYFHYLYIKDKQEQTI---IKQRTGKGIWQGLYEFPVIEELAALQEGEGD-RFRESVKNH
F.ba.HTCC2      RYFNYLVFLDANNRTL---LRQRKGKGIWQNLWEFPLLETNGKINIDELGGKHHNVVSLN
K.al.OT-1       RWFNYLVVVSNASETL---LEKRKGKGIWQGLYQFPLLETETSIETIADY-QSEIEEIIK
Po.irgensi      RYFNFLVIKTANNKTI---LTERTGKGIWQGLYQFPLIECEKTVNQKEII-DSEEFANLF
Po.s._MED1      RYFNYLVVKTKDDKTI---LTERKGKGIWQGLYQFPLLEDTHMITKEELL-ASEMFNELF
Cr.at.HTCC      RYLNYIVLLSDNENTQ---IKQRVGKGIWQGLYEFPCIETKKDISETEFLSLFKASDISN
Z.pr.SM-A8      RYFNYMVFSSEENKTL---LQQRKGKGIWYGLYEFPLIETKSDIQEAKIIEENNEFQHLM
G.f.KT0803      RYFNYLVFNHENETTI---LEQRVGKGIWNGLYQFPLVESERLIDEKELV-TFEAFKNSI
                                   .       :  .:                            

GOS_152601      D------MKI---AINMKNNLPENSD----------GFF-------------------IN
Ps.to.ATCC      D------MN----IVINKNKIKSTNK----------GLI-------------------LN
Can.P.amoe      L------------TVHLLQSLSSIEH--GFTRYQARLDP---CVFNCLEMSPVKDLEWLD
ChlD/UW-3/      E------------TLHFVSSLPSQKQ--VFTRYRVTLFP---HVFYTKYSLPNS----YT
Chl.tracho      E------------TLHFVSSLPSQKQ--VFTRYRVTLFP---HVFYTKYSLPNS----YT
Chl434/Bu       E------------TLHFVSSLPSQKQ--VFTRYRVTLFP---HVFYTKYSLPNS----YT
Chl70_Out       E------------TLHFVSSLPSQKQ--VFTRYRVTLFP---HVFYTKYSLPNS----YT
S.r.DSM_13      G------MT----DVEPF--YTLSHA--YSHFKITLHAFRGRLADGPPEAREDQPFRWVT
Chi.pi.DSM      K------D-----IRYNMDGASATFKQQLTHQTIHSQFL---LLSVSKKPEIPG-YTAVP
Pr.ti.CRIS      K-------------------KGVKHV--LTHRVLTADFY---LVELNQRPSLPEDYIWIP
M.m.ATCC_2      -------------KKMVIGKESVIYKHILTHQRIQAKFH---HIEVKPAQK-DL----PM
Cap.g.ATCC      -------------TYIKKYATEFLHK--LTHQHLHTCFW---EVEVAEVLS-DG----LP
L.bl.MED21      KEKSIRFSDLPVEEVILQQRDPIIHK--LSHQKLHVKFW---VVKLSEAPGLQT----IA
D.d.MED134      P----LLQDLVINDIDRYNNTPIVHK--LSHQHLHTTFW---IVTVDEITD-NA----TP
F.ba.HTCC2      E----------APKIYEFNQEDIVHK--LSHQHLHTKFW---ILKTKTKFK-DG----IG
K.al.OT-1       I------KDF---SVTKFNEKEMIHK--LSHQHLYTTFW---IVETTDSLK-NG----IS
Po.irgensi      P------DET---TLSLFNSKEIVHK--LSHQHLYTQFW---IVETKTLKN-AD----IL
Po.s._MED1      P------NDV---SISLFNKKDIVHK--LSHQHLYTQFW---VIETEQLTS-AN----IS
Cr.at.HTCC      D----INENY---NVSLFNDASIVHK--LSHQHLYTKFW---IVRVSTL-N-DG----IP
Z.pr.SM-A8      E-----AKNP---SVSLYNDQPIIHK--LSHQHIYARFW---LVDVQKLPK-GG----IS
G.f.KT0803      T-----GSGV---ELELFNEIPVIHK--LSHQHLITRFW---VVNSGTASE-NS----VK
                                                                            

GOS_152601      VKDLSNW--------TL----PSFTKKILNTI-----K----------------
Ps.to.ATCC      RKKIVSE--------VI----PSFTKKLFRVA-----SSNV-------------
Can.P.amoe      TKSLKQK--------AFSSGHRRIFQSLL--------SLDID------------
ChlD/UW-3/      LAELSSL--------PSSSGHRRIKETFLVEY-----HKSLEKMVSCSGD---K
Chl.tracho      LAELSSL--------PSSSGHRRIKETFLVEY-----HKSLEK----DGKLFWR
Chl434/Bu       LAELSSL--------PSSSGHRRIKETFLVEY-----HKSLEK----DGKLFWR
Chl70_Out       LAELSSL--------PSSSGHRRIKETFLVEY-----HKSLEK----DGKLFWR
S.r.DSM_13      VDELDDY--------AF----PRANRRLIEELVRRQTEPSLFD-----------
Chi.pi.DSM      RDQLDLY--------AF----PKTITDFLRNR-----ELTLF------------
Pr.ti.CRIS      EDELDQY--------AL----PRLIEILLASL-----PA---------------
M.m.ATCC_2      FDKLRFYEVNEVAALPK----PVLIDNYLNKD-----FF---------------
Cap.g.ATCC      IRELVHY--------PM----PALLIKFLKKE-----KI---------------
L.bl.MED21      YERLGDF--------AV----PRVIDRFMEDF-----DFKDFL-----------
D.d.MED134      INRITEL--------PV----PVLIGNFIEKL-----L----------------
F.ba.HTCC2      FNELDKF--------PV----PVLIADFIKTF-----KI---------------
K.al.OT-1       LQEIRTY--------PV----PILIGNFIEEF-----NF---------------
Po.irgensi      WENIQDF--------PV----PVLIANFLKAF-----EIVK-------------
Po.s._MED1      WKNIEDY--------PV----PVLIANFLEDF-----KLKN-------------
Cr.at.HTCC      THQLKDY--------PV----PVLIARFLEDF-----SF---------------
Z.pr.SM-A8      AEKVKEY--------PV----PVLIQNFLNEI-----DIENL------------
G.f.KT0803      LKNVTDY--------PV----PVLIENFLNEY-----LPDGYK-----------
                   :                        :                         


Number of sequences: 21
Alignment assumed to be: Protein
New number of positions: 88 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
GOS_1526010      ------------------------------------------------------------
Ps.to.ATCC_7007  ------------------------------------------------------------
Can.P.amoebophi  ----------MSSSFPNEKLKKWFL-SSKRDLPWRQNPTPYAVWISEVMLQQTQVAVVIP
ChlD/UW-3/CX]_O  --MIRTAFFQDKKCFPLEALRSWFL-ESKRSFPWRDSPTPYRVWVSEVMLQQTRAEVVVP
Chl.trachomatis  --MIRTAFFQDKECFPLEALRSWFL-ESKRSFPWRDSPTPYRVWVSEVMLQQTRAEVVVP
Chl434/Bu]_Out   --MIRTAFFQDKECFPLEALRSWFL-ESKRSFPWRDSPTPYRVWVSEVMLQQTRAEVVVP
Chl70]Out        --MIRTAFFQDKKCFPLEALRSWFL-ESKRSFPWRDSPTPYRVWVSEVMLQQTRAEVVVP
S.r.DSM_13855]I  -------------------MLDWYD-THKRSMPWRETDDPYRIWVSEIMLQQTRVDTVRD
Chi.pi.DSM_2588  -----------MKQFFTNALLEWNDNENTRSMPWKGEKDPYRIWLSEIILQQTRVEQGWA
Pr.ti.CRIS_5C-B  MNDSMEHKDVISTNPFAVTLLKWFE-EYGRSLPWRETTDPYAIWLSEIILQQTRVQQGWE
M.m.ATCC_23134]  ----------MDKHLFANSILNWYA-KNKRDLPWRHTKDPYKIWLSEIILQQTRVKQGLP
Cap.g.ATCC_3362  --------MKEQTTEIAVLLLTWYA-AHKRELPWRGAGNPYYIWLSEVILQQTRVAQGLP
L.bl.MED217]In   ------------MLNFSKKLIHWYL-QNKRELPWRQTKDPYRIWLSEIILQQTRVEQGMP
D.d.MED134]In    -------------MSFSNKLITWYL-EHKRDMPWRNTTHPYHIWLSEIILQQTRVAQGLP
F.ba.HTCC2170]I  -------------MIFSQKILHWYA-QNKRNLPWRSTKDPYRIWLSEIMLQQTRVSQGLP
K.al.OT-1]In     -------------MNFSKEIIQWYF-QNKRDLPWRKTKDPYRIWLSEIMLQQTRVAQGLP
Po.irgensii      -------------MKFSNTLVYWYL-QNNRELPWRKSKNPYFIWLSEIMLQQTRVAQGLG
Po.s._MED152]In  -------------MKFSNTLIFWYL-QNKRDLPWRKTKNPYFIWLSEIMLQQTRVAQGLD
Cr.at.HTCC2559]  ---------MQKDLNFSKILINWYL-KYKRDLPWRHTTDPYFIWLSEIMLQQTQVAQGLP
Z.pr.SM-A87]In   -------------MNFSKTLINWYL-KSRRELPWRETTNPYNIWLSEIMLQQTRIEQGLP
G.f.KT0803]In    -------------MVLSNRLTHWYL-QNKRDLPWRKTHEPYHIWLSEIMLQQTRIEQGLP
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
GOS_1526010      ------------------------------------------------------------
Ps.to.ATCC_7007  ----------------------------------------KSAIMINGKFGGTLPSNIED
Can.P.amoebophi  YFNRWMQAFPSIEALAIASLEEVIKAWEGLGYYSRARHLHQGAQYLVEHCQGELPADEKE
ChlD/UW-3/CX]_O  YFLKWMERFPTLQDLAQARESDVVQLWEGLGYYSRARNLLAGARVITEIFGGEIPNDLAL
Chl.trachomatis  YFLKWMERFPTLQDLAQARESDVVQLWEGLGYYSRARNLLAGARVITEIFGGEIPNDLAL
Chl434/Bu]_Out   YFLKWMERFPTLQDLAQARESDVVQLWEGLGYYSRARNLLAGARVITEIFGGEIPNDLAL
Chl70]Out        YFLKWMERFPTLQDLAQARESDVVQLWEGLGYYSRARNLLAGARVITEIFGGEIPNDLAL
S.r.DSM_13855]I  YYHRFLEAFPTVEALADADRDTVLKHWEGLGFYARARHLHTAAQHVVDEHDGTVPSTMDA
Chi.pi.DSM_2588  YYEKFILNYPTVQELAAAPEEAVFRLWQGLGYYARCKNMLAAAKQIASQYHGHFPNTYET
Pr.ti.CRIS_5C-B  YWERFMHRFPHVEDLAAATQDEVLRLWQGLGYYSRARHLHEAAKQVVAL--GHFPCTMSE
M.m.ATCC_23134]  YYQKFVETYPLVQDLASADEQNVLRLWQGLGYYSRARNLHTAAKFVHHERGGVFPESYQE
Cap.g.ATCC_3362  YYQRFVEQFPTVEALAQAPEAQVLKVWQGLGYYSRAKNLQRAAQYITEELQGVFPSTYET
L.bl.MED217]In   YYFSFVETYPDVKALADAPEDDVLKLWQGLGYYSRARNLHATAKKVAYEHKGIFPDTYKE
D.d.MED134]In    YYIAFTEAFPTVQDLAQATEEEVLKLWQGLGYYSRGRNLHASAKMIVEEMDGVFPNTYEE
F.ba.HTCC2170]I  YYLKFTEHFPTVNELAGASEEQVLKLWQGLGYYSRARNLHTTAKTVVNEYHGKFPNTYIE
K.al.OT-1]In     YYEKFTEAFPTVYDLANAEESQVLKLWQGLGYYSRARNLHYTAKDIVENYNGQFPSTYKA
Po.irgensii      YYLKFTSTFPTVFDLAKAEESTVLKMWQGLGYYSRARNLHFSAKHIAQELNGEFPTSYAE
Po.s._MED152]In  YYQKFTTNFPTVFDLANADESTVLKMWQGLGYYSRARNLHFSAKQIVSDFNGEFPSTFKD
Cr.at.HTCC2559]  YYLKFTETYPTVFHLAKASQEEVLKNWQGLGYYSRARNLHETAKYVANERDGKFPEDYKG
Z.pr.SM-A87]In   YYNKFIAEFPSVFDLADASQDKVMKLWQGLGYYSRARNLHATAKHVAYELNGEFPKDYNG
G.f.KT0803]In    YYNKFIQAYPSVFDLANATPEEVLKLWQGLGYYSRARNLHETAKYVAFELNGKFPGTYKG
                                                                             


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
GOS_1526010      -----------SNAIMAIAFNKKIIPLDGNVERILKRVFYLKKEKEISKENLHQKKMFFG
Ps.to.ATCC_7007  LKSLPGVGDYTSTAIMAIAFNQKFIPLDGNVERILKRVLYLRSEKAISKENMQISKKFFG
Can.P.amoebophi  LKKIKGLGPYTIGAILSFAFHQKKAAVDGNVLRVLARYFQIEEDIAKTSTIKKLRDFAES
ChlD/UW-3/CX]_O  LSSIKGIGSYTANAILAFAFKQKNPAVDGNVLRVMSRLFAIEESIDRMNTRREITGLCES
Chl.trachomatis  LSSIKGIGSYTANAILAFAFKQKNPAVDGNVLRVMSRLFAIEESIDRMNTRREITRLCES
Chl434/Bu]_Out   LSSIKGIGSYTANAILAFAFKQKNPAVDGNVLRVMSRLFAIEESIDRMNTRREITGLCES
Chl70]Out        LSSIKGIGSYTANAILAFAFKQKNPAVDGNVLRVMSRLFAIEESIDRMNTRREITGLCES
S.r.DSM_13855]I  IKDLKGVGPYTAAAVLSIAYRKPHAVLDGNVTRVLSRVFAVDEDATTSAAEGHLRDLANE
Chi.pi.DSM_2588  IQSLKGVGPYTSAAIASFAFNLPHAVLDGNVFRVLSRFFDIDTPIDTTAGKKQFTDLAQE
Pr.ti.CRIS_5C-B  LKAMKGVGDYTAAAIGSIAFGLPVAVVDGNVYRVLSRYFGISTPINTTEGQKEFVDLAQS
M.m.ATCC_23134]  LLKMKGVGDYTASAIASFAYNEKVAVVDGNVFRVLARVFGIDTDIASHKGAKEFGALAKS
Cap.g.ATCC_3362  LLKLKGVGEYTASAIASICYNEPKAVVDGNVYRVLSRIFDIDTPINTTEGAKYFKELAQE
L.bl.MED217]In   LKKLKGVGDYTASAIASICFDEAAAVVDGNVYRVLSRIFGIDTPINSTPGAKEFKALAQE
D.d.MED134]In    IKKLKGVGDYTASAIASICFNEPTAVVDGNVYRVLSRVYGIDTPINSTAGIKEFKALAQE
F.ba.HTCC2170]I  LLKLKGVGDYTASAIASICFDEPEPVVDGNVYRVLSRYFGVDIPINGTKGVKYFKELAKE
K.al.OT-1]In     LLKLKGVGDYTASAIASICFDEVAPVVDGNVYRVLSRYFDIDTPINSTEGIKKFKELAFE
Po.irgensii      IIKLKGIGDYTASAIASICFNEPTAVVDGNVYRVLSRYFGIKTATNSASGIKEFKTLAQT
Po.s._MED152]In  IIKLKGVGDYTASAIASIAFNEPTAVVDGNVYRVLSRYFGINTPINSSKGIKEFKELAQS
Cr.at.HTCC2559]  LLRLKGVGDYTASAIASICYNEPVAVVDGNVYRVLSRYFGIETPINSTKGIKEFKAMAEL
Z.pr.SM-A87]In   LLKLKGVGDYTASAIASISYKEPVAVVDGNVYRVLSRYFNIDTPINSTEGVKEFKALAME
G.f.KT0803]In    LLKLKGVGDYTASAIASICYNEPVAVVDGNVYRVLSRIFGIDTPINSAAGIKEFKLLAQE
                              #############################################  


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
GOS_1526010      --ETIRASDYAQAIMEIGALICKPSNPLCYQCPISTNCKSLKKN---DFEIIKINKFNKQ
Ps.to.ATCC_7007  L--SERASDYAQAIMELGALVCRPTFPLCDKCPIRINCISYKRK---DFSLIKKTKKNKI
Can.P.amoebophi  ILPDEESWISSEALIELGATICS-RKAICQECPLKSNCQSYLHGLSDKLPIKTKAIKTQY
ChlD/UW-3/CX]_O  LLPDQDPQVIAESFIELGARICK-KQPLCEQCPLRSFCTAYRQGTMEQYPVRNTRAAISR
Chl.trachomatis  LLPDQDPQVIAESFIELGARICK-KQPLCEQCPLRSFCTAYRQGTMEQYPVRNTRVAISR
Chl434/Bu]_Out   LLPDQDPQVIAESFIELGARICK-KQPLCEQCPLRSFCTAYRQGTMEQYPVRNTRAAISR
Chl70]Out        LLPDQDPQVIAESFIELGARICK-KQPLCEQCPLRSFCTAYRQGTMEQYPVRNTRAAISR
S.r.DSM_13855]I  LLDPDRPGDFNQAMMELGALVCTPRTPHCDRCPLNAVCRAHDAGTEEDYPITPESEPVPH
Chi.pi.DSM_2588  LLPHGKSASYNQSIMDFGAVVCKPQQPACKSCPLAAKCKGYQQGLTALLPVKSKKLVIKK
Pr.ti.CRIS_5C-B  LLPTSAPSAYNQAIMDFGAIQCTPTSPRCLICPLADSCEALRSGKTAELPVKLRKLKIKK
M.m.ATCC_23134]  LLPDEHTDAYNQGIMEFGALQCTPQKPDCMYCPLQTHCVAYAQGKQKELPVKIKKIKVKH
Cap.g.ATCC_3362  LLDKERAGEYNQAIMDFGALQCKPQSPDCESCILSAKCLAYHRKKVTQRPVKIAKIKPIH
L.bl.MED217]In   LIDEKDPATFNQAIMEFGATQCKPKNPYCLHCPFNEGCIAFQQGKISDLPVKKGKIKVRD
D.d.MED134]In    LIDENRPADFNQAIMEFGAIQCKPQNPYCLHCIYNHSCVALQQNKVSELPVKLKKTKVKH
F.ba.HTCC2170]I  VMNVENIRDYNQGIMEFGAIQCAPKNPDCSVCPLNEGCVALKKNIIKELPIKINKTKIKN
K.al.OT-1]In     VVDHDDPANFNQAIMEFGAVQCKPQNPYCIICPLHESCEGLKNQRVDMLPVKLKKTKVKK
Po.irgensii      LIDPSQPGTYNQALMDFGALHCKPQNPLCVSCPFSDSCVALEKKLTKELPVKDKKIKVKK
Po.s._MED152]In  LIDKSQPGTFNQAIMDFGAIQCKPKKPFCMFCPFSESCVALQKNLIEVLPVKEKKVKVKK
Cr.at.HTCC2559]  LLDENQPALFNQAIMEFGARHCKPKNPFCDTCPFSDSCKALQDDNVLSLPVKLKKTTIKK
Z.pr.SM-A87]In   LLDKKDPSNFNQALMEFGALQCKPKNPLCDSCPFNTSCLALKEDKIGDLPVKIKKGKIKN
G.f.KT0803]In    LLDKNDPATFNQAIMEFGALHCKPQKPKCEICPFNDSCLALKNDKIKELPVKLKKNKVKK
                       #################   ##############                    


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
GOS_1526010      KFFEANIFQNKQNNYY---LLKNRKFNFLKDMPIFPMNEIPKTKFKNHLGKRINIKMSNM
Ps.to.ATCC_7007  KYFEANIYMNENKLL----LVRNNKFNFLKNLLIFPMNEIDKSKFNSSPKVKTKIKISNI
Can.P.amoebophi  LYRAVAIVKCGDYFL----VKKGKKGEIMSDLYEFPFFEVSQEGITFKEL-QENIKLHWN
ChlD/UW-3/CX]_O  LFRAVVIVLYKDQVL----MTKREEKEIMAGLYEFPYYQLPKEDCCDIEKITHLVQKDYG
Chl.trachomatis  LFRAVVIVLYKDQVL----MTKREEKEIMAGLYEFPYYQLPKEDCCDIEKITHLVQKDYG
Chl434/Bu]_Out   LFRAVVIVLYKDQVL----MTKREEKEIMAGLYEFPYYQLPKEDCCDIEKIIHLVQKDYG
Chl70]Out        LFRAVVIVLYKDQVL----MTKREEKEIMAGLYEFPYYQLPKEDCCDIEKITHLVQKDYG
S.r.DSM_13855]I  EDIAVGLVFDDNDRLL---IQRRPDEGLLGGLWEFPGGKQEGDESMEAACRREVREELGV
Chi.pi.DSM_2588  RYFYYLVLQHKENVY----IRKRTENDIWQNLHEFILIETPGPEDPGSLL-SSAAFKAVM
Pr.ti.CRIS_5C-B  RHFSYIYLRCQGMTA----FHKRSAGDIWQGLWE-PLLIENADLP------VFSAPLSLI
M.m.ATCC_23134]  RYFHYLLFFYKNNGQTFVAMKQRGSQDIWGGLYDFWLEEQPKLLSAIDLLDVINLPQAQL
Cap.g.ATCC_3362  RYFHYCVLKDSQGNTQ---LHKREAKDIWQGLYEFPLIEVKENTTEAQVIETIRAQYPHT
L.bl.MED217]In   RFFNYLIFITPDGQTM---LQQREGKGIWRGLFDFPLLETEKDLPEARFRESVNSLKITT
D.d.MED134]In    KYFHYLYIKDKQEQTI---IKQRTGKGIWQGLYEFPVIEELAALQEGEGD-RFRESVKNH
F.ba.HTCC2170]I  RYFNYLVFLDANNRTL---LRQRKGKGIWQNLWEFPLLETNGKINIDELGGKHHNVVSLN
K.al.OT-1]In     RWFNYLVVVSNASETL---LEKRKGKGIWQGLYQFPLLETETSIETIADY-QSEIEEIIK
Po.irgensii      RYFNFLVIKTANNKTI---LTERTGKGIWQGLYQFPLIECEKTVNQKEII-DSEEFANLF
Po.s._MED152]In  RYFNYLVVKTKDDKTI---LTERKGKGIWQGLYQFPLLEDTHMITKEELL-ASEMFNELF
Cr.at.HTCC2559]  RYLNYIVLLSDNENTQ---IKQRVGKGIWQGLYEFPCIETKKDISETEFLSLFKASDISN
Z.pr.SM-A87]In   RYFNYMVFSSEENKTL---LQQRKGKGIWYGLYEFPLIETKSDIQEAKIIEENNEFQHLM
G.f.KT0803]In    RYFNYLVFNHENETTI---LEQRVGKGIWNGLYQFPLVESERLIDEKELV-TFEAFKNSI
                                       ############                          


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
GOS_1526010      D------MKI---AINMKNNLPENSD----------GFF-------------------IN
Ps.to.ATCC_7007  D------MN----IVINKNKIKSTNK----------GLI-------------------LN
Can.P.amoebophi  L------------TVHLLQSLSSIEH--GFTRYQARLDP---CVFNCLEMSPVKDLEWLD
ChlD/UW-3/CX]_O  E------------TLHFVSSLPSQKQ--VFTRYRVTLFP---HVFYTKYSLPNS----YT
Chl.trachomatis  E------------TLHFVSSLPSQKQ--VFTRYRVTLFP---HVFYTKYSLPNS----YT
Chl434/Bu]_Out   E------------TLHFVSSLPSQKQ--VFTRYRVTLFP---HVFYTKYSLPNS----YT
Chl70]Out        E------------TLHFVSSLPSQKQ--VFTRYRVTLFP---HVFYTKYSLPNS----YT
S.r.DSM_13855]I  G------MT----DVEPF--YTLSHA--YSHFKITLHAFRGRLADGPPEAREDQPFRWVT
Chi.pi.DSM_2588  K------D-----IRYNMDGASATFKQQLTHQTIHSQFL---LLSVSKKPEIPG-YTAVP
Pr.ti.CRIS_5C-B  K-------------------KGVKHV--LTHRVLTADFY---LVELNQRPSLPEDYIWIP
M.m.ATCC_23134]  -------------KKMVIGKESVIYKHILTHQRIQAKFH---HIEVKPAQK-DL----PM
Cap.g.ATCC_3362  -------------TYIKKYATEFLHK--LTHQHLHTCFW---EVEVAEVLS-DG----LP
L.bl.MED217]In   KEKSIRFSDLPVEEVILQQRDPIIHK--LSHQKLHVKFW---VVKLSEAPGLQT----IA
D.d.MED134]In    P----LLQDLVINDIDRYNNTPIVHK--LSHQHLHTTFW---IVTVDEITD-NA----TP
F.ba.HTCC2170]I  E----------APKIYEFNQEDIVHK--LSHQHLHTKFW---ILKTKTKFK-DG----IG
K.al.OT-1]In     I------KDF---SVTKFNEKEMIHK--LSHQHLYTTFW---IVETTDSLK-NG----IS
Po.irgensii      P------DET---TLSLFNSKEIVHK--LSHQHLYTQFW---IVETKTLKN-AD----IL
Po.s._MED152]In  P------NDV---SISLFNKKDIVHK--LSHQHLYTQFW---VIETEQLTS-AN----IS
Cr.at.HTCC2559]  D----INENY---NVSLFNDASIVHK--LSHQHLYTKFW---IVRVSTL-N-DG----IP
Z.pr.SM-A87]In   E-----AKNP---SVSLYNDQPIIHK--LSHQHIYARFW---LVDVQKLPK-GG----IS
G.f.KT0803]In    T-----GSGV---ELELFNEIPVIHK--LSHQHLITRFW---VVNSGTASE-NS----VK
                                                                             


                        370       380       390       400       410
                 =========+=========+=========+=========+=========+====
GOS_1526010      VKDLSNW--------TL----PSFTKKILNTI-----K----------------
Ps.to.ATCC_7007  RKKIVSE--------VI----PSFTKKLFRVA-----SSNV-------------
Can.P.amoebophi  TKSLKQK--------AFSSGHRRIFQSLL--------SLDID------------
ChlD/UW-3/CX]_O  LAELSSL--------PSSSGHRRIKETFLVEY-----HKSLEKMVSCSGD---K
Chl.trachomatis  LAELSSL--------PSSSGHRRIKETFLVEY-----HKSLEK----DGKLFWR
Chl434/Bu]_Out   LAELSSL--------PSSSGHRRIKETFLVEY-----HKSLEK----DGKLFWR
Chl70]Out        LAELSSL--------PSSSGHRRIKETFLVEY-----HKSLEK----DGKLFWR
S.r.DSM_13855]I  VDELDDY--------AF----PRANRRLIEELVRRQTEPSLFD-----------
Chi.pi.DSM_2588  RDQLDLY--------AF----PKTITDFLRNR-----ELTLF------------
Pr.ti.CRIS_5C-B  EDELDQY--------AL----PRLIEILLASL-----PA---------------
M.m.ATCC_23134]  FDKLRFYEVNEVAALPK----PVLIDNYLNKD-----FF---------------
Cap.g.ATCC_3362  IRELVHY--------PM----PALLIKFLKKE-----KI---------------
L.bl.MED217]In   YERLGDF--------AV----PRVIDRFMEDF-----DFKDFL-----------
D.d.MED134]In    INRITEL--------PV----PVLIGNFIEKL-----L----------------
F.ba.HTCC2170]I  FNELDKF--------PV----PVLIADFIKTF-----KI---------------
K.al.OT-1]In     LQEIRTY--------PV----PILIGNFIEEF-----NF---------------
Po.irgensii      WENIQDF--------PV----PVLIANFLKAF-----EIVK-------------
Po.s._MED152]In  WKNIEDY--------PV----PVLIANFLEDF-----KLKN-------------
Cr.at.HTCC2559]  THQLKDY--------PV----PVLIARFLEDF-----SF---------------
Z.pr.SM-A87]In   AEKVKEY--------PV----PVLIQNFLNEI-----DIENL------------
G.f.KT0803]In    LKNVTDY--------PV----PVLIENFLNEY-----LPDGYK-----------
                                                                       






Parameters used
Minimum Number Of Sequences For A Conserved Position: 11
Minimum Number Of Sequences For A Flanking Position: 18
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes


Flank positions of the 4 selected block(s)
Flanks: [134  178]  [187  203]  [207  220]  [263  274]  

New number of positions in input.fasta-gb:  88  (21% of the original 414 positions)







Protein Domains

PROTOCOL


InterPro default parameters.


RESULTS ANALYSIS


The best result is poor, is e value is too high, by this we can´t, with sure of it, determine the

function of it.


HMMSmart SM00525 FES 68 88 0.48 T 18-Mar-2010 IPR003651 Endonuclease III-like,

iron-sulphur cluster loop motif

Molecular Function: endonuclease activity (GO:0004519),

Molecular Function: 4 iron, 4 sulfur cluster binding (GO:0051539)



The DNA repair enzyme MutY as an important role in the prevention of DNA mutations

is also responsible for recognition and removal of the inappropriately inserted adenine in an

A_8-oxoG mispair that can cause mutation on the nucleus of mitochondrias being a good corrector of damages for this organelle.


So the E value is very high (5e-18) and that's not good, we like it lower since the porpotion of sequences that can be compared with this one decrease with the decrease of this valor, and with this we can say, that it has a catalytic activity, at least that's what we can say without any sures of it, since we olny use E value as a base of certainty.

RAW RESULTS

Translation	F4810822A39987BB	204	HMMSmart	SM00525	FES	68	88	0.48	T	18-Mar-2010	IPR003651	Endonuclease III-like, iron-sulphur cluster loop motif	Molecular Function: endonuclease activity (GO:0004519), Molecular Function: 4 iron, 4 sulfur cluster binding (GO:0051539)
Translation	F4810822A39987BB	204	Gene3D	G3DSA:1.10.1670.10	no description	7	105	2.1e-18	T	18-Mar-2010	NULL	NULL	
Translation	F4810822A39987BB	204	superfamily	SSF48150	DNA-glycosylase	2	100	5.9e-18	T	18-Mar-2010	IPR011257	DNA glycosylase	Molecular Function: catalytic activity (GO:0003824), Biological Process: DNA repair (GO:0006281)
Translation	F4810822A39987BB	204	PatternScan	PS00764	ENDONUCLEASE_III_1	69	85	NA	T	18-Mar-2010	IPR004035	Endonuclease III, iron-sulphur binding site	Molecular Function: endonuclease activity (GO:0004519), Biological Process: DNA repair (GO:0006281)
Translation	F4810822A39987BB	204	HMMPanther	PTHR10359:SF1	A/G-SPECIFIC ADENINE GLYCOSYLASE MUTY	2	86	9.9e-19	T	18-Mar-2010	NULL	NULL	
Translation	F4810822A39987BB	204	HMMPanther	PTHR10359	A/G-SPECIFIC ADENINE GLYCOSYLASE/ENDONUCLEASE III	2	86	9.9e-19	T	18-Mar-2010	NULL	NULL	

Phylogeny

PROTOCOL


Phylogeny.fr/"a la carte"/BioNJ method and Phyml method/Bootstraps: 100/ out group:[chlamydias]


RESULTS ANALYSIS


Both trees are concordant, saying that the closest organism to the Gos sequence is Psychroflexus_torquis, in both the location of this node, that has a valor of 1 - maximum score for a node - varies showing us a real In group in the BioNJ and a kind of out group in the Phyml tree.


Both Out/In groups seem to be correct, except that little problem with the node of the Gos sequence in the Phyml tree.

RAW RESULTS


Tree by BioNJ; Bootstraps: 100

                                                                                                         ----0.1---
 
                           +---------------------------------Candidatus_Protochlamydia_amoebophila_UWE25_Out [chlamydias]
                 0.87      |
           +---------------+                                +-Chlamydia_trachomatis_6276_Out [chlamydias]
           |               |                                |
           |               |               1                |Chlamydia_trachomatis_D/UW-3/CX_Out [chlamydias]
           |               +--------------------------------+
           |                                                |Chlamydia_trachomatis_434/Bu_Out [chlamydias]
       1   |                                                |
 +---------+                                                |
 |         |                                                +Chlamydia_trachomatis_70_Out [chlamydias]
 |         |
 |         |       +------------------------------------Salinibacter_ruber_DSM_13855_In [CFB group bacteria]
 |         |       |
 |         |       |              +------------------------Chitinophaga_pinensis_DSM_2588_In [CFB group bacteria]
 |         +-------+              |
 |                 |              |       +------------------------------Microscilla_marina_ATCC_23134_In [CFB group bacteria]
 |                 |              |       |
 |                 |   0.92       |       |    +----------------Capnocytophaga_gingivalis_ATCC_33624_In [CFB group bacteria]
 |                 +--------------+       |    |
 |                                |       |    |         +-----------Leeuwenhoekiella_blandensis_MED217_In [CFB group bacteria]
 |                                |       |    |       +-+
 |                                |       |    |       | +---------Dokdonia_donghaensis_MED134_In [CFB group bacteria]
 |                                |       | +--+       |
 |                                +-------+ |  |     +-+
 |                                        | |  |     | |  +-----------------------Flavobacteriales_bacterium_HTCC2170_In [CFB group bacteria]
 |                                        | |  |     | +--+
 |                                        | |  |     |    +-----------Kordia_algicida_OT-1_In [CFB group bacteria]
 |                                        | |  |     |
 |                                        | |  +-----+  +------------Zunongwangia_profunda_SM-A87_In [CFB group bacteria]
 |                                        | |        |  |
 |                                        | |        |+-+ +---------Croceibacter_atlanticus_HTCC2559_In [CFB group bacteria]
 |                                        +-+        || +-+
 |                                          |        ||   +--------Gramella_forsetii_KT0803_In [CFB group bacteria]
 |                                          |        ++
 |                                          |         |   +------------Polaribacter_irgensii_23-P_In [CFB group bacteria]
 |                                          |         +---+
 |                                          |             |
 |                                          |             +-------Polaribacter_sp._MED152_In [CFB group bacteria]
 |                                          |
 |                                          +---------------------Prevotella_timonensis_CRIS_5C-B1_In [CFB group bacteria]
 |
 |                           1                                     +-------------GOS_1526010
 +-----------------------------------------------------------------+
                                                                   +--------------Psychroflexus_torquis_ATCC_700755_In [CFB group bacteria]


Tree by Phyml; Bootstraps: 100

 
                                1                                         +--------GOS_1526010
 +------------------------------------------------------------------------+
 |                                                                        +---------Psychroflexus_torquis_ATCC_700755_In [CFB group bacteria]
 |
 |        +------------------------Salinibacter_ruber_DSM_13855_In [CFB group bacteria]
 |        |
 |        |                                 +----------------------Candidatus_Protochlamydia_amoebophila_UWE25_Out [chlamydias]
 |        |                                 |
 |   1    |              0.86               |
 +--------+       +-------------------------+                        +-Chlamydia_trachomatis_6276_Out [chlamydias]
          |       |                         |        0.97            |
          |       |                         +------------------------+Chlamydia_trachomatis_D/UW-3/CX_Out [chlamydias]
          |       |                                                  |
          |       |                                                  |Chlamydia_trachomatis_434/Bu_Out [chlamydias]
          +-------+                                                  |
                  |                                                  +Chlamydia_trachomatis_70_Out [chlamydias]
                  |
                  |                  +-----------Chitinophaga_pinensis_DSM_2588_In [CFB group bacteria]
                  |                  |
                  |      0.83        |        +------------Prevotella_timonensis_CRIS_5C-B1_In [CFB group bacteria]
                  +------------------+        |
                                     |        |         +---------------------------Microscilla_marina_ATCC_23134_In [CFB group bacteria]
                                     |        |         |
                                     +--------+     +---+
                                              |     |   +-------Capnocytophaga_gingivalis_ATCC_33624_In [CFB group bacteria]
                                              |     |
                                              |     |         +---------Polaribacter_irgensii_23-P_In [CFB group bacteria]
                                              +-----+      +--+
                                                    |      |  +--Polaribacter_sp._MED152_In [CFB group bacteria]
                                                    |      |
                                                    |      |     +---------------Flavobacteriales_bacterium_HTCC2170_In [CFB group bacteria]
                                                    +------+ +---+
                                                           | |   +------Kordia_algicida_OT-1_In [CFB group bacteria]
                                                           | |
                                                           | |  +---------Leeuwenhoekiella_blandensis_MED217_In [CFB group bacteria]
                                                           +-++-+
                                                             || |
                                                             || +-----Dokdonia_donghaensis_MED134_In [CFB group bacteria]
                                                             ++
                                                              |   +--------Zunongwangia_profunda_SM-A87_In [CFB group bacteria]
                                                              +---+
                                                                  | +-----Croceibacter_atlanticus_HTCC2559_In [CFB group bacteria]
                                                                  +-+
                                                                    +-------Gramella_forsetii_KT0803_In [CFB group bacteria]

Taxonomy report

PROTOCOL


BLASTp versus NR, NCBI default parameters apart from "Number of descriptions_1000"



RESULTS ANALYSIS


Best result we had was, Psychroflexus torquis ATCC 700755.


Recent studies indicate, with comparisons of profiles of fatty acids used as stone base, that this organism belong to a different group of the family Flavobacteriaceae. The differences are so strong that we can talk in diferent genus or even a new specie when refering to this organism -(in Psychroflexus torquis Bowman et al. 1999, sp. nov. (Type species of the genus)).



The results from the lineage report aren't solid we have may diferent families in the various organisms between the first results altough some of them share the class Flavobacteriaceae as they family, we can garantee that they belong to the CFB group bacteria, at leat the first twenty or so, if we concentrate in the score its obivious that there is an enormous difference between the first and the remaining results, Psychroflexus torquis is from the CFB group but it's a diferent kind of organism.


RAW RESULTS

Lineage Report

root
. cellular organisms
. . Bacteria           [bacteria]
. . . Bacteroidetes      [CFB group bacteria]
. . . . Flavobacteriales   [CFB group bacteria]
. . . . . Flavobacteriaceae  [CFB group bacteria]
. . . . . . Psychroflexus torquis ATCC 700755 --------------------------  211  3 hits [CFB group bacteria]    A/G-specific adenine glycosylase [Psychroflexus torquis ATC
. . . . . . Zunongwangia profunda SM-A87 ...............................   72  2 hits [CFB group bacteria]    A/G-specific adenine glycosylase [Zunongwangia profunda SM-
. . . . . . Capnocytophaga gingivalis ATCC 33624 .......................   70  2 hits [CFB group bacteria]    A/G-specific adenine glycosylase [Capnocytophaga gingivalis
. . . . . . Polaribacter irgensii 23-P .................................   70  2 hits [CFB group bacteria]    putative A/G-specific adenine glycosylase [Polaribacter irg
. . . . . . Dokdonia donghaensis MED134 ................................   67  2 hits [CFB group bacteria]    putative A/G-specific adenine glycosylase [Dokdonia donghae
. . . . . . Polaribacter sp. MED152 ....................................   67  2 hits [CFB group bacteria]    HhH-GPD superfamily base excision DNA repair protein [Polar
. . . . . . Leeuwenhoekiella blandensis MED217 .........................   66  2 hits [CFB group bacteria]    putative A/G-specific adenine glycosylase [Leeuwenhoekiella
. . . . . . Croceibacter atlanticus HTCC2559 ...........................   64  2 hits [CFB group bacteria]    putative A/G-specific adenine glycosylase [Croceibacter atl
. . . . . . Kordia algicida OT-1 .......................................   63  2 hits [CFB group bacteria]    A/G-specific adenine glycosylase [Kordia algicida OT-1] >gi
. . . . . . Gramella forsetii KT0803 ...................................   63  2 hits [CFB group bacteria]    A/G-specific adenine glycosylase [Gramella forsetii KT0803]
. . . . . Flavobacteriales bacterium HTCC2170 --------------------------   71  2 hits [CFB group bacteria]    A/G-specific adenine glycosylase [Flavobacteriales bacteriu
. . . . . Flavobacteriales bacterium ALC-1 .............................   65  2 hits [CFB group bacteria]    putative A/G-specific adenine glycosylase [Flavobacteriales
. . . . Bacteroides vulgatus EK4.2 -------------------------------------   76  2 hits [CFB group bacteria]    A/G-specific adenine glycosylase MutY [Enterococcus faecali
. . . . Salinibacter ruber DSM 13855 ...................................   74  2 hits [CFB group bacteria]    A/G-specific adenine glycosylase [Salinibacter ruber DSM 13
. . . . Salinibacter ruber .............................................   74  2 hits [CFB group bacteria]    A/G-specific adenine glycosylase [Salinibacter ruber DSM 13
. . . . Chitinophaga pinensis DSM 2588 .................................   70  2 hits [CFB group bacteria]    A/G-specific adenine glycosylase [Chitinophaga pinensis DSM
. . . . Prevotella timonensis CRIS 5C-B1 ...............................   66  2 hits [CFB group bacteria]    A/G-specific adenine glycosylase [Prevotella timonensis CRI
. . . . Bacteroides sp. D20 ............................................   65  2 hits [CFB group bacteria]    conserved hypothetical protein [Bacteroides sp. D20] >gi|27
. . . . Microscilla marina ATCC 23134 ..................................   64  2 hits [CFB group bacteria]    A/G-specific adenine glycosylase [Microscilla marina ATCC 2
. . . . Prevotella sp. oral taxon 299 str. F0039 .......................   64  2 hits [CFB group bacteria]    A/G-specific adenine glycosylase [Prevotella sp. oral taxon
. . . Candidatus Pelagibacter ubique HTCC1002 --------------------------  204  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Candidatus Pelagibacter u
. . . Candidatus Pelagibacter ubique HTCC1062 ..........................  203  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Candidatus Pelagibacter u
. . . Candidatus Pelagibacter sp. HTCC7211 .............................  193  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Candidatus Pelagibacter s
. . . Maricaulis maris MCS10 ...........................................   92  2 hits [a-proteobacteria]      A/G-specific DNA-adenine glycosylase [Maricaulis maris MCS1
. . . Staphylococcus aureus 04-02981 ...................................   91  1 hit  [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus 04-
. . . Staphylococcus aureus subsp. aureus Mu50 .........................   90  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus subsp. aureus N315 .........................   90  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus subsp. aureus JH9 ..........................   90  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus subsp. aureus JH1 ..........................   90  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus subsp. aureus Mu3 ..........................   90  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus subsp. aureus str. CF-Marseille ............   90  1 hit  [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus subsp. aureus Mu50-omega ...................   90  1 hit  [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus A9781 ......................................   90  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus A9763 ......................................   90  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus A9719 ......................................   90  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus A9299 ......................................   90  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus A8115 ......................................   90  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus A6300 ......................................   90  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus A6224 ......................................   90  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus A5937 ......................................   90  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus subsp. aureus ED98 .........................   90  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus A8117 ......................................   90  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus A10102 .....................................   90  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus A8819 ......................................   90  1 hit  [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus subsp. aureus TCH130 .......................   90  2 hits [firmicutes]            A/G-specific DNA glycosylase [Staphylococcus aureus subsp. 
. . . Staphylococcus aureus A5948 ......................................   90  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus A59
. . . Rhizobium leguminosarum bv. viciae 3841 ..........................   90  2 hits [a-proteobacteria]      putative A/G-specific adenine glycosylase [Rhizobium legumi
. . . Staphylococcus aureus subsp. aureus MW2 ..........................   90  2 hits [firmicutes]            hypothetical protein MW1808 [Staphylococcus aureus subsp. a
. . . Staphylococcus aureus subsp. aureus MSSA476 ......................   90  2 hits [firmicutes]            hypothetical protein MW1808 [Staphylococcus aureus subsp. a
. . . Staphylococcus aureus subsp. aureus TCH70 ........................   90  2 hits [firmicutes]            hypothetical protein MW1808 [Staphylococcus aureus subsp. a
. . . Staphylococcus aureus subsp. aureus USA300_TCH959 ................   90  2 hits [firmicutes]            A/G-specific DNA glycosylase [Staphylococcus aureus subsp. 
. . . Ochrobactrum intermedium LMG 3301 ................................   89  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Ochrobactrum intermedium 
. . . Rhizobium leguminosarum bv. trifolii WSM1325 .....................   89  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Rhizobium leguminosarum b
. . . Staphylococcus aureus subsp. aureus COL ..........................   89  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus subsp. aureus USA300_FPR3757 ...............   89  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus subsp. aureus NCTC 8325 ....................   89  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus subsp. aureus str. Newman ..................   89  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus subsp. aureus USA300_TCH1516 ...............   89  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus subsp. aureus str. JKD6008 .................   89  1 hit  [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus subsp. aureus str. JKD6009 .................   89  1 hit  [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus D30 ........................................   89  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus 930918-3 ...................................   89  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus subsp. aureus 132 ..........................   89  1 hit  [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus A9754 ......................................   89  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus subsp. aureus TW20 .........................   89  1 hit  [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus A9765 ......................................   89  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus A97
. . . Thermus aquaticus Y51MC23 ........................................   88  2 hits [bacteria]              HhH-GPD family protein [Thermus aquaticus Y51MC23] >gi|2182
. . . Agrobacterium vitis S4 ...........................................   88  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Agrobacterium vitis S4] >
. . . Agrobacterium tumefaciens str. C58 ...............................   88  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Agrobacterium tumefaciens
. . . Mesorhizobium opportunistum WSM2075 ..............................   88  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Mesorhizobium opportunist
. . . Mesorhizobium loti MAFF303099 ....................................   88  2 hits [a-proteobacteria]      adenine glycosylase [Mesorhizobium loti MAFF303099] >gi|140
. . . Bartonella grahamii as4aup .......................................   88  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase MutY [Bartonella grahamii 
. . . alpha proteobacterium BAL199 .....................................   87  2 hits [a-proteobacteria]      A/G-specific DNA glycosylase [alpha proteobacterium BAL199]
. . . Staphylococcus aureus A9635 ......................................   87  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus A96
. . . Staphylococcus aureus subsp. aureus D139 .........................   87  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus subsp. aureus H19 ..........................   87  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus subsp. aureus ST398 ........................   87  1 hit  [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Rhodobacterales bacterium HTCC2255 ...............................   86  2 hits [a-proteobacteria]      Putative mutY, A/G-specific adenine glycosylase [alpha prot
. . . Staphylococcus aureus subsp. aureus Btn1260 ......................   86  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus aureus sub
. . . Staphylococcus aureus subsp. aureus MRSA252 ......................   86  2 hits [firmicutes]            HhH-GPD superfamily base excision DNA repair protein [Staph
. . . Staphylococcus aureus subsp. aureus MN8 ..........................   86  2 hits [firmicutes]            HhH-GPD superfamily base excision DNA repair protein [Staph
. . . Staphylococcus aureus subsp. aureus TCH60 ........................   86  2 hits [firmicutes]            HhH-GPD superfamily base excision DNA repair protein [Staph
. . . Staphylococcus aureus subsp. aureus 55/2053 ......................   86  2 hits [firmicutes]            HhH-GPD superfamily base excision DNA repair protein [Staph
. . . Staphylococcus aureus subsp. aureus 65-1322 ......................   86  2 hits [firmicutes]            HhH-GPD superfamily base excision DNA repair protein [Staph
. . . Staphylococcus aureus subsp. aureus 68-397 .......................   86  2 hits [firmicutes]            HhH-GPD superfamily base excision DNA repair protein [Staph
. . . Staphylococcus aureus subsp. aureus E1410 ........................   86  2 hits [firmicutes]            HhH-GPD superfamily base excision DNA repair protein [Staph
. . . Staphylococcus aureus subsp. aureus M876 .........................   86  2 hits [firmicutes]            HhH-GPD superfamily base excision DNA repair protein [Staph
. . . Staphylococcus aureus subsp. aureus C160 .........................   86  2 hits [firmicutes]            HhH-GPD superfamily base excision DNA repair protein [Staph
. . . Staphylococcus aureus subsp. aureus WW2703/97 ....................   86  2 hits [firmicutes]            HhH-GPD superfamily base excision DNA repair protein [Staph
. . . Staphylococcus aureus subsp. aureus WBG10049 .....................   86  2 hits [firmicutes]            HhH-GPD superfamily base excision DNA repair protein [Staph
. . . Staphylococcus aureus subsp. aureus M899 .........................   86  2 hits [firmicutes]            HhH-GPD superfamily base excision DNA repair protein [Staph
. . . Staphylococcus aureus subsp. aureus C427 .........................   86  2 hits [firmicutes]            HhH-GPD superfamily base excision DNA repair protein [Staph
. . . Staphylococcus aureus subsp. aureus C101 .........................   86  2 hits [firmicutes]            HhH-GPD superfamily base excision DNA repair protein [Staph
. . . Staphylococcus aureus subsp. aureus A017934/97 ...................   86  2 hits [firmicutes]            HhH-GPD superfamily base excision DNA repair protein [Staph
. . . Staphylococcus aureus subsp. aureus 58-424 .......................   86  2 hits [firmicutes]            HhH-GPD superfamily base excision DNA repair protein [Staph
. . . Staphylococcus aureus subsp. aureus M809 .........................   86  2 hits [firmicutes]            HhH-GPD superfamily base excision DNA repair protein [Staph
. . . Staphylococcus aureus subsp. aureus M1015 ........................   86  2 hits [firmicutes]            HhH-GPD superfamily base excision DNA repair protein [Staph
. . . Staphylococcus aureus subsp. aureus EMRSA16 ......................   86  1 hit  [firmicutes]            HhH-GPD superfamily base excision DNA repair protein [Staph
. . . Hyphomicrobium denitrificans ATCC 51888 ..........................   86  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Hyphomicrobium denitrific
. . . Brucella abortus bv. 4 str. 292 ..................................   86  3 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella abortus bv. 4 st
. . . Brucella abortus bv. 2 str. 86/8/59 ..............................   86  3 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella abortus bv. 4 st
. . . Brucella abortus bv. 1 str. 9-941 ................................   86  2 hits [a-proteobacteria]      MutY, A/G-specific adenine glycosylase [Brucella abortus bv
. . . Brucella melitensis biovar Abortus 2308 ..........................   86  2 hits [a-proteobacteria]      MutY, A/G-specific adenine glycosylase [Brucella abortus bv
. . . Brucella abortus str. 2308 A .....................................   86  2 hits [a-proteobacteria]      MutY, A/G-specific adenine glycosylase [Brucella abortus bv
. . . Brucella abortus bv. 6 str. 870 ..................................   86  3 hits [a-proteobacteria]      MutY, A/G-specific adenine glycosylase [Brucella abortus bv
. . . Brucella abortus bv. 3 str. Tulya ................................   86  3 hits [a-proteobacteria]      MutY, A/G-specific adenine glycosylase [Brucella abortus bv
. . . Brucella abortus bv. 9 str. C68 ..................................   86  3 hits [a-proteobacteria]      MutY, A/G-specific adenine glycosylase [Brucella abortus bv
. . . Brucella abortus S19 .............................................   85  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella abortus S19] >gi
. . . Brucella abortus NCTC 8038 .......................................   85  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella abortus S19] >gi
. . . Rhodomicrobium vannielii ATCC 17100 ..............................   85  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Rhodomicrobium vannielii 
. . . Rhizobium etli CFN 42 ............................................   85  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase protein [Rhizobium etli CF
. . . Agrobacterium radiobacter K84 ....................................   85  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Agrobacterium radiobacter
. . . Rhizobium etli Brasil 5 ..........................................   85  1 hit  [a-proteobacteria]      A/G-specific adenine glycosylase protein [Rhizobium etli Br
. . . Brucella sp. 83/13 ...............................................   85  3 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella sp. 83/13] >gi|2
. . . Brucella suis ATCC 23445 .........................................   84  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella suis ATCC 23445]
. . . Brucella ceti str. Cudo ..........................................   84  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella suis ATCC 23445]
. . . Brucella melitensis ATCC 23457 ...................................   84  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella suis ATCC 23445]
. . . Brucella suis bv. 5 str. 513 .....................................   84  3 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella suis ATCC 23445]
. . . Brucella pinnipedialis M163/99/10 ................................   84  3 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella suis ATCC 23445]
. . . Brucella pinnipedialis B2/94 .....................................   84  3 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella suis ATCC 23445]
. . . Brucella pinnipedialis M292/94/1 .................................   84  3 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella suis ATCC 23445]
. . . Brucella melitensis bv. 1 str. Rev.1 .............................   84  3 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella suis ATCC 23445]
. . . Brucella neotomae 5K33 ...........................................   84  3 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella suis ATCC 23445]
. . . Brucella melitensis bv. 3 str. Ether .............................   84  3 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella suis ATCC 23445]
. . . Brucella ceti M490/95/1 ..........................................   84  3 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella suis ATCC 23445]
. . . Brucella ceti B1/94 ..............................................   84  3 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella suis ATCC 23445]
. . . Brucella microti CCM 4915 ........................................   84  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella suis ATCC 23445]
. . . Brucella sp. F5/99 ...............................................   84  3 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella suis ATCC 23445]
. . . Brucella sp. NVSL 07-0026 ........................................   84  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella suis ATCC 23445]
. . . Staphylococcus aureus RF122 ......................................   84  2 hits [firmicutes]            A/G-specific adenine glycosylase DNA repair protein [Staphy
. . . Brucella ovis ATCC 25840 .........................................   84  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella ovis ATCC 25840]
. . . Brucella ceti M644/93/1 ..........................................   84  3 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella ceti M644/93/1] 
. . . Brucella ceti M13/05/1 ...........................................   84  3 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella ceti M644/93/1] 
. . . Sphingopyxis alaskensis RB2256 ...................................   84  2 hits [a-proteobacteria]      HhH-GPD [Sphingopyxis alaskensis RB2256] >gi|98977824|gb|AB
. . . Brucella melitensis bv. 1 str. 16M ...............................   84  4 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella melitensis 16M] 
. . . Brucella melitensis bv. 2 str. 63/9 ..............................   84  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella melitensis 16M] 
. . . Rhizobium leguminosarum bv. trifolii WSM2304 .....................   84  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Rhizobium leguminosarum b
. . . Methylocella silvestris BL2 ......................................   84  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Methylocella silvestris B
. . . Rhizobium etli CIAT 652 ..........................................   84  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase protein [Rhizobium etli CI
. . . Brucella suis 1330 ...............................................   83  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella suis 1330] >gi|2
. . . Brucella suis bv. 3 str. 686 .....................................   83  3 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella suis 1330] >gi|2
. . . Brucella canis ATCC 23365 ........................................   83  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella canis ATCC 23365
. . . Brucella suis bv. 4 str. 40 ......................................   83  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brucella suis bv. 4 str. 
. . . Ruegeria sp. R11 .................................................   83  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Ruegeria sp. R11] >gi|214
. . . Gluconobacter oxydans 621H .......................................   82  2 hits [a-proteobacteria]      A/G-specific adenine DNA glycosylase [Gluconobacter oxydans
. . . Thermus thermophilus HB27 ........................................   82  2 hits [bacteria]              A/G-specific adenine DNA glycosylase [Thermus thermophilus 
. . . Rhodopseudomonas palustris HaA2 ..................................   82  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Rhodopseudomonas palustri
. . . Rhodopseudomonas palustris BisA53 ................................   82  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Rhodopseudomonas palustri
. . . Phaeobacter gallaeciensis 2.10 ...................................   81  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Phaeobacter gallaeciensis
. . . Staphylococcus epidermidis W23144 ................................   81  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus epidermidi
. . . Xanthobacter autotrophicus Py2 ...................................   81  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Xanthobacter autotrophicu
. . . Staphylococcus haemolyticus JCSC1435 .............................   81  2 hits [firmicutes]            hypothetical protein SH1093 [Staphylococcus haemolyticus JC
. . . Desulfitobacterium hafniense Y51 .................................   81  2 hits [firmicutes]            hypothetical protein DSY3260 [Desulfitobacterium hafniense 
. . . Desulfitobacterium hafniense DCB-2 ...............................   81  2 hits [firmicutes]            hypothetical protein DSY3260 [Desulfitobacterium hafniense 
. . . Magnetospirillum gryphiswaldense MSR-1 ...........................   81  1 hit  [a-proteobacteria]      A/G-specific adenine glycosylase MutY [Magnetospirillum gry
. . . Bartonella tribocorum CIP 105476 .................................   81  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase MutY [Bartonella tribocoru
. . . Phaeobacter gallaeciensis BS107 ..................................   80  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Phaeobacter gallaeciensis
. . . Azorhizobium caulinodans ORS 571 .................................   80  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Azorhizobium caulinodans 
. . . Sinorhizobium meliloti 1021 ......................................   80  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase protein [Sinorhizobium mel
. . . Sulfitobacter sp. EE-36 ..........................................   80  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Sulfitobacter sp. EE-36] 
. . . Thermus thermophilus HB8 .........................................   80  2 hits [bacteria]              A/G-specific adenine glycosylase (MutY) [Thermus thermophil
. . . Loktanella vestfoldensis SKA53 ...................................   80  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Loktanella vestfoldensis 
. . . Rhizobium sp. NGR234 .............................................   80  2 hits [a-proteobacteria]      putative A/G-specific adenine glycosylase [Rhizobium sp. NG
. . . Pelobacter carbinolicus DSM 2380 .................................   80  2 hits [d-proteobacteria]      A/G-specific adenine glycosylase [Pelobacter carbinolicus D
. . . Magnetospirillum magnetotacticum MS-1 ............................   80  1 hit  [a-proteobacteria]      COG1194: A/G-specific DNA glycosylase [Magnetospirillum mag
. . . Rhodopseudomonas palustris BisB18 ................................   79  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Rhodopseudomonas palustri
. . . Staphylococcus epidermidis M23864:W2(grey) .......................   79  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus epidermidi
. . . Staphylococcus epidermidis ATCC 12228 ............................   79  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus epidermidi
. . . Staphylococcus epidermidis RP62A .................................   79  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus epidermidi
. . . Staphylococcus epidermidis SK135 .................................   79  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus epidermidi
. . . Sulfitobacter sp. NAS-14.1 .......................................   79  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Sulfitobacter sp. NAS-14.
. . . Candidatus Liberibacter asiaticus str. psy62 .....................   79  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Candidatus Liberibacter a
. . . Rhodobacter sphaeroides 2.4.1 ....................................   78  2 hits [a-proteobacteria]      A/G-specific DNA-adenine glycosylase [Rhodobacter sphaeroid
. . . Sphingobium japonicum UT26S ......................................   78  2 hits [a-proteobacteria]      A/G-specific DNA glycosylase [Sphingobium japonicum UT26S] 
. . . Staphylococcus epidermidis BCM-HMP0060 ...........................   78  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus epidermidi
. . . Rhodopseudomonas palustris BisB5 .................................   78  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Rhodopseudomonas palustri
. . . Octadecabacter antarcticus 238 ...................................   78  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Octadecabacter antarcticu
. . . Lactococcus lactis subsp. lactis KF147 ...........................   78  2 hits [firmicutes]            A/G-specific adenine DNA glycosylase [Lactococcus lactis su
. . . Aurantimonas manganoxydans SI85-9A1 ..............................   78  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Aurantimonas manganoxydan
. . . Lactococcus lactis subsp. lactis Il1403 ..........................   78  2 hits [firmicutes]            A/G-specific adenine glycosylase [Lactococcus lactis subsp.
. . . Acinetobacter johnsonii SH046 ....................................   78  2 hits [g-proteobacteria]      A/G specific adenine glycosylase [Acinetobacter johnsonii S
. . . Ochrobactrum anthropi ATCC 49188 .................................   78  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Ochrobactrum anthropi ATC
. . . Fulvimarina pelagi HTCC2506 ......................................   77  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase protein [Fulvimarina pelag
. . . Magnetospirillum magneticum AMB-1 ................................   77  2 hits [a-proteobacteria]      A/G-specific DNA glycosylase [Magnetospirillum magneticum A
. . . Enterococcus faecalis V583 .......................................   77  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus faecalis V58
. . . Gluconacetobacter diazotrophicus PAl 5 ...........................   77  4 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Gluconacetobacter diazotr
. . . Rhodobacter sphaeroides KD131 ....................................   77  2 hits [a-proteobacteria]      A/G-specific DNA-adenine glycosylase [Rhodobacter sphaeroid
. . . Lactococcus lactis subsp. cremoris SK11 ..........................   77  2 hits [firmicutes]            A/G-specific adenine glycosylase [Lactococcus lactis subsp.
. . . Sinorhizobium medicae WSM419 .....................................   77  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Sinorhizobium medicae WSM
. . . Enterococcus faecalis HIP11704 ...................................   77  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecali
. . . Octadecabacter antarcticus 307 ...................................   77  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Octadecabacter antarcticu
. . . Azospirillum sp. B510 ............................................   77  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Azospirillum sp. B510] >g
. . . Meiothermus ruber DSM 1279 .......................................   77  2 hits [bacteria]              A/G-specific adenine glycosylase [Meiothermus ruber DSM 127
. . . Enterococcus sp. 7L76 ............................................   76  1 hit  [firmicutes]            A/G-specific DNA-adenine glycosylase [Enterococcus sp. 7L76]
. . . Enterococcus faecalis Fly1 .......................................   76  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecali
. . . Enterococcus faecalis T11 ........................................   76  2 hits [firmicutes]            A/G-specific adenine glycosylase mutY [Enterococcus faecali
. . . Enterococcus faecalis HH22 .......................................   76  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus faecalis HH2
. . . Roseobacter sp. GAI101 ...........................................   76  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Roseobacter sp. GAI101] >
. . . Anoxybacillus flavithermus WK1 ...................................   76  2 hits [firmicutes]            A/G-specific adenine glycosylase [Anoxybacillus flavithermu
. . . Enterococcus faecalis JH1 ........................................   76  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecali
. . . Enterococcus faecalis D6 .........................................   76  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecali
. . . Enterococcus faecalis ATCC 29200 .................................   76  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus faecalis ATC
. . . Enterococcus faecalis TUSoD Ef11 .................................   76  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus faecalis ATC
. . . Enterococcus faecalis T1 .........................................   76  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus faecalis ATC
. . . Enterococcus faecalis DS5 ........................................   76  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus faecalis ATC
. . . Enterococcus faecalis E1Sol ......................................   76  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecali
. . . Enterococcus faecalis Merz96 .....................................   76  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecali
. . . Enterococcus faecalis R712 .......................................   76  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecali
. . . Enterococcus faecalis S613 .......................................   76  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecali
. . . Enterococcus faecalis T3 .........................................   76  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecali
. . . Enterococcus faecalis T8 .........................................   76  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus faecalis T8]
. . . Methylobacterium radiotolerans JCM 2831 ..........................   76  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Methylobacterium radiotol
. . . Enterococcus faecalis X98 ........................................   76  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus faecalis X98
. . . Oceanibulbus indolifex HEL-45 ....................................   76  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase, putative [Oceanibulbus in
. . . Enterococcus faecalis CH188 ......................................   76  2 hits [firmicutes]            A/G-specific adenine glycosylase mutY [Enterococcus faecali
. . . Bartonella bacilliformis KC583 ...................................   76  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Bartonella bacilliformis 
. . . gamma proteobacterium HTCC5015 ...................................   76  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [gamma proteobacterium HTC
. . . Jannaschia sp. CCS1 ..............................................   76  2 hits [a-proteobacteria]      A/G-specific DNA-adenine glycosylase [Jannaschia sp. CCS1] 
. . . Acinetobacter baumannii ATCC 19606 ...............................   75  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Acinetobacter baumannii A
. . . Bradyrhizobium sp. BTAi1 .........................................   75  2 hits [a-proteobacteria]      A/G-specific DNA-adenine glycosylase [Bradyrhizobium sp. BT
. . . Staphylococcus lugdunensis HKU09-01 ..............................   75  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus lugdunensi
. . . Staphylococcus hominis SK119 .....................................   75  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus hominis SK
. . . Rhodobacter sphaeroides ATCC 17029 ...............................   75  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Rhodobacter sphaeroides A
. . . Roseovarius sp. 217 ..............................................   75  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Roseovarius sp. 217] >gi|
. . . Enterococcus faecalis TX0104 .....................................   75  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus faecalis TX0
. . . Enterococcus faecalis ARO1/DG ....................................   75  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus faecalis TX0
. . . Syntrophus aciditrophicus SB .....................................   75  2 hits [d-proteobacteria]      a/g-specific DNA glycosylase [Syntrophus aciditrophicus SB]
. . . Bacillus sp. B14905 ..............................................   75  2 hits [firmicutes]            adenine glycosylase [Bacillus sp. B14905] >gi|126593838|gb|
. . . Oceanicaulis alexandrii HTCC2633 .................................   75  2 hits [a-proteobacteria]      hypothetical protein OA2633_14171 [Oceanicaulis alexandrii 
. . . Roseobacter sp. SK209-2-6 ........................................   75  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Roseobacter sp. SK209-2-6
. . . Lactococcus lactis subsp. cremoris MG1363 ........................   75  2 hits [firmicutes]            A/G-specific adenine glycosylase [Lactococcus lactis subsp.
. . . Bradyrhizobium sp. ORS278 ........................................   75  2 hits [a-proteobacteria]      adenine glycosylase mutY [Bradyrhizobium sp. ORS278] >gi|14
. . . Bacillus selenitireducens MLS10 ..................................   75  2 hits [firmicutes]            A/G-specific DNA glycosylase-like protein [Bacillus selenit
. . . Rhodobacterales bacterium HTCC2150 ...............................   75  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Rhodobacterales bacterium
. . . Paracoccus denitrificans PD1222 ..................................   75  2 hits [a-proteobacteria]      HhH-GPD family protein [Paracoccus denitrificans PD1222] >g
. . . Bdellovibrio bacteriovorus HD100 .................................   75  2 hits [d-proteobacteria]      A/G-specific adenine glycosylase [Bdellovibrio bacteriovoru
. . . Acinetobacter sp. RUH2624 ........................................   75  2 hits [g-proteobacteria]      A/G specific adenine glycosylase [Acinetobacter sp. RUH2624
. . . Oceanobacillus iheyensis HTE831 ..................................   75  2 hits [firmicutes]            A/G-specific adenine glycosylase [Oceanobacillus iheyensis 
. . . Acinetobacter calcoaceticus RUH2202 ..............................   75  2 hits [g-proteobacteria]      A/G specific adenine glycosylase [Acinetobacter calcoacetic
. . . Roseobacter sp. MED193 ...........................................   75  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Roseobacter sp. MED193] >
. . . Legionella pneumophila subsp. pneumophila str. Philadelphia 1 ....   75  2 hits [g-proteobacteria]      A/G specific adenine glycosylase [Legionella pneumophila su
. . . Legionella pneumophila str. Paris ................................   75  2 hits [g-proteobacteria]      A/G specific adenine glycosylase [Legionella pneumophila su
. . . Acinetobacter baumannii SDF ......................................   75  1 hit  [g-proteobacteria]      A/G specific adenine glycosylase [Acinetobacter baumannii S
. . . Acinetobacter baumannii AYE ......................................   75  1 hit  [g-proteobacteria]      A/G specific adenine glycosylase [Acinetobacter baumannii S
. . . Acinetobacter baumannii AB0057 ...................................   75  2 hits [g-proteobacteria]      A/G specific adenine glycosylase [Acinetobacter baumannii S
. . . Acinetobacter baumannii AB307-0294 ...............................   75  2 hits [g-proteobacteria]      A/G specific adenine glycosylase [Acinetobacter baumannii S
. . . Acinetobacter sp. 6013113 ........................................   75  1 hit  [g-proteobacteria]      A/G specific adenine glycosylase [Acinetobacter baumannii S
. . . Acinetobacter sp. 6013150 ........................................   75  1 hit  [g-proteobacteria]      A/G specific adenine glycosylase [Acinetobacter baumannii S
. . . Acinetobacter baumannii ..........................................   75  2 hits [g-proteobacteria]      A/G specific adenine glycosylase [Acinetobacter baumannii S
. . . Acinetobacter baumannii ATCC 17978 ...............................   75  2 hits [g-proteobacteria]      A/G specific adenine glycosylase [Acinetobacter baumannii A
. . . Bradyrhizobium japonicum USDA 110 ................................   75  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Bradyrhizobium japonicum 
. . . Acinetobacter sp. SH024 ..........................................   75  2 hits [g-proteobacteria]      conserved hypothetical protein [Acinetobacter sp. SH024] >g
. . . Acinetobacter sp. 6014059 ........................................   74  1 hit  [g-proteobacteria]      A/G specific adenine glycosylase [Acinetobacter sp. 6014059]
. . . Acinetobacter baumannii AB900 ....................................   74  1 hit  [g-proteobacteria]      A/G-specific DNA glycosylase [Acinetobacter baumannii AB900]
. . . Acinetobacter baumannii ACICU ....................................   74  2 hits [g-proteobacteria]      A/G-specific DNA glycosylase [Acinetobacter baumannii ACICU
. . . Brevundimonas sp. BAL3 ...........................................   74  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brevundimonas sp. BAL3] >
. . . Thalassiobium sp. R2A62 ..........................................   74  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Thalassiobium sp. R2A62] 
. . . Enterococcus faecalis TX1322 .....................................   74  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus faecalis TX1
. . . Methylobacterium nodulans ORS 2060 ...............................   74  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Methylobacterium nodulans
. . . Lysinibacillus sphaericus C3-41 ..................................   74  2 hits [firmicutes]            A/G-specific adenine DNA glycosylase [Lysinibacillus sphaer
. . . Rhodobacterales bacterium HTCC2654 ...............................   74  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Rhodobacterales bacterium
. . . Rhodopseudomonas palustris TIE-1 .................................   74  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Rhodopseudomonas palustri
. . . Legionella pneumophila str. Corby ................................   74  2 hits [g-proteobacteria]      A/G specific adenine glycosylase [Legionella pneumophila st
. . . Paenibacillus larvae subsp. larvae BRL-230010 ....................   74  1 hit  [firmicutes]            A/G-specific adenine glycosylase [Paenibacillus larvae subs
. . . Dinoroseobacter shibae DFL 12 ....................................   74  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Dinoroseobacter shibae DF
. . . Labrenzia aggregata IAM 12614 ....................................   74  2 hits [a-proteobacteria]      probable a/g-specific adenine glycosylase protein [Stappia 
. . . Rhodopseudomonas palustris CGA009 ................................   74  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Rhodopseudomonas palustri
. . . alpha proteobacterium HIMB114 ....................................   74  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [alpha proteobacterium HIM
. . . Legionella pneumophila str. Lens .................................   74  2 hits [g-proteobacteria]      hypothetical protein lpl0930 [Legionella pneumophila str. L
. . . Caulobacter sp. K31 ..............................................   74  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Caulobacter sp. K31] >gi|
. . . Enterococcus faecalis T2 .........................................   74  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecali
. . . Nitrobacter sp. Nb-311A ..........................................   74  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase MutY [Nitrobacter sp. Nb-3
. . . Methylobacterium sp. 4-46 ........................................   74  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Methylobacterium sp. 4-46
. . . Brevundimonas subvibrioides ATCC 15264 ...........................   73  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Brevundimonas subvibrioid
. . . Enterococcus faecalis ATCC 4200 ..................................   73  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecali
. . . beta proteobacterium KB13 ........................................   73  2 hits [b-proteobacteria]      A/G-specific adenine glycosylase [beta proteobacterium KB13
. . . Rhodobacteraceae bacterium KLH11 .................................   73  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Rhodobacteraceae bacteriu
. . . Phenylobacterium zucineum HLK1 ...................................   73  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Phenylobacterium zucineum
. . . Staphylococcus capitis SK14 ......................................   73  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus capitis SK
. . . Caulobacter segnis ATCC 21756 ....................................   73  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Caulobacter segnis ATCC 2
. . . Wolinella succinogenes DSM 1740 ..................................   73  1 hit  [e-proteobacteria]      A/G-specific adenine glycosylase [Wolinella succinogenes DS
. . . Wolinella succinogenes ...........................................   73  1 hit  [e-proteobacteria]      A/G-specific adenine glycosylase [Wolinella succinogenes DS
. . . Silicibacter sp. TrichCH4B .......................................   73  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Silicibacter sp. TrichCH4
. . . Enterococcus casseliflavus EC30 ..................................   73  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus casseliflavu
. . . Enterococcus casseliflavus EC10 ..................................   73  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus casseliflavu
. . . Zymomonas mobilis subsp. mobilis ZM4 .............................   73  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Zymomonas mobilis subsp. 
. . . Zymomonas mobilis subsp. mobilis NCIMB 11163 .....................   73  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Zymomonas mobilis subsp. 
. . . Ruegeria sp. TM1040 ..............................................   73  2 hits [a-proteobacteria]      A/G-specific DNA-adenine glycosylase [Ruegeria sp. TM1040] 
. . . Rhodobacterales bacterium HTCC2083 ...............................   73  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Rhodobacterales bacterium
. . . Acinetobacter sp. ADP1 ...........................................   72  2 hits [g-proteobacteria]      A/G specific adenine glycosylase [Acinetobacter sp. ADP1] >
. . . Geobacillus sp. Y412MC10 .........................................   72  2 hits [firmicutes]            A/G-specific adenine glycosylase [Geobacillus sp. Y412MC10]
. . . Enterococcus casseliflavus EC20 ..................................   72  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus casseliflavu
. . . Nitrobacter winogradskyi Nb-255 ..................................   72  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase MutY [Nitrobacter winograd
. . . Neisseria lactamica ATCC 23970 ...................................   72  2 hits [b-proteobacteria]      A/G-specific adenine glycosylase [Neisseria lactamica ATCC 
. . . Bacillus sp. NRRL B-14911 ........................................   72  2 hits [firmicutes]            YfhQ [Bacillus sp. NRRL B-14911] >gi|89085127|gb|EAR64260.1
. . . Roseobacter denitrificans OCh 114 ................................   72  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase, putative [Roseobacter den
. . . Oligotropha carboxidovorans OM5 ..................................   72  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Oligotropha carboxidovora
. . . Bacillus amyloliquefaciens FZB42 .................................   72  2 hits [firmicutes]            YfhQ [Bacillus amyloliquefaciens FZB42] >gi|154351177|gb|AB
. . . Parvibaculum lavamentivorans DS-1 ................................   72  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Parvibaculum lavamentivor
. . . Staphylococcus epidermidis M23864:W1 .............................   72  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus epidermidi
. . . Symbiobacterium thermophilum IAM 14863 ...........................   72  2 hits [firmicutes]            A/G-specific adenine glycosylase [Symbiobacterium thermophi
. . . Desulfovibrio vulgaris RCH1 ......................................   72  2 hits [d-proteobacteria]      A/G-specific adenine glycosylase [Desulfovibrio vulgaris RC
. . . Caulobacter crescentus CB15 ......................................   72  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Caulobacter crescentus CB
. . . Caulobacter crescentus NA1000 ....................................   72  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Caulobacter crescentus CB
. . . Desulfovibrio vulgaris DP4 .......................................   72  2 hits [d-proteobacteria]      A/G-specific adenine glycosylase [Desulfovibrio vulgaris su
. . . Desulfovibrio vulgaris str. Hildenborough ........................   72  2 hits [d-proteobacteria]      A/G-specific adenine glycosylase [Desulfovibrio vulgaris su
. . . Lentisphaera araneosa HTCC2155 ...................................   72  2 hits [bacteria]              adenine glycosylase [Lentisphaera araneosa HTCC2155] >gi|14
. . . Bacillus pumilus ATCC 7061 .......................................   72  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus pumilus ATCC 706
. . . Acidaminococcus fermentans DSM 20731 .............................   72  2 hits [firmicutes]            A/G-specific adenine glycosylase [Acidaminococcus fermentan
. . . Sagittula stellata E-37 ..........................................   72  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Sagittula stellata E-37] 
. . . Rhizobium etli CIAT 894 ..........................................   72  1 hit  [a-proteobacteria]      A/G-specific adenine glycosylase [Rhizobium etli CIAT 894]
. . . Halothiobacillus neapolitanus c2 .................................   72  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Halothiobacillus neapolit
. . . Roseobacter litoralis Och 149 ....................................   72  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase, putative [Roseobacter lit
. . . Zymomonas mobilis subsp. mobilis ATCC 10988 ......................   71  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Zymomonas mobilis subsp. 
. . . Acinetobacter lwoffii SH145 ......................................   71  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Acinetobacter lwoffii SH1
. . . Paenibacillus sp. JDR-2 ..........................................   71  2 hits [firmicutes]            A/G-specific adenine glycosylase [Paenibacillus sp. JDR-2] 
. . . Idiomarina baltica OS145 .........................................   71  2 hits [g-proteobacteria]      A/G-specific DNA glycosylase [Idiomarina baltica OS145] >gi
. . . Paenibacillus sp. oral taxon 786 str. D14 ........................   71  2 hits [firmicutes]            A/G-specific adenine glycosylase [Paenibacillus sp. oral ta
. . . Reinekea blandensis MED297 .......................................   71  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Reinekea sp. MED297] >gi|
. . . Staphylococcus warneri L37603 ....................................   71  2 hits [firmicutes]            A/G-specific adenine glycosylase [Staphylococcus warneri L3
. . . Rhodopseudomonas palustris DX-1 ..................................   71  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Rhodopseudomonas palustri
. . . Nitrobacter hamburgensis X14 .....................................   71  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Nitrobacter hamburgensis 
. . . Legionella longbeachae NSW150 ....................................   71  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Legionella longbeachae NS
. . . Legionella longbeachae D-4968 ....................................   71  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Legionella longbeachae D-
. . . Bacillus cereus Rock3-44 .........................................   71  2 hits [firmicutes]            hypothetical protein bcere0022_4230 [Bacillus cereus Rock3-
. . . Enterococcus faecium 1,231,501 ...................................   71  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus faecium 1,23
. . . Acinetobacter junii SH205 ........................................   71  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Acinetobacter junii SH205
. . . Roseovarius sp. TM1035 ...........................................   71  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Roseovarius sp. TM1035] >
. . . Enterococcus faecium DO ..........................................   71  3 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecium
. . . Enterococcus faecium 1,230,933 ...................................   71  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecium
. . . Enterococcus faecium 1,231,502 ...................................   71  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecium
. . . Enterococcus faecium 1,231,410 ...................................   71  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecium
. . . Enterococcus faecium 1,231,408 ...................................   71  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecium
. . . Enterococcus faecium C68 .........................................   71  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecium
. . . Enterococcus faecium TC 6 ........................................   71  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecium
. . . Enterococcus faecium D344SRF .....................................   71  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecium
. . . Enterococcus faecium E1162 .......................................   71  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecium
. . . Enterococcus faecium E1636 .......................................   71  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecium
. . . Enterococcus faecium E1679 .......................................   71  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecium
. . . Enterococcus faecium U0317 .......................................   71  2 hits [firmicutes]            A/G-specific adenine glycosylase MutY [Enterococcus faecium
. . . Staphylococcus carnosus subsp. carnosus TM300 ....................   71  2 hits [firmicutes]            putative A/G-specific adenine glycosylase [Staphylococcus c
. . . Acinetobacter haemolyticus ATCC 19194 ............................   71  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Acinetobacter haemolyticu
. . . Enterococcus faecium E1039 .......................................   70  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus faecium E103
. . . Enterococcus faecium E980 ........................................   70  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus faecium E103
. . . Enterococcus faecium E1071 .......................................   70  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus faecium E107
. . . Bacillus clausii KSM-K16 .........................................   70  2 hits [firmicutes]            A/G-specific adenine DNA glycosylase [Bacillus clausii KSM-
. . . Acinetobacter sp. ATCC 27244 .....................................   70  2 hits [g-proteobacteria]      A/G specific adenine glycosylase [Acinetobacter sp. ATCC 27
. . . Erythrobacter sp. SD-21 ..........................................   70  2 hits [a-proteobacteria]      hypothetical protein ED21_29994 [Erythrobacter sp. SD-21] >
. . . Bacillus pumilus SAFR-032 ........................................   70  2 hits [firmicutes]            adenine glycosylase [Bacillus pumilus SAFR-032] >gi|1576803
. . . Rhodospirillum centenum SW .......................................   70  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Rhodospirillum centenum S
. . . Enterococcus faecium Com15 .......................................   70  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus faecium Com1
. . . Neisseria gonorrhoeae NCCP11945 ..................................   70  2 hits [b-proteobacteria]      putative adenine glycosylase [Neisseria gonorrhoeae NCCP119
. . . Neisseria gonorrhoeae 35/02 ......................................   70  3 hits [b-proteobacteria]      putative adenine glycosylase [Neisseria gonorrhoeae NCCP119
. . . Neisseria gonorrhoeae PID332 .....................................   70  3 hits [b-proteobacteria]      putative adenine glycosylase [Neisseria gonorrhoeae NCCP119
. . . Neisseria gonorrhoeae SK-92-679 ..................................   70  3 hits [b-proteobacteria]      putative adenine glycosylase [Neisseria gonorrhoeae NCCP119
. . . Oceanicola granulosus HTCC2516 ...................................   70  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Oceanicola granulosus HTC
. . . Neisseria gonorrhoeae PID18 ......................................   70  3 hits [b-proteobacteria]      putative adenine glycosylase [Neisseria gonorrhoeae PID18]
. . . Bacillus subtilis subsp. natto BEST195 ...........................   70  1 hit  [firmicutes]            hypothetical protein [Bacillus subtilis subsp. natto BEST19
. . . Bacillus subtilis subsp. subtilis str. 168 .......................   70  3 hits [firmicutes]            A/G-specific adenine glycosylase or DNA-(apurinic or apyrim
. . . Bacillus subtilis subsp. subtilis str. NCIB 3610 .................   70  1 hit  [firmicutes]            A/G-specific adenine glycosylase or DNA-(apurinic or apyrim
. . . Bacillus subtilis subsp. subtilis str. JH642 .....................   70  1 hit  [firmicutes]            A/G-specific adenine glycosylase or DNA-(apurinic or apyrim
. . . Bacillus subtilis subsp. subtilis str. SMY .......................   70  1 hit  [firmicutes]            A/G-specific adenine glycosylase or DNA-(apurinic or apyrim
. . . Bacillus subtilis ................................................   70  2 hits [firmicutes]            A/G-specific adenine glycosylase or DNA-(apurinic or apyrim
. . . Neisseria gonorrhoeae DGI18 ......................................   70  1 hit  [b-proteobacteria]      putative adenine glycosylase [Neisseria gonorrhoeae DGI18] 
. . . Neisseria gonorrhoeae FA6140 .....................................   70  1 hit  [b-proteobacteria]      putative adenine glycosylase [Neisseria gonorrhoeae DGI18] 
. . . Neisseria gonorrhoeae FA19 .......................................   70  3 hits [b-proteobacteria]      putative adenine glycosylase [Neisseria gonorrhoeae DGI18] 
. . . Neisseria gonorrhoeae MS11 .......................................   70  3 hits [b-proteobacteria]      putative adenine glycosylase [Neisseria gonorrhoeae DGI18] 
. . . Neisseria gonorrhoeae PID1 .......................................   70  3 hits [b-proteobacteria]      putative adenine glycosylase [Neisseria gonorrhoeae DGI18] 
. . . Neisseria gonorrhoeae PID24-1 ....................................   70  1 hit  [b-proteobacteria]      putative adenine glycosylase [Neisseria gonorrhoeae DGI18] 
. . . Neisseria gonorrhoeae SK-93-1035 .................................   70  3 hits [b-proteobacteria]      putative adenine glycosylase [Neisseria gonorrhoeae DGI18] 
. . . Veillonella parvula ATCC 17745 ...................................   70  2 hits [firmicutes]            A/G-specific adenine glycosylase [Veillonella parvula ATCC 
. . . Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)' ........   70  2 hits [spirochetes]           putative A/G-specific DNA glycosylase [Leptospira biflexa s
. . . Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)' .........   70  2 hits [spirochetes]           putative A/G-specific DNA glycosylase [Leptospira biflexa s
. . . Oceanicola batsensis HTCC2597 ....................................   70  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Oceanicola batsensis HTCC
. . . Chelativorans sp. BNC1 ...........................................   70  2 hits [a-proteobacteria]      A/G-specific DNA-adenine glycosylase [Mesorhizobium sp. BNC
. . . Neisseria gonorrhoeae FA 1090 ....................................   70  2 hits [b-proteobacteria]      putative adenine glycosylase [Neisseria gonorrhoeae FA 1090
. . . Neisseria gonorrhoeae 1291 .......................................   70  2 hits [b-proteobacteria]      putative adenine glycosylase [Neisseria gonorrhoeae FA 1090
. . . Neisseria gonorrhoeae F62 ........................................   70  2 hits [b-proteobacteria]      putative adenine glycosylase [Neisseria gonorrhoeae FA 1090
. . . Roseovarius nubinhibens ISM ......................................   70  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Roseovarius nubinhibens I
. . . Neisseria gonorrhoeae DGI2 .......................................   70  3 hits [b-proteobacteria]      putative adenine glycosylase [Neisseria gonorrhoeae DGI2] >
. . . Myxococcus xanthus DK 1622 .......................................   70  2 hits [d-proteobacteria]      A/G-specific adenine glycosylase [Myxococcus xanthus DK 162
. . . Geobacillus sp. WCH70 ............................................   70  2 hits [firmicutes]            A/G-specific adenine glycosylase [Geobacillus sp. WCH70] >g
. . . Neisseria meningitidis alpha14 ...................................   70  2 hits [b-proteobacteria]      A/G-specific adenine glycosylase [Neisseria meningitidis al
. . . Clostridium sp. SS2/1 ............................................   70  2 hits [firmicutes]            hypothetical protein CLOSS21_00537 [Clostridium sp. SS2/1] 
. . . butyrate-producing bacterium SSC/2 ...............................   70  1 hit  [firmicutes]            hypothetical protein CLOSS21_00537 [Clostridium sp. SS2/1] 
. . . Enterococcus faecium Com12 .......................................   70  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus faecium Com1
. . . Enterococcus faecium 1,141,733 ...................................   70  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus faecium 1,14
. . . Enterococcus faecium TX1330 ......................................   70  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus faecium TX13
. . . Enterococcus faecalis PC1.1 ......................................   70  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus faecium TX13
. . . Rhodobacterales bacterium Y4I ....................................   70  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Rhodobacterales bacterium
. . . Veillonella dispar ATCC 17748 ....................................   70  2 hits [firmicutes]            hypothetical protein VEIDISOL_00237 [Veillonella dispar ATC
. . . Neisseria meningitidis 053442 ....................................   70  2 hits [b-proteobacteria]      A/G-specific adenine glycosylase [Neisseria meningitidis 05
. . . Thiomicrospira crunogena XCL-2 ...................................   70  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Thiomicrospira crunogena 
. . . Veillonella sp. 3_1_44 ...........................................   70  2 hits [firmicutes]            A/G-specific adenine glycosylase [Veillonella sp. 3_1_44] >
. . . Candidatus Koribacter versatilis Ellin345 ........................   70  2 hits [bacteria]              A/G-specific DNA glycosylase [Candidatus Koribacter versati
. . . Novosphingobium aromaticivorans DSM 12444 ........................   70  2 hits [a-proteobacteria]      A/G-specific DNA-adenine glycosylase [Novosphingobium aroma
. . . Acidobacterium capsulatum ATCC 51196 .............................   69  2 hits [bacteria]              A/G-specific adenine glycosylase, putative [Acidobacterium 
. . . Rhodobacter sphaeroides ATCC 17025 ...............................   69  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Rhodobacter sphaeroides A
. . . Neisseria cinerea ATCC 14685 .....................................   69  2 hits [b-proteobacteria]      A/G-specific adenine glycosylase [Neisseria cinerea ATCC 14
. . . Bartonella henselae str. Houston-1 ...............................   69  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Bartonella henselae str. 
. . . Bacillus cytotoxicus NVH 391-98 ..................................   69  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus cereus subsp. cy
. . . Sphingomonas sp. SKA58 ...........................................   69  2 hits [a-proteobacteria]      HhH-GPD [Sphingomonas sp. SKA58] >gi|94424304|gb|EAT09327.1
. . . Bacillus pseudomycoides DSM 12442 ................................   69  2 hits [firmicutes]            hypothetical protein bpmyx0001_4160 [Bacillus pseudomycoide
. . . Thioalkalivibrio sp. K90mix ......................................   69  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Thioalkalivibrio sp. K90m
. . . Rhodospirillum rubrum ATCC 11170 .................................   69  2 hits [a-proteobacteria]      A/G-specific DNA-adenine glycosylase [Rhodospirillum rubrum
. . . Desulfococcus oleovorans Hxd3 ....................................   69  2 hits [d-proteobacteria]      A/G-specific adenine glycosylase [Desulfococcus oleovorans 
. . . Magnetococcus sp. MC-1 ...........................................   69  2 hits [proteobacteria]        A/G-specific DNA-adenine glycosylase [Magnetococcus sp. MC-
. . . Acinetobacter radioresistens SK82 ................................   69  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Acinetobacter radioresist
. . . Rhodobacter capsulatus SB1003 ....................................   69  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Rhodobacter capsulatus SB
. . . Bacillus mycoides Rock3-17 .......................................   68  2 hits [firmicutes]            hypothetical protein bmyco0003_4300 [Bacillus mycoides Rock
. . . Bacillus mycoides Rock1-4 ........................................   68  2 hits [firmicutes]            hypothetical protein bmyco0003_4300 [Bacillus mycoides Rock
. . . Acinetobacter radioresistens SH164 ...............................   68  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Acinetobacter radioresist
. . . Xanthomonas campestris pv. campestris str. ATCC 33913 ............   68  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Xanthomonas campestris pv
. . . Xanthomonas campestris pv. campestris str. 8004 ..................   68  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Xanthomonas campestris pv
. . . Bartonella quintana str. Toulouse ................................   68  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Bartonella quintana str. 
. . . Alicyclobacillus acidocaldarius LAA1 .............................   68  2 hits [firmicutes]            A/G-specific adenine glycosylase [Alicyclobacillus acidocal
. . . Xanthomonas campestris pv. campestris str. B100 ..................   68  1 hit  [g-proteobacteria]      A/G-specific adenine glycosylase [Xanthomonas campestris pv
. . . Xanthomonas campestris pv. campestris ............................   68  1 hit  [g-proteobacteria]      A/G-specific adenine glycosylase [Xanthomonas campestris pv
. . . Stigmatella aurantiaca DW4/3-1 ...................................   68  2 hits [d-proteobacteria]      A/G-specific adenine glycosylase [Stigmatella aurantiaca DW
. . . Ruegeria pomeroyi DSS-3 ..........................................   68  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Ruegeria pomeroyi DSS-3] 
. . . Methylobacterium extorquens DM4 ..................................   68  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Methylobacterium extorque
. . . Methylobacterium extorquens AM1 ..................................   68  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Methylobacterium extorque
. . . Roseovarius sp. HTCC2601 .........................................   68  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Roseovarius sp. HTCC2601]
. . . Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 .....   68  2 hits [firmicutes]            putative A G-specific DNA glycosylase [Staphylococcus sapro
. . . Desulfobacterium autotrophicum HRM2 ..............................   68  2 hits [d-proteobacteria]      MutY [Desulfobacterium autotrophicum HRM2] >gi|223694440|gb
. . . Methylobacterium populi BJ001 ....................................   68  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Methylobacterium populi B
. . . Nitratiruptor sp. SB155-2 ........................................   68  2 hits [e-proteobacteria]      A/G-specific adenine glycosylase [Nitratiruptor sp. SB155-2
. . . Methylobacterium chloromethanicum CM4 ............................   68  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Methylobacterium chlorome
. . . Methylobacterium extorquens PA1 ..................................   68  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Methylobacterium extorque
. . . Veillonella parvula DSM 2008 .....................................   68  2 hits [firmicutes]            A/G-specific adenine glycosylase [Veillonella parvula DSM 2
. . . Veillonella sp. 6_1_27 ...........................................   68  2 hits [firmicutes]            A/G-specific adenine glycosylase [Veillonella sp. 6_1_27] >
. . . Anaeromyxobacter sp. Fw109-5 .....................................   68  2 hits [d-proteobacteria]      A/G-specific adenine glycosylase [Anaeromyxobacter sp. Fw10
. . . Bacillus cellulosilyticus DSM 2522 ...............................   68  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus cellulosilyticus
. . . Acetobacter pasteurianus IFO 3283-01 .............................   68  2 hits [a-proteobacteria]      DNA glycosylase A/G-specific MutY [Acetobacter pasteurianus
. . . Acetobacter pasteurianus IFO 3283-03 .............................   68  1 hit  [a-proteobacteria]      DNA glycosylase A/G-specific MutY [Acetobacter pasteurianus
. . . Acetobacter pasteurianus IFO 3283-07 .............................   68  1 hit  [a-proteobacteria]      DNA glycosylase A/G-specific MutY [Acetobacter pasteurianus
. . . Acetobacter pasteurianus IFO 3283-22 .............................   68  1 hit  [a-proteobacteria]      DNA glycosylase A/G-specific MutY [Acetobacter pasteurianus
. . . Acetobacter pasteurianus IFO 3283-26 .............................   68  1 hit  [a-proteobacteria]      DNA glycosylase A/G-specific MutY [Acetobacter pasteurianus
. . . Acetobacter pasteurianus IFO 3283-32 .............................   68  1 hit  [a-proteobacteria]      DNA glycosylase A/G-specific MutY [Acetobacter pasteurianus
. . . Acetobacter pasteurianus IFO 3283-01-42C .........................   68  1 hit  [a-proteobacteria]      DNA glycosylase A/G-specific MutY [Acetobacter pasteurianus
. . . Acetobacter pasteurianus IFO 3283-12 .............................   68  1 hit  [a-proteobacteria]      DNA glycosylase A/G-specific MutY [Acetobacter pasteurianus
. . . Neisseria flavescens NRL30031/H210 ...............................   68  2 hits [b-proteobacteria]      hypothetical protein NEIFLAOT_00801 [Neisseria flavescens N
. . . Legionella drancourtii LLAP12 ....................................   68  2 hits [g-proteobacteria]      A/G specific adenine glycosylase [Legionella drancourtii LL
. . . Neisseria meningitidis ...........................................   68  9 hits [b-proteobacteria]      MutY [Neisseria meningitidis]
. . . Neisseria meningitidis FAM18 .....................................   68  2 hits [b-proteobacteria]      adenine glycosylase [Neisseria meningitidis FAM18] >gi|1208
. . . Brevibacillus brevis NBRC 100599 .................................   68  2 hits [firmicutes]            probable A/G-specific adenine glycosylase [Brevibacillus br
. . . Rhodobacter sp. SW2 ..............................................   67  2 hits [a-proteobacteria]      HhH-GPD family protein [Rhodobacter sp. SW2] >gi|259023520|
. . . Desulfatibacillum alkenivorans AK-01 .............................   67  2 hits [d-proteobacteria]      A/G-specific adenine glycosylase [Desulfatibacillum alkeniv
. . . Desulfuromonas acetoxidans DSM 684 ...............................   67  2 hits [d-proteobacteria]      A/G-specific adenine glycosylase [Desulfuromonas acetoxidan
. . . Geobacillus sp. Y4.1MC1 ..........................................   67  2 hits [firmicutes]            A/G-specific adenine glycosylase [Geobacillus sp. Y4.1MC1] 
. . . Neisseria flavescens SK114 .......................................   67  2 hits [b-proteobacteria]      A/G-specific adenine glycosylase [Neisseria flavescens SK11
. . . Thermosynechococcus elongatus BP-1 ...............................   67  2 hits [cyanobacteria]         adenine glycosylase [Thermosynechococcus elongatus BP-1] >g
. . . Desulfovibrio magneticus RS-1 ....................................   67  2 hits [d-proteobacteria]      A/G-specific adenine glycosylase [Desulfovibrio magneticus 
. . . Bacillus coagulans 36D1 ..........................................   67  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus coagulans 36D1] 
. . . Desulfovibrio sp. FW1012B ........................................   67  2 hits [d-proteobacteria]      A/G-specific adenine glycosylase [Desulfovibrio sp. FW1012B
. . . Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 ....   67  2 hits [firmicutes]            A/G-specific adenine glycosylase [Alicyclobacillus acidocal
. . . Geobacillus thermoglucosidasius C56-YS93 .........................   67  1 hit  [firmicutes]            A/G-specific adenine glycosylase [Geobacillus thermoglucosi
. . . Prochlorococcus marinus str. MIT 9313 ............................   67  2 hits [cyanobacteria]         adenine glycosylase [Prochlorococcus marinus str. MIT 9313]
. . . Silicibacter lacuscaerulensis ITI-1157 ...........................   67  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Silicibacter lacuscaerule
. . . Neisseria meningitidis alpha153 ..................................   67  1 hit  [b-proteobacteria]      putative A/G-specific adenine glycosylase [Neisseria mening
. . . Roseobacter sp. AzwK-3b ..........................................   67  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Roseobacter sp. AzwK-3b] 
. . . Nitrosococcus oceani ATCC 19707 ..................................   67  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase MutY [Nitrosococcus oceani
. . . Nitrosococcus oceani AFC27 .......................................   67  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase MutY [Nitrosococcus oceani
. . . Listeria welshimeri serovar 6b str. SLCC5334 .....................   67  2 hits [firmicutes]            A/G-specific adenine glycosylase family protein [Listeria w
. . . Hahella chejuensis KCTC 2396 .....................................   67  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Hahella chejuensis KCTC 2
. . . Neisseria subflava NJ9703 ........................................   67  2 hits [b-proteobacteria]      A/G-specific adenine glycosylase [Neisseria subflava NJ9703
. . . Beijerinckia indica subsp. indica ATCC 9039 ......................   67  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Beijerinckia indica subsp
. . . Faecalibacterium prausnitzii A2-165 ..............................   67  2 hits [firmicutes]            A/G-specific adenine glycosylase [Faecalibacterium prausnit
. . . Enterococcus gallinarum EG2 ......................................   67  2 hits [firmicutes]            A/G-specific adenine glycosylase [Enterococcus gallinarum E
. . . Synechococcus sp. CC9902 .........................................   67  2 hits [cyanobacteria]         Mutator MutT [Synechococcus sp. CC9902] >gi|78168021|gb|ABB
. . . Prochlorococcus marinus str. MIT 9303 ............................   67  2 hits [cyanobacteria]         adenine glycosylase [Prochlorococcus marinus str. MIT 9303]
. . . Labrenzia alexandrii DFL-11 ......................................   67  2 hits [a-proteobacteria]      base excision DNA repair protein, HhH-GPD family [Labrenzia
. . . Xanthomonas axonopodis pv. citri str. 306 ........................   67  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Xanthomonas axonopodis pv
. . . Teredinibacter turnerae T7901 ....................................   66  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Teredinibacter turnerae T
. . . Roseobacter sp. CCS2 .............................................   66  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Roseobacter sp. CCS2] >gi
. . . Citreicella sp. SE45 .............................................   66  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Citreicella sp. SE45] >gi
. . . gamma proteobacterium HTCC2207 ...................................   66  2 hits [g-proteobacteria]      adenine glycosylase [marine gamma proteobacterium HTCC2207]
. . . Bacillus halodurans C-125 ........................................   66  2 hits [firmicutes]            adenine glycosylase [Bacillus halodurans C-125] >gi|1017354
. . . Neisseria meningitidis MC58 ......................................   66  2 hits [b-proteobacteria]      A/G-specific adenine glycosylase [Neisseria meningitidis MC
. . . Leptospirillum ferrodiazotrophum .................................   66  1 hit  [bacteria]              putative A/G-specific DNA glycosylase [Leptospirillum ferro
. . . Asticcacaulis excentricus CB 48 ..................................   66  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Asticcacaulis excentricus
. . . Neisseria meningitidis Z2491 .....................................   66  2 hits [b-proteobacteria]      adenine glycosylase [Neisseria meningitidis Z2491] >gi|9311
. . . Bacillus coahuilensis m4-4 .......................................   66  1 hit  [firmicutes]            adenine glycosylase [Bacillus coahuilensis m4-4]
. . . Xanthomonas campestris pv. vasculorum NCPPB702 ...................   66  1 hit  [g-proteobacteria]      A/G-specific adenine glycosylase [Xanthomonas campestris pv
. . . Prochlorococcus marinus str. NATL1A ..............................   66  2 hits [cyanobacteria]         adenine glycosylase [Prochlorococcus marinus str. NATL1A] >
. . . Macrococcus caseolyticus JCSC5402 ................................   66  2 hits [firmicutes]            A/G-specific adenine glycosylase homolog [Macrococcus caseo
. . . Neisseria mucosa ATCC 25996 ......................................   66  2 hits [b-proteobacteria]      A/G-specific adenine glycosylase [Neisseria mucosa ATCC 259
. . . Bacillus cereus F65185 ...........................................   66  2 hits [firmicutes]            hypothetical protein bcere0025_4220 [Bacillus cereus F65185
. . . Candidatus Protochlamydia amoebophila UWE25 ......................   66  2 hits [chlamydias]            putative A/G-specific adenine glycosylase, mutY [Candidatus
. . . Parascardovia denticolens F0305 ..................................   65  2 hits [high GC Gram+]         putative A/G-specific adenine glycosylase [Parascardovia de
. . . Xanthomonas campestris pv. musacearum NCPPB4381 ..................   65  1 hit  [g-proteobacteria]      A/G-specific adenine glycosylase [Xanthomonas campestris pv
. . . Prochlorococcus marinus str. NATL2A ..............................   65  2 hits [cyanobacteria]         A/G-specific DNA-adenine glycosylase [Prochlorococcus marin
. . . Nitrosococcus halophilus Nc4 .....................................   65  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Nitrosococcus halophilus 
. . . Marinobacter sp. ELB17 ...........................................   65  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Marinobacter sp. ELB17] >
. . . Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum) ........   65  2 hits [enterobacteria]        adenine DNA glycosylase [Candidatus Hamiltonella defensa 5A
. . . Variovorax paradoxus S110 ........................................   65  2 hits [b-proteobacteria]      A/G-specific adenine glycosylase [Variovorax paradoxus S110
. . . Leptospirillum rubarum ...........................................   65  1 hit  [bacteria]              putative A/G-specific DNA glycosylase [Leptospirillum rubar
. . . Bacillus cereus ATCC 14579 .......................................   65  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus cereus ATCC 1457
. . . Bacillus cereus B4264 ............................................   65  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus cereus ATCC 1457
. . . Bacillus cereus AH676 ............................................   65  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus cereus ATCC 1457
. . . Bacillus cereus BDRD-Cer4 ........................................   65  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus cereus ATCC 1457
. . . Bacillus cereus BDRD-ST24 ........................................   65  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus cereus ATCC 1457
. . . Bacillus cereus m1550 ............................................   65  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus cereus ATCC 1457
. . . Neisseria meningitidis 8013 ......................................   65  1 hit  [b-proteobacteria]      A/G-specific adenine glycosylase [Neisseria meningitidis 80
. . . Bacillus thuringiensis serovar pakistani str. T13001 .............   65  2 hits [firmicutes]            hypothetical protein bthur0005_4740 [Bacillus thuringiensis
. . . Plesiocystis pacifica SIR-1 ......................................   65  2 hits [d-proteobacteria]      A/G-specific adenine glycosylase [Plesiocystis pacifica SIR
. . . Bacillus licheniformis ATCC 14580 ................................   65  4 hits [firmicutes]            putative A/G-specific adenine glycosylase YfhQ [Bacillus li
. . . Bacillus megaterium QM B1551 .....................................   65  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus megaterium QM B1
. . . Coprococcus catus GD/7 ...........................................   65  1 hit  [firmicutes]            A/G-specific adenine glycosylase [Coprococcus catus GD/7]
. . . Exiguobacterium sp. AT1b .........................................   65  2 hits [firmicutes]            A/G-specific adenine glycosylase [Exiguobacterium sp. AT1b]
. . . Bacillus cereus AH1134 ...........................................   65  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus cereus AH1134] >
. . . Bacillus thuringiensis serovar kurstaki str. T03a001 .............   65  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus cereus AH1134] >
. . . Bacillus cereus Rock4-2 ..........................................   65  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus cereus AH1134] >
. . . Methylococcus capsulatus str. Bath ...............................   65  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Methylococcus capsulatus 
. . . Marinobacter algicola DG893 ......................................   65  2 hits [g-proteobacteria]      A/G specific adenine glycosylase [Marinobacter algicola DG8
. . . Parvularcula bermudensis HTCC2503 ................................   65  2 hits [a-proteobacteria]      Putative mutY, A/G-specific adenine glycosylase [Parvularcu
. . . alpha proteobacterium IMCC1322 ...................................   65  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [alpha proteobacterium IMC
. . . Microcoleus chthonoplastes PCC 7420 ..............................   65  2 hits [cyanobacteria]         A/G-specific adenine glycosylase [Microcoleus chthonoplaste
. . . Marinobacter aquaeolei VT8 .......................................   65  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Marinobacter aquaeolei VT
. . . Verrucomicrobiae bacterium DG1235 ................................   65  2 hits [verrucomicrobia]       base excision DNA repair protein, HhH-GPD family [Verrucomi
. . . Bacillus thuringiensis serovar sotto str. T04001 .................   65  2 hits [firmicutes]            hypothetical protein bthur0004_4830 [Bacillus thuringiensis
. . . Bacillus thuringiensis serovar israelensis ATCC 35646 ............   65  2 hits [firmicutes]            A/G-specific adenine DNA glycosylase [Bacillus thuringiensi
. . . Bacillus cereus G9842 ............................................   65  2 hits [firmicutes]            A/G-specific adenine DNA glycosylase [Bacillus thuringiensi
. . . Bacillus thuringiensis IBL 200 ...................................   65  2 hits [firmicutes]            A/G-specific adenine DNA glycosylase [Bacillus thuringiensi
. . . Rickettsiella grylli .............................................   65  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Rickettsiella grylli] >gi
. . . Acidiphilium cryptum JF-5 ........................................   65  2 hits [a-proteobacteria]      HhH-GPD family protein [Acidiphilium cryptum JF-5] >gi|1464
. . . Bacillus cereus 172560W ..........................................   65  2 hits [firmicutes]            hypothetical protein bcere0005_4250 [Bacillus cereus 172560
. . . Bacillus cereus ATCC 10876 .......................................   65  2 hits [firmicutes]            hypothetical protein bcere0005_4250 [Bacillus cereus 172560
. . . Pseudovibrio sp. JE062 ...........................................   64  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Pseudovibrio sp. JE062] >
. . . Synechococcus elongatus PCC 6301 .................................   64  2 hits [cyanobacteria]         mutator MutT protein [Synechococcus elongatus PCC 6301] >gi
. . . Synechococcus elongatus PCC 7942 .................................   64  2 hits [cyanobacteria]         mutator MutT protein [Synechococcus elongatus PCC 6301] >gi
. . . Candidatus Blochmannia floridanus ................................   64  2 hits [enterobacteria]        A/G-specific adenine glycosylase [Candidatus Blochmannia fl
. . . Listeria seeligeri serovar 1/2b str. SLCC3954 ....................   64  2 hits [firmicutes]            A/G-specific adenine glycosylase family protein [Listeria s
. . . Catenibacterium mitsuokai DSM 15897 ..............................   64  2 hits [firmicutes]            hypothetical protein CATMIT_00928 [Catenibacterium mitsuoka
. . . Xanthomonas oryzae pv. oryzicola BLS256 ..........................   64  1 hit  [g-proteobacteria]      A/G-specific adenine glycosylase [Xanthomonas oryzae pv. or
. . . Bifidobacterium catenulatum DSM 16992 ............................   64  2 hits [high GC Gram+]         hypothetical protein BIFCAT_01160 [Bifidobacterium catenula
. . . Bacillus sp. SG-1 ................................................   64  2 hits [firmicutes]            hypothetical protein BSG1_05639 [Bacillus sp. SG-1] >gi|148
. . . Chlamydia trachomatis 6276 .......................................   64  1 hit  [chlamydias]            putative DNA glycosylase [Chlamydia trachomatis 6276] >gi|2
. . . Chlamydia trachomatis 6276s ......................................   64  1 hit  [chlamydias]            putative DNA glycosylase [Chlamydia trachomatis 6276] >gi|2
. . . Synechococcus sp. CC9605 .........................................   64  2 hits [cyanobacteria]         A/G-specific DNA-adenine glycosylase [Synechococcus sp. CC9
. . . Hyphomonas neptunium ATCC 15444 ..................................   64  2 hits [a-proteobacteria]      A/G-specific adenine glycosylase [Hyphomonas neptunium ATCC
. . . marine gamma proteobacterium HTCC2148 ............................   64  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [marine gamma proteobacter
. . . Clostridium phytofermentans ISDg .................................   64  2 hits [firmicutes]            A/G-specific adenine glycosylase [Clostridium phytofermenta
. . . Neptuniibacter caesariensis ......................................   64  2 hits [g-proteobacteria]      adenine glycosylase [Oceanospirillum sp. MED92] >gi|8908351
. . . Chlamydia trachomatis 70 .........................................   64  1 hit  [chlamydias]            putative DNA glycosylase [Chlamydia trachomatis 70] >gi|255
. . . Chlamydia trachomatis 70s ........................................   64  1 hit  [chlamydias]            putative DNA glycosylase [Chlamydia trachomatis 70] >gi|255
. . . Chlamydia trachomatis Sweden2 ....................................   64  1 hit  [chlamydias]            putative DNA glycosylase [Chlamydia trachomatis 70] >gi|255
. . . Chlamydia trachomatis D/UW-3/CX ..................................   64  2 hits [chlamydias]            A/G-specific adenine glycosylase [Chlamydia trachomatis D/U
. . . Chlamydia trachomatis D(s)2923 ...................................   64  1 hit  [chlamydias]            A/G-specific adenine glycosylase [Chlamydia trachomatis D/U
. . . Chlamydia trachomatis 434/Bu .....................................   64  2 hits [chlamydias]            putative DNA glycosylase [Chlamydia trachomatis 434/Bu] >gi
. . . Chlamydia trachomatis L2b/UCH-1/proctitis ........................   64  2 hits [chlamydias]            putative DNA glycosylase [Chlamydia trachomatis 434/Bu] >gi
. . . Mannheimia succiniciproducens MBEL55E ............................   64  2 hits [g-proteobacteria]      MutY protein [Mannheimia succiniciproducens MBEL55E] >gi|52
. . . Anaerostipes caccae DSM 14662 ....................................   63  2 hits [firmicutes]            hypothetical protein ANACAC_03041 [Anaerostipes caccae DSM 
. . . Chlamydia trachomatis A/HAR-13 ...................................   63  2 hits [chlamydias]            A/G-specific adenine DNA glycosylase [Chlamydia trachomatis
. . . Chlamydia trachomatis B/Jali20/OT ................................   63  2 hits [chlamydias]            A/G-specific adenine DNA glycosylase [Chlamydia trachomatis
. . . Chlamydia trachomatis B/TZ1A828/OT ...............................   63  2 hits [chlamydias]            A/G-specific adenine DNA glycosylase [Chlamydia trachomatis
. . . Burkholderia xenovorans LB400 ....................................   63  2 hits [b-proteobacteria]      A/G-specific DNA-adenine glycosylase [Burkholderia xenovora
. . . Xanthomonas campestris pv. vesicatoria str. 85-10 ................   63  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Xanthomonas campestris pv
. . . Erysipelothrix rhusiopathiae ATCC 19414 ..........................   63  2 hits [firmicutes]            A/G-specific adenine glycosylase [Erysipelothrix rhusiopath
. . . Marinomonas sp. MED121 ...........................................   63  2 hits [g-proteobacteria]      A/G-specific adenine glycosylase [Marinomonas sp. MED121] >
. . . Bacillus weihenstephanensis KBAB4 ................................   63  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus weihenstephanens
. . . Bacillus mycoides DSM 2048 .......................................   63  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus weihenstephanens
. . . Bacillus megaterium DSM319 .......................................   63  1 hit  [firmicutes]            A/G-specific adenine glycosylase [Bacillus megaterium DSM31
. . . Bacillus cereus AH621 ............................................   63  2 hits [firmicutes]            hypothetical protein bcere0007_4470 [Bacillus cereus AH621]
. . . Cyanothece sp. PCC 7425 ..........................................   63  2 hits [cyanobacteria]         A/G-specific adenine glycosylase [Cyanothece sp. PCC 7425] 
. . . Lawsonia intracellularis PHE/MN1-00 ..............................   63  2 hits [d-proteobacteria]      A/G-specific DNA glycosylase [Lawsonia intracellularis PHE/
. . . Synechococcus sp. WH 8109 ........................................   63  2 hits [cyanobacteria]         A/G-specific DNA-adenine glycosylase [Synechococcus sp. WH 
. . . Haemophilus influenzae 7P49H1 ....................................   63  2 hits [g-proteobacteria]      50S ribosomal protein L31 [Haemophilus influenzae 7P49H1] >
. . . Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 .   63  2 hits [d-proteobacteria]      A/G-specific adenine glycosylase [Desulfovibrio desulfurica
. . . Listeria grayi DSM 20601 .........................................   63  2 hits [firmicutes]            adenine glycosylase [Listeria grayi DSM 20601] >gi|22931269
. . . Thiomonas intermedia K12 .........................................   63  2 hits [b-proteobacteria]      A/G-specific adenine glycosylase [Thiomonas intermedia K12]
. . . Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1 .........   63  2 hits [firmicutes]            hypothetical protein bthur0010_4370 [Bacillus thuringiensis
. . . Bacillus cereus 95/8201 ..........................................   63  2 hits [firmicutes]            hypothetical protein bthur0010_4370 [Bacillus thuringiensis
. . . Chloroflexus aurantiacus J-10-fl .................................   63  2 hits [GNS bacteria]          HhH-GPD family protein [Chloroflexus aurantiacus J-10-fl] >
. . . Chloroflexus sp. Y-400-fl ........................................   63  2 hits [GNS bacteria]          HhH-GPD family protein [Chloroflexus aurantiacus J-10-fl] >
. . . Holdemania filiformis DSM 12042 ..................................   63  2 hits [firmicutes]            hypothetical protein HOLDEFILI_02114 [Holdemania filiformis
. . . Bacillus cereus G9241 ............................................   63  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus cereus G9241] >g
. . . Hirschia baltica ATCC 49814 ......................................   63  2 hits [a-proteobacteria]      HhH-GPD family protein [Hirschia baltica ATCC 49814] >gi|25
. . . Bacillus thuringiensis serovar huazhongensis BGSC 4BD1 ...........   63  2 hits [firmicutes]            hypothetical protein bthur0011_4100 [Bacillus thuringiensis
. . . Syntrophobacter fumaroxidans MPOB ................................   63  2 hits [d-proteobacteria]      A/G-specific adenine glycosylase [Syntrophobacter fumaroxid
. . . Bacillus cereus Rock1-15 .........................................   63  2 hits [firmicutes]            hypothetical protein bcere0018_4180 [Bacillus cereus Rock1-
. . . Acholeplasma laidlawii PG-8A .....................................   63  2 hits [mycoplasmas]           A/G-specific adenine DNA glycosylase [Acholeplasma laidlawi
. . . Alkaliphilus metalliredigens QYMF ................................   63  2 hits [firmicutes]            A/G-specific adenine glycosylase [Alkaliphilus metalliredig
. . . Listeria innocua Clip11262 .......................................   63  1 hit  [firmicutes]            hypothetical protein lin1797 [Listeria innocua Clip11262] >
. . . Listeria innocua .................................................   63  1 hit  [firmicutes]            hypothetical protein lin1797 [Listeria innocua Clip11262] >
. . . Bacillus cereus AH1273 ...........................................   63  2 hits [firmicutes]            hypothetical protein bcere0030_4300 [Bacillus cereus AH1273
. . . Bacillus cereus AH1272 ...........................................   63  2 hits [firmicutes]            hypothetical protein bcere0030_4300 [Bacillus cereus AH1273
. . . Bacillus thuringiensis str. Al Hakam .............................   63  2 hits [firmicutes]            A/G-specific DNA-adenine glycosylase [Bacillus thuringiensi
. . . Bacillus cereus 03BB108 ..........................................   63  2 hits [firmicutes]            A/G-specific DNA-adenine glycosylase [Bacillus thuringiensi
. . . Bacillus cereus 03BB102 ..........................................   63  2 hits [firmicutes]            A/G-specific DNA-adenine glycosylase [Bacillus thuringiensi
. . . Bacillus cereus BGSC 6E1 .........................................   63  2 hits [firmicutes]            A/G-specific DNA-adenine glycosylase [Bacillus thuringiensi
. . . Cellvibrio japonicus Ueda107 .....................................   63  2 hits [g-proteobacteria]      A / G specific adenine glycosylase [Cellvibrio japonicus Ue
. . . Bacillus cereus W ................................................   63  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus cereus W] >gi|19
. . . Bacillus cereus NVH0597-99 .......................................   63  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus cereus W] >gi|19
. . . Bacillus cereus AH820 ............................................   63  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus cereus W] >gi|19
. . . Bacillus thuringiensis serovar pulsiensis BGSC 4CC1 ..............   63  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus cereus W] >gi|19
. . . Bacillus thuringiensis serovar monterrey BGSC 4AJ1 ...............   63  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus cereus W] >gi|19
. . . Bacillus cereus Rock3-42 .........................................   63  2 hits [firmicutes]            A/G-specific adenine glycosylase [Bacillus cereus W] >gi|19
. . Ostreococcus tauri -------------------------------------------------   75  1 hit  [green algae]           adenine-DNA glycosylase-related / MYH-related (ISS) [Ostreo
. . Trypanosoma brucei gambiense DAL972 ................................   72  1 hit  [kinetoplastids]        A/G-specific adenine glycosylase, putative [Trypanosoma bru
. . Trypanosoma brucei TREU927 .........................................   71  1 hit  [kinetoplastids]        A/G-specific adenine glycosylase [Trypanosoma brucei TREU92
. . Trypanosoma brucei .................................................   71  2 hits [kinetoplastids]        A/G-specific adenine glycosylase [Trypanosoma brucei TREU92
. . Oryza sativa Japonica Group (Japanese rice) ........................   70  1 hit  [monocots]              hypothetical protein OsJ_35582 [Oryza sativa Japonica Group]
. . Pan troglodytes ....................................................   70 10 hits [primates]              PREDICTED: mutY homolog isoform 10 [Pan troglodytes] >gi|11
. . Homo sapiens (man) .................................................   70 40 hits [primates]              hMYHalpha4 [Homo sapiens] >gi|6691539|dbj|BAA89345.1| hMYHg
. . Macaca fascicularis (cynomolgus monkey) ............................   69  1 hit  [primates]              unnamed protein product [Macaca fascicularis]
. . Macaca mulatta (rhesus macaque) ....................................   69  3 hits [primates]              PREDICTED: mutY homolog isoform 2 [Macaca mulatta] >gi|1090
. . Monodelphis domestica ..............................................   69  1 hit  [marsupials]            PREDICTED: similar to mutY homolog [Monodelphis domestica]
. . Ostreococcus lucimarinus CCE9901 ...................................   69  2 hits [green algae]           predicted protein [Ostreococcus lucimarinus CCE9901] >gi|14
. . Hydra magnipapillata ...............................................   68  1 hit  [hydrozoans]            PREDICTED: similar to mutY homolog, partial [Hydra magnipap
. . Canis lupus familiaris (dogs) ......................................   68  1 hit  [carnivores]            PREDICTED: similar to A/G-specific adenine DNA glycosylase 
. . Zea mays (maize) ...................................................   68  3 hits [monocots]              A/G-specific adenine DNA glycosylase [Zea mays] >gi|1956395
. . Equus caballus (equine) ............................................   67  1 hit  [odd-toed ungulates]    PREDICTED: mutY homolog (E. coli) isoform 1 [Equus caballus]
. . Bos taurus (cow) ...................................................   67  3 hits [even-toed ungulates]   a/G-specific adenine DNA glycosylase [Bos taurus] >gi|19466
. . Micromonas sp. RCC299 ..............................................   67  2 hits [green algae]           predicted protein [Micromonas sp. RCC299] >gi|226520907|gb|
. . Danio rerio (zebra fish) ...........................................   66  2 hits [bony fishes]           PREDICTED: si:ch211-241d21.4 [Danio rerio] >gi|220679596|em
. . Ailuropoda melanoleuca .............................................   65  1 hit  [carnivores]            hypothetical protein PANDA_008126 [Ailuropoda melanoleuca]
. . Taeniopygia guttata (zebra finch) ..................................   65  1 hit  [birds]                 PREDICTED: hypothetical protein [Taeniopygia guttata]
. . Rattus norvegicus (brown rat) ......................................   65  6 hits [rodents]               Mutyh protein [Rattus norvegicus]
. . Schizosaccharomyces pombe ..........................................   65  4 hits [ascomycetes]           A/G-specific adenine DNA glycosylase [Schizosaccharomyces p
. . Mus musculus (mouse) ...............................................   65 11 hits [rodents]               a/G-specific adenine DNA glycosylase [Mus musculus] >gi|227
. . Populus trichocarpa (black cottonwood) .............................   64  2 hits [eudicots]              predicted protein [Populus trichocarpa] >gi|222861994|gb|EE
. . Polysphondylium pallidum PN500 .....................................   63  1 hit  [cellular slime molds]  A/G-specific adenine DNA glycosylase [Polysphondylium palli
. . Vitis vinifera (wine grape) ........................................   63  2 hits [eudicots]              PREDICTED: hypothetical protein [Vitis vinifera] >gi|270236
. . Dictyostelium discoideum AX4 .......................................   63  2 hits [cellular slime molds]  hypothetical protein DDB_G0270764 [Dictyostelium discoideum
. uncultured marine microorganism HF4000_APKG3D20 ----------------------   65  1 hit  [unclassified]          putative HhH-GPD superfamily base excision DNA repair prote

BLAST

PROTOCOL


BLASTp versus NR, NCBI default parameters apart from "Number of descriptions_1000"




RESULTS ANALYSIS


>ref|ZP_01256434.1| A/G-specific adenine glycosylase [Psychroflexus torquis ATCC

700755]

Length_236


Score _ 211 bits (536), Expect _ 5e-53, Method: Compositional matrix adjust.

Identities _ 116/199 (58%), Positives _ 146/199 (73%), Gaps _ 2/199 (1%)



We can say that the protein is something near a A/G-specific adenine glycosylase since thet best result in blastp gives us that confirmation, the score is high (211) and the E value seems good (6e-53) but it isn´t the centerpiece since it could be a lot better.

For the multiple sequence analisys (MSA) we choose 15 sequences from the CFB group bacteria as the In group and five sequences from the chlamydias for the Out group. We alsocan say that the frist result in the Ingroup is the best since it has a great discrepancy from the second and remaining, the same could be said for the score result, this could lead to a weak MSA analysis.


In Group:


Psychroflexus torquis ATCC 700755 -------------------------- 211 6e-53 [CFB group bacteria]

Zunongwangia profunda SM-A87 ............................... 72 3e-11 [CFB group bacteria]

Capnocytophaga gingivalis ATCC 33624 ....................... 70.9 8e-11 [CFB group bacteria]

Polaribacter irgensii 23-P ................................. 70.9 9e-11 [CFB group bacteria]

Dokdonia donghaensis MED134 ................................ 67.4 8e-10 [CFB group bacteria]

Polaribacter sp. MED152 .................................... 67.0 1e-09 [CFB group bacteria]

Leeuwenhoekiella blandensis MED217 ......................... 66.6 1e-09 [CFB group bacteria]

Croceibacter atlanticus HTCC2559 ........................... 64.3 8e-09 [CFB group bacteria]

Kordia algicida OT-1 ....................................... 63.9 9e-09 [CFB group bacteria]

Gramella forsetii KT0803 ................................... 63.9 1e-08 [CFB group bacteria]

Flavobacteriales bacterium HTCC2170 ------------------------ 71.2 5e-11 [CFB group bacteria]

Salinibacter ruber DSM 13855 ................................74.7 6e-12 [CFB group bacteria]

Chitinophaga pinensis DSM 2588 ..............................70.1 1e-10 [CFB group bacteria]

Prevotella timonensis CRIS 5C-B1 ............................66.6 2e-09 [CFB group bacteria]

Microscilla marina ATCC 23134 ...............................64.7 6e-09 [CFB group bacteria]


Out Group:


Candidatus Protochlamydia amoebophila UWE25 .................66.2 2e-09 [chlamydias]

Chlamydia trachomatis 6276 ..................................64.7 6e-09 [chlamydias]

Chlamydia trachomatis 70 ....................................64.3 8e-09 [chlamydias]

Chlamydia trachomatis D/UW-3/CX .............................64.3 8e-09 [chlamydias]

Chlamydia trachomatis 434/Bu ................................64.3 8e-09 [chlamydias]

RAW RESULTS

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_01256434.1|  A/G-specific adenine glycosylase [Psychrof...   211    6e-53
ref|ZP_01264723.1|  A/G-specific adenine glycosylase [Candidat...   204    4e-51
ref|YP_265538.1|  A/G-specific adenine glycosylase [Candidatus...   203    1e-50
ref|ZP_05068747.1|  A/G-specific adenine glycosylase [Candidat...   193    9e-48
ref|YP_757425.1|  A/G-specific DNA-adenine glycosylase [Marica...  92.0    4e-17
gb|ADC38035.1|  A/G-specific adenine glycosylase [Staphylococc...  91.3    6e-17
ref|NP_372392.1|  A/G-specific adenine glycosylase [Staphyloco...  90.5    9e-17
ref|ZP_04868609.1|  A/G-specific DNA glycosylase [Staphylococc...  90.5    9e-17
ref|ZP_05699103.1|  A/G-specific adenine glycosylase [Staphylo...  90.5    1e-16
ref|YP_766689.1|  putative A/G-specific adenine glycosylase [R...  90.5    1e-16
ref|NP_646625.1|  hypothetical protein MW1808 [Staphylococcus ...  90.1    1e-16
ref|ZP_04863791.1|  A/G-specific DNA glycosylase [Staphylococc...  90.1    1e-16
ref|ZP_04679689.1|  A/G-specific adenine glycosylase [Ochrobac...  89.7    1e-16
ref|YP_002974549.1|  A/G-specific adenine glycosylase [Rhizobi...  89.4    2e-16
ref|YP_186751.1|  A/G-specific adenine glycosylase [Staphyloco...  89.4    2e-16
ref|ZP_06330884.1|  A/G-specific adenine glycosylase [Staphylo...  89.4    2e-16
ref|ZP_03496828.1|  HhH-GPD family protein [Thermus aquaticus ...  89.0    3e-16
ref|YP_002548784.1|  A/G-specific adenine glycosylase [Agrobac...  88.6    3e-16
ref|NP_353822.1|  A/G-specific adenine glycosylase [Agrobacter...  88.6    3e-16
ref|ZP_05808529.1|  A/G-specific adenine glycosylase [Mesorhiz...  88.2    5e-16
ref|NP_107820.1|  adenine glycosylase [Mesorhizobium loti MAFF...  88.2    5e-16
ref|YP_002971494.1|  A/G-specific adenine glycosylase MutY [Ba...  88.2    5e-16
ref|ZP_02188939.1|  A/G-specific DNA glycosylase [alpha proteo...  87.8    7e-16
ref|ZP_05685844.1|  A/G-specific adenine glycosylase [Staphylo...  87.4    8e-16
ref|ZP_06324897.1|  A/G-specific adenine glycosylase [Staphylo...  87.4    9e-16
emb|CAQ50349.1|  A/G-specific adenine glycosylase [Staphylococ...  87.0    1e-15
ref|ZP_01447307.1|  Putative mutY, A/G-specific adenine glycos...  86.7    1e-15
ref|ZP_06314122.1|  A/G-specific adenine glycosylase [Staphylo...  86.7    1e-15
ref|YP_041333.1|  HhH-GPD superfamily base excision DNA repair...  86.7    2e-15
ref|ZP_05377722.1|  A/G-specific adenine glycosylase [Hyphomic...  86.3    2e-15
ref|ZP_05869839.1|  A/G-specific adenine glycosylase [Brucella...  86.3    2e-15
ref|YP_221267.1|  MutY, A/G-specific adenine glycosylase [Bruc...  86.3    2e-15
ref|YP_001934491.1|  A/G-specific adenine glycosylase [Brucell...  85.9    2e-15
ref|ZP_06350281.1|  A/G-specific adenine glycosylase [Rhodomic...  85.9    2e-15
ref|YP_468535.1|  A/G-specific adenine glycosylase protein [Rh...  85.9    3e-15
ref|YP_002543690.1|  A/G-specific adenine glycosylase [Agrobac...  85.5    3e-15
ref|ZP_03508370.1|  A/G-specific adenine glycosylase protein [...  85.1    4e-15
ref|ZP_06096383.1|  A/G-specific adenine glycosylase [Brucella...  85.1    4e-15
ref|ZP_05180477.1|  A/G-specific adenine glycosylase [Brucella...  85.1    5e-15
ref|YP_001627179.1|  A/G-specific adenine glycosylase [Brucell...  84.7    5e-15
ref|YP_417263.1|  A/G-specific adenine glycosylase DNA repair ...  84.7    5e-15
ref|YP_001258507.1|  A/G-specific adenine glycosylase [Brucell...  84.7    5e-15
ref|ZP_06001433.1|  A/G-specific adenine glycosylase [Brucella...  84.7    5e-15
ref|ZP_05174759.1|  A/G-specific adenine glycosylase [Brucella...  84.7    5e-15
ref|YP_617308.1|  HhH-GPD [Sphingopyxis alaskensis RB2256] >gb...  84.7    5e-15
ref|NP_540359.1|  A/G-specific adenine glycosylase [Brucella m...  84.7    5e-15
ref|YP_002280175.1|  A/G-specific adenine glycosylase [Rhizobi...  84.3    6e-15
ref|YP_002361911.1|  A/G-specific adenine glycosylase [Methylo...  84.3    7e-15
ref|YP_001977250.1|  A/G-specific adenine glycosylase protein ...  84.3    7e-15
ref|NP_697521.1|  A/G-specific adenine glycosylase [Brucella s...  84.0    1e-14
ref|YP_001592353.1|  A/G-specific adenine glycosylase [Brucell...  84.0    1e-14
ref|ZP_05837375.1|  A/G-specific adenine glycosylase [Brucella...  83.6    1e-14
ref|ZP_05090895.1|  A/G-specific adenine glycosylase [Ruegeria...  83.2    1e-14
ref|YP_191509.1|  A/G-specific adenine DNA glycosylase [Glucon...  82.8    2e-14
ref|YP_005504.1|  A/G-specific adenine DNA glycosylase [Thermu...  82.4    2e-14
ref|YP_484691.1|  A/G-specific adenine glycosylase [Rhodopseud...  82.4    3e-14
ref|YP_783337.1|  A/G-specific adenine glycosylase [Rhodopseud...  82.0    3e-14
ref|ZP_02150762.1|  A/G-specific adenine glycosylase [Phaeobac...  81.6    5e-14
ref|ZP_04796151.1|  A/G-specific adenine glycosylase [Staphylo...  81.3    5e-14
ref|YP_001416078.1|  A/G-specific adenine glycosylase [Xanthob...  81.3    5e-14
ref|YP_253008.1|  hypothetical protein SH1093 [Staphylococcus ...  81.3    5e-14
ref|YP_519493.1|  hypothetical protein DSY3260 [Desulfitobacte...  81.3    6e-14
emb|CAM77166.1|  A/G-specific adenine glycosylase MutY [Magnet...  81.3    6e-14
ref|YP_001609098.1|  A/G-specific adenine glycosylase MutY [Ba...  81.3    7e-14
ref|ZP_02147280.1|  A/G-specific adenine glycosylase [Phaeobac...  80.9    8e-14
ref|YP_001523372.1|  A/G-specific adenine glycosylase [Azorhiz...  80.9    8e-14
ref|NP_385034.1|  A/G-specific adenine glycosylase protein [Si...  80.5    1e-13
ref|ZP_00954266.1|  A/G-specific adenine glycosylase [Sulfitob...  80.5    1e-13
ref|YP_145164.1|  A/G-specific adenine glycosylase (MutY) [The...  80.1    1e-13
ref|ZP_01002390.1|  A/G-specific adenine glycosylase [Loktanel...  80.1    1e-13
ref|YP_002825105.1|  putative A/G-specific adenine glycosylase...  80.1    1e-13
ref|YP_355752.1|  A/G-specific adenine glycosylase [Pelobacter...  80.1    1e-13
ref|ZP_00207933.1|  COG1194: A/G-specific DNA glycosylase [Mag...  80.1    1e-13
ref|YP_534210.1|  A/G-specific adenine glycosylase [Rhodopseud...  79.7    2e-13
ref|ZP_06614467.1|  A/G-specific adenine glycosylase [Staphylo...  79.3    2e-13
ref|NP_765107.1|  A/G-specific adenine glycosylase [Staphyloco...  79.3    2e-13
ref|YP_188975.1|  A/G-specific adenine glycosylase [Staphyloco...  79.3    2e-13
ref|ZP_00948811.1|  A/G-specific adenine glycosylase [Sulfitob...  79.3    2e-13
ref|YP_003064892.1|  A/G-specific adenine glycosylase [Candida...  79.3    3e-13
ref|YP_351509.1|  A/G-specific DNA-adenine glycosylase [Rhodob...  79.0    3e-13
ref|YP_003543532.1|  A/G-specific DNA glycosylase [Sphingobium...  79.0    3e-13
ref|ZP_04824399.1|  A/G-specific adenine glycosylase [Staphylo...  78.6    3e-13
ref|YP_568338.1|  A/G-specific adenine glycosylase [Rhodopseud...  78.6    4e-13
ref|ZP_05065799.1|  A/G-specific adenine glycosylase [Octadeca...  78.6    4e-13
ref|YP_003353310.1|  A/G-specific adenine DNA glycosylase [Lac...  78.6    4e-13
ref|ZP_01228004.1|  A/G-specific adenine glycosylase [Aurantim...  78.6    4e-13
ref|NP_266997.1|  A/G-specific adenine glycosylase [Lactococcu...  78.6    4e-13
ref|ZP_06064111.1|  A/G specific adenine glycosylase [Acinetob...  78.6    4e-13
ref|YP_001369167.1|  A/G-specific adenine glycosylase [Ochroba...  78.2    5e-13
ref|ZP_01440577.1|  A/G-specific adenine glycosylase protein [...  77.8    6e-13
ref|YP_423347.1|  A/G-specific DNA glycosylase [Magnetospirill...  77.8    6e-13
ref|NP_816338.1|  A/G-specific adenine glycosylase [Enterococc...  77.8    6e-13
ref|YP_002276407.1|  A/G-specific adenine glycosylase [Glucona...  77.8    7e-13
ref|YP_001601580.1|  putative A/G-specific adenine glycosylase...  77.8    7e-13
ref|YP_002527218.1|  A/G-specific DNA-adenine glycosylase [Rho...  77.8    7e-13
ref|YP_808874.1|  A/G-specific adenine glycosylase [Lactococcu...  77.4    8e-13
ref|YP_001326234.1|  A/G-specific adenine glycosylase [Sinorhi...  77.4    8e-13
ref|ZP_05567984.1|  A/G-specific adenine glycosylase MutY [Ent...  77.4    9e-13
ref|ZP_05052908.1|  A/G-specific adenine glycosylase [Octadeca...  77.4    9e-13
ref|YP_003451893.1|  A/G-specific adenine glycosylase [Azospir...  77.0    1e-12
ref|YP_003508593.1|  A/G-specific adenine glycosylase [Meiothe...  77.0    1e-12
emb|CBL32290.1|  A/G-specific DNA-adenine glycosylase [Enteroc...  76.6    2e-12
ref|ZP_05578686.1|  A/G-specific adenine glycosylase MutY [Ent...  76.6    2e-12
ref|ZP_05597094.1|  A/G-specific adenine glycosylase mutY [Ent...  76.6    2e-12
ref|ZP_03984241.1|  A/G-specific adenine glycosylase [Enteroco...  76.6    2e-12
ref|ZP_05100592.1|  A/G-specific adenine glycosylase [Roseobac...  76.6    2e-12
ref|YP_002314721.1|  A/G-specific adenine glycosylase [Anoxyba...  76.6    2e-12
ref|ZP_05574233.1|  A/G-specific adenine glycosylase MutY [Ent...  76.3    2e-12
ref|ZP_05582038.1|  A/G-specific adenine glycosylase MutY [Ent...  76.3    2e-12
ref|ZP_04437901.1|  A/G-specific adenine glycosylase [Enteroco...  76.3    2e-12
ref|ZP_05576090.1|  A/G-specific adenine glycosylase MutY [Ent...  76.3    2e-12
ref|ZP_05565216.1|  A/G-specific adenine glycosylase MutY [Ent...  76.3    2e-12
ref|ZP_05503913.1|  A/G-specific adenine glycosylase MutY [Ent...  76.3    2e-12
ref|ZP_05559372.1|  A/G-specific adenine glycosylase [Enteroco...  76.3    2e-12
ref|YP_001753412.1|  A/G-specific adenine glycosylase [Methylo...  76.3    2e-12
ref|ZP_05598668.1|  A/G-specific adenine glycosylase [Enteroco...  76.3    2e-12
ref|ZP_02152774.1|  A/G-specific adenine glycosylase, putative...  76.3    2e-12
ref|ZP_05585255.1|  A/G-specific adenine glycosylase mutY [Ent...  76.3    2e-12
ref|YP_988733.1|  A/G-specific adenine glycosylase [Bartonella...  76.3    2e-12
ref|ZP_05060867.1|  A/G-specific adenine glycosylase [gamma pr...  76.3    2e-12
ref|YP_508337.1|  A/G-specific DNA-adenine glycosylase [Jannas...  76.3    2e-12
ref|ZP_05830020.1|  A/G-specific adenine glycosylase [Acinetob...  75.9    2e-12
ref|YP_001238400.1|  A/G-specific DNA-adenine glycosylase [Bra...  75.9    2e-12
ref|YP_003471320.1|  A/G-specific adenine glycosylase [Staphyl...  75.9    2e-12
ref|ZP_04061029.1|  A/G-specific adenine glycosylase [Staphylo...  75.9    2e-12
emb|CAL57086.1|  adenine-DNA glycosylase-related / MYH-related...  75.9    2e-12
ref|YP_001042009.1|  A/G-specific adenine glycosylase [Rhodoba...  75.9    2e-12
ref|ZP_01035051.1|  A/G-specific adenine glycosylase [Roseovar...  75.9    2e-12
ref|ZP_03949554.1|  A/G-specific adenine glycosylase [Enteroco...  75.9    3e-12
ref|YP_463179.1|  a/g-specific DNA glycosylase [Syntrophus aci...  75.5    3e-12
ref|ZP_01721754.1|  adenine glycosylase [Bacillus sp. B14905] ...  75.5    3e-12
ref|ZP_00957687.1|  hypothetical protein OA2633_14171 [Oceanic...  75.5    3e-12
ref|ZP_01754376.1|  A/G-specific adenine glycosylase [Roseobac...  75.5    3e-12
ref|YP_001032993.1|  A/G-specific adenine glycosylase [Lactoco...  75.5    3e-12
ref|YP_001204099.1|  adenine glycosylase mutY [Bradyrhizobium ...  75.5    3e-12
ref|ZP_02169216.1|  A/G-specific DNA glycosylase-like protein ...  75.5    3e-12
ref|ZP_01740605.1|  A/G-specific adenine glycosylase [Rhodobac...  75.5    3e-12
ref|YP_915885.1|  HhH-GPD family protein [Paracoccus denitrifi...  75.5    3e-12
ref|NP_970174.1|  A/G-specific adenine glycosylase [Bdellovibr...  75.5    4e-12
ref|ZP_05826149.1|  A/G specific adenine glycosylase [Acinetob...  75.5    4e-12
ref|NP_691817.1|  A/G-specific adenine glycosylase [Oceanobaci...  75.1    4e-12
ref|ZP_06058374.1|  A/G specific adenine glycosylase [Acinetob...  75.1    4e-12
ref|ZP_01055481.1|  A/G-specific adenine glycosylase [Roseobac...  75.1    4e-12
ref|YP_094933.1|  A/G specific adenine glycosylase [Legionella...  75.1    4e-12
ref|YP_001708624.1|  A/G specific adenine glycosylase [Acineto...  75.1    5e-12
gb|ABO13821.2|  A/G specific adenine glycosylase [Acinetobacte...  75.1    5e-12
ref|NP_769139.1|  A/G-specific adenine glycosylase [Bradyrhizo...  75.1    5e-12
ref|ZP_06692767.1|  conserved hypothetical protein [Acinetobac...  75.1    5e-12
ref|ZP_06785829.1|  A/G specific adenine glycosylase [Acinetob...  74.7    5e-12
ref|ZP_04662085.1|  A/G-specific DNA glycosylase [Acinetobacte...  74.7    5e-12
ref|YP_001848286.1|  A/G-specific DNA glycosylase [Acinetobact...  74.7    5e-12
ref|ZP_05033674.1|  A/G-specific adenine glycosylase [Brevundi...  74.7    5e-12
ref|ZP_05341000.1|  A/G-specific adenine glycosylase [Thalassi...  74.7    5e-12
ref|ZP_04433635.1|  A/G-specific adenine glycosylase [Enteroco...  74.7    6e-12
ref|YP_002502685.1|  A/G-specific adenine glycosylase [Methylo...  74.7    6e-12
ref|YP_001086423.1|  A/G specific adenine glycosylase [Acineto...  74.7    6e-12
ref|YP_446225.1|  A/G-specific adenine glycosylase [Salinibact...  74.7    6e-12
ref|YP_001696071.1|  A/G-specific adenine DNA glycosylase [Lys...  74.7    6e-12
ref|ZP_01015839.1|  A/G-specific adenine glycosylase [Rhodobac...  74.3    6e-12
ref|YP_001993942.1|  A/G-specific adenine glycosylase [Rhodops...  74.3    7e-12
ref|YP_001251662.1|  A/G specific adenine glycosylase [Legione...  74.3    7e-12
ref|ZP_02326968.1|  A/G-specific adenine glycosylase [Paenibac...  74.3    7e-12
ref|YP_001531378.1|  A/G-specific adenine glycosylase [Dinoros...  74.3    7e-12
ref|ZP_01548181.1|  probable a/g-specific adenine glycosylase ...  74.3    7e-12
ref|NP_949821.1|  A/G-specific adenine glycosylase [Rhodopseud...  74.3    7e-12
ref|ZP_06054622.1|  A/G-specific adenine glycosylase [alpha pr...  74.3    7e-12
ref|YP_126289.1|  hypothetical protein lpl0930 [Legionella pne...  74.3    7e-12
ref|YP_001685986.1|  A/G-specific adenine glycosylase [Cauloba...  74.3    8e-12
ref|ZP_05425473.1|  A/G-specific adenine glycosylase MutY [Ent...  74.3    8e-12
ref|ZP_01045244.1|  A/G-specific adenine glycosylase MutY [Nit...  74.3    8e-12
ref|YP_001773607.1|  A/G-specific adenine glycosylase [Methylo...  74.3    8e-12
ref|ZP_06173326.1|  A/G-specific adenine glycosylase [Brevundi...  73.9    8e-12
ref|ZP_05473637.1|  A/G-specific adenine glycosylase MutY [Ent...  73.9    8e-12
ref|ZP_05082098.1|  A/G-specific adenine glycosylase [beta pro...  73.9    9e-12
ref|ZP_05123438.1|  A/G-specific adenine glycosylase [Rhodobac...  73.9    9e-12
ref|YP_002129421.1|  A/G-specific adenine glycosylase [Phenylo...  73.9    1e-11
ref|ZP_03614055.1|  A/G-specific adenine glycosylase [Staphylo...  73.6    1e-11
ref|ZP_06122387.1|  A/G-specific adenine glycosylase [Caulobac...  73.6    1e-11
ref|NP_906961.1|  A/G-specific adenine glycosylase [Wolinella ...  73.6    1e-11
ref|ZP_05741969.1|  A/G-specific adenine glycosylase [Siliciba...  73.6    1e-11
ref|ZP_05645502.1|  A/G-specific adenine glycosylase [Enteroco...  73.6    1e-11
ref|YP_163412.1|  A/G-specific adenine glycosylase [Zymomonas ...  73.6    1e-11
ref|YP_003226664.1|  A/G-specific adenine glycosylase [Zymomon...  73.2    1e-11
ref|YP_614639.1|  A/G-specific DNA-adenine glycosylase [Rueger...  73.2    1e-11
ref|ZP_05074550.1|  A/G-specific adenine glycosylase [Rhodobac...  73.2    2e-11
ref|YP_048065.1|  A/G specific adenine glycosylase [Acinetobac...  72.8    2e-11
ref|YP_003240954.1|  A/G-specific adenine glycosylase [Geobaci...  72.8    2e-11
ref|ZP_05655129.1|  A/G-specific adenine glycosylase [Enteroco...  72.8    2e-11
ref|YP_319210.1|  A/G-specific adenine glycosylase MutY [Nitro...  72.8    2e-11
ref|ZP_05986419.1|  A/G-specific adenine glycosylase [Neisseri...  72.8    2e-11
ref|ZP_01173029.1|  YfhQ [Bacillus sp. NRRL B-14911] >gb|EAR64...  72.8    2e-11
ref|YP_680708.1|  A/G-specific adenine glycosylase, putative [...  72.8    2e-11
ref|YP_002289955.1|  A/G-specific adenine glycosylase [Oligotr...  72.8    2e-11
ref|YP_001420487.1|  YfhQ [Bacillus amyloliquefaciens FZB42] >...  72.8    2e-11
ref|YP_001411981.1|  A/G-specific adenine glycosylase [Parviba...  72.8    2e-11
ref|ZP_04817395.1|  A/G-specific adenine glycosylase [Staphylo...  72.4    3e-11
ref|YP_075556.1|  A/G-specific adenine glycosylase [Symbiobact...  72.4    3e-11
ref|ZP_04792498.1|  A/G-specific adenine glycosylase [Desulfov...  72.4    3e-11
ref|NP_419196.1|  A/G-specific adenine glycosylase [Caulobacte...  72.4    3e-11
ref|YP_968136.1|  A/G-specific adenine glycosylase [Desulfovib...  72.4    3e-11
ref|YP_009506.1|  A/G-specific adenine glycosylase [Desulfovib...  72.4    3e-11
ref|ZP_01877196.1|  adenine glycosylase [Lentisphaera araneosa...  72.4    3e-11
ref|YP_003586988.1|  A/G-specific adenine glycosylase [Zunongw...  72.0    3e-11
ref|ZP_03056536.1|  A/G-specific adenine glycosylase [Bacillus...  72.0    3e-11
ref|YP_003399533.1|  A/G-specific adenine glycosylase [Acidami...  72.0    3e-11
emb|CBH18164.1|  A/G-specific adenine glycosylase, putative [T...  72.0    3e-11
ref|ZP_01746660.1|  A/G-specific adenine glycosylase [Sagittul...  72.0    3e-11
ref|ZP_03529944.1|  A/G-specific adenine glycosylase [Rhizobiu...  72.0    4e-11
ref|YP_003263720.1|  A/G-specific adenine glycosylase [Halothi...  72.0    4e-11
ref|ZP_02140530.1|  A/G-specific adenine glycosylase, putative...  72.0    4e-11
ref|XP_829209.1|  A/G-specific adenine glycosylase [Trypanosom...  71.6    4e-11
ref|ZP_04760268.1|  A/G-specific adenine glycosylase [Zymomona...  71.6    4e-11
ref|ZP_06070049.1|  A/G-specific adenine glycosylase [Acinetob...  71.6    4e-11
ref|YP_003013837.1|  A/G-specific adenine glycosylase [Paeniba...  71.6    5e-11
ref|ZP_01043899.1|  A/G-specific DNA glycosylase [Idiomarina b...  71.6    5e-11
ref|ZP_04854928.1|  A/G-specific adenine glycosylase [Paenibac...  71.6    5e-11
ref|ZP_01113485.1|  A/G-specific adenine glycosylase [Reinekea...  71.2    5e-11
ref|ZP_01108226.1|  A/G-specific adenine glycosylase [Flavobac...  71.2    5e-11
ref|ZP_04679088.1|  A/G-specific adenine glycosylase [Staphylo...  71.2    5e-11
ref|ZP_06361011.1|  A/G-specific adenine glycosylase [Rhodopse...  71.2    5e-11
ref|YP_578422.1|  A/G-specific adenine glycosylase [Nitrobacte...  71.2    6e-11
ref|YP_003454327.1|  A/G-specific adenine glycosylase [Legione...  71.2    6e-11
ref|ZP_06186075.1|  A/G-specific adenine glycosylase [Legionel...  71.2    6e-11
ref|ZP_04216077.1|  hypothetical protein bcere0022_4230 [Bacil...  71.2    6e-11
ref|ZP_05664909.1|  A/G-specific adenine glycosylase [Enteroco...  71.2    6e-11
ref|ZP_06067134.1|  A/G-specific adenine glycosylase [Acinetob...  71.2    6e-11
ref|ZP_01880442.1|  A/G-specific adenine glycosylase [Roseovar...  71.2    6e-11
ref|ZP_00604694.1|  A/G-specific adenine glycosylase MutY [Ent...  71.2    6e-11
ref|YP_002634531.1|  putative A/G-specific adenine glycosylase...  71.2    7e-11
ref|ZP_06726114.1|  A/G-specific adenine glycosylase [Acinetob...  71.2    7e-11
ref|ZP_06673900.1|  A/G-specific adenine glycosylase [Enteroco...  70.9    7e-11
ref|ZP_06680603.1|  A/G-specific adenine glycosylase [Enteroco...  70.9    7e-11
ref|YP_174808.1|  A/G-specific adenine DNA glycosylase [Bacill...  70.9    7e-11
ref|ZP_03823768.1|  A/G specific adenine glycosylase [Acinetob...  70.9    7e-11
ref|ZP_01864368.1|  hypothetical protein ED21_29994 [Erythroba...  70.9    8e-11
ref|YP_001486054.1|  adenine glycosylase [Bacillus pumilus SAF...  70.9    8e-11
ref|YP_002296760.1|  A/G-specific adenine glycosylase [Rhodosp...  70.9    8e-11
ref|ZP_05678645.1|  A/G-specific adenine glycosylase [Enteroco...  70.9    8e-11
ref|YP_002001805.1|  putative adenine glycosylase [Neisseria g...  70.9    8e-11
ref|ZP_04056814.1|  A/G-specific adenine glycosylase [Capnocyt...  70.9    8e-11
ref|ZP_01157351.1|  A/G-specific adenine glycosylase [Oceanico...  70.9    8e-11
ref|ZP_04729842.1|  putative adenine glycosylase [Neisseria go...  70.9    9e-11
ref|ZP_01117399.1|  putative A/G-specific adenine glycosylase ...  70.9    9e-11
dbj|BAI84382.1|  hypothetical protein [Bacillus subtilis subsp...  70.9    9e-11
ref|NP_388743.1|  A/G-specific adenine glycosylase or DNA-(apu...  70.9    9e-11
ref|ZP_04720965.1|  putative adenine glycosylase [Neisseria go...  70.9    9e-11
ref|ZP_06259104.1|  A/G-specific adenine glycosylase [Veillone...  70.9    9e-11
ref|YP_001838673.1|  putative A/G-specific DNA glycosylase [Le...  70.5    9e-11
ref|ZP_01000907.1|  A/G-specific adenine glycosylase [Oceanico...  70.5    1e-10
ref|YP_673330.1|  A/G-specific DNA-adenine glycosylase [Mesorh...  70.5    1e-10
ref|YP_207842.1|  putative adenine glycosylase [Neisseria gono...  70.5    1e-10
ref|ZP_00959619.1|  A/G-specific adenine glycosylase [Roseovar...  70.5    1e-10
ref|ZP_06130900.1|  A/G-specific adenine glycosylase [Neisseri...  70.5    1e-10
ref|ZP_05794224.1|  putative adenine glycosylase [Neisseria go...  70.5    1e-10
gb|EEE52948.1|  hypothetical protein OsJ_35582 [Oryza sativa J...  70.5    1e-10
ref|YP_630211.1|  A/G-specific adenine glycosylase [Myxococcus...  70.5    1e-10
ref|YP_002948645.1|  A/G-specific adenine glycosylase [Geobaci...  70.5    1e-10
ref|YP_003083410.1|  A/G-specific adenine glycosylase [Neisser...  70.5    1e-10
ref|ZP_02438097.1|  hypothetical protein CLOSS21_00537 [Clostr...  70.5    1e-10
ref|ZP_05676705.1|  A/G-specific adenine glycosylase [Enteroco...  70.5    1e-10
ref|XP_513125.2|  PREDICTED: mutY homolog isoform 10 [Pan trog...  70.1    1e-10
ref|ZP_05668224.1|  A/G-specific adenine glycosylase [Enteroco...  70.1    1e-10
ref|ZP_03980595.1|  A/G-specific adenine glycosylase [Enteroco...  70.1    1e-10
ref|ZP_05079406.1|  A/G-specific adenine glycosylase [Rhodobac...  70.1    1e-10
ref|ZP_04598837.1|  hypothetical protein VEIDISOL_00237 [Veill...  70.1    1e-10
ref|YP_003120636.1|  A/G-specific adenine glycosylase [Chitino...  70.1    1e-10
ref|XP_001155582.1|  PREDICTED: mutY homolog isoform 5 [Pan tr...  70.1    1e-10
ref|XP_001155397.1|  PREDICTED: mutY homolog isoform 2 [Pan tr...  70.1    1e-10
ref|YP_001599440.1|  A/G-specific adenine glycosylase [Neisser...  70.1    1e-10
ref|XP_001155767.1|  PREDICTED: mutY homolog isoform 8 [Pan tr...  70.1    1e-10
ref|XP_001155827.1|  PREDICTED: mutY homolog isoform 9 [Pan tr...  70.1    1e-10
dbj|BAA89339.1|  hMYHalpha4 [Homo sapiens] >dbj|BAA89345.1| hM...  70.1    1e-10
ref|XP_001155201.1|  PREDICTED: mutY homolog isoform 1 [Pan tr...  70.1    1e-10
ref|YP_390390.1|  A/G-specific adenine glycosylase [Thiomicros...  70.1    1e-10
ref|ZP_06759524.1|  A/G-specific adenine glycosylase [Veillone...  70.1    1e-10
ref|XP_001155517.1|  PREDICTED: mutY homolog isoform 4 [Pan tr...  70.1    2e-10
ref|YP_589883.1|  A/G-specific DNA glycosylase [Candidatus Kor...  70.1    2e-10
ref|YP_496239.1|  A/G-specific DNA-adenine glycosylase [Novosp...  70.1    2e-10
ref|YP_002755078.1|  A/G-specific adenine glycosylase, putativ...  69.7    2e-10
ref|NP_001041636.1|  a/G-specific adenine DNA glycosylase isof...  69.7    2e-10
ref|YP_001166281.1|  A/G-specific adenine glycosylase [Rhodoba...  69.7    2e-10
dbj|BAA89337.1|  hMYHalpha2 [Homo sapiens] >emb|CAI21720.1| mu...  69.7    2e-10
dbj|BAE02476.1|  unnamed protein product [Macaca fascicularis]     69.7    2e-10
ref|NP_001041638.1|  a/G-specific adenine DNA glycosylase isof...  69.7    2e-10
ref|ZP_05982298.1|  A/G-specific adenine glycosylase [Neisseri...  69.7    2e-10
ref|NP_001041637.1|  a/G-specific adenine DNA glycosylase isof...  69.7    2e-10
ref|NP_036354.1|  a/G-specific adenine DNA glycosylase isoform...  69.7    2e-10
ref|NP_001121897.1|  a/G-specific adenine DNA glycosylase isof...  69.7    2e-10
ref|YP_033292.1|  A/G-specific adenine glycosylase [Bartonella...  69.7    2e-10
dbj|BAA89340.1|  hMYHbeta1 [Homo sapiens] >gb|EAX06999.1| mutY...  69.7    2e-10
ref|XP_001101469.1|  PREDICTED: mutY homolog isoform 2 [Macaca...  69.7    2e-10
ref|XP_001101555.1|  PREDICTED: mutY homolog isoform 3 [Macaca...  69.7    2e-10
ref|YP_001373793.1|  A/G-specific adenine glycosylase [Bacillu...  69.7    2e-10
gb|EAX07001.1|  mutY homolog (E. coli), isoform CRA_h [Homo sa...  69.7    2e-10
emb|CAI21716.1|  mutY homolog (E. coli) [Homo sapiens]             69.7    2e-10
emb|CAI21717.1|  mutY homolog (E. coli) [Homo sapiens]             69.7    2e-10
ref|XP_001375944.1|  PREDICTED: similar to mutY homolog [Monod...  69.7    2e-10
ref|ZP_01302703.1|  HhH-GPD [Sphingomonas sp. SKA58] >gb|EAT09...  69.7    2e-10
emb|CAI21721.1|  mutY homolog (E. coli) [Homo sapiens]             69.3    2e-10
ref|ZP_04149628.1|  hypothetical protein bpmyx0001_4160 [Bacil...  69.3    2e-10
ref|YP_003461710.1|  A/G-specific adenine glycosylase [Thioalk...  69.3    2e-10
ref|YP_428333.1|  A/G-specific DNA-adenine glycosylase [Rhodos...  69.3    2e-10
ref|YP_001529400.1|  A/G-specific adenine glycosylase [Desulfo...  69.3    2e-10
ref|YP_864167.1|  A/G-specific DNA-adenine glycosylase [Magnet...  69.3    2e-10
ref|ZP_05359300.1|  A/G-specific adenine glycosylase [Acinetob...  69.3    2e-10
ref|XP_001422621.1|  predicted protein [Ostreococcus lucimarin...  69.3    2e-10
ref|YP_003576398.1|  A/G-specific adenine glycosylase [Rhodoba...  69.3    3e-10
ref|ZP_04155492.1|  hypothetical protein bmyco0003_4300 [Bacil...  68.9    3e-10
ref|ZP_06073753.1|  A/G-specific adenine glycosylase [Acinetob...  68.9    3e-10
ref|NP_637772.1|  A/G-specific adenine glycosylase [Xanthomona...  68.9    3e-10
ref|YP_032055.1|  A/G-specific adenine glycosylase [Bartonella...  68.9    3e-10
ref|ZP_03494546.1|  A/G-specific adenine glycosylase [Alicyclo...  68.9    3e-10
ref|YP_001903153.1|  A/G-specific adenine glycosylase [Xanthom...  68.9    3e-10
ref|ZP_01466007.1|  A/G-specific adenine glycosylase [Stigmate...  68.9    3e-10
ref|YP_168644.1|  A/G-specific adenine glycosylase [Ruegeria p...  68.9    3e-10
ref|YP_003069448.1|  A/G-specific adenine glycosylase [Methylo...  68.9    3e-10
ref|YP_002964406.1|  A/G-specific adenine glycosylase [Methylo...  68.9    3e-10
ref|ZP_01444282.1|  A/G-specific adenine glycosylase [Roseovar...  68.9    3e-10
ref|YP_301015.1|  putative A G-specific DNA glycosylase [Staph...  68.9    3e-10
ref|YP_002605887.1|  MutY [Desulfobacterium autotrophicum HRM2...  68.9    3e-10
ref|YP_001926061.1|  A/G-specific adenine glycosylase [Methylo...  68.9    3e-10
ref|YP_001355677.1|  A/G-specific adenine glycosylase [Nitrati...  68.9    3e-10
ref|XP_002159248.1|  PREDICTED: similar to mutY homolog, parti...  68.9    3e-10
ref|YP_002422252.1|  A/G-specific adenine glycosylase [Methylo...  68.6    4e-10
ref|YP_001640638.1|  A/G-specific adenine glycosylase [Methylo...  68.6    4e-10
ref|XP_539632.2|  PREDICTED: similar to A/G-specific adenine D...  68.6    4e-10
ref|YP_003312615.1|  A/G-specific adenine glycosylase [Veillon...  68.6    4e-10
ref|ZP_06757749.1|  A/G-specific adenine glycosylase [Veillone...  68.6    4e-10
ref|YP_001379093.1|  A/G-specific adenine glycosylase [Anaerom...  68.6    4e-10
ref|ZP_06363109.1|  A/G-specific adenine glycosylase [Bacillus...  68.6    4e-10
ref|YP_003189027.1|  DNA glycosylase A/G-specific MutY [Acetob...  68.6    4e-10
ref|ZP_03718984.1|  hypothetical protein NEIFLAOT_00801 [Neiss...  68.6    4e-10
ref|ZP_05109930.1|  A/G specific adenine glycosylase [Legionel...  68.6    4e-10
emb|CAI21715.1|  mutY homolog (E. coli) [Homo sapiens]             68.2    5e-10
gb|ABE99595.1|  MutY [Neisseria meningitidis]                      68.2    5e-10
ref|YP_975344.1|  adenine glycosylase [Neisseria meningitidis ...  68.2    5e-10
ref|YP_002770507.1|  probable A/G-specific adenine glycosylase...  68.2    5e-10
ref|NP_001150481.1|  A/G-specific adenine DNA glycosylase [Zea...  68.2    6e-10
ref|ZP_05842059.1|  HhH-GPD family protein [Rhodobacter sp. SW...  67.8    6e-10
ref|YP_002433612.1|  A/G-specific adenine glycosylase [Desulfa...  67.8    6e-10
ref|ZP_01311161.1|  A/G-specific adenine glycosylase [Desulfur...  67.8    6e-10
ref|XP_001496280.1|  PREDICTED: mutY homolog (E. coli) isoform...  67.8    7e-10
ref|ZP_05373359.1|  A/G-specific adenine glycosylase [Geobacil...  67.8    7e-10
gb|ACN26398.1|  unknown [Zea mays]                                 67.8    7e-10
ref|ZP_04758375.1|  A/G-specific adenine glycosylase [Neisseri...  67.8    7e-10
ref|NP_681868.1|  adenine glycosylase [Thermosynechococcus elo...  67.8    7e-10
ref|YP_002953011.1|  A/G-specific adenine glycosylase [Desulfo...  67.8    8e-10
ref|ZP_04432199.1|  A/G-specific adenine glycosylase [Bacillus...  67.8    8e-10
ref|ZP_06369494.1|  A/G-specific adenine glycosylase [Desulfov...  67.8    8e-10
ref|YP_003183871.1|  A/G-specific adenine glycosylase [Alicycl...  67.4    8e-10
ref|ZP_01049918.1|  putative A/G-specific adenine glycosylase ...  67.4    8e-10
ref|ZP_06812194.1|  A/G-specific adenine glycosylase [Geobacil...  67.4    8e-10
ref|NP_893968.1|  adenine glycosylase [Prochlorococcus marinus...  67.4    8e-10
ref|ZP_05786270.1|  A/G-specific adenine glycosylase [Siliciba...  67.4    8e-10
emb|CBA04033.1|  putative A/G-specific adenine glycosylase [Ne...  67.4    9e-10
ref|ZP_01901010.1|  A/G-specific adenine glycosylase [Roseobac...  67.4    9e-10
ref|YP_344255.1|  A/G-specific adenine glycosylase MutY [Nitro...  67.4    9e-10
ref|YP_849904.1|  A/G-specific adenine glycosylase family prot...  67.4    9e-10
gb|ABE99596.1|  MutY [Neisseria meningitidis] >gb|ABE99599.1| ...  67.4    1e-09
ref|YP_432632.1|  A/G-specific adenine glycosylase [Hahella ch...  67.4    1e-09
ref|ZP_05984371.1|  A/G-specific adenine glycosylase [Neisseri...  67.4    1e-09
gb|ABE99597.1|  MutY [Neisseria meningitidis]                      67.4    1e-09
ref|YP_001831887.1|  A/G-specific adenine glycosylase [Beijeri...  67.0    1e-09
ref|ZP_05613739.1|  A/G-specific adenine glycosylase [Faecalib...  67.0    1e-09
ref|NP_001039600.2|  a/G-specific adenine DNA glycosylase [Bos...  67.0    1e-09
ref|ZP_05648790.1|  A/G-specific adenine glycosylase [Enteroco...  67.0    1e-09
ref|YP_376161.1|  Mutator MutT [Synechococcus sp. CC9902] >gb|...  67.0    1e-09
ref|XP_002505637.1|  predicted protein [Micromonas sp. RCC299]...  67.0    1e-09
ref|YP_001016192.1|  adenine glycosylase [Prochlorococcus mari...  67.0    1e-09
ref|ZP_05115968.1|  base excision DNA repair protein, HhH-GPD ...  67.0    1e-09
ref|NP_642868.1|  A/G-specific adenine glycosylase [Xanthomona...  67.0    1e-09
ref|ZP_01053548.1|  HhH-GPD superfamily base excision DNA repa...  67.0    1e-09
ref|YP_003072017.1|  A/G-specific adenine glycosylase [Teredin...  66.6    1e-09
ref|ZP_01751971.1|  A/G-specific adenine glycosylase [Roseobac...  66.6    1e-09
ref|ZP_05781419.1|  A/G-specific adenine glycosylase [Citreice...  66.6    1e-09
ref|ZP_01062161.1|  putative A/G-specific adenine glycosylase ...  66.6    1e-09
ref|XP_686698.2|  PREDICTED: si:ch211-241d21.4 [Danio rerio] >...  66.6    1e-09
ref|ZP_01225335.1|  adenine glycosylase [marine gamma proteoba...  66.6    1e-09
ref|NP_241797.1|  adenine glycosylase [Bacillus halodurans C-1...  66.6    1e-09
emb|CAA04675.1|  adenine glycosylase [Neisseria meningitidis]      66.6    2e-09
gb|ABE99598.1|  MutY [Neisseria meningitidis]                      66.6    2e-09
ref|ZP_06288846.1|  A/G-specific adenine glycosylase [Prevotel...  66.6    2e-09
ref|NP_274410.1|  A/G-specific adenine glycosylase [Neisseria ...  66.6    2e-09
gb|EES52900.1|  putative A/G-specific DNA glycosylase [Leptosp...  66.6    2e-09
ref|ZP_04771341.1|  A/G-specific adenine glycosylase [Asticcac...  66.6    2e-09
ref|YP_002342922.1|  adenine glycosylase [Neisseria meningitid...  66.6    2e-09
emb|CAZ87127.1|  adenine DNA glycosylase [Thiomonas sp.]           66.6    2e-09
ref|ZP_03225436.1|  adenine glycosylase [Bacillus coahuilensis...  66.6    2e-09
ref|ZP_06483296.1|  A/G-specific adenine glycosylase [Xanthomo...  66.6    2e-09
ref|YP_001015900.1|  adenine glycosylase [Prochlorococcus mari...  66.6    2e-09
ref|YP_002561002.1|  A/G-specific adenine glycosylase homolog ...  66.2    2e-09
ref|ZP_05978650.2|  A/G-specific adenine glycosylase [Neisseri...  66.2    2e-09
ref|ZP_04201513.1|  hypothetical protein bcere0025_4220 [Bacil...  66.2    2e-09
ref|YP_007088.1|  putative A/G-specific adenine glycosylase, m...  66.2    2e-09
gb|EFB27510.1|  hypothetical protein PANDA_008126 [Ailuropoda ...  65.9    2e-09
ref|ZP_06751819.1|  putative A/G-specific adenine glycosylase ...  65.9    2e-09
ref|ZP_06489744.1|  A/G-specific adenine glycosylase [Xanthomo...  65.9    2e-09
ref|YP_292398.1|  A/G-specific DNA-adenine glycosylase [Prochl...  65.9    2e-09
ref|YP_003526479.1|  A/G-specific adenine glycosylase [Nitroso...  65.9    2e-09
ref|XP_002191220.1|  PREDICTED: hypothetical protein [Taeniopy...  65.9    2e-09
ref|ZP_01736699.1|  A/G-specific adenine glycosylase [Marinoba...  65.9    3e-09
ref|ZP_06200063.1|  conserved hypothetical protein [Bacteroide...  65.9    3e-09
ref|YP_002923265.1|  adenine DNA glycosylase [Candidatus Hamil...  65.9    3e-09
gb|AAI28729.1|  Mutyh protein [Rattus norvegicus]                  65.9    3e-09
gb|ABZ08472.1|  putative HhH-GPD superfamily base excision DNA...  65.9    3e-09
ref|YP_002946216.1|  A/G-specific adenine glycosylase [Variovo...  65.9    3e-09
gb|EAY57782.1|  putative A/G-specific DNA glycosylase [Leptosp...  65.5    3e-09
gb|AAI05491.1|  MutY homolog (E. coli) [Bos taurus]                65.5    3e-09
gb|AAC36207.1|  A/G-specific adenine DNA glycosylase [Schizosa...  65.5    3e-09
ref|NP_594145.1|  adenine DNA glycosylase [Schizosaccharomyces...  65.5    3e-09
ref|NP_830341.1|  A/G-specific adenine glycosylase [Bacillus c...  65.5    3e-09
emb|CAX49864.1|  A/G-specific adenine glycosylase [Neisseria m...  65.5    3e-09
ref|ZP_04118717.1|  hypothetical protein bthur0005_4740 [Bacil...  65.5    3e-09
gb|EDL90244.1|  mutY homolog (E. coli), isoform CRA_a [Rattus ...  65.5    3e-09
ref|ZP_01909479.1|  A/G-specific adenine glycosylase [Plesiocy...  65.5    3e-09
ref|YP_078109.1|  putative A/G-specific adenine glycosylase Yf...  65.5    3e-09
ref|YP_003560917.1|  A/G-specific adenine glycosylase [Bacillu...  65.5    3e-09
emb|CBK80427.1|  A/G-specific adenine glycosylase [Coprococcus...  65.5    3e-09
ref|YP_002886780.1|  A/G-specific adenine glycosylase [Exiguob...  65.5    3e-09
gb|EDL90245.1|  mutY homolog (E. coli), isoform CRA_b [Rattus ...  65.5    3e-09
ref|ZP_03229420.1|  A/G-specific adenine glycosylase [Bacillus...  65.5    3e-09
ref|YP_113351.1|  A/G-specific adenine glycosylase [Methylococ...  65.5    4e-09
ref|ZP_01893827.1|  A/G specific adenine glycosylase [Marinoba...  65.5    4e-09
ref|ZP_01016287.1|  Putative mutY, A/G-specific adenine glycos...  65.1    4e-09
ref|YP_003551423.1|  A/G-specific adenine glycosylase [alpha p...  65.1    4e-09
ref|ZP_05027215.1|  A/G-specific adenine glycosylase [Microcol...  65.1    4e-09
ref|YP_960437.1|  A/G-specific adenine glycosylase [Marinobact...  65.1    4e-09
ref|ZP_05058593.1|  base excision DNA repair protein, HhH-GPD ...  65.1    4e-09
ref|ZP_04124757.1|  hypothetical protein bthur0004_4830 [Bacil...  65.1    4e-09
ref|NP_573513.2|  a/G-specific adenine DNA glycosylase [Mus mu...  65.1    4e-09
ref|ZP_00739588.1|  A/G-specific adenine DNA glycosylase [Baci...  65.1    4e-09
ref|ZP_02062217.1|  A/G-specific adenine glycosylase [Ricketts...  65.1    4e-09
ref|YP_001234629.1|  HhH-GPD family protein [Acidiphilium cryp...  65.1    4e-09
gb|AAH57942.1|  MutY homolog (E. coli) [Mus musculus] >dbj|BAE...  65.1    4e-09
sp|Q99P21.1|MUTYH_MOUSE  RecName: Full=A/G-specific adenine DN...  65.1    5e-09
ref|ZP_04304440.1|  hypothetical protein bcere0005_4250 [Bacil...  65.1    5e-09
gb|EDL30583.1|  mutY homolog (E. coli), isoform CRA_c [Mus mus...  65.1    5e-09
ref|ZP_02181631.1|  putative A/G-specific adenine glycosylase ...  65.1    5e-09
ref|ZP_05085160.1|  A/G-specific adenine glycosylase [Pseudovi...  64.7    5e-09
gb|EDL30582.1|  mutY homolog (E. coli), isoform CRA_b [Mus mus...  64.7    5e-09
dbj|BAC98379.1|  mutY homolog beta [Mus musculus]                  64.7    5e-09
ref|NP_579850.1|  a/G-specific adenine DNA glycosylase [Rattus...  64.7    5e-09
ref|YP_171566.1|  mutator MutT protein [Synechococcus elongatu...  64.7    5e-09
ref|NP_878546.1|  A/G-specific adenine glycosylase [Candidatus...  64.7    5e-09
ref|ZP_01254931.1|  putative A/G-specific adenine glycosylase ...  64.7    5e-09
ref|YP_003464894.1|  A/G-specific adenine glycosylase family p...  64.7    6e-09
ref|ZP_01692102.1|  A/G-specific adenine glycosylase [Microsci...  64.7    6e-09
ref|ZP_03682295.1|  hypothetical protein CATMIT_00928 [Catenib...  64.7    6e-09
ref|ZP_02242832.1|  A/G-specific adenine glycosylase [Xanthomo...  64.7    6e-09
ref|ZP_03324372.1|  hypothetical protein BIFCAT_01160 [Bifidob...  64.7    6e-09
ref|ZP_01859756.1|  hypothetical protein BSG1_05639 [Bacillus ...  64.7    6e-09
ref|ZP_05353478.1|  putative DNA glycosylase [Chlamydia tracho...  64.7    6e-09
ref|YP_380430.1|  A/G-specific DNA-adenine glycosylase [Synech...  64.7    6e-09
ref|XP_002321221.1|  predicted protein [Populus trichocarpa] >...  64.7    6e-09
ref|YP_760615.1|  A/G-specific adenine glycosylase [Hyphomonas...  64.7    6e-09
ref|ZP_05095911.1|  A/G-specific adenine glycosylase [marine g...  64.3    7e-09
ref|ZP_06406515.1|  A/G-specific adenine glycosylase [Prevotel...  64.3    7e-09
ref|YP_001560454.1|  A/G-specific adenine glycosylase [Clostri...  64.3    8e-09
ref|ZP_00949484.1|  putative A/G-specific adenine glycosylase ...  64.3    8e-09
ref|ZP_01165380.1|  adenine glycosylase [Oceanospirillum sp. M...  64.3    8e-09
ref|ZP_05380474.1|  putative DNA glycosylase [Chlamydia tracho...  64.3    8e-09
ref|NP_219610.1|  A/G-specific adenine glycosylase [Chlamydia ...  64.3    8e-09
ref|YP_001654446.1|  putative DNA glycosylase [Chlamydia trach...  64.3    8e-09
ref|YP_087509.1|  MutY protein [Mannheimia succiniciproducens ...  64.3    8e-09
ref|ZP_02420424.1|  hypothetical protein ANACAC_03041 [Anaeros...  63.9    9e-09
ref|YP_327908.1|  A/G-specific adenine DNA glycosylase [Chlamy...  63.9    9e-09
ref|YP_556924.1|  A/G-specific DNA-adenine glycosylase [Burkho...  63.9    9e-09
ref|YP_364483.1|  A/G-specific adenine glycosylase [Xanthomona...  63.9    9e-09
ref|ZP_05747752.1|  A/G-specific adenine glycosylase [Erysipel...  63.9    9e-09
ref|ZP_02160566.1|  A/G-specific adenine glycosylase [Kordia a...  63.9    9e-09
ref|ZP_01076244.1|  A/G-specific adenine glycosylase [Marinomo...  63.9    9e-09
ref|YP_001643333.1|  A/G-specific adenine glycosylase [Bacillu...  63.9    9e-09
gb|ADF37313.1|  A/G-specific adenine glycosylase [Bacillus meg...  63.9    1e-08
ref|ZP_04293243.1|  hypothetical protein bcere0007_4470 [Bacil...  63.9    1e-08
ref|YP_002484855.1|  A/G-specific adenine glycosylase [Cyanoth...  63.9    1e-08
ref|YP_863581.1|  A/G-specific adenine glycosylase [Gramella f...  63.9    1e-08
ref|YP_594542.1|  A/G-specific DNA glycosylase [Lawsonia intra...  63.5    1e-08
ref|ZP_05790007.1|  A/G-specific DNA-adenine glycosylase [Syne...  63.5    1e-08
ref|ZP_04465917.1|  50S ribosomal protein L31 [Haemophilus inf...  63.5    1e-08
ref|YP_002478662.1|  A/G-specific adenine glycosylase [Desulfo...  63.5    1e-08
ref|ZP_04442631.1|  adenine glycosylase [Listeria grayi DSM 20...  63.5    1e-08
ref|ZP_05498997.1|  A/G-specific adenine glycosylase [Thiomona...  63.5    1e-08
ref|ZP_04088797.1|  hypothetical protein bthur0010_4370 [Bacil...  63.5    1e-08
ref|YP_001635058.1|  HhH-GPD family protein [Chloroflexus aura...  63.5    1e-08
ref|ZP_03634818.1|  hypothetical protein HOLDEFILI_02114 [Hold...  63.5    1e-08
ref|ZP_00238003.1|  A/G-specific adenine glycosylase [Bacillus...  63.5    1e-08
gb|EFA85170.1|  A/G-specific adenine DNA glycosylase [Polyspho...  63.5    1e-08
ref|YP_003059454.1|  HhH-GPD family protein [Hirschia baltica ...  63.5    1e-08
ref|XP_002265027.1|  PREDICTED: hypothetical protein [Vitis vi...  63.5    1e-08
ref|ZP_04082751.1|  hypothetical protein bthur0011_4100 [Bacil...  63.5    1e-08
ref|YP_846846.1|  A/G-specific adenine glycosylase [Syntrophob...  63.5    1e-08
ref|ZP_04237751.1|  hypothetical protein bcere0018_4180 [Bacil...  63.5    1e-08
ref|YP_001620701.1|  A/G-specific adenine DNA glycosylase [Ach...  63.2    1e-08
ref|YP_001322060.1|  A/G-specific adenine glycosylase [Alkalip...  63.2    2e-08
ref|NP_471133.1|  hypothetical protein lin1797 [Listeria innoc...  63.2    2e-08
ref|ZP_04172816.1|  hypothetical protein bcere0030_4300 [Bacil...  63.2    2e-08
ref|XP_001134477.1|  hypothetical protein DDB_G0270764 [Dictyo...  63.2    2e-08
ref|YP_893358.1|  A/G-specific DNA-adenine glycosylase [Bacill...  63.2    2e-08
ref|YP_001981053.1|  A / G specific adenine glycosylase [Cellv...  63.2    2e-08
ref|ZP_03102118.1|  A/G-specific adenine glycosylase [Bacillus...  63.2    2e-08
ref|NP_843058.1|  A/G-specific adenine glycosylase [Bacillus a...  63.2    2e-08
ref|NP_712509.1|  A/G specific adenine glycosylase [Leptospira...  63.2    2e-08
ref|ZP_04207423.1|  hypothetical protein bcere0024_4160 [Bacil...  63.2    2e-08
ref|ZP_04094844.1|  hypothetical protein bthur0009_4350 [Bacil...  63.2    2e-08
gb|EDZ39593.1|  Putative A/G-specific DNA glycosylase [Leptosp...  63.2    2e-08
ref|ZP_04226167.1|  hypothetical protein bcere0020_4310 [Bacil...  63.2    2e-08
ref|ZP_01730474.1|  mutator mutT protein A/G-specific adenine ...  63.2    2e-08
ref|YP_001572.1|  A/G specific adenine glycosylase [Leptospira...  63.2    2e-08
ref|YP_002758399.1|  A/G-specific adenine glycosylase [Listeri...  63.2    2e-08
ref|ZP_03235244.1|  A/G-specific adenine glycosylase [Bacillus...  63.2    2e-08
ref|ZP_00683847.1|  A/G-specific adenine glycosylase MutY [Xyl...  63.2    2e-08
ref|YP_001518220.1|  A/G-specific adenine glycosylase [Acaryoc...  63.2    2e-08
ref|ZP_00231532.1|  A/G-specific adenine glycosylase [Listeria...  62.8    2e-08
emb|CBA07684.1|  putative A/G-specific adenine glycosylase [Ne...  62.8    2e-08
ref|YP_002528314.1|  A/G-specific adenine glycosylase [Bacillu...  62.8    2e-08
ref|YP_034784.1|  A/G-specific adenine glycosylase [Bacillus t...  62.8    2e-08
ref|YP_002436332.1|  A/G-specific adenine glycosylase [Desulfo...  62.8    2e-08
ref|NP_976904.1|  A/G-specific adenine glycosylase [Bacillus c...  62.8    2e-08
ref|ZP_05231064.1|  A/G-specific adenine glycosylase [Listeria...  62.8    2e-08
ref|ZP_04287621.1|  hypothetical protein bcere0009_4130 [Bacil...  62.8    2e-08
ref|YP_014309.1|  A/G-specific adenine glycosylase [Listeria m...  62.8    2e-08
ref|XP_001744114.1|  hypothetical protein [Monosiga brevicolli...  62.8    2e-08
ref|YP_694005.1|  A/G specific adenine glycosylase [Alcanivora...  62.8    2e-08
ref|XP_001772500.1|  predicted protein [Physcomitrella patens ...  62.8    2e-08
ref|ZP_01449377.1|  A/G-specific adenine glycosylase [alpha pr...  62.8    2e-08
ref|YP_001265165.1|  A/G-specific DNA-adenine glycosylase [Sph...  62.8    2e-08
ref|ZP_02092200.1|  hypothetical protein FAEPRAM212_02489 [Fae...  62.8    2e-08
ref|XP_001196919.1|  PREDICTED: hypothetical protein, partial ...  62.8    2e-08
ref|YP_082039.1|  A/G-specific adenine glycosylase [Bacillus c...  62.8    2e-08
ref|YP_002515004.1|  A/G-specific DNA-adenine glycosylase [Thi...  62.8    2e-08
ref|YP_003284155.1|  A/G-specific adenine glycosylase [Blattab...  62.8    2e-08
ref|NP_896210.1|  putative adenine glycosylase [Synechococcus ...  62.8    2e-08
ref|XP_791369.2|  PREDICTED: hypothetical protein, partial [St...  62.8    2e-08
ref|NP_465214.1|  hypothetical protein lmo1689 [Listeria monoc...  62.8    2e-08
ref|YP_001296541.1|  A/G-specific adenine glycosylase [Flavoba...  62.8    2e-08
ref|YP_743525.1|  A/G-specific DNA-adenine glycosylase [Alkali...  62.4    2e-08
ref|ZP_04100389.1|  hypothetical protein bthur0008_4340 [Bacil...  62.4    2e-08
ref|YP_003303083.1|  A/G-specific adenine glycosylase [Sulfuro...  62.4    3e-08
ref|ZP_05233900.1|  A/G-specific adenine glycosylase [Listeria...  62.4    3e-08
ref|ZP_02076694.1|  hypothetical protein EUBDOL_00484 [Eubacte...  62.4    3e-08
ref|YP_248467.1|  A/G-specific adenine glycosylase [Haemophilu...  62.4    3e-08
ref|ZP_00234951.1|  A/G-specific adenine glycosylase [Listeria...  62.4    3e-08
ref|YP_664163.1|  A/G-specific adenine glycosylase [Helicobact...  62.4    3e-08
ref|ZP_01615888.1|  A / G specific adenine glycosylase [marine...  62.4    3e-08
ref|XP_422433.2|  PREDICTED: similar to mutY homolog [Gallus g...  62.4    3e-08
ref|ZP_05876411.1|  A/G-specific adenine glycosylase [Vibrio f...  62.4    3e-08
ref|ZP_04448408.1|  hypothetical protein BIFANG_03418 [Bifidob...  62.4    3e-08
ref|ZP_05042684.1|  A/G-specific adenine glycosylase [Alcanivo...  62.4    3e-08
ref|ZP_04580727.1|  A/G-specific adenine glycosylase [Helicoba...  62.4    3e-08
ref|ZP_05965545.2|  A/G-specific adenine glycosylase [Bifidoba...  62.4    3e-08
ref|ZP_01786282.1|  A/G-specific adenine glycosylase [Haemophi...  62.4    3e-08
emb|CAG01442.1|  unnamed protein product [Tetraodon nigroviridis]  62.4    3e-08
ref|YP_002349840.1|  A/G-specific adenine glycosylase [Listeri...  62.4    3e-08
ref|ZP_01123744.1|  mutator mutT protein [Synechococcus sp. WH...  62.4    3e-08
ref|ZP_04958164.1|  A/G-specific adenine glycosylase [gamma pr...  62.4    3e-08
ref|YP_003376553.1|  probable a/g-specific adenine glycosylase...  62.0    3e-08
ref|ZP_00155777.2|  COG1194: A/G-specific DNA glycosylase [Hae...  62.0    3e-08
ref|ZP_00203080.1|  COG1194: A/G-specific DNA glycosylase [Hae...  62.0    3e-08
ref|ZP_05849370.1|  A/G-specific adenine glycosylase [Haemophi...  62.0    3e-08
ref|ZP_04669183.1|  conserved hypothetical protein [Clostridia...  62.0    3e-08
ref|ZP_01102989.1|  A/G-specific adenine glycosylase [Congregi...  62.0    3e-08
ref|ZP_06732763.1|  A/G-specific adenine glycosylase [Xanthomo...  62.0    3e-08
ref|YP_659662.1|  A/G-specific adenine glycosylase [Pseudoalte...  62.0    3e-08
ref|YP_003427112.1|  adenine glycosylase [Bacillus pseudofirmu...  62.0    4e-08
ref|YP_001997095.1|  A/G-specific adenine glycosylase [Chloroh...  62.0    4e-08
ref|ZP_01468962.1|  Mutator MutT [Synechococcus sp. BL107] >gb...  62.0    4e-08
ref|YP_476998.1|  A/G-specific adenine glycosylase [Synechococ...  62.0    4e-08
ref|YP_003390744.1|  A/G-specific adenine glycosylase [Spiroso...  62.0    4e-08
ref|YP_201783.1|  A/G-specific adenine glycosylase [Xanthomona...  62.0    4e-08
ref|YP_003255248.1|  A/G-specific adenine glycosylase [Aggrega...  62.0    4e-08
ref|XP_002571574.1|  DNA glycosylase [Schistosoma mansoni] >em...  62.0    4e-08
ref|ZP_01784157.1|  A/G-specific adenine glycosylase [Haemophi...  61.6    4e-08
ref|ZP_01040210.1|  hypothetical protein NAP1_07875 [Erythroba...  61.6    4e-08
ref|ZP_02734587.1|  A/G-specific adenine glycosylase [Gemmata ...  61.6    5e-08
ref|ZP_01236082.1|  A/G-specific adenine DNA glycosylase [Vibr...  61.6    5e-08
ref|YP_003523055.1|  A/G-specific adenine glycosylase [Siderox...  61.6    5e-08
ref|ZP_06704769.1|  A/G-specific adenine glycosylase [Xanthomo...  61.6    5e-08
ref|YP_001223886.1|  A/G-specific DNA glycosylase MutY [Synech...  61.6    5e-08
ref|NP_438918.1|  A/G-specific adenine glycosylase [Haemophilu...  61.6    5e-08
ref|YP_370365.1|  A/G-specific DNA-adenine glycosylase [Burkho...  61.6    5e-08
emb|CAN71629.1|  hypothetical protein [Vitis vinifera]             61.6    5e-08
ref|ZP_02070025.1|  hypothetical protein BACUNI_01442 [Bactero...  61.6    5e-08
emb|CBK70910.1|  A/G-specific DNA glycosylase [Bifidobacterium...  61.2    6e-08
ref|YP_003394670.1|  HhH-GPD family protein [Conexibacter woes...  61.2    6e-08
ref|ZP_05044354.1|  A/G specific adenine glycosylase [Cyanobiu...  61.2    6e-08
ref|YP_001140428.1|  A/G-specific adenine glycosylase [Aeromon...  61.2    6e-08
ref|ZP_05128123.1|  A/G-specific adenine glycosylase [gamma pr...  61.2    6e-08
ref|ZP_04464766.1|  A/G-specific adenine glycosylase [Haemophi...  61.2    6e-08
ref|YP_001124595.1|  A/G-specific adenine DNA glycosylase [Geo...  61.2    6e-08
ref|ZP_01733500.1|  putative A/G-specific adenine glycosylase ...  61.2    6e-08
ref|YP_002524150.1|  Catalytic Domain Of MutyY [Thermomicrobiu...  61.2    7e-08
ref|ZP_03707245.1|  hypothetical protein CLOSTMETH_01989 [Clos...  61.2    7e-08
ref|YP_002229962.1|  putative A/G-specific adenine glycosylase...  61.2    7e-08
ref|ZP_02167439.1|  A/G-specific adenine glycosylase [Hoeflea ...  61.2    7e-08
ref|ZP_06712908.1|  A/G-specific adenine glycosylase [Edwardsi...  61.2    7e-08
ref|ZP_02426171.1|  hypothetical protein ALIPUT_02332 [Alistip...  61.2    7e-08
ref|ZP_06344660.1|  A/G-specific adenine glycosylase [Clostrid...  61.2    7e-08
ref|ZP_03209678.1|  hypothetical protein BACPLE_03355 [Bactero...  61.2    7e-08
ref|NP_299195.1|  A/G-specific adenine glycosylase [Xylella fa...  61.2    7e-08
ref|ZP_00390898.1|  COG1194: A/G-specific DNA glycosylase [Bac...  61.2    7e-08
ref|YP_001805010.1|  mutator protein MutT [Cyanothece sp. ATCC...  60.8    8e-08
ref|ZP_03656034.1|  A/G-specific adenine glycosylase [Helicoba...  60.8    8e-08
ref|ZP_00652090.1|  A/G-specific adenine glycosylase MutY [Xyl...  60.8    8e-08
ref|YP_003008047.1|  A/G-specific adenine glycosylase [Aggrega...  60.8    8e-08
ref|ZP_03849627.1|  possible A/G-specific adenine glycosylase ...  60.8    8e-08
emb|CBK77296.1|  A/G-specific adenine glycosylase [Clostridium...  60.8    8e-08
ref|ZP_03742779.1|  hypothetical protein BIFPSEUDO_03353 [Bifi...  60.8    9e-08
ref|YP_003553196.1|  A/G-specific adenine glycosylase [Aminoba...  60.8    9e-08
emb|CBK72954.1|  A/G-specific DNA glycosylase [Bifidobacterium...  60.8    9e-08
ref|ZP_06471193.1|  A/G-specific adenine glycosylase [Ethanoli...  60.8    9e-08
ref|ZP_03657967.1|  A/G-specific adenine glycosylase [Helicoba...  60.8    9e-08
ref|ZP_05627376.1|  A/G-specific adenine glycosylase [Fusobact...  60.8    9e-08
ref|YP_001818979.1|  HhH-GPD family protein [Opitutus terrae P...  60.8    9e-08
ref|ZP_01627555.1|  A/G-specific adenine glycosylase MutY [mar...  60.8    9e-08
ref|ZP_06573147.1|  A/G-specific adenine glycosylase [Filifact...  60.8    9e-08
ref|NP_779098.1|  A/G-specific adenine glycosylase [Xylella fa...  60.8    9e-08
ref|YP_858235.1|  A/G-specific adenine glycosylase [Aeromonas ...  60.5    1e-07
ref|YP_410779.1|  A/G-specific adenine glycosylase [Nitrosospi...  60.5    1e-07
ref|YP_001174562.1|  A / G specific adenine glycosylase [Pseud...  60.5    1e-07
ref|YP_001547160.1|  HhH-GPD family protein [Herpetosiphon aur...  60.5    1e-07
ref|YP_458605.1|  hypothetical protein ELI_08580 [Erythrobacte...  60.5    1e-07
ref|ZP_05733643.1|  A/G-specific adenine glycosylase [Dialiste...  60.5    1e-07
ref|ZP_06635263.1|  A/G-specific adenine glycosylase [Aggregat...  60.5    1e-07
ref|YP_001957330.1|  A/G-specific adenine glycosylase [Candida...  60.5    1e-07
ref|YP_001513820.1|  A/G-specific adenine glycosylase [Alkalip...  60.5    1e-07
ref|ZP_04389250.1|  A/G-specific adenine glycosylase [Porphyro...  60.5    1e-07
ref|XP_760101.1|  hypothetical protein UM03954.1 [Ustilago may...  60.5    1e-07
ref|ZP_06595579.1|  putative A/G-specific adenine glycosylase ...  60.5    1e-07
ref|ZP_04944702.1|  A/G-specific DNA glycosylase [Burkholderia...  60.5    1e-07
ref|ZP_06805779.1|  A/G-specific adenine glycosylase [Brevibac...  60.5    1e-07
ref|YP_002323493.1|  HhH-GPD family protein [Bifidobacterium l...  60.1    1e-07
ref|XP_001519000.1|  PREDICTED: similar to mutY homolog (E. co...  60.1    1e-07
ref|ZP_03700655.1|  A/G-specific adenine glycosylase [Flavobac...  60.1    1e-07
ref|YP_265265.1|  A/G-specific DNA-adenine glycosylase [Psychr...  60.1    1e-07
emb|CBL22266.1|  A/G-specific adenine glycosylase [Ruminococcu...  60.1    1e-07
ref|ZP_05617440.1|  A/G-specific adenine glycosylase [Fusobact...  60.1    1e-07
emb|CAD11262.1|  A/G-specific adenine glycosylase [Helicobacte...  60.1    1e-07
ref|XP_002603927.1|  hypothetical protein BRAFLDRAFT_248509 [B...  60.1    1e-07
ref|ZP_06560301.1|  A/G-specific adenine glycosylase [Megaspha...  60.1    1e-07
ref|ZP_01796426.1|  A/G-specific adenine glycosylase [Haemophi...  60.1    1e-07
ref|YP_821593.1|  A/G-specific DNA-adenine glycosylase [Soliba...  60.1    1e-07
ref|ZP_04855758.1|  conserved hypothetical protein [Ruminococc...  60.1    1e-07
ref|ZP_06118790.1|  A/G-specific adenine glycosylase [Clostrid...  60.1    1e-07
ref|ZP_03584177.1|  A/G-specific adenine glycosylase [Burkhold...  60.1    1e-07
ref|YP_003197761.1|  A/G-specific adenine glycosylase [Desulfo...  60.1    2e-07
ref|ZP_03727170.1|  HhH-GPD family protein [Opitutaceae bacter...  60.1    2e-07
ref|YP_066199.1|  A/G-specific adenine glycosylase [Desulfotal...  59.7    2e-07
ref|ZP_06386768.1|  A/G-specific adenine glycosylase [Candidat...  59.7    2e-07
ref|YP_003145397.1|  A/G-specific adenine glycosylase [Kangiel...  59.7    2e-07
emb|CBK65193.1|  A/G-specific DNA-adenine glycosylase [Alistip...  59.7    2e-07
ref|YP_001291350.1|  hypothetical protein CGSHiEE_08300 [Haemo...  59.7    2e-07
ref|ZP_03989631.1|  A/G-specific adenine glycosylase [Acidamin...  59.7    2e-07
ref|YP_002463838.1|  HhH-GPD family protein [Chloroflexus aggr...  59.7    2e-07
ref|ZP_05280484.1|  putative A/G-specific adenine glycosylase ...  59.7    2e-07
ref|YP_001436465.1|  adenine DNA glycosylase [Cronobacter saka...  59.7    2e-07
ref|ZP_03222404.1|  A/G-specific adenine glycosylase [Campylob...  59.7    2e-07
ref|YP_003052375.1|  A/G-specific adenine glycosylase [Methylo...  59.7    2e-07
ref|ZP_03702793.1|  A/G-specific adenine glycosylase [Flavobac...  59.7    2e-07
ref|NP_660864.1|  A/G-specific adenine glycosylase [Buchnera a...  59.7    2e-07
ref|YP_003158271.1|  A/G-specific adenine glycosylase [Desulfo...  59.7    2e-07
ref|ZP_01947109.1|  A/G-specific adenine glycosylase [Coxiella...  59.7    2e-07
ref|ZP_02361596.1|  A/G-specific adenine glycosylase [Burkhold...  59.7    2e-07
ref|NP_348127.1|  A/G-specific DNA glycosylase [Clostridium ac...  59.7    2e-07
ref|NP_860773.1|  A/G-specific adenine glycosylase [Helicobact...  59.7    2e-07
ref|YP_002475848.1|  A/G-specific DNA-adenine glycosylase [Hae...  59.7    2e-07
ref|YP_003291194.1|  A/G-specific adenine glycosylase [Rhodoth...  59.3    2e-07
ref|YP_002303551.1|  A/G-specific adenine DNA glycosylase [Cox...  59.3    2e-07
ref|YP_441037.1|  A/G-specific adenine glycosylase [Burkholder...  59.3    2e-07
ref|ZP_02372642.1|  A/G-specific adenine glycosylase [Burkhold...  59.3    2e-07
ref|ZP_02354409.1|  A/G-specific adenine glycosylase [Burkhold...  59.3    2e-07
ref|YP_522915.1|  A/G-specific adenine glycosylase [Rhodoferax...  59.3    2e-07
ref|ZP_02435517.1|  hypothetical protein BACSTE_01764 [Bactero...  59.3    2e-07
ref|NP_819952.1|  A/G-specific adenine DNA glycosylase [Coxiel...  59.3    2e-07
ref|YP_001351203.1|  A/G-specific adenine glycosylase [Pseudom...  59.3    2e-07
ref|ZP_05630376.1|  A/G-specific adenine glycosylase [Fusobact...  59.3    2e-07
ref|ZP_02469751.1|  A/G-specific adenine glycosylase [Burkhold...  59.3    2e-07
ref|YP_001398900.1|  A/G-specific adenine glycosylase [Campylo...  59.3    2e-07
emb|CAD11259.1|  A/G-specific adenine glycosylase [Helicobacte...  59.3    2e-07
ref|YP_332172.1|  A/G-specific adenine glycosylase [Burkholder...  59.3    2e-07
ref|ZP_06286985.1|  A/G-specific adenine glycosylase [Prevotel...  59.3    2e-07
ref|YP_001057627.1|  A/G-specific adenine glycosylase [Burkhol...  59.3    3e-07
ref|ZP_06256327.1|  A/G-specific adenine glycosylase [Prevotel...  59.3    3e-07
ref|YP_001813152.1|  A/G-specific adenine glycosylase [Exiguob...  59.3    3e-07
ref|ZP_02477652.1|  4-hydroxy-3-methylbut-2-enyl diphosphate r...  59.3    3e-07
ref|YP_001673382.1|  A/G-specific adenine glycosylase [Shewane...  59.3    3e-07
ref|ZP_05314179.1|  A/G-specific adenine glycosylase [Nitrosom...  59.3    3e-07
ref|ZP_01160616.1|  putative A/G-specific adenine glycosylase ...  58.9    3e-07
ref|ZP_02030876.1|  hypothetical protein PARMER_00852 [Parabac...  58.9    3e-07
ref|YP_002027933.1|  A/G-specific adenine glycosylase [Stenotr...  58.9    3e-07
ref|YP_797917.1|  A/G-specific DNA glycosylase [Leptospira bor...  58.9    3e-07
ref|ZP_06269172.1|  A/G-specific adenine glycosylase [Prevotel...  58.9    3e-07
ref|YP_002379760.1|  A/G-specific adenine glycosylase [Cyanoth...  58.9    3e-07
ref|ZP_04976834.1|  A/G-specific adenine glycosylase [Mannheim...  58.9    3e-07
ref|YP_003529941.1|  A/G-specific adenine glycosylase [Erwinia...  58.9    3e-07
ref|ZP_01963105.1|  hypothetical protein RUMOBE_00818 [Ruminoc...  58.9    3e-07
ref|NP_296006.1|  A/G-specific adenine glycosylase [Deinococcu...  58.9    3e-07
ref|ZP_05991158.1|  A/G-specific adenine glycosylase [Mannheim...  58.9    3e-07
ref|ZP_05988430.1|  A/G-specific adenine glycosylase [Mannheim...  58.9    3e-07
ref|ZP_02377816.1|  A/G-specific adenine glycosylase MutY [Bur...  58.9    3e-07
ref|ZP_04937294.1|  A / G specific adenine glycosylase [Pseudo...  58.9    3e-07
ref|ZP_04401985.1|  A/G-specific adenine glycosylase [Vibrio c...  58.9    3e-07
ref|YP_793619.1|  A/G-specific adenine glycosylase [Pseudomona...  58.9    3e-07
ref|ZP_04393032.1|  A/G-specific adenine glycosylase [Geobacil...  58.9    3e-07
gb|EAY82600.1|  hypothetical protein OsI_37821 [Oryza sativa I...  58.9    3e-07
ref|NP_253834.1|  A/G-specific adenine glycosylase [Pseudomona...  58.9    3e-07
ref|ZP_06374476.1|  A/G-specific adenine glycosylase [Campylob...  58.9    3e-07
ref|ZP_01084523.1|  probable adenine glycosylase [Synechococcu...  58.9    3e-07
ref|ZP_03780623.1|  hypothetical protein CLOHYLEM_07725 [Clost...  58.9    4e-07
ref|ZP_03488962.1|  hypothetical protein EUBIFOR_01548 [Eubact...  58.5    4e-07
gb|EAZ19986.1|  hypothetical protein OsJ_35579 [Oryza sativa J...  58.5    4e-07
pdb|3FSP|A  Chain A, Muty Adenine Glycosylase Bound To A Trans...  58.5    4e-07
ref|NP_001066403.1|  Os12g0211400 [Oryza sativa (japonica cult...  58.5    4e-07
ref|ZP_02496558.1|  A/G-specific adenine glycosylase [Burkhold...  58.5    4e-07
ref|ZP_01067681.1|  A/G-specific adenine glycosylase [Campylob...  58.5    4e-07
ref|YP_003443812.1|  A/G-specific adenine glycosylase [Allochr...  58.5    4e-07
ref|YP_146316.1|  adenine glycosylase [Geobacillus kaustophilu...  58.5    4e-07
ref|ZP_03149315.1|  A/G-specific adenine glycosylase [Geobacil...  58.5    4e-07
ref|YP_001339624.1|  A/G-specific adenine glycosylase [Marinom...  58.5    4e-07
ref|ZP_05292681.1|  A/G-specific adenine glycosylase [Acidithi...  58.5    4e-07
ref|ZP_06091515.1|  A/G-specific adenine glycosylase [Bacteroi...  58.5    4e-07
ref|ZP_04833725.1|  A/G-specific adenine glycosylase [Prevotel...  58.5    4e-07
ref|ZP_02454142.1|  A/G-specific adenine glycosylase [Burkhold...  58.5    4e-07
ref|YP_001614575.1|  A/G-specific adenine glycosylase [Sorangi...  58.5    4e-07
ref|NP_206942.1|  DNA glycosylase MutY [Helicobacter pylori 26...  58.5    4e-07
ref|ZP_02462265.1|  A/G-specific adenine glycosylase [Burkhold...  58.5    4e-07
ref|ZP_02401259.1|  A/G-specific adenine glycosylase [Burkhold...  58.5    4e-07
ref|NP_874328.1|  A/G-specific adenine glycosylase [Haemophilu...  58.5    4e-07
ref|XP_807715.1|  A/G-specific adenine glycosylase [Trypanosom...  58.5    4e-07
ref|ZP_04903420.1|  A/G-specific adenine glycosylase [Burkhold...  58.5    4e-07
ref|YP_104599.1|  A/G-specific adenine glycosylase [Burkholder...  58.5    4e-07
ref|YP_107152.1|  putative A/G-specific adenine glycosylase [B...  58.5    4e-07
ref|ZP_05629145.1|  A/G-specific adenine glycosylase [Actinoba...  58.5    4e-07
ref|YP_001908763.1|  adenine DNA glycosylase [Erwinia tasmanie...  58.5    4e-07
gb|ACX97359.1|  A/G-specific adenine glycosylase [Helicobacter...  58.5    5e-07
ref|ZP_04579939.1|  A/G-specific adenine glycosylase [Oxalobac...  58.2    5e-07
ref|ZP_04449189.1|  hypothetical protein GCWU000282_00417 [Cat...  58.2    5e-07
ref|YP_002797683.1|  A/G-specific adenine glycosylase [Azotoba...  58.2    5e-07
ref|ZP_06080479.1|  A/G-specific adenine glycosylase [Vibrio s...  58.2    5e-07
ref|ZP_02445827.1|  A/G-specific adenine glycosylase [Burkhold...  58.2    5e-07
ref|ZP_01306372.1|  A/G-specific adenine DNA glycosylase [Ocea...  58.2    5e-07
ref|ZP_02409812.1|  A/G-specific adenine glycosylase [Burkhold...  58.2    5e-07
ref|YP_001022423.1|  A/G-specific DNA-adenine glycosylase [Met...  58.2    5e-07
ref|ZP_03831717.1|  adenine DNA glycosylase [Pectobacterium ca...  58.2    5e-07
ref|ZP_06621735.1|  A/G-specific adenine glycosylase [Turiciba...  58.2    5e-07
ref|ZP_05924327.1|  A/G-specific adenine glycosylase [Vibrio s...  58.2    5e-07
ref|ZP_05715749.1|  A/G-specific adenine glycosylase [Vibrio m...  58.2    5e-07
ref|ZP_03476290.1|  hypothetical protein PRABACTJOHN_01956 [Pa...  58.2    5e-07
ref|YP_729339.1|  putative A/G-specific adenine glycosylase [S...  58.2    5e-07
ref|ZP_05859190.1|  A/G-specific adenine glycosylase [Bacteroi...  58.2    5e-07
ref|ZP_04414548.1|  A/G-specific adenine glycosylase [Vibrio c...  58.2    5e-07
ref|ZP_01809452.1|  A/G-specific adenine glycosylase [Campylob...  58.2    5e-07
ref|YP_001279077.1|  A/G-specific adenine glycosylase [Psychro...  58.2    6e-07
emb|CBE69933.1|  A/G-specific adenine glycosylase (fragment) [...  58.2    6e-07
ref|YP_156364.1|  A/G-specific DNA glycosylase [Idiomarina loi...  58.2    6e-07
ref|YP_001226359.1|  A/G-specific DNA glycosylase [Synechococc...  58.2    6e-07
ref|YP_001894239.1|  A/G-specific adenine glycosylase [Burkhol...  58.2    6e-07
ref|ZP_01979243.1|  A/G-specific adenine glycosylase [Vibrio c...  58.2    6e-07
emb|CAD11250.1|  A/G-specific adenine glycosylase [Helicobacte...  58.2    6e-07
ref|ZP_03268438.1|  A/G-specific adenine glycosylase [Burkhold...  58.2    6e-07
ref|YP_001969594.1|  A/G-specific adenine glycosylase [Actinob...  58.2    6e-07
ref|YP_001652769.1|  A/G-specific adenine glycosylase [Actinob...  58.2    6e-07
ref|YP_001189738.1|  A/G-specific DNA-adenine glycosylase [Pse...  58.2    6e-07
ref|ZP_04752299.1|  A/G-specific adenine glycosylase [Actinoba...  57.8    6e-07
ref|ZP_04917044.1|  A/G-specific adenine glycosylase [Vibrio c...  57.8    6e-07
ref|ZP_04919910.1|  A/G-specific adenine glycosylase [Vibrio c...  57.8    6e-07
ref|YP_719872.1|  A/G-specific DNA-adenine glycosylase [Haemop...  57.8    6e-07
ref|ZP_00135609.2|  COG1194: A/G-specific DNA glycosylase [Act...  57.8    6e-07
ref|YP_049083.1|  adenine DNA glycosylase [Pectobacterium atro...  57.8    6e-07
ref|NP_863827.1|  A/G-specific adenine glycosylase [Rhodopirel...  57.8    6e-07
ref|ZP_03968914.1|  possible adenine glycosylase [Sphingobacte...  57.8    6e-07
ref|YP_910184.1|  A/G-specific adenine glycosylase [Bifidobact...  57.8    7e-07
ref|YP_001785147.1|  A/G-specific adenine glycosylase [Haemoph...  57.8    7e-07
pdb|3G0Q|A  Chain A, Crystal Structure Of Muty Bound To Its In...  57.8    7e-07
ref|ZP_02029354.1|  hypothetical protein BIFADO_01811 [Bifidob...  57.8    7e-07
ref|ZP_02488455.1|  A/G-specific adenine glycosylase [Burkhold...  57.8    7e-07
ref|ZP_01091008.1|  A/G-specific adenine glycosylase [Blastopi...  57.8    7e-07
ref|ZP_06076594.1|  A/G-specific adenine glycosylase [Bacteroi...  57.8    7e-07
ref|ZP_06040113.1|  A/G-specific adenine glycosylase [Vibrio m...  57.8    7e-07
ref|ZP_03645821.1|  A/G-specific DNA glycosylase [Bifidobacter...  57.8    7e-07
ref|NP_778100.1|  A/G-specific adenine glycosylase [Buchnera a...  57.8    8e-07
ref|ZP_03015311.1|  hypothetical protein BACINT_02901 [Bactero...  57.8    8e-07
emb|CAL34131.1|  A/G-specific adenine glycosylase [Enterobacte...  57.8    8e-07
ref|NP_296761.1|  A/G-specific adenine glycosylase [Chlamydia ...  57.4    8e-07
ref|ZP_01070965.1|  A/G-specific adenine glycosylase [Campylob...  57.4    8e-07
emb|CBL21190.1|  A/G-specific adenine glycosylase [Ruminococcu...  57.4    8e-07
ref|ZP_05105841.1|  A/G-specific adenine glycosylase [Methylop...  57.4    8e-07
ref|NP_222851.1|  DNA glycosylase MutY [Helicobacter pylori J9...  57.4    8e-07
ref|ZP_06408406.1|  A/G-specific adenine glycosylase [Prevotel...  57.4    8e-07
ref|ZP_03573033.1|  A/G-specific adenine glycosylase [Burkhold...  57.4    8e-07
ref|YP_001578710.1|  A/G-specific adenine glycosylase [Burkhol...  57.4    8e-07
ref|YP_001303351.1|  A/G-specific adenine glycosylase [Parabac...  57.4    8e-07
ref|ZP_03312785.1|  hypothetical protein DESPIG_02720 [Desulfo...  57.4    8e-07
ref|YP_179763.1|  A/G-specific adenine glycosylase [Campylobac...  57.4    8e-07
ref|ZP_05546882.1|  A/G-specific adenine glycosylase [Parabact...  57.4    9e-07
ref|YP_003094986.1|  A/G-specific adenine glycosylase [Flavoba...  57.4    9e-07
ref|YP_003056963.1|  A/G-specific adenine glycosylase [Helicob...  57.4    9e-07
ref|YP_001500970.1|  A/G-specific adenine glycosylase [Shewane...  57.4    9e-07
ref|ZP_03012078.1|  hypothetical protein BACCOP_04010 [Bactero...  57.4    9e-07
ref|YP_003090417.1|  helix-hairpin-helix motif protein [Pedoba...  57.4    9e-07
ref|ZP_01471652.1|  putative adenine glycosylase [Synechococcu...  57.4    9e-07
ref|YP_001209556.1|  A-G-specific adenine glycosylase [Dichelo...  57.4    9e-07
ref|YP_001566441.1|  A/G-specific adenine glycosylase [Delftia...  57.4    9e-07
ref|ZP_05036399.1|  A/G-specific adenine glycosylase [Synechoc...  57.4    9e-07
ref|NP_001072831.1|  mutY homolog [Xenopus (Silurana) tropical...  57.4    9e-07
ref|YP_455715.1|  adenine DNA glycosylase [Sodalis glossinidiu...  57.4    9e-07
ref|YP_002373196.1|  A/G-specific adenine glycosylase [Cyanoth...  57.4    9e-07
ref|ZP_04454756.1|  hypothetical protein GCWU000342_00753 [Shu...  57.4    9e-07
ref|YP_003138743.1|  A/G-specific adenine glycosylase [Cyanoth...  57.4    9e-07
ref|ZP_03068898.1|  A/G-specific adenine glycosylase [Escheric...  57.4    1e-06
ref|YP_003169225.1|  A/G-specific adenine glycosylase [Candida...  57.4    1e-06
ref|YP_474278.1|  A/G-specific adenine glycosylase [Synechococ...  57.4    1e-06
ref|ZP_06371296.1|  A/G-specific adenine glycosylase [Campylob...  57.4    1e-06
ref|ZP_05240032.1|  A/G-specific adenine glycosylase [Vibrio c...  57.4    1e-06
ref|YP_098838.1|  A/G-specific adenine glycosylase [Bacteroide...  57.4    1e-06
ref|YP_002221024.1|  A/G-specific adenine glycosylase [Acidith...  57.4    1e-06
ref|YP_003549876.1|  HhH-GPD family protein [Coraliomargarita ...  57.4    1e-06
ref|ZP_03758268.1|  hypothetical protein CLOSTASPAR_02280 [Clo...  57.4    1e-06
ref|ZP_04840626.1|  A/G-specific adenine glycosylase [Bacteroi...  57.0    1e-06
ref|ZP_06646531.1|  A/G-specific adenine glycosylase [Erysipel...  57.0    1e-06
ref|NP_230106.1|  A/G-specific adenine glycosylase [Vibrio cho...  57.0    1e-06
ref|ZP_04409185.1|  A/G-specific adenine glycosylase [Vibrio c...  57.0    1e-06
ref|ZP_05136190.1|  A/G-specific adenine glycosylase [Stenotro...  57.0    1e-06
ref|ZP_03439609.1|  hypothetical protein HP9810_886g27 [Helico...  57.0    1e-06
ref|ZP_04396596.1|  A/G-specific adenine glycosylase [Vibrio c...  57.0    1e-06
ref|ZP_04835199.1|  A/G-specific adenine glycosylase [Coryneba...  57.0    1e-06
ref|YP_001120728.1|  A/G-specific DNA-adenine glycosylase [Bur...  57.0    1e-06
ref|YP_002134285.1|  A/G-specific adenine glycosylase [Anaerom...  57.0    1e-06
ref|ZP_06049269.1|  A/G-specific adenine glycosylase [Vibrio c...  57.0    1e-06
ref|ZP_01957177.1|  A/G-specific adenine glycosylase [Vibrio c...  57.0    1e-06
ref|ZP_01678056.1|  A/G-specific adenine glycosylase [Vibrio c...  57.0    1e-06
ref|ZP_06031835.1|  A/G-specific adenine glycosylase [Vibrio m...  57.0    1e-06
ref|ZP_06612222.1|  A/G-specific adenine glycosylase [Streptoc...  57.0    1e-06
ref|YP_003005507.1|  A/G-specific adenine glycosylase [Dickeya...  57.0    1e-06
ref|YP_680262.1|  A/G-specific adenine glycosylase [Cytophaga ...  57.0    1e-06
ref|ZP_05720481.1|  A/G-specific adenine glycosylase [Vibrio m...  57.0    1e-06
ref|YP_002492420.1|  A/G-specific adenine glycosylase [Anaerom...  57.0    1e-06
ref|ZP_04409272.1|  A/G-specific adenine glycosylase [Vibrio c...  57.0    1e-06
ref|ZP_04419683.1|  A/G-specific adenine glycosylase [Vibrio c...  57.0    1e-06
ref|YP_001909633.1|  DNA glycosylase MutY [Helicobacter pylori...  57.0    1e-06
ref|YP_001002719.1|  A/G-specific adenine glycosylase [Halorho...  57.0    1e-06
ref|ZP_01551618.1|  A/G-specific adenine glycosylase [Methylop...  57.0    1e-06
ref|NP_246257.1|  MutY [Pasteurella multocida subsp. multocida...  57.0    1e-06
ref|YP_002265764.1|  A/G-specific adenine glycosylase [Helicob...  57.0    1e-06
ref|ZP_06685608.1|  A/G specific adenine glycosylase [Achromob...  57.0    1e-06
ref|YP_003368888.1|  HhH-GPD family protein [Pirellula staleyi...  57.0    1e-06
ref|ZP_01079083.1|  probable adenine glycosylase [Synechococcu...  57.0    1e-06
ref|NP_923812.1|  A/G-specific adenine glycosylase [Gloeobacte...  57.0    1e-06
ref|YP_001766089.1|  A/G-specific adenine glycosylase [Burkhol...  57.0    1e-06
ref|NP_903373.1|  A/G-specific DNA glycosylase [Chromobacteriu...  57.0    1e-06
ref|YP_622057.1|  A/G-specific adenine glycosylase [Burkholder...  57.0    1e-06
gb|ACX98771.1|  hypothetical protein HPKB_0150 [Helicobacter p...  56.6    1e-06
ref|ZP_04940502.1|  A/G-specific DNA glycosylase [Burkholderia...  56.6    1e-06
ref|XP_002672346.1|  predicted protein [Naegleria gruberi] >gb...  56.6    1e-06
ref|ZP_03827347.1|  adenine DNA glycosylase [Pectobacterium ca...  56.6    1e-06
ref|YP_581545.1|  A/G-specific adenine glycosylase [Psychrobac...  56.6    1e-06
ref|YP_312049.1|  adenine DNA glycosylase [Shigella sonnei Ss0...  56.6    1e-06
ref|ZP_03628356.1|  A/G-specific adenine glycosylase [bacteriu...  56.6    1e-06
pdb|1KG5|A  Chain A, Crystal Structure Of The K142q Mutant Of ...  56.6    1e-06
ref|YP_002124594.1|  A/G-specific adenine glycosylase [Alterom...  56.6    1e-06
ref|ZP_03680787.1|  hypothetical protein BACCELL_05161 [Bacter...  56.6    1e-06
ref|YP_001354812.1|  A/G-specific adenine glycosylase [Janthin...  56.6    2e-06
ref|ZP_05858072.1|  A/G-specific adenine glycosylase [Prevotel...  56.6    2e-06
ref|ZP_01914034.1|  probable a/g-specific adenine glycosylase ...  56.6    2e-06
ref|YP_002760336.1|  putative adenine glycosylase [Gemmatimona...  56.6    2e-06
ref|YP_002384002.1|  adenine DNA glycosylase [Escherichia ferg...  56.6    2e-06
ref|YP_277760.1|  adenine DNA glycosylase [Candidatus Blochman...  56.6    2e-06
ref|ZP_02088499.1|  hypothetical protein CLOBOL_06055 [Clostri...  56.6    2e-06
emb|CAD11253.1|  A/G-specific adenine glycosylase [Helicobacte...  56.6    2e-06
ref|YP_002988622.1|  A/G-specific adenine glycosylase [Dickeya...  56.6    2e-06
ref|ZP_03459269.1|  hypothetical protein BACEGG_02054 [Bactero...  56.6    2e-06
ref|ZP_01216321.1|  A/G-specific adenine glycosylase [Psychrom...  56.6    2e-06
ref|YP_003250306.1|  HhH-GPD family protein [Fibrobacter succi...  56.6    2e-06
ref|ZP_04778510.1|  possible adenine glycosylase [Sphingobacte...  56.6    2e-06
ref|YP_001971631.1|  putative A/G-specific adenine glycosylase...  56.6    2e-06
ref|YP_525813.1|  A/G-specific DNA-adenine glycosylase [Saccha...  56.6    2e-06
dbj|BAC33800.1|  unnamed protein product [Mus musculus]            56.6    2e-06
ref|ZP_04332051.1|  A/G-specific DNA-adenine glycosylase [Noca...  56.2    2e-06
ref|ZP_04713558.1|  A/G-specific adenine glycosylase [Alteromo...  56.2    2e-06
ref|ZP_04426872.1|  A/G-specific DNA-adenine glycosylase [Plan...  56.2    2e-06
emb|CAD11256.1|  A/G-specific adenine glycosylase [Helicobacte...  56.2    2e-06
ref|ZP_00367967.1|  A/G-specific adenine glycosylase [Campylob...  56.2    2e-06
ref|ZP_06655046.1|  adenine DNA glycosylase [Escherichia coli ...  56.2    2e-06
ref|ZP_04615974.1|  A/G-specific adenine glycosylase [Yersinia...  56.2    2e-06
gb|ADG07266.1|  A/G-specific adenine glycosylase [Bacillus tus...  56.2    2e-06
ref|YP_001881735.1|  A/G-specific adenine glycosylase [Shigell...  56.2    2e-06
ref|YP_002912894.1|  A/G-specific adenine glycosylase MutY [Bu...  56.2    2e-06
ref|ZP_04872070.1|  adenine DNA glycosylase [Escherichia sp. 1...  56.2    2e-06
ref|YP_001792511.1|  A/G-specific adenine glycosylase [Leptoth...  56.2    2e-06
ref|YP_001464315.1|  adenine DNA glycosylase [Escherichia coli...  56.2    2e-06
ref|ZP_01070507.1|  A/G-specific adenine glycosylase [Campylob...  56.2    2e-06
ref|YP_542330.1|  adenine DNA glycosylase [Escherichia coli UT...  56.2    2e-06
ref|ZP_03007208.1|  A/G-specific adenine glycosylase [Escheric...  56.2    2e-06
ref|YP_003016468.1|  A/G-specific adenine glycosylase [Pectoba...  56.2    2e-06
ref|ZP_06426065.1|  putative A/G-specific adenine glycosylase ...  56.2    2e-06
ref|ZP_04642263.1|  A/G-specific adenine glycosylase [Yersinia...  56.2    2e-06
ref|NP_755423.1|  adenine DNA glycosylase [Escherichia coli CF...  56.2    2e-06
emb|CAD11244.1|  A/G-specific adenine glycosylase [Helicobacte...  56.2    2e-06
ref|YP_733317.1|  A/G-specific DNA-adenine glycosylase [Shewan...  56.2    2e-06
ref|ZP_03064096.1|  A/G-specific adenine glycosylase [Shigella...  56.2    2e-06
ref|ZP_02891392.1|  A/G-specific adenine glycosylase [Burkhold...  56.2    2e-06
ref|YP_690393.1|  adenine DNA glycosylase [Shigella flexneri 5...  56.2    2e-06
ref|ZP_04638654.1|  A/G-specific adenine glycosylase [Yersinia...  56.2    2e-06
ref|YP_001459741.1|  adenine DNA glycosylase [Escherichia coli...  56.2    2e-06
ref|XP_001701896.1|  DNA repair glycosylase [Chlamydomonas rei...  56.2    2e-06
pdb|1RRS|A  Chain A, Muty Adenine Glycosylase In Complex With ...  56.2    2e-06
ref|YP_002413998.1|  adenine DNA glycosylase [Escherichia coli...  55.8    2e-06
ref|ZP_02156671.1|  A/G-specific adenine glycosylase [Shewanel...  55.8    2e-06
ref|ZP_05980142.1|  A/G-specific adenine glycosylase [Subdolig...  55.8    2e-06
pdb|1KG6|A  Chain A, Crystal Structure Of The K142r Mutant Of ...  55.8    2e-06
ref|YP_409363.1|  adenine DNA glycosylase [Shigella boydii Sb2...  55.8    2e-06
ref|ZP_03029721.1|  A/G-specific adenine glycosylase [Escheric...  55.8    2e-06
ref|YP_854176.1|  adenine DNA glycosylase [Escherichia coli AP...  55.8    2e-06
ref|ZP_02907783.1|  A/G-specific adenine glycosylase [Burkhold...  55.8    2e-06
ref|YP_641906.1|  HhH-GPD [Mycobacterium sp. MCS] >ref|YP_9408...  55.8    2e-06
ref|NP_838453.1|  adenine DNA glycosylase [Shigella flexneri 2...  55.8    2e-06
ref|ZP_06040126.1|  A/G-specific adenine glycosylase [Vibrio m...  55.8    2e-06
ref|ZP_05438394.1|  adenine DNA glycosylase [Escherichia sp. 4...  55.8    2e-06
ref|ZP_04006322.1|  adenine DNA glycosylase [Escherichia coli ...  55.8    2e-06
ref|YP_002649980.1|  A/G-specific adenine glycosylase [Erwinia...  55.8    2e-06
ref|YP_002409304.1|  adenine DNA glycosylase [Escherichia coli...  55.8    2e-06
ref|YP_002330690.1|  adenine DNA glycosylase [Escherichia coli...  55.8    2e-06
ref|YP_001432997.1|  HhH-GPD family protein [Roseiflexus caste...  55.8    2e-06
pdb|1MUY|A  Chain A, Catalytic Domain Of Muty From Escherichia...  55.8    2e-06
ref|NP_289533.1|  adenine DNA glycosylase [Escherichia coli O1...  55.8    2e-06
ref|YP_670840.1|  adenine DNA glycosylase [Escherichia coli 53...  55.8    3e-06
ref|YP_003260752.1|  A/G-specific adenine glycosylase [Pectoba...  55.8    3e-06
ref|YP_404616.1|  adenine DNA glycosylase [Shigella dysenteria...  55.8    3e-06
ref|ZP_02900356.1|  A/G-specific adenine glycosylase [Escheric...  55.8    3e-06
ref|YP_774747.1|  A/G-specific adenine glycosylase [Burkholder...  55.8    3e-06
ref|YP_001215977.1|  A/G-specific adenine glycosylase [Vibrio ...  55.8    3e-06
ref|YP_001093253.1|  A/G-specific adenine glycosylase [Shewane...  55.8    3e-06
ref|XP_001684497.1|  A/G-specific adenine glycosylase [Leishma...  55.8    3e-06
ref|NP_417436.1|  adenine DNA glycosylase [Escherichia coli st...  55.8    3e-06
ref|ZP_03044677.1|  A/G-specific adenine glycosylase [Escheric...  55.8    3e-06
ref|YP_001277500.1|  HhH-GPD family protein [Roseiflexus sp. R...  55.8    3e-06
pdb|1WEF|A  Chain A, Catalytic Domain Of Muty From Escherichia...  55.8    3e-06
ref|ZP_01883467.1|  putative A/G-specific adenine glycosylase ...  55.8    3e-06
ref|ZP_06658862.1|  A/G-specific adenine glycosylase [Escheric...  55.8    3e-06
ref|YP_001751767.1|  A/G-specific adenine glycosylase [Pseudom...  55.8    3e-06
pdb|1KG4|A  Chain A, Crystal Structure Of The K142a Mutant Of ...  55.8    3e-06
ref|ZP_06228865.1|  A/G-specific DNA-adenine glycosylase [Burk...  55.8    3e-06
ref|YP_001856559.1|  A/G-specific adenine glycosylase [Burkhol...  55.8    3e-06
ref|ZP_04808704.1|  A/G-specific adenine glycosylase [Helicoba...  55.8    3e-06
ref|ZP_06293260.1|  A/G-specific adenine glycosylase [Burkhold...  55.5    3e-06
ref|ZP_06756611.1|  putative A/G-specific adenine glycosylase ...  55.5    3e-06
ref|YP_003211921.1|  A/G-specific adenine glycosylase [Cronoba...  55.5    3e-06
ref|YP_003332478.1|  A/G-specific adenine glycosylase [Dickeya...  55.5    3e-06
ref|ZP_06051563.1|  A/G-specific adenine glycosylase [Grimonti...  55.5    3e-06
ref|ZP_02882664.1|  A/G-specific adenine glycosylase [Burkhold...  55.5    3e-06
ref|YP_001101122.1|  adenine DNA glycosylase [Herminiimonas ar...  55.5    3e-06
ref|NP_940311.1|  putative DNA repair protein [Corynebacterium...  55.5    3e-06
ref|XP_001879869.1|  predicted protein [Laccaria bicolor S238N...  55.5    3e-06
ref|YP_002784759.1|  putative A/G-specific adenine glycosylase...  55.5    4e-06
ref|ZP_03644737.1|  hypothetical protein BACCOPRO_03127 [Bacte...  55.5    4e-06
emb|CAD11247.1|  A/G-specific adenine glycosylase [Helicobacte...  55.5    4e-06
ref|YP_001745123.1|  A/G-specific adenine glycosylase [Escheri...  55.5    4e-06
ref|ZP_06191339.1|  hypothetical protein SOD_d00840 [Serratia ...  55.5    4e-06
ref|ZP_00371640.1|  A/G-specific adenine glycosylase [Campylob...  55.1    4e-06
ref|YP_003141096.1|  A/G-specific adenine glycosylase [Capnocy...  55.1    4e-06
ref|YP_003294323.1|  A/G-specific adenine glycosylase [Edwards...  55.1    4e-06
ref|ZP_02034946.1|  hypothetical protein BACCAP_00535 [Bactero...  55.1    4e-06
ref|YP_003374369.1|  putative A/G-specific adenine glycosylase...  55.1    4e-06
ref|ZP_06198990.1|  A/G-specific adenine glycosylase [Streptoc...  55.1    4e-06
ref|XP_001621476.1|  hypothetical protein NEMVEDRAFT_v1g144756...  55.1    4e-06
ref|ZP_04365369.1|  A/G-specific DNA-adenine glycosylase [Cell...  55.1    4e-06
ref|ZP_01889511.1|  A/G-specific adenine glycosylase [unidenti...  55.1    4e-06
ref|ZP_03711323.1|  hypothetical protein CORMATOL_02164 [Coryn...  55.1    4e-06
ref|YP_626881.1|  DNA glycosylase MutY [Helicobacter pylori HP...  55.1    4e-06
ref|ZP_06466505.1|  A/G-specific DNA-adenine glycosylase [Burk...  55.1    5e-06
gb|ADD79757.1|  A/G-specific adenine glycosylase [Candidatus R...  55.1    5e-06
ref|XP_001470255.1|  A/G-specific adenine glycosylase [Leishma...  55.1    5e-06
ref|YP_002892172.1|  A/G-specific adenine glycosylase [Tolumon...  55.1    5e-06
ref|YP_003555779.1|  A/G-specific adenine glycosylase [Shewane...  55.1    5e-06
ref|YP_003047466.1|  A/G-specific adenine glycosylase [Methylo...  55.1    5e-06
pdb|1RRQ|A  Chain A, Muty Adenine Glycosylase In Complex With ...  55.1    5e-06
ref|XP_002442003.1|  hypothetical protein SORBIDRAFT_08g006760...  55.1    5e-06
ref|ZP_04545495.1|  A/G-specific adenine glycosylase [Bacteroi...  55.1    5e-06
ref|YP_257502.1|  A/G-specific adenine glycosylase [Pseudomona...  54.7    5e-06
ref|YP_737307.1|  A/G-specific DNA-adenine glycosylase [Shewan...  54.7    5e-06
ref|YP_921696.1|  HhH-GPD family protein [Nocardioides sp. JS6...  54.7    5e-06
ref|YP_055015.1|  A/G-specific adenine glycosylase [Propioniba...  54.7    5e-06
ref|YP_001809408.1|  A/G-specific adenine glycosylase [Burkhol...  54.7    6e-06
gb|AAR84084.1|  MutY [Pseudomonas fluorescens]                     54.7    6e-06
ref|ZP_06162167.1|  A/G-specific adenine glycosylase [Actinomy...  54.7    6e-06
ref|ZP_06212177.1|  A/G-specific adenine glycosylase [Acidovor...  54.7    6e-06
ref|ZP_01201122.1|  adenine glycosylase [Flavobacteria bacteri...  54.7    6e-06
ref|YP_001343850.1|  A/G-specific adenine glycosylase [Actinob...  54.7    6e-06
pdb|1KG7|A  Chain A, Crystal Structure Of The E161a Mutant Of ...  54.7    6e-06
ref|YP_001666560.1|  A/G-specific adenine glycosylase [Pseudom...  54.7    6e-06
ref|ZP_01220037.1|  putative A/G-specific adenine glycosylase ...  54.7    6e-06
ref|YP_131271.1|  putative A/G-specific adenine glycosylase [P...  54.7    6e-06
ref|ZP_06242138.1|  A/G-specific adenine glycosylase [Victival...  54.3    7e-06
ref|YP_572583.1|  A/G-specific DNA-adenine glycosylase [Chromo...  54.3    7e-06
ref|ZP_04620503.1|  A/G-specific adenine glycosylase [Yersinia...  54.3    7e-06
ref|ZP_05637769.1|  A/G-specific adenine glycosylase [Pseudomo...  54.3    7e-06
ref|YP_981143.1|  A/G-specific adenine glycosylase [Polaromona...  54.3    7e-06
ref|YP_277020.1|  A/G-specific adenine glycosylase [Pseudomona...  54.3    7e-06
ref|YP_003098158.1|  HhH-GPD family protein [Actinosynnema mir...  54.3    7e-06
ref|ZP_04553514.1|  A/G-specific adenine glycosylase [Bacteroi...  54.3    7e-06
ref|YP_270802.1|  A/G-specific adenine glycosylase [Colwellia ...  54.3    7e-06

ALIGNMENTS
>ref|ZP_01256434.1| A/G-specific adenine glycosylase [Psychroflexus torquis ATCC 
700755]
Length=236

 Score =  211 bits (536),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 146/199 (73%), Gaps = 2/199 (1%)

Query  1    SNAIMAIAFNKKIIPLDGNVERILKRVFYLKKEKEISKENLHQKKMFFGETIRASDYAQA  60
            S AIMAIAFN+K IPLDGNVERILKRV YL+ EK ISKEN+   K FFG + RASDYAQA
Sbjct  32   STAIMAIAFNQKFIPLDGNVERILKRVLYLRSEKAISKENMQISKKFFGLSERASDYAQA  91

Query  61   IMEIGALICKPSNPLCYQCPISTNCKSLKKNDFEIIKINKFNKQKFFEANIFQNKQNNYY  120
            IME+GAL+C+P+ PLC +CPI  NC S K+ DF +IK  K NK K+FEANI+ N +N   
Sbjct  92   IMELGALVCRPTFPLCDKCPIRINCISYKRKDFSLIKKTKKNKIKYFEANIYMN-ENKLL  150

Query  121  LLKNRKFNFLKDMPIFPMNEIPKTKFKNHLGKRINIKMSNMDMKIAINMKNNLPENSDGF  180
            L++N KFNFLK++ IFPMNEI K+KF +    +  IK+SN+DM I IN KN +   + G 
Sbjct  151  LVRNNKFNFLKNLLIFPMNEIDKSKFNSSPKVKTKIKISNIDMNIVIN-KNKIKSTNKGL  209

Query  181  FINVKDLSNWTLPSFTKKI  199
             +N K + +  +PSFTKK+
Sbjct  210  ILNRKKIVSEVIPSFTKKL  228


>ref|ZP_01264723.1| A/G-specific adenine glycosylase [Candidatus Pelagibacter ubique 
HTCC1002]
 gb|EAS85210.1| A/G-specific adenine glycosylase [Candidatus Pelagibacter ubique 
HTCC1002]
Length=326

 Score =  204 bits (520),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 144/204 (70%), Gaps = 4/204 (1%)

Query  1    SNAIMAIAFNKKIIPLDGNVERILKRVFYLKKEKEISKENLHQKKMFFGETIRASDYAQA  60
            SNAIMAIAFNK  IPLDGN+ER++KR+  LK  KEI+K+NL + K   G + RASDYAQA
Sbjct  125  SNAIMAIAFNKPFIPLDGNIERVIKRLLNLKLPKEITKDNLVKNKKILGNSTRASDYAQA  184

Query  61   IMEIGALICKPSNPLCYQCPISTNCKSLKKNDFEIIKINKFNKQKFFEANIFQNKQNNYY  120
            +ME+GALIC+P NPLC+QCP+  NCKS KK DFEIIK  K    KF+   +++ K N + 
Sbjct  185  LMELGALICRPKNPLCHQCPLIKNCKSFKKKDFEIIKERKKKIDKFYLLEVYK-KNNKFL  243

Query  121  LLKNRKFNFLKDMPIFPMNEIPKTKFKNHLGKRINIKMSNMDMKIAINMKNNLPENSDGF  180
            L+KN KFNFLK++ IFPM +I K    ++L K +N K+SNM+M + I       E S+  
Sbjct  244  LIKNTKFNFLKNLQIFPMKQISKP---DNLAKALNFKISNMNMNVIIKFSKLKGEISNSS  300

Query  181  FINVKDLSNWTLPSFTKKILNTIK  204
            +I+   L ++TLP+FTKKI N +K
Sbjct  301  WIDSSKLEDYTLPTFTKKIFNYLK  324


>ref|YP_265538.1| A/G-specific adenine glycosylase [Candidatus Pelagibacter ubique 
HTCC1062]
 gb|AAZ20935.1| A/G-specific adenine glycosylase [Candidatus Pelagibacter ubique 
HTCC1062]
Length=326

 Score =  203 bits (516),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 108/204 (52%), Positives = 142/204 (69%), Gaps = 4/204 (1%)

Query  1    SNAIMAIAFNKKIIPLDGNVERILKRVFYLKKEKEISKENLHQKKMFFGETIRASDYAQA  60
            SNAIMAIAFNK  IPLDGN+ER++KR+  LK  KEI+K+NL + K   G + RASDYAQA
Sbjct  125  SNAIMAIAFNKPFIPLDGNIERVIKRLLNLKLPKEITKDNLVKSKKILGNSTRASDYAQA  184

Query  61   IMEIGALICKPSNPLCYQCPISTNCKSLKKNDFEIIKINKFNKQKFFEANIFQNKQNNYY  120
            +ME+GALIC+P NPLCYQCP+  NCKS KK DFE IK  K    KF+   +++ K N + 
Sbjct  185  LMELGALICRPKNPLCYQCPLIKNCKSFKKKDFETIKERKKKIDKFYLLEVYK-KNNKFL  243

Query  121  LLKNRKFNFLKDMPIFPMNEIPKTKFKNHLGKRINIKMSNMDMKIAINMKNNLPENSDGF  180
            L+KN KFNFLK++ IFPM +I K    ++L K +N K+SNM+M + I         S+  
Sbjct  244  LIKNTKFNFLKNLQIFPMKQISKP---DNLAKALNFKISNMNMNVIIKFSKLKGTISNSS  300

Query  181  FINVKDLSNWTLPSFTKKILNTIK  204
            +I+   L ++TLP+FTKKI N +K
Sbjct  301  WIDSSKLEDYTLPTFTKKIFNYLK  324


>ref|ZP_05068747.1| A/G-specific adenine glycosylase [Candidatus Pelagibacter sp. 
HTCC7211]
 gb|EDZ59746.1| A/G-specific adenine glycosylase [Candidatus Pelagibacter sp. 
HTCC7211]
Length=326

 Score =  193 bits (490),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 146/206 (70%), Gaps = 5/206 (2%)

Query  1    SNAIMAIAFNKKIIPLDGNVERILKRVFYLKKEKEISKENLHQKKMFFGETIRASDYAQA  60
            ++AI AIAFN++IIPLDGN+ER+LKR+  LK EKEI KE LH++K  FG+T R++DY QA
Sbjct  121  ASAISAIAFNQQIIPLDGNIERLLKRILNLKTEKEIKKEYLHKEKKVFGQTSRSNDYVQA  180

Query  61   IMEIGALICKPSNPLCYQCPISTNCKSLKKNDFEIIKINKFNKQKFFEANIFQNKQNNYY  120
            +MEIGAL+CKP NP C +CPI+  C S K+ DFEI K NK    KF+ A +++N  N   
Sbjct  181  LMEIGALLCKPKNPNCDKCPITKYCLSFKRQDFEIKKKNKKIINKFYLATLYKN-NNQLL  239

Query  121  LLKNRKFNFLKDMPIFPMNEIPKTKFKNHL--GKRINIKMSNMDMKIAINMKNNLPENSD  178
            L+KN KFNFLK++ IFPM EI  T F + L   K+++IKMSNM+M I+I+  N   +  +
Sbjct  240  LIKNEKFNFLKNLLIFPMKEI--TLFDSLLKSNKKLSIKMSNMNMNISIDFLNTKKKTKE  297

Query  179  GFFINVKDLSNWTLPSFTKKILNTIK  204
            G +I    L N+ +P FTKKI  ++K
Sbjct  298  GLWIEKSKLENYLIPKFTKKIFESVK  323


>ref|YP_757425.1| A/G-specific DNA-adenine glycosylase [Maricaulis maris MCS10]
 gb|ABI66487.1| A/G-specific DNA-adenine glycosylase [Maricaulis maris MCS10]
Length=350

 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 93/213 (43%), Gaps = 13/213 (6%)

Query  1    SNAIMAIAFNKKIIPLDGNVERILKRVFYLKKEKEISKENLHQKKMFFGETIRASDYAQA  60
            +NAI+A AF+K    +DGNVER++ R+  ++     +K  + +      +  R+ DYAQA
Sbjct  133  ANAILAAAFDKPASVVDGNVERVITRLHRVETAMPKAKPEVRKLAAAIADPDRSGDYAQA  192

Query  61   IMEIGALICKPSNPLCYQCPISTNCKSLKKNDFEIIKINKFNKQKFFEANI--FQNKQNN  118
            IM++GA +C P  P C  C  S  C +    D E   +    K K           +   
Sbjct  193  IMDLGATVCTPRKPDCSACCWSFACAASAVGDMERYPVKAPRKVKPVRRGTAWLVRRAGR  252

Query  119  YYLLKNRKFNFLKDMPIFP---------MNEIPKTKFKNHLGKRINIKMSNMDMKIAINM  169
             +L K      L  M   P          +E P  + +      +    ++ ++++A+  
Sbjct  253  IWLRKRGDAGLLGGMTEVPSSPWLETGHASEAPPLEAEWADRGEVRHVFTHFELRLAVRE  312

Query  170  KNNLP--ENSDGFFINVKDLSNWTLPSFTKKIL  200
                P  E   G++ + +DL N  LPS  +K+L
Sbjct  313  GEASPGWEPDSGYWADERDLGNEALPSVMRKVL  345


>gb|ADC38035.1| A/G-specific adenine glycosylase [Staphylococcus aureus 04-02981]
Length=345

 Score = 91.3 bits (225),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 69/223 (30%), Positives = 110/223 (49%), Gaps = 25/223 (11%)

Query  3    AIMAIAFNKKIIPLDGNVERILKRVFYLKKEKEI-SKENLHQKKMFFGETIRASDYAQAI  61
            A+M+IA+N  +  +DGNV R+  R+    ++ ++ S    +++++    T  A  + QA+
Sbjct  124  AVMSIAYNVPLATVDGNVFRVWSRLNDDYRDIKLQSTRKSYEQELLPYVTTEAGTFNQAM  183

Query  62   MEIGALICKPSNPLCYQCPISTNCKSLKKNDFEIIKINKFN-KQKFFEANIFQNKQN-NY  119
            ME+GALIC P NPLC  CP+  NC++  K  FE + +   N  +K  E ++F  + N   
Sbjct  184  MELGALICTPKNPLCLFCPVQENCEAFDKGTFEKLPVKSKNVSKKVIEQSVFLIRNNQGQ  243

Query  120  YLLKNRKFNFLKDMPIFPM--NEIPKTKFKNHLGKRINI----------KMSNMDMKI--  165
            YLL+ R    L  M  FPM  +E  K K    +G  I            + +++  KI  
Sbjct  244  YLLQKRSEKLLHGMWQFPMFESEHAKRKMTEKIGHDIQPVETPIFELKHQFTHLTWKIKV  303

Query  166  -----AINMKNNLPENSDGFFINVKDLSNWTLPSFTKKILNTI  203
                 AIN++  LP+  D  + N+ D   +T P    KI   I
Sbjct  304  YAASGAINIE-TLPD--DMIWFNLSDRDQYTFPVPMSKIYQFI  343


>ref|NP_372392.1| A/G-specific adenine glycosylase [Staphylococcus aureus subsp. 
aureus Mu50]
 ref|NP_374975.1| hypothetical protein SA1685 [Staphylococcus aureus subsp. aureus 
N315]
 ref|YP_001247283.1| A/G-specific adenine glycosylase [Staphylococcus aureus subsp. 
aureus JH9]
 ref|YP_001317077.1| A/G-specific adenine glycosylase [Staphylococcus aureus subsp. 
aureus JH1]
 ref|YP_001442443.1| hypothetical protein SAHV_1853 [Staphylococcus aureus subsp. 
aureus Mu3]
 ref|ZP_04838052.1| hypothetical protein SauraC_01440 [Staphylococcus aureus subsp. 
aureus str. CF-Marseille]
 ref|ZP_05145257.2| hypothetical protein SauraM_09310 [Staphylococcus aureus subsp. 
aureus Mu50-omega]
 ref|ZP_05642197.1| A/G-specific adenine glycosylase [Staphylococcus aureus A9781]
 ref|ZP_05681202.1| A/G-specific adenine glycosylase [Staphylococcus aureus A9763]
 ref|ZP_05684032.1| A/G-specific adenine glycosylase [Staphylococcus aureus A9719]
 ref|ZP_05688423.1| A/G-specific adenine glycosylase [Staphylococcus aureus A9299]
 ref|ZP_05691771.1| A/G-specific adenine glycosylase [Staphylococcus aureus A8115]
 ref|ZP_05693478.1| A/G-specific adenine glycosylase [Staphylococcus aureus A6300]
 ref|ZP_05695985.1| A/G-specific adenine glycosylase [Staphylococcus aureus A6224]
 ref|ZP_05701269.1| A/G-specific adenine glycosylase [Staphylococcus aureus A5937]
 ref|YP_003282774.1| A/G-specific adenine glycosylase [Staphylococcus aureus subsp. 
aureus ED98]
 ref|ZP_06302760.1| A/G-specific adenine glycosylase [Staphylococcus aureus A8117]
 ref|ZP_06335646.1| A/G-specific adenine glycosylase [Staphylococcus aureus A10102]
 ref|ZP_06817044.1| hypothetical protein SMAG_02418 [Staphylococcus aureus A8819]
 dbj|BAB42954.1| SA1685 [Staphylococcus aureus subsp. aureus N315]
 dbj|BAB58030.1| similar to A/G-specific adenine glycosylase [Staphylococcus aureus 
subsp. aureus Mu50]
 gb|ABQ49707.1| A/G-specific DNA-adenine glycosylase [Staphylococcus aureus subsp. 
aureus JH9]
 gb|ABR52790.1| A/G-specific adenine glycosylase [Staphylococcus aureus subsp. 
aureus JH1]
 dbj|BAF78736.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3]
 gb|EEV25530.1| A/G-specific adenine glycosylase [Staphylococcus aureus A9781]
 gb|EEV64829.1| A/G-specific adenine glycosylase [Staphylococcus aureus A9763]
 gb|EEV67335.1| A/G-specific adenine glycosylase [Staphylococcus aureus A9719]
 gb|EEV73615.1| A/G-specific adenine glycosylase [Staphylococcus aureus A9299]
 gb|EEV75254.1| A/G-specific adenine glycosylase [Staphylococcus aureus A8115]
 gb|EEV78729.1| A/G-specific adenine glycosylase [Staphylococcus aureus A6300]
 gb|EEV81652.1| A/G-specific adenine glycosylase [Staphylococcus aureus A6224]
 gb|EEV87235.1| A/G-specific adenine glycosylase [Staphylococcus aureus A5937]
 gb|ACY11768.1| A/G-specific adenine glycosylase [Staphylococcus aureus subsp. 
aureus ED98]
 gb|EFB95184.1| A/G-specific adenine glycosylase [Staphylococcus aureus A10102]
 gb|EFC03151.1| A/G-specific adenine glycosylase [Staphylococcus aureus A8117]
 gb|EFG43850.1| hypothetical protein SMAG_02418 [Staphylococcus aureus A8819]
Length=345

 Score = 90.5 bits (223),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 110/223 (49%), Gaps = 25/223 (11%)

Query  3    AIMAIAFNKKIIPLDGNVERILKRVFYLKKEKEI-SKENLHQKKMFFGETIRASDYAQAI  61
            A+M+IA+N  +  +DGNV R+  R+    ++ ++ S    +++++    T  A  + QA+
Sbjct  124  AVMSIAYNVPLATVDGNVFRVWSRLNDDYRDIKLQSTRKSYEQELLPYVTTEAGTFNQAM  183

Query  62   MEIGALICKPSNPLCYQCPISTNCKSLKKNDFEIIKINKFN-KQKFFEANIFQNKQN-NY  119
            ME+GALIC P NPLC  CP+  NC++  K  FE + +   N  +K  E ++F  + N   
Sbjct  184  MELGALICTPKNPLCLFCPVQENCEAFDKGTFEKLPVKSKNVSKKVIEQSVFLIRNNQGQ  243

Query  120  YLLKNRKFNFLKDMPIFPM--NEIPKTKFKNHLGKRINI----------KMSNMDMKI--  165
            YLL+ R    L  M  FPM  +E  + K    +G  I            + +++  KI  
Sbjct  244  YLLQKRSEKLLHGMWQFPMFESEHARRKMTEKIGHDIQPVETPIFELKHQFTHLTWKIKV  303

Query  166  -----AINMKNNLPENSDGFFINVKDLSNWTLPSFTKKILNTI  203
                 AIN++  LP+  D  + N+ D   +T P    KI   I
Sbjct  304  YAASGAINIE-TLPD--DMIWFNLSDRDQYTFPVPMSKIYQFI  343


>ref|ZP_04868609.1| A/G-specific DNA glycosylase [Staphylococcus aureus subsp. aureus 
TCH130]
 gb|EES96326.1| A/G-specific DNA glycosylase [Staphylococcus aureus subsp. aureus 
TCH130]
Length=345

 Score = 90.5 bits (223),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 110/223 (49%), Gaps = 25/223 (11%)

Query  3    AIMAIAFNKKIIPLDGNVERILKRVFYLKKEKEI-SKENLHQKKMFFGETIRASDYAQAI  61
            A+M+IA+N  +  +DGNV R+  R+    ++ ++ S    +++++    T  A  + QA+
Sbjct  124  AVMSIAYNVPLATVDGNVFRVWSRLNDDYRDIKLQSTRKSYEQELLPYVTTEAGTFNQAM  183

Query  62   MEIGALICKPSNPLCYQCPISTNCKSLKKNDFEIIKINKFN-KQKFFEANIFQNKQN-NY  119
            ME+GALIC P NPLC  CP+  NC++  K  FE + +   N  +K  E ++F  + N   
Sbjct  184  MELGALICTPKNPLCLFCPVQENCEAFDKGTFEKLPVKSKNVSKKVIEQSVFLIRNNQGQ  243

Query  120  YLLKNRKFNFLKDMPIFPM--NEIPKTKFKNHLGKRINI----------KMSNMDMKI--  165
            YLL+ R    L  M  FPM  +E  + K    +G  I            + +++  KI  
Sbjct  244  YLLQKRSEKLLHGMWQFPMFESEHARRKMTEKIGHDIQPVETPIFELKHQFTHLTWKIKV  303

Query  166  -----AINMKNNLPENSDGFFINVKDLSNWTLPSFTKKILNTI  203
                 AIN++  LP+  D  + N+ D   +T P    KI   I
Sbjct  304  YAVSGAINIE-TLPD--DMIWFNLSDRDQYTFPVPMSKIYQFI  343


>ref|ZP_05699103.1| A/G-specific adenine glycosylase [Staphylococcus aureus A5948]
 gb|EEV84121.1| A/G-specific adenine glycosylase [Staphylococcus aureus A5948]
Length=345

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 110/223 (49%), Gaps = 25/223 (11%)

Query  3    AIMAIAFNKKIIPLDGNVERILKRVFYLKKEKEI-SKENLHQKKMFFGETIRASDYAQAI  61
            A+M+IA+N  +  +DGNV R+  R+    ++ ++ S    +++++    T  A  + QA+
Sbjct  124  AVMSIAYNVPLATVDGNVFRVWSRLNDDYRDIKLQSTRKSYEQELLPYVTTEAGTFNQAM  183

Query  62   MEIGALICKPSNPLCYQCPISTNCKSLKKNDFEIIKINKFN-KQKFFEANIFQNKQN-NY  119
            MEIGALIC P NPLC  CP+  NC++  K  FE + +   N  +K  E ++F  + N   
Sbjct  184  MEIGALICTPKNPLCLFCPVQENCEAFDKGTFEKLPVKSKNVSKKVIEQSVFLIRNNQGQ  243

Query  120  YLLKNRKFNFLKDMPIFPM--NEIPKTKFKNHLGKRIN----------IKMSNMDMKI--  165
            YLL+ R    L  M  FPM  +E  + K    +G  I            + +++  KI  
Sbjct  244  YLLQKRSEKLLHGMWQFPMFESEHARRKMTEKIGHDIQPVETPIFELKHQFTHLTWKIKV  303

Query  166  -----AINMKNNLPENSDGFFINVKDLSNWTLPSFTKKILNTI  203
                 AIN++  LP+  D  + ++ D   +T P    KI   I
Sbjct  304  YAVSGAINIE-TLPD--DMIWFDLSDRDQYTFPVPMSKIYQFI  343


>ref|YP_766689.1| putative A/G-specific adenine glycosylase [Rhizobium leguminosarum 
bv. viciae 3841]
 emb|CAK06575.1| putative A/G-specific adenine glycosylase [Rhizobium leguminosarum 
bv. viciae 3841]
Length=367

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 96/222 (43%), Gaps = 39/222 (17%)

Query  9    FNKKIIPLDGNVERILKRVFYLKKEKEISKENLHQKKMFFGETIRASDYAQAIMEIGALI  68
            FN++   +DGNVER++ R++ +      +K  + +K        R  D+AQA+M++GA I
Sbjct  142  FNRQAAVMDGNVERVISRLYAISTPLPAAKPAMREKVALLTPADRPGDFAQAMMDLGATI  201

Query  69   CKPSNPLCYQCPISTNCKSLKKNDFEIIKINKFNKQK--FFEANIFQNKQNNYYLLKNRK  126
            C P  P C  CP    C++LK +D E+  +    K+K   + A       +   LL+ R 
Sbjct  202  CTPKRPACSLCPFRGACEALKLSDPELFPVKAAKKEKPVRYGAAFIAVTGDGEILLRRRI  261

Query  127  FNFLKDMPIFPMNEIPKTKFK----------------------------NHLGKRINIKM  158
             + L    +  M E+P T +                              H   R++I  
Sbjct  262  DSGL----LGGMTEVPTTAWTARIDGETSADAAPFDAAWQSSGTVIHVFTHFELRLSIWR  317

Query  159  SNMDMKIAINMKNNLPENSDGFFINVKDLSNWTLPSFTKKIL  200
            + +  K+A++   N     DG++  V +L    LP+  KK +
Sbjct  318  AAIAAKVAMDDGRN-----DGWWEPVTNLEAQALPTIMKKAI  354


>ref|NP_646625.1| hypothetical protein MW1808 [Staphylococcus aureus subsp. aureus 
MW2]
 ref|YP_043907.1| HhH-GPD superfamily base excision DNA repair protein [Staphylococcus 
aureus subsp. aureus MSSA476]
 ref|ZP_04829551.1| A/G-specific DNA glycosylase [Staphylococcus aureus subsp. aureus 
TCH70]
 dbj|BAB95673.1| MW1808 [Staphylococcus aureus subsp. aureus MW2]
 emb|CAG43595.1| HhH-GPD superfamily base excision DNA repair protein [Staphylococcus 
aureus subsp. aureus MSSA476]
 gb|EES54074.1| A/G-specific DNA glycosylase [Staphylococcus aureus subsp. aureus 
TCH70]
Length=345

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 111/223 (49%), Gaps = 25/223 (11%)

Query  3    AIMAIAFNKKIIPLDGNVERILKRVFYLKKEKEI-SKENLHQKKMFFGETIRASDYAQAI  61
            A+M+IA+N  +  +DGNV R+  R+    ++ ++ S    +++++    T  A  + QA+
Sbjct  124  AVMSIAYNVPLATVDGNVFRVWSRLNDDYRDIKLQSTRKSYEQELLPYVTTEAGTFNQAM  183

Query  62   MEIGALICKPSNPLCYQCPISTNCKSLKKNDFEIIKINKFN-KQKFFEANIFQNKQN-NY  119
            ME+GALIC P NPLC  CP+  NC++  K  FE + +   N  +K  E ++F  + N   
Sbjct  184  MELGALICTPKNPLCLFCPVQENCEAFDKGTFEKLPVKSKNVSKKVIEQSVFLIRNNQGQ  243

Query  120  YLLKNRKFNFLKDMPIFPM--NEIPKTKFKNHLGKRINI----------KMSNMDMKI--  165
            YLL+ R+   L  M  FPM  +E  + K    +G  I            + +++  KI  
Sbjct  244  YLLQKRREKLLHGMWQFPMFESEHARRKMTEKIGHDIQPVETPIFELKHQFTHLTWKIKV  303

Query  166  -----AINMKNNLPENSDGFFINVKDLSNWTLPSFTKKILNTI  203
                 AIN++  LP+  D  + ++ D   +T P    KI   I
Sbjct  304  YAVSGAINIE-TLPD--DMIWFDLSDRDQYTFPVPMSKIYQFI  343


>ref|ZP_04863791.1| A/G-specific DNA glycosylase [Staphylococcus aureus subsp. aureus 
USA300_TCH959]
 gb|EES95351.1| A/G-specific DNA glycosylase [Staphylococcus aureus subsp. aureus 
USA300_TCH959]
Length=345

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 110/223 (49%), Gaps = 25/223 (11%)

Query  3    AIMAIAFNKKIIPLDGNVERILKRVFYLKKEKEI-SKENLHQKKMFFGETIRASDYAQAI  61
            A+M+IA+N  +  +DGNV R+  R+    ++ ++ S    +++++    T  A  + QA+
Sbjct  124  AVMSIAYNVPLATVDGNVFRVWSRLNDDYRDIKLQSTRKSYEQELLPYVTTEAGTFNQAM  183

Query  62   MEIGALICKPSNPLCYQCPISTNCKSLKKNDFEIIKINKFN-KQKFFEANIFQNKQN-NY  119
            ME+GALIC P NPLC  CP+  NC++  K  FE + +   N  +K  E ++F  + N   
Sbjct  184  MELGALICTPKNPLCLFCPVQENCEAFDKGTFEKLPVKSKNVSKKVIEQSVFLIRNNQGQ  243

Query  120  YLLKNRKFNFLKDMPIFPM--NEIPKTKFKNHLGK----------RINIKMSNMDMKI--  165
            YLL+ R    L  M  FPM  +E  + K    +G            +  + +++  KI  
Sbjct  244  YLLQKRSEKLLHGMWQFPMFESEHARRKMTEKIGHDNQPVETPIFELKHQFTHLTWKIKV  303

Query  166  -----AINMKNNLPENSDGFFINVKDLSNWTLPSFTKKILNTI  203
                 AIN++  LP+  D  + N+ D   +T P    KI   I
Sbjct  304  YAVSGAINIE-TLPD--DMIWFNLSDRDQYTFPVPMSKIYQFI  343