GOS 1513040

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091120682291
Annotathon code: GOS_1513040
Sample :
  • GPS :41°29'9n; 71°21'4w
  • North American East Coast: Newport Harbor, RI - USA
  • Coastal (-1m, 9.4°C, 0.1-0.8 microns)
Authors
Team : Algarve
Username : grhmgr
Annotated on : 2010-08-12 17:48:55
  • a29857 NunoPanascoGranadeiro
  • a30908 HélderManuelRibeiro
  • a30913 TiagoMiguelTrancosdeMiraGrosso

Synopsis

  • Taxonomy: Candidatus Pelagibacter (NCBI info)
    Rank: genus - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 198251
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order: Rickettsiales
    Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; SAR11 cluster; Candidatus Pelagibacter;

Genomic Sequence

>JCVI_READ_1091120682291 GOS_1513040 Genomic DNA
ATATAAAATTTAATGGTGATATGAGATTTAATATAATTATTCGATCAATTCTTAATTTTAAAAATATTTCAGAAGTAGCCGTGGCTTCAGGAGTAGTAAT
AGACAGTAATGCAAATCGTGAATTTAATGAAAATTATATAAAAGCAAAAGCTTTAATAGATTTATATTAATGATTTACATTATAGATCATAACGACTCGT
TCACATTTAATGTTGTTCATCAATTTTCTAAATTTGATGAAGTAATTTGTGATAATTACGACAGAGTTAATAATGATATTTTAGAAAAAGCTAGTTCAAT
CGTTTTATCTCCAGGGCCAGGAAATCCTAAAAACTATCCAAAATCTTCAAAAATTTATAAAAAATACAAGGGCAAAAAAAGAATAATTGGGATCTGCTTA
GGTTTTCAGCAAATTCTTTATAATGAAGGAGCTAAAATAGTAGAGCAAAAAAACATATATCATGGGTTTCAATCAGAAATAAAAGTTACCAATAATAGTA
AAATTTTTAATAATAATTCAGTATTTAAAGTTGGAAGATATCATTCCTTAAAGCTTAAAGAACCTTTTAATAAAACCAATTTTGATATAACAATGCGATG
CAAAATTACAAATGTTGCTATGGCATTTGAAAACAATTTAGACAAAATTTATGGATTTCAATTTCACCCAGAATCTTTTTTAACTTTAAATGGCAACTTT
CTTATTAAAAAAATCTTATCAGCTTAACAATTTAAGAGAGATTAAATTTAATGATCTATGGGGAGATCATGGTGTTTCACTACCATGTGGATT

Translation

[170 - 724/793]   direct strand
>GOS_1513040 Translation [170-724   direct strand]
MIYIIDHNDSFTFNVVHQFSKFDEVICDNYDRVNNDILEKASSIVLSPGPGNPKNYPKSSKIYKKYKGKKRIIGICLGFQQILYNEGAKIVEQKNIYHGF
QSEIKVTNNSKIFNNNSVFKVGRYHSLKLKEPFNKTNFDITMRCKITNVAMAFENNLDKIYGFQFHPESFLTLNGNFLIKKILSA

Annotator commentaries

The sequence analyzed has 185 aa and a molecular weight of 21.4 kDa, to our analysis it was found that this sequence has biological significance, and as such was designated as the coding.

This sequence most likely, and by using protein domains, encode the protein Glutamine amidotransferase class-I C-terminal (e-value of 1.1e-35). Therefore we can say that possibly the function of our sequence is a molecular function, catalytic activity, this activity involves the removal of an ammonia group from one molecule of glutamate and subsequently transfers this ammonia to a specific substrate, this will create a new group carbon- nitrogen in the substrate. This biochemical process is involved in biosynthetic processes. Using the results of the MSA and phylogenetic trees, we can say that our sequence is homologous to the sequences present in the organism of the genus Candidatus Pelagibacter, therefore we observed very conserved sequences in alignment with these sequences and our sequence, and she came on the same node of the sequences of Candidatus genus Pelagibacter and this one has a bootstrap node of 0.7.

ORF finding

PROTOCOL


a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code


RESULTS ANALYSIS


There is only one ORF, and this is in the reading frame 2 of the direct strand. There is no ORF's in the reverse strand.

This ORF has a stop codon (UAA), and has no start codon at the beginning of the sequence, showing only a methionine at the 14th position,so the ORF is not complete, missing the start codon in the begining of the sequence. There are no stop codon in the middle of te ORF. The ORF has 198 aa and has biological significance, and because of that wye could say that ORF is coding.

RAW RESULTS

a)forward strand
 
No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 131 to base 727.
AAATTATATAAAAGCAAAAGCTTTAATAGATTTATATTAATGATTTACATTATAGATCAT
AACGACTCGTTCACATTTAATGTTGTTCATCAATTTTCTAAATTTGATGAAGTAATTTGT
GATAATTACGACAGAGTTAATAATGATATTTTAGAAAAAGCTAGTTCAATCGTTTTATCT
CCAGGGCCAGGAAATCCTAAAAACTATCCAAAATCTTCAAAAATTTATAAAAAATACAAG
GGCAAAAAAAGAATAATTGGGATCTGCTTAGGTTTTCAGCAAATTCTTTATAATGAAGGA
GCTAAAATAGTAGAGCAAAAAAACATATATCATGGGTTTCAATCAGAAATAAAAGTTACC
AATAATAGTAAAATTTTTAATAATAATTCAGTATTTAAAGTTGGAAGATATCATTCCTTA
AAGCTTAAAGAACCTTTTAATAAAACCAATTTTGATATAACAATGCGATGCAAAATTACA
AATGTTGCTATGGCATTTGAAAACAATTTAGACAAAATTTATGGATTTCAATTTCACCCA
GAATCTTTTTTAACTTTAAATGGCAACTTTCTTATTAAAAAAATCTTATCAGCTTAA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
KLYKSKSFNRFILMIYIIDHNDSFTFNVVHQFSKFDEVICDNYDRVNNDILEKASSIVLS
PGPGNPKNYPKSSKIYKKYKGKKRIIGICLGFQQILYNEGAKIVEQKNIYHGFQSEIKVT
NNSKIFNNNSVFKVGRYHSLKLKEPFNKTNFDITMRCKITNVAMAFENNLDKIYGFQFHP
ESFLTLNGNFLIKKILSA*

No ORFs were found in reading frame 3.

b)reverse strand

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOL


a) CLUSTAL 2.0.12 multiple sequence alignment



RESULTS ANALYSIS


We could only choose 10 ingroups, because with the results of lineage report was impossible to choose more. Of these 10 ingroups, one we cannot get the sequence, and another one had a sequence too large compared with the remaining 8 ingroups, then eliminated this ingroup to obtain a better multiple alignment.

Analyzing the results of the MSA, it appears that our sequence is conserved, and there are no relevant differences in size among the sequences analyzed.

After performing the MSA was found that our sequence had a methionine at position 13. Because of this fact we changed the starting position of the ORF, which began earlier in the third nucleotide, to position 170, and now we have obtained a ORF complete.

RAW RESULTS

GOS_1513040                         KLYKSKSFNRFILMIYIIDHNDSFTFNVVHQFSKFDEVICDNYDRVNNDI 50
Candidatus_Pelagibacter_sp._IN      -------------MIYVIDHKDSFTHNVVHQFSLFDNVVCDDFSKINNSK 37
Candidatus_Pelagibacter_ub_IN       -------------MIYIIDHHDSFTQNVVHQFQNFDEVVCTNFNEINQNK 37
Candidatus_Pelagibacter_HTC_IN      -------------MIYIIDHHDSFTQNVVHQFQNFDEVVCTNFNEINQNK 37
alpha_proteobacterium_IN            ------------MKIALIDNYDSFTFNVYHYLKNIKCEVEVFRNDKFKIK 38
Bradyrhizobium_japonicum_IN         -------------MIVIVDNYDSFVFNIARYFHKLSEATEVIRNDAISIS 37
Methylocella_silvestris_BL2_IN      -------------MILVVDNYDSFVHTVAGYLRELGETPVVIRNDAS--- 34
Methylobacterium_extorquens_IN      -------------MILVVDNYDSFVFNVVRYFEELGETVEVVRNDALDVA 37
Hyphomonas_neptunium_IN             -------------MILVIDNYDSFTWNLVHYLEELGAKTHVVRNDQLTVD 37
Aggregatibacter_actinomy_IN         MS------------LLIINNHDSFTFNLVDLIRRLAVPFQVVNVEDLDLD 38
Oxalobacter_formigenes_OUT          MFCFSRINTRVTAMLLMIDNYDSFTYNLVQYFGELGTDVETYRNDEISID 50
Helicobacter_pylori_OUT             ------------MKIFFIDNFDSFSYNLVYELECLGYEVAVYQNDIDPSY 38
Geobacter_sp._M21_OUT               -------------MLLMIDNYDSFTYNIVQYLGELGEDVRVYRNDKITLE 37
Helicobacter_mustelae_OUT           MSKFPLNFSRGNFMILLIDHYDSFTYNIVHYLK--DFPLLVRHPQELDRE 48
                                                  : .::: ***  .:   :                  

GOS_1513040                         LEKASS-------IVLSPGPGNPKNYPKSSKIYKKYKGKKRIIGICLGFQ 93
Candidatus_Pelagibacter_sp._IN      LNQAST-------IVFSPGPGSPKDYPLSSKIYKKFKGKKKIIGICLGFQ 80
Candidatus_Pelagibacter_ub_IN       LKKADI-------IVFSPGPGAPKDYPISSEIYKKFKGKKKIIGICLGFQ 80
Candidatus_Pelagibacter_HTCC10      LKKADI-------IVFSPGPGAPKDYPISSEIYKKFKGKKKIIGICLGFQ 80
alpha_proteobacterium_IN            QIKSF--DK----IVISPGPGNPRQAGKCLELIKYYFKNKPILGICLGHQ 82
Bradyrhizobium_japonicum_IN         ELVGLNPRA----VVISPGPCTPTEAGISTAVVRELSGRVPILGICLGHQ 83
Methylocella_silvestris_BL2_IN      -LPAEAPEA----IVISPGPCTPNEAGMSMDLIRDWSGRVPILGICLGHQ 79
Methylobacterium_extorquens_AM      GIRARNPEA----VVISPGPCTPAEAGVSLPAIRELSGEVPILGVCLGHQ 83
Hyphomonas_neptunium_IN             EALALKPDA----LLLSPGPCTPNEAGICLDLLKAAPDDLPVLGVCLGHQ 83
Aggregatibacter_actinomycetemc      AVENFS------HLLISPGPDVPRAYPQLFALLERYHRCKSIFGVCLGHQ 82
Oxalobacter_formigenes_OUT          RIEKLNPDQ----ICISPGPRTPYEAGISLEVLKHFAGKKPIFGVCLGHQ 96
Helicobacter_pylori_OUT             LMDLMHKESKTPLLFISPGPGNPNSSGNLLKIIEMAKKKFPILGVCLGLQ 88
Geobacter_sp._M21_OUT               EIEAMAPER----IVISPGPCSPEEAGISVEVVRRFAGRIPILGVCLGHQ 83
Helicobacter_mustelae_OUT           EIHHYS------HLILSPGPGHPKDCKVALEILECYHKSKKILGICLGHQ 92
                                                 : :****  *          .       ::*:*** *

GOS_1513040                         QILYNEGAKIVEQKNIYHGFQS--EIKVTNNSKIFNNNSVFKVGRYHSLK 141
Candidatus_Pelagibacter_sp._IN      QILFCEGASIIEQSKIYHGFQS--EVLVNKSSKLFNTGRKFKVGRYHSLK 128
Candidatus_Pelagibacter_ub_IN       QILHCENGKIVEQKKIYHGFQS--KIKVTSKNSLFKKNSQFTVGRYHSLK 128
Candidatus_Pelagibacter_HTCC10      QILHCENGKIVEQKKIYHGFQS--KIKVTSKNSLFKKNSQFTVGRYHSLK 128
alpha_proteobacterium_IN            AIAQSFGAKIIKAKKLMHGKISKIKILSTKSKMFKKIPRIINATRYHSLI 132
Bradyrhizobium_japonicum_IN         CIASVFGGRVARARRPMHGRRS--YVAHDGRGLFKGLPTPLDVGRYHSLI 131
Methylocella_silvestris_BL2_IN      AIGQVFGGRVTRARRPMHGEAS--AVRHTGAGVLAGLPQPLLVGRYHSLI 127
Methylobacterium_extorquens_AM      AIGAAFGGRVERAGRPLHGHAT--PIRHGGERLFAGLPQPMQVGRYHSLI 131
Hyphomonas_neptunium_IN             AIGQAFGGAVIHAREIRHGKIS--EIETNQSGLFEGLPERYQVVRYHSLA 131
Aggregatibacter_actinomycetemc      MLCEFFGAALYNLPSPRHGQAK-LLYLVSDSPLFKNLPPSFQIGLYHSWA 131
Oxalobacter_formigenes_OUT          SIGAAFGGKIVRAKQVMHGKTS--PVFHTDKGVFRGLPNPFIVTRYHSLA 144
Helicobacter_pylori_OUT             ALAQSYGAKIIRSKEIVHGKAT--TIALKKHAVFKGLGESMVVGRYHSLM 136
Geobacter_sp._M21_OUT               SIGYAFGGKIVKSATLMHGKTS--PILHDGKELFAGLPNPFAATRYHSLI 131
Helicobacter_mustelae_OUT           IIAYYFGSKIAGLSAPMHGKIS-KISMHQGR-LFTGIGEEFFVGRYHSLH 140
                                     :    .. :       **  .           :           ***  

GOS_1513040                         LKEPFNKTNFDITMRCKITNVAMAFENNLDKIYGFQFHPESFLTLNGNFL 191
Candidatus_Pelagibacter_sp._IN      LKEPFVAENFDITMRCVISGAAMSFENNIDKIYGFQFHPESFLTLNGKIL 178
Candidatus_Pelagibacter_ub_IN       LKEPFAAKNFEITMRCAISNTAMTIENNKEKIYGFQFHPESFLTENGNLL 178
Candidatus_Pelagibacter_HTCC10      LKEPFAAKNFEITMRCAISNTAMTIENNKEKIFGFQFHPESFLTENGNLL 178
alpha_proteobacterium_IN            IDKKT-LDQSFEITAQTTDKIIMAIEHRNYPLYGIQFHPESYKTKHGQQI 181
Bradyrhizobium_japonicum_IN         VALDQSCAQNLVVTARSEEGEIMALTHGYYPTYGVQFHPESILTSQGHVL 181
Methylocella_silvestris_BL2_IN      VELDG-AETPLEATAWSDEGEIMALQHHAHPTYGVQFHPESILTQEGHRL 176
Methylobacterium_extorquens_AM      VEPTPEMERHLTVDAASGEGEVMALSHRSHPTWGIQFHPESVLTENGHAL 181
Hyphomonas_neptunium_IN             IRTDD-LPDCLLADAHTDDGEIMAVHHKTRPVYGVQFHPESILTEHGHAL 180
Aggregatibacter_actinomycetemc      VG-EPHCPTQLQITARCSDNIIMAMQHKTLPIYGVQFHPESYISEYGEQI 180
Oxalobacter_formigenes_OUT          IERES-LPACLEITAWTEDGEIMGVRHKQYAIEGVQFHPESILSERGHTL 193
Helicobacter_pylori_OUT             A---SGLPKNLEVIAEHDN-IPMAIVNEEDKILAYQFHPESIMTLQGRAL 182
Geobacter_sp._M21_OUT               VERES-LPAELEVTAWVAEGEIMGMRHRTLPIWGVQFHPESILTEGGMEL 180
Helicobacter_mustelae_OUT           VS-DLKPP--LRACAYSDDGILMALEHRDLPIFGLQFHPESILSDFGKEI 187
                                                          * . :      . ******  :  *  :

GOS_1513040                         IKKILSA--------------------- 198
Candidatus_Pelagibacter_sp._IN      IKKILSA--------------------- 185
Candidatus_Pelagibacter_ub_IN       IKKILSA--------------------- 185
Candidatus_Pelagibacter_HTCC10      IKKILSA--------------------- 185
alpha_proteobacterium_IN            IKNFIKL--------------------- 188
Bradyrhizobium_japonicum_IN         LKNFLRLAQDFRNRAEQ----------- 198
Methylocella_silvestris_BL2_IN      LRNFLAGARRGADRHAST---------- 194
Methylobacterium_extorquens_AM      FSNFLKEARAWRAAGAPERTDRLADAVV 209
Hyphomonas_neptunium_IN             LKNFLKKVKP------------------ 190
Aggregatibacter_actinomycetemc      LRNWLQAS-------------------- 188
Oxalobacter_formigenes_OUT          LKNFIGD--------------------- 200
Helicobacter_pylori_OUT             LEQSVGFLRGLS---------------- 194
Geobacter_sp._M21_OUT               LQNFLQMTK------------------- 189
Helicobacter_mustelae_OUT           LRNFVMQ--------------------- 194
                                    : : :                       

Protein Domains

PROTOCOL


INTERPRO, default parameters at EBI



RESULTS ANALYSIS


We found four domains, Glutamine amidotransferase class-I C-terminal (e-value of 1.1e-35), Anthranilate synthase component II / delta crystallin (e-value of 5.2e-25), Glutamine amidotransferase superfamily (e-value of 8.9e-12), Glutamine amidotransferase type 1 (e-value of 21 263). Only the domain Glutamine amidotransferase class-I C-terminal (e-value of 1.1e-35) was selected, because it is the one that covers most of our sequence and possibly lead to better accuracy with the function of our protein. The areas Anthranilate synthase component II / delta crystallin (e-value of 5.2e-25), Glutamine amidotransferase superfamily (e-value of 8.9e-12), Glutamine amidotransferase type 1 (e-value of 21 263) are areas that overlap the selected domain, because that domains don´t cover our sequence as the domain Glutamine amidotransferase class-I C-terminal.

This protein has, as molecular function, catalytic activity, this activity involves the removal of an ammonia group from one molecule of glutamate and subsequently transferred that ammonia to a specific substrate, this will create a new group carbon-nitrogen on the substrate.

RAW RESULTS

Translation	3926A8B569457A80	198	HMMPanther	PTHR11922	GMP SYNTHASE-RELATED	                  14	196	1.9e-30	T	19-Apr-2010	NULL	NULL	
Translation	3926A8B569457A80	198	HMMPfam	         PF00117	GATase	                                    17	195	1.1e-35	T	19-Apr-2010	IPR000991	Glutamine amidotransferase class-I, C-terminal	Molecular Function: catalytic activity (GO:0003824)
Translation	3926A8B569457A80	198	FPrintScan	PR00097	ANTSNTHASEII	                           15	29	5.2e-25	T	19-Apr-2010	IPR006220	Anthranilate synthase component II/delta crystallin	Molecular Function: catalytic activity (GO:0003824), Biological Process: biosynthetic process (GO:0009058)
Translation	3926A8B569457A80	198	FPrintScan	PR00097	ANTSNTHASEII	                           57	66	5.2e-25	T	19-Apr-2010	IPR006220	Anthranilate synthase component II/delta crystallin	Molecular Function: catalytic activity (GO:0003824), Biological Process: biosynthetic process (GO:0009058)
Translation	3926A8B569457A80	198	FPrintScan	PR00097	ANTSNTHASEII	                           84	95	5.2e-25	T	19-Apr-2010	IPR006220	Anthranilate synthase component II/delta crystallin	Molecular Function: catalytic activity (GO:0003824), Biological Process: biosynthetic process (GO:0009058)
Translation	3926A8B569457A80	198	FPrintScan	PR00097	ANTSNTHASEII	                           109	117	5.2e-25	T	19-Apr-2010	IPR006220	Anthranilate synthase component II/delta crystallin	Molecular Function: catalytic activity (GO:0003824), Biological Process: biosynthetic process (GO:0009058)
Translation	3926A8B569457A80	198	FPrintScan	PR00097	ANTSNTHASEII	                           129	141	5.2e-25	T	19-Apr-2010	IPR006220	Anthranilate synthase component II/delta crystallin	Molecular Function: catalytic activity (GO:0003824), Biological Process: biosynthetic process (GO:0009058)
Translation	3926A8B569457A80	198	FPrintScan	PR00097	ANTSNTHASEII	                           175	188	5.2e-25	T	19-Apr-2010	IPR006220	Anthranilate synthase component II/delta crystallin	Molecular Function: catalytic activity (GO:0003824), Biological Process: biosynthetic process (GO:0009058)
Translation	3926A8B569457A80	198	FPrintScan	PR00096	GATASE	                                    57	66	8.9e-12	T	19-Apr-2010	IPR011702	Glutamine amidotransferase superfamily	Molecular Function: catalytic activity (GO:0003824), Biological Process: glutamine metabolic process (GO:0006541)
Translation	3926A8B569457A80	198	FPrintScan	PR00096	GATASE	                                    84	95	8.9e-12	T	19-Apr-2010	IPR011702	Glutamine amidotransferase superfamily	Molecular Function: catalytic activity (GO:0003824), Biological Process: glutamine metabolic process (GO:0006541)
Translation	3926A8B569457A80	198	FPrintScan	PR00096	GATASE	                                    175	188	8.9e-12	T	19-Apr-2010	IPR011702	Glutamine amidotransferase superfamily	Molecular Function: catalytic activity (GO:0003824), Biological Process: glutamine metabolic process (GO:0006541)
Translation	3926A8B569457A80	198	ProfileScan	PS51273	GATASE_TYPE_1	                           14	198	21.263	T	19-Apr-2010	IPR017926	Glutamine amidotransferase type 1	
Translation	3926A8B569457A80	198	Gene3D	G3DSA:3.40.50.880	no description	                           15	196	4.2e-32	T	19-Apr-2010	NULL	NULL	
Translation	3926A8B569457A80	198	superfamily	SSF52317	Class I glutamine amidotransferase-like	13	198	6.1e-32	T	19-Apr-2010	NULL	NULL	

Phylogeny

PROTOCOL


a) Phylogeny.fr / BioNJ method / out group: a-proteobacteria

b) Phylogeny.fr / PhyML method / out group: b-proteobacteria, g-proteobacteria, e-proteobacteria, d-proteobacteria



RESULTS ANALYSIS


Analyzing the two methods of constructing phylogenetic tree we could see that there is agreement between the BioNJ and the PhyML, although the trees are not completely equal, but the node in question (marked with (a)) to define the taxonomic group to which it belongs the GOS_1513040, is the same. This was chosen because the bootstrap value observed, which is 0.7, is a good argument to identify the taxonomic group, genus. We can conclude that our sequence has a hypothetical common ancestor with Candidatus Pelagibacter.

Note also that the bootstrap values indicated at nodes (2) and (3) are dee exactly 1, which justifies the homology between the GOS_1513040 and Candidatus Pelagibacter.

RAW RESULTS

a) BioNJ
                                                                                       ----0.1---
 
                                           (1)+-----------GOS_1513040
                                          +---+
                                       (2)|   +-------------Candidatus_Pelagibacter_sp._IN                                    [a-proteobacteria]
 +----------------------------------------+
 |                                        |         +Candidatus_Pelagibacter_ub_IN                                            [a-proteobacteria]
 |                                        |      (3)|
 |                                        +---------+
 |                                                  +-Candidatus_Pelagibacter_HTCC1062_IN                                     [a-proteobacteria]
 |
 |    +-------------------------------------------Helicobacter_pylori_OUT                                                     [e-proteobacteria]
 |    |
 |    |        +-----------------------------alpha_proteobacterium_IN                                                         [a-proteobacteria]
 |    |        |
 |    |      +-+       +-------------------------------------------------------Aggregatibacter_actinomycetemcomitans_OUT      [g-proteobacteria]
 +----+      | +-------+
      |      |         |
      |      |         +------------------------------Helicobacter_mustelae_OUT                                               [e-proteobacteria]
      |      |
      |      |                             +----------------Bradyrhizobium_japonicum_IN                                       [a-proteobacteria]
      +------+                            ++
             |                            |+--------------Methylocella_silvestris_BL2_IN                                      [a-proteobacteria]
             |              +-------------+
             |              |             +------------------Methylobacterium_extorquens_AM1_IN                               [a-proteobacteria]
             |           +--+
             |           |  |
             +-----------+  +-----------------------Hyphomonas_neptunium_IN                                                   [a-proteobacteria]
                         |
                         |         +--------------Oxalobacter_formigenes_OUT                                                  [b-proteobacteria]
                         +---------+
                                   +----------------Geobacter_sp._M21_OUT                                                     [d-proteobacteria]





b) PhyML

                                                                                                       -----0.2----
 
                                            +Candidatus_Pelagibacter_ub_IN                                                    [a-proteobacteria]
                                       +----+
                                       |    +Candidatus_Pelagibacter_HTCC1062_IN                                              [a-proteobacteria]
 +-------------------------------------+
 |                                     |  +-------GOS_1513040
 |                                     |  |
 |                                     +--+
 |                                        +-------Candidatus_Pelagibacter_sp._IN                                              [a-proteobacteria]
 |
 | +--------------------------Helicobacter_pylori_OUT                                                                         [e-proteobacteria]
 | |
 | |              +----------------alpha_proteobacterium_IN [a-proteobacteria]
 | |              |
 | |         +----+              +---------------------------------------------Aggregatibacter_actinomycetemcomitans_OUT      [g-proteobacteria]
 +----+      | +-------+
 +-+         |    +--------------+
   |         |                   |
   |         |                   +---------------Helicobacter_mustelae_OUT                                                    [e-proteobacteria]
   |         |
   |         |                          +--------------Bradyrhizobium_japonicum_IN                                            [a-proteobacteria]
   +---------+                        +-+
             |                        | +------------Methylobacterium_extorquens_AM1_IN                                       [a-proteobacteria]
             |            +-----------+
             |            |           +---------Methylocella_silvestris_BL2_IN                                                [a-proteobacteria]
             |        +---+ 
             |        |   |
             +--------+   +----------------Hyphomonas_neptunium_IN                                                            [a-proteobacteria]
                      |
                      |        +--------Oxalobacter_formigenes_OUT                                                            [b-proteobacteria]
                      +--------+
                               +-------------Geobacter_sp._M21_OUT                                                            [d-proteobacteria]

Taxonomy report

PROTOCOL


1)BLASTp vs NR, defaut NCBI parameters * "1000 max target sequences"


RESULTS ANALYSIS


With the results in the lineage report, we probably can say that our response will be present in bacteria from the class of a-proteobacteria, and most probably belong to a Candidatus Pelagibacter because of scores obtained between 246 and 257, much higher than those following scores.

Based on the lineage report were chosen ingroups, a-proteobacteria, and the outgroups, b-proteobacteria, g-proteobacteria,d-proteobacteria and e-proteobacteria. The sequences chosen are described in the analysis of the blast.






RAW RESULTS

Lineage Report

root
. cellular organisms
. . Bacteria                [bacteria]
. . . Proteobacteria          [proteobacteria]
. . . . Alphaproteobacteria     [a-proteobacteria]
. . . . . SAR11 cluster           [a-proteobacteria]
. . . . . . Candidatus Pelagibacter [a-proteobacteria]
. . . . . . . Candidatus Pelagibacter sp. HTCC7211 -------------------------------  257 2 hits [a-proteobacteria]       anthranilate synthase component II (Glutamine amido-transfe
. . . . . . . Candidatus Pelagibacter ubique HTCC1002 ............................  248 2 hits [a-proteobacteria]       Anthranilate synthase component II (Glutamine amido-transfe
. . . . . . . Candidatus Pelagibacter ubique HTCC1062 ............................  246 2 hits [a-proteobacteria]       anthranilate synthase component II (glutamine amido-transfe
. . . . . . alpha proteobacterium HIMB114 ----------------------------------------  108 2 hits [a-proteobacteria]       para-aminobenzoate/anthranilate synthase glutamine amidotra
. . . . . alpha proteobacterium IMCC1322 -----------------------------------------  102 2 hits [a-proteobacteria]       Glutamine amidotransferase of anthranilate synthase [alpha 
. . . . . Bradyrhizobium japonicum ...............................................  101 1 hit  [a-proteobacteria]       ID891 [Bradyrhizobium japonicum]
. . . . . Methylocella silvestris BL2 ............................................  100 2 hits [a-proteobacteria]       glutamine amidotransferase of anthranilate synthase [Methyl
. . . . . Methylobacterium extorquens AM1 ........................................   99 2 hits [a-proteobacteria]       aminodeoxychorismate synthase subunit II, component of p-am
. . . . . Pseudovibrio sp. JE062 .................................................   98 2 hits [a-proteobacteria]       anthranilate synthase [Pseudovibrio sp. JE062] >gi|21195925
. . . . . Hyphomonas neptunium ATCC 15444 ........................................   98 2 hits [a-proteobacteria]       anthranilate synthase component II [Hyphomonas neptunium AT
. . . . Aggregatibacter actinomycetemcomitans D11S-1 -----------------------------  114 2 hits [g-proteobacteria]       para-aminobenzoate synthase glutamine amidotransferase comp
. . . . Vibrio cholerae TM 11079-80 ..............................................  113 2 hits [g-proteobacteria]       anthranilate synthase amidotransferase component [Vibrio ch
. . . . Vibrio cholerae AM-19226 .................................................  113 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio cholerae AM-1922
. . . . Vibrio cholerae bv. albensis VL426 .......................................  113 2 hits [g-proteobacteria]       anthranilate synthase amidotransferase component [Vibrio ch
. . . . Vibrio mimicus VM223 .....................................................  113 2 hits [g-proteobacteria]       anthranilate synthase amidotransferase component [Vibrio mi
. . . . Vibrio cholerae MZO-2 ....................................................  113 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio cholerae MZO-2] 
. . . . Vibrio cholerae 12129(1) .................................................  112 2 hits [g-proteobacteria]       anthranilate synthase amidotransferase component [Vibrio ch
. . . . Vibrio mimicus MB-451 ....................................................  112 2 hits [g-proteobacteria]       anthranilate synthase amidotransferase component [Vibrio mi
. . . . Vibrio cholerae TMA 21 ...................................................  112 2 hits [g-proteobacteria]       anthranilate synthase amidotransferase component [Vibrio ch
. . . . Vibrio mimicus VM573 .....................................................  112 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio mimicus VM573] >
. . . . Pasteurella dagmatis ATCC 43325 ..........................................  112 2 hits [g-proteobacteria]       anthranilate synthase component II [Pasteurella dagmatis AT
. . . . Pasteurella multocida subsp. multocida str. Pm70 .........................  112 2 hits [g-proteobacteria]       para-aminobenzoate synthase component II [Pasteurella multo
. . . . Buchnera aphidicola ......................................................  112 5 hits [enterobacteria]         anthranilate synthetase small subunit [Buchnera aphidicola]
. . . . Vibrio sp. RC586 .........................................................  111 2 hits [g-proteobacteria]       anthranilate synthase amidotransferase component [Vibrio sp
. . . . Vibrio cholerae MZO-3 ....................................................  111 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio cholerae MZO-3] 
. . . . Vibrio cholerae CT 5369-93 ...............................................  111 2 hits [g-proteobacteria]       anthranilate synthase amidotransferase component [Vibrio ch
. . . . Vibrio cholerae O1 biovar El Tor str. N16961 .............................  111 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio cholerae O1 biov
. . . . Vibrio cholerae 2740-80 ..................................................  111 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio cholerae O1 biov
. . . . Vibrio cholerae V52 ......................................................  111 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio cholerae O1 biov
. . . . Vibrio cholerae O395 .....................................................  111 3 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio cholerae O1 biov
. . . . Vibrio cholerae MAK 757 ..................................................  111 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio cholerae O1 biov
. . . . Vibrio cholerae NCTC 8457 ................................................  111 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio cholerae O1 biov
. . . . Vibrio cholerae B33 ......................................................  111 4 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio cholerae O1 biov
. . . . Vibrio cholerae M66-2 ....................................................  111 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio cholerae O1 biov
. . . . Vibrio cholerae BX 330286 ................................................  111 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio cholerae O1 biov
. . . . Vibrio cholerae RC9 ......................................................  111 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio cholerae O1 biov
. . . . Vibrio cholerae MJ-1236 ..................................................  111 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio cholerae O1 biov
. . . . Vibrio cholerae MO10 .....................................................  111 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio cholerae O1 biov
. . . . Vibrio cholera CIRS 101 ..................................................  111 2 hits [g-proteobacteria]       anthranilate synthase amidotransferase component [Vibrio ch
. . . . Vibrio cholerae INDRE 91/1 ...............................................  111 2 hits [g-proteobacteria]       anthranilate synthase amidotransferase component [Vibrio ch
. . . . Vibrio cholerae RC27 .....................................................  111 2 hits [g-proteobacteria]       anthranilate synthase amidotransferase component [Vibrio ch
. . . . Vibrio cholerae ..........................................................  111 1 hit  [g-proteobacteria]       anthranilate synthase amidotransferase component [Vibrio ch
. . . . Vibrio cholerae 623-39 ...................................................  110 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio cholerae 623-39]
. . . . Vibrio cholerae 1587 .....................................................  110 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio cholerae 1587] >
. . . . Vibrio sp. RC341 .........................................................  110 2 hits [g-proteobacteria]       anthranilate synthase amidotransferase component [Vibrio sp
. . . . Vibrio mimicus VM603 .....................................................  110 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio mimicus VM603] >
. . . . Sodalis glossinidius str. 'morsitans' ....................................  110 2 hits [enterobacteria]         anthranilate synthase component II [Sodalis glossinidius st
. . . . Helicobacter mustelae 12198 ..............................................  110 2 hits [e-proteobacteria]       para-aminobenzoate synthase glutamine amidotransferase comp
. . . . Aggregatibacter actinomycetemcomitans D7S-1 ..............................  109 2 hits [g-proteobacteria]       para-aminobenzoate synthase glutamine amidotransferase comp
. . . . Burkholderia thailandensis Bt4 ...........................................  109 1 hit  [b-proteobacteria]       anthranilate synthase component II [Burkholderia thailanden
. . . . Pantoea ananatis LMG 20103 ...............................................  108 2 hits [enterobacteria]         TrpD [Pantoea ananatis LMG 20103] >gi|291152650|gb|ADD77234
. . . . Photobacterium profundum 3TCK ............................................  108 2 hits [g-proteobacteria]       anthranilate synthase component II [Photobacterium profundu
. . . . Actinobacillus minor 202 .................................................  108 4 hits [g-proteobacteria]       anthranilate phosphoribosyltransferase [Actinobacillus mino
. . . . Burkholderia thailandensis E264 ..........................................  108 3 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia thailanden
. . . . Burkholderia thailandensis TXDOH .........................................  108 1 hit  [b-proteobacteria]       anthranilate synthase component II [Burkholderia thailanden
. . . . Pantoea sp. At-9b ........................................................  108 2 hits [enterobacteria]         glutamine amidotransferase of anthranilate synthase [Pantoe
. . . . Burkholderia pseudomallei 668 ............................................  108 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia pseudomall
. . . . Buchnera aphidicola str. Bp (Baizongia pistaciae) ........................  108 2 hits [enterobacteria]         anthranilate synthase component II [Buchnera aphidicola str
. . . . Buchnera aphidicola (Baizongia pistaciae) ................................  108 1 hit  [enterobacteria]         anthranilate synthase component II [Buchnera aphidicola str
. . . . Actinobacillus pleuropneumoniae serovar 3 str. JL03 ......................  108 4 hits [g-proteobacteria]       anthranilate synthase component II [Actinobacillus pleuropn
. . . . Grimontia hollisae CIP 101886 ............................................  107 2 hits [g-proteobacteria]       anthranilate synthase amidotransferase component [Grimontia
. . . . Actinobacillus pleuropneumoniae serovar 7 str. AP76 ......................  107 4 hits [g-proteobacteria]       anthranilate synthase component II [Actinobacillus pleuropn
. . . . Mannheimia haemolytica serotype A2 str. BOVINE ...........................  107 4 hits [g-proteobacteria]       anthranilate synthase subunit II [Mannheimia haemolytica se
. . . . Mannheimia haemolytica serotype A2 str. OVINE ............................  107 4 hits [g-proteobacteria]       anthranilate synthase subunit II [Mannheimia haemolytica se
. . . . Haemophilus ducreyi 35000HP ..............................................  107 2 hits [g-proteobacteria]       para-aminobenzoate synthase component II [Haemophilus ducre
. . . . Haemophilus ducreyi ......................................................  107 1 hit  [g-proteobacteria]       para-aminobenzoate synthase component II [Haemophilus ducre
. . . . Burkholderia mallei ATCC 23344 ...........................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei K96243 .........................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia mallei GB8 horse 4 ..........................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei 1710b ..........................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia mallei SAVP1 ................................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia mallei NCTC 10229 ...........................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia mallei NCTC 10247 ...........................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei 1106a ..........................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei 305 ............................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia mallei PRL-20 ...............................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei DM98 ...........................................  107 1 hit  [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei 14 .............................................  107 1 hit  [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei 91 .............................................  107 1 hit  [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei 9 ..............................................  107 1 hit  [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei B7210 ..........................................  107 1 hit  [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei 7894 ...........................................  107 1 hit  [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei NCTC 13177 .....................................  107 1 hit  [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei 112 ............................................  107 1 hit  [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei BCC215 .........................................  107 1 hit  [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei 576 ............................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei Pakistan 9 .....................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei MSHR346 ........................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei 1106b ..........................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia mallei ATCC 10399 ...........................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei 1655 ...........................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei Pasteur 52237 ..................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei S13 ............................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia mallei FMH ..................................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia mallei JHU ..................................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei 1710a ..........................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia pseudomallei 406e ...........................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Burkholderia mallei 2002721280 ...........................................  107 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia mallei ATC
. . . . Mannheimia haemolytica PHL213 ............................................  107 4 hits [g-proteobacteria]       anthranilate synthase subunit II [Mannheimia haemolytica PH
. . . . Burkholderia thailandensis MSMB43 ........................................  106 1 hit  [b-proteobacteria]       anthranilate synthase component II [Burkholderia thailanden
. . . . Francisella novicida GA99-3548 ...........................................  106 2 hits [g-proteobacteria]       hypothetical protein FTDG_00401 [Francisella novicida GA99-
. . . . Actinobacillus pleuropneumoniae serovar 1 str. 4074 ......................  106 1 hit  [g-proteobacteria]       COG0512: Anthranilate/para-aminobenzoate synthases componen
. . . . Actinobacillus pleuropneumoniae L20 ......................................  106 2 hits [g-proteobacteria]       COG0512: Anthranilate/para-aminobenzoate synthases componen
. . . . Actinobacillus minor NM305 ...............................................  106 4 hits [g-proteobacteria]       anthranilate synthase component II [Actinobacillus minor NM
. . . . Alteromonas macleodii 'Deep ecotype' .....................................  106 2 hits [g-proteobacteria]       glutamine amido-transferase [Alteromonas macleodii 'Deep ec
. . . . Burkholderia ambifaria IOP40-10 ..........................................  106 2 hits [b-proteobacteria]       glutamine amidotransferase of anthranilate synthase [Burkho
. . . . Francisella novicida U112 ................................................  106 2 hits [g-proteobacteria]       anthranilate synthase component II [Francisella tularensis 
. . . . Francisella novicida FTE .................................................  106 2 hits [g-proteobacteria]       anthranilate synthase component II [Francisella tularensis 
. . . . Burkholderia glumae BGR1 .................................................  106 2 hits [b-proteobacteria]       Anthranilate synthase component II [Burkholderia glumae BGR
. . . . Mannheimia succiniciproducens MBEL55E ....................................  106 4 hits [g-proteobacteria]       para-aminobenzoate synthase component II [Mannheimia succin
. . . . Francisella novicida GA99-3549 ...........................................  106 2 hits [g-proteobacteria]       anthranilate synthase component II [Francisella tularensis 
. . . . Haemophilus influenzae PittAA ............................................  106 2 hits [g-proteobacteria]       para-aminobenzoate synthase component II [Haemophilus influ
. . . . Haemophilus influenzae PittEE ............................................  106 2 hits [g-proteobacteria]       para-aminobenzoate synthase component II [Haemophilus influ
. . . . Haemophilus somnus 129PT .................................................  105 2 hits [g-proteobacteria]       para-aminobenzoate synthase component II [Haemophilus somnu
. . . . Photobacterium profundum SS9 .............................................  105 2 hits [g-proteobacteria]       anthranilate synthase component II [Photobacterium profundu
. . . . Haemophilus influenzae R2846 .............................................  105 1 hit  [g-proteobacteria]       COG0512: Anthranilate/para-aminobenzoate synthases componen
. . . . Haemophilus influenzae 6P18H1 ............................................  105 2 hits [g-proteobacteria]       para-aminobenzoate synthase component II [Haemophilus influ
. . . . Burkholderia multivorans ATCC 17616 ......................................  105 5 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia multivoran
. . . . Burkholderia multivorans CGD2M ...........................................  105 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia multivoran
. . . . Burkholderia multivorans CGD2 ............................................  105 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia multivoran
. . . . Burkholderia multivorans CGD1 ............................................  105 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia multivoran
. . . . Buchnera aphidicola (Cinara cedri) .......................................  105 1 hit  [enterobacteria]         anthranilate synthase small subunit [Buchnera aphidicola (C
. . . . Serratia odorifera DSM 4582 ..............................................  105 2 hits [enterobacteria]         anthranilate synthase component II TrpG [Serratia odorifera
. . . . Burkholderia ambifaria MEX-5 .............................................  105 2 hits [b-proteobacteria]       glutamine amidotransferase of anthranilate synthase [Burkho
. . . . Desulfobacterium autotrophicum HRM2 ......................................  105 2 hits [d-proteobacteria]       TrpG [Desulfobacterium autotrophicum HRM2] >gi|223691591|gb
. . . . Francisella novicida FTG .................................................  105 2 hits [g-proteobacteria]       class I glutamine amidotransferase, putative [Francisella n
. . . . Haemophilus influenzae PittGG ............................................  105 2 hits [g-proteobacteria]       putative anthranilate synthase component II [Haemophilus in
. . . . Burkholderia ambifaria AMMD ..............................................  105 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia ambifaria 
. . . . Burkholderia ambifaria MC40-6 ............................................  105 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia ambifaria 
. . . . Burkholderia cenocepacia J2315 ...........................................  105 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia cenocepaci
. . . . Haemophilus influenzae 86-028NP ..........................................  105 2 hits [g-proteobacteria]       para-aminobenzoate synthase component II [Haemophilus influ
. . . . Haemophilus parasuis SH0165 ..............................................  105 4 hits [g-proteobacteria]       anthranilate synthase component II [Haemophilus parasuis SH
. . . . Francisella tularensis subsp. tularensis WY96-3418 .......................  105 2 hits [g-proteobacteria]       anthranilate synthase component II [Francisella tularensis 
. . . . Photorhabdus asymbiotica .................................................  105 2 hits [enterobacteria]         anthranilate synthase component ii (glutamine amido-transfe
. . . . Burkholderia vietnamiensis G4 ............................................  105 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia vietnamien
. . . . Burkholderia cenocepacia AU 1054 .........................................  105 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia cenocepaci
. . . . Burkholderia cenocepacia HI2424 ..........................................  105 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia cenocepaci
. . . . Burkholderia cenocepacia MC0-3 ...........................................  105 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia cenocepaci
. . . . Burkholderia cenocepacia PC184 ...........................................  105 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia cenocepaci
. . . . Photobacterium sp. SKA34 .................................................  105 2 hits [g-proteobacteria]       anthranilate synthase component II [Photobacterium sp. SKA3
. . . . Vibrio harveyi ATCC BAA-1116 .............................................  105 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio harveyi ATCC BAA
. . . . beta proteobacterium KB13 ................................................  104 2 hits [b-proteobacteria]       anthranilate synthase component II [beta proteobacterium KB
. . . . Vibrio alginolyticus 12G01 ...............................................  104 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio alginolyticus 12
. . . . Burkholderia oklahomensis EO147 ..........................................  104 1 hit  [b-proteobacteria]       anthranilate synthase component II [Burkholderia oklahomens
. . . . Burkholderia oklahomensis C6786 ..........................................  104 1 hit  [b-proteobacteria]       anthranilate synthase component II [Burkholderia oklahomens
. . . . Pelobacter carbinolicus DSM 2380 .........................................  104 2 hits [d-proteobacteria]       anthranilate synthase component II [Pelobacter carbinolicus
. . . . Haemophilus parasuis 29755 ...............................................  104 4 hits [g-proteobacteria]       glutamine amidotransferase of anthranilate synthase [Haemop
. . . . Vibrio parahaemolyticus RIMD 2210633 .....................................  104 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio parahaemolyticus
. . . . Vibrio parahaemolyticus AQ3810 ...........................................  104 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio parahaemolyticus
. . . . Vibrio parahaemolyticus K5030 ............................................  104 1 hit  [g-proteobacteria]       anthranilate synthase component II [Vibrio parahaemolyticus
. . . . Vibrio parahaemolyticus AN-5034 ..........................................  104 1 hit  [g-proteobacteria]       anthranilate synthase component II [Vibrio parahaemolyticus
. . . . Vibrio parahaemolyticus Peru-466 .........................................  104 1 hit  [g-proteobacteria]       anthranilate synthase component II [Vibrio parahaemolyticus
. . . . Vibrio parahaemolyticus AQ4037 ...........................................  104 1 hit  [g-proteobacteria]       anthranilate synthase component II [Vibrio parahaemolyticus
. . . . Vibrio parahaemolyticus ..................................................  104 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio parahaemolyticus
. . . . Photorhabdus luminescens subsp. laumondii TTO1 ...........................  104 2 hits [enterobacteria]         anthranilate synthase component II (glutamine amido-transfe
. . . . Haemophilus somnus 2336 ..................................................  104 4 hits [g-proteobacteria]       glutamine amidotransferase of anthranilate synthase [Haemop
. . . . Vibrio orientalis CIP 102891 .............................................  104 2 hits [g-proteobacteria]       anthranilate synthase amidotransferase component [Vibrio or
. . . . Vibrio harveyi 1DA3 ......................................................  104 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio harveyi 1DA3] >g
. . . . Haemophilus influenzae Rd KW20 ...........................................  104 2 hits [g-proteobacteria]       para-aminobenzoate synthase component II [Haemophilus influ
. . . . Haemophilus influenzae RdAW ..............................................  104 2 hits [g-proteobacteria]       para-aminobenzoate synthase component II [Haemophilus influ
. . . . Haemophilus influenzae ...................................................  104 1 hit  [g-proteobacteria]       para-aminobenzoate synthase component II [Haemophilus influ
. . . . Aggregatibacter aphrophilus NJ8700 .......................................  104 2 hits [g-proteobacteria]       para-aminobenzoate synthase glutamine amidotransferase comp
. . . . Haemophilus influenzae R3021 .............................................  104 2 hits [g-proteobacteria]       para-aminobenzoate synthase component II [Haemophilus influ
. . . . Haemophilus influenzae 7P49H1 ............................................  104 2 hits [g-proteobacteria]       para-aminobenzoate synthase component II [Haemophilus influ
. . . . Haemophilus influenzae R2866 .............................................  104 1 hit  [g-proteobacteria]       COG0512: Anthranilate/para-aminobenzoate synthases componen
. . . . Haemophilus influenzae PittII ............................................  104 2 hits [g-proteobacteria]       COG0512: Anthranilate/para-aminobenzoate synthases componen
. . . . Burkholderia ubonensis Bu ................................................  104 1 hit  [b-proteobacteria]       anthranilate synthase component II [Burkholderia ubonensis 
. . . . Serratia odorifera 4Rx13 .................................................  104 2 hits [enterobacteria]         glutamine amidotransferase of anthranilate synthase [Serrat
. . . . Haemophilus influenzae 22.1-21 ...........................................  104 2 hits [g-proteobacteria]       para-aminobenzoate synthase component II [Haemophilus influ
. . . . Francisella tularensis subsp. tularensis SCHU S4 .........................  104 2 hits [g-proteobacteria]       anthranilate synthase component II [Francisella tularensis 
. . . . Francisella tularensis subsp. tularensis FSC198 ..........................  104 2 hits [g-proteobacteria]       anthranilate synthase component II [Francisella tularensis 
. . . . Francisella tularensis subsp. tularensis MA00-2987 .......................  104 3 hits [g-proteobacteria]       anthranilate synthase component II [Francisella tularensis 
. . . . Francisella tularensis subsp. tularensis FSC033 ..........................  104 2 hits [g-proteobacteria]       anthranilate synthase component II [Francisella tularensis 
. . . . Francisella tularensis subsp. tularensis NE061598 ........................  104 1 hit  [g-proteobacteria]       anthranilate synthase component II [Francisella tularensis 
. . . . Francisella tularensis subsp. holarctica FSC022 ..........................  103 2 hits [g-proteobacteria]       anthranilate synthase component II [Francisella tularensis 
. . . . Burkholderia sp. 383 .....................................................  103 2 hits [b-proteobacteria]       anthranilate synthase component II [Burkholderia sp. 383] >
. . . . Candidatus Blochmannia pennsylvanicus str. BPEN ..........................  103 2 hits [enterobacteria]         anthranilate synthase component II [Candidatus Blochmannia 
. . . . Methylophaga thiooxidans DMS010 ..........................................  103 2 hits [g-proteobacteria]       class I glutamine amidotransferase, putative [Methylophaga 
. . . . Vibrio coralliilyticus ATCC BAA-450 ......................................  103 2 hits [g-proteobacteria]       anthranilate synthase amidotransferase component [Vibrio co
. . . . Serratia marcescens ......................................................  103 6 hits [enterobacteria]         Chain B, Anthranilate Synthase From S. Marcescens >gi|14277
. . . . Photobacterium damselae subsp. damselae CIP 102761 .......................  103 2 hits [g-proteobacteria]       anthranilate synthase amidotransferase component [Photobact
. . . . Alteromonas macleodii ATCC 27126 .........................................  103 2 hits [g-proteobacteria]       glutamine amido-transferase [Alteromonas macleodii ATCC 271
. . . . Shewanella sediminis HAW-EB3 .............................................  103 2 hits [g-proteobacteria]       glutamine amidotransferase of anthranilate synthase or para
. . . . Erwinia amylovora ........................................................  103 1 hit  [enterobacteria]         Glutamine amidotransferase of anthranilate synthase [Erwini
. . . . Erwinia amylovora ATCC 49946 .............................................  103 2 hits [enterobacteria]         Glutamine amidotransferase of anthranilate synthase [Erwini
. . . . Erwinia amylovora CFBP1430 ...............................................  103 1 hit  [enterobacteria]         Glutamine amidotransferase of anthranilate synthase [Erwini
. . . . Vibrio furnissii CIP 102972 ..............................................  103 2 hits [g-proteobacteria]       anthranilate synthase amidotransferase component [Vibrio fu
. . . . Vibrio sp. Ex25 ..........................................................  103 4 hits [g-proteobacteria]       class I glutamine amidotransferase, putative [Vibrio sp. Ex
. . . . Haemophilus influenzae 3655 ..............................................  103 2 hits [g-proteobacteria]       para-aminobenzoate synthase component II [Haemophilus influ
. . . . Haemophilus influenzae PittHH ............................................  103 2 hits [g-proteobacteria]       para-aminobenzoate synthase component II [Haemophilus influ
. . . . Haemophilus influenzae NT127 .............................................  103 2 hits [g-proteobacteria]       para-aminobenzoate synthase component II [Haemophilus influ
. . . . Desulfotalea psychrophila LSv54 ..........................................  103 2 hits [d-proteobacteria]       para-aminobenzoate/anthranilate synthase glutamine amidotra
. . . . Burkholderia dolosa AUO158 ...............................................  102 2 hits [b-proteobacteria]       Anthranilate/para-aminobenzoate synthases component II [Bur
. . . . Moritella sp. PE36 .......................................................  102 2 hits [g-proteobacteria]       anthranilate phosphoribosyltransferase [Moritella sp. PE36]
. . . . Shewanella piezotolerans WP3 .............................................  102 2 hits [g-proteobacteria]       Glutamine amidotransferase of anthranilate synthase [Shewan
. . . . Shewanella amazonensis SB2B ..............................................  102 4 hits [g-proteobacteria]       anthranilate synthase component II [Shewanella amazonensis 
. . . . Vibrio sp. AND4 ..........................................................  102 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio sp. AND4] >gi|15
. . . . Cronobacter sakazakii ATCC BAA-894 .......................................  102 4 hits [enterobacteria]         hypothetical protein ESA_04373 [Cronobacter sakazakii ATCC 
. . . . Erwinia pyrifoliae Ep1/96 ................................................  102 2 hits [enterobacteria]         Putative Anthranilate synthase component II [Erwinia pyrifo
. . . . Erwinia pyrifoliae DSM 12163 .............................................  102 1 hit  [enterobacteria]         Putative Anthranilate synthase component II [Erwinia pyrifo
. . . . Serratia proteamaculans 568 ..............................................  102 2 hits [enterobacteria]         anthranilate synthase component II [Serratia proteamaculans
. . . . Cronobacter turicensis z3032 .............................................  102 2 hits [enterobacteria]         Para-aminobenzoate synthase glutamine amidotransferase comp
. . . . Francisella tularensis subsp. mediasiatica FSC147 ........................  102 2 hits [g-proteobacteria]       para-aminobenzoate synthase component [Francisella tularens
. . . . Vibrio metschnikovii CIP 69.14 ...........................................  102 2 hits [g-proteobacteria]       anthranilate synthase amidotransferase component [Vibrio me
. . . . Vibrio alginolyticus 40B .................................................  102 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio alginolyticus 40
. . . . Erwinia tasmaniensis Et1/99 ..............................................  102 2 hits [enterobacteria]         anthranilate synthase component II [Erwinia tasmaniensis Et
. . . . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ........................  102 4 hits [enterobacteria]         para-aminobenzoate synthase component II [Klebsiella pneumo
. . . . Klebsiella pneumoniae NTUH-K2044 .........................................  102 4 hits [enterobacteria]         para-aminobenzoate synthase component II [Klebsiella pneumo
. . . . Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 .................  102 4 hits [enterobacteria]         para-aminobenzoate synthase component II [Klebsiella pneumo
. . . . Providencia rettgeri DSM 1131 ............................................  102 2 hits [enterobacteria]         glutamine amido-transferase [Providencia rettgeri DSM 1131]
. . . . Geobacter bemidjiensis Bem ...............................................  101 2 hits [d-proteobacteria]       glutamine amidotransferase of anthranilate synthase [Geobac
. . . . Klebsiella pneumoniae 342 ................................................  101 4 hits [enterobacteria]         aminodeoxychorismate synthase, component II [Klebsiella pne
. . . . Klebsiella variicola At-22 ...............................................  101 4 hits [enterobacteria]         aminodeoxychorismate synthase, component II [Klebsiella pne
. . . . Photobacterium angustum S14 ..............................................  101 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio angustum S14] >g
. . . . Yersinia enterocolitica subsp. enterocolitica 8081 .......................  101 2 hits [enterobacteria]         anthranilate synthase component II [Yersinia enterocolitica
. . . . Helicobacter pylori B128 .................................................  101 2 hits [e-proteobacteria]       hypothetical protein HPB128_132g43 [Helicobacter pylori B12
. . . . Yersinia pestis biovar Microtus str. 91001 ...............................  101 2 hits [enterobacteria]         anthranilate synthase component II [Yersinia pestis biovar 
. . . . Yersinia pseudotuberculosis IP 32953 .....................................  101 2 hits [enterobacteria]         anthranilate synthase component II [Yersinia pestis biovar 
. . . . Yersinia pestis Antiqua ..................................................  101 2 hits [enterobacteria]         anthranilate synthase component II [Yersinia pestis biovar 
. . . . Yersinia pestis Nepal516 .................................................  101 4 hits [enterobacteria]         anthranilate synthase component II [Yersinia pestis biovar 
. . . . Yersinia pestis Pestoides F ..............................................  101 2 hits [enterobacteria]         anthranilate synthase component II [Yersinia pestis biovar 
. . . . Yersinia pestis CA88-4125 ................................................  101 2 hits [enterobacteria]         anthranilate synthase component II [Yersinia pestis biovar 
. . . . Yersinia pseudotuberculosis IP 31758 .....................................  101 2 hits [enterobacteria]         anthranilate synthase component II [Yersinia pestis biovar 
. . . . Yersinia pestis FV-1 .....................................................  101 1 hit  [enterobacteria]         anthranilate synthase component II [Yersinia pestis biovar 
. . . . Yersinia pseudotuberculosis YPIII ........................................  101 2 hits [enterobacteria]         anthranilate synthase component II [Yersinia pestis biovar 
. . . . Yersinia pseudotuberculosis PB1/+ ........................................  101 2 hits [enterobacteria]         anthranilate synthase component II [Yersinia pestis biovar 
. . . . Yersinia pestis CO92 .....................................................  101 2 hits [enterobacteria]         anthranilate synthase component II [Yersinia pestis biovar 
. . . . Yersinia pestis Pestoides A ..............................................  101 2 hits [enterobacteria]         anthranilate synthase component II [Yersinia pestis biovar 
. . . . Yersinia pestis biovar Orientalis str. PEXU2 .............................  101 2 hits [enterobacteria]         anthranilate synthase component II [Yersinia pestis biovar 
. . . . Yersinia pestis biovar Orientalis str. India 195 .........................  101 2 hits [enterobacteria]         anthranilate synthase component II [Yersinia pestis biovar 
. . . . Yersinia pestis KIM D27 ..................................................  101 2 hits [enterobacteria]         anthranilate synthase component II [Yersinia pestis biovar 
. . . . Yersinia pestis Z176003 ..................................................  101 2 hits [enterobacteria]         anthranilate synthase component II [Yersinia pestis biovar 
. . . . Yersinia pestis ..........................................................  101 1 hit  [enterobacteria]         anthranilate synthase component II [Yersinia pestis biovar 
. . . . Yersinia pestis D106004 ..................................................  101 1 hit  [enterobacteria]         anthranilate synthase component II [Yersinia pestis biovar 
. . . . Yersinia pestis D182038 ..................................................  101 1 hit  [enterobacteria]         anthranilate synthase component II [Yersinia pestis biovar 
. . . . Shewanella halifaxensis HAW-EB4 ..........................................  101 4 hits [g-proteobacteria]       glutamine amidotransferase of anthranilate synthase [Shewan
. . . . Pectobacterium carotovorum subsp. carotovorum PC1 ........................  101 2 hits [enterobacteria]         glutamine amidotransferase of anthranilate synthase [Pectob
. . . . Oxalobacter formigenes HOxBLS ............................................  101 2 hits [b-proteobacteria]       anthranilate synthase component II [Oxalobacter formigenes 
. . . . Francisella tularensis subsp. holarctica .................................  101 1 hit  [g-proteobacteria]       anthranilate synthase component II [Francisella tularensis 
. . . . Francisella tularensis subsp. holarctica FSC200 ..........................  101 1 hit  [g-proteobacteria]       anthranilate synthase component II [Francisella tularensis 
. . . . Francisella tularensis subsp. holarctica LVS .............................  101 1 hit  [g-proteobacteria]       anthranilate synthase component II [Francisella tularensis 
. . . . Vibrio fischeri ES114 ....................................................  101 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio fischeri ES114] 
. . . . Pectobacterium wasabiae WPP163 ...........................................  100 2 hits [enterobacteria]         glutamine amidotransferase of anthranilate synthase [Pectob
. . . . Helicobacter pylori 98-10 ................................................  100 2 hits [e-proteobacteria]       hypothetical protein HP9810_899g39 [Helicobacter pylori 98-
. . . . Coxiella burnetii Dugway 5J108-111 .......................................  100 2 hits [g-proteobacteria]       anthranilate synthase component II [Coxiella burnetii Dugwa
. . . . Coxiella burnetii 'MSU Goat Q177' ........................................  100 2 hits [g-proteobacteria]       anthranilate synthase component II [Coxiella burnetii Dugwa
. . . . Coxiella burnetii RSA 334 ................................................  100 2 hits [g-proteobacteria]       anthranilate synthase component II [Coxiella burnetii Dugwa
. . . . Coxiella burnetii CbuG_Q212 ..............................................  100 2 hits [g-proteobacteria]       anthranilate synthase component II [Coxiella burnetii Dugwa
. . . . Coxiella burnetii CbuK_Q154 ..............................................  100 2 hits [g-proteobacteria]       anthranilate synthase component II [Coxiella burnetii Dugwa
. . . . Coxiella burnetii RSA 493 ................................................  100 2 hits [g-proteobacteria]       anthranilate synthase component II [Coxiella burnetii RSA 4
. . . . Helicobacter pylori G27 ..................................................  100 2 hits [e-proteobacteria]       anthranilate synthasecomponent II. glutamineamido-transfera
. . . . Vibrio fischeri MJ11 .....................................................  100 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio fischeri MJ11] >
. . . . Geobacter sp. M21 ........................................................  100 2 hits [d-proteobacteria]       glutamine amidotransferase of anthranilate synthase [Geobac
. . . . Colwellia psychrerythraea 34H ............................................  100 2 hits [g-proteobacteria]       anthranilate synthase component II [Colwellia psychrerythra
. . . . Helicobacter pylori 26695 ................................................  100 2 hits [e-proteobacteria]       anthranilate synthase component II [Helicobacter pylori 266
. . . . Helicobacter pylori ......................................................  100 1 hit  [e-proteobacteria]       anthranilate synthase component II [Helicobacter pylori 266
. . . . Acidovorax avenae subsp. avenae ATCC 19860 ...............................  100 2 hits [b-proteobacteria]       glutamine amidotransferase of anthranilate synthase [Acidov
. . . . Klebsiella sp. 1_1_55 ....................................................  100 4 hits [enterobacteria]         para-aminobenzoate synthetase component II [Klebsiella sp. 
. . . . Pectobacterium atrosepticum SCRI1043 .....................................  100 2 hits [enterobacteria]         anthranilate synthase component II [Pectobacterium atrosept
. . . . Pectobacterium carotovorum subsp. brasiliensis PBR1692 ...................  100 1 hit  [enterobacteria]         anthranilate synthase component II [Pectobacterium atrosept
. . . . Pectobacterium carotovorum subsp. carotovorum WPP14 ......................  100 1 hit  [enterobacteria]         anthranilate synthase component II [Pectobacterium atrosept
. . . . Francisella tularensis subsp. holarctica OSU18 ...........................  100 2 hits [g-proteobacteria]       anthranilate synthase component II [Francisella tularensis 
. . . . Francisella tularensis subsp. holarctica FTNF002-00 ......................  100 2 hits [g-proteobacteria]       anthranilate synthase component II [Francisella tularensis 
. . . . Francisella tularensis subsp. holarctica URFT1 ...........................  100 1 hit  [g-proteobacteria]       anthranilate synthase component II [Francisella tularensis 
. . . . Helicobacter pylori HPAG1 ................................................  100 2 hits [e-proteobacteria]       anthranilate synthase component II [Helicobacter pylori HPA
. . . . Helicobacter pylori Shi470 ...............................................  100 2 hits [e-proteobacteria]       anthranilate synthase component II [Helicobacter pylori Shi
. . . . Citrobacter youngae ATCC 29220 ...........................................  100 2 hits [enterobacteria]         anthranilate phosphoribosyltransferase [Citrobacter youngae
. . . . Edwardsiella tarda EIB202 ................................................  100 2 hits [enterobacteria]         anthranilate synthase component II [Edwardsiella tarda EIB2
. . . . Providencia stuartii ATCC 25827 ..........................................   99 2 hits [enterobacteria]         hypothetical protein PROSTU_02731 [Providencia stuartii ATC
. . . . Klebsiella aerogenes .....................................................   99 2 hits [enterobacteria]         RecName: Full=Para-aminobenzoate synthase glutamine amidotr
. . . . Klebsiella pneumoniae ....................................................   99 1 hit  [enterobacteria]         RecName: Full=Para-aminobenzoate synthase glutamine amidotr
. . . . Helicobacter pylori P12 ..................................................   99 2 hits [e-proteobacteria]       anthranilate synthase component II [Helicobacter pylori P12
. . . . Polynucleobacter necessarius subsp. necessarius STIR1 ....................   99 2 hits [b-proteobacteria]       glutamine amidotransferase of anthranilate synthase [Polynu
. . . . Shewanella pealeana ATCC 700345 ..........................................   99 2 hits [g-proteobacteria]       glutamine amidotransferase of anthranilate synthase [Shewan
. . . . Helicobacter pylori B38 ..................................................   99 2 hits [e-proteobacteria]       Anthranilate synthase component II (Glutamine amido-transfe
. . . . Candidatus Blochmannia floridanus ........................................   99 2 hits [enterobacteria]         anthranilate synthase component II [Candidatus Blochmannia 
. . . . Enterobacter sp. 638 .....................................................   99 2 hits [enterobacteria]         para-aminobenzoate synthase component II [Enterobacter sp. 
. . . . Acidovorax avenae subsp. avenae ..........................................   99 1 hit  [b-proteobacteria]       Anthranilate/para-aminobenzoate synthases component II [Aci
. . . . Helicobacter pylori 52 ...................................................   99 1 hit  [e-proteobacteria]       anthranilate synthase component II [Helicobacter pylori 52]
. . . . Geobacter sp. M18 ........................................................   99 2 hits [d-proteobacteria]       glutamine amidotransferase of anthranilate synthase [Geobac
. . . . Edwardsiella ictaluri 93-146 .............................................   99 2 hits [enterobacteria]         anthranilate synthase component II, putative [Edwardsiella 
. . . . Salmonella enterica subsp. enterica serovar Typhi str. E98-3139 ..........   99 1 hit  [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Sideroxydans lithotrophicus ES-1 .........................................   99 2 hits [b-proteobacteria]       glutamine amidotransferase of anthranilate synthase [Sidero
. . . . Helicobacter pylori J99 ..................................................   99 3 hits [e-proteobacteria]       anthranilate synthase component II [Helicobacter pylori J99
. . . . Nitratiruptor sp. SB155-2 ................................................   99 2 hits [e-proteobacteria]       anthranilate synthase component II [Nitratiruptor sp. SB155
. . . . Desulfovibrio aespoeensis Aspo-2 .........................................   99 2 hits [d-proteobacteria]       glutamine amidotransferase of anthranilate synthase [Desulf
. . . . Janthinobacterium sp. Marseille ..........................................   99 2 hits [b-proteobacteria]       anthranilate synthase component II [Janthinobacterium sp. M
. . . . Shigella flexneri 5 str. 8401 ............................................   99 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Helicobacter pylori 51 ...................................................   99 1 hit  [e-proteobacteria]       anthranilate synthase component II [Helicobacter pylori 51]
. . . . Shewanella benthica KT99 .................................................   99 2 hits [g-proteobacteria]       para-aminobenzoate synthase glutamine amidotransferase, com
. . . . Desulfatibacillum alkenivorans AK-01 .....................................   98 2 hits [d-proteobacteria]       glutamine amidotransferase of anthranilate synthase [Desulf
. . . . Syntrophus aciditrophicus SB .............................................   98 2 hits [d-proteobacteria]       anthranilate synthase component II [Syntrophus aciditrophic
. . . . Vibrio vulnificus CMCP6 ..................................................   98 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio vulnificus CMCP6
. . . . Arsenophonus nasoniae ....................................................   98 1 hit  [enterobacteria]         anthranilate synthase component (glutamine amidotransferase
. . . . Xenorhabdus bovienii SS-2004 .............................................   98 2 hits [enterobacteria]         aminodeoxychorismate synthase subunit II, component of p-am
. . . . Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1 ............   98 2 hits [b-proteobacteria]       glutamine amidotransferase of anthranilate synthase [Polynu
. . . . Shewanella loihica PV-4 ..................................................   98 2 hits [g-proteobacteria]       glutamine amidotransferase of anthranilate synthase [Shewan
. . . . Escherichia coli 042 .....................................................   98 1 hit  [enterobacteria]         anthranilate synthase component II [includes: glutamine ami
. . . . Shewanella denitrificans OS217 ...........................................   98 2 hits [g-proteobacteria]       glutamine amidotransferase of anthranilate synthase or para
. . . . Shigella sonnei Ss046 ....................................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Citrobacter koseri ATCC BAA-895 ..........................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia sp. 4_1_40B ..................................................   98 1 hit  [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Aliivibrio salmonicida LFI1238 ...........................................   98 2 hits [g-proteobacteria]       anthranilate synthase component II [Aliivibrio salmonicida 
. . . . Shigella dysenteriae 1012 ................................................   98 2 hits [enterobacteria]         anthranilate synthase, component II [Shigella dysenteriae 1
. . . . Burkholderia phymatum STM815 .............................................   98 2 hits [b-proteobacteria]       glutamine amidotransferase of anthranilate synthase [Burkho
. . . . Escherichia coli str. K-12 substr. MG1655 ................................   98 2 hits [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli str. K-12 substr. W3110 .................................   98 2 hits [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli E24377A .................................................   98 2 hits [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli HS ......................................................   98 2 hits [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli ATCC 8739 ...............................................   98 2 hits [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli str. K-12 substr. DH10B .................................   98 2 hits [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli 53638 ...................................................   98 2 hits [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli B7A .....................................................   98 2 hits [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli E22 .....................................................   98 2 hits [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli E110019 .................................................   98 2 hits [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli B171 ....................................................   98 2 hits [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli 101-1 ...................................................   98 2 hits [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli SE11 ....................................................   98 2 hits [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli 55989 ...................................................   98 2 hits [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli BW2952 ..................................................   98 2 hits [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli BL21(DE3) ...............................................   98 4 hits [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli B str. REL606 ...........................................   98 2 hits [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Shigella sp. D9 ..........................................................   98 1 hit  [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli O103:H2 str. 12009 ......................................   98 2 hits [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli O26:H11 str. 11368 ......................................   98 2 hits [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli O111:H- str. 11128 ......................................   98 2 hits [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli B088 ....................................................   98 2 hits [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli K-12 ....................................................   98 1 hit  [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli O111:H- .................................................   98 1 hit  [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli DH1 .....................................................   98 1 hit  [enterobacteria]         fused glutamine amidotransferase (component II) of anthrani
. . . . Escherichia coli IAI1 ....................................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli CFT073 ..................................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli UTI89 ...................................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli APEC O1 .................................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli SMS-3-5 .................................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia fergusonii ATCC 35469 ........................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli S88 .....................................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli IAI39 ...................................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli 83972 ...................................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia sp. 3_2_53FAA ................................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli B354 ....................................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli IHE3034 .................................................   98 1 hit  [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli 536 .....................................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli F11 .....................................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia albertii TW07627 .............................................   98 2 hits [enterobacteria]         anthranilate synthase, component II [Escherichia albertii T
. . . . Escherichia coli .........................................................   98 8 hits [enterobacteria]         unnamed protein product [Escherichia coli] >gi|43203|emb|CA
. . . . Shigella boydii Sb227 ....................................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Shigella boydii CDC 3083-94 ..............................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli O157:H7 str. Sakai ......................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli O157:H7 str. EC4113 .....................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli O157:H7 str. EC4401 .....................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli O157:H7 str. EC4501 .....................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli O157:H7 str. EC4486 .....................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli O157:H7 str. EC4196 .....................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli O157:H7 str. EC4076 .....................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli O157:H7 str. EC508 ......................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli O157:H7 str. EC4024 .....................................   98 1 hit  [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli O157:H7 str. EC4206 .....................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli O157:H7 str. EC4045 .....................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli O157:H7 str. EC4042 .....................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli O157:H7 str. EC4115 .....................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli O157:H7 str. TW14588 ....................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli O157:H7 str. TW14359 ....................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli O55:H7 str. CB9615 ......................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli B185 ....................................................   98 2 hits [enterobacteria]         anthranilate phosphoribosyltransferase [Escherichia coli B1
. . . . Shigella flexneri 2a str. 301 ............................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Shigella flexneri 2a str. 2457T ..........................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Shigella flexneri 2002017 ................................................   98 1 hit  [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli SE15 ....................................................   98 1 hit  [enterobacteria]         anthranilate synthase component II [Escherichia coli SE15]
. . . . Citrobacter sp. 30_2 .....................................................   98 2 hits [enterobacteria]         anthranilate synthase component II [Citrobacter sp. 30_2] >
. . . . Escherichia coli UMN026 ..................................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli FVEC1412 ................................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli O127:H6 str. E2348/69 ...................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Escherichia coli O157:H7 EDL933 ..........................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Citrobacter rodentium ICC168 .............................................   98 2 hits [enterobacteria]         anthranilate synthase component II [Citrobacter rodentium I
. . . . Pseudoalteromonas haloplanktis TAC125 ....................................   98 2 hits [g-proteobacteria]       glutamine amidotransferase [Pseudoalteromonas haloplanktis 
. . . . Enterobacter cancerogenus ATCC 35316 .....................................   98 2 hits [enterobacteria]         anthranilate synthase, component II [Enterobacter canceroge
. . . . Vibrio shilonii AK1 ......................................................   98 2 hits [g-proteobacteria]       para-aminobenzoate synthase component II [Vibrio shilonii A
. . . . Aeromonas salmonicida subsp. salmonicida A449 ............................   98 2 hits [g-proteobacteria]       anthranilate synthase component II [Aeromonas salmonicida s
. . . . Burkholderia sp. CCGE1002 ................................................   98 2 hits [b-proteobacteria]       glutamine amidotransferase of anthranilate synthase [Burkho
. . . . Vibrio splendidus LGP32 ..................................................   98 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio splendidus LGP32
. . . . Shigella dysenteriae Sd197 ...............................................   98 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Vibrio sp. MED222 ........................................................   98 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio sp. MED222] >gi|
. . . . Escherichia coli O157:H7 str. EC869 ......................................   97 2 hits [enterobacteria]         anthranilate synthase, component II [Escherichia coli O157:
. . . . Escherichia coli O157:H7 str. FRIK2000 ...................................   97 1 hit  [enterobacteria]         anthranilate synthase, component II [Escherichia coli O157:
. . . . Escherichia coli O157:H7 str. FRIK966 ....................................   97 1 hit  [enterobacteria]         anthranilate synthase, component II [Escherichia coli O157:
. . . . Vibrio splendidus 12B01 ..................................................   97 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrio splendidus 12B01
. . . . Salmonella enterica subsp. enterica serovar Typhimurium ..................   97 3 hits [enterobacteria]         trpD [Salmonella enterica subsp. enterica serovar Typhimuri
. . . . Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .................   97 2 hits [enterobacteria]         bifunctional anthranilate synthase/anthranilate phosphoribo
. . . . Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 .........   97 2 hits [enterobacteria]         bifunctional anthranilate synthase/anthranilate phosphoribo
. . . . Helicobacter acinonychis str. Sheeba .....................................   97 2 hits [e-proteobacteria]       anthranilate synthase component II [Helicobacter acinonychi
. . . . Shigella dysenteriae .....................................................   97 2 hits [enterobacteria]         RecName: Full=Anthranilate synthase component II; Includes:
. . . . Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066 .........   97 2 hits [enterobacteria]         anthranilate synthase, component II [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Newport str. SL317 ...........   97 2 hits [enterobacteria]         anthranilate synthase, component II [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191 ........   97 2 hits [enterobacteria]         anthranilate synthase, component II [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537 ..   97 2 hits [enterobacteria]         anthranilate synthase, component II [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 .......   97 2 hits [enterobacteria]         anthranilate synthase, component II [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Agona str. SL483 .............   97 2 hits [enterobacteria]         anthranilate synthase, component II [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ......   97 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .......   97 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 .....   97 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Vibrionales bacterium SWAT-3 .............................................   97 2 hits [g-proteobacteria]       anthranilate synthase component II [Vibrionales bacterium S
. . . . Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 ...   97 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 .....   97 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ........   97 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29 ........   97 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701 ...   97 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23 ........   97 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...   97 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191 ....   97 1 hit  [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Salmonella enterica subsp. enterica serovar Typhimurium str. D23580 ......   97 1 hit  [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S ......   97 1 hit  [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480 ....   97 2 hits [enterobacteria]         anthranilate synthase, component II [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .   97 2 hits [enterobacteria]         anthranilate synthase, component II [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Newport str. SL254 ...........   97 2 hits [enterobacteria]         bifunctional glutamine amidotransferase/anthranilate phosph
. . . . Dickeya zeae Ech1591 .....................................................   97 2 hits [enterobacteria]         glutamine amidotransferase of anthranilate synthase [Dickey
. . . Psychroflexus torquis ATCC 700755 ------------------------------------------  243 3 hits [CFB group bacteria]     Anthranilate synthase component II (Glutamine amido-transfe
. . . Lactococcus lactis subsp. lactis Il1403 ....................................  132 2 hits [firmicutes]             anthranilate synthase component II [Lactococcus lactis subs
. . . Lactococcus lactis subsp. lactis ...........................................  132 1 hit  [firmicutes]             anthranilate synthase component II [Lactococcus lactis subs
. . . Lactococcus lactis .........................................................  132 1 hit  [firmicutes]             anthranilate synthase component II [Lactococcus lactis subs
. . . Lactococcus lactis subsp. lactis KF147 .....................................  131 2 hits [firmicutes]             Anthranilate synthase component II [Lactococcus lactis subs
. . . Lactococcus lactis subsp. cremoris MG1363 ..................................  128 2 hits [firmicutes]             anthranilate synthase component II [Lactococcus lactis subs
. . . Lactococcus lactis subsp. cremoris SK11 ....................................  128 2 hits [firmicutes]             anthranilate synthase component II [Lactococcus lactis subs
. . . Oribacterium sinus F0268 ...................................................  122 2 hits [firmicutes]             anthranilate synthase component II [Oribacterium sinus F026
. . . Streptococcus infantarius subsp. infantarius ATCC BAA-102 ..................  121 2 hits [firmicutes]             hypothetical protein STRINF_00672 [Streptococcus infantariu
. . . Caldicellulosiruptor saccharolyticus DSM 8903 ..............................  119 2 hits [firmicutes]             glutamine amidotransferase of anthranilate synthase [Caldic
. . . Streptococcus pyogenes str. Manfredo .......................................  119 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pyogenes 
. . . Streptococcus pyogenes MGAS315 .............................................  117 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pyogenes 
. . . Streptococcus pyogenes SSI-1 ...............................................  117 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pyogenes 
. . . Streptococcus pyogenes M1 GAS ..............................................  117 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pyogenes 
. . . Streptococcus pyogenes MGAS10394 ...........................................  117 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pyogenes 
. . . Streptococcus pyogenes MGAS5005 ............................................  117 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pyogenes 
. . . Streptococcus pyogenes MGAS10270 ...........................................  117 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pyogenes 
. . . Streptococcus sp. 2_1_36FAA ................................................  116 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus sp. 2_1_3
. . . Streptococcus pyogenes NZ131 ...............................................  116 2 hits [firmicutes]             Anthranilate synthase, amidotransferase-like component / Pa
. . . Streptococcus pyogenes MGAS6180 ............................................  116 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pyogenes 
. . . Streptococcus pyogenes MGAS8232 ............................................  116 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pyogenes 
. . . Streptococcus equi subsp. zooepidemicus MGCS10565 ..........................  116 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus equi subs
. . . Streptococcus sanguinis SK36 ...............................................  115 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus sanguinis
. . . Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 ...............  115 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Streptococcus equi subsp. equi 4047 ........................................  114 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus equi subs
. . . Petrotoga mobilis SJ95 .....................................................  114 2 hits [thermotogales]          glutamine amidotransferase of anthranilate synthase [Petrot
. . . Streptococcus equi subsp. zooepidemicus ....................................  114 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus equi subs
. . . Streptococcus pyogenes MGAS10750 ...........................................  114 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pyogenes 
. . . Streptococcus gordonii str. Challis substr. CH1 ............................  114 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus gordonii 
. . . Streptococcus pyogenes MGAS9429 ............................................  113 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pyogenes 
. . . Streptococcus pyogenes MGAS2096 ............................................  113 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pyogenes 
. . . Lactobacillus brevis subsp. gravesensis ATCC 27305 .........................  113 2 hits [firmicutes]             anthranilate synthase component II [Lactobacillus brevis su
. . . Anaerocellum thermophilum DSM 6725 .........................................  112 2 hits [firmicutes]             glutamine amidotransferase of anthranilate synthase [Anaero
. . . Candidatus Kuenenia stuttgartiensis ........................................  112 1 hit  [planctomycetes]         strongly similar to anthranilate synthase component II [Can
. . . Clostridiales bacterium 1_7_47FAA ..........................................  112 2 hits [firmicutes]             anthranilate synthase [Clostridiales bacterium 1_7_47_FAA] 
. . . Streptococcus gallolyticus UCN34 ...........................................  112 2 hits [firmicutes]             para-aminobenzoate synthase glutamine amidotransferase (sub
. . . Streptococcus mutans UA159 .................................................  112 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus mutans UA
. . . Clostridium phytofermentans ISDg ...........................................  112 2 hits [firmicutes]             glutamine amidotransferase of anthranilate synthase [Clostr
. . . Streptococcus dysgalactiae subsp. equisimilis GGS_124 ......................  111 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus dysgalact
. . . Streptococcus agalactiae A909 ..............................................  111 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus agalactia
. . . Streptococcus agalactiae H36B ..............................................  111 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus agalactia
. . . Streptococcus agalactiae 2603V/R ...........................................  111 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus agalactia
. . . Streptococcus agalactiae 18RS21 ............................................  111 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus agalactia
. . . Streptococcus mutans NN2025 ................................................  111 2 hits [firmicutes]             putative anthranilate synthase subunit beta [Streptococcus 
. . . Planctomyces maris DSM 8797 ................................................  111 4 hits [planctomycetes]         para-aminobenzoate/anthranilate synthase glutamine amidotra
. . . Lactobacillus buchneri ATCC 11577 ..........................................  110 2 hits [firmicutes]             anthranilate synthase component II [Lactobacillus buchneri 
. . . Streptococcus agalactiae CJB111 ............................................  110 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus agalactia
. . . Lactobacillus hilgardii ATCC 8290 ..........................................  110 2 hits [firmicutes]             anthranilate synthase component II [Lactobacillus hilgardii
. . . Streptococcus thermophilus LMG 18311 .......................................  110 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus thermophi
. . . Streptococcus thermophilus CNRZ1066 ........................................  110 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus thermophi
. . . Streptococcus salivarius SK126 .............................................  110 2 hits [firmicutes]             para-aminobenzoate/anthranilate synthase glutamine amidotra
. . . Bacteroides thetaiotaomicron VPI-5482 ......................................  110 2 hits [CFB group bacteria]     anthranilate synthase component II [Bacteroides thetaiotaom
. . . Bacteroides sp. 1_1_6 ......................................................  110 2 hits [CFB group bacteria]     anthranilate synthase component II [Bacteroides thetaiotaom
. . . Streptococcus thermophilus LMD-9 ...........................................  110 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus thermophi
. . . Streptococcus agalactiae NEM316 ............................................  109 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus agalactia
. . . Streptococcus agalactiae COH1 ..............................................  109 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus agalactia
. . . Streptococcus agalactiae 515 ...............................................  109 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus agalactia
. . . Streptococcus mitis B6 .....................................................  109 2 hits [firmicutes]             anthranilate synthase component II (glutamine amido-transfe
. . . Listeria monocytogenes HPB2262 .............................................  109 4 hits [firmicutes]             class I glutamine amidotransferase [Listeria monocytogenes 
. . . Atopobium vaginae DSM 15829 ................................................  109 2 hits [high GC Gram+]          anthranilate synthase component II [Atopobium vaginae DSM 1
. . . Victivallis vadensis ATCC BAA-548 ..........................................  108 2 hits [bacteria]               glutamine amidotransferase of anthranilate synthase [Victiv
. . . Bacteroides caccae ATCC 43185 ..............................................  108 2 hits [CFB group bacteria]     hypothetical protein BACCAC_00422 [Bacteroides caccae ATCC 
. . . Bacillus coahuilensis m4-4 .................................................  108 1 hit  [firmicutes]             anthranilate synthase component II [Bacillus coahuilensis m
. . . Chitinophaga pinensis DSM 2588 .............................................  108 2 hits [CFB group bacteria]     glutamine amidotransferase of anthranilate synthase [Chitin
. . . Enterococcus casseliflavus EC30 ............................................  108 2 hits [firmicutes]             anthranilate synthase component II [Enterococcus casselifla
. . . Enterococcus casseliflavus EC10 ............................................  108 2 hits [firmicutes]             anthranilate synthase component II [Enterococcus casselifla
. . . Streptococcus sp. M143 .....................................................  108 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus sp. M143]
. . . Streptococcus oralis ATCC 35037 ............................................  107 2 hits [firmicutes]             nthranilate synthase component II TrpG [Streptococcus orali
. . . Denitrovibrio acetiphilus DSM 12809 ........................................  107 2 hits [bacteria]               glutamine amidotransferase of anthranilate synthase [Denitr
. . . Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2 ..............  107 2 hits [CFB group bacteria]     anthranilate synthase component II [Candidatus Azobacteroid
. . . Persephonella marina EX-H1 .................................................  106 2 hits [aquificales]            para-aminobenzoate synthase glutamine amidotransferase comp
. . . Staphylococcus haemolyticus JCSC1435 .......................................  106 4 hits [firmicutes]             hypothetical protein SH2185 [Staphylococcus haemolyticus JC
. . . Streptococcus pneumoniae SP9-BS68 ..........................................  106 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pneumonia
. . . Streptococcus pneumoniae SP14-BS69 .........................................  106 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pneumonia
. . . Streptococcus pneumoniae SP23-BS72 .........................................  106 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pneumonia
. . . Streptococcus pneumoniae SP195 .............................................  106 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pneumonia
. . . Streptococcus pneumoniae CDC3059-06 ........................................  106 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pneumonia
. . . Streptococcus pneumoniae CCRI 1974 .........................................  106 1 hit  [firmicutes]             anthranilate synthase component II [Streptococcus pneumonia
. . . Streptococcus pneumoniae CCRI 1974M2 .......................................  106 1 hit  [firmicutes]             anthranilate synthase component II [Streptococcus pneumonia
. . . Flavobacteria bacterium MS024-2A ...........................................  106 2 hits [CFB group bacteria]     glutamine amidotransferase of anthranilate synthase [Flavob
. . . Bacteroides sp. D2 .........................................................  106 1 hit  [CFB group bacteria]     anthranilate synthase component II [Bacteroides sp. D2]
. . . Epulopiscium sp. 'N.t. morphotype B' .......................................  106 1 hit  [firmicutes]             glutamine amidotransferase of anthranilate synthase [Epulop
. . . Candidatus Sulcia muelleri GWSS ............................................  106 2 hits [CFB group bacteria]     anthranilate synthase component II [Candidatus Sulcia muell
. . . Candidatus Sulcia muelleri DMIN ............................................  106 2 hits [CFB group bacteria]     anthranilate synthase component II [Candidatus Sulcia muell
. . . Streptococcus pneumoniae TIGR4 .............................................  106 3 hits [firmicutes]             anthranilate synthase component II [Streptococcus pneumonia
. . . Streptococcus pneumoniae R6 ................................................  106 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pneumonia
. . . Streptococcus pneumoniae D39 ...............................................  106 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pneumonia
. . . Streptococcus pneumoniae SP3-BS71 ..........................................  106 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pneumonia
. . . Streptococcus pneumoniae SP11-BS70 .........................................  106 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pneumonia
. . . Streptococcus pneumoniae SP19-BS75 .........................................  106 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pneumonia
. . . Streptococcus pneumoniae MLV-016 ...........................................  106 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pneumonia
. . . Dethiosulfovibrio peptidovorans DSM 11002 ..................................  106 2 hits [bacteria]               glutamine amidotransferase of anthranilate synthase [Dethio
. . . Lysinibacillus sphaericus C3-41 ............................................  106 2 hits [firmicutes]             anthranilate synthase component II [Lysinibacillus sphaeric
. . . Streptococcus pneumoniae SP6-BS73 ..........................................  106 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pneumonia
. . . Streptococcus pneumoniae SP18-BS74 .........................................  106 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pneumonia
. . . Streptococcus pneumoniae CDC1087-00 ........................................  106 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pneumonia
. . . Streptococcus pneumoniae 70585 .............................................  106 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pneumonia
. . . Bacteroides ovatus ATCC 8483 ...............................................  106 2 hits [CFB group bacteria]     hypothetical protein BACOVA_03781 [Bacteroides ovatus ATCC 
. . . Bacteroides ovatus SD CMC 3f ...............................................  106 2 hits [CFB group bacteria]     hypothetical protein BACOVA_03781 [Bacteroides ovatus ATCC 
. . . Bacteroides cellulosilyticus DSM 14838 .....................................  106 2 hits [CFB group bacteria]     hypothetical protein BACCELL_05021 [Bacteroides cellulosily
. . . Streptococcus pneumoniae G54 ...............................................  106 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pneumonia
. . . Streptococcus pneumoniae P1031 .............................................  106 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pneumonia
. . . Bacteroides sp. 2_2_4 ......................................................  106 2 hits [CFB group bacteria]     anthranilate synthase component II [Bacteroides sp. 2_2_4] 
. . . Candidatus Sulcia muelleri SMDSEM ..........................................  106 2 hits [CFB group bacteria]     anthranilate synthase component II [Candidatus Sulcia muell
. . . Thermotoga neapolitana DSM 4359 ............................................  105 2 hits [thermotogales]          Anthranilate synthase component II [Thermotoga neapolitana 
. . . Bacteroides stercoris ATCC 43183 ...........................................  105 2 hits [CFB group bacteria]     hypothetical protein BACSTE_00478 [Bacteroides stercoris AT
. . . Bacteroides eggerthii DSM 20697 ............................................  105 2 hits [CFB group bacteria]     hypothetical protein BACEGG_01814 [Bacteroides eggerthii DS
. . . Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293 ...................  105 2 hits [firmicutes]             anthranilate synthase, component II [Leuconostoc mesenteroi
. . . Micromonospora aurantiaca ATCC 27029 .......................................  105 2 hits [high GC Gram+]          glutamine amidotransferase of anthranilate synthase [Microm
. . . Bacteroides finegoldii DSM 17565 ...........................................  105 2 hits [CFB group bacteria]     anthranilate synthase component II [Bacteroides finegoldii 
. . . Enterococcus casseliflavus EC20 ............................................  105 2 hits [firmicutes]             class-I glutamine amidotransferase [Enterococcus casselifla
. . . Thermomicrobium roseum DSM 5159 ............................................  105 2 hits [GNS bacteria]           para-aminobenzoate synthase glutamine amidotransferase comp
. . . Leuconostoc mesenteroides subsp. cremoris ATCC 19254 .......................  105 2 hits [firmicutes]             anthranilate synthase, component II [Leuconostoc mesenteroi
. . . Sulfurihydrogenibium sp. YO3AOP1 ...........................................  105 2 hits [aquificales]            glutamine amidotransferase of anthranilate synthase [Sulfur
. . . Sulfurihydrogenibium yellowstonense SS-5 ...................................  105 2 hits [aquificales]            para-aminobenzoate/anthranilate synthase glutamine amidotra
. . . Micromonospora sp. L5 ......................................................  105 2 hits [high GC Gram+]          glutamine amidotransferase of anthranilate synthase [Microm
. . . Bacteroides sp. D1 .........................................................  105 2 hits [CFB group bacteria]     anthranilate synthase component II [Bacteroides sp. D1] >gi
. . . Bacteroides sp. 2_1_22 .....................................................  105 2 hits [CFB group bacteria]     anthranilate synthase component II [Bacteroides sp. D1] >gi
. . . Bacteroides ovatus SD CC 2a ................................................  105 2 hits [CFB group bacteria]     glutamine amidotransferase, class I [Bacteroides ovatus SD 
. . . Bacteroides xylanisolvens SD CC 1b .........................................  105 2 hits [CFB group bacteria]     glutamine amidotransferase, class I [Bacteroides ovatus SD 
. . . Dethiobacter alkaliphilus AHT 1 ............................................  105 2 hits [firmicutes]             glutamine amidotransferase of anthranilate synthase [Dethio
. . . Bacteroides intestinalis DSM 17393 .........................................  104 2 hits [CFB group bacteria]     hypothetical protein BACINT_01898 [Bacteroides intestinalis
. . . Bacteroides plebeius DSM 17135 .............................................  104 2 hits [CFB group bacteria]     hypothetical protein BACPLE_03368 [Bacteroides plebeius DSM
. . . Bacteroides vulgatus ATCC 8482 .............................................  104 2 hits [CFB group bacteria]     anthranilate synthase component II [Bacteroides vulgatus AT
. . . Bacteroides sp. 4_3_47FAA ..................................................  104 2 hits [CFB group bacteria]     anthranilate synthase component II [Bacteroides vulgatus AT
. . . Bacteroides vulgatus PC510 .................................................  104 2 hits [CFB group bacteria]     anthranilate synthase component II [Bacteroides vulgatus AT
. . . Streptococcus pneumoniae ATCC 700669 .......................................  104 2 hits [firmicutes]             anthranilate synthase component II [Streptococcus pneumonia
. . . Butyrivibrio fibrisolvens 16/4 .............................................  104 1 hit  [firmicutes]             anthranilate synthase, component II [Butyrivibrio fibrisolv
. . . Bacteroides dorei DSM 17855 ................................................  104 2 hits [CFB group bacteria]     hypothetical protein BACDOR_00744 [Bacteroides dorei DSM 17
. . . Bacteroides sp. 9_1_42FAA ..................................................  104 2 hits [CFB group bacteria]     hypothetical protein BACDOR_00744 [Bacteroides dorei DSM 17
. . . Bacteroides dorei 5_1_36/D4 ................................................  104 2 hits [CFB group bacteria]     hypothetical protein BACDOR_00744 [Bacteroides dorei DSM 17
. . . Bacteroides sp. 3_1_33FAA ..................................................  104 2 hits [CFB group bacteria]     hypothetical protein BACDOR_00744 [Bacteroides dorei DSM 17
. . . Bacteroides coprocola DSM 17136 ............................................  104 2 hits [CFB group bacteria]     hypothetical protein BACCOP_03998 [Bacteroides coprocola DS
. . . Acidothermus cellulolyticus 11B ............................................  104 2 hits [high GC Gram+]          anthranilate synthase, component II [Acidothermus celluloly
. . . Streptococcus pneumoniae JJA ...............................................  104 2 hits [firmicutes]             para-aminobenzoate/anthranilate synthase glutamine amidotra
. . . Parabacteroides merdae ATCC 43184 ..........................................  104 2 hits [CFB group bacteria]     hypothetical protein PARMER_00520 [Parabacteroides merdae A
. . . Streptococcus pneumoniae CDC1873-00 ........................................  104 2 hits [firmicutes]             para-aminobenzoate/anthranilate synthase glutamine amidotra
. . . Streptococcus pneumoniae Hungary19A-6 ......................................  104 2 hits [firmicutes]             para-aminobenzoate/anthranilate synthase glutamine amidotra
. . . Streptococcus pneumoniae CGSP14 ............................................  104 2 hits [firmicutes]             para-aminobenzoate/anthranilate synthase glutamine amidotra
. . . Streptococcus pneumoniae CDC0288-04 ........................................  104 2 hits [firmicutes]             para-aminobenzoate synthase glutamine amidotransferase comp
. . . Streptococcus pneumoniae Taiwan19F-14 ......................................  104 2 hits [firmicutes]             para-aminobenzoate synthase glutamine amidotransferase comp
. . . Streptococcus pneumoniae TCH8431/19A .......................................  104 2 hits [firmicutes]             para-aminobenzoate synthase glutamine amidotransferase comp
. . . Listeria monocytogenes Clip80459 ...........................................  103 2 hits [firmicutes]             glutamine amidotransferase [Listeria monocytogenes Clip8145
. . . Listeria monocytogenes FSL J1-194 ..........................................  103 2 hits [firmicutes]             glutamine amidotransferase [Listeria monocytogenes Clip8145
. . . Listeria monocytogenes FSL J1-175 ..........................................  103 1 hit  [firmicutes]             glutamine amidotransferase [Listeria monocytogenes Clip8145
. . . Flavobacteria bacterium BBFL7 ..............................................  103 2 hits [CFB group bacteria]     anthranilate/para-aminobenzoate synthetase component II, Tr
. . . Ruminococcus bromii L2-63 ..................................................  103 1 hit  [firmicutes]             anthranilate synthase, component II [Ruminococcus bromii L2
. . . Staphylococcus capitis SK14 ................................................  103 2 hits [firmicutes]             para-aminobenzoate synthase glutamine amidotransferase comp
. . . Coprococcus eutactus ATCC 27759 ............................................  103 2 hits [firmicutes]             hypothetical protein COPEUT_01173 [Coprococcus eutactus ATC
. . . Clostridium carboxidivorans P7 .............................................  103 2 hits [firmicutes]             glutamine amidotransferase of anthranilate synthase [Clostr
. . . Candidatus Koribacter versatilis Ellin345 ..................................  103 2 hits [bacteria]               anthranilate synthase, component II [Candidatus Koribacter 
. . . Listeria monocytogenes str. 1/2a F6854 .....................................  103 2 hits [firmicutes]             glutamine amidotransferase, class I [Listeria monocytogenes
. . . Listeria monocytogenes 10403S ..............................................  103 1 hit  [firmicutes]             glutamine amidotransferase, class I [Listeria monocytogenes
. . . Listeria monocytogenes J0161 ...............................................  103 1 hit  [firmicutes]             glutamine amidotransferase, class I [Listeria monocytogenes
. . . Listeria monocytogenes J2818 ...............................................  103 2 hits [firmicutes]             glutamine amidotransferase, class I [Listeria monocytogenes
. . . Listeria monocytogenes F6900 ...............................................  103 2 hits [firmicutes]             glutamine amidotransferase, class I [Listeria monocytogenes
. . . Listeria monocytogenes 08-5578 .............................................  103 2 hits [firmicutes]             glutamine amidotransferase, class I [Listeria monocytogenes
. . . Listeria monocytogenes 08-5923 .............................................  103 2 hits [firmicutes]             glutamine amidotransferase, class I [Listeria monocytogenes
. . . Bacillus cereus G9241 ......................................................  103 2 hits [firmicutes]             anthranilate synthase, component II [Bacillus cereus G9241]
. . . Corynebacterium tuberculostearicum SK141 ...................................  103 2 hits [high GC Gram+]          anthranilate synthase component 2 [Corynebacterium tubercul
. . . Megasphaera genomosp. type_1 str. 28L ......................................  103 2 hits [firmicutes]             glutamine amidotransferase, class I [Megasphaera genomosp. 
. . . uncultured Termite group 1 bacterium phylotype Rs-D17 ......................  103 2 hits [bacteria]               anthranilate synthase glutamine amidotransferase component 
. . . Algoriphagus sp. PR1 .......................................................  103 2 hits [CFB group bacteria]     anthranilate synthase component II [Algoriphagus sp. PR1] >
. . . Bacteroides sp. 3_2_5 ......................................................  103 2 hits [CFB group bacteria]     anthranilate synthase component II [Bacteroides sp. 3_2_5] 
. . . Bacteroides fragilis NCTC 9343 .............................................  103 2 hits [CFB group bacteria]     glutamine amidotransferase [Bacteroides fragilis NCTC 9343]
. . . Gemmatimonas aurantiaca T-27 ...............................................  103 2 hits [bacteria]               anthranilate synthase component II [Gemmatimonas aurantiaca
. . . Thermoanaerobacter sp. X514 ................................................  103 2 hits [firmicutes]             glutamine amidotransferase of anthranilate synthase [Thermo
. . . Thermoanaerobacter sp. X513 ................................................  103 2 hits [firmicutes]             glutamine amidotransferase of anthranilate synthase [Thermo
. . . Thermoanaerobacter sp. X561 ................................................  103 2 hits [firmicutes]             glutamine amidotransferase of anthranilate synthase [Thermo
. . . Listeria monocytogenes str. 4b H7858 .......................................  103 2 hits [firmicutes]             glutamine amidotransferase, class I [Listeria monocytogenes
. . . Clostridium beijerinckii NCIMB 8052 ........................................  102 4 hits [firmicutes]             glutamine amidotransferase of anthranilate synthase [Clostr
. . . Listeria monocytogenes EGD-e ...............................................  102 2 hits [firmicutes]             hypothetical protein lmo2749 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes FSL R2-561 ..........................................  102 1 hit  [firmicutes]             hypothetical protein lmo2749 [Listeria monocytogenes EGD-e]
. . . Bacillus thuringiensis serovar israelensis ATCC 35646 ......................  102 2 hits [firmicutes]             Anthranilate synthase component II  / Para-aminobenzoate sy
. . . Bacillus cereus G9842 ......................................................  102 2 hits [firmicutes]             Anthranilate synthase component II  / Para-aminobenzoate sy
. . . Corynebacterium pseudogenitalium ATCC 33035 ................................  102 2 hits [high GC Gram+]          anthranilate synthase component II [Corynebacterium pseudog
. . . Listeria monocytogenes str. 4b F2365 .......................................  102 2 hits [firmicutes]             glutamine amidotransferase, class I [Listeria monocytogenes
. . . Listeria monocytogenes FSL R2-503 ..........................................  102 2 hits [firmicutes]             glutamine amidotransferase, class I [Listeria monocytogenes
. . . Bacteroides fragilis YCH46 .................................................  102 2 hits [CFB group bacteria]     anthranilate synthase component II [Bacteroides fragilis YC
. . . Staphylococcus lugdunensis HKU09-01 ........................................  102 2 hits [firmicutes]             Para-aminobenzoate synthase, amidotransferase component Pab
. . . Fibrobacter succinogenes subsp. succinogenes S85 ...........................  102 2 hits [bacteria]               anthranilate phosphoribosyltransferase [Fibrobacter succino
. . . Bacteroides fragilis 3_1_12 ................................................  102 1 hit  [CFB group bacteria]     glutamine amidotransferase [Bacteroides fragilis 3_1_12]
. . . Leptotrichia buccalis C-1013-b .............................................  102 2 hits [fusobacteria]           anthranilate phosphoribosyltransferase [Leptotrichia buccal
. . . Bacteroides sp. 2_1_16 .....................................................  102 2 hits [CFB group bacteria]     anthranilate synthase component II protein [Bacteroides sp.
. . . Chlorobium phaeobacteroides BS1 ............................................  102 2 hits [green sulfur bacteria]  glutamine amidotransferase of anthranilate synthase [Chloro
. . . Sulfurihydrogenibium azorense Az-Fu1 .......................................  102 2 hits [aquificales]            para-aminobenzoate/anthranilate synthase glutamine amidotra
. . . Listeria welshimeri serovar 6b str. SLCC5334 ...............................  102 2 hits [firmicutes]             glutamine amidotransferase, class I [Listeria welshimeri se
. . . Bacillus cereus ATCC 10987 .................................................  102 2 hits [firmicutes]             anthranilate synthase component II [Bacillus cereus ATCC 10
. . . Salinibacter ruber DSM 13855 ...............................................  102 2 hits [CFB group bacteria]     para-aminobenzoate/anthranilate synthase glutamine amidotra
. . . Salinibacter ruber .........................................................  102 2 hits [CFB group bacteria]     para-aminobenzoate/anthranilate synthase glutamine amidotra
. . . Pirellula staleyi DSM 6068 .................................................  102 2 hits [planctomycetes]         glutamine amidotransferase of anthranilate synthase [Pirell
. . . Listeria monocytogenes FSL J2-003 ..........................................  102 1 hit  [firmicutes]             hypothetical protein LmonocytFSL_01087 [Listeria monocytoge
. . . Thermoanaerobacter pseudethanolicus ATCC 33223 .............................  102 2 hits [firmicutes]             glutamine amidotransferase of anthranilate synthase [Thermo
. . . Thermoanaerobacter brockii subsp. finnii Ako-1 .............................  102 2 hits [firmicutes]             glutamine amidotransferase of anthranilate synthase [Thermo
. . . Thermoanaerobacter ethanolicus CCSD1 .......................................  102 2 hits [firmicutes]             glutamine amidotransferase of anthranilate synthase [Thermo
. . . Exiguobacterium sibiricum 255-15 ...........................................  102 2 hits [firmicutes]             glutamine amidotransferase of anthranilate synthase [Exiguo
. . . Chlorobaculum parvum NCIB 8327 .............................................  102 2 hits [green sulfur bacteria]  glutamine amidotransferase of anthranilate synthase [Chloro
. . . Micromonospora sp. ATCC 39149 ..............................................  102 2 hits [high GC Gram+]          para-aminobenzoate synthase component II [Micromonospora sp
. . . Flavobacteriales bacterium ALC-1 ...........................................  102 2 hits [CFB group bacteria]     anthranilate synthase component II [Flavobacteriales bacter
. . . Chlorobium luteolum DSM 273 ................................................  102 2 hits [green sulfur bacteria]  anthranilate synthase component II [Chlorobium luteolum DSM
. . . Eubacterium hallii DSM 3353 ................................................  102 2 hits [firmicutes]             hypothetical protein EUBHAL_01974 [Eubacterium hallii DSM 3
. . . Listeria seeligeri serovar 1/2b str. SLCC3954 ..............................  102 4 hits [firmicutes]             anthranilate synthase, glutamine amidotransferase component
. . . Ruminococcus lactaris ATCC 29176 ...........................................  102 2 hits [firmicutes]             hypothetical protein RUMLAC_00617 [Ruminococcus lactaris AT
. . . Thermoanaerobacter italicus Ab9 ............................................  101 2 hits [firmicutes]             glutamine amidotransferase of anthranilate synthase [Thermo
. . . Prevotella copri DSM 18205 .................................................  101 2 hits [CFB group bacteria]     anthranilate synthase component II [Prevotella copri DSM 18
. . . Listeria innocua Clip11262 .................................................  101 1 hit  [firmicutes]             hypothetical protein lin2892 [Listeria innocua Clip11262] >
. . . Listeria innocua ...........................................................  101 1 hit  [firmicutes]             hypothetical protein lin2892 [Listeria innocua Clip11262] >
. . . Thermotoga petrophila RKU-1 ................................................  101 2 hits [thermotogales]          anthranilate phosphoribosyltransferase [Thermotoga petrophi
. . . Thermotoga naphthophila RKU-10 .............................................  101 2 hits [thermotogales]          anthranilate phosphoribosyltransferase [Thermotoga petrophi
. . . Bacillus cereus H3081.97 ...................................................  101 2 hits [firmicutes]             anthranilate synthase, glutamine amidotransferase component
. . . Bacillus cereus AH187 ......................................................  101 2 hits [firmicutes]             anthranilate synthase, glutamine amidotransferase component
. . . Bacillus cereus Q1 .........................................................  101 2 hits [firmicutes]             anthranilate synthase, glutamine amidotransferase component
. . . Flavobacteriales bacterium HTCC2170 ........................................  101 2 hits [CFB group bacteria]     anthranilate synthase component II [Flavobacteriales bacter
. . . Frankia sp. EAN1pec ........................................................  101 2 hits [high GC Gram+]          para-aminobenzoate synthase component II [Frankia sp. EAN1p
. . . Clostridium butyricum 5521 .................................................  101 2 hits [firmicutes]             para-aminobenzoate/anthranilate synthase glutamine amidotra
. . . Clostridium butyricum E4 str. BoNT E BL5262 ................................  101 2 hits [firmicutes]             para-aminobenzoate/anthranilate synthase glutamine amidotra
. . . Thermotoga maritima ........................................................  101 2 hits [thermotogales]          anthranilate synthase component II and anthranilate phospho
. . . Bacillus weihenstephanensis KBAB4 ..........................................  100 2 hits [firmicutes]             anthranilate synthase component II [Bacillus weihenstephane
. . . Prevotella sp. oral taxon 317 str. F0108 ...................................  100 2 hits [CFB group bacteria]     aspartate 1-decarboxylase [Prevotella sp. oral taxon 317 st
. . . Staphylococcus epidermidis M23864:W1 .......................................  100 2 hits [firmicutes]             aminodeoxychorismate synthase [Staphylococcus epidermidis M
. . . Thermotoga maritima MSB8 ...................................................  100 2 hits [thermotogales]          anthranilate synthase component II [Thermotoga maritima MSB
. . . Clostridium sp. L2-50 ......................................................  100 2 hits [firmicutes]             hypothetical protein CLOL250_01007 [Clostridium sp. L2-50] 
. . . Prevotella ruminicola 23 ...................................................  100 2 hits [CFB group bacteria]     anthranilate synthase subunit II [Prevotella ruminicola 23]
. . . Parabacteroides johnsonii DSM 18315 ........................................  100 2 hits [CFB group bacteria]     hypothetical protein PRABACTJOHN_00956 [Parabacteroides joh
. . . Thermotoga sp. RQ2 .........................................................  100 2 hits [thermotogales]          anthranilate phosphoribosyltransferase [Thermotoga sp. RQ2]
. . . Bacillus anthracis str. A0442 ..............................................  100 2 hits [firmicutes]             anthranilate synthase, glutamine amidotransferase component
. . . Bacillus anthracis str. A0465 ..............................................  100 2 hits [firmicutes]             anthranilate synthase, glutamine amidotransferase component
. . . Bacillus cereus AH820 ......................................................  100 2 hits [firmicutes]             anthranilate synthase, glutamine amidotransferase component
. . . Bacillus anthracis str. CNEVA-9066 .........................................  100 1 hit  [firmicutes]             anthranilate synthase, glutamine amidotransferase component
. . . Bacillus anthracis str. Kruger B ...........................................  100 1 hit  [firmicutes]             anthranilate synthase, glutamine amidotransferase component
. . . Bacillus thuringiensis str. Al Hakam .......................................  100 2 hits [firmicutes]             anthranilate synthase component II [Bacillus thuringiensis 
. . . Bacillus cereus 03BB108 ....................................................  100 2 hits [firmicutes]             anthranilate synthase component II [Bacillus thuringiensis 
. . . Bacillus cereus 03BB102 ....................................................  100 2 hits [firmicutes]             anthranilate synthase component II [Bacillus thuringiensis 
. . . Thermoanaerobacterium thermosaccharolyticum DSM 571 ........................  100 2 hits [firmicutes]             glutamine amidotransferase of anthranilate synthase [Thermo
. . . Bacteroides coprophilus DSM 18228 ..........................................  100 2 hits [CFB group bacteria]     hypothetical protein BACCOPRO_02958 [Bacteroides coprophilu
. . . Ruminococcus torques L2-14 .................................................  100 1 hit  [firmicutes]             anthranilate synthase, component II [Ruminococcus torques L
. . . Marinitoga piezophila KA3 ..................................................  100 2 hits [thermotogales]          anthranilate synthase component II [Marinitoga piezophila K
. . . Clostridium bolteae ATCC BAA-613 ...........................................  100 2 hits [firmicutes]             hypothetical protein CLOBOL_04491 [Clostridium bolteae ATCC
. . . Gemmata obscuriglobus UQM 2246 .............................................  100 1 hit  [planctomycetes]         anthranilate synthase, component II [Gemmata obscuriglobus 
. . . Polaribacter sp. MED152 ....................................................  100 2 hits [CFB group bacteria]     anthranilate synthase component II [Polaribacter sp. MED152
. . . Anaerostipes caccae DSM 14662 ..............................................  100 2 hits [firmicutes]             hypothetical protein ANACAC_00148 [Anaerostipes caccae DSM 
. . . Salinispora tropica CNB-440 ................................................  100 2 hits [high GC Gram+]          para-aminobenzoate synthase component II [Salinispora tropi
. . . Prevotella sp. oral taxon 472 str. F0295 ...................................  100 2 hits [CFB group bacteria]     anthranilate synthase component II [Prevotella sp. oral tax
. . . Acidaminococcus sp. D21 ....................................................  100 2 hits [firmicutes]             anthranilate synthase component II [Acidaminococcus sp. D21
. . . Bacillus cellulosilyticus DSM 2522 .........................................  100 2 hits [firmicutes]             glutamine amidotransferase of anthranilate synthase [Bacill
. . . Listeria monocytogenes Finland 1988 ........................................  100 1 hit  [firmicutes]             para-aminobenzoate synthase glutamine amidotransferase comp
. . . Prochlorococcus marinus subsp. marinus str. CCMP1375 .......................  100 2 hits [cyanobacteria]          anthranilate/para-aminobenzoate synthase component II [Proc
. . . Bacillus cereus E33L .......................................................  100 2 hits [firmicutes]             anthranilate synthase component II [Bacillus cereus E33L] >
. . . Bacillus cereus NVH0597-99 .................................................  100 2 hits [firmicutes]             anthranilate synthase component II [Bacillus cereus E33L] >
. . . Bacillus thuringiensis serovar konkukian str. 97-27 ........................   99 2 hits [firmicutes]             anthranilate synthase component II [Bacillus thuringiensis 
. . . Bacillus cereus W ..........................................................   99 2 hits [firmicutes]             anthranilate synthase component II [Bacillus thuringiensis 
. . . Macrococcus caseolyticus JCSC5402 ..........................................   99 2 hits [firmicutes]             hypothetical protein MCCL_0466 [Macrococcus caseolyticus JC
. . . Brevibacillus brevis NBRC 100599 ...........................................   99 2 hits [firmicutes]             para-aminobenzoate/anthranilate synthase glutamine amidotra
. . . Staphylococcus hominis SK119 ...............................................   99 4 hits [firmicutes]             para-aminobenzoate synthase glutamine amidotransferase comp
. . . Bacteroides sp. 2_1_7 ......................................................   99 1 hit  [CFB group bacteria]     anthranilate synthase component II [Bacteroides sp. 2_1_7]
. . . Dokdonia donghaensis MED134 ................................................   99 2 hits [CFB group bacteria]     anthranilate synthase component II [Dokdonia donghaensis ME
. . . Planctomyces limnophilus DSM 3776 ..........................................   99 2 hits [planctomycetes]         glutamine amidotransferase of anthranilate synthase or amin
. . . Bacillus anthracis str. Ames ...............................................   99 2 hits [firmicutes]             anthranilate synthase component II [Bacillus anthracis str.
. . . Bacillus anthracis str. 'Ames Ancestor' ....................................   99 2 hits [firmicutes]             anthranilate synthase component II [Bacillus anthracis str.
. . . Bacillus anthracis str. Sterne .............................................   99 2 hits [firmicutes]             anthranilate synthase component II [Bacillus anthracis str.
. . . Bacillus anthracis str. A2012 ..............................................   99 1 hit  [firmicutes]             anthranilate synthase component II [Bacillus anthracis str.
. . . Bacillus anthracis str. A0488 ..............................................   99 2 hits [firmicutes]             anthranilate synthase component II [Bacillus anthracis str.
. . . Bacillus anthracis str. A0193 ..............................................   99 2 hits [firmicutes]             anthranilate synthase component II [Bacillus anthracis str.
. . . Bacillus anthracis str. A0389 ..............................................   99 2 hits [firmicutes]             anthranilate synthase component II [Bacillus anthracis str.
. . . Bacillus anthracis str. A0174 ..............................................   99 2 hits [firmicutes]             anthranilate synthase component II [Bacillus anthracis str.
. . . Bacillus anthracis Tsiankovskii-I ..........................................   99 2 hits [firmicutes]             anthranilate synthase component II [Bacillus anthracis str.
. . . Bacillus anthracis str. CDC 684 ............................................   99 2 hits [firmicutes]             anthranilate synthase component II [Bacillus anthracis str.
. . . Bacillus anthracis str. A0248 ..............................................   99 2 hits [firmicutes]             anthranilate synthase component II [Bacillus anthracis str.
. . . Bacillus anthracis str. Western North America USA6153 ......................   99 1 hit  [firmicutes]             anthranilate synthase component II [Bacillus anthracis str.
. . . Bacillus anthracis str. Vollum .............................................   99 1 hit  [firmicutes]             anthranilate synthase component II [Bacillus anthracis str.
. . . Bacillus anthracis str. Australia 94 .......................................   99 1 hit  [firmicutes]             anthranilate synthase component II [Bacillus anthracis str.
. . . Clostridium spiroforme DSM 1552 ............................................   99 2 hits [firmicutes]             hypothetical protein CLOSPI_00034 [Clostridium spiroforme D
. . . Listeria monocytogenes FSL N3-165 ..........................................   99 2 hits [firmicutes]             glutamine amidotransferase [Listeria monocytogenes FSL N3-1
. . . Thermoanaerobacter tengcongensis MB4 .......................................   99 2 hits [firmicutes]             anthranilate/para-aminobenzoate synthase component II [Ther
. . . Bacillus cereus B4264 ......................................................   99 2 hits [firmicutes]             anthranilate synthase component II [Bacillus cereus B4264] 
. . . Chryseobacterium gleum ATCC 35910 ..........................................   99 2 hits [CFB group bacteria]     anthranilate synthase component II [Chryseobacterium gleum 
. . . Prevotella melaninogenica ATCC 25845 .......................................   99 2 hits [CFB group bacteria]     para-aminobenzoate/anthranilate synthase glutamine amidotra
. . . Clostridium kluyveri DSM 555 ...............................................   99 2 hits [firmicutes]             TrpG [Clostridium kluyveri DSM 555] >gi|219854514|ref|YP_00
. . . Clostridium kluyveri NBRC 12016 ............................................   99 2 hits [firmicutes]             TrpG [Clostridium kluyveri DSM 555] >gi|219854514|ref|YP_00
. . . Oceanobacillus iheyensis HTE831 ............................................   98 2 hits [firmicutes]             anthranilate synthase component II [Oceanobacillus iheyensi
. . . Exiguobacterium sp. AT1b ...................................................   98 2 hits [firmicutes]             glutamine amidotransferase of anthranilate synthase [Exiguo
. . . Bacillus cereus AH1134 .....................................................   98 2 hits [firmicutes]             anthranilate synthase, glutamine amidotransferase component
. . . Veillonella dispar ATCC 17748 ..............................................   98 2 hits [firmicutes]             hypothetical protein VEIDISOL_01725 [Veillonella dispar ATC
. . . Saccharopolyspora erythraea NRRL 2338 ......................................   98 3 hits [high GC Gram+]          putative p-aminobenzoate synthase glutamine amidotransferas
. . . Staphylococcus aureus RF122 ................................................   98 2 hits [firmicutes]             anthranilate/para-aminobenzoate synthase component II [Stap
. . . Veillonella parvula DSM 2008 ...............................................   98 2 hits [firmicutes]             glutamine amidotransferase of anthranilate synthase [Veillo
. . . Croceibacter atlanticus HTCC2559 ...........................................   98 2 hits [CFB group bacteria]     anthranilate synthase component II [Croceibacter atlanticus
. . . Kribbella flavida DSM 17836 ................................................   98 2 hits [high GC Gram+]          glutamine amidotransferase of anthranilate synthase [Kribbe
. . . Staphylococcus aureus subsp. aureus MW2 ....................................   98 2 hits [firmicutes]             hypothetical protein MW0675 [Staphylococcus aureus subsp. a
. . . Staphylococcus aureus subsp. aureus MSSA476 ................................   98 2 hits [firmicutes]             hypothetical protein MW0675 [Staphylococcus aureus subsp. a
. . . Staphylococcus aureus subsp. aureus TCH70 ..................................   98 2 hits [firmicutes]             hypothetical protein MW0675 [Staphylococcus aureus subsp. a
. . . Aquifex aeolicus VF5 .......................................................   98 2 hits [aquificales]            anthranilate synthase component II [Aquifex aeolicus VF5] >
. . . Staphylococcus aureus subsp. aureus MRSA252 ................................   98 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus MN8 ....................................   98 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus TCH60 ..................................   98 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus C160 ...................................   98 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus Btn1260 ................................   98 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus WW2703/97 ..............................   98 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus WBG10049 ...............................   98 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus D139 ...................................   98 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus C427 ...................................   98 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus A017934/97 .............................   98 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Veillonella sp. 3_1_44 .....................................................   98 2 hits [firmicutes]             anthranilate synthase component II [Veillonella sp. 3_1_44]
. . . Parabacteroides distasonis ATCC 8503 .......................................   98 2 hits [CFB group bacteria]     anthranilate synthase component II [Parabacteroides distaso
. . . Bacteroides sp. 2_1_33B ....................................................   98 2 hits [CFB group bacteria]     anthranilate synthase component II [Parabacteroides distaso
. . . Veillonella sp. 6_1_27 .....................................................   98 2 hits [firmicutes]             anthranilate synthase component II [Veillonella sp. 6_1_27]
. . . Desulfotomaculum acetoxidans DSM 771 .......................................   98 2 hits [firmicutes]             glutamine amidotransferase of anthranilate synthase [Desulf
. . . Staphylococcus aureus subsp. aureus H19 ....................................   98 2 hits [firmicutes]             para-aminobenzoate synthetase component II [Staphylococcus 
. . . Hydrogenobacter thermophilus TK-6 ..........................................   98 2 hits [aquificales]            anthranilate synthase component II [Hydrogenobacter thermop
. . . Staphylococcus aureus subsp. aureus Mu50 ...................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus subsp. aureus N315 ...................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus subsp. aureus COL ....................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus subsp. aureus USA300_FPR3757 .........................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus subsp. aureus NCTC 8325 ..............................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus subsp. aureus JH9 ....................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus subsp. aureus JH1 ....................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus subsp. aureus str. Newman ............................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus subsp. aureus Mu3 ....................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus subsp. aureus USA300_TCH1516 .........................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus subsp. aureus str. JKD6008 ...........................   98 1 hit  [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus subsp. aureus str. JKD6009 ...........................   98 1 hit  [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus subsp. aureus str. CF-Marseille ......................   98 1 hit  [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus subsp. aureus USA300_TCH959 ..........................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus subsp. aureus TCH130 .................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus subsp. aureus Mu50-omega .............................   98 1 hit  [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus A9781 ................................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus A9763 ................................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus A9719 ................................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus A9299 ................................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus A8115 ................................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus A6300 ................................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus A6224 ................................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus A5948 ................................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus A5937 ................................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus D30 ..................................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus 930918-3 .............................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus subsp. aureus ED98 ...................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus A8117 ................................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus A9765 ................................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus A10102 ...............................................   98 2 hits [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus subsp. aureus 132 ....................................   98 1 hit  [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus subsp. aureus TW20 ...................................   98 1 hit  [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus 04-02981 .............................................   98 1 hit  [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Staphylococcus aureus A9754 ................................................   98 1 hit  [firmicutes]             para-aminobenzoate synthase component II [Staphylococcus au
. . . Parachlamydia acanthamoebae str. Hall's coccus .............................   98 2 hits [chlamydias]             hypothetical protein pah_c178o039 [Parachlamydia acanthamoe
. . . Staphylococcus aureus A9635 ................................................   98 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Gramella forsetii KT0803 ...................................................   98 2 hits [CFB group bacteria]     anthranilate synthase component II [Gramella forsetii KT080
. . . Carboxydibrachium pacificum DSM 12653 ......................................   98 2 hits [firmicutes]             class I glutamine amidotransferase, putative [Carboxydibrac
. . . Blattabacterium sp. (Periplaneta americana) str. BPLAN .....................   98 2 hits [CFB group bacteria]     anthranilate synthase component II [Blattabacterium sp. (Pe
. . . Saccharomonospora viridis DSM 43017 ........................................   98 2 hits [high GC Gram+]          anthranilate synthase, component II [Saccharomonospora viri
. . . Dictyoglomus thermophilum H-6-12 ...........................................   98 2 hits [bacteria]               para-aminobenzoate synthase glutamine amidotransferase comp
. . . Chlorobium phaeobacteroides DSM 266 ........................................   97 2 hits [green sulfur bacteria]  anthranilate synthase component II [Chlorobium phaeobactero
. . . Staphylococcus aureus subsp. aureus 55/2053 ................................   97 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus 65-1322 ................................   97 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus 68-397 .................................   97 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus E1410 ..................................   97 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus M876 ...................................   97 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus M899 ...................................   97 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus C101 ...................................   97 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus 58-424 .................................   97 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus M809 ...................................   97 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus M1015 ..................................   97 2 hits [firmicutes]             glutamine amidotransferase class-I protein [Staphylococcus 
. . . Veillonella parvula ATCC 17745 .............................................   97 2 hits [firmicutes]             glutamine amidotransferase, class I [Veillonella parvula AT
. . . Leptospirillum ferrodiazotrophum ...........................................   97 1 hit  [bacteria]               Anthranilate synthase component II [Leptospirillum ferrodia
. . . Ruminococcus flavefaciens FD-1 .............................................   97 1 hit  [firmicutes]             anthranilate/para-aminobenzoate synthase component II, TrpG
. . . Listeria monocytogenes FSL N1-017 ..........................................   97 1 hit  [firmicutes]             para-aminobenzoate synthase glutamine amidotransferase comp
. . . Listeria monocytogenes FSL J2-071 ..........................................   97 2 hits [firmicutes]             para-aminobenzoate synthase glutamine amidotransferase comp
. . . Thermoanaerobacter mathranii subsp. mathranii str. A3 ......................   97 2 hits [firmicutes]             glutamine amidotransferase of anthranilate synthase [Thermo
. . . Mitsuokella multacida DSM 20544 ............................................   97 2 hits [firmicutes]             aspartate 1-decarboxylase [Mitsuokella multacida DSM 20544]
. . . Parabacteroides sp. D13 ....................................................   97 2 hits [CFB group bacteria]     anthranilate synthase component II [Parabacteroides sp. D13
. . . Bacteroides pectinophilus ATCC 43243 .......................................   97 2 hits [CFB group bacteria]     hypothetical protein BACPEC_00601 [Bacteroides pectinophilu
. . . Corynebacterium glucuronolyticum ATCC 51867 ................................   97 2 hits [high GC Gram+]          anthranilate synthase component II [Corynebacterium glucuro
. . . Symbiobacterium thermophilum IAM 14863 .....................................   97 2 hits [firmicutes]             anthranilate synthetase component II [Symbiobacterium therm
. . . Rhodopirellula baltica SH 1 ................................................   97 2 hits [planctomycetes]         anthranilate synthase component II (glutamine amido-transfe
. . Ricinus communis -------------------------------------------------------------  117 2 hits [eudicots]               Anthranilate synthase component II, putative [Ricinus commu
. . Methanocorpusculum labreanum Z ...............................................  102 2 hits [euryarchaeotes]         anthranilate synthase, component II [Methanocorpusculum lab
. . Gracilaria tenuistipitata var. liui ..........................................  100 2 hits [red algae]              anthranilate synthase component 2 [Gracilaria tenuistipitat
. . Methanospirillum hungatei JF-1 ...............................................   98 2 hits [euryarchaeotes]         glutamine amidotransferase of anthranilate synthase or para
. . Phytophthora infestans T30-4 .................................................   98 1 hit  [oomycetes]              anthranilate synthase component 2, putative [Phytophthora i
. synthetic construct ------------------------------------------------------------  104 1 hit  [other sequences]        anthranilate synthase component II [Francisella tularensis 

BLAST

PROTOCOL


1)BLASTp vs NR, default NCBI parameters * "1000 max target sequences"



RESULTS ANALYSIS


Analyzing the results obtained in blastp, can be observed low e-values between 4e-67 and 3e-25. It may also be noted that the fourth to the fifth hit is a very big leap up on the values of e-value (from 7e-63 to 2e-29), which leads to want that our sequence is homologous with the first 4 hits corresponding to a Glutamine amidotransferase. If we look at the percentages of identity between the first 4 sequences and our sequence we get values in the order of 71% to 73%, while the for other hits the identity drops to 35-39%. With these values we can, very probably, assumed that we are indeed in the presence of a Glutamine amidotransferase. Comparing the results with the results of protein domain there has been a strong homology of our protein sequence metagenomics with the first 4 hits lineage report. May well indicate that there is great possibility of our having a protein catalytic activity, this activity which involves the removal of an ammonia group from one molecule of glutamate and ammonia that subsequently transferred to a specific substrate, this will create a new group carbon-nitrogen in susbtracto.

In accordance with the results obtained in blastp and the lineage, we choose the sequences with higher homology with the sequence our ingroups (a-proteobacteria), and as outgroups chosen organisms from the class of b-proteobacteria, g-proteobacteria and-proteobacteria and d-proteobacteria.



In Groups: a-proteobacteria


|ref|ZP_05068906.1| Candidatus Pelagibacter sp. HTCC7211 4e-67

|ref|ZP_01264011.1| Candidatus Pelagibacter ubique HTCC1002 4e-64

|ref|YP_266252.1| Candidatus Pelagibacter ubique HTCC1062 1e-63

|ref|ZP_06055055.1| alpha proteobacterium HIMB114 3e-22

|gb|AAG61066.1| Bradyrhizobium japonicum 5e-20

|ref|YP_002362689.1| Methylocella silvestris BL2 9e-20

|ref|YP_002965196.1| Methylobacterium extorquens AM1 2e-19

|ref|ZP_05085457.1| Pseudovibrio sp. JE062 2e-19

|ref|YP_760493.1| Hyphomonas neptunium ATCC 15444 5e-19


Out Groups: b-proteobacteria, g-proteobacteria, e-proteobacteria, d-proteobacteria


|ref|YP_003255587.1| Aggregatibacter actinomycetemcomitans D11S-1 6e-24 [g-proteobacteria]

|ref|YP_003516546.1| Helicobacter mustelae 12198 1e-22 [e-proteobacteria]

|ref|ZP_04577625.1| Oxalobacter formigenes HOxBLS 5e-20 [b-proteobacteria]

|ref|YP_002266841.1| Helicobacter pylori G27 8e-20 [e-proteobacteria]

|ref|YP_003022068.1| Geobacter sp. M21 8e-20 [d-proteobacteria]






RAW RESULTS

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_05068906.1|  anthranilate synthase component II (Glutam...   257    4e-67
ref|ZP_01264011.1|  Anthranilate synthase component II (Glutam...   248    4e-64
ref|YP_266252.1|  anthranilate synthase component II (glutamin...   246    1e-63
ref|ZP_01255979.1|  Anthranilate synthase component II (Glutam...   243    7e-63
ref|NP_267625.1|  anthranilate synthase component II [Lactococ...   132    2e-29
ref|YP_003354001.1|  Anthranilate synthase component II [Lacto...   131    3e-29
ref|YP_001032349.1|  anthranilate synthase component II [Lacto...   128    3e-28
ref|YP_809487.1|  anthranilate synthase component II [Lactococ...   128    4e-28
ref|ZP_03991894.1|  anthranilate synthase component II [Oribac...   122    3e-26
ref|ZP_02919820.1|  hypothetical protein STRINF_00672 [Strepto...   121    5e-26
ref|YP_001181004.1|  glutamine amidotransferase of anthranilat...   119    1e-25
ref|YP_001129185.1|  anthranilate synthase component II [Strep...   119    3e-25
ref|XP_002535476.1|  Anthranilate synthase component II, putat...   117    6e-25
ref|NP_665517.1|  anthranilate synthase component II [Streptoc...   117    7e-25
ref|NP_269955.1|  anthranilate synthase component II [Streptoc...   117    1e-24
ref|YP_599375.1|  anthranilate synthase component II [Streptoc...   117    1e-24
ref|ZP_06060525.1|  anthranilate synthase component II [Strept...   116    1e-24
ref|YP_002286603.1|  Anthranilate synthase, amidotransferase-l...   116    1e-24
ref|YP_281148.1|  anthranilate synthase component II [Streptoc...   116    1e-24
ref|NP_608031.1|  anthranilate synthase component II [Streptoc...   116    2e-24
ref|YP_002124135.1|  anthranilate synthase component II [Strep...   116    2e-24
ref|YP_001034622.1|  anthranilate synthase component II [Strep...   115    2e-24
ref|YP_302097.1|  glutamine amidotransferase class-I protein [...   115    3e-24
ref|YP_002747247.1|  anthranilate synthase component II [Strep...   114    4e-24
ref|YP_001568252.1|  glutamine amidotransferase of anthranilat...   114    5e-24
ref|YP_002745300.1|  anthranilate synthase component II [Strep...   114    5e-24
ref|YP_003255587.1|  para-aminobenzoate synthase glutamine ami...   114    6e-24
ref|YP_603284.1|  anthranilate synthase component II [Streptoc...   114    7e-24
ref|YP_001449961.1|  anthranilate synthase component II [Strep...   114    8e-24
ref|YP_597434.1|  anthranilate synthase component II [Streptoc...   113    1e-23
ref|ZP_04409822.1|  anthranilate synthase amidotransferase com...   113    1e-23
ref|ZP_04962773.1|  anthranilate synthase component II [Vibrio...   113    1e-23
ref|ZP_04415190.1|  anthranilate synthase amidotransferase com...   113    1e-23
ref|ZP_06033181.1|  anthranilate synthase amidotransferase com...   113    1e-23
ref|ZP_03938162.1|  anthranilate synthase component II [Lactob...   113    1e-23
ref|ZP_01979348.1|  anthranilate synthase component II [Vibrio...   113    1e-23
ref|YP_002573562.1|  glutamine amidotransferase of anthranilat...   112    2e-23
emb|CAJ73848.1|  strongly similar to anthranilate synthase com...   112    2e-23
ref|ZP_04671915.1|  anthranilate synthase [Clostridiales bacte...   112    2e-23
ref|YP_003430017.1|  para-aminobenzoate synthase glutamine ami...   112    2e-23
ref|ZP_04419129.1|  anthranilate synthase amidotransferase com...   112    2e-23
ref|NP_720970.1|  anthranilate synthase component II [Streptoc...   112    2e-23
ref|ZP_06039471.1|  anthranilate synthase amidotransferase com...   112    2e-23
ref|ZP_04405014.1|  anthranilate synthase amidotransferase com...   112    2e-23
ref|ZP_05716692.1|  anthranilate synthase component II [Vibrio...   112    2e-23
ref|YP_001560933.1|  glutamine amidotransferase of anthranilat...   112    2e-23
ref|ZP_05920023.1|  anthranilate synthase component II [Pasteu...   112    3e-23
ref|NP_246402.1|  para-aminobenzoate synthase component II [Pa...   112    3e-23
gb|ABA12608.1|  anthranilate synthetase small subunit [Buchner...   112    3e-23
ref|ZP_06079030.1|  anthranilate synthase amidotransferase com...   111    4e-23
ref|ZP_02957790.1|  anthranilate synthase component II [Vibrio...   111    4e-23
ref|YP_002995947.1|  anthranilate synthase component II [Strep...   111    4e-23
ref|ZP_06049808.1|  anthranilate synthase amidotransferase com...   111    4e-23
ref|YP_329195.1|  anthranilate synthase component II [Streptoc...   111    4e-23
ref|NP_687492.1|  anthranilate synthase component II [Streptoc...   111    4e-23
ref|YP_003485356.1|  putative anthranilate synthase subunit be...   111    4e-23
ref|NP_230818.1|  anthranilate synthase component II [Vibrio c...   111    5e-23
ref|ZP_01856206.1|  para-aminobenzoate/anthranilate synthase g...   111    5e-23
ref|ZP_05419532.1|  anthranilate synthase amidotransferase com...   111    5e-23
ref|ZP_03941187.1|  anthranilate synthase component II [Lactob...   110    7e-23
ref|ZP_00787770.1|  anthranilate synthase component II [Strept...   110    7e-23
ref|ZP_03953373.1|  anthranilate synthase component II [Lactob...   110    7e-23
ref|YP_140010.1|  anthranilate synthase component II [Streptoc...   110    7e-23
ref|ZP_01982301.1|  anthranilate synthase component II [Vibrio...   110    7e-23
ref|ZP_01949961.1|  anthranilate synthase component II [Vibrio...   110    8e-23
ref|ZP_04061918.1|  para-aminobenzoate/anthranilate synthase g...   110    8e-23
ref|ZP_05924959.1|  anthranilate synthase amidotransferase com...   110    8e-23
ref|ZP_05721241.1|  anthranilate synthase component II [Vibrio...   110    9e-23
ref|YP_455081.1|  anthranilate synthase component II [Sodalis ...   110    1e-22
ref|NP_809444.1|  anthranilate synthase component II [Bacteroi...   110    1e-22
ref|YP_003516546.1|  para-aminobenzoate synthase glutamine ami...   110    1e-22
ref|YP_820901.1|  anthranilate synthase component II [Streptoc...   110    1e-22
ref|ZP_06636541.1|  para-aminobenzoate synthase glutamine amid...   109    1e-22
ref|NP_734974.1|  anthranilate synthase component II [Streptoc...   109    2e-22
ref|YP_003445660.1|  anthranilate synthase component II (gluta...   109    2e-22
ref|ZP_05266793.1|  class I glutamine amidotransferase [Lister...   109    2e-22
ref|ZP_02389185.1|  anthranilate synthase component II [Burkho...   109    2e-22
ref|ZP_03945849.1|  anthranilate synthase component II [Atopob...   109    2e-22
ref|ZP_06242825.1|  glutamine amidotransferase of anthranilate...   108    2e-22
ref|ZP_01958835.1|  hypothetical protein BACCAC_00422 [Bactero...   108    3e-22
ref|ZP_03226012.1|  anthranilate synthase component II [Bacill...   108    3e-22
ref|ZP_06055055.1|  para-aminobenzoate/anthranilate synthase g...   108    3e-22
ref|YP_003121520.1|  glutamine amidotransferase of anthranilat...   108    3e-22
ref|YP_003520362.1|  TrpD [Pantoea ananatis LMG 20103] >gb|ADD...   108    3e-22
ref|ZP_01220192.1|  anthranilate synthase component II [Photob...   108    3e-22
ref|ZP_03612179.1|  anthranilate phosphoribosyltransferase [Ac...   108    4e-22
ref|YP_443417.1|  anthranilate synthase component II [Burkhold...   108    4e-22
ref|ZP_05729315.1|  glutamine amidotransferase of anthranilate...   108    4e-22
ref|YP_001060562.1|  anthranilate synthase component II [Burkh...   108    4e-22
ref|ZP_05645383.1|  anthranilate synthase component II [Entero...   108    4e-22
ref|ZP_06199323.1|  anthranilate synthase component II [Strept...   108    4e-22
ref|NP_778122.1|  anthranilate synthase component II [Buchnera...   108    4e-22
ref|YP_001652184.1|  anthranilate synthase component II [Actin...   108    5e-22
ref|ZP_06053892.1|  anthranilate synthase amidotransferase com...   107    5e-22
ref|YP_001969016.1|  anthranilate synthase component II [Actin...   107    6e-22
ref|ZP_05990546.1|  anthranilate synthase subunit II [Mannheim...   107    6e-22
ref|NP_872982.1|  para-aminobenzoate synthase component II [Ha...   107    6e-22
ref|ZP_06612676.1|  nthranilate synthase component II TrpG [St...   107    7e-22
ref|YP_003503901.1|  glutamine amidotransferase of anthranilat...   107    7e-22
ref|YP_002309063.1|  anthranilate synthase component II [Candi...   107    7e-22
ref|YP_105300.1|  anthranilate synthase component II [Burkhold...   107    8e-22
ref|ZP_04977890.1|  anthranilate synthase subunit II [Mannheim...   107    8e-22
ref|ZP_02464892.1|  anthranilate synthase component II [Burkho...   106    1e-21
ref|ZP_04989719.1|  hypothetical protein FTDG_00401 [Francisel...   106    1e-21
ref|YP_002731328.1|  para-aminobenzoate synthase glutamine ami...   106    1e-21
ref|YP_254100.1|  hypothetical protein SH2185 [Staphylococcus ...   106    1e-21
ref|ZP_01822814.1|  anthranilate synthase component II [Strept...   106    1e-21
ref|ZP_03703064.1|  glutamine amidotransferase of anthranilate...   106    1e-21
ref|ZP_00134154.1|  COG0512: Anthranilate/para-aminobenzoate s...   106    1e-21
ref|ZP_05761756.1|  anthranilate synthase component II [Bacter...   106    1e-21
ref|ZP_04752891.1|  anthranilate synthase component II [Actino...   106    1e-21
ref|ZP_02692441.1|  glutamine amidotransferase of anthranilate...   106    1e-21
ref|YP_001597933.1|  anthranilate synthase component II [Candi...   106    1e-21
ref|YP_002126579.1|  glutamine amido-transferase [Alteromonas ...   106    1e-21
ref|NP_346249.1|  anthranilate synthase component II [Streptoc...   106    1e-21
ref|ZP_06392115.1|  glutamine amidotransferase of anthranilate...   106    1e-21
ref|YP_001699243.1|  anthranilate synthase component II [Lysin...   106    1e-21
ref|ZP_01820938.1|  anthranilate synthase component II [Strept...   106    1e-21
ref|ZP_02066780.1|  hypothetical protein BACOVA_03781 [Bactero...   106    2e-21
ref|ZP_02891453.1|  glutamine amidotransferase of anthranilate...   106    2e-21
ref|ZP_03680647.1|  hypothetical protein BACCELL_05021 [Bacter...   106    2e-21
ref|YP_002038416.1|  anthranilate synthase component II [Strep...   106    2e-21
ref|ZP_04549861.1|  anthranilate synthase component II [Bacter...   106    2e-21
ref|YP_898465.1|  anthranilate synthase component II [Francise...   106    2e-21
ref|YP_003108518.1|  anthranilate synthase component II [Candi...   106    2e-21
ref|YP_002910340.1|  Anthranilate synthase component II [Burkh...   106    2e-21
ref|YP_089386.1|  para-aminobenzoate synthase component II [Ma...   106    2e-21
ref|ZP_04988265.1|  anthranilate synthase component II [Franci...   106    2e-21
ref|ZP_01790727.1|  para-aminobenzoate synthase component II [...   106    2e-21
ref|YP_718334.1|  para-aminobenzoate synthase component II [Ha...   105    2e-21
ref|YP_130671.1|  anthranilate synthase component II [Photobac...   105    2e-21
ref|ZP_00349490.1|  COG0512: Anthranilate/para-aminobenzoate s...   105    2e-21
ref|YP_002534090.1|  Anthranilate synthase component II [Therm...   105    2e-21
ref|ZP_04465010.1|  para-aminobenzoate synthase component II [...   105    2e-21
ref|ZP_02434253.1|  hypothetical protein BACSTE_00478 [Bactero...   105    2e-21
ref|YP_001581042.1|  anthranilate synthase component II [Burkh...   105    2e-21
ref|ZP_05629317.1|  putative anthranilate synthase component I...   105    2e-21
gb|ACF20458.1|  anthranilate synthase small subunit [Buchnera ...   105    2e-21
ref|ZP_06640210.1|  anthranilate synthase component II TrpG [S...   105    2e-21
ref|ZP_02907184.1|  glutamine amidotransferase of anthranilate...   105    3e-21
ref|YP_002603036.1|  TrpG [Desulfobacterium autotrophicum HRM2...   105    3e-21
ref|ZP_01252153.1|  anthranilate synthase component II [Psychr...   105    3e-21
ref|ZP_03459030.1|  hypothetical protein BACEGG_01814 [Bactero...   105    3e-21
ref|ZP_03246555.1|  class I glutamine amidotransferase, putati...   105    3e-21
ref|YP_001293078.1|  putative anthranilate synthase component ...   105    3e-21
ref|YP_818641.1|  anthranilate synthase, component II [Leucono...   105    3e-21
ref|ZP_06218633.1|  glutamine amidotransferase of anthranilate...   105    3e-21
ref|ZP_04752676.1|  para-aminobenzoate synthase component II [...   105    3e-21
ref|ZP_05415165.1|  anthranilate synthase component II [Bacter...   105    3e-21
ref|ZP_05655015.1|  class-I glutamine amidotransferase [Entero...   105    3e-21
ref|YP_772331.1|  anthranilate synthase component II [Burkhold...   105    3e-21
ref|YP_002521359.1|  para-aminobenzoate synthase glutamine ami...   105    3e-21
ref|ZP_03913627.1|  anthranilate synthase, component II [Leuco...   105    3e-21
ref|YP_001930400.1|  glutamine amidotransferase of anthranilat...   105    3e-21
ref|ZP_04584220.1|  para-aminobenzoate/anthranilate synthase g...   105    3e-21
ref|YP_002229564.1|  anthranilate synthase component II [Burkh...   105    3e-21
ref|YP_248831.1|  para-aminobenzoate synthase component II [Ha...   105    4e-21
ref|YP_002476416.1|  anthranilate synthase component II [Haemo...   105    4e-21
ref|ZP_06400331.1|  glutamine amidotransferase of anthranilate...   105    4e-21
ref|YP_001121826.1|  anthranilate synthase component II [Franc...   105    4e-21
ref|ZP_04544075.1|  anthranilate synthase component II [Bacter...   105    4e-21
ref|YP_003040890.1|  anthranilate synthase component ii (gluta...   105    4e-21
ref|YP_001118357.1|  anthranilate synthase component II [Burkh...   105    4e-21
ref|ZP_06725029.1|  glutamine amidotransferase, class I [Bacte...   105    4e-21
ref|ZP_03728565.1|  glutamine amidotransferase of anthranilate...   105    4e-21
ref|YP_622444.1|  anthranilate synthase component II [Burkhold...   105    4e-21
ref|ZP_01160552.1|  anthranilate synthase component II [Photob...   105    4e-21
ref|YP_001445940.1|  anthranilate synthase component II [Vibri...   105    4e-21
ref|ZP_03014325.1|  hypothetical protein BACINT_01898 [Bactero...   104    4e-21
ref|ZP_03209691.1|  hypothetical protein BACPLE_03368 [Bactero...   104    4e-21
ref|YP_001301313.1|  anthranilate synthase component II [Bacte...   104    4e-21
ref|YP_002511714.1|  anthranilate synthase component II [Strep...   104    4e-21
ref|ZP_05081882.1|  anthranilate synthase component II [beta p...   104    4e-21
ref|ZP_01262578.1|  anthranilate synthase component II [Vibrio...   104    4e-21
ref|ZP_02357141.1|  anthranilate synthase component II [Burkho...   104    4e-21
ref|YP_356160.1|  anthranilate synthase component II [Pelobact...   104    5e-21
ref|ZP_02477988.1|  glutamine amidotransferase of anthranilate...   104    5e-21
ref|NP_798336.1|  anthranilate synthase component II [Vibrio p...   104    5e-21
ref|NP_929700.1|  anthranilate synthase component II (glutamin...   104    5e-21
ref|YP_001785329.1|  glutamine amidotransferase of anthranilat...   104    5e-21
ref|ZP_05945809.1|  anthranilate synthase amidotransferase com...   104    5e-21
emb|CBK74294.1|  anthranilate synthase, component II [Butyrivi...   104    5e-21
ref|ZP_06174017.1|  anthranilate synthase component II [Vibrio...   104    5e-21
ref|ZP_03299381.1|  hypothetical protein BACDOR_00744 [Bactero...   104    5e-21
ref|ZP_03012066.1|  hypothetical protein BACCOP_03998 [Bactero...   104    6e-21
emb|CAA09997.1|  anthranilate synthase [Buchnera aphidicola] >...   104    6e-21
ref|NP_439329.1|  para-aminobenzoate synthase component II [Ha...   104    6e-21
ref|YP_871780.1|  anthranilate synthase, component II [Acidoth...   104    6e-21
ref|YP_003007150.1|  para-aminobenzoate synthase glutamine ami...   104    6e-21
ref|ZP_01786991.1|  para-aminobenzoate synthase component II [...   104    6e-21
ref|YP_002736767.1|  para-aminobenzoate/anthranilate synthase ...   104    6e-21
ref|ZP_02030549.1|  hypothetical protein PARMER_00520 [Parabac...   104    6e-21
ref|ZP_02478620.1|  putative anthranilate synthase component I...   104    6e-21
ref|ZP_02708297.1|  para-aminobenzoate/anthranilate synthase g...   104    6e-21
ref|ZP_00157009.2|  COG0512: Anthranilate/para-aminobenzoate s...   104    6e-21
ref|ZP_02380001.1|  anthranilate synthase component II [Burkho...   104    7e-21
ref|ZP_06190391.1|  glutamine amidotransferase of anthranilate...   104    7e-21
ref|ZP_01783653.1|  para-aminobenzoate synthase component II [...   104    7e-21
ref|ZP_02716012.1|  para-aminobenzoate synthase glutamine amid...   104    7e-21
ref|YP_169939.1|  anthranilate synthase component II [Francise...   104    7e-21
ref|ZP_04985451.1|  anthranilate synthase component II [Franci...   103    7e-21
ref|YP_367865.1|  anthranilate synthase component II [Burkhold...   103    7e-21
ref|YP_002759407.1|  glutamine amidotransferase [Listeria mono...   103    7e-21
ref|ZP_05264338.1|  glutamine amidotransferase [Listeria monoc...   103    8e-21
ref|ZP_01203207.1|  anthranilate/para-aminobenzoate synthetase...   103    8e-21
ref|YP_277934.1|  anthranilate synthase component II [Candidat...   103    8e-21
emb|CBL15003.1|  anthranilate synthase, component II [Ruminoco...   103    8e-21
ref|ZP_03612888.1|  para-aminobenzoate synthase glutamine amid...   103    8e-21
ref|ZP_05103092.1|  class I glutamine amidotransferase, putati...   103    9e-21
ref|ZP_05885000.1|  anthranilate synthase amidotransferase com...   103    9e-21
ref|ZP_02206404.1|  hypothetical protein COPEUT_01173 [Coproco...   103    9e-21
pdb|1I7Q|B  Chain B, Anthranilate Synthase From S. Marcescens ...   103    9e-21
ref|ZP_05394315.1|  glutamine amidotransferase of anthranilate...   103    1e-20
ref|YP_593199.1|  anthranilate synthase, component II [Candida...   103    1e-20
ref|ZP_06155664.1|  anthranilate synthase amidotransferase com...   103    1e-20
ref|ZP_00233165.1|  glutamine amidotransferase, class I [Liste...   103    1e-20
ref|YP_002475726.1|  para-aminobenzoate synthase component II ...   103    1e-20
ref|ZP_04714977.1|  glutamine amido-transferase [Alteromonas m...   103    1e-20
ref|ZP_00239857.1|  anthranilate synthase, component II [Bacil...   103    1e-20
ref|ZP_05365165.1|  anthranilate synthase component 2 [Coryneb...   103    1e-20
ref|YP_001472545.1|  glutamine amidotransferase of anthranilat...   103    1e-20
ref|YP_003531274.1|  Glutamine amidotransferase of anthranilat...   103    1e-20
ref|ZP_06559604.1|  glutamine amidotransferase, class I [Megas...   103    1e-20
sp|P00900.2|TRPG_SERMA  RecName: Full=Anthranilate synthase co...   103    1e-20
ref|YP_001956061.1|  anthranilate synthase glutamine amidotran...   103    1e-20
ref|ZP_01720218.1|  anthranilate synthase component II [Algori...   103    1e-20
ref|ZP_05877674.1|  anthranilate synthase amidotransferase com...   103    1e-20
ref|ZP_04923887.1|  class I glutamine amidotransferase, putati...   103    1e-20
ref|ZP_04844513.1|  anthranilate synthase component II [Bacter...   103    1e-20
ref|ZP_01788830.1|  para-aminobenzoate synthase component II [...   103    1e-20
ref|YP_212293.1|  glutamine amidotransferase [Bacteroides frag...   103    1e-20
ref|YP_002761140.1|  anthranilate synthase component II [Gemma...   103    1e-20
ref|YP_001663484.1|  glutamine amidotransferase of anthranilat...   103    1e-20
ref|YP_064613.1|  para-aminobenzoate/anthranilate synthase glu...   103    1e-20
ref|ZP_00230159.1|  glutamine amidotransferase, class I [Liste...   103    1e-20
ref|YP_003550559.1|  Glutamine amidotransferase of anthranilat...   102    2e-20
ref|ZP_04946674.1|  Anthranilate/para-aminobenzoate synthases ...   102    2e-20
ref|YP_001308878.1|  glutamine amidotransferase of anthranilat...   102    2e-20
ref|ZP_01896560.1|  anthranilate phosphoribosyltransferase [Mo...   102    2e-20
ref|NP_466271.1|  hypothetical protein lmo2749 [Listeria monoc...   102    2e-20
ref|ZP_00743284.1|  Anthranilate synthase component II  / Para...   102    2e-20
ref|ZP_01853596.1|  para-aminobenzoate synthase component II [...   102    2e-20
ref|ZP_03920743.1|  anthranilate synthase component II [Coryne...   102    2e-20
ref|YP_015324.1|  glutamine amidotransferase, class I [Listeri...   102    2e-20
ref|YP_099936.1|  anthranilate synthase component II [Bacteroi...   102    2e-20
ref|YP_003472336.1|  Para-aminobenzoate synthase, amidotransfe...   102    2e-20
ref|YP_002311267.1|  Glutamine amidotransferase of anthranilat...   102    2e-20
ref|YP_003248234.1|  anthranilate phosphoribosyltransferase [F...   102    2e-20
ref|YP_928005.1|  anthranilate synthase component II [Shewanel...   102    2e-20
ref|ZP_05281743.1|  glutamine amidotransferase [Bacteroides fr...   102    2e-20
ref|YP_003163730.1|  anthranilate phosphoribosyltransferase [L...   102    2e-20
ref|ZP_02196914.1|  anthranilate synthase component II [Vibrio...   102    2e-20
ref|YP_001030831.1|  anthranilate synthase, component II [Meth...   102    2e-20
ref|YP_001440388.1|  hypothetical protein ESA_04373 [Cronobact...   102    2e-20
ref|YP_002648681.1|  Putative Anthranilate synthase component ...   102    2e-20
ref|YP_001478897.1|  anthranilate synthase component II [Serra...   102    2e-20
ref|ZP_06092860.1|  anthranilate synthase component II protein...   102    2e-20
ref|YP_001960439.1|  glutamine amidotransferase of anthranilat...   102    2e-20
ref|YP_002728205.1|  para-aminobenzoate/anthranilate synthase ...   102    2e-20
ref|YP_850894.1|  glutamine amidotransferase, class I [Listeri...   102    2e-20
ref|YP_003212241.1|  Para-aminobenzoate synthase glutamine ami...   102    2e-20
ref|YP_001891700.1|  para-aminobenzoate synthase component [Fr...   102    2e-20
ref|NP_977678.1|  anthranilate synthase component II [Bacillus...   102    2e-20
ref|YP_445784.1|  para-aminobenzoate/anthranilate synthase glu...   102    2e-20
ref|ZP_05881937.1|  anthranilate synthase amidotransferase com...   102    2e-20
ref|YP_003371235.1|  glutamine amidotransferase of anthranilat...   102    2e-20
ref|ZP_06181113.1|  anthranilate synthase component II [Vibrio...   102    3e-20
ref|ZP_05297225.1|  hypothetical protein LmonocytFSL_01087 [Li...   102    3e-20
ref|YP_001664881.1|  glutamine amidotransferase of anthranilat...   102    3e-20
ref|YP_001907542.1|  anthranilate synthase component II [Erwin...   102    3e-20
ref|YP_001813420.1|  glutamine amidotransferase of anthranilat...   102    3e-20
ref|YP_001998017.1|  glutamine amidotransferase of anthranilat...   102    3e-20
ref|YP_001337400.1|  para-aminobenzoate synthase component II ...   102    3e-20
ref|ZP_04606678.1|  para-aminobenzoate synthase component II [...   102    3e-20
ref|ZP_02182210.1|  anthranilate synthase component II [Flavob...   102    3e-20
ref|YP_374287.1|  anthranilate synthase component II [Chlorobi...   102    3e-20
ref|ZP_06123708.1|  glutamine amido-transferase [Providencia r...   102    3e-20
ref|ZP_03716907.1|  hypothetical protein EUBHAL_01974 [Eubacte...   102    3e-20
ref|YP_003464790.1|  anthranilate synthase, glutamine amidotra...   102    3e-20
ref|ZP_03166960.1|  hypothetical protein RUMLAC_00617 [Ruminoc...   102    3e-20
ref|YP_002138765.1|  glutamine amidotransferase of anthranilat...   101    3e-20
ref|YP_003477247.1|  glutamine amidotransferase of anthranilat...   101    4e-20
ref|YP_002236253.1|  aminodeoxychorismate synthase, component ...   101    4e-20
ref|ZP_01237015.1|  anthranilate synthase component II [Vibrio...   101    4e-20
ref|YP_001006448.1|  anthranilate synthase component II [Yersi...   101    4e-20
ref|ZP_06250739.1|  anthranilate synthase component II [Prevot...   101    4e-20
ref|YP_003465895.1|  glutamine amidotransferase, class l prote...   101    4e-20
ref|NP_472220.1|  hypothetical protein lin2892 [Listeria innoc...   101    4e-20
ref|ZP_03437841.1|  hypothetical protein HPB128_132g43 [Helico...   101    4e-20
ref|NP_993344.1|  anthranilate synthase component II [Yersinia...   101    4e-20
ref|YP_001244379.1|  anthranilate phosphoribosyltransferase [T...   101    5e-20
ref|YP_001675813.1|  glutamine amidotransferase of anthranilat...   101    5e-20
ref|YP_003017583.1|  glutamine amidotransferase of anthranilat...   101    5e-20
ref|ZP_03238736.1|  anthranilate synthase, glutamine amidotran...   101    5e-20
ref|ZP_04577625.1|  anthranilate synthase component II [Oxalob...   101    5e-20
ref|ZP_01107127.1|  anthranilate synthase component II [Flavob...   101    5e-20
gb|AAG61066.1|AF322013_185  ID891 [Bradyrhizobium japonicum]        101    5e-20
ref|YP_001504506.1|  para-aminobenzoate synthase component II ...   101    5e-20
ref|ZP_02948043.1|  para-aminobenzoate/anthranilate synthase g...   101    5e-20
ref|YP_513935.1|  anthranilate synthase component II [Francise...   101    6e-20
emb|CAA52203.1|  anthranilate synthase component II and anthra...   101    6e-20
ref|YP_204415.1|  anthranilate synthase component II [Vibrio f...   101    6e-20
ref|YP_001644022.1|  anthranilate synthase component II [Bacil...   100    6e-20
ref|ZP_06421474.1|  aspartate 1-decarboxylase [Prevotella sp. ...   100    6e-20
ref|ZP_04818520.1|  aminodeoxychorismate synthase [Staphylococ...   100    6e-20
ref|NP_227956.1|  anthranilate synthase component II [Thermoto...   100    6e-20
ref|ZP_02074241.1|  hypothetical protein CLOL250_01007 [Clostr...   100    6e-20
ref|YP_003574763.1|  anthranilate synthase subunit II [Prevote...   100    6e-20
ref|YP_003259682.1|  glutamine amidotransferase of anthranilat...   100    6e-20
ref|ZP_03475297.1|  hypothetical protein PRABACTJOHN_00956 [Pa...   100    6e-20
ref|YP_001738842.1|  anthranilate phosphoribosyltransferase [T...   100    6e-20
ref|ZP_03439031.1|  hypothetical protein HP9810_899g39 [Helico...   100    7e-20
ref|ZP_02392800.1|  anthranilate synthase, glutamine amidotran...   100    7e-20
ref|YP_001423534.1|  anthranilate synthase component II [Coxie...   100    7e-20
ref|NP_820848.1|  anthranilate synthase component II [Coxiella...   100    7e-20
ref|YP_893960.1|  anthranilate synthase component II [Bacillus...   100    7e-20
ref|ZP_05337106.1|  glutamine amidotransferase of anthranilate...   100    7e-20
ref|ZP_03644568.1|  hypothetical protein BACCOPRO_02958 [Bacte...   100    8e-20
emb|CBL25489.1|  anthranilate synthase, component II [Ruminoco...   100    8e-20
ref|YP_002266841.1|  anthranilate synthasecomponent II. glutam...   100    8e-20
ref|YP_002155835.1|  anthranilate synthase component II [Vibri...   100    8e-20
ref|ZP_05098008.1|  anthranilate synthase component II [Marini...   100    8e-20
ref|YP_003022068.1|  glutamine amidotransferase of anthranilat...   100    8e-20
ref|YP_001969000.1|  putative anthranilate synthase component ...   100    8e-20
ref|YP_267388.1|  anthranilate synthase component II [Colwelli...   100    9e-20
ref|YP_002362689.1|  glutamine amidotransferase of anthranilat...   100    9e-20
ref|NP_208073.1|  anthranilate synthase component II [Helicoba...   100    9e-20
ref|ZP_06211249.1|  glutamine amidotransferase of anthranilate...   100    9e-20
ref|ZP_06551410.1|  para-aminobenzoate synthetase component II...   100    1e-19
ref|ZP_02086947.1|  hypothetical protein CLOBOL_04491 [Clostri...   100    1e-19
ref|YP_050392.1|  anthranilate synthase component II [Pectobac...   100    1e-19
ref|ZP_02731974.1|  anthranilate synthase, component II [Gemma...   100    1e-19
ref|YP_763728.1|  anthranilate synthase component II [Francise...   100    1e-19
ref|ZP_05108202.1|  anthranilate synthase component II [Polari...   100    1e-19
ref|ZP_02417584.1|  hypothetical protein ANACAC_00148 [Anaeros...   100    1e-19
ref|YP_001156912.1|  para-aminobenzoate synthase component II ...   100    1e-19
ref|ZP_05918360.1|  anthranilate synthase component II [Prevot...   100    1e-19
ref|ZP_03929357.1|  anthranilate synthase component II [Acidam...   100    1e-19
ref|YP_627972.1|  anthranilate synthase component II [Helicoba...   100    1e-19
ref|ZP_06363978.1|  glutamine amidotransferase of anthranilate...   100    1e-19
ref|YP_001910757.1|  anthranilate synthase component II [Helic...   100    1e-19
ref|ZP_03666754.1|  para-aminobenzoate synthase glutamine amid...   100    1e-19
ref|NP_874603.1|  anthranilate/para-aminobenzoate synthase com...   100    1e-19
ref|ZP_06352646.1|  anthranilate phosphoribosyltransferase [Ci...   100    1e-19
ref|YP_082731.1|  anthranilate synthase component II [Bacillus...   100    1e-19
ref|YP_063535.1|  anthranilate synthase component 2 [Gracilari...   100    1e-19
ref|YP_003295586.1|  anthranilate synthase component II [Edwar...   100    1e-19
ref|ZP_02960763.1|  hypothetical protein PROSTU_02731 [Provide...  99.8    1e-19
sp|P06194.1|PABA_KLEAE  RecName: Full=Para-aminobenzoate synth...  99.8    1e-19
ref|YP_002301879.1|  anthranilate synthase component II [Helic...  99.8    1e-19
ref|YP_035473.1|  anthranilate synthase component II [Bacillus...  99.8    1e-19
ref|YP_002559869.1|  hypothetical protein MCCL_0466 [Macrococc...  99.8    1e-19
ref|YP_002769653.1|  para-aminobenzoate/anthranilate synthase ...  99.8    1e-19
ref|ZP_04060031.1|  para-aminobenzoate synthase glutamine amid...  99.8    1e-19
ref|YP_002965196.1|  aminodeoxychorismate synthase subunit II,...  99.8    2e-19
ref|YP_001797084.1|  glutamine amidotransferase of anthranilat...  99.8    2e-19
ref|YP_001503367.1|  glutamine amidotransferase of anthranilat...  99.8    2e-19
ref|ZP_05286256.1|  anthranilate synthase component II [Bacter...  99.8    2e-19
ref|ZP_04978421.1|  anthranilate synthase component II [Mannhe...  99.8    2e-19
ref|YP_003057930.1|  Anthranilate synthase component II (Gluta...  99.8    2e-19
ref|NP_878713.1|  anthranilate synthase component II [Candidat...  99.8    2e-19
ref|YP_001178494.1|  para-aminobenzoate synthase component II ...  99.8    2e-19
dbj|BAE80260.1|  Anthranilate/para-aminobenzoate synthases com...  99.8    2e-19
gb|ACX99764.1|  anthranilate synthase component II [Helicobact...  99.8    2e-19
ref|ZP_01051428.1|  anthranilate synthase component II [Dokdon...  99.8    2e-19
ref|ZP_05311393.1|  glutamine amidotransferase of anthranilate...  99.8    2e-19
ref|YP_002933107.1|  anthranilate synthase component II, putat...  99.8    2e-19
ref|YP_253456.1|  anthranilate synthase component II [Staphylo...  99.8    2e-19
ref|ZP_06546766.1|  bifunctional glutamine amidotransferase/an...  99.8    2e-19
ref|ZP_04428374.1|  glutamine amidotransferase of anthranilate...  99.4    2e-19
ref|NP_843721.1|  anthranilate synthase component II [Bacillus...  99.4    2e-19
ref|YP_003522906.1|  glutamine amidotransferase of anthranilat...  99.4    2e-19
ref|ZP_02866257.1|  hypothetical protein CLOSPI_00034 [Clostri...  99.4    2e-19
ref|ZP_05232002.1|  glutamine amidotransferase [Listeria monoc...  99.4    2e-19
ref|NP_223920.1|  anthranilate synthase component II [Helicoba...  99.4    2e-19
ref|YP_001356121.1|  anthranilate synthase component II [Nitra...  99.4    2e-19
ref|NP_623182.1|  anthranilate/para-aminobenzoate synthase com...  99.4    2e-19
ref|ZP_06232616.1|  glutamine amidotransferase of anthranilate...  99.4    2e-19
ref|YP_001351924.1|  anthranilate synthase component II [Janth...  99.4    2e-19
ref|YP_688787.1|  bifunctional glutamine amidotransferase/anth...  99.4    2e-19
ref|YP_002366024.1|  anthranilate synthase component II [Bacil...  99.4    2e-19
gb|ACX98369.1|  anthranilate synthase component II [Helicobact...  99.4    2e-19
ref|ZP_03849963.1|  anthranilate synthase component II [Chryse...  99.4    2e-19
ref|ZP_04834773.1|  para-aminobenzoate/anthranilate synthase g...  99.4    2e-19
ref|YP_001652167.1|  putative anthranilate synthase component ...  99.4    2e-19
ref|ZP_02156605.1|  para-aminobenzoate synthase glutamine amid...  99.4    2e-19
ref|YP_001437651.1|  bifunctional glutamine amidotransferase/a...  99.4    2e-19
ref|YP_001394665.1|  TrpG [Clostridium kluyveri DSM 555] >ref|...  99.4    2e-19
ref|NP_691447.1|  anthranilate synthase component II [Oceanoba...  99.0    2e-19
ref|ZP_05085457.1|  anthranilate synthase [Pseudovibrio sp. JE...  99.0    2e-19
ref|YP_002885490.1|  glutamine amidotransferase of anthranilat...  99.0    2e-19
ref|YP_002430606.1|  glutamine amidotransferase of anthranilat...  99.0    2e-19
ref|ZP_03229164.1|  anthranilate synthase, glutamine amidotran...  99.0    2e-19
ref|YP_461871.1|  anthranilate synthase component II [Syntroph...  99.0    2e-19
ref|YP_001334919.1|  bifunctional anthranilate synthase/anthra...  99.0    2e-19
ref|NP_761862.1|  anthranilate synthase component II [Vibrio v...  99.0    2e-19
ref|ZP_06016157.1|  anthranilate phosphoribosyltransferase [Kl...  99.0    2e-19
ref|ZP_04600275.1|  hypothetical protein VEIDISOL_01725 [Veill...  99.0    2e-19
ref|YP_001102319.1|  putative p-aminobenzoate synthase glutami...  99.0    2e-19
ref|YP_416156.1|  anthranilate/para-aminobenzoate synthase com...  99.0    3e-19
ref|ZP_04715926.1|  P-aminobenzoate synthetase, component II [...  99.0    3e-19
emb|CBA72973.1|  anthranilate synthase component (glutamine am...  98.6    3e-19
ref|YP_003466355.1|  aminodeoxychorismate synthase subunit II,...  98.6    3e-19
ref|YP_003311127.1|  glutamine amidotransferase of anthranilat...  98.6    3e-19
ref|ZP_00950230.1|  anthranilate synthase component II [Crocei...  98.6    3e-19
ref|YP_003377987.1|  glutamine amidotransferase of anthranilat...  98.6    3e-19
ref|YP_001154932.1|  glutamine amidotransferase of anthranilat...  98.6    3e-19
ref|NP_645492.1|  hypothetical protein MW0675 [Staphylococcus ...  98.6    3e-19
ref|NP_213385.1|  anthranilate synthase component II [Aquifex ...  98.6    3e-19
ref|YP_040193.1|  glutamine amidotransferase class-I protein [...  98.6    3e-19
ref|ZP_06759912.1|  anthranilate synthase component II [Veillo...  98.6    3e-19
ref|YP_001301988.1|  anthranilate synthase component II [Parab...  98.6    3e-19
gb|AAF13811.1|AF130815_3  anthranilate synthase small subunit ...  98.6    3e-19
ref|YP_001092706.1|  glutamine amidotransferase of anthranilat...  98.6    3e-19
emb|CBG34211.1|  anthranilate synthase component II [includes:...  98.6    3e-19
ref|ZP_04060767.1|  para-aminobenzoate/anthranilate synthase g...  98.6    3e-19
ref|YP_503226.1|  glutamine amidotransferase of anthranilate s...  98.6    3e-19
ref|YP_564195.1|  glutamine amidotransferase of anthranilate s...  98.6    3e-19
ref|YP_310786.1|  bifunctional glutamine amidotransferase/anth...  98.6    3e-19
ref|YP_001452912.1|  bifunctional glutamine amidotransferase/a...  98.6    3e-19
ref|ZP_05436893.1|  bifunctional glutamine amidotransferase/an...  98.6    3e-19
ref|YP_002262630.1|  anthranilate synthase component II [Aliiv...  98.6    3e-19
ref|ZP_03067295.1|  anthranilate synthase, component II [Shige...  98.6    3e-19
ref|YP_001858917.1|  glutamine amidotransferase of anthranilat...  98.6    3e-19
ref|ZP_06758339.1|  anthranilate synthase component II [Veillo...  98.6    3e-19
ref|NP_415779.1|  fused glutamine amidotransferase (component ...  98.6    3e-19
ref|YP_002386728.1|  bifunctional glutamine amidotransferase/a...  98.6    3e-19
ref|NP_753632.1|  bifunctional glutamine amidotransferase/anth...  98.6    4e-19
ref|YP_669223.1|  bifunctional glutamine amidotransferase/anth...  98.6    4e-19
ref|ZP_02902805.1|  anthranilate synthase, component II [Esche...  98.6    4e-19
emb|CAA23665.1|  unnamed protein product [Escherichia coli] >e...  98.6    4e-19
ref|YP_408230.1|  bifunctional glutamine amidotransferase/anth...  98.6    4e-19
ref|NP_309862.1|  bifunctional glutamine amidotransferase/anth...  98.6    4e-19
ref|ZP_06657245.1|  anthranilate phosphoribosyltransferase [Es...  98.6    4e-19
ref|NP_707172.1|  bifunctional glutamine amidotransferase/anth...  98.6    4e-19
dbj|BAI54781.1|  anthranilate synthase component II [Escherich...  98.6    4e-19
ref|ZP_04562203.1|  anthranilate synthase component II [Citrob...  98.6    4e-19
ref|YP_002412305.1|  bifunctional glutamine amidotransferase/a...  98.6    4e-19
ref|YP_002328989.1|  bifunctional glutamine amidotransferase/a...  98.2    4e-19
ref|YP_003190424.1|  glutamine amidotransferase of anthranilat...  98.2    4e-19
ref|ZP_06342767.1|  para-aminobenzoate synthetase component II...  98.2    4e-19
ref|NP_287936.1|  bifunctional glutamine amidotransferase/anth...  98.2    4e-19
ref|YP_003365307.1|  anthranilate synthase component II [Citro...  98.2    4e-19
ref|YP_338738.1|  glutamine amidotransferase [Pseudoalteromona...  98.2    4e-19
ref|ZP_05969731.1|  anthranilate synthase, component II [Enter...  98.2    4e-19
ref|ZP_01869855.1|  para-aminobenzoate synthase component II [...  98.2    4e-19
ref|YP_003431744.1|  anthranilate synthase component II [Hydro...  98.2    4e-19
ref|NP_371237.1|  para-aminobenzoate synthase component II [St...  98.2    4e-19
ref|YP_001141254.1|  anthranilate synthase component II [Aerom...  98.2    4e-19
ref|ZP_06300008.1|  hypothetical protein pah_c178o039 [Parachl...  98.2    4e-19
ref|ZP_05686253.1|  glutamine amidotransferase class-I protein...  98.2    4e-19
ref|YP_862692.1|  anthranilate synthase component II [Gramella...  98.2    4e-19
ref|YP_002919052.1|  anthranilate phosphoribosyltransferase [K...  98.2    5e-19
ref|ZP_05091903.1|  class I glutamine amidotransferase, putati...  98.2    5e-19
ref|YP_088342.1|  anthranilate synthase component II [Mannheim...  98.2    5e-19
ref|ZP_06228420.1|  glutamine amidotransferase of anthranilate...  98.2    5e-19
ref|YP_003256990.1|  anthranilate synthase component II [Blatt...  98.2    5e-19
ref|YP_001784636.1|  glutamine amidotransferase of anthranilat...  98.2    5e-19
gb|EEY56306.1|  anthranilate synthase component 2, putative [P...  98.2    5e-19
ref|YP_003131952.1|  anthranilate synthase, component II [Sacc...  98.2    5e-19
ref|YP_002249938.1|  para-aminobenzoate synthase glutamine ami...  98.2    5e-19
ref|YP_002417569.1|  anthranilate synthase component II [Vibri...  98.2    5e-19
ref|YP_760493.1|  anthranilate synthase component II [Hyphomon...  98.2    5e-19
ref|YP_402969.1|  bifunctional glutamine amidotransferase/anth...  98.2    5e-19
ref|ZP_01065357.1|  anthranilate synthase component II [Vibrio...  98.2    5e-19
ref|ZP_02815070.1|  anthranilate synthase, component II [Esche...  97.8    5e-19
ref|ZP_00992962.1|  anthranilate synthase component II [Vibrio...  97.8    5e-19
ref|YP_912473.1|  anthranilate synthase component II [Chlorobi...  97.8    5e-19
ref|ZP_05601259.1|  glutamine amidotransferase class-I protein...  97.8    5e-19
ref|YP_001673882.1|  anthranilate synthase component II [Shewa...  97.8    5e-19
gb|AAA57312.1|  trpD [Salmonella enterica subsp. enterica sero...  97.8    5e-19
ref|ZP_06258748.1|  glutamine amidotransferase, class I [Veill...  97.8    5e-19
gb|EES52403.1|  Anthranilate synthase component II [Leptospiri...  97.8    5e-19
ref|YP_001570275.1|  bifunctional anthranilate synthase/anthra...  97.8    5e-19
ref|ZP_06144011.1|  anthranilate/para-aminobenzoate synthase c...  97.8    5e-19
ref|YP_001311186.1|  glutamine amidotransferase of anthranilat...  97.8    5e-19
ref|YP_928887.1|  para-aminobenzoate synthase glutamine amidot...  97.8    5e-19
ref|ZP_05244164.1|  para-aminobenzoate synthase glutamine amid...  97.8    6e-19
ref|ZP_05378173.1|  glutamine amidotransferase of anthranilate...  97.8    6e-19
ref|ZP_05403270.1|  aspartate 1-decarboxylase [Mitsuokella mul...  97.8    6e-19
ref|NP_460683.1|  bifunctional anthranilate synthase/anthranil...  97.8    6e-19
ref|YP_663884.1|  anthranilate synthase component II [Helicoba...  97.8    6e-19
sp|P00906.2|TRPG_SHIDY  RecName: Full=Anthranilate synthase co...  97.8    6e-19
ref|ZP_05545044.1|  anthranilate synthase component II [Paraba...  97.8    6e-19
ref|ZP_02682028.1|  anthranilate synthase, component II [Salmo...  97.8    6e-19
ref|ZP_02696733.1|  anthranilate synthase, component II [Salmo...  97.8    6e-19
ref|ZP_02655220.1|  anthranilate synthase, component II [Salmo...  97.8    6e-19
ref|YP_002215418.1|  bifunctional glutamine amidotransferase/a...  97.8    6e-19
ref|ZP_01816526.1|  anthranilate synthase component II [Vibrio...  97.8    6e-19
ref|YP_150426.1|  bifunctional glutamine amidotransferase/anth...  97.8    6e-19
ref|ZP_03461544.1|  hypothetical protein BACPEC_00601 [Bactero...  97.8    6e-19
ref|YP_216707.1|  bifunctional glutamine amidotransferase/anth...  97.8    6e-19
ref|ZP_03918005.1|  anthranilate synthase component II [Coryne...  97.8    6e-19
ref|ZP_02662834.1|  anthranilate synthase, component II [Salmo...  97.8    6e-19
ref|YP_075237.1|  anthranilate synthetase component II [Symbio...  97.8    6e-19
gb|AAA27236.1|  glutamine amido/phosphoribosyl anthranilate tr...  97.8    6e-19
ref|NP_867170.1|  anthranilate synthase component II (glutamin...  97.8    6e-19
ref|YP_002040977.1|  bifunctional glutamine amidotransferase/a...  97.8    6e-19
emb|CAA09994.1|  anthranilate synthase small subunit [Buchnera...  97.8    6e-19
ref|YP_003004495.1|  glutamine amidotransferase of anthranilat...  97.8    6e-19
ref|YP_002252200.1|  panthranilate synthase component II (glut...  97.8    6e-19
ref|YP_001641348.1|  glutamine amidotransferase of anthranilat...  97.8    6e-19
ref|ZP_01869150.1|  anthranilate synthase component II [Vibrio...  97.4    7e-19
ref|ZP_06192670.1|  para-aminobenzoate synthase glutamine amid...  97.4    7e-19
ref|ZP_05967898.1|  anthranilate phosphoribosyltransferase [En...  97.4    7e-19
ref|YP_003070322.1|  aminodeoxychorismate synthase subunit II,...  97.4    7e-19
ref|ZP_04857942.1|  conserved hypothetical protein [Ruminococc...  97.4    7e-19
ref|YP_001678519.1|  para-aminobenzoate synthase component II ...  97.4    7e-19
ref|YP_002422979.1|  glutamine amidotransferase of anthranilat...  97.4    7e-19
ref|ZP_02666234.1|  anthranilate synthase, component II [Salmo...  97.4    7e-19
ref|NP_455774.1|  bifunctional glutamine amidotransferase/anth...  97.4    7e-19
ref|ZP_03218921.1|  anthranilate synthase, component II [Salmo...  97.4    7e-19
ref|YP_003199501.1|  glutamine amidotransferase of anthranilat...  97.4    7e-19
ref|YP_001176931.1|  bifunctional glutamine amidotransferase/a...  97.4    7e-19
ref|ZP_00944519.1|  Anthranilate synthase component II / Para-...  97.4    7e-19
ref|YP_002987545.1|  glutamine amidotransferase of anthranilat...  97.4    8e-19
ref|ZP_03805775.1|  hypothetical protein PROPEN_04170 [Proteus...  97.4    8e-19
ref|ZP_05119176.1|  anthranilate synthase component II (Glutam...  97.4    8e-19
ref|YP_002351731.1|  para-aminobenzoate synthase glutamine ami...  97.4    8e-19
ref|YP_002930749.1|  anthranilate synthase component II [Eubac...  97.4    8e-19
sp|P42388.1|TRPG_BUCAP  RecName: Full=Anthranilate synthase co...  97.4    8e-19
ref|YP_001717333.1|  glutamine amidotransferase of anthranilat...  97.4    8e-19
ref|YP_001996775.1|  glutamine amidotransferase of anthranilat...  97.4    8e-19
ref|ZP_05245453.1|  anthranilate synthase component II [Lister...  97.1    9e-19
ref|YP_002397465.1|  bifunctional glutamine amidotransferase/a...  97.1    9e-19
ref|YP_001098562.1|  aminodeoxychorismate synthase subunit II,...  97.1    9e-19
ref|ZP_01119066.1|  anthranilate synthase component II [Polari...  97.1    9e-19
ref|ZP_05094273.1|  class I glutamine amidotransferase, putati...  97.1    9e-19
ref|YP_001927014.1|  glutamine amidotransferase of anthranilat...  97.1    9e-19
ref|ZP_06188541.1|  para-aminobenzoate synthase glutamine amid...  97.1    9e-19
ref|YP_001473424.1|  anthranilate synthase component II [Shewa...  97.1    9e-19
ref|ZP_01385214.1|  glutamine amidotransferase of anthranilate...  97.1    9e-19
ref|NP_934013.1|  anthranilate synthase component II [Vibrio v...  97.1    9e-19
ref|ZP_06380567.1|  anthranilate synthase component II [Arthro...  97.1    9e-19
ref|YP_002310198.1|  Glutamine amidotransferase of anthranilat...  97.1    9e-19
ref|YP_001480804.1|  para-aminobenzoate synthase component II ...  97.1    9e-19
ref|ZP_01551657.1|  anthranilate synthase component II [Methyl...  97.1    1e-18
ref|YP_849845.1|  anthranilate synthase component II [Listeria...  97.1    1e-18
ref|ZP_04819238.1|  anthranilate synthase component II [Staphy...  97.1    1e-18
ref|YP_014251.1|  anthranilate synthase component II [Listeria...  97.1    1e-18
ref|ZP_00232126.1|  anthranilate synthase, glutamine amidotran...  97.1    1e-18
ref|ZP_01170817.1|  anthranilate synthase component II [Bacill...  97.1    1e-18
ref|YP_001940415.1|  Anthranilate/para-aminobenzoate synthase ...  97.1    1e-18
ref|ZP_05264930.1|  anthranilate synthase component II [Lister...  97.1    1e-18
ref|YP_002633460.1|  glutamine amidotransferase class-I protei...  96.7    1e-18
pdb|1I1Q|B  Chain B, Structure Of The Cooperative Allosteric A...  96.7    1e-18
ref|YP_901254.1|  anthranilate synthase component II [Pelobact...  96.7    1e-18
ref|YP_001662258.1|  glutamine amidotransferase of anthranilat...  96.7    1e-18
ref|YP_001692360.1|  para-aminobenzoate synthase component II ...  96.7    1e-18
ref|YP_968961.1|  anthranilate synthase component II [Acidovor...  96.7    1e-18
ref|YP_128529.1|  para-aminobenzoate synthase component II [Ph...  96.7    1e-18
ref|ZP_01453431.1|  para-aminobenzoate synthase component II [...  96.7    1e-18
ref|YP_003555243.1|  para-aminobenzoate synthase glutamine ami...  96.7    1e-18
ref|YP_483512.1|  para-aminobenzoate synthase component II [Fr...  96.7    1e-18
ref|YP_001892300.1|  anthranilate synthase component II [Franc...  96.7    1e-18
ref|YP_467254.1|  anthranilate synthase, component II [Anaerom...  96.7    1e-18
ref|ZP_04632730.1|  Para-aminobenzoate synthase glutamine amid...  96.7    1e-18
ref|ZP_05056962.1|  class I glutamine amidotransferase, putati...  96.7    1e-18
ref|YP_001550087.1|  para-aminobenzoate synthase component II ...  96.7    1e-18
ref|YP_001490891.1|  anthranilate synthase component II [Arcob...  96.7    1e-18
ref|ZP_05857644.1|  anthranilate synthase, component II [Prevo...  96.7    1e-18
ref|YP_657548.1|  anthranilate synthase component II [Haloquad...  96.7    1e-18
ref|YP_727757.1|  anthranilate synthase component II [Ralstoni...  96.7    1e-18
ref|YP_297228.1|  anthranilate synthase component II [Ralstoni...  96.7    1e-18
ref|YP_315982.1|  anthranilate synthase component II [Thiobaci...  96.7    1e-18
ref|YP_002349893.1|  para-aminobenzoate synthase glutamine ami...  96.7    1e-18
ref|YP_001534981.1|  para-aminobenzoate synthase component II ...  96.7    1e-18
ref|ZP_01221575.1|  para-aminobenzoate synthase component II [...  96.7    1e-18
ref|ZP_01891121.1|  anthranilate synthase component II [uniden...  96.3    2e-18
ref|ZP_04764364.1|  glutamine amidotransferase of anthranilate...  96.3    2e-18
ref|YP_899381.1|  anthranilate synthase component II [Francise...  96.3    2e-18
ref|YP_679873.1|  anthranilate synthase, component II [Cytopha...  96.3    2e-18
gb|AAB05987.1|  anthranilate synthase small subunit [Buchnera ...  96.3    2e-18
ref|ZP_03701339.1|  glutamine amidotransferase of anthranilate...  96.3    2e-18
ref|ZP_03265384.1|  glutamine amidotransferase of anthranilate...  96.3    2e-18
ref|YP_001022650.1|  anthranilate synthase, component II [Meth...  96.3    2e-18
ref|ZP_06297232.1|  glutamine amidotransferase of anthranilate...  96.3    2e-18
ref|ZP_06409094.1|  anthranilate synthase component II [Prevot...  96.3    2e-18
ref|YP_002755895.1|  anthranilate synthase component II [Acido...  96.3    2e-18
ref|YP_378617.1|  anthranilate synthase component II [Chlorobi...  96.3    2e-18
emb|CAQ49218.1|  para-aminobenzoate synthase glutamine amidotr...  96.3    2e-18
ref|YP_764256.1|  anthranilate synthase component II [Francise...  96.3    2e-18
ref|YP_002494579.1|  glutamine amidotransferase of anthranilat...  96.3    2e-18
ref|ZP_05500265.1|  glutamine amidotransferase of anthranilate...  96.3    2e-18
ref|ZP_06664086.1|  para-aminobenzoate synthase component II [...  95.9    2e-18
ref|ZP_01624806.1|  Anthranilate/para-aminobenzoate synthases ...  95.9    2e-18
ref|YP_560525.1|  anthranilate synthase component II [Burkhold...  95.9    2e-18
ref|YP_857428.1|  anthranilate synthase component II [Aeromona...  95.9    2e-18
ref|ZP_06560458.1|  glutamine amidotransferase, class I [Megas...  95.9    2e-18
ref|YP_002538883.1|  glutamine amidotransferase of anthranilat...  95.9    2e-18
ref|ZP_02420769.1|  hypothetical protein ANACAC_03416 [Anaeros...  95.9    2e-18
ref|NP_045086.1|  anthranilate synthase component 2 [Cyanidium...  95.9    2e-18
ref|ZP_05363070.1|  anthranilate synthase component II [Campyl...  95.9    2e-18
ref|ZP_05735334.1|  anthranilate synthase component II [Prevot...  95.9    2e-18
ref|ZP_03669732.1|  anthranilate synthase component II [Lister...  95.9    2e-18
ref|ZP_00235012.1|  anthranilate synthase, glutamine amidotran...  95.9    2e-18
ref|ZP_03495342.1|  glutamine amidotransferase of anthranilate...  95.9    2e-18
ref|NP_465157.1|  anthranilate synthase component II [Listeria...  95.9    2e-18
ref|YP_003196660.1|  anthranilate synthase component II [Robig...  95.9    2e-18
ref|ZP_04831733.1|  glutamine amidotransferase of anthranilate...  95.9    2e-18
ref|NP_521003.1|  anthranilate synthase component II [Ralstoni...  95.9    2e-18
ref|ZP_03783733.1|  hypothetical protein RUMHYD_03212 [Blautia...  95.9    2e-18
ref|ZP_06714412.1|  glutamine amido-transferase [Edwardsiella ...  95.9    2e-18
ref|YP_001210011.1|  para-aminobenzoate synthetase, component ...  95.9    2e-18
gb|EAY56745.1|  Anthranilate synthase component II [Leptospiri...  95.9    2e-18
ref|ZP_01624026.1|  Glutamine amidotransferase of anthranilate...  95.9    2e-18
ref|YP_455982.1|  para-aminobenzoate synthase component II [So...  95.9    2e-18
ref|ZP_00134139.2|  COG0512: Anthranilate/para-aminobenzoate s...  95.9    2e-18
ref|NP_662448.1|  anthranilate synthase component II [Chlorobi...  95.9    2e-18
ref|ZP_06469042.1|  glutamine amidotransferase of anthranilate...  95.9    2e-18
ref|YP_001008103.1|  para-aminobenzoate synthase component II ...  95.5    2e-18
ref|ZP_04018781.1|  anthranilate synthase [Finegoldia magna AT...  95.5    2e-18
ref|YP_301468.1|  anthranilate synthase component II [Staphylo...  95.5    3e-18
ref|YP_393082.1|  anthranilate synthase component II [Sulfurim...  95.5    3e-18
ref|YP_003413889.1|  anthranilate synthase component II [Liste...  95.5    3e-18
ref|ZP_01898717.1|  para-aminobenzoate synthase component II [...  95.5    3e-18
ref|ZP_05302034.1|  anthranilate synthase component II [Lister...  95.5    3e-18
ref|ZP_04444997.1|  anthranilate synthase [Listeria grayi DSM ...  95.5    3e-18
emb|CBL21467.1|  anthranilate synthase, component II [Ruminoco...  95.5    3e-18
gb|AAB05975.1|  anthranilate synthase small subunit [Buchnera ...  95.5    3e-18
ref|YP_003184637.1|  glutamine amidotransferase of anthranilat...  95.5    3e-18
ref|ZP_01223182.1|  anthranilate synthase component II [marine...  95.5    3e-18
ref|ZP_04024849.1|  anthranilate synthase, component II [Tsuka...  95.5    3e-18
ref|YP_001897111.1|  anthranilate synthase component II [Burkh...  95.5    3e-18
ref|ZP_01216981.1|  anthranilate synthase component II [Psychr...  95.5    3e-18
ref|YP_001141002.1|  anthranilate synthase component II [Aerom...  95.5    3e-18
ref|ZP_06172183.1|  glutamine amidotransferase of anthranilate...  95.5    3e-18
ref|YP_003550821.1|  para-aminobenzoate synthase component II ...  95.5    3e-18
ref|YP_002250412.1|  anthranilate synthase component II [Dicty...  95.5    3e-18
ref|YP_003333679.1|  glutamine amidotransferase of anthranilat...  95.1    3e-18
ref|YP_001273718.1|  anthranilate/para-aminobenzoate synthase ...  95.1    3e-18
ref|ZP_01966700.1|  hypothetical protein RUMTOR_00240 [Ruminoc...  95.1    3e-18
ref|ZP_01734801.1|  anthranilate synthase, component II [Flavo...  95.1    3e-18
ref|ZP_01042939.1|  para-aminobenzoate synthase glutamine amid...  95.1    3e-18
ref|ZP_01796815.1|  para-aminobenzoate synthase component II [...  95.1    3e-18
ref|ZP_01173360.1|  para-aminobenzoate synthase component II [...  95.1    4e-18
ref|YP_002836037.1|  anthranilate synthase component II [Coryn...  95.1    4e-18
ref|YP_002942504.1|  glutamine amidotransferase of anthranilat...  95.1    4e-18
ref|ZP_05715544.1|  Para-aminobenzoate synthase glutamine amid...  95.1    4e-18
ref|ZP_01611332.1|  putative glutamine amidotransferase; putat...  95.1    4e-18
ref|YP_001762511.1|  glutamine amidotransferase of anthranilat...  95.1    4e-18
ref|ZP_04048477.1|  anthranilate synthase, component II [Brach...  95.1    4e-18
ref|YP_003297291.1|  para-aminobenzoate synthase component II ...  95.1    4e-18
ref|YP_001865001.1|  glutamine amidotransferase of anthranilat...  95.1    4e-18
ref|ZP_02427840.1|  hypothetical protein CLORAM_01228 [Clostri...  95.1    4e-18
gb|EDZ38025.1|  Anthranilate synthase component II [Leptospiri...  95.1    4e-18
ref|YP_857672.1|  para-aminobenzoate synthase glutamine amidot...  95.1    4e-18
ref|YP_983869.1|  anthranilate synthase component II [Polaromo...  95.1    4e-18
ref|YP_003514851.1|  glutamine amidotransferase of anthranilat...  95.1    4e-18
ref|ZP_02887405.1|  glutamine amidotransferase of anthranilate...  95.1    4e-18
ref|ZP_03607951.1|  hypothetical protein METSMIALI_01074 [Meth...  95.1    4e-18
emb|CBA32185.1|  Anthranilate synthase component II [Curvibact...  95.1    4e-18
ref|ZP_04582692.1|  anthranilate phosphoribosyltransferase [He...  95.1    4e-18
ref|ZP_03608946.1|  anthranilate synthase component II [Campyl...  95.1    4e-18
ref|ZP_05129445.1|  anthranilate synthase component II (Glutam...  95.1    4e-18
ref|YP_001540861.1|  anthranilate synthase component II [Caldi...  94.7    5e-18
ref|YP_430197.1|  anthranilate synthase, component II [Moorell...  94.7    5e-18
ref|YP_003304731.1|  glutamine amidotransferase of anthranilat...  94.7    5e-18
ref|ZP_02157468.1|  glutamine amido-transferase [Shewanella be...  94.7    5e-18
ref|YP_524839.1|  anthranilate synthase component II [Rhodofer...  94.7    5e-18
ref|YP_009588.1|  para-aminobenzoate/anthranilate synthase glu...  94.7    5e-18
ref|ZP_05975419.1|  para-aminobenzoate synthase glutamine amid...  94.7    5e-18
ref|ZP_01288251.1|  Glutamine amidotransferase of anthranilate...  94.7    5e-18
ref|ZP_05294561.1|  para-aminobenzoate synthase glutamine amid...  94.7    5e-18
ref|ZP_04444130.1|  anthranilate synthase component II [Lister...  94.7    5e-18
ref|YP_001677562.1|  anthranilate synthase component II [Franc...  94.7    5e-18
ref|ZP_05971287.1|  glutamine amido-transferase [Providencia r...  94.7    5e-18
ref|YP_002136501.1|  glutamine amidotransferase of anthranilat...  94.7    5e-18
ref|YP_001179538.1|  glutamine amidotransferase of anthranilat...  94.7    5e-18
ref|ZP_01306564.1|  Anthranilate/para-aminobenzoate synthases ...  94.7    5e-18
ref|ZP_04677676.1|  para-aminobenzoate/anthranilate synthase g...  94.7    5e-18
ref|ZP_01236651.1|  para-aminobenzoate synthase component II [...  94.7    5e-18
ref|YP_003159305.1|  glutamine amidotransferase of anthranilat...  94.7    5e-18
ref|YP_002992650.1|  glutamine amidotransferase of anthranilat...  94.7    5e-18
ref|YP_002938841.1|  anthranilate/para-aminobenzoate synthase ...  94.4    5e-18
ref|YP_003468177.1|  Anthranilate synthase component II (Gluta...  94.4    6e-18
ref|YP_003297708.1|  glutamine amidotransferase of anthranilat...  94.4    6e-18
ref|YP_114991.1|  anthranilate synthase component II [Methyloc...  94.4    6e-18
ref|ZP_05731077.1|  glutamine amidotransferase of anthranilate...  94.4    6e-18
ref|ZP_03318835.1|  hypothetical protein PROVALCAL_01774 [Prov...  94.4    6e-18
ref|NP_387956.1|  para-aminobenzoate/anthranilate synthase glu...  94.4    6e-18
ref|ZP_02930727.1|  anthranilate synthase component II [Verruc...  94.4    6e-18
ref|ZP_01547610.1|  anthranilate synthase includes: glutamine ...  94.4    6e-18
ref|YP_001680486.1|  anthranilate synthase component ii [Helio...  94.4    6e-18
ref|YP_751977.1|  glutamine amidotransferase of anthranilate s...  94.4    6e-18
ref|YP_002377991.1|  glutamine amidotransferase of anthranilat...  94.4    6e-18
ref|ZP_05624074.1|  anthranilate synthase component II [Campyl...  94.4    7e-18
ref|YP_001456263.1|  para-aminobenzoate synthase component II ...  94.4    7e-18
ref|NP_709135.1|  para-aminobenzoate synthase component II [Sh...  94.4    7e-18
ref|ZP_05708410.1|  anthranilate synthase component II [Coryne...  94.4    7e-18
ref|ZP_06118289.1|  aspartate 1-decarboxylase [Clostridium hat...  94.4    7e-18
ref|XP_002155081.1|  PREDICTED: similar to AER446Wp [Hydra mag...  94.4    7e-18
ref|YP_001909105.1|  Para-aminobenzoate synthase glutamine ami...  94.4    7e-18
ref|YP_312286.1|  para-aminobenzoate synthase component II [Sh...  94.0    7e-18
ref|YP_002551842.1|  glutamine amidotransferase of anthranilat...  94.0    7e-18
ref|ZP_06420396.1|  para-aminobenzoate synthase glutamine amid...  94.0    7e-18
ref|YP_944897.1|  glutamine amidotransferase of anthranilate s...  94.0    7e-18
ref|YP_000565.1|  anthranilate synthase component II [Leptospi...  94.0    7e-18
ref|YP_003526250.1|  glutamine amidotransferase of anthranilat...  94.0    8e-18
ref|YP_344478.1|  glutamine amidotransferase of anthranilate s...  94.0    8e-18
ref|NP_881807.1|  anthranilate synthase component II [Bordetel...  94.0    8e-18
ref|ZP_02536255.1|  Anthranilate/para-aminobenzoate synthases ...  94.0    8e-18
ref|ZP_03737145.1|  glutamine amidotransferase of anthranilate...  94.0    8e-18
ref|YP_001684401.1|  anthranilate synthase component II [Caulo...  94.0    8e-18
ref|ZP_03968803.1|  aminodeoxychorismate synthase [Sphingobact...  94.0    8e-18
ref|YP_001529449.1|  glutamine amidotransferase of anthranilat...  94.0    8e-18
ref|YP_002006762.1|  anthranilate synthase component II [Cupri...  94.0    8e-18
ref|YP_845897.1|  glutamine amidotransferase of anthranilate s...  94.0    8e-18
ref|ZP_01872357.1|  ANTHRANILATE SYNTHASE COMPONENT II [Camini...  94.0    9e-18
ref|YP_996000.1|  anthranilate synthase component II [Verminep...  94.0    9e-18
ref|ZP_06235636.1|  glutamine amidotransferase of anthranilate...  94.0    9e-18
ref|ZP_01858318.1|  anthranilate synthase component II [Bacill...  94.0    9e-18
ref|YP_716883.1|  para-aminobenzoate synthase component II [Fr...  94.0    9e-18
ref|YP_003156062.1|  glutamine amidotransferase of anthranilat...  94.0    9e-18
ref|ZP_02438871.1|  hypothetical protein CLOSS21_01326 [Clostr...  94.0    9e-18
ref|ZP_06051227.1|  para-aminobenzoate synthase amidotransfera...  94.0    9e-18
ref|NP_617879.1|  anthranilate synthase component II [Methanos...  94.0    9e-18
ref|YP_001817067.1|  glutamine amidotransferase of anthranilat...  94.0    9e-18
gb|AAC31216.1|  anthranilate synthase small subunit [Buchnera ...  94.0    9e-18
ref|YP_001515772.1|  anthranilate synthase component II [Acary...  93.6    9e-18
ref|NP_057963.1|  anthranilate synthase component II [Buchnera...  93.6    1e-17
ref|ZP_06716821.1|  anthranilate phosphoribosyltransferase [Ru...  93.6    1e-17
ref|YP_002460884.1|  para-aminobenzoate synthase, subunit I [D...  93.6    1e-17
ref|YP_002982702.1|  glutamine amidotransferase of anthranilat...  93.6    1e-17
ref|ZP_06634272.1|  anthranilate synthase component II [Aggreg...  93.6    1e-17
ref|NP_764043.1|  putative anthranilate synthase component II ...  93.6    1e-17
ref|NP_923829.1|  anthranilate synthase component II [Gloeobac...  93.6    1e-17
ref|YP_385444.1|  anthranilate synthase component II [Geobacte...  93.6    1e-17
sp|P06195.1|PABA_SERMA  RecName: Full=Para-aminobenzoate synth...  93.6    1e-17
ref|ZP_05793258.1|  anthranilate synthase, component II [Butyr...  93.6    1e-17
ref|YP_003335304.1|  glutamine amidotransferase of anthranilat...  93.6    1e-17
ref|YP_001344566.1|  anthranilate synthase component II [Actin...  93.6    1e-17
ref|NP_848997.1|  anthranilate synthase component 2 [Cyanidios...  93.6    1e-17
ref|ZP_03712793.1|  hypothetical protein EIKCOROL_00461 [Eiken...  93.6    1e-17
ref|NP_471009.1|  anthranilate synthase component II [Listeria...  93.6    1e-17
ref|ZP_05347397.1|  anthranilate synthase component II [Bryant...  93.6    1e-17
ref|YP_001370142.1|  anthranilate synthase [Ochrobactrum anthr...  93.6    1e-17
gb|AAB65804.1|  putative glutamine amidotransferase subunit [D...  93.6    1e-17
ref|NP_953428.1|  anthranilate synthase component II [Geobacte...  93.6    1e-17
ref|ZP_01161648.1|  para-aminobenzoate synthase component II [...  93.6    1e-17
ref|YP_002908770.1|  Glutamine amidotransferase of anthranilat...  93.6    1e-17
ref|NP_301141.1|  para-aminobenzoate synthase component II [My...  93.6    1e-17
ref|ZP_02162926.1|  anthranilate synthase component II [Kordia...  93.6    1e-17
ref|ZP_05920554.1|  glutamine amido-transferase [Pasteurella d...  93.6    1e-17
ref|YP_904115.1|  anthranilate synthase, component II [Candida...  93.6    1e-17
gb|AAK27443.1|AF326474_1  anthranilate synthase component I [B...  93.6    1e-17
gb|AAD09347.1|  anthranilate synthase small subunit [Buchnera ...  93.6    1e-17
gb|AAR99728.1|  anthranilate synthase small subunit [Buchnera ...  93.6    1e-17
ref|ZP_05888416.1|  para-aminobenzoate synthase amidotransfera...  93.6    1e-17
ref|ZP_06126449.1|  anthranilate synthase, component II [Provi...  93.6    1e-17
ref|YP_409658.1|  para-aminobenzoate synthase component II [Sh...  93.6    1e-17
ref|YP_743081.1|  anthranilate synthase, component II [Alkalil...  93.6    1e-17
ref|ZP_03319673.1|  hypothetical protein PROVALCAL_02618 [Prov...  93.2    1e-17
ref|ZP_05429349.1|  glutamine amidotransferase of anthranilate...  93.2    1e-17
ref|ZP_03049724.1|  aminodeoxychorismate synthase, component I...  93.2    1e-17
ref|ZP_02949177.1|  para-aminobenzoate synthase glutamine amid...  93.2    1e-17
ref|YP_002221237.1|  glutamine amidotransferase of anthranilat...  93.2    1e-17
ref|YP_002495406.1|  glutamine amidotransferase of anthranilat...  93.2    1e-17
ref|YP_001483407.1|  para-aminobenzoate synthase component II ...  93.2    1e-17
ref|YP_750118.1|  anthranilate synthase component II [Shewanel...  93.2    1e-17
ref|NP_417819.1|  aminodeoxychorismate synthase, subunit II [E...  93.2    1e-17
ref|ZP_04778398.1|  aminodeoxychorismate synthase [Sphingobact...  93.2    1e-17
ref|YP_001037301.1|  anthranilate synthase, component II [Clos...  93.2    1e-17
ref|ZP_03508443.1|  anthranilate synthase [Rhizobium etli Bras...  93.2    1e-17
ref|YP_002124813.1|  P-aminobenzoate synthetase, component II ...  93.2    1e-17
ref|ZP_06471511.1|  glutamine amidotransferase of anthranilate...  93.2    1e-17
ref|YP_001900679.1|  glutamine amidotransferase of anthranilat...  93.2    1e-17
ref|NP_892305.1|  para-aminobenzoate synthase component II [Pr...  93.2    1e-17
ref|ZP_06462928.1|  glutamine amidotransferase of anthranilate...  93.2    1e-17
ref|YP_002886042.1|  glutamine amidotransferase of anthranilat...  93.2    1e-17
ref|YP_390105.1|  aminodeoxychorismate synthase, glutamine ami...  93.2    1e-17
ref|NP_613721.1|  anthranilate/para-aminobenzoate synthase com...  93.2    1e-17
ref|ZP_05972072.1|  anthranilate synthase, component II [Provi...  93.2    1e-17
ref|YP_002607122.1|  para-aminobenzoate/anthranilate synthase ...  93.2    1e-17
ref|YP_964899.1|  glutamine amidotransferase of anthranilate s...  93.2    1e-17
ref|ZP_01313229.1|  glutamine amidotransferase of anthranilate...  93.2    1e-17
ref|YP_003262427.1|  glutamine amidotransferase of anthranilat...  93.2    1e-17
ref|YP_001745609.1|  aminodeoxychorismate synthase, component ...  93.2    1e-17
ref|YP_001051059.1|  anthranilate synthase component II [Shewa...  93.2    1e-17
ref|YP_001008597.1|  para-aminobenzoate synthase component II ...  93.2    1e-17
ref|NP_799177.1|  para-aminobenzoate synthase component II [Vi...  93.2    1e-17
ref|ZP_01450236.1|  glutamine amido-transferase [alpha proteob...  93.2    1e-17
ref|ZP_05720598.1|  Para-aminobenzoate synthase glutamine amid...  93.2    2e-17
ref|YP_003096005.1|  Anthranilate synthase, amidotransferase c...  93.2    2e-17
ref|YP_001767074.1|  glutamine amidotransferase of anthranilat...  93.2    2e-17
ref|YP_002480169.1|  anthranilate phosphoribosyltransferase [D...  93.2    2e-17
ref|ZP_03705990.1|  hypothetical protein CLOSTMETH_00710 [Clos...  93.2    2e-17
ref|YP_001555229.1|  anthranilate synthase component II [Shewa...  93.2    2e-17
ref|YP_519508.1|  hypothetical protein DSY3275 [Desulfitobacte...  93.2    2e-17
ref|YP_003284040.1|  anthranilate synthase component II [Blatt...  92.8    2e-17
ref|ZP_02070448.1|  hypothetical protein BACUNI_01869 [Bactero...  92.8    2e-17
ref|YP_002019199.1|  glutamine amidotransferase of anthranilat...  92.8    2e-17
ref|YP_962995.1|  anthranilate synthase component II [Shewanel...  92.8    2e-17
ref|ZP_05451761.1|  anthranilate synthase [Brucella neotomae 5...  92.8    2e-17
ref|ZP_05164116.1|  anthranilate synthase [Brucella suis bv. 5...  92.8    2e-17
ref|YP_001259442.1|  anthranilate synthase [Brucella ovis ATCC...  92.8    2e-17
ref|YP_222246.1|  anthranilate synthase [Brucella abortus bv. ...  92.8    2e-17
ref|NP_539366.1|  anthranilate synthase [Brucella melitensis 1...  92.8    2e-17
ref|YP_414950.1|  anthranilate synthase [Brucella melitensis b...  92.8    2e-17
ref|YP_660236.1|  glutamine amidotransferase of anthranilate s...  92.8    2e-17
ref|ZP_05112700.1|  anthranilate synthase [Labrenzia alexandri...  92.8    2e-17
ref|YP_002418400.1|  para-aminobenzoate synthase component II ...  92.8    2e-17
ref|ZP_03155768.1|  glutamine amidotransferase of anthranilate...  92.8    2e-17
ref|YP_001366920.1|  anthranilate synthase component II [Shewa...  92.8    2e-17
ref|YP_796760.1|  anthranilate synthase component II [Leptospi...  92.8    2e-17
ref|ZP_05457988.1|  anthranilate synthase [Brucella ceti M490/...  92.8    2e-17
ref|ZP_05170063.1|  anthranilate synthase [Brucella pinnipedia...  92.8    2e-17
ref|ZP_03786044.1|  anthranilate synthase [Brucella ceti str. ...  92.8    2e-17
ref|YP_003187749.1|  anthranilate synthase component II [Aceto...  92.8    2e-17
ref|YP_001837481.1|  anthranilate synthase component II [Lepto...  92.8    2e-17
ref|YP_001942466.1|  glutamine amidotransferase of anthranilat...  92.8    2e-17
ref|ZP_04054342.1|  para-aminobenzoate/anthranilate synthase g...  92.8    2e-17
gb|ACI76721.1|  p-aminobenzoate synthetase component II [Esche...  92.8    2e-17
ref|YP_002801697.1|  Glutamine amidotransferase of anthranilat...  92.8    2e-17
ref|ZP_06473816.1|  glutamine amidotransferase of anthranilate...  92.8    2e-17
ref|YP_003322984.1|  glutamine amidotransferase of anthranilat...  92.8    2e-17
ref|ZP_01216662.1|  anthranilate synthase component II [Psychr...  92.8    2e-17
ref|YP_002934975.1|  para-aminobenzoate synthase glutamine ami...  92.8    2e-17
ref|ZP_01261795.1|  para-aminobenzoate synthase component II [...  92.8    2e-17
ref|ZP_06637664.1|  anthranilate synthase [Serratia odorifera ...  92.8    2e-17
ref|ZP_06604062.1|  anthranilate synthase component II [Seleno...  92.8    2e-17
ref|ZP_05340697.1|  para-aminobenzoate/anthranilate synthase g...  92.8    2e-17
ref|ZP_06685487.1|  anthranilate synthase component II [Achrom...  92.8    2e-17
ref|YP_739461.1|  aminodeoxychorismate synthase, glutamine ami...  92.8    2e-17
ref|YP_585320.1|  anthranilate synthase component II [Cupriavi...  92.8    2e-17
ref|YP_001295436.1|  Para-aminobenzoate/anthranilate synthase ...  92.8    2e-17
ref|YP_761063.1|  4-amino-4-deoxychorismate synthase, glutamin...  92.8    2e-17
ref|YP_551240.1|  anthranilate synthase component II [Polaromo...  92.8    2e-17
ref|ZP_01075591.1|  glutamine amidotransferase of anthranilate...  92.8    2e-17
ref|YP_002986003.1|  glutamine amidotransferase of anthranilat...  92.4    2e-17
ref|YP_001657347.1|  anthranilate synthase component II [Micro...  92.4    2e-17
ref|YP_788819.1|  anthranilate synthase component II [Pseudomo...  92.4    2e-17
emb|CBK89974.1|  anthranilate synthase, component II [Eubacter...  92.4    2e-17
ref|NP_349759.1|  Para-aminobenzoate synthase component II [Cl...  92.4    2e-17
ref|ZP_02904054.1|  aminodeoxychorismate synthase, component I...  92.4    2e-17
ref|NP_716246.1|  para-aminobenzoate synthase glutamine amidot...  92.4    2e-17
ref|YP_002016509.1|  glutamine amidotransferase of anthranilat...  92.4    2e-17
ref|YP_002650384.1|  Para-aminobenzoate synthase glutamine ami...  92.4    2e-17
ref|ZP_03310905.1|  hypothetical protein DESPIG_00807 [Desulfo...  92.4    2e-17
ref|YP_001878134.1|  anthranilate phosphoribosyltransferase [A...  92.4    2e-17
ref|YP_003320132.1|  glutamine amidotransferase of anthranilat...  92.4    2e-17
ref|YP_732744.1|  aminodeoxychorismate synthase, glutamine ami...  92.4    2e-17
ref|ZP_01707394.1|  glutamine amidotransferase of anthranilate...  92.4    2e-17
ref|YP_001792897.1|  glutamine amidotransferase of anthranilat...  92.4    2e-17
ref|YP_003521951.1|  PabA [Pantoea ananatis LMG 20103] >gb|ADD...  92.4    2e-17
ref|ZP_01615197.1|  Anthranilate/para-aminobenzoate synthases ...  92.4    2e-17
ref|ZP_02958578.1|  hypothetical protein PROSTU_00325 [Provide...  92.4    2e-17
ref|YP_002354686.1|  glutamine amidotransferase of anthranilat...  92.4    2e-17
ref|ZP_01916725.1|  anthranilate synthase component II [Limnob...  92.4    2e-17
ref|ZP_01129180.1|  anthranilate synthase component II [marine...  92.4    2e-17
ref|YP_868251.1|  aminodeoxychorismate synthase, glutamine ami...  92.4    3e-17
ref|ZP_06222158.1|  anthranilate synthase component II [Haemop...  92.4    3e-17
ref|YP_001812562.1|  glutamine amidotransferase of anthranilat...  92.4    3e-17
ref|ZP_01135636.1|  putative glutamine amidotransferase [Pseud...  92.4    3e-17
ref|ZP_04627163.1|  Para-aminobenzoate synthase glutamine amid...  92.4    3e-17
ref|YP_001602180.1|  putative mnthranilate synthase component ...  92.4    3e-17
ref|ZP_01228514.1|  anthranilate synthase component II [Aurant...  92.4    3e-17
ref|YP_002352590.1|  glutamine amidotransferase of anthranilat...  92.4    3e-17
ref|ZP_04680779.1|  anthranilate synthase [Ochrobactrum interm...  92.0    3e-17
ref|ZP_03518052.1|  anthranilate synthase [Rhizobium etli IE4771]  92.0    3e-17
ref|YP_134726.1|  anthranilate synthase component II [Haloarcu...  92.0    3e-17
ref|ZP_01102298.1|  Anthranilate synthase component II [Congre...  92.0    3e-17
ref|YP_003007284.1|  anthranilate synthase component II [Aggre...  92.0    3e-17
gb|ACA34346.1|  glutamine amidotransferase [Paenibacillus poly...  92.0    3e-17
ref|ZP_04636537.1|  Para-aminobenzoate synthase glutamine amid...  92.0    3e-17
ref|ZP_01667025.1|  glutamine amidotransferase of anthranilate...  92.0    3e-17
ref|YP_001183924.1|  anthranilate synthase component II [Shewa...  92.0    3e-17
ref|YP_001952777.1|  glutamine amidotransferase of anthranilat...  92.0    3e-17
ref|YP_003532769.1|  para-aminobenzoate synthase glutamine ami...  92.0    3e-17
ref|YP_001501449.1|  anthranilate synthase component II [Shewa...  92.0    3e-17
ref|YP_003549044.1|  glutamine amidotransferase of anthranilat...  92.0    3e-17
ref|ZP_03936270.1|  anthranilate synthase [Corynebacterium str...  92.0    3e-17
ref|ZP_01787134.1|  anthranilate synthase component II [Haemop...  92.0    3e-17
ref|ZP_01987627.1|  para-aminobenzoate synthase glutamine amid...  92.0    3e-17
ref|ZP_01093370.1|  glutamine amidotransferase of anthranilate...  92.0    3e-17
ref|ZP_01088722.1|  anthranilate synthase component II (glutam...  92.0    3e-17
ref|ZP_04861813.1|  para-aminobenzoate/anthranilate synthase g...  92.0    3e-17
ref|YP_001346185.1|  anthranilate synthase component II [Pseud...  92.0    3e-17
ref|YP_001230499.1|  anthranilate synthase component II [Geoba...  92.0    3e-17
ref|YP_001111623.1|  glutamine amidotransferase of anthranilat...  92.0    3e-17
ref|YP_001377574.1|  glutamine amidotransferase of anthranilat...  92.0    3e-17
ref|YP_001357856.1|  anthranilate synthase component II [Sulfu...  92.0    3e-17
ref|YP_756631.1|  anthranilate synthase component II [Maricaul...  92.0    3e-17
ref|ZP_00157226.2|  COG0512: Anthranilate/para-aminobenzoate s...  91.7    4e-17
ref|ZP_02330812.1|  para-aminobenzoate/anthranilate synthase g...  91.7    4e-17
ref|YP_003557553.1|  glutamine amido-transferase [Shewanella v...  91.7    4e-17
ref|ZP_06403183.1|  glutamine amidotransferase of anthranilate...  91.7    4e-17
ref|ZP_02830722.1|  aminodeoxychorismate synthase, component I...  91.7    4e-17
ref|ZP_01965256.1|  hypothetical protein RUMOBE_02988 [Ruminoc...  91.7    4e-17
ref|ZP_04932662.1|  anthranilate synthase component II [Pseudo...  91.7    4e-17
ref|ZP_01862011.1|  para-aminobenzoate synthase component II [...  91.7    4e-17
ref|YP_746388.1|  anthranilate synthase component II [Nitrosom...  91.7    4e-17
ref|YP_002923692.1|  aminodeoxychorismate synthase subunit II,...  91.7    4e-17
ref|YP_001794554.1|  glutamine amidotransferase of anthranilat...  91.7    4e-17
ref|ZP_06178737.1|  Para-aminobenzoate synthase glutamine amid...  91.7    4e-17
ref|YP_001435056.1|  anthranilate synthase, component II [Igni...  91.7    4e-17
ref|ZP_05686521.1|  anthranilate synthase component II [Staphy...  91.7    4e-17
ref|ZP_01463500.1|  anthranilate synthase component II [Stigma...  91.7    4e-17
dbj|BAI83522.1|  para-aminobenzoate/anthranilate synthase glut...  91.7    4e-17
ref|ZP_05823973.1|  anthranilate/para-aminobenzoate synthase c...  91.7    4e-17
ref|YP_001466293.1|  anthranilate synthase/para-aminobenzoate ...  91.7    4e-17
ref|ZP_03290909.1|  hypothetical protein CLONEX_03128 [Clostri...  91.7    4e-17
ref|YP_001212177.1|  anthranilate/para-aminobenzoate synthases...  91.7    4e-17
ref|YP_001090428.1|  para-aminobenzoate synthase component II ...  91.7    4e-17
ref|YP_145109.1|  anthranilate synthase component II [Thermus ...  91.7    4e-17
ref|ZP_04797091.1|  anthranilate synthase component II [Staphy...  91.7    4e-17
ref|YP_001723357.1|  para-aminobenzoate synthase component II ...  91.7    4e-17
ref|YP_003461587.1|  glutamine amidotransferase of anthranilat...  91.7    4e-17
ref|ZP_03127434.1|  glutamine amidotransferase of anthranilate...  91.7    4e-17
ref|YP_003371161.1|  glutamine amidotransferase of anthranilat...  91.7    4e-17
ref|YP_404990.1|  para-aminobenzoate synthase component II [Sh...  91.7    4e-17
ref|ZP_04624718.1|  Para-aminobenzoate synthase glutamine amid...  91.7    4e-17
emb|CBI49247.1|  anthranilate synthase component II [Staphyloc...  91.7    4e-17
ref|ZP_04796525.1|  aminodeoxychorismate synthase [Staphylococ...  91.7    4e-17
ref|YP_003008843.1|  glutamine amidotransferase of anthranilat...  91.7    4e-17
ref|ZP_06324387.1|  anthranilate synthase component II [Staphy...  91.7    4e-17
ref|ZP_05710741.1|  glutamine amidotransferase of anthranilate...  91.7    4e-17
ref|ZP_06156687.1|  para-aminobenzoate synthase amidotransfera...  91.7    5e-17
gb|AAF82321.1|  anthranilate synthase small subunit [Buchnera ...  91.7    5e-17
ref|ZP_06350668.1|  glutamine amidotransferase of anthranilate...  91.7    5e-17
ref|ZP_04581800.1|  anthranilate phosphoribosyltransferase [He...  91.7    5e-17
ref|YP_262682.1|  anthranilate synthase component II [Pseudomo...  91.7    5e-17
ref|YP_001129939.1|  anthranilate synthase component II [Prost...  91.7    5e-17
ref|ZP_06202796.1|  anthranilate synthase component II [Bacter...  91.3    5e-17
ref|ZP_01127744.1|  Anthranilate/para-aminobenzoate synthase c...  91.3    5e-17
ref|YP_984697.1|  anthranilate synthase component II [Acidovor...  91.3    5e-17
ref|YP_001443367.1|  para-aminobenzoate synthase component II ...  91.3    5e-17
ref|YP_931403.1|  anthranilate synthase component II [Pyrobacu...  91.3    5e-17
ref|ZP_05376929.1|  glutamine amidotransferase of anthranilate...  91.3    5e-17
ref|NP_462372.1|  para-aminobenzoate synthase component II [Sa...  91.3    5e-17
ref|ZP_01062382.1|  anthranilate synthase component II [Leeuwe...  91.3    5e-17
ref|ZP_01791770.1|  anthranilate synthase component II [Haemop...  91.3    5e-17
ref|YP_001291623.1|  anthranilate synthase component II [Haemo...  91.3    5e-17
gb|EEZ80059.1|  anthranilate/para-aminobenzoate synthase compo...  91.3    5e-17
ref|ZP_06034374.1|  para-aminobenzoate synthase amidotransfera...  91.3    5e-17
ref|ZP_03613173.1|  para-aminobenzoate/anthranilate synthase g...  91.3    5e-17
ref|ZP_04808568.1|  anthranilate synthase component II [Helico...  91.3    5e-17
ref|ZP_01226231.1|  anthranilate synthase [Aurantimonas mangan...  91.3    5e-17
ref|YP_001543373.1|  glutamine amidotransferase of anthranilat...  91.3    5e-17
ref|ZP_01167105.1|  Glutamine amidotransferase of anthranilate...  91.3    5e-17
ref|YP_001927839.1|  glutamine amidotransferase of anthranilat...  91.3    5e-17
ref|YP_003398003.1|  glutamine amidotransferase of anthranilat...  91.3    5e-17
ref|ZP_03657161.1|  anthranilate phosphoribosyltransferase [He...  91.3    5e-17
ref|YP_003239128.1|  glutamine amidotransferase of anthranilat...  91.3    5e-17
ref|ZP_02666535.1|  aminodeoxychorismate synthase, component I...  91.3    5e-17
ref|NP_289908.1|  para-aminobenzoate synthase component II [Es...  91.3    5e-17
ref|NP_240957.1|  para-aminobenzoate/anthranilate synthase glu...  91.3    5e-17
ref|ZP_05879820.1|  para-aminobenzoate synthase amidotransfera...  91.3    5e-17
ref|ZP_04058410.1|  anthranilate synthase component II [Capnoc...  91.3    5e-17
ref|YP_001754315.1|  glutamine amidotransferase of anthranilat...  91.3    5e-17
gb|AAF82315.1|  anthranilate synthase small subunit [Buchnera ...  91.3    5e-17
ref|YP_173615.1|  para-aminobenzoate/anthranilate synthase glu...  91.3    5e-17
ref|YP_787648.1|  anthranilate synthase component II [Bordetel...  91.3    6e-17
ref|YP_003426620.1|  para-aminobenzoate/anthranilate synthase ...  91.3    6e-17
ref|ZP_01363533.1|  hypothetical protein PaerPA_01000631 [Pseu...  91.3    6e-17
ref|ZP_03823064.1|  anthranilate synthase component II (glutam...  91.3    6e-17
ref|ZP_04640768.1|  Para-aminobenzoate synthase glutamine amid...  91.3    6e-17
ref|ZP_03394616.1|  para-aminobenzoate/anthranilate synthase g...  91.3    6e-17
ref|ZP_04403006.1|  para-aminobenzoate synthase amidotransfera...  91.3    6e-17
ref|YP_001525123.1|  glutamine amidotransferase of anthranilat...  91.3    6e-17
ref|ZP_05897847.1|  anthranilate synthase component II [Seleno...  91.3    6e-17
ref|YP_001561799.1|  glutamine amidotransferase of anthranilat...  91.3    6e-17
emb|CBL11726.1|  anthranilate synthase, component II [Roseburi...  91.3    6e-17
ref|NP_377160.1|  anthranilate synthase component II [Sulfolob...  90.9    6e-17
ref|ZP_06038123.1|  para-aminobenzoate synthase amidotransfera...  90.9    6e-17
ref|YP_662394.1|  glutamine amidotransferase of anthranilate s...  90.9    6e-17
ref|YP_448097.1|  TrpG [Methanosphaera stadtmanae DSM 3091] >g...  90.9    6e-17
ref|YP_003473645.1|  glutamine amidotransferase of anthranilat...  90.9    6e-17
ref|YP_003407216.1|  glutamine amidotransferase of anthranilat...  90.9    6e-17
ref|YP_001003647.1|  glutamine amidotransferase of anthranilat...  90.9    6e-17
ref|YP_003290325.1|  glutamine amidotransferase of anthranilat...  90.9    7e-17
ref|YP_634206.1|  putative anthranilate synthase, glutamine am...  90.9    7e-17
ref|ZP_01977782.1|  para-aminobenzoate synthase glutamine amid...  90.9    7e-17
ref|YP_116283.1|  para-aminobenzoate synthase component II [No...  90.9    7e-17
ref|NP_232247.1|  para-aminobenzoate synthase component II [Vi...  90.9    7e-17
ref|ZP_02957825.1|  para-aminobenzoate synthase glutamine amid...  90.9    7e-17
ref|YP_272970.1|  anthranilate synthase component II [Pseudomo...  90.9    7e-17
ref|ZP_06056133.1|  anthranilate synthase [Acinetobacter calco...  90.9    7e-17
ref|ZP_02171903.1|  Anthranilate/para-aminobenzoate synthase c...  90.9    7e-17
ref|YP_653207.1|  para-aminobenzoate synthase component II [Ye...  90.9    7e-17
ref|YP_001983122.1|  anthranilate synthase component II [Cellv...  90.9    7e-17
ref|ZP_04416844.1|  para-aminobenzoate synthase amidotransfera...  90.9    7e-17
ref|YP_416700.1|  anthranilate synthase component II [Staphylo...  90.9    7e-17
ref|YP_003088160.1|  glutamine amidotransferase of anthranilat...  90.9    7e-17
ref|NP_698561.1|  anthranilate synthase [Brucella suis 1330] >...  90.9    8e-17
ref|NP_053972.1|  anthranilate synthase component 2 [Porphyra ...  90.9    8e-17
ref|YP_003002653.1|  glutamine amidotransferase of anthranilat...  90.9    8e-17
ref|YP_001847212.1|  anthranilate/para-aminobenzoate synthase ...  90.9    8e-17
ref|ZP_03803181.1|  hypothetical protein PROPEN_01536 [Proteus...  90.5    8e-17
gb|AAT50762.1|  PA0649 [synthetic construct]                       90.5    8e-17
ref|ZP_04615498.1|  Para-aminobenzoate synthase glutamine amid...  90.5    8e-17
ref|YP_002152523.1|  para-aminobenzoate synthase glutamine ami...  90.5    8e-17
ref|YP_218390.1|  para-aminobenzoate synthase component II [Sa...  90.5    8e-17
ref|ZP_00154865.2|  COG0512: Anthranilate/para-aminobenzoate s...  90.5    8e-17
ref|ZP_06691989.1|  conserved hypothetical protein [Acinetobac...  90.5    8e-17
gb|AAB02276.1|  anthranilate synthase small subunit [Buchnera ...  90.5    8e-17
ref|ZP_04150291.1|  Anthranilate synthase component II [Bacill...  90.5    8e-17
ref|YP_002228706.1|  para-aminobenzoate synthase component II ...  90.5    8e-17
ref|ZP_05031821.1|  class I glutamine amidotransferase, putati...  90.5    8e-17
ref|YP_563454.1|  anthranilate synthase component II [Shewanel...  90.5    8e-17

ALIGNMENTS
>ref|ZP_05068906.1| anthranilate synthase component II (Glutamine amido-transferase) 
[Candidatus Pelagibacter sp. HTCC7211]
 gb|EDZ59905.1| anthranilate synthase component II (Glutamine amido-transferase) 
[Candidatus Pelagibacter sp. HTCC7211]
Length=185

 Score =  257 bits (657),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 136/185 (73%), Positives = 156/185 (84%), Gaps = 0/185 (0%)

Query  14   MIYIIDHNDSFTFNVVHQFSKFDEVICDNYDRVNNDILEKASSIVLSPGPGNPKNYPKSS  73
            MIY+IDH DSFT NVVHQFS FD V+CD++ ++NN  L +AS+IV SPGPG+PK+YP SS
Sbjct  1    MIYVIDHKDSFTHNVVHQFSLFDNVVCDDFSKINNSKLNQASTIVFSPGPGSPKDYPLSS  60

Query  74   KIYKKYKGKKRIIGICLGFQQILYNEGAKIVEQKNIYHGFQSEIKVTNNSKIFNNNSVFK  133
            KIYKK+KGKK+IIGICLGFQQIL+ EGA I+EQ  IYHGFQSE+ V  +SK+FN    FK
Sbjct  61   KIYKKFKGKKKIIGICLGFQQILFCEGASIIEQSKIYHGFQSEVLVNKSSKLFNTGRKFK  120

Query  134  VGRYHSLKLKEPFNKTNFDITMRCKITNVAMAFENNLDKIYGFQFHPESFLTLNGNFLIK  193
            VGRYHSLKLKEPF   NFDITMRC I+  AM+FENN+DKIYGFQFHPESFLTLNG  LIK
Sbjct  121  VGRYHSLKLKEPFVAENFDITMRCVISGAAMSFENNIDKIYGFQFHPESFLTLNGKILIK  180

Query  194  KILSA  198
            KILSA
Sbjct  181  KILSA  185


>ref|ZP_01264011.1| Anthranilate synthase component II (Glutamine amido-transferase) 
[Candidatus Pelagibacter ubique HTCC1002]
 gb|EAS84498.1| Anthranilate synthase component II (Glutamine amido-transferase) 
[Candidatus Pelagibacter ubique HTCC1002]
Length=185

 Score =  248 bits (632),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 153/185 (82%), Gaps = 0/185 (0%)

Query  14   MIYIIDHNDSFTFNVVHQFSKFDEVICDNYDRVNNDILEKASSIVLSPGPGNPKNYPKSS  73
            MIYIIDH+DSFT NVVHQF  FDEV+C N++ +N + L+KA  IV SPGPG PK+YP SS
Sbjct  1    MIYIIDHHDSFTQNVVHQFQNFDEVVCTNFNEINQNKLKKADIIVFSPGPGAPKDYPISS  60

Query  74   KIYKKYKGKKRIIGICLGFQQILYNEGAKIVEQKNIYHGFQSEIKVTNNSKIFNNNSVFK  133
            +IYKK+KGKK+IIGICLGFQQIL+ E  KIVEQK IYHGFQS+IKVT+ + +F  NS F 
Sbjct  61   EIYKKFKGKKKIIGICLGFQQILHCENGKIVEQKKIYHGFQSKIKVTSKNSLFKKNSQFT  120

Query  134  VGRYHSLKLKEPFNKTNFDITMRCKITNVAMAFENNLDKIYGFQFHPESFLTLNGNFLIK  193
            VGRYHSLKLKEPF   NF+ITMRC I+N AM  ENN +KIYGFQFHPESFLT NGN LIK
Sbjct  121  VGRYHSLKLKEPFAAKNFEITMRCAISNTAMTIENNKEKIYGFQFHPESFLTENGNLLIK  180

Query  194  KILSA  198
            KILSA
Sbjct  181  KILSA  185


>ref|YP_266252.1| anthranilate synthase component II (glutamine amido-transferase) 
[Candidatus Pelagibacter ubique HTCC1062]
 gb|AAZ21649.1| Anthranilate synthase component II (Glutamine amido-transferase) 
[Candidatus Pelagibacter ubique HTCC1062]
Length=185

 Score =  246 bits (628),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 133/185 (71%), Positives = 153/185 (82%), Gaps = 0/185 (0%)

Query  14   MIYIIDHNDSFTFNVVHQFSKFDEVICDNYDRVNNDILEKASSIVLSPGPGNPKNYPKSS  73
            MIYIIDH+DSFT NVVHQF  FDEV+C N++ +N + L+KA  IV SPGPG PK+YP SS
Sbjct  1    MIYIIDHHDSFTQNVVHQFQNFDEVVCTNFNEINQNKLKKADIIVFSPGPGAPKDYPISS  60

Query  74   KIYKKYKGKKRIIGICLGFQQILYNEGAKIVEQKNIYHGFQSEIKVTNNSKIFNNNSVFK  133
            +IYKK+KGKK+IIGICLGFQQIL+ E  KIVEQK IYHGFQS+IKVT+ + +F  NS F 
Sbjct  61   EIYKKFKGKKKIIGICLGFQQILHCENGKIVEQKKIYHGFQSKIKVTSKNSLFKKNSQFT  120

Query  134  VGRYHSLKLKEPFNKTNFDITMRCKITNVAMAFENNLDKIYGFQFHPESFLTLNGNFLIK  193
            VGRYHSLKLKEPF   NF+ITMRC I+N AM  ENN +KI+GFQFHPESFLT NGN LIK
Sbjct  121  VGRYHSLKLKEPFAAKNFEITMRCAISNTAMTIENNKEKIFGFQFHPESFLTENGNLLIK  180

Query  194  KILSA  198
            KILSA
Sbjct  181  KILSA  185


>ref|ZP_01255979.1| Anthranilate synthase component II (Glutamine amido-transferase) 
[Psychroflexus torquis ATCC 700755]
Length=185

 Score =  243 bits (620),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 151/185 (81%), Gaps = 0/185 (0%)

Query  14   MIYIIDHNDSFTFNVVHQFSKFDEVICDNYDRVNNDILEKASSIVLSPGPGNPKNYPKSS  73
            MIYIIDH DSFT+NVVHQF+KFDEV C NY  +NN +L ++  IVLSPGPG+PK+YP SS
Sbjct  1    MIYIIDHQDSFTWNVVHQFAKFDEVFCSNYYEINNKLLNRSDVIVLSPGPGSPKDYPISS  60

Query  74   KIYKKYKGKKRIIGICLGFQQILYNEGAKIVEQKNIYHGFQSEIKVTNNSKIFNNNSVFK  133
            KIYKKYKGKK+IIGICLG+Q ILYNEG KI++QK IYHGFQS+IK+ N S I+ NN  FK
Sbjct  61   KIYKKYKGKKKIIGICLGYQMILYNEGGKIIQQKKIYHGFQSKIKINNQSNIYKNNQQFK  120

Query  134  VGRYHSLKLKEPFNKTNFDITMRCKITNVAMAFENNLDKIYGFQFHPESFLTLNGNFLIK  193
            VGRYHSLKL EPF   +  ITMRC  T + M  E+N +KIYGFQFHPESFLT NGN LIK
Sbjct  121  VGRYHSLKLMEPFKSNSIKITMRCTKTKIPMGLEDNKNKIYGFQFHPESFLTENGNTLIK  180

Query  194  KILSA  198
            KILSA
Sbjct  181  KILSA  185


>ref|NP_267625.1| anthranilate synthase component II [Lactococcus lactis subsp. 
lactis Il1403]
 sp|Q02003.1|TRPG_LACLA RecName: Full=Anthranilate synthase component II; AltName: Full=Glutamine 
amido-transferase
 gb|AAK05567.1|AE006377_8 anthranilate synthase component II [Lactococcus lactis subsp. 
lactis Il1403]
 gb|AAA25224.1| anthranilate synthase beta subunit [Lactococcus lactis]
Length=198

 Score =  132 bits (331),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/182 (39%), Positives = 106/182 (58%), Gaps = 2/182 (1%)

Query  14   MIYIIDHNDSFTFNVVHQFSKFDEV-ICDNYDRVNNDILEKASSIVLSPGPGNPKNYPKS  72
            MI IID+ DSFT+N+V       +V +  N D    ++ EKA +++ SPGPG P +  K 
Sbjct  1    MILIIDNYDSFTYNLVQYVGVLTDVAVVKNDDDSLGNMAEKADALIFSPGPGWPADAGKM  60

Query  73   SKIYKKYKGKKRIIGICLGFQQILYNEGAKIVEQKNIYHGFQSEIKVTNNSKIFNN-NSV  131
              + +++ G+K I+GICLGFQ I+   G K+     + HG  S+++ T+ + IFN+  S 
Sbjct  61   ETLIQQFAGQKPILGICLGFQAIVEVFGGKLRLAHQVMHGKNSQVRQTSGNLIFNHLPSK  120

Query  132  FKVGRYHSLKLKEPFNKTNFDITMRCKITNVAMAFENNLDKIYGFQFHPESFLTLNGNFL  191
            F V RYHS+ + E     +F IT         MA EN  ++IYG QFHPES  TL+G  +
Sbjct  121  FLVMRYHSIVMDEAVALPDFAITAVATDDGEIMAIENEKEQIYGLQFHPESIGTLDGMTM  180

Query  192  IK  193
            I+
Sbjct  181  IE  182


>ref|YP_003354001.1| Anthranilate synthase component II [Lactococcus lactis subsp. 
lactis KF147]
 gb|ADA65234.1| Anthranilate synthase component II [Lactococcus lactis subsp. 
lactis KF147]
Length=198

 Score =  131 bits (330),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 106/182 (58%), Gaps = 2/182 (1%)

Query  14   MIYIIDHNDSFTFNVVHQFSKFDEV-ICDNYDRVNNDILEKASSIVLSPGPGNPKNYPKS  72
            MI IID+ DSFT+N+V       +V +  N D    ++ EKA +++ SPGPG P +  K 
Sbjct  1    MILIIDNYDSFTYNLVQYVGALTDVAVVKNDDDSLENMAEKADALIFSPGPGWPADAGKM  60

Query  73   SKIYKKYKGKKRIIGICLGFQQILYNEGAKIVEQKNIYHGFQSEIKVTNNSKIFNN-NSV  131
              + +++ G+K I+GICLGFQ I+   G K+     + HG  S+++ T+ + +FN+  S 
Sbjct  61   ETLIQQFAGQKPILGICLGFQAIVEVFGGKLRLAHQVMHGKNSQVRQTSGNLLFNHLPSK  120

Query  132  FKVGRYHSLKLKEPFNKTNFDITMRCKITNVAMAFENNLDKIYGFQFHPESFLTLNGNFL  191
            F V RYHS+ + E     +F IT         MA EN  ++IYG QFHPES  TL+G  +
Sbjct  121  FLVMRYHSIVMDEAVALPDFAITAVATDDGEIMAIENEKEQIYGLQFHPESIGTLDGMTM  180

Query  192  IK  193
            I+
Sbjct  181  IE  182


>ref|YP_001032349.1| anthranilate synthase component II [Lactococcus lactis subsp. 
cremoris MG1363]
 emb|CAL97625.1| anthranilate synthase component II [Lactococcus lactis subsp. 
cremoris MG1363]
Length=193

 Score =  128 bits (322),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/182 (37%), Positives = 103/182 (56%), Gaps = 2/182 (1%)

Query  14   MIYIIDHNDSFTFNVVHQFSKFDEV-ICDNYDRVNNDILEKASSIVLSPGPGNPKNYPKS  72
            MI IID+ DSFT+N+V       +V +  N D     +++ A +++ SPGPG P +  K 
Sbjct  1    MILIIDNYDSFTYNLVQYVGALTDVAVVRNDDENLEKMVQNADALIFSPGPGWPADAGKM  60

Query  73   SKIYKKYKGKKRIIGICLGFQQILYNEGAKIVEQKNIYHGFQSEIKVTNNSKIFNN-NSV  131
              + +++ G+K I+GICLGFQ I+   G K+     + HG  S+++ T+ + IF    S 
Sbjct  61   EAMIQEFGGQKPILGICLGFQAIVEVFGGKLRLAHQVMHGKNSQVRQTSGNSIFKQLPSK  120

Query  132  FKVGRYHSLKLKEPFNKTNFDITMRCKITNVAMAFENNLDKIYGFQFHPESFLTLNGNFL  191
            F V RYHS+ + E     +F IT         MA EN  ++IYG QFHPES  TL+G  +
Sbjct  121  FWVMRYHSIVMDEAVALPDFAITALAMDDGEIMAIENEKEQIYGLQFHPESIGTLDGMIM  180

Query  192  IK  193
            I+
Sbjct  181  IE  182


>ref|YP_809487.1| anthranilate synthase component II [Lactococcus lactis subsp. 
cremoris SK11]
 gb|ABJ73065.1| anthranilate synthase, component II [Lactococcus lactis subsp. 
cremoris SK11]
Length=193

 Score =  128 bits (321),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/182 (37%), Positives = 102/182 (56%), Gaps = 2/182 (1%)

Query  14   MIYIIDHNDSFTFNVVHQFSKFDEV-ICDNYDRVNNDILEKASSIVLSPGPGNPKNYPKS  72
            MI IID+ DSFT+N+V       +V +  N D     + + A +++ SPGPG P +  K 
Sbjct  1    MILIIDNYDSFTYNLVQYVGALTDVAVVRNDDENLEKMAQNADALIFSPGPGWPADAGKM  60

Query  73   SKIYKKYKGKKRIIGICLGFQQILYNEGAKIVEQKNIYHGFQSEIKVTNNSKIFNN-NSV  131
              + +++ G+K I+GICLGFQ I+   G K+     + HG  S+++ T+ + IF    S 
Sbjct  61   EAMIQEFAGQKPILGICLGFQAIVEVFGGKLRLAHQVMHGKNSQVRQTSGNSIFKQLPSK  120

Query  132  FKVGRYHSLKLKEPFNKTNFDITMRCKITNVAMAFENNLDKIYGFQFHPESFLTLNGNFL  191
            F V RYHS+ + E     +F IT         MA EN  ++IYG QFHPES  TL+G  +
Sbjct  121  FWVMRYHSIVMDEAVALPDFAITALAMDDGEIMAIENEKEQIYGLQFHPESIGTLDGMIM  180

Query  192  IK  193
            I+
Sbjct  181  IE  182


>ref|ZP_03991894.1| anthranilate synthase component II [Oribacterium sinus F0268]
 gb|EEJ50889.1| anthranilate synthase component II [Oribacterium sinus F0268]
Length=192

 Score =  122 bits (305),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 101/184 (54%), Gaps = 5/184 (2%)

Query  14   MIYIIDHNDSFTFNVVHQFSKFD--EVICDNYDRVNNDILEKASSIVLSPGPGNPKNYPK  71
            MI +ID+ DSFTFN+    S+++  EVI ++   V      K + IVLSPGPG P+N   
Sbjct  1    MILLIDNYDSFTFNLYQMLSQYERVEVIRNDGKTVEEIEAMKPAGIVLSPGPGRPENSGI  60

Query  72   SSKIYKKYKGKKRIIGICLGFQQILYNEGAKIVEQKNIYHGFQSEIKVTNNSKIFNN-NS  130
              ++ +  +GK  I+G+CLG Q I    G  +       HG QSE+ +  +S++F     
Sbjct  61   CPQVIRSLRGKIPILGVCLGEQAICQVYGGTVSHAIKPMHGRQSEVDIVEDSELFKGLGR  120

Query  131  VFKVGRYHSL-KLKEPFNKTNFDITMRCKITNVAMAFENNLDKIYGFQFHPESFLTLNGN  189
              KV RYHSL   +E    T   IT + K   V MA E+   K+YG QFHPES +T +G 
Sbjct  121  KMKVARYHSLIAEEESLEGTELRITGKTKQEEV-MAVEDRERKVYGVQFHPESIMTKDGA  179

Query  190  FLIK  193
             +++
Sbjct  180  KILE  183


>ref|ZP_02919820.1| hypothetical protein STRINF_00672 [Streptococcus infantarius 
subsp. infantarius ATCC BAA-102]
 gb|EDT48105.1| hypothetical protein STRINF_00672 [Streptococcus infantarius 
subsp. infantarius ATCC BAA-102]
Length=189

 Score =  121 bits (303),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 72/185 (38%), Positives = 105/185 (56%), Gaps = 10/185 (5%)

Query  14   MIYIIDHNDSFTFNVVHQFSKFDEVICDNYDRVNNDILEKA----SSIVLSPGPGNPKNY  69
            MI +ID+ DSFT+N+      F EV      R + D LEKA    S+IVLSPGPG P + 
Sbjct  1    MILLIDNYDSFTYNLAQYLGTFAEV---KVLRNDADALEKAAKEASAIVLSPGPGWPADA  57

Query  70   PKSSKIYKKYKGKKRIIGICLGFQQILYNEGAKIVEQKNIYHGFQSEIKVTNNSKIFNNN  129
             K  ++ +K+ GKK ++GICLG Q I  + G K+   KN+ HG QS+I V + S IF   
Sbjct  58   GKLEEMIQKFAGKKPMLGICLGHQAIAESFGGKLGLAKNVMHGKQSDIDVLSQSPIFAGL  117

Query  130  SV-FKVGRYHSLKLKEPFNKTNFDITMRCKITNVAMAFENNLDKIYGFQFHPESFLTLNG  188
            +    + RYHS+ + +     +F++T +       MA ++    IYG QFHPES  + +G
Sbjct  118  ARNMPIMRYHSIVVTD--MPDDFEVTAKTTDDQEIMAIQHKQLPIYGLQFHPESIGSPDG  175

Query  189  NFLIK  193
              +I+
Sbjct  176  LKMIE  180


>ref|YP_001181004.1| glutamine amidotransferase of anthranilate synthase [Caldicellulosiruptor 
saccharolyticus DSM 8903]
 gb|ABP67813.1| anthranilate synthase, component II [Caldicellulosiruptor saccharolyticus 
DSM 8903]
Length=203

 Score =  119 bits (299),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 110/192 (57%), Gaps = 13/192 (6%)

Query  14   MIYIIDHNDSFTFNVVHQFSKFDEVICDNYDRVNNDILEK--ASSIVLSPGPGNPKNYPK  71
            MI +ID+ DSFTFN+    +   +V+    D+V  + ++K   + I++SPGPG+PK+   
Sbjct  1    MILLIDNYDSFTFNIYQMIASKTQVVVFRNDKVTIETIQKLNPAGIIISPGPGSPKDAGI  60

Query  72   SSKIYKKYKGKKRIIGICLGFQQILYNEGAKIVEQKNIYHGFQSEIKVTNNSKIFNNNSV  131
            SS++ K++ G   I+G+CLG Q I    GA++V  K+IYHG +S + +    K    + +
Sbjct  61   SSEVVKRFAGVVPILGVCLGHQVIGECFGARVVHAKSIYHGMRSRVDLLEAGK---RSPL  117

Query  132  FK-------VGRYHSLKLKEPFNKTNFDITMRCKITNVAMAFENNLDKIYGFQFHPESFL  184
            +K        GRYHSL +++  +    +I    +   V M+  N+  KIYG QFHPES L
Sbjct  118  YKCVPDRFFAGRYHSLVVEKTASLQGLEIAAVSEDDEV-MSILNDELKIYGIQFHPESIL  176

Query  185  TLNGNFLIKKIL  196
            T +G  +++  L
Sbjct  177  TPDGEKILQNFL  188


>ref|YP_001129185.1| anthranilate synthase component II [Streptococcus pyogenes str. 
Manfredo]
 emb|CAM30988.1| anthranilate synthase component II [Streptococcus pyogenes str. 
Manfredo]
Length=188

 Score =  119 bits (297),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 103/187 (55%), Gaps = 4/187 (2%)

Query  14   MIYIIDHNDSFTFNVVHQFSKFDE-VICDNYDRVNNDILEKASSIVLSPGPGNPKNYPKS  72
            MI +ID+ DSFT+N+    SKFDE ++  N D    D+ +KA+++VLSPGPG PK   + 
Sbjct  1    MILLIDNYDSFTYNLAQYLSKFDETIVLYNQDPNLYDMAKKANALVLSPGPGRPKEANQM  60

Query  73   SKIYKKYKGKKRIIGICLGFQQILYNEGAKIVEQKNIYHGFQSEIKVTNNSKIFNN-NSV  131
             K+ + +   K I+G+CLG Q I    G  +   K + HG QS I+    + +F +    
Sbjct  61   PKLIQDFYQTKPILGVCLGHQAIAETLGGTLRLAKRVMHGRQSTIETQGPASLFRSLPQE  120

Query  132  FKVGRYHSLKLKEPFNKTNFDITMRCKITNVAMAFENNLDKIYGFQFHPESFLTLNGNFL  191
              V RYHS+ + +      F +T R       MAFE++   ++G QFHPES  T +G  +
Sbjct  121  ITVMRYHSIVVDQ--LPKGFSVTARDCDDQEIMAFEHHTLPLFGLQFHPESIGTPDGMTM  178

Query  192  IKKILSA  198
            I   ++A
Sbjct  179  IANFIAA  185