GOS 1513030

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1093012272041
Annotathon code: GOS_1513030
Sample :
  • GPS :17°27'11s; 149°47'56w
  • Polynesia Archipelagos: Moorea, Outside Cooks Bay - Fr. Polynesia
  • Coastal (-1.4m, 28.8°C, 0.1-0.8 microns)
Authors
Team : Algarve
Username : grhmgr
Annotated on : 2010-08-12 17:48:55
  • a29857 NunoPanascoGranadeiro
  • a30908 HélderManuelRibeiro
  • a30913 TiagoMiguelTrancosdeMiraGrosso

Synopsis

  • Taxonomy: Alphaproteobacteria (NCBI info)
    Rank: class - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 28211
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order:
    Bacteria; Proteobacteria; Alphaproteobacteria;

Genomic Sequence

>JCVI_READ_1093012272041 GOS_1513030 Genomic DNA
AAAGTCCTTAAGGGCTTAGAAGCTGTTAAAAAACGTCCTGGTATGTATATTGGAGATACAGACGATGGTTCTGGTCTTCATCACATGGTTTACGAGGTAG
TTGACAATTGTGTAGATGAAGCATTAGCTGGACATTGTTCAGAGATCACGGTTTCACTTTTTGATGGATCATTAGTAACTGTCAGAGATAATGGTCGTGG
AATACCCACCGATATTCATCCTGGAGAAGGTATATCTGCAGCAGAAGTTATAATGACTCAACTGCATGCTGGTGGTAAATTTGATCAAAACTCTTATAAG
GTTTCTGGCGGTCTACATGGAGTAGGCGTGTCAGTAGTTAATGCATTATCAGAATATTTAAAATTAACTATTTGGAGAGATGGCAAAGAACATTGTGCAA
CTTTTAAAAATGGAAATACTGAACAAAGTCTGGAAATTATTGGTAATTCAAATTCACTCACTGGTACAGAAATAACATTTCAGCCATCCACAGATATTTT
TACTAATATTAATTTTAATTTTAAAACATTAGAGTCAAGATTGCGTGAACTCGCATTTTTAAATGCTGGATTAAAAATAAAACTTACTGATAACAGAAAC
GATCAATCTAAAACAATAGATATGTTTTATGAAGGTGGTGTAAGTGAATTTGTAAAATTTATAGATAAGTCACGAACACCTTTGATGAATAAGCCTATTT
TTATATCAGGTATTAAGGACAATATTCAGATAGATACCGCGCTTTGGTGGAATGATGGATATAATGAAAATGTGTTTCCATTTACAAATAATATTCCACA
AAGAGATGGTGGTACTCATCTTGCAGGGTTGAGAGGTG

Translation

[1 - 837/838]   direct strand
>GOS_1513030 Translation [1-837   direct strand]
KVLKGLEAVKKRPGMYIGDTDDGSGLHHMVYEVVDNCVDEALAGHCSEITVSLFDGSLVTVRDNGRGIPTDIHPGEGISAAEVIMTQLHAGGKFDQNSYK
VSGGLHGVGVSVVNALSEYLKLTIWRDGKEHCATFKNGNTEQSLEIIGNSNSLTGTEITFQPSTDIFTNINFNFKTLESRLRELAFLNAGLKIKLTDNRN
DQSKTIDMFYEGGVSEFVKFIDKSRTPLMNKPIFISGIKDNIQIDTALWWNDGYNENVFPFTNNIPQRDGGTHLAGLRG

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

The sequence analyzed has 279 aa, has biological significance so is regarded as a coding sequence. There are no Start codon or STOP codon, so our sequence is incomplete. Based on the analysis of the blast and found that the e-values are quite good values (2e-114) with scores of 416 bits, which leads to the conclusion that our sequence has biological significance, and present some homologies.

With the results in the field of protein domain, there was found the ATPase domain, and that would lead us to think that we are possibly in the presence of a regulatory enzyme and that interacts selectively and non-covalent with the ATP, but the results of the MSA and the results of the Phylogenetic tree shows low bootstrap values for the taxa more specific, below 0.70, we can only conclude on the class of our sequence, an alpha-protobacteria, because the node that indicates the class presents a bootstrap of 0.97. Thus, we can conclude nothing about their biological function.



ORF finding

PROTOCOL

a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code


RESULTS ANALYSIS


Looking at the first ORF of the reading frame of the direct strand, we found that does not have Start codon, methionine, as it is initiated by the aminoacid K (lysine) encoded by AAA, and there is no Stop codon, the sequence is incomplete at the 5'ends and 3' ends. Internally, there are not stop codons, but our sequence is coding. There are no bigger ORF's, and the ORF of the reverse strand has no biological significance.




RAW RESULTS

a) direct strand

>ORF number 1 in reading frame 1 on the direct strand extends from base 1 to base 837.
AAAGTCCTTAAGGGCTTAGAAGCTGTTAAAAAACGTCCTGGTATGTATATTGGAGATACA
GACGATGGTTCTGGTCTTCATCACATGGTTTACGAGGTAGTTGACAATTGTGTAGATGAA
GCATTAGCTGGACATTGTTCAGAGATCACGGTTTCACTTTTTGATGGATCATTAGTAACT
GTCAGAGATAATGGTCGTGGAATACCCACCGATATTCATCCTGGAGAAGGTATATCTGCA
GCAGAAGTTATAATGACTCAACTGCATGCTGGTGGTAAATTTGATCAAAACTCTTATAAG
GTTTCTGGCGGTCTACATGGAGTAGGCGTGTCAGTAGTTAATGCATTATCAGAATATTTA
AAATTAACTATTTGGAGAGATGGCAAAGAACATTGTGCAACTTTTAAAAATGGAAATACT
GAACAAAGTCTGGAAATTATTGGTAATTCAAATTCACTCACTGGTACAGAAATAACATTT
CAGCCATCCACAGATATTTTTACTAATATTAATTTTAATTTTAAAACATTAGAGTCAAGA
TTGCGTGAACTCGCATTTTTAAATGCTGGATTAAAAATAAAACTTACTGATAACAGAAAC
GATCAATCTAAAACAATAGATATGTTTTATGAAGGTGGTGTAAGTGAATTTGTAAAATTT
ATAGATAAGTCACGAACACCTTTGATGAATAAGCCTATTTTTATATCAGGTATTAAGGAC
AATATTCAGATAGATACCGCGCTTTGGTGGAATGATGGATATAATGAAAATGTGTTTCCA
TTTACAAATAATATTCCACAAAGAGATGGTGGTACTCATCTTGCAGGGTTGAGAGGT

>Translation of ORF number 1 in reading frame 1 on the direct strand.
KVLKGLEAVKKRPGMYIGDTDDGSGLHHMVYEVVDNCVDEALAGHCSEITVSLFDGSLVT
VRDNGRGIPTDIHPGEGISAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSEYL
KLTIWRDGKEHCATFKNGNTEQSLEIIGNSNSLTGTEITFQPSTDIFTNINFNFKTLESR
LRELAFLNAGLKIKLTDNRNDQSKTIDMFYEGGVSEFVKFIDKSRTPLMNKPIFISGIKD
NIQIDTALWWNDGYNENVFPFTNNIPQRDGGTHLAGLRG

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

-----------------------------------------------------------------------------------------------------

b) reverse strand
No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 360 to base 545.
AATGTTATTTCTGTACCAGTGAGTGAATTTGAATTACCAATAATTTCCAGACTTTGTTCA
GTATTTCCATTTTTAAAAGTTGCACAATGTTCTTTGCCATCTCTCCAAATAGTTAATTTT
AAATATTCTGATAATGCATTAACTACTGACACGCCTACTCCATGTAGACCGCCAGAAACC
TTATAA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
NVISVPVSEFELPIISRLCSVFPFLKVAQCSLPSLQIVNFKYSDNALTTDTPTPCRPPET
L*

Multiple Alignement

PROTOCOL


a) CLUSTAL 2.0.12 multiple sequence alignment


RESULTS ANALYSIS


Analyzing the results obtained in the MSA, we found that several gap penalty (23) until there codons identical between our and the other ORF sequences chosen for comparison. Since there are a further 14 amino acids homologous among all sequences, until we get to the initiation methionine codon in ORF. Ie not determined the start of the ORF with the data of the MSA, as compared to ingroups and outgroups in the analysis, our most ORF is already quite small, and if we were to remove aa so that the ORF starts at methionine, would lose even more identity with them.

Given that the ingroups are all a-protobacteria, and the outgroups protobacteria beta and gamma, and that all present functions as the DNA gyrase subunit b, dna superelicoidização with the consumption of ATP, possibly beat the results of Clustal with the right to IntePro areas. But the fact that we can not conclude anything about the kind of our ORF, means that we can not conclude that our ORF also has the function mentioned above.



RAW RESULTS

CLUSTAL 2.0.12 multiple sequence alignment


GOS_1513030.20                      -----------------------KVLKGLEAVKKRPGMYIGDTDDGSGLH 27
Ruegeria_sp._R11_IN                 --MSGNEQAPAE-----YGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLH 43
Roseobacter_sp._SK209-2-6_IN        --MSENEQSPAE-----YGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLH 43
Silicibacter_sp._TrichCH4B_IN       --MSENEQAPTE-----YGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLH 43
Jannaschia_sp._CCS1_IN              --MNDIPASGDD-----YGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLH 43
Roseovarius_sp._TM1035_IN           --MSEPAAAPEE-----YGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLH 43
Rhodobacterales_bacterium_IN        --MSGNEQAPAE-----YGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLH 43
Dinoroseobacter_shibae_IN           --MAETAQVAEE-----YGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLH 43
Sulfitobacter_sp._IN                --MSDTDQLPEE-----YGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLH 43
Phaeobacter_gallaeciensis_IN        --MSGNEQAPAE-----YGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLH 43
Oceanicola_granulosus_IN            --MAEPERIPED-----YGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLH 43
Sagittula_stellata_E-37_IN          MGMSDQPSEAYE-----YGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLH 45
Oceanibulbus_indolifex_IN           --MSDTAQTPQE-----YGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLH 43
Methylobacterium_r._IN              --MADTPQTEPA----VYGAESIRVLKGLDAVRKRPGMYIGDTDDGSGLH 44
Citreicella_sp._SE45_IN             --MAEPAGAPQE-----YGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLH 43
alpha_proteobacterium_IN            --MSDDQIKSEE-----YGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLH 43
Hoeflea_phototrophica_IN            --MTDTPETDPT-VEAEYGADSIKVLKGLDAVRKRPGMYIGDTDDGSGLH 47
Octadecabacter_antarcticus_IN       --MTDEQQKPEE-----YGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLH 43
Beijerinckia_indica_subsp._IN       --MDEPASAPLTNEEQAYGADSIKVLRGLDAVRKRPGMYIGDTDDGSGLH 48
Rhizobium_etli_IE4771_IN            --MSDTSATENG-VSTEYGADSIKVLKGLDAVRKRPGMYIGDTDDGSGLH 47
Aggregatibacter_aphrophilu_OUT      --MSTNTPENYG-------ANSIKVLKGLDAVRKRPGMYIGDTDDGTGLH 41
Haemophilus_influenzae_OUT          --MSETTNDNYG-------ASSIKVLKGLDAVRKRPGMYIGDTDDGTGLH 41
Neisseria_meningitidis_OUT          --MTEQKHEEYG-------ADSIQVLEGLEAVRKRPGMYIGDTQDGSGLH 41
Coxiella_burnetii_RSA_OUT           --MSVSAPQKYD-------SSTIKVLKGLDAVRKRPGMYIGDTDDGSGLH 41
beta_proteobacterium_OUT            --MTEE-NKAYS-------SDSIKVLKGLEAVRKRPGMYIGDTSDGSGLH 40
                                                           :**.**:**:**********.**:***

GOS_1513030.20                      HMVYEVVDNCVDEALAGHCSEITVSLFDGSLVTVRDNGRGIPTDIHP--G 75
Ruegeria_sp._R11_IN                 HMVYEVVDNGIDEALAGHADRVVVKIHADSSVSVSDNGRGIPVDIHP--E 91
Roseobacter_sp._SK209-2-6_IN        HMVYEVVDNGIDEALAGHADHVTVKIHADSSVSVGDNGRGIPVDIHP--E 91
Silicibacter_sp._TrichCH4B_IN       HMVYEVVDNGIDEALAGHADRVTVTIHADSSVSVSDNGRGIPVDIHA--E 91
Jannaschia_sp._CCS1_IN              HMVYEVVDNGIDEALAGHADAVTVTLHADSSVSVSDNGRGIPVGIHE--E 91
Roseovarius_sp._TM1035_IN           HMVYEVVDNGIDEALAGHADAVNVTIHADSSVSVSDNGRGIPVDIHE--G 91
Rhodobacterales_bacterium_IN        HMVYEVVDNGIDEALAGHADHVTVKIHADSSVSVSDNGRGIPVGIHE--E 91
Dinoroseobacter_shibae_IN           HMVYEVVDNGIDEALAGHADAVNVKIHADSSVSVSDNGRGIPVGVHE--E 91
Sulfitobacter_sp._IN                HMVYEVVDNGIDEALAGHADAVNVTIHDDSSVSVSDNGRGIPVGIHQ--E 91
Phaeobacter_gallaeciensis_IN        HMVYEVVDNGIDEALAGHADRVVVKIHADSSVSVNDNGRGIPVGIHE--E 91
Oceanicola_granulosus_IN            HMVYEVVDNGIDEALAGHADHVHVKIHADSSVSVSDNGRGIPVDIHQ--G 91
Sagittula_stellata_E-37_IN          HMVYEVVDNGIDEALAKHADYVHVKIHADSSVSVRDNGRGIPTDIHA--E 93
Oceanibulbus_indolifex_IN           HMVYEVVDNGIDEALAGHADAVTVTIHEDSSVSVSDNGRGIPVGIHE--E 91
Methylobacterium_r._IN              HMVYEVVDNAIDEALAGHADLVTVTLNADGSCTVSDNGRGIPVDIHK--E 92
Citreicella_sp._SE45_IN             HMVYEVVDNGIDEALAGHADFVRVKIHADNSVSVRDNGRGIPVDMHH--E 91
alpha_proteobacterium_IN            HMVYEVVDNGIDEALAKHADFVSVTIHADESVSVRDNGRGVPVGIHE--E 91
Hoeflea_phototrophica_IN            HMVYEVVDNAIDEALAGHADRVTVTLNPDGSVTVTDNGRGIPTDMHQ--G 95
Octadecabacter_antarcticus_IN       HMVYEVVDNGIDEALAGHADAVNVKIHDDGSVSVSDNGRGIPVGIHE--G 91
Beijerinckia_indica_subsp._IN       HMIYEVVDNAIDEALAGHATRVTVTLNADGSVTVTDDGRGIPTDIHA--E 96
Rhizobium_etli_IE4771_IN            HMVYEVVDNAIDEALAGHADIVTVSLNPDGSVTVTDNGRGIPTDIHS--G 95
Aggregatibacter_aphrophilu_OUT      HMVFEVVDNAIDEALAGYCDDIVVTIHSDNSVSVQDDGRGIPVDIHP--E 89
Haemophilus_influenzae_OUT          HMVFEVVDNAIDEALAGHCSDIIVTIHDDNSVSVQDDGRGIPVDIHP--E 89
Neisseria_meningitidis_OUT          HMVFEVLDNAIDEALAGHCDKITVTIHADHSVSVADNGRGMPTGIHP--K 89
Coxiella_burnetii_RSA_OUT           HMVFEVVDNSIDEALAGFCSHIWVTIHADGSVSVRDNGRGIPTDIHP--E 89
beta_proteobacterium_OUT            HMVFEVLDNAIDEALAGHCDDIKVIIHPDNSVSVQDNGRGIPTDIKEDDE 90
                                    **::**:** :***** ..  : * :  .   :* *:***:*..::    

GOS_1513030.20                      EGISAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSEYLKLTIW 125
Ruegeria_sp._R11_IN                 EGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDWLELRIW 141
Roseobacter_sp._SK209-2-6_IN        EGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDWLELRIW 141
Silicibacter_sp._TrichCH4B_IN       EGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDWLELRIW 141
Jannaschia_sp._CCS1_IN              EGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDWLELRIW 141
Roseovarius_sp._TM1035_IN           EGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSEWLELRIW 141
Rhodobacterales_bacterium_IN        EGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDWLELRIW 141
Dinoroseobacter_shibae_IN           EGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDWLELRIW 141
Sulfitobacter_sp._IN                EGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDWLELRIW 141
Phaeobacter_gallaeciensis_IN        EGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDWLELRIW 141
Oceanicola_granulosus_IN            EGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSVWLELRVW 141
Sagittula_stellata_E-37_IN          EGVSAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSVWLELRIW 143
Oceanibulbus_indolifex_IN           EGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDWLELRIW 141
Methylobacterium_r._IN              EGVSAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSSWLRLRIW 142
Citreicella_sp._SE45_IN             EGVSAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSVWLELRIW 141
alpha_proteobacterium_IN            EGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDWLELKIW 141
Hoeflea_phototrophica_IN            EGISAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSVWLKLVVR 145
Octadecabacter_antarcticus_IN       EGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDYLELRIW 141
Beijerinckia_indica_subsp._IN       EGVSAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSTWLKLRIW 146
Rhizobium_etli_IE4771_IN            EGVSAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSVWLKLKIR 145
Aggregatibacter_aphrophilu_OUT      EGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSDKLQLTIR 139
Haemophilus_influenzae_OUT          EGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSDKLQLTIR 139
Neisseria_meningitidis_OUT          EGRSAAEVIMTVLHAGGKFDNNSYKISGGLHGVGVSVVNALSDWVTLTIY 139
Coxiella_burnetii_RSA_OUT           EGRSAAEVIMTVLHAGGKFDKNAYKVSGGLHGVGISVVNALSEELYMTIR 139
beta_proteobacterium_OUT            EKRSAAEIVMTELHAGGKFDQNSYKVSGGLHGVGVSVVNALSDWLKLKVH 140
                                    *  ****::** ********.*:**:********:*******  : : : 

GOS_1513030.20                      RDGKEHCATFKNGNTEQSLEIIGNSNSLTG-----TEITFQPSTDIFTNI 170
Ruegeria_sp._R11_IN                 RNGKEHVARFERGDTAKHLTVVGDCGDQTG-----TEVRFLASTDTFSNL 186
Roseobacter_sp._SK209-2-6_IN        RNGKEHVARFERGDTAKHLEVVGDCGDRTG-----TEVRFMASTDTFSNL 186
Silicibacter_sp._TrichCH4B_IN       RNGKEHVARFERGDTVKHLAVVGDCGDRTG-----TEVRFLASTDTFSNL 186
Jannaschia_sp._CCS1_IN              RDGKEHIARFEGGFTTKPLEVVSECGDRTG-----TEVRFMASTETFSNL 186
Roseovarius_sp._TM1035_IN           RNGKEHYARFEGGFTVESLRVVGDANGRKG-----TEVRFLASTETFSNL 186
Rhodobacterales_bacterium_IN        RDGKEHIARFERGDTVKHLEVVGDCGDRTG-----TEVRFMASTDTFSNL 186
Dinoroseobacter_shibae_IN           RDGKEHVARFEHGDTVKHLEVIGDAGDRTG-----TEVRFMASTGTFSNL 186
Sulfitobacter_sp._IN                REGKEHVARFEGGFTTKHLEVVGPT-ERTG-----TEVRFMASTETFSNL 185
Phaeobacter_gallaeciensis_IN        RDGKEHVARFERGDTAEHLKVVGDCGDQTG-----TEVRFLASTDTFSNL 186
Oceanicola_granulosus_IN            RNGKEHVARFEHGETVEHLKVVGDAHGRSG-----TEVRFLASTDTFSNL 186
Sagittula_stellata_E-37_IN          RNGKEHYAKFEHGETSEHLRVVGDAEGEQG-----TEVRFLASTDTFSNL 188
Oceanibulbus_indolifex_IN           REGKEHIARFEGGFTTKHLEVLGDT-DRTG-----TEVRFMASTDTFSNR 185
Methylobacterium_r._IN              RNDKEHAMEFRHGDAVAPLEVIGPGNGRRG-----TEVTFLPSTETFTMI 187
Citreicella_sp._SE45_IN             RNGKEHYAKFEHGETTEHLRVVGEAPGEKG-----TEVRFLASTGTFSNL 186
alpha_proteobacterium_IN            RDGKIHIARFEHGDTVKHLEIIGDANGETG-----TEVRFMASTETFSNR 186
Hoeflea_phototrophica_IN            RKGKIHEIRFTHGVADAPLQVLGDCGDETG-----TEVTFMPSSETFTMI 190
Octadecabacter_antarcticus_IN       RNGKEHYARFEGGFTVKHLEVVADCGDRTG-----TEVRFLASLDTFSNR 186
Beijerinckia_indica_subsp._IN       RDGKEHEITFEHGVAKSSLAVVGPAPEIDGKPKRGTEVTFLPSPETFSMV 196
Rhizobium_etli_IE4771_IN            RHGKIHEMSFTHGVADAPLKVTGEAPDETG-----TEVSFMPSSETFTMT 190
Aggregatibacter_aphrophilu_OUT      RQGKVHEQFYSLGDPKAPLAVIGETNQTG------TTVRFWPSPTIFTNI 183
Haemophilus_influenzae_OUT          RQGHVHEQFYHLGEPQSPLTVIGETEATG------TTVRFWPSSDIFAIT 183
Neisseria_meningitidis_OUT          RDGKEHFVRFVRGETEEPLKIVGDSDKKG------TTVRFLASTETFGNV 183
Coxiella_burnetii_RSA_OUT           QNGNVYTQTYKMGVPQAPLAVTGKSDKTG------TEIRFKPSNAIFSNT 183
beta_proteobacterium_OUT            RNNKIHEIEFARGERKESLKIIGDTDKTG------TEVQFLPSVSTFTDI 184
                                    :..: :   :  *     * : .            * : * .*   *   

GOS_1513030.20                      NFNFKTLESRLRELAFLNAGLKIKLTDNRNDQSKTIDMFYEGGVSEFVKF 220
Ruegeria_sp._R11_IN                 EYSFETLEKRLRELAFLNSGVRIILEDERPAEKLTAELFYEGGVKEFVKY 236
Roseobacter_sp._SK209-2-6_IN        EYSFETLEKRLRELAFLNSGVRIILEDERPAEKLTAELFYDGGVKEFVKY 236
Silicibacter_sp._TrichCH4B_IN       EYSFETLEKRLRELAFLNSGVRIVVTDERPAERLESELFYEGGVNEFVKY 236
Jannaschia_sp._CCS1_IN              DYVFKTLENRLRELAFLNSGVRIILRDERPAEALESDLFYEGGVREFVRY 236
Roseovarius_sp._TM1035_IN           EYIFETLEKRLRELAFLNSGVRIILTDERPTEPLRSELFYEGGVKEFVKY 236
Rhodobacterales_bacterium_IN        EYSFETLEKRLRELAFLNSGVRIILEDERPAEKITAELYYEGGVREFVKY 236
Dinoroseobacter_shibae_IN           DYSFKTLENRLRELAFLNSGVRIILEDERPAEPLRSELFYEGGVREFVRY 236
Sulfitobacter_sp._IN                DYSFETLEKRLRELAFLNSGVRIILTDERPAEPLRTELFYEGGVKEFVKY 235
Phaeobacter_gallaeciensis_IN        EYLFETLEKRLRELAFLNSGVRIILIDERPAERLEVELFYEGGVKEFVKY 236
Oceanicola_granulosus_IN            DYDFHTLEKRLRELAFLNSGVRIILEDDRPAEPLHVELFYEGGVKEFVKY 236
Sagittula_stellata_E-37_IN          DYDFHTLEKRLRELAFLNSGVRIILDDDRPAEPLHIELHYEGGVREFVKY 238
Oceanibulbus_indolifex_IN           EYIFETLEKRLRELAFLNSGVRIILTDERPVEPLRTELYYDGGVKEFVKY 235
Methylobacterium_r._IN              EFDYATLEKRLRELAFLNSGVRIVLTDARHAEKKREELYYEGGIEAFVRY 237
Citreicella_sp._SE45_IN             DFDFHTLEKRLRELAFLNSGVRIILEDERPAEPLRIELHYDGGVKEFVKY 236
alpha_proteobacterium_IN            EYVFKTLENRLRELAFLNSGVKIILRDERPTEHLETTLLYDGGVKEFVKF 236
Hoeflea_phototrophica_IN            DFDFGTLEHRLRELAFLNSGVRILLADRRHSDAKELELYYEGGLEAFVRY 240
Octadecabacter_antarcticus_IN       EFYFETLEKRLRELAFLNSGVRIILTDERPAEHLVSELYYDGGVKEFVKY 236
Beijerinckia_indica_subsp._IN       DFTYATIEHRLRELAFLNSGVRILLTDARGAEVKVEELHYEGGLEAFVRF 246
Rhizobium_etli_IE4771_IN            EFDYGTLEHRLRELAFLNSGVRILLTDKRHSDIKQEELRYDGGLEAFVAY 240
Aggregatibacter_aphrophilu_OUT      EFEYDTLAKRLRELSFLNSGVSIRLVDERNGK--EDHFHYEGGIQAFVEY 231
Haemophilus_influenzae_OUT          TFDYKILAKRLRELSFLNSGVSIRLIDKRDGS--EDHFHYEGGIQAFVEY 231
Neisseria_meningitidis_OUT          EYSFDILAKRIRELSFLNNGVDIELTDERDGK--HESFALSGGVAGFVQY 231
Coxiella_burnetii_RSA_OUT           EFHYDILAKRLRELAFLNLGVRIELTDERSGR--GDIFEYEGGIKAFVEH 231
beta_proteobacterium_OUT            NFHFEILAKRIRELSFLNNGVKIELIDHRTGK--SENFAFSGGVTGFVEY 232
                                     : :  :  *:***:*** *: * : * *        :  .**:  ** .

GOS_1513030.20                      IDKSRTPL--MNKPIFISGIKDNIQIDTALWWNDGYNENVFPFTNNIPQR 268
Ruegeria_sp._R11_IN                 LDRSKTPV--MDAPVYITGEKDDIGVEVAMWWNDSYHETVLPFTNNIPQR 284
Roseobacter_sp._SK209-2-6_IN        LDRHKTPV--MEAPVYIVGEKDDIGVEIAMWWNDSYHETVLPFTNNIPQR 284
Silicibacter_sp._TrichCH4B_IN       LDRSKTPV--MDAPIYIKGEKDDIGIEIAMWWNDSYHETVLPFTNNIPQR 284
Jannaschia_sp._CCS1_IN              LDRSKTSA--MEEPIFITGEKDDIGVEVAMWWNDSYHENVLPFTNNIPQR 284
Roseovarius_sp._TM1035_IN           LDRHKSPA--MPDPIFITGERDDIGIEVAMWWNDSYHETVLPFTNNIPQR 284
Rhodobacterales_bacterium_IN        LDRHKTPV--MDAPVYIVGEKDYIGVEIAMWWNDSYHETVLPFTNNIPQR 284
Dinoroseobacter_shibae_IN           LDRSKTSA--MEEPIFITGERDDIGIEVAMWWNDSYHETVLPFTNNIPQR 284
Sulfitobacter_sp._IN                LDRSKTSV--MPEPIFISGEKDDIGVEVAMWWNDSYHENVLPFTNNIPQR 283
Phaeobacter_gallaeciensis_IN        LDRSKSPV--MEAPIYITGDRDEIGVEVAMWWNDSYHETVLPFTNNIPQR 284
Oceanicola_granulosus_IN            LDRSKSAM--LPEPIHVEGMRDDITVEVAMWWNDSYNEMVLPFTNNIPQR 284
Sagittula_stellata_E-37_IN          LDRSKQAV--MPDPIYMEGEKDGIGVEVAMWWNDSYHENVLPFTNNIPQR 286
Oceanibulbus_indolifex_IN           LDRHKTSV--MPEPIFITGERDDIGIEVAMWWNDSYHENVLPFTNNIPQR 283
Methylobacterium_r._IN              LDRSRKPIDGMTSPVVVSSERDGIRVEVAFWWNDSFNETVLPFTNNIPQR 287
Citreicella_sp._SE45_IN             LDRSKQPM--MPDPIYMTGEKDGIGVEVAMWWNDSYHETVLPFTNNIPQR 284
alpha_proteobacterium_IN            LDRSKSSV--IEDPIYIIGEKDDITVECAMWWNDSYHENVLPFTNNIPQR 284
Hoeflea_phototrophica_IN            LDRSKKPL--VNDPVTLIGEKDGITVELAMWWNDSYHENVLCFTNNIPQR 288
Octadecabacter_antarcticus_IN       LDRSKTSI--LPEPIYVIGERDEIVVEVAMWWNDSYNEMVLPFTNNIPQR 284
Beijerinckia_indica_subsp._IN       LDRAKSPL--LDQPILIAGERDGITVEAALWWNDSYHEHVLAFTNNIPQR 294
Rhizobium_etli_IE4771_IN            LDRAKKSL--VDKPVAIRGEKDGITVEVAMWWNDSYHENVLCFTNNIPQR 288
Aggregatibacter_aphrophilu_OUT      INRGKTPI--HPKPFYFSAEKDGIGVEIALQWNDGYAENIYCFTNNIPQR 279
Haemophilus_influenzae_OUT          LNKNKNPI--HPKPFYFTAEKDGIGVEVALQWNDGVNENVYCFTNNIPQR 279
Neisseria_meningitidis_OUT          MNRKKTPL--HEKIFYAFGEKDGMSVECAMQWNDSYQESVQCFTNNIPQR 279
Coxiella_burnetii_RSA_OUT           LNKKKTPI--HSDVFHFSTEKNDIVVEVAMQWNDGFQETIFCFTNNIPQN 279
beta_proteobacterium_OUT            LNKTKTTI--HKNPFSAEGEKDGITVEVSMQWNDSYGENVQCFTNNIPQR 280
                                    ::: : .       .     :: : :: :: ***.  * :  *******.

GOS_1513030.20                      DGGTHLAGLRG--------------------------------------- 279
Ruegeria_sp._R11_IN                 DGGTHVAGFRGALTRTINNYAQSSGIAKKEKVSFTGDDAREGLTCVLSVK 334
Roseobacter_sp._SK209-2-6_IN        DGGTHVAGFRGALTRTINNYAQSSGIAKKEKVSFTGDDAREGLTCVLSVK 334
Silicibacter_sp._TrichCH4B_IN       DGGTHVAGFRGALTRTINNYAQSSGIAKKEKVSFTGDDAREGLTCVLSVK 334
Jannaschia_sp._CCS1_IN              DGGTHLAGFRGALTRTINLYAQSSGIAKKEKVSFTGDDAREGLTCVLSVK 334
Roseovarius_sp._TM1035_IN           DGGTHLAGFRGALTRTINTYAQTSGIAKKEKVTFTGDDAREGLTCVLSVK 334
Rhodobacterales_bacterium_IN        DGGTHVAGFRGALTRTINNYAQSSGIAKKEKVSFTGDDAREGLTCVLSVK 334
Dinoroseobacter_shibae_IN           DGGTHLAGFRGALTRTINAYAQSSGIAKREKVNFTGDDAREGLTCVLSVK 334
Sulfitobacter_sp._IN                DGGTHTAGFRGALTRTINNYAQSSGIAKKEKVSFTGDDAREGLTCVLSVK 333
Phaeobacter_gallaeciensis_IN        DGGTHVAGFRGALTRTINNYAQSSGIAKKEKVSFTGDDAREGLTCVLSVK 334
Oceanicola_granulosus_IN            DGGTHMAGFRAALTRTVTKYATESGIAKREKVNFTGDDMREGLTCVLSVK 334
Sagittula_stellata_E-37_IN          DGGTHLAGFRGALTRQLQKYAQESGIAKREKINFTGDDAREGLTAVLSVK 336
Oceanibulbus_indolifex_IN           DGGTHMAGFRGALTRTINGYAQSSGIAKREKINFTGDDAREGLTCVLSVK 333
Methylobacterium_r._IN              DGGTHMAGFRAALTRQVTGYAESSGIAKKEKVSLTGEDCREGLTAVISVQ 337
Citreicella_sp._SE45_IN             DGGTHLAGFRGALTRTLTRYATDSGIAKREKVNFTGDDAREGLTCVLSVK 334
alpha_proteobacterium_IN            DGGTHIAGFRGALTRTINNYAASSGIAKKEKVSFTGDDAREGLTCVLSVK 334
Hoeflea_phototrophica_IN            DGGTHMAGFRAALTRQMVSYADVSGMTKKEKVSLTGDDCREGLTAVLSVK 338
Octadecabacter_antarcticus_IN       DGGTHMAGFRAALTRTINNYAQSSGIAKREKISFTGDDAREGLTCVLSIK 334
Beijerinckia_indica_subsp._IN       DGGTHLTGLRSALTRQVTGYADRSGLIKREKVDLAPDDCREGLTCVLSVK 344
Rhizobium_etli_IE4771_IN            DGGTHMAGFRAALTRQVVSYADNSGITKKEKVTLQGEDCREGLTAVLSVK 338
Aggregatibacter_aphrophilu_OUT      DGGTHLAGFRGAMTRTLNNYMENEGYTKKSKVATSGDDAREGLVAVISVK 329
Haemophilus_influenzae_OUT          DGGTHLAGFRGALTRSLNSYMENEGMLKKEKVATSGDDAREGLVAIISVK 329
Neisseria_meningitidis_OUT          DGGTHLTALRQVMTRTINNYIEANEVAKKAKVETAGDDMREGLTCVLSVK 329
Coxiella_burnetii_RSA_OUT           DGGTHLAGFRAALTRTLNNYIEGEALAKKSKVTISGDDTREGLTVVLSVK 329
beta_proteobacterium_OUT            DGGTHLTGLRGAMTRTINTYIESNDLAKKAKVDTTGDDMREGLSCVLSVK 330
                                    ***** :.:*                                        

GOS_1513030.20                      --------------------------------------------------
Ruegeria_sp._R11_IN                 VPDPKFSSQTKDKLVSSEVRPVVESLVGEKLAEWFEENPNEAKQIVGKII 384
Roseobacter_sp._SK209-2-6_IN        VPDPKFSSQTKDKLVSSEVRPVVESLMGEKLAEWFEENPNQAKQIVGKIV 384
Silicibacter_sp._TrichCH4B_IN       VPDPKFSSQTKDKLVSSEVRPVVESLMGEKLAEWFEENPHVAKQVVGKII 384
Jannaschia_sp._CCS1_IN              VPDPKFSSQTKDKLVSSEVRPAVEGLVNEKLQEWFEEHPHEARVIVSKIV 384
Roseovarius_sp._TM1035_IN           VPDPKFSSQTKDKLVSSEVRPAVEGLVGEKLAEWFEENPQVARVIVGKII 384
Rhodobacterales_bacterium_IN        VPDPKFSSQTKDKLVSSEVRPVVESLMGEKLAEWFEENPNQAKQIVGKIV 384
Dinoroseobacter_shibae_IN           VPDPKFSSQTKDKLVSSEVRPAVEGLVNEKLGEWFEENPAQAKVIVGKII 384
Sulfitobacter_sp._IN                VPDPKFSSQTKDKLVSSEVRPAVEGLVNEKLAEWFEENPQIAKIVVGKII 383
Phaeobacter_gallaeciensis_IN        VPDPKFSSQTKDKLVSSEVRPVVESLVNEKLAEWFEENPNQAKQIVGKII 384
Oceanicola_granulosus_IN            VPDPKFSSQTKDKLVSSEVRPAVESLVSEKLAEWFEENPGQAKMIVSKIV 384
Sagittula_stellata_E-37_IN          VPDPKFSSQTKDKLVSSEVRPAVESLMNEKLGEWFEENPNEAKQITGKII 386
Oceanibulbus_indolifex_IN           VPDPKFSSQTKDKLVSSEVRPAVEGLVNEKLAEWFEENPAEAKQIVGKIV 383
Methylobacterium_r._IN              VPDPKFSSQTKDKLVSSEVRPAVENVLNEGLSTWLEENPSQARSVMGKVV 387
Citreicella_sp._SE45_IN             VPDPKFSSQTKDKLVSSEVRPAVENLVNEKLTEWFEEHPNEAKIIVGKIV 384
alpha_proteobacterium_IN            VPDPKFSSQTKDKLVSSEVRPVVESLMNEKLSEWFEENPAHAKEIVTKIV 384
Hoeflea_phototrophica_IN            VPDPKFSSQTKDKLVSSEVRPVVENLVNSTLSSWLEEHPTEAKTLVGKVI 388
Octadecabacter_antarcticus_IN       VPDPKFSSQTKDKLVSSEVRPAVENIMNEKLSEWFEENPQIAKIVVSKIV 384
Beijerinckia_indica_subsp._IN       VPDPKFSSQTKEKLVSSEVRPVVESLVNDKLGQWFEEHPQEARSIIGKVV 394
Rhizobium_etli_IE4771_IN            VPDPKFSSQTKDKLVSSE-------------------------------- 356
Aggregatibacter_aphrophilu_OUT      VPDPKFSSQTKDKLVSSEVKSAVESLMNEYLQTYLLENPNDVKIIVSKII 379
Haemophilus_influenzae_OUT          VPDPKFSSQTKDKLVSSEVKSAVESAMNEKMQEYLLENPADAKIIVNQII 379
Neisseria_meningitidis_OUT          LPDPKFSSQTKDKLVSGEIGPVVNEVISQALTDFLEENPNEAKIITGKIV 379
Coxiella_burnetii_RSA_OUT           VPDPKFSSQTKDKLVSSEVKPVVESTVAKQLHDYLLENPKQARIIAMKVI 379
beta_proteobacterium_OUT            VPEPKFSSQTKDKLVSSEVQPVVQDVVAKKLTDYLLEHPADAKIICGKIV 380
                                                                                      

GOS_1513030.20                      --------------------------------------------------
Ruegeria_sp._R11_IN                 EAALAREAARKARELTRRKTAMDVNYLAGKLKDCSEKDPSKTEVFLVEGD 434
Roseobacter_sp._SK209-2-6_IN        EAALAREAARKARELTRRKTAMDVNFLAGKLKDCSEKDPSKTEVFLVEGD 434
Silicibacter_sp._TrichCH4B_IN       EAALAREAARKARELTRRKTAMDVNFLAGKLKDCSEKDPSKTEVFLVEGD 434
Jannaschia_sp._CCS1_IN              EAALAREAARKARELTRRKTAMDIASLPGKLADCQEKDPSKSELFLVEGD 434
Roseovarius_sp._TM1035_IN           EAAHAREAARKARELTRRKNPMDVNFLAGKLKDCSSKDPSKTELFLVEGD 434
Rhodobacterales_bacterium_IN        EAALAREAARKARELTRRKTAMDVNYLAGKLKDCSEKDPSKTEVFLVEGD 434
Dinoroseobacter_shibae_IN           EAALAREAARKARELTRRKTAMDVASLPGKLADCQEKDPAHSELFLVEGD 434
Sulfitobacter_sp._IN                EAAHAREAARKARDLTRRKTAMDVNFLAGKLKDCSEKDPSKTEVFLVEGD 433
Phaeobacter_gallaeciensis_IN        EAALAREAARKARELTRRKTAMDVNYLAGKLKDCSEKDPSKTEVFLVEGD 434
Oceanicola_granulosus_IN            EAAQAREAARKARELTRRKTAMDVNYLAGKLKDCSEKDPTQTEVFLVEGD 434
Sagittula_stellata_E-37_IN          EAAMAREAARKARELTRRKTAMDVSFNAAKLKDCSEKDASKTELFLVEGD 436
Oceanibulbus_indolifex_IN           EAAQAREAARKARELTRRKSAMDVNFLAGKLKDCSEKDPSKTEVFLVEGD 433
Methylobacterium_r._IN              LAASAREAARKARETVTRKGALDIASLPGKLADCQERDPTKCEILLVEGD 437
Citreicella_sp._SE45_IN             EAALAREAARKARELTRRKNPMDVNFLAGKLKDCSEKDPSKTELFIVEGD 434
alpha_proteobacterium_IN            EAALAREAARKARELTRRKTAFGGTSLPGKLADCQQKDPSLSEIFIVEGD 434
Hoeflea_phototrophica_IN            EAAAAREAARKARELTRRKGALDIASLPGKLADCSERDPAKSELFLVEGD 438
Octadecabacter_antarcticus_IN       EAAHAREAARKARDLTRRKTAMDVNFLAGKLKDCSEKDPSKTEVFLVEGD 434
Beijerinckia_indica_subsp._IN       EAAQAREAARKARELTRRKGALDVANLPGKLADCQERDPAKAELFLVEGD 444
Rhizobium_etli_IE4771_IN            --------------------------------------------------
Aggregatibacter_aphrophilu_OUT      DAARAREAARKAREMTRRKGALDLGGLPGKLADCQERDPALSELYIVEGD 429
Haemophilus_influenzae_OUT          MAARAREAARKAREMTRRKGALDIAGLPGKLADCQEKDPALSELYLVEGD 429
Neisseria_meningitidis_OUT          DAARAREAARKAREITRRKGVMDGLGLPGKLADCQEKDPALSELYLVEGD 429
Coxiella_burnetii_RSA_OUT           DAARAREAARKARDMTRRKNVLDLGGLPGKLADCQEKDPALCELFLVEGD 429
beta_proteobacterium_OUT            DAARAREAARKARDMTRRKGAMDSLGLPGKLADCQEKDPSLSELYLVEGD 430
                                                                                      

GOS_1513030.20                      --------------------------------------------------
Ruegeria_sp._R11_IN                 SAGGSAQTGRDRMTQAILPLRGKILNVERARFDRMLGSQEIGNLVMALGT 484
Roseobacter_sp._SK209-2-6_IN        SAGGSAQTGRDRMTQAILPLRGKILNVERARFDRMLGSQEIGNLVMALGT 484
Silicibacter_sp._TrichCH4B_IN       SAGGSAQTGRDRQTQAILPLKGKILNVERARFDRMLGSQEIGNLVMALGT 484
Jannaschia_sp._CCS1_IN              SAGGSAKQGRSRHNQAVLPLRGKILNVERARFDRMLGSQEIGTLITALGT 484
Roseovarius_sp._TM1035_IN           SAGGSAQTGRDRGTQAVLPLRGKILNVERARFDRMLGSQEIGNLVMALGT 484
Rhodobacterales_bacterium_IN        SAGGSAQTGRDRMTQAILPLRGKILNVERARFDRMLSSQEIGNLVMALGT 484
Dinoroseobacter_shibae_IN           SAGGSAKQGRSRHNQAVLPLRGKILNVERARFDRMLSSQEIGTLITALGT 484
Sulfitobacter_sp._IN                SAGGSAQTGRDRQTQAILPLKGKILNVERARFDRMLGSQEIGNLVMALGT 483
Phaeobacter_gallaeciensis_IN        SAGGSAQTGRDRMTQAILPLRGKILNVERARFDRMLGSQEIGNLVMALGT 484
Oceanicola_granulosus_IN            SAGGSAQTGRDRRTQAVLPLKGKILNVERARFDRMLGSQEIGNLVMALGT 484
Sagittula_stellata_E-37_IN          SAGGSAQTGRDRRTQAILPLRGKILNVERARFDRMLGSQEIGNLVMALGT 486
Oceanibulbus_indolifex_IN           SAGGSAQTGRDRQTQAILPLKGKILNVERARFDRMLGSQEIGNLVMALGT 483
Methylobacterium_r._IN              SAGGSAKQGRDRTFQAVLPLRGKILNVERVRADRMLSSAEIGTLITALGA 487
Citreicella_sp._SE45_IN             SAGGSAQTGRDRGTQAILPLKGKILNVERARFDRMLGSQEIGNLVMALGT 484
alpha_proteobacterium_IN            SAGGSAKQGRSRENQAVLPLRGKILNIERARFDKMLTSEQITNLITALGT 484
Hoeflea_phototrophica_IN            SAGGSAKQGRSRENQAILPLRGKILNVERARFDKMLSSQEIGTLITALGT 488
Octadecabacter_antarcticus_IN       SAGGSAQTGRDRQTQAILPLKGKILNVERARFDRMLGSQEIGNLVMALGT 484
Beijerinckia_indica_subsp._IN       SAGGSAKQGRNREYQAVLPLRGKILNVERARFDKMLSSQEIGTLITALGT 494
Rhizobium_etli_IE4771_IN            --------------------------------------------------
Aggregatibacter_aphrophilu_OUT      SAGGSAKQGRNRKNQAILPLKGKILNVEKARFDKMLSSAEVGTLITALGC 479
Haemophilus_influenzae_OUT          SAGGSAKVGRDRKTQAILPLKGKILNVEKARFDKMLSSQEVGTLITALGC 479
Neisseria_meningitidis_OUT          SAGGSAMQGRDRKFQAILPLKGKILNVEKARFEKMLASQEVATLITALGA 479
Coxiella_burnetii_RSA_OUT           SAGGSAKQARDRRYQAILPLKGKILNVEKARFDKMLSSAEVGTLITALGC 479
beta_proteobacterium_OUT            SAGGSAKQGRDRKNQAILPLKGKILNVEKARLDKLLSSQEIATLITALGT 480
                                                                                      

GOS_1513030.20                      --------------------------------------------------
Ruegeria_sp._R11_IN                 GIGR-----DEFNIEKLRYHKIVIMTDADVDGAHIRTLLLTFFYRQMPEL 529
Roseobacter_sp._SK209-2-6_IN        GIGR-----DEFNIEKLRYHKIVIMTDADVDGAHIRTLLLTFFYRQMPEL 529
Silicibacter_sp._TrichCH4B_IN       GIGR-----DEFNIEKLRYHKIVIMTDADVDGAHIRTLLLTFFYRQMPEL 529
Jannaschia_sp._CCS1_IN              GIGR-----DEFNIDKLRYHKIIIMTDADVDGAHIRTLLLTFFFRQMPEL 529
Roseovarius_sp._TM1035_IN           GIGR-----DEFDIKKLRYHKIVIMTDADVDGAHIRTLLLTFFYRQMPEL 529
Rhodobacterales_bacterium_IN        GIGR-----DEFDISKLRYHKIVIMTDADVDGAHIRTLLLTFFYRQMPEL 529
Dinoroseobacter_shibae_IN           GIGR-----DEFDIGKLRYHKIIIMTDADVDGAHIRTLLLTFFFRQMPEI 529
Sulfitobacter_sp._IN                GIGR-----DEFNIDKLRYHKIVIMTDADVDGAHIRTLLLTFFYRQMPQL 528
Phaeobacter_gallaeciensis_IN        GIGR-----DEFNIDKLRYHKIVIMTDADVDGAHIRTLLLTFFYRQMPEL 529
Oceanicola_granulosus_IN            GIGR-----DEFDISKLRYHKIVIMTDADVDGAHIRTLLLTFFFRQMPQL 529
Sagittula_stellata_E-37_IN          GIGR-----DEFNISKLRYHKIIIMTDADVDGAHIRTLLLTFFYRQMPEL 531
Oceanibulbus_indolifex_IN           GIGR-----DEFNLSKLRYHKIVIMTDADVDGAHIRTLLLTFFFRQMPEL 528
Methylobacterium_r._IN              GIGRSSTDREGFNPEKLRYHRIIIMTDADVDGSHIRTLLLTFFFRQMPEL 537
Citreicella_sp._SE45_IN             GIGR-----DEFNIEKLRYHKIILMTDADVDGAHIRTLLLTFFYRQMPEL 529
alpha_proteobacterium_IN            GIGR-----DEFDISKLRYHKVVIMTDADVDGAHIRTLLLTFFFRQMPEL 529
Hoeflea_phototrophica_IN            GIGK-----DEFNADKLRYHKIIIMTDADVDGAHIRTLLLTFFFRQMPVL 533
Octadecabacter_antarcticus_IN       GIGR-----DEFNIEKLRYHKIVIMTDADVDGAHIRTLLLTFFFRQMPEL 529
Beijerinckia_indica_subsp._IN       GIGH-----EDFNPDKLRYHKIIIMTDADVDGSHIRTLLLTFFFRQMRPL 539
Rhizobium_etli_IE4771_IN            --------------------------------------------------
Aggregatibacter_aphrophilu_OUT      GIGR-----DEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQMPEL 524
Haemophilus_influenzae_OUT          GIGR-----DEYNPDKLRYHHIIIMTDADVDGSHIRTLLLTFFYRQMPEL 524
Neisseria_meningitidis_OUT          GIGK-----EEFNAEKLRYHRIIIMTDADVDGAHIRTLLLTFFYRQMPEL 524
Coxiella_burnetii_RSA_OUT           GIGK-----EEYNPDKLRYHRIILMTDADVDGSHIRTLLLTFFYRQMPEL 524
beta_proteobacterium_OUT            GIDK-----D-FNLEKLRYHRIIIMTDADVDGAHIRTLLLTFFYRQMPQL 524
                                                                                      

GOS_1513030.20                      --------------------------------------------------
Ruegeria_sp._R11_IN                 IEGGYLYIAQPPLYKVSRGKSEVYLKDQAALDEYLINQGVEGAVLKLG-S 578
Roseobacter_sp._SK209-2-6_IN        IEGGYLYIAQPPLFKVARGKSEVYLKDQAALDDYLINQGVDGAVLKLG-N 578
Silicibacter_sp._TrichCH4B_IN       IEGGYLYIAQPPLYKVSRGKSEVYLKDQAAMEEYLINQGVDGAILRLG-D 578
Jannaschia_sp._CCS1_IN              IEGGYLYIAQPPLYKVSRGKSEVYLKDETALEDYLVAQGVEGASLRLS-S 578
Roseovarius_sp._TM1035_IN           IEGGYLYIAQPPLYKVMRGKSEVYLKDQGGLEDYLIAQGTTDAALRLG-S 578
Rhodobacterales_bacterium_IN        IEGGYLYIAQPPLYKVARGKSEVYLKDQAALDDYLINQGVDGALLKLG-D 578
Dinoroseobacter_shibae_IN           IEGGYLYIAQPPLYKVARGKSEVYLKDQAALEDHLIGQGIEGAVLRLP-G 578
Sulfitobacter_sp._IN                IENGHLYIAQPPLYKVSRGKSEVYLKDQAAMEDYLIQQGIEGAMLKQG-N 577
Phaeobacter_gallaeciensis_IN        IEGGYLYIAQPPLYKVSRGKSEVYLKDQAALDEYLINQGVDGAVLKLG-S 578
Oceanicola_granulosus_IN            IENGHIYIAQPPLYKVSRGRSEVYLKDQAAMDEYLIEQGVDGAALRLG-T 578
Sagittula_stellata_E-37_IN          IEGGYLYIAQPPLYKVARGKSEVYLKDQTALEDYLIQQGIENAQLFQG-N 580
Oceanibulbus_indolifex_IN           IEHGHLYIAQPPLYKVSRGKSEVYLKDQAAMEDYLIQQGVDGAMLRQG-N 577
Methylobacterium_r._IN              IERGHLYIAQPPLYKAERGRRAIYLKDERALEDYLIDQGTEGAVLRLS-S 586
Citreicella_sp._SE45_IN             IEGGYLYIAQPPLYKVSRGKSEVYVKDQAALDAYLIDQGIDGAHLTLG-S 578
alpha_proteobacterium_IN            IEGGYLYIAQPPLYKVARGKSEVYLKDQVSLEDFLAEQGIEGATLTLG-G 578
Hoeflea_phototrophica_IN            IERGHLYIAQPPLYKVSRGKSSQYLKDEKAMEEYLVSSGLEEAALELS-T 582
Octadecabacter_antarcticus_IN       IERGHLYIAQPPLYKVSRGKSEVYLKDQAAMNDYLTEQGVEGAMLRQG-N 578
Beijerinckia_indica_subsp._IN       IERGHLYIAQPPLYKVKRGSSEQYLKDERAREDYLINSGLDHAVLRLA-N 588
Rhizobium_etli_IE4771_IN            --------------------------------------------------
Aggregatibacter_aphrophilu_OUT      IERGYVYIAQPPLYKVKKGKQEQYIKDDEAMAEFELAIALENAALYVSEH 574
Haemophilus_influenzae_OUT          IERGYVYIAQPPLYKVKKGKQERYIKDADEMEQYELTLALDGAELHISAN 574
Neisseria_meningitidis_OUT          VERGYIYIAQPPLYKAKYGKQERYLKDELEKDQWLLGLALEKAKIIS--D 572
Coxiella_burnetii_RSA_OUT           IERGHIYIAQPPLYKVKKSKQEQYVKDDLALDALLLQLALDGAQFHPTPQ 574
beta_proteobacterium_OUT            VENGYVYIAQPPLFKVRQNKKEQYLKDEQELEQYLIESALDGAELKI--D 572
                                                                                      

GOS_1513030.20                      --------------------------------------------------
Ruegeria_sp._R11_IN                 GEELVGQDLTRVVDEARQLKRVLDAFPTHYPRHILEQAAIAGAFVPGAVD 628
Roseobacter_sp._SK209-2-6_IN        GSEIAGADLTRIVDEARQLKRVLDAFPTHYPRHILEQAAVAGAFVPGAVD 628
Silicibacter_sp._TrichCH4B_IN       GSEIAGQDLTRVVDEARRLNRLLDAFPTHYPRHILEQAAIAGAFVPGAVD 628
Jannaschia_sp._CCS1_IN              GEEIAGQDLARVVTGARNFKRILDAFPTHYPRRIVEQAALAGAFDAGKAD 628
Roseovarius_sp._TM1035_IN           GEEIAGPDLVRVVEEARQARRILEAFPTHYPRHILEQAAIAEAFLPGRVD 628
Rhodobacterales_bacterium_IN        GSEIAGADLTRVVDEARQLKRVLDAFPTHYPRHILEQAAVAGAFVPGAVD 628
Dinoroseobacter_shibae_IN           GEEIAGKDLARVVDAARQFKRILDAFPTHYPRPILEQAALAGAFDPGKAD 628
Sulfitobacter_sp._IN                GEEITGQDLARVVDLARQMRRVLEAFPTHYPRHILEQAAIAGAFVPGAVD 627
Phaeobacter_gallaeciensis_IN        GEELVGQDLARVVDEARQLKRVLDAFPTHYPRHILEQAAVAGAFVPGAVD 628
Oceanicola_granulosus_IN            GEEIVGQDLKRVVEEARQLRRVLEAFPTHYPRHILEQAAIAGAFVSGEVE 628
Sagittula_stellata_E-37_IN          GEVIVGQDLVRVVEEARQLKRVLDAFPTHYPRHILEQAAIAGAFVPGAVD 630
Oceanibulbus_indolifex_IN           GEEISGQDLTRVVDMARQLRRVLEAFPTHYPRHIVEQAAIAGAFVDGVVD 627
Methylobacterium_r._IN              GAEFAGAQLKSLVEEARTFRSILQGLHTRYDRSVVEQAVLAGAFDAEAAS 636
Citreicella_sp._SE45_IN             GEVIVGQDLRRIIDEARQLKRVLDAFPTHYPRHILEQAAVAGAFVPGAVD 628
alpha_proteobacterium_IN            GSAMAGPDLARVIDEARQSRTILNAFPTHYSHHILEQAAIAGALNIDQVL 628
Hoeflea_phototrophica_IN            GEVRTGADLKDTITDALRMRMLLESLHSRYDHTVVEQAAIAGALNPERTT 632
Octadecabacter_antarcticus_IN       GEEIGGADLRRVVDEAGRLKRVLDAFPTHYPRHILEQAAIAGAFVAGAVD 628
Beijerinckia_indica_subsp._IN       GVERGGADLRAIVENAQLARQILSGLHSRYNRRIVEQTAIAGALQPITPD 638
Rhizobium_etli_IE4771_IN            --------------------------------------------------
Aggregatibacter_aphrophilu_OUT      APAMQGLPLENLASDYLGIQKLIARLSRYYPESLLKELIYQPALNVQFMQ 624
Haemophilus_influenzae_OUT          APAMNALVFEKLVAEYNSVQKLIGRLSRHYPAPVLQGLIYQSPISIEMMK 624
Neisseria_meningitidis_OUT          GRTIEGAELADTAKQFLLAKTVIEQESRFVDELVLRAMLHASPIDLTSSE 622
Coxiella_burnetii_RSA_OUT           APAIQGSALENLAAHYRTAMRSINRLGKRYPLYILKRLLNFPPLTVADLS 624
beta_proteobacterium_OUT            KNIISGESLGNLAREMILNDAVIRRLAHRYDSSILKAIYLCGDINLDSEE 622
                                                                                      

GOS_1513030.20                      --------------------------------------------------
Ruegeria_sp._R11_IN                 SNLQG--VADKVAARLDAIALE-----YERGWSGRITQDHGIRLSRILRG 671
Roseobacter_sp._SK209-2-6_IN        SDLQG--VADKVAQRLDAIALE-----YERGWQGRITQDHGIRLARILRG 671
Silicibacter_sp._TrichCH4B_IN       SDLQG--VADKVATRLDLIALE-----YERGWQGRITQDHGIRLARILRG 671
Jannaschia_sp._CCS1_IN              ADLQG--VADDVAKRLDLVAVE-----YERGWNGRITQDHGIRLSRVLRG 671
Roseovarius_sp._TM1035_IN           SDLQG--VADTVAARLDMISNE-----YERGWQGRPTQDKGLRLSRTVRG 671
Rhodobacterales_bacterium_IN        SDLQG--VADKVATRLDAIALE-----YERGWQGRITQDHGIRLARILRG 671
Dinoroseobacter_shibae_IN           ADLQK--VADQVAARLDLVAVE-----YERGWQGRITQDHGIRLSRVLRG 671
Sulfitobacter_sp._IN                ADLQG--VADKVAERLNLIALE-----WERGWQGRITQDHGVRLARILRG 670
Phaeobacter_gallaeciensis_IN        ADLQG--VADKVAQRLDLIALE-----YERGWRGRITQDHGIRLSRILRG 671
Oceanicola_granulosus_IN            RDLQG--VADKVAARLDLIALE-----YERGWQGRITQDKGIRLARILRG 671
Sagittula_stellata_E-37_IN          SDLQG--VADKVAARLDLVALE-----YERGWIGRITQDKGVRLARILRG 673
Oceanibulbus_indolifex_IN           SDLQG--VADKVADRLNLIALE-----YERGWQGRITQDHGIRLARILRG 670
Methylobacterium_r._IN              RAGEAEVLADMTARRLDAIADE-----IERGWQGESFEGG-YRLSRTLRG 680
Citreicella_sp._SE45_IN             ADLQG--VADRVAQRLDLIAVE-----YEKGWTGRITQDRGIRLARILRG 671
alpha_proteobacterium_IN            SNPQA--AADAVATRLDLVSTE-----YERGWSGRPTQDDGLRFSRILRG 671
Hoeflea_phototrophica_IN            DPASSDDMAAEVARRLDMVSEE-----SERGWTGAATENGGLRFERMVRG 677
Octadecabacter_antarcticus_IN       ADLQG--VADKVAKRLDLIAHE-----WERGWQGRITQDSGIRLARILRG 671
Beijerinckia_indica_subsp._IN       QETEAPALAVEVAARLDELAED-----MERGWTG-TVENGGYIFARTLRG 682
Rhizobium_etli_IE4771_IN            --------------------------------------------------
Aggregatibacter_aphrophilu_OUT      DESAVNSWAGSLVASLTAKETD-GKHYSYRLQFNGERHIHEVVLTVRTHG 673
Haemophilus_influenzae_OUT          EESAVENWGKSFVEQLTAKETE-AHQYSVRTQFNAERQVYEAVITVRKHG 673
Neisseria_meningitidis_OUT          N-------ADKAVAELSGLLDE--KEVALERIEG-HEGHRFIKITRKLHG 662
Coxiella_burnetii_RSA_OUT           EEEKVIAWTQRLEEQLNEPKTENSLRYQTAIKKDAERELYLPMVTIINHG 674
beta_proteobacterium_OUT            A-------ALSYVEKLKNSSSI--ENINFDVKKNPNSEKFMIEINQFRHG 663
                                                                                      

GOS_1513030.20                      --------------------------------------------------
Ruegeria_sp._R11_IN                 VEELRTLDGPMLRSGEARKTGSFTNSLQEIYGTTATLVRRDRAQTIHGPL 721
Roseobacter_sp._SK209-2-6_IN        VEEVRTLDGPMLRSGEARKTGSFTQSLQEIYGTTGQLIRRDRVQMIHGPL 721
Silicibacter_sp._TrichCH4B_IN       VEEVRTLDGPMLRSGEARKTGSFTKSLQEIYGAPAVLHRKDRQQAIYGPL 721
Jannaschia_sp._CCS1_IN              VEEIRTLDGAVLRSGEARKLAEVSKDSRTVYQDPATLTRKDRVQLIHGPT 721
Roseovarius_sp._TM1035_IN           VEEMRTLDGPVLRGGEARKLAQLTAPLRDIYRERATLIRKDRAQAIYGPL 721
Rhodobacterales_bacterium_IN        VEEVRTLDGPMLRSGEARKTGSFTKSLQEIYGATAQLVRRDRSQLIHGPL 721
Dinoroseobacter_shibae_IN           VEEIRTLDGAVLRSGEARKLASVSTESRDVYQDPAKLVRKEREVSIHGPL 721
Sulfitobacter_sp._IN                VEEVRTLDGRMLRSGEAKRSGGFTEHLQDVYGTPAKLVRKDRSQLIHGPM 720
Phaeobacter_gallaeciensis_IN        VEELRTLDGPMLRSGEARKTGSFTNSLQETYGATATLVRRDRSQAIHGPL 721
Oceanicola_granulosus_IN            VEEVRTLDGPMLRSGEARRSGSFTQSLQEVYGTAATLYRKDRSQVIYGPL 721
Sagittula_stellata_E-37_IN          VEEVRTLDGPMLRSGEARRTGTLTESLQAVYGSPATLERKDRRQLIHGPL 723
Oceanibulbus_indolifex_IN           VEEVRTLDGRMMRSGEARKSGTFTKHLQEVYDQPATLVRKDRSQLIHGPM 720
Methylobacterium_r._IN              VRQVSILDAGLITSQEARRLSERADAFREIYGEPATLMRKSDETVLHGPV 730
Citreicella_sp._SE45_IN             VEEVRTLDGPMLRSGEARKTGSFTQALQAIYSTASTLERKDRRQAIYGPL 721
alpha_proteobacterium_IN            VEEVQTLDGKCLKSNEARKLSSMTNSLQEVYSEPSKFTRKEKTTTINAPS 721
Hoeflea_phototrophica_IN            VKESVHLDAGLIGSQDARMIDQMNAKLRDVYTEPPVLRRKEGGLQISGPR 727
Octadecabacter_antarcticus_IN       VEEVRTLDGPMMRSGEARKSGTFTQHLQDVYNTPATLIRKDRVQNIYGPL 721
Beijerinckia_indica_subsp._IN       VRQAAILDAGLLASAEARRLNDLAPVFHDIFARPALFLRQNDEKPVSGPS 732
Rhizobium_etli_IE4771_IN            --------------------------------------------------
Aggregatibacter_aphrophilu_OUT      IDIDYFLNFPFITGNEYARLTALGAKLVGLLETNAYVMRGERKQAVTSFE 723
Haemophilus_influenzae_OUT          IDTDYFLNFDFVHGNEYAKIVSLNKQLNGLLEEGAYVIRGEKVQPVRNFE 723
Neisseria_meningitidis_OUT          NVMVSYIEPKFLNSKAYQTLTQTAAALKGMVGEGAKLYKGENGYDADSFE 712
Coxiella_burnetii_RSA_OUT           IAQQHLFHQEFFGCADYRHLVDLYNKISGLIEPGAYIVRNDKRRTVTHFG 724
beta_proteobacterium_OUT            NLITSVLDEEFLLSGDYKQIIKTSSLTKDLIQEKATISRNDKALEVGEFK 713
                                                                                      

GOS_1513030.20                      --------------------------------------------------
Ruegeria_sp._R11_IN                 GLLQAILEEGEKGL-TLQRYKGLGEMNPDQLWETTLDPDARTLLQVRVED 770
Roseobacter_sp._SK209-2-6_IN        DLLKAILEEGEKGL-SLQRYKGLGEMNPDQLWETTLDPDARTLLQVRVDD 770
Silicibacter_sp._TrichCH4B_IN       DLLKAILEEGEKGL-TLQRYKGLGEMNPDQLWETTLDPDARTLLQVRVDD 770
Jannaschia_sp._CCS1_IN              ELLKAILDEGAKGQ-QMQRYKGLGEMNPDQLWETTLDHEARTLLQVKIDD 770
Roseovarius_sp._TM1035_IN           DLLDAILKEGEKGL-SLQRYKGLGEMNPNQLWETTLDPEARTLLQVKIDD 770
Rhodobacterales_bacterium_IN        GLLQAILEEGEKGL-TLQRYKGLGEMNPDQLWETTLDPDARTLLQVRVDD 770
Dinoroseobacter_shibae_IN           ALLSTILEEGEKGQ-SLQRYKGLGEMNPDQLWETTLDPEARTLLQVQIED 770
Sulfitobacter_sp._IN                DLLEAILAEGEKGL-SLQRYKGLGEMNPDQLWETTLDPDARTLLQVKVAD 769
Phaeobacter_gallaeciensis_IN        GLLKAILEEGEKGL-ALQRYKGLGEMNPDQLWETTLDPDARTLLQVRVED 770
Oceanicola_granulosus_IN            GLLQAILEEGERGL-TLQRYKGLGEMNPEQLWETTLDPDARTFLQVKIDD 770
Sagittula_stellata_E-37_IN          ELLKAILEEGEKGL-SLQRYKGLGEMNPDQLWETTLDPNARTLLQVTIDD 772
Oceanibulbus_indolifex_IN           DLLDAIFAEGEKGL-SLQRYKGLGEMNPDQLWETTLDPDARTLLQVRVED 769
Methylobacterium_r._IN              ALFEAVMAFGRKGL-QLQRYKGLGEMTAQQLWETTLDRDVRSLLQVRVKD 779
Citreicella_sp._SE45_IN             GLLEGILEEGEKGL-ALQRYKGLGEMNPGQLWETTLDPDARTLLQVRVDD 770
alpha_proteobacterium_IN            DLLNIVNSEGEKGL-SLQRYKGLGEMNPGQLWETTLDPEARIFLQVKVED 770
Hoeflea_phototrophica_IN            ELLDAVFSVGRKGL-ALQRYKGLGEMNAEQLWETTLDPNARSLLQVRVND 776
Octadecabacter_antarcticus_IN       DLLKAVLEEGERGL-SLQRYKGLGEMNPSQLWETTLDPDARTLLQVKVED 770
Beijerinckia_indica_subsp._IN       DLLDAVMAAGQKGISQMQRYKGLGEMNPDQLWETTLDREARSLLQVRIKE 782
Rhizobium_etli_IE4771_IN            --------------------------------------------------
Aggregatibacter_aphrophilu_OUT      QAIDWLMKESRRGL-LIQRYKGLGEMNPEQLWETTMDPNSRRMLKVSIKD 772
Haemophilus_influenzae_OUT          QVVEWLVKESRKGL-EVQRYKGLGEMNADQLWETTMDPNSRRMLKVSIKD 772
Neisseria_meningitidis_OUT          TALDILMSVAQKGM-SIQRYKGLGEMNPEQLWETTMDPAVRRLLKVRIED 761
Coxiella_burnetii_RSA_OUT           EALEWFIEEGKKGL-NIQRYKGLGEMNPDQLWETTMDRESRRLLSVSIED 773
beta_proteobacterium_OUT            EALDWLMSEAKSGL-NIQRYKGLGEMNPSQLWETTMDPSVRRLLQVKIED 762
                                                                                      

GOS_1513030.20                      -----------------------------------
Ruegeria_sp._R11_IN                 MVEADDLFTKLMGDVVEPRREFIQKNALSVENLDF 805
Roseobacter_sp._SK209-2-6_IN        MVEADDLFTKLMGDVVEPRREFIQKNALSVENLDF 805
Silicibacter_sp._TrichCH4B_IN       MIEADDLFTKLMGDVVEPRREFIQKNALSVENLDF 805
Jannaschia_sp._CCS1_IN              LADADDIFTKLMGDVVEPRREFIQNNALSVENLDF 805
Roseovarius_sp._TM1035_IN           VAEADDLFTKLMGDVVEPRREFIQDNALNVANLDF 805
Rhodobacterales_bacterium_IN        MVEADDLFTKLMGDVVEPRREFIQKNALSVENLDF 805
Dinoroseobacter_shibae_IN           LADADDIFTKLMGDVVEPRRAFIQQNALSVENLDF 805
Sulfitobacter_sp._IN                MAEADDLFTKLMGDVVEPRREFIQQNALSVENLDF 804
Phaeobacter_gallaeciensis_IN        MVEADDLFTKLMGDVVEPRREFIQKNALSVENLDF 805
Oceanicola_granulosus_IN            VTEADDLFTKLMGDVVEPRREFIQQNALSVENLDF 805
Sagittula_stellata_E-37_IN          MTEADDLFTKLMGDVVEPRRDFIQQNALSVENLDF 807
Oceanibulbus_indolifex_IN           MAEADDLFTKLMGDVVEPRREFIQQNALSVENLDF 804
Methylobacterium_r._IN              VTDADDLFVKLMGDVVEPRREFIQENALSVANLDV 814
Citreicella_sp._SE45_IN             LTEADDIFTKLMGDVVEPRREFIQQNALSVENLDF 805
alpha_proteobacterium_IN            LADADDLFTKLMGDVVEPRREFIQQNALSVENLDF 805
Hoeflea_phototrophica_IN            AVDADSLFSRLMGDEVEPRREFIQDNALSVANLDI 811
Octadecabacter_antarcticus_IN       VAEADDLFTKLMGDVVEPRREFIQQNALNVENLDF 805
Beijerinckia_indica_subsp._IN       GDDADDIFVKLMGDIVEPRREFIQDNALNVHNLDV 817
Rhizobium_etli_IE4771_IN            -----------------------------------
Aggregatibacter_aphrophilu_OUT      AVAADQLFTTLMGDEVEPRRDFIESNALRAN-LDI 806
Haemophilus_influenzae_OUT          AVAADQLFTTLMGDEVEPRREFIELNALRAN-LDV 806
Neisseria_meningitidis_OUT          AIAADEVFVTLMGDEVEPRRAFIENNALIAQNIDA 796
Coxiella_burnetii_RSA_OUT           AVMADEIFTTLMGDQVEPRRLFIEQNALAVENLDV 808
beta_proteobacterium_OUT            AISADQVFSTLMGDQVEPRRNFIESNALGVNNLDI 797
                                                                       

Protein Domains

PROTOCOL


INTERPRO, default parameters at EBI


RESULTS ANALYSIS


We obtained four domains with the following e-values: HSP90chaperone/DNA ATPase domain of topoisomerase II / histidine kinase, 1.1e-78, DNA topoisomerase type IIA, subunit B / N-terminal, 4.6e-66 Ribosomal protein S5 domain 2 - type fold, 1.1e-18, DNA topoisomerase, type IIA, subunit B, domain 2, 5e-16, and the first domain here described has the great significance because it has a higher homology with the ORF in question, and the remaining domains are redundant.

Through analysis of the ATPase domain, we are possibly in the presence of a regulatory enzyme and that it interacts with selective and non-covalent ATP, which are listed in the BLAST analysis, the function of it.





RAW RESULTS
Translation	35E8B0A0674D6358	279	superfamily	SSF55874	ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase	1	209	4.6e-66	T	19-Apr-2010	IPR003594	ATPase-like, ATP-binding domain	Molecular Function: ATP binding (GO:0005524)
Translation	35E8B0A0674D6358	279	superfamily	SSF54211	Ribosomal protein S5 domain 2-like	209	278	1.1e-18	T	19-Apr-2010	IPR020568	Ribosomal protein S5 domain 2-type fold	
Translation	35E8B0A0674D6358	279	Gene3D	G3DSA:3.30.565.10	no description	3	221	1.1e-78	T	19-Apr-2010	IPR003594	ATPase-like, ATP-binding domain	Molecular Function: ATP binding (GO:0005524)
Translation	35E8B0A0674D6358	279	HMMPanther	PTHR10169:SF3	DNA GYRASE SUBUNIT B	14	278	1.4e-126	T	19-Apr-2010	NULL	NULL	
Translation	35E8B0A0674D6358	279	HMMPanther	PTHR10169	DNA TOPOISOMERASE/GYRASE	14	278	1.4e-126	T	19-Apr-2010	NULL	NULL	
Translation	35E8B0A0674D6358	279	HMMPfam	PF02518	HATPase_c	22	160	1.1e-18	T	19-Apr-2010	IPR003594	ATPase-like, ATP-binding domain	Molecular Function: ATP binding (GO:0005524)
Translation	35E8B0A0674D6358	279	HMMPfam	PF00204	DNA_gyraseB	213	278	5e-16	T	19-Apr-2010	IPR013506	DNA topoisomerase, type IIA, subunit B, domain 2	Molecular Function: DNA binding (GO:0003677), Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918), Molecular Function: ATP binding (GO:0005524), Cellular Component: chromosome (GO:0005694), Biological Process: DNA topological change (GO:0006265)
Translation	35E8B0A0674D6358	279	HMMSmart	SM00387	HATPase_c	21	166	1.7e-27	T	19-Apr-2010	IPR003594	ATPase-like, ATP-binding domain	Molecular Function: ATP binding (GO:0005524)
Translation	35E8B0A0674D6358	279	HMMSmart	SM00433	TOP2c	25	279	2.1e-13	T	19-Apr-2010	IPR001241	DNA topoisomerase, type IIA, subunit B/N-terminal	Molecular Function: DNA binding (GO:0003677), Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918), Molecular Function: ATP binding (GO:0005524), Cellular Component: chromosome (GO:0005694), Biological Process: DNA topological change (GO:0006265)
Translation	35E8B0A0674D6358	279	FPrintScan	PR00418	TPI2FAMILY	25	40	3.2e-27	T	19-Apr-2010	IPR001241	DNA topoisomerase, type IIA, subunit B/N-terminal	Molecular Function: DNA binding (GO:0003677), Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918), Molecular Function: ATP binding (GO:0005524), Cellular Component: chromosome (GO:0005694), Biological Process: DNA topological change (GO:0006265)
Translation	35E8B0A0674D6358	279	FPrintScan	PR00418	TPI2FAMILY	60	73	3.2e-27	T	19-Apr-2010	IPR001241	DNA topoisomerase, type IIA, subunit B/N-terminal	Molecular Function: DNA binding (GO:0003677), Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918), Molecular Function: ATP binding (GO:0005524), Cellular Component: chromosome (GO:0005694), Biological Process: DNA topological change (GO:0006265)
Translation	35E8B0A0674D6358	279	FPrintScan	PR00418	TPI2FAMILY	103	117	3.2e-27	T	19-Apr-2010	IPR001241	DNA topoisomerase, type IIA, subunit B/N-terminal	Molecular Function: DNA binding (GO:0003677), Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918), Molecular Function: ATP binding (GO:0005524), Cellular Component: chromosome (GO:0005694), Biological Process: DNA topological change (GO:0006265)
Translation	35E8B0A0674D6358	279	FPrintScan	PR00418	TPI2FAMILY	260	273	3.2e-27	T	19-Apr-2010	IPR001241	DNA topoisomerase, type IIA, subunit B/N-terminal	Molecular Function: DNA binding (GO:0003677), Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918), Molecular Function: ATP binding (GO:0005524), Cellular Component: chromosome (GO:0005694), Biological Process: DNA topological change (GO:0006265)

Phylogeny

PROTOCOL

a) Phylogeny.fr / BioNJ method / out group: gamma-proteobacteria e beta-proteobacteria

b) Phylogeny.fr / PhyML method / out group: gamma-proteobacteria e beta-proteobacteria



RESULTS ANALYSIS


After the construction of two trees with different methods,BioNJ and PhyML, and properly identified in the raw results, we can see that the trees are concordant because ingroups and outgroups are arranged in the same way and the node that roots for our ORF, have the same distance from ingroups and outgroups for both methods.

We suggest that the most likelytaxonomic group of the ORF, is the Class, because the node that is indicated by rooted shows a divergence from ORF toward ingroups, perhaps due to the smaller number of aminoacid relatively to the other sequences, ie the ancestors are very distant. Numerically, using the bootstrap, the node that we choose to identify the taxonomy is 0.97 (identified in the tree with (a)), also suggests that the class is the taxonomic group and cannot infer more about our response.

In (2) the node that roots for ingroups, we have a bootstrap value of 0.99 suggesting a high homology, as in (3) for the outgroups because the value is 0.97.



RAW RESULTS

a) BioNJ                                                                                             --------0.05------
 
                                                    +------------------Aggregatibacter_aphrophilu_OUT                        [g-proteobacteria]         
                          +-------------------------+
                          |                         +--------------------------Haemophilus_influenzae_OUT                    [g-proteobacteria]
    +---------------------+
 (3)|                     +----------------------------------------------------------------Coxiella_burnetii_RSA_OUT         [g-proteobacteria]
 +--+ 
 |  |                   +--------------------------------------------------Neisseria_meningitidis_OUT                        [b-proteobacteria]
 |  +-------------------+
 |                      |
 |                      +------------------------------------------------------------beta_proteobacterium_OUT                [b-proteobacteria]
 |
 |                     +------------------------------------------------------------------------------GOS_1513030.20
 |                     |
 |                     |                                      +---------Sulfitobacter_sp._IN                                 [a-proteobacteria]
 |                     |                                   +--+
 |                     |                                   |  | +-----------Oceanibulbus_indolifex_IN                        [a-proteobacteria]
 |                     |                                   |  +-+
 |                     |                                   |    +------------------------Octadecabacter_antarcticus_IN       [a-proteobacteria]
 |                     |                                +--+
 |                     |                                |  |    +-------------Jannaschia_sp._CCS1_IN                         [a-proteobacteria]
 |                     |                                |  |  +-+
 |                     |                                |  |  | +------------Dinoroseobacter_shibae_IN                       [a-proteobacteria]
 |                     |                              +-+  +--+
 |                     |                              | |     +---------------------------------alpha_proteobacterium_IN     [a-proteobacteria]
 |                  (1)|                              | |
 +---------------------+                              | +----------------Roseovarius_sp._TM1035_IN                           [a-proteobacteria]
                       |                              |
                       |                              |
                       |                           +--+        +------Ruegeria_sp._R11_IN                                    [a-proteobacteria]
                       |                           |  |       ++
                       |                           |  |       |+---------Silicibacter_sp._TrichCH4B_IN                       [a-proteobacteria]
                       |                           |  |     +-+
                       |                           |  |     | |  +------Roseobacter_sp._SK209-2-6_IN                         [a-proteobacteria]
                       |                           |  +-----+ +--+
                       |    +----------------------+        |    +-------Rhodobacterales_bacterium_IN                        [a-proteobacteria]
                       |    |                      |        |
                       |    |                      |        +------------Phaeobacter_gallaeciensis_IN                        [a-proteobacteria]
                       |    |                      |
                       |    |                      |    +------------------Oceanicola_granulosus_IN                          [a-proteobacteria]
                       | (2)|                      |    |
                       +----+                      +----+         +------------Sagittula_stellata_E-37_IN                    [a-proteobacteria]
                            |                           +---------+
                            |                                     |
                            |                                     +-----------Citreicella_sp._SE45_IN                        [a-proteobacteria]
                            |
                            |               +----------------------------------Methylobacterium_r._IN                        [a-proteobacteria]
                            +---------------+
                                            |     +--------------------------------------Beijerinckia_indica_subsp._IN       [a-proteobacteria]
                                            +-----+
                                                  |                    +--------------------Hoeflea_phototrophica_IN         [a-proteobacteria]
                                                  +--------------------+
                                                                       +-------------------Rhizobium_etli_IE4771_IN          [a-proteobacteria]



b) PhyML                                                                                                    ----0.05---
 
                                                               +----------Aggregatibacter_aphrophilu_OUT
                                          +--------------------+
                                          |                    +-------------------Haemophilus_influenzae_OUT
                +-------------------------+
                |                         +----------------------------------------------------Coxiella_burnetii_RSA_OUT
 +--------------+
 |              |                  +-----------------------------------------Neisseria_meningitidis_OUT
 |              +------------------+
 |                                 |
 |                                 +-------------------------------------------beta_proteobacterium_OUT
 |
 |        +---------------------------------------------------------------GOS_1513030.20
 |        |
 |        |                               +---------------------Methylobacterium_r._IN
 |        |                               |
 |        |         +---------------------+        +-------------------------------Beijerinckia_indica_subsp._IN
 |        |         |                     +--------+
 +--------+         |                              |                +---------------Hoeflea_phototrophica_IN
          |         |                              +----------------+
          |         |                                               +------------Rhizobium_etli_IE4771_IN
          |         |
          |         |                        +-------Silicibacter_sp._TrichCH4B_IN
          |         |                        |
          +---------+                        |      +--Roseobacter_sp._SK209-2-6_IN
                    |                      +-+ +----+
                    |                      | | |    +----Rhodobacterales_bacterium_IN
                    |                      | +-+
                    |                   +--+   |
                    |                   |  |   +--Ruegeria_sp._R11_IN
                    |                   |  |
                    |                   |  +--------Phaeobacter_gallaeciensis_IN
                    |                   |
                    +-------------------+           +----------Oceanicola_granulosus_IN
                                        |  +--------+
                                        |  |        |         +------Sagittula_stellata_E-37_IN
                                        |  |        +---------+
                                        |  |                  +-------Citreicella_sp._SE45_IN
                                        +--+
                                           |    +----------Roseovarius_sp._TM1035_IN
                                           |    |
                                           |    |    +----------------Octadecabacter_antarcticus_IN
                                           +----+    |
                                                |    |
                                                |    |      +----Sulfitobacter_sp._IN
                                                +----+    +-+
                                                     |    | |       +----Jannaschia_sp._CCS1_IN
                                                     |    | +-------+
                                                     |    |         |  +-----------------------alpha_proteobacterium_IN
                                                     +----+         +--+
                                                          |            +--------Dinoroseobacter_shibae_IN
                                                          |
                                                          +------Oceanibulbus_indolifex_IN

Taxonomy report

PROTOCOL


1)BLASTp vs NR, defaut NCBI parameters * "1000 max target sequences"


RESULTS ANALYSIS


Analyzing the taxonomy data we can observed that our result is a cellular organism that belongs to the domain bacteria, and to the class a-proteobacteria. We cannot infer more taxonomically, since the values of identity are quite low, round the 67% for the best 12 sequences, like that round score of 400 bits.

Based on the report were chosen lineage ingroups, alpha-proteobacteria, and the outgroups, gamma-proteobacteria, beta-proteobacteria. The sequences chosen are described in the analysis of the blast.




RAW RESULTS

Lineage Report

root
. Bacteria            [bacteria]
. . Proteobacteria      [proteobacteria]
. . . Alphaproteobacteria [a-proteobacteria]
. . . . Rhodobacterales     [a-proteobacteria]
. . . . . Rhodobacteraceae    [a-proteobacteria]
. . . . . . Ruegeria            [a-proteobacteria]
. . . . . . . Ruegeria sp. R11 -------------------------------------------------  416  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Ruegeria sp. R11] >gi|214031262|gb|E
. . . . . . . Silicibacter sp. TrichCH4B .......................................  412  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Silicibacter sp. TrichCH4B] >gi|2593
. . . . . . . Ruegeria sp. TM1040 ..............................................  410  2 hits [a-proteobacteria]  DNA gyrase subunit B [Ruegeria sp. TM1040] >gi|99036128|gb|
. . . . . . . Silicibacter lacuscaerulensis ITI-1157 ...........................  409  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Silicibacter lacuscaerulensis ITI-11
. . . . . . . Ruegeria pomeroyi DSS-3 ..........................................  400  2 hits [a-proteobacteria]  DNA gyrase subunit B [Ruegeria pomeroyi DSS-3] >gi|56676817
. . . . . . Roseobacter sp. SK209-2-6 ------------------------------------------  414  2 hits [a-proteobacteria]  DNA gyrase subunit B [Roseobacter sp. SK209-2-6] >gi|126720
. . . . . . Jannaschia sp. CCS1 ................................................  411  2 hits [a-proteobacteria]  DNA gyrase subunit B [Jannaschia sp. CCS1] >gi|88862044|gb|
. . . . . . Roseovarius sp. TM1035 .............................................  410  2 hits [a-proteobacteria]  DNA gyrase subunit B [Roseovarius sp. TM1035] >gi|149142173
. . . . . . Roseobacter sp. MED193 .............................................  409  2 hits [a-proteobacteria]  DNA gyrase subunit B [Roseobacter sp. MED193] >gi|85823916|
. . . . . . Rhodobacteraceae bacterium KLH11 ...................................  408  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Rhodobacteraceae bacterium KLH11] >g
. . . . . . Dinoroseobacter shibae DFL 12 ......................................  408  2 hits [a-proteobacteria]  DNA gyrase subunit B [Dinoroseobacter shibae DFL 12] >gi|15
. . . . . . Sulfitobacter sp. NAS-14.1 .........................................  407  2 hits [a-proteobacteria]  DNA gyrase subunit B [Sulfitobacter sp. NAS-14.1] >gi|83941
. . . . . . Sulfitobacter sp. EE-36 ............................................  407  2 hits [a-proteobacteria]  DNA gyrase subunit B [Sulfitobacter sp. NAS-14.1] >gi|83941
. . . . . . Phaeobacter gallaeciensis BS107 ....................................  407  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Phaeobacter gallaeciensis BS107] >gi
. . . . . . Phaeobacter gallaeciensis 2.10 .....................................  407  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Phaeobacter gallaeciensis BS107] >gi
. . . . . . Roseovarius nubinhibens ISM ........................................  407  2 hits [a-proteobacteria]  DNA gyrase subunit B [Roseovarius nubinhibens ISM] >gi|8383
. . . . . . Roseobacter denitrificans OCh 114 ..................................  406  2 hits [a-proteobacteria]  DNA gyrase subunit B [Roseobacter denitrificans OCh 114] >g
. . . . . . Oceanicola granulosus HTCC2516 .....................................  405  2 hits [a-proteobacteria]  DNA gyrase subunit B [Oceanicola granulosus HTCC2516] >gi|8
. . . . . . Sagittula stellata E-37 ............................................  404  2 hits [a-proteobacteria]  DNA gyrase subunit B [Sagittula stellata E-37] >gi|12670953
. . . . . . Roseobacter sp. GAI101 .............................................  404  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Roseobacter sp. GAI101] >gi|21404303
. . . . . . Roseobacter litoralis Och 149 ......................................  403  2 hits [a-proteobacteria]  DNA gyrase subunit B [Roseobacter litoralis Och 149] >gi|16
. . . . . . Roseobacter sp. CCS2 ...............................................  402  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Roseobacter sp. CCS2] >gi|126716942|
. . . . . . Oceanibulbus indolifex HEL-45 ......................................  402  2 hits [a-proteobacteria]  DNA gyrase subunit B [Oceanibulbus indolifex HEL-45] >gi|16
. . . . . . Roseovarius sp. HTCC2601 ...........................................  400  2 hits [a-proteobacteria]  DNA gyrase subunit B [Roseovarius sp. HTCC2601] >gi|1145451
. . . . . . Rhodobacter sphaeroides KD131 ......................................  399  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rhodobacter sphaeroides KD131] >gi|22
. . . . . . Rhodobacter sphaeroides 2.4.1 ......................................  399  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rhodobacter sphaeroides 2.4.1] >gi|12
. . . . . . Rhodobacter sphaeroides ATCC 17029 .................................  399  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rhodobacter sphaeroides 2.4.1] >gi|12
. . . . . . Rhodobacter sphaeroides ATCC 17025 .................................  398  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rhodobacter sphaeroides ATCC 17025] >
. . . . . . Citreicella sp. SE45 ...............................................  397  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Citreicella sp. SE45] >gi|260420052|
. . . . . . Octadecabacter antarcticus 307 .....................................  395  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Octadecabacter antarcticus 307] >gi|
. . . . . . Rhodobacter sp. SW2 ................................................  395  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Rhodobacter sp. SW2] >gi|259023326|g
. . . . . . Roseobacter sp. AzwK-3b ............................................  394  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Roseobacter sp. AzwK-3b] >gi|1498132
. . . . . . Labrenzia aggregata IAM 12614 ......................................  394  2 hits [a-proteobacteria]  DNA gyrase subunit B [Stappia aggregata IAM 12614] >gi|1184
. . . . . . Oceanicola batsensis HTCC2597 ......................................  392  2 hits [a-proteobacteria]  DNA gyrase subunit B [Oceanicola batsensis HTCC2597] >gi|84
. . . . . . Thalassiobium sp. R2A62 ............................................  392  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Thalassiobium sp. R2A62] >gi|2551037
. . . . . . Paracoccus denitrificans PD1222 ....................................  391  2 hits [a-proteobacteria]  DNA gyrase subunit B [Paracoccus denitrificans PD1222] >gi|
. . . . . . Labrenzia alexandrii DFL-11 ........................................  387  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Labrenzia alexandrii DFL-11] >gi|222
. . . . . . Pseudovibrio sp. JE062 .............................................  381  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Pseudovibrio sp. JE062] >gi|21195854
. . . . . . Roseovarius sp. 217 ................................................  378  2 hits [a-proteobacteria]  DNA gyrase subunit B [Roseovarius sp. 217] >gi|85669670|gb|
. . . . . . Loktanella vestfoldensis SKA53 .....................................  375  2 hits [a-proteobacteria]  DNA gyrase subunit B [Loktanella vestfoldensis SKA53] >gi|8
. . . . . . Octadecabacter antarcticus 238 .....................................  368  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Octadecabacter antarcticus 238] >gi|
. . . . . . Rhodobacter veldkampii .............................................  361  1 hit  [a-proteobacteria]  DNA gyrase subunit B [Rhodobacter veldkampii]
. . . . . . Rhodobacter azotoformans ...........................................  358  1 hit  [a-proteobacteria]  DNA gyrase subunit B [Rhodobacter azotoformans]
. . . . . . Paracoccus sp. .....................................................  348  2 hits [a-proteobacteria]  DNA gyrase subunit B [Paracoccus sp.]
. . . . . . Paracoccus aminophilus .............................................  345  1 hit  [a-proteobacteria]  DNA gyrase subunit B [Paracoccus aminophilus]
. . . . . . Rhodobacter blasticus ..............................................  338  1 hit  [a-proteobacteria]  DNA gyrase subunit B [Rhodobacter blasticus]
. . . . . Rhodobacterales bacterium HTCC2654 -----------------------------------  410  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rhodobacterales bacterium HTCC2654] >
. . . . . Rhodobacterales bacterium Y4I ........................................  409  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Rhodobacterales bacterium Y4I] >gi|2
. . . . . Rhodobacterales bacterium HTCC2150 ...................................  406  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rhodobacterales bacterium HTCC2150] >
. . . . . Rhodobacterales bacterium HTCC2255 ...................................  397  3 hits [a-proteobacteria]  DNA gyrase subunit B [alpha proteobacterium HTCC2255] >gi|1
. . . . . Rhodobacterales bacterium HTCC2083 ...................................  397  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Rhodobacterales bacterium HTCC2083] 
. . . . . Maricaulis maris MCS10 ...............................................  389  2 hits [a-proteobacteria]  DNA gyrase subunit B [Maricaulis maris MCS10] >gi|114339030
. . . . . Oceanicaulis alexandrii HTCC2633 .....................................  374  2 hits [a-proteobacteria]  DNA gyrase subunit B [Oceanicaulis alexandrii HTCC2633] >gi
. . . . . Hirschia baltica ATCC 49814 ..........................................  367  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Hirschia baltica ATCC 49814] >gi|254
. . . . . Hyphomonas neptunium ATCC 15444 ......................................  360  2 hits [a-proteobacteria]  DNA gyrase subunit B [Hyphomonas neptunium ATCC 15444] >gi|
. . . . Methylobacterium radiotolerans JCM 2831 --------------------------------  400  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Methylobacterium radiotolerans JCM 2
. . . . Methylobacterium sp. 4-46 ..............................................  399  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Methylobacterium sp. 4-46] >gi|16819
. . . . Methylobacterium chloromethanicum CM4 ..................................  397  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Methylobacterium chloromethanicum CM
. . . . Methylobacterium extorquens AM1 ........................................  396  2 hits [a-proteobacteria]  DNA gyrase, subunit B (type II topoisomerase) [Methylobacte
. . . . Methylobacterium extorquens DM4 ........................................  396  2 hits [a-proteobacteria]  DNA gyrase, subunit B (type II topoisomerase) [Methylobacte
. . . . Methylobacterium extorquens PA1 ........................................  396  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Methylobacterium extorquens PA1] >gi
. . . . Hoeflea phototrophica DFL-43 ...........................................  396  2 hits [a-proteobacteria]  DNA gyrase subunit B [Hoeflea phototrophica DFL-43] >gi|162
. . . . Beijerinckia indica subsp. indica ATCC 9039 ............................  395  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Beijerinckia indica subsp. indica AT
. . . . Parvibaculum lavamentivorans DS-1 ......................................  395  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Parvibaculum lavamentivorans DS-1] >
. . . . Methylobacterium nodulans ORS 2060 .....................................  395  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Methylobacterium nodulans ORS 2060] 
. . . . Methylocella silvestris BL2 ............................................  394  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Methylocella silvestris BL2] >gi|217
. . . . Methylobacterium populi BJ001 ..........................................  394  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Methylobacterium populi BJ001] >gi|1
. . . . Bartonella grahamii as4aup .............................................  392  2 hits [a-proteobacteria]  DNA gyrase subunit B [Bartonella grahamii as4aup] >gi|24026
. . . . Bartonella quintana str. Toulouse ......................................  390  2 hits [a-proteobacteria]  DNA gyrase subunit B [Bartonella quintana str. Toulouse] >g
. . . . Bartonella tribocorum CIP 105476 .......................................  389  2 hits [a-proteobacteria]  DNA gyrase subunit B [Bartonella tribocorum CIP 105476] >gi
. . . . Chelativorans sp. BNC1 .................................................  389  2 hits [a-proteobacteria]  DNA gyrase subunit B [Mesorhizobium sp. BNC1] >gi|110286913
. . . . Rhizobium etli CIAT 652 ................................................  389  2 hits [a-proteobacteria]  DNA gyrase protein, B subunit [Rhizobium etli CIAT 652] >gi
. . . . Aurantimonas manganoxydans SI85-9A1 ....................................  389  2 hits [a-proteobacteria]  DNA gyrase, subunit B [Aurantimonas manganoxydans SI85-9A1]
. . . . Agrobacterium vitis S4 .................................................  388  2 hits [a-proteobacteria]  DNA gyrase subunit B [Agrobacterium vitis S4] >gi|221734017
. . . . Nitrobacter winogradskyi Nb-255 ........................................  388  2 hits [a-proteobacteria]  DNA gyrase subunit B [Nitrobacter winogradskyi Nb-255] >gi|
. . . . Sinorhizobium meliloti 1021 ............................................  388  2 hits [a-proteobacteria]  DNA gyrase subunit B [Sinorhizobium meliloti 1021] >gi|1507
. . . . Rhodopseudomonas palustris DX-1 ........................................  388  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Rhodopseudomonas palustris DX-1] >gi
. . . . Rhizobium etli CFN 42 ..................................................  386  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rhizobium etli CFN 42] >gi|86279783|g
. . . . Fulvimarina pelagi HTCC2506 ............................................  386  2 hits [a-proteobacteria]  DNA gyrase subunit B [Fulvimarina pelagi HTCC2506] >gi|1145
. . . . Nitrobacter sp. Nb-311A ................................................  386  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Nitrobacter sp. Nb-311A] >gi|8569909
. . . . Bartonella henselae str. Houston-1 .....................................  386  2 hits [a-proteobacteria]  DNA gyrase subunit B [Bartonella henselae str. Houston-1] >
. . . . Rhodopseudomonas palustris BisA53 ......................................  386  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rhodopseudomonas palustris BisA53] >g
. . . . Rhizobium leguminosarum bv. trifolii WSM2304 ...........................  385  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rhizobium leguminosarum bv. trifolii 
. . . . Brucella canis ATCC 23365 ..............................................  385  2 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella canis ATCC 23365] >gi|260567
. . . . Brucella suis bv. 4 str. 40 ............................................  385  2 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella canis ATCC 23365] >gi|260567
. . . . Brucella sp. 83/13 .....................................................  385  3 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella sp. 83/13] >gi|265983305|ref
. . . . Brucella suis ATCC 23445 ...............................................  385  2 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella suis ATCC 23445] >gi|2547053
. . . . Brucella suis bv. 3 str. 686 ...........................................  385  3 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella suis ATCC 23445] >gi|2547053
. . . . Brucella suis 1330 .....................................................  384  2 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella suis 1330] >gi|23346904|gb|A
. . . . Brucella abortus bv. 6 str. 870 ........................................  384  3 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella abortus bv. 6 str. 870] >gi|
. . . . Brucella abortus bv. 1 str. 9-941 ......................................  384  2 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella abortus bv. 1 str. 9-941] >g
. . . . Brucella melitensis biovar Abortus 2308 ................................  384  2 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella abortus bv. 1 str. 9-941] >g
. . . . Brucella microti CCM 4915 ..............................................  384  2 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella abortus bv. 1 str. 9-941] >g
. . . . Brucella abortus S19 ...................................................  384  2 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella abortus S19] >gi|225626666|r
. . . . Brucella ceti str. Cudo ................................................  384  2 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella abortus S19] >gi|225626666|r
. . . . Brucella abortus str. 2308 A ...........................................  384  2 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella abortus S19] >gi|225626666|r
. . . . Brucella abortus bv. 3 str. Tulya ......................................  384  3 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella abortus S19] >gi|225626666|r
. . . . Brucella abortus bv. 2 str. 86/8/59 ....................................  384  3 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella abortus S19] >gi|225626666|r
. . . . Brucella suis bv. 5 str. 513 ...........................................  384  3 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella abortus S19] >gi|225626666|r
. . . . Brucella pinnipedialis M163/99/10 ......................................  384  3 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella abortus S19] >gi|225626666|r
. . . . Brucella pinnipedialis B2/94 ...........................................  384  3 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella abortus S19] >gi|225626666|r
. . . . Brucella abortus bv. 4 str. 292 ........................................  384  3 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella abortus S19] >gi|225626666|r
. . . . Brucella pinnipedialis M292/94/1 .......................................  384  3 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella abortus S19] >gi|225626666|r
. . . . Brucella neotomae 5K33 .................................................  384  3 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella abortus S19] >gi|225626666|r
. . . . Brucella ceti M490/95/1 ................................................  384  3 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella abortus S19] >gi|225626666|r
. . . . Brucella ceti B1/94 ....................................................  384  3 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella abortus S19] >gi|225626666|r
. . . . Brucella abortus bv. 9 str. C68 ........................................  384  3 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella abortus S19] >gi|225626666|r
. . . . Brucella sp. F5/99 .....................................................  384  3 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella abortus S19] >gi|225626666|r
. . . . Brucella abortus NCTC 8038 .............................................  384  2 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella abortus S19] >gi|225626666|r
. . . . Sinorhizobium medicae WSM419 ...........................................  384  2 hits [a-proteobacteria]  DNA gyrase subunit B [Sinorhizobium medicae WSM419] >gi|150
. . . . Rhodopseudomonas palustris CGA009 ......................................  384  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rhodopseudomonas palustris CGA009] >g
. . . . Rhizobium sp. NGR234 ...................................................  384  2 hits [a-proteobacteria]  DNA gyrase, subunit B [Rhizobium sp. NGR234] >gi|227342873|
. . . . Rhodopseudomonas palustris TIE-1 .......................................  384  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Rhodopseudomonas palustris TIE-1] >g
. . . . Rhodopseudomonas palustris BisB18 ......................................  384  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rhodopseudomonas palustris BisB18] >g
. . . . Agrobacterium radiobacter K84 ..........................................  384  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Agrobacterium radiobacter K84] >gi|2
. . . . Brucella ovis ATCC 25840 ...............................................  383  2 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella ovis ATCC 25840] >gi|1483716
. . . . Rhodopseudomonas palustris HaA2 ........................................  383  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rhodopseudomonas palustris HaA2] >gi|
. . . . Ochrobactrum anthropi ATCC 49188 .......................................  383  2 hits [a-proteobacteria]  DNA gyrase subunit B [Ochrobactrum anthropi ATCC 49188] >gi
. . . . Bartonella bacilliformis KC583 .........................................  383  2 hits [a-proteobacteria]  DNA gyrase subunit B [Bartonella bacilliformis KC583] >gi|1
. . . . Brucella melitensis bv. 1 str. 16M .....................................  382  4 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella melitensis 16M] >gi|22585166
. . . . Brucella melitensis ATCC 23457 .........................................  382  2 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella melitensis 16M] >gi|22585166
. . . . Brucella melitensis bv. 1 str. Rev.1 ...................................  382  3 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella melitensis 16M] >gi|22585166
. . . . Brucella melitensis bv. 3 str. Ether ...................................  382  3 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella melitensis 16M] >gi|22585166
. . . . Brucella melitensis bv. 2 str. 63/9 ....................................  382  2 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella melitensis 16M] >gi|22585166
. . . . Rhizobium leguminosarum bv. viciae 3841 ................................  382  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rhizobium leguminosarum bv. viciae 38
. . . . Oligotropha carboxidovorans OM5 ........................................  382  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Oligotropha carboxidovorans OM5] >gi
. . . . Ochrobactrum intermedium LMG 3301 ......................................  382  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Ochrobactrum intermedium LMG 3301] >
. . . . Zymomonas mobilis subsp. mobilis ATCC 10988 ............................  382  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Zymomonas mobilis subsp. mobilis ATC
. . . . Zymomonas mobilis subsp. mobilis NCIMB 11163 ...........................  382  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Zymomonas mobilis subsp. mobilis ATC
. . . . Rhodopseudomonas palustris BisB5 .......................................  381  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rhodopseudomonas palustris BisB5] >gi
. . . . Rhizobium etli IE4771 ..................................................  381  1 hit  [a-proteobacteria]  DNA gyrase subunit B [Rhizobium etli IE4771]
. . . . Zymomonas mobilis subsp. mobilis ZM4 ...................................  381  3 hits [a-proteobacteria]  DNA gyrase, B subunit [Zymomonas mobilis subsp. mobilis ZM4
. . . . Brucella ceti M644/93/1 ................................................  381  3 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella ceti M644/93/1] >gi|25471634
. . . . Brucella ceti M13/05/1 .................................................  381  3 hits [a-proteobacteria]  DNA gyrase subunit B [Brucella ceti M644/93/1] >gi|25471634
. . . . Azorhizobium caulinodans ORS 571 .......................................  380  2 hits [a-proteobacteria]  DNA gyrase B subunit [Azorhizobium caulinodans ORS 571] >gi
. . . . Nitrobacter hamburgensis X14 ...........................................  380  2 hits [a-proteobacteria]  DNA gyrase subunit B [Nitrobacter hamburgensis X14] >gi|917
. . . . Agrobacterium tumefaciens str. C58 .....................................  380  2 hits [a-proteobacteria]  DNA gyrase subunit B [Agrobacterium tumefaciens str. C58] >
. . . . Bradyrhizobium japonicum USDA 110 ......................................  380  2 hits [a-proteobacteria]  DNA gyrase subunit B [Bradyrhizobium japonicum USDA 110] >g
. . . . Rhizobium leguminosarum bv. trifolii WSM1325 ...........................  379  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Rhizobium leguminosarum bv. trifolii
. . . . Rhodomicrobium vannielii ATCC 17100 ....................................  379  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Rhodomicrobium vannielii ATCC 17100]
. . . . Bradyrhizobium sp. BTAi1 ...............................................  379  2 hits [a-proteobacteria]  DNA gyrase subunit B [Bradyrhizobium sp. BTAi1] >gi|1464038
. . . . Brevundimonas sp. BAL3 .................................................  379  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Brevundimonas sp. BAL3] >gi|19618679
. . . . Caulobacter crescentus CB15 ............................................  378  2 hits [a-proteobacteria]  DNA gyrase subunit B [Caulobacter crescentus CB15] >gi|2212
. . . . Caulobacter crescentus NA1000 ..........................................  378  3 hits [a-proteobacteria]  DNA gyrase subunit B [Caulobacter crescentus CB15] >gi|2212
. . . . Caulobacter vibrioides .................................................  378  2 hits [a-proteobacteria]  DNA gyrase subunit B [Caulobacter crescentus CB15] >gi|2212
. . . . Mesorhizobium opportunistum WSM2075 ....................................  377  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Mesorhizobium opportunistum WSM2075]
. . . . Phenylobacterium zucineum HLK1 .........................................  377  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Phenylobacterium zucineum HLK1] >gi|
. . . . Brevundimonas subvibrioides ATCC 15264 .................................  376  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Brevundimonas subvibrioides ATCC 152
. . . . Sphingopyxis alaskensis RB2256 .........................................  375  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Sphingopyxis alaskensis RB2256] >gi|
. . . . Xanthobacter autotrophicus Py2 .........................................  375  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Xanthobacter autotrophicus Py2] >gi|
. . . . alpha proteobacterium BAL199 ...........................................  374  2 hits [a-proteobacteria]  Type IIA topoisomerase [alpha proteobacterium BAL199] >gi|1
. . . . Caulobacter segnis ATCC 21756 ..........................................  374  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Caulobacter segnis ATCC 21756] >gi|2
. . . . Rhizobium etli CIAT 894 ................................................  374  1 hit  [a-proteobacteria]  DNA gyrase subunit B [Rhizobium etli CIAT 894]
. . . . Bradyrhizobium sp. ORS278 ..............................................  374  2 hits [a-proteobacteria]  DNA gyrase subunit B [Bradyrhizobium sp. ORS278] >gi|146189
. . . . Mesorhizobium loti MAFF303099 ..........................................  373  2 hits [a-proteobacteria]  DNA gyrase subunit B [Mesorhizobium loti MAFF303099] >gi|14
. . . . Rhizobium etli GR56 ....................................................  371  1 hit  [a-proteobacteria]  DNA gyrase subunit B [Rhizobium etli GR56]
. . . . Novosphingobium aromaticivorans DSM 12444 ..............................  370  2 hits [a-proteobacteria]  DNA gyrase subunit B [Novosphingobium aromaticivorans DSM 1
. . . . Sphingomonas wittichii RW1 .............................................  370  2 hits [a-proteobacteria]  DNA gyrase subunit B [Sphingomonas wittichii RW1] >gi|14850
. . . . Rhodospirillum rubrum ATCC 11170 .......................................  370  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rhodospirillum rubrum ATCC 11170] >gi
. . . . Erythrobacter litoralis HTCC2594 .......................................  370  2 hits [a-proteobacteria]  type IIA topoisomeraseb subunit [Erythrobacter litoralis HT
. . . . Magnetospirillum gryphiswaldense MSR-1 .................................  369  1 hit  [a-proteobacteria]  DNA topoisomerase II [Magnetospirillum gryphiswaldense MSR-
. . . . Caulobacter sp. K31 ....................................................  368  2 hits [a-proteobacteria]  DNA gyrase subunit B [Caulobacter sp. K31] >gi|167346559|gb
. . . . Asticcacaulis excentricus CB 48 ........................................  366  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Asticcacaulis excentricus CB 48] >gi
. . . . Azospirillum sp. B510 ..................................................  364  2 hits [a-proteobacteria]  DNA gyrase subunit B [Azospirillum sp. B510] >gi|288911877|
. . . . Hyphomicrobium denitrificans ATCC 51888 ................................  361  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Hyphomicrobium denitrificans ATCC 51
. . . . Erythrobacter sp. SD-21 ................................................  361  2 hits [a-proteobacteria]  type IIA topoisomeraseB subunit [Erythrobacter sp. SD-21] >
. . . . Sphingomonas sp. SKA58 .................................................  360  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Sphingomonas sp. SKA58] >gi|94423906
. . . . Candidatus Liberibacter asiaticus str. psy62 ...........................  359  2 hits [a-proteobacteria]  DNA gyrase subunit B [Candidatus Liberibacter asiaticus str
. . . . Rhodospirillum centenum SW .............................................  359  2 hits [a-proteobacteria]  DNA gyrase, B subunit, putative [Rhodospirillum centenum SW
. . . . Parvularcula bermudensis HTCC2503 ......................................  358  2 hits [a-proteobacteria]  DNA gyrase subunit B [Parvularcula bermudensis HTCC2503] >g
. . . . Erythrobacter sp. NAP1 .................................................  358  2 hits [a-proteobacteria]  type IIA topoisomerase B subunit [Erythrobacter sp. NAP1] >
. . . . Candidatus Pelagibacter sp. HTCC7211 ...................................  356  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Candidatus Pelagibacter sp. HTCC7211
. . . . Candidatus Pelagibacter ubique HTCC1002 ................................  355  2 hits [a-proteobacteria]  DNA topoisomerase (ATP-hydrolyzing) chain B (DNA gyrase B) 
. . . . Candidatus Pelagibacter ubique HTCC1062 ................................  355  2 hits [a-proteobacteria]  DNA topoisomerase (ATP-hydrolyzing) chain B (DNA gyrase B) 
. . . . Rickettsia felis URRWXCal2 .............................................  353  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rickettsia felis URRWXCal2] >gi|75536
. . . . Rickettsia felis .......................................................  353  1 hit  [a-proteobacteria]  DNA gyrase subunit B [Rickettsia felis URRWXCal2] >gi|75536
. . . . Rickettsia typhi str. Wilmington .......................................  352  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rickettsia typhi str. Wilmington] >gi
. . . . Rickettsia typhi .......................................................  352  1 hit  [a-proteobacteria]  DNA gyrase subunit B [Rickettsia typhi str. Wilmington] >gi
. . . . Neorickettsia sennetsu str. Miyayama ...................................  352  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Neorickettsia sennetsu str. Miyayama
. . . . Rickettsia rickettsii str. 'Sheila Smith' ..............................  351  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rickettsia rickettsii str. 'Sheila Sm
. . . . Rickettsia rickettsii str. Iowa ........................................  351  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rickettsia rickettsii str. 'Sheila Sm
. . . . Rickettsia prowazekii str. Madrid E ....................................  350  1 hit  [a-proteobacteria]  DNA gyrase subunit B [Rickettsia prowazekii str. Madrid E] 
. . . . Rickettsia prowazekii ..................................................  350  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rickettsia prowazekii str. Madrid E] 
. . . . Bradyrhizobium japonicum ...............................................  350 23 hits [a-proteobacteria]  subunit B protein of DNA gyrase [Bradyrhizobium japonicum]
. . . . Rickettsia bellii RML369-C .............................................  350  3 hits [a-proteobacteria]  DNA gyrase subunit B [Rickettsia bellii RML369-C] >gi|15782
. . . . Rickettsia bellii OSU 85-389 ...........................................  350  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rickettsia bellii RML369-C] >gi|15782
. . . . Rickettsia sibirica 246 ................................................  350  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rickettsia sibirica 246] >gi|28262868
. . . . Rickettsia massiliae MTU5 ..............................................  349  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rickettsia massiliae MTU5] >gi|157844
. . . . alpha proteobacterium HIMB114 ..........................................  349  2 hits [a-proteobacteria]  DNA gyrase, B subunit [alpha proteobacterium HIMB114] >gi|2
. . . . Rickettsia africae ESF-5 ...............................................  349  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rickettsia africae ESF-5] >gi|2280219
. . . . Rickettsia conorii str. Malish 7 .......................................  349  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rickettsia conorii str. Malish 7] >gi
. . . . Rickettsia conorii .....................................................  349  1 hit  [a-proteobacteria]  DNA gyrase subunit B [Rickettsia conorii str. Malish 7] >gi
. . . . Rickettsia peacockii str. Rustic .......................................  349  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rickettsia peacockii str. Rustic] >gi
. . . . Bradyrhizobium liaoningense ............................................  348  1 hit  [a-proteobacteria]  DNA gyrase subunit B [Bradyrhizobium liaoningense]
. . . . Wolbachia endosymbiont of Culex quinquefasciatus Pel ...................  348  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Wolbachia endosymbiont of Culex quin
. . . . Wolbachia endosymbiont of Culex quinquefasciatus JHB ...................  348  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Wolbachia endosymbiont of Culex quin
. . . . Rickettsia canadensis str. McKiel ......................................  348  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rickettsia canadensis str. McKiel] >g
. . . . Rhodomicrobium vannielii ...............................................  348  1 hit  [a-proteobacteria]  DNA gyrase subunit B [Rhodomicrobium vannielii]
. . . . Candidatus Midichloria mitochondrii ....................................  348  1 hit  [a-proteobacteria]  gyrase subunit beta [Candidatus Midichloria mitochondrii]
. . . . Acetobacter pasteurianus IFO 3283-01 ...................................  347  2 hits [a-proteobacteria]  DNA gyrase subunit B Hsp90-like ATPase [Acetobacter pasteur
. . . . Acetobacter pasteurianus IFO 3283-03 ...................................  347  1 hit  [a-proteobacteria]  DNA gyrase subunit B Hsp90-like ATPase [Acetobacter pasteur
. . . . Acetobacter pasteurianus IFO 3283-07 ...................................  347  1 hit  [a-proteobacteria]  DNA gyrase subunit B Hsp90-like ATPase [Acetobacter pasteur
. . . . Acetobacter pasteurianus IFO 3283-22 ...................................  347  1 hit  [a-proteobacteria]  DNA gyrase subunit B Hsp90-like ATPase [Acetobacter pasteur
. . . . Acetobacter pasteurianus IFO 3283-26 ...................................  347  1 hit  [a-proteobacteria]  DNA gyrase subunit B Hsp90-like ATPase [Acetobacter pasteur
. . . . Acetobacter pasteurianus IFO 3283-32 ...................................  347  1 hit  [a-proteobacteria]  DNA gyrase subunit B Hsp90-like ATPase [Acetobacter pasteur
. . . . Acetobacter pasteurianus IFO 3283-01-42C ...............................  347  1 hit  [a-proteobacteria]  DNA gyrase subunit B Hsp90-like ATPase [Acetobacter pasteur
. . . . Acetobacter pasteurianus IFO 3283-12 ...................................  347  1 hit  [a-proteobacteria]  DNA gyrase subunit B Hsp90-like ATPase [Acetobacter pasteur
. . . . Granulibacter bethesdensis CGDNIH1 .....................................  346  2 hits [a-proteobacteria]  DNA gyrase subunit B [Granulibacter bethesdensis CGDNIH1] >
. . . . Rhodopseudomonas sp. B29 ...............................................  346  1 hit  [a-proteobacteria]  DNA gyrase subunit B [Rhodopseudomonas sp. B29]
. . . . Caulobacter sp. ........................................................  345  2 hits [a-proteobacteria]  DNA gyrase subunit B [Caulobacter sp.]
. . . . Gluconobacter oxydans 621H .............................................  345  2 hits [a-proteobacteria]  DNA gyrase subunit B [Gluconobacter oxydans 621H] >gi|58000
. . . . Rhizobium leguminosarum ................................................  345  1 hit  [a-proteobacteria]  DNA gyrase subunit B [Rhizobium leguminosarum]
. . . . Acidiphilium cryptum JF-5 ..............................................  345  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Acidiphilium cryptum JF-5] >gi|14640
. . . . Rickettsia akari str. Hartford .........................................  344  2 hits [a-proteobacteria]  DNA gyrase subunit B [Rickettsia akari str. Hartford] >gi|1
. . . . Bradyrhizobium elkanii USDA 94 .........................................  340  1 hit  [a-proteobacteria]  DNA gyrase subunit B [Bradyrhizobium elkanii USDA 94]
. . . . Bradyrhizobium elkanii USDA 76 .........................................  338  1 hit  [a-proteobacteria]  DNA gyrase subunit B [Bradyrhizobium elkanii USDA 76] >gi|1
. . . . Bradyrhizobium elkanii .................................................  338  4 hits [a-proteobacteria]  DNA gyrase subunit B [Bradyrhizobium elkanii USDA 76] >gi|1
. . . . Gluconacetobacter diazotrophicus PAl 5 .................................  338  4 hits [a-proteobacteria]  DNA gyrase, B subunit [Gluconacetobacter diazotrophicus PAl
. . . . Wolbachia endosymbiont strain TRS of Brugia malayi .....................  337  2 hits [a-proteobacteria]  DNA gyrase, topoisomerase II, B subunit, GyrB [Wolbachia en
. . . . Orientia tsutsugamushi str. Ikeda ......................................  337  2 hits [a-proteobacteria]  DNA gyrase subunit B [Orientia tsutsugamushi str. Ikeda] >g
. . . . Orientia tsutsugamushi str. Boryong ....................................  336  2 hits [a-proteobacteria]  DNA gyrase subunit B [Orientia tsutsugamushi str. Boryong] 
. . . . Wolbachia sp. wRi ......................................................  335  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Wolbachia sp. wRi] >gi|225591969|gb|
. . . . Wolbachia endosymbiont of Drosophila melanogaster ......................  333  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Wolbachia endosymbiont of Drosophila
. . . . Caulobacter fusiformis .................................................  333  1 hit  [a-proteobacteria]  DNA gyrase subunit B [Caulobacter fusiformis]
. . . . Ehrlichia canis str. Jake ..............................................  333  2 hits [a-proteobacteria]  DNA gyrase subunit B [Ehrlichia canis str. Jake] >gi|723941
. . . . Bradyrhizobium canariense ..............................................  333  1 hit  [a-proteobacteria]  DNA gyrase subunit B [Bradyrhizobium canariense]
. . . . Ehrlichia chaffeensis str. Sapulpa .....................................  332  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Ehrlichia chaffeensis str. Sapulpa] 
. . . . Ehrlichia chaffeensis str. Arkansas ....................................  332  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Ehrlichia chaffeensis str. Sapulpa] 
. . . . Wolbachia endosymbiont of Muscidifurax uniraptor .......................  332  2 hits [a-proteobacteria]  DNA gyrase, B subunit [Wolbachia endosymbiont of Muscidifur
. . . Aggregatibacter aphrophilus NJ8700 ---------------------------------------  365  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Aggregatibacter aphrophilus NJ8700] 
. . . Haemophilus somnus 2336 ..................................................  362  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Haemophilus somnus 2336] >gi|1688262
. . . Haemophilus influenzae PittEE ............................................  362  2 hits [g-proteobacteria]  DNA gyrase subunit B [Haemophilus influenzae PittEE] >gi|89
. . . Haemophilus influenzae ...................................................  362  2 hits [g-proteobacteria]  DNA gyrase subunit B [Haemophilus influenzae PittEE] >gi|89
. . . Haemophilus somnus 129PT .................................................  361  2 hits [g-proteobacteria]  DNA gyrase subunit B [Haemophilus somnus 129PT] >gi|1128238
. . . Aggregatibacter actinomycetemcomitans D11S-1 .............................  361  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Aggregatibacter actinomycetemcomitan
. . . Haemophilus influenzae 3655 ..............................................  360  2 hits [g-proteobacteria]  DNA gyrase subunit B [Haemophilus influenzae 3655] >gi|1449
. . . Haemophilus influenzae R2866 .............................................  360  1 hit  [g-proteobacteria]  COG0187: Type IIA topoisomerase (DNA gyrase/topo II, topois
. . . Haemophilus influenzae PittII ............................................  360  2 hits [g-proteobacteria]  COG0187: Type IIA topoisomerase (DNA gyrase/topo II, topois
. . . Haemophilus influenzae 86-028NP ..........................................  360  2 hits [g-proteobacteria]  DNA gyrase subunit B [Haemophilus influenzae 86-028NP] >gi|
. . . Haemophilus influenzae 6P18H1 ............................................  360  2 hits [g-proteobacteria]  DNA gyrase subunit B [Haemophilus influenzae 86-028NP] >gi|
. . . Haemophilus influenzae PittGG ............................................  360  2 hits [g-proteobacteria]  DNA gyrase subunit B [Haemophilus influenzae PittGG] >gi|14
. . . Haemophilus influenzae PittAA ............................................  360  2 hits [g-proteobacteria]  DNA gyrase subunit B [Haemophilus influenzae PittAA] >gi|14
. . . Haemophilus influenzae RdAW ..............................................  360  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Haemophilus influenzae RdAW] >gi|260
. . . Haemophilus influenzae 7P49H1 ............................................  360  2 hits [g-proteobacteria]  DNA gyrase subunit B [Haemophilus influenzae 7P49H1] >gi|22
. . . Haemophilus influenzae 22.1-21 ...........................................  360  2 hits [g-proteobacteria]  DNA gyrase subunit B [Haemophilus influenzae 22.1-21] >gi|1
. . . Haemophilus influenzae R2846 .............................................  360  1 hit  [g-proteobacteria]  COG0187: Type IIA topoisomerase (DNA gyrase/topo II, topois
. . . Haemophilus influenzae NT127 .............................................  359  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Haemophilus influenzae NT127] >gi|26
. . . Haemophilus influenzae PittHH ............................................  359  2 hits [g-proteobacteria]  DNA gyrase subunit B [Haemophilus influenzae PittHH] >gi|14
. . . Aggregatibacter actinomycetemcomitans D7S-1 ..............................  358  1 hit  [g-proteobacteria]  DNA gyrase, B subunit [Aggregatibacter actinomycetemcomitan
. . . Haemophilus influenzae R3021 .............................................  358  2 hits [g-proteobacteria]  DNA gyrase subunit B [Haemophilus influenzae 22.4-21] >gi|1
. . . Cardiobacterium hominis ATCC 15826 .......................................  357  2 hits [g-proteobacteria]  DNA gyrase subunit B [Cardiobacterium hominis ATCC 15826] >
. . . Yersinia aldovae ATCC 35236 ..............................................  357  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia aldovae ATCC 35236] >gi|2387
. . . Pasteurella dagmatis ATCC 43325 ..........................................  356  2 hits [g-proteobacteria]  DNA topoisomerase (ATP-hydrolyzing) subunit B [Pasteurella 
. . . Haemophilus influenzae Rd KW20 ...........................................  356  2 hits [g-proteobacteria]  DNA gyrase subunit B [Haemophilus influenzae Rd KW20] >gi|1
. . . Haemophilus influenzae 22.4-21 ...........................................  355  2 hits [g-proteobacteria]  DNA gyrase subunit B [Haemophilus influenzae R3021] >gi|145
. . . Yersinia intermedia ATCC 29909 ...........................................  355  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia intermedia ATCC 29909] >gi|2
. . . Pasteurella multocida subsp. multocida str. Pm70 .........................  354  2 hits [g-proteobacteria]  DNA gyrase subunit B [Pasteurella multocida subsp. multocid
. . . Yersinia mollaretii ATCC 43969 ...........................................  353  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia mollaretii ATCC 43969] >gi|2
. . . Halorhodospira halophila SL1 .............................................  353  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Halorhodospira halophila SL1] >gi|12
. . . Yersinia bercovieri ATCC 43970 ...........................................  353  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia bercovieri ATCC 43970] >gi|2
. . . Actinobacillus succinogenes 130Z .........................................  353  2 hits [g-proteobacteria]  DNA gyrase subunit B [Actinobacillus succinogenes 130Z] >gi
. . . Edwardsiella ictaluri 93-146 .............................................  353  2 hits [enterobacteria]    DNA gyrase, B subunit, putative [Edwardsiella ictaluri 93-1
. . . gamma proteobacterium HTCC5015 ...........................................  352  2 hits [g-proteobacteria]  DNA gyrase, B subunit [gamma proteobacterium HTCC5015] >gi|
. . . Yersinia ruckeri ATCC 29473 ..............................................  352  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia ruckeri ATCC 29473] >gi|2387
. . . Francisella novicida GA99-3548 ...........................................  352  2 hits [g-proteobacteria]  hypothetical protein FTDG_00183 [Francisella novicida GA99-
. . . Francisella novicida FTG .................................................  352  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Francisella novicida FTG] >gi|208744
. . . Francisella philomiragia subsp. philomiragia ATCC 25017 ..................  351  2 hits [g-proteobacteria]  DNA topoisomerase (ATP-hydrolyzing) [Francisella philomirag
. . . Francisella philomiragia subsp. philomiragia ATCC 25015 ..................  351  3 hits [g-proteobacteria]  DNA topoisomerase (ATP-hydrolyzing) [Francisella philomirag
. . . Edwardsiella tarda .......................................................  350  1 hit  [enterobacteria]    DNA gyrase subunit B [Edwardsiella tarda]
. . . Edwardsiella tarda EIB202 ................................................  350  2 hits [enterobacteria]    DNA gyrase subunit B [Edwardsiella tarda EIB202] >gi|267983
. . . Yersinia enterocolitica subsp. enterocolitica 8081 .......................  350  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia enterocolitica subsp. entero
. . . Yersinia kristensenii ATCC 33638 .........................................  350  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia kristensenii ATCC 33638] >gi
. . . Francisella tularensis subsp. holarctica .................................  350  1 hit  [g-proteobacteria]  DNA gyrase subunit B [Francisella tularensis subsp. holarct
. . . Francisella tularensis subsp. holarctica OSU18 ...........................  350  2 hits [g-proteobacteria]  DNA gyrase subunit B [Francisella tularensis subsp. holarct
. . . Francisella tularensis subsp. holarctica FSC200 ..........................  350  1 hit  [g-proteobacteria]  DNA gyrase subunit B [Francisella tularensis subsp. holarct
. . . Francisella tularensis subsp. holarctica URFT1 ...........................  350  1 hit  [g-proteobacteria]  DNA gyrase subunit B [Francisella tularensis subsp. holarct
. . . Francisella tularensis subsp. holarctica LVS .............................  350  1 hit  [g-proteobacteria]  DNA gyrase subunit B [Francisella tularensis subsp. holarct
. . . Francisella tularensis subsp. holarctica FSC022 ..........................  350  2 hits [g-proteobacteria]  DNA gyrase subunit B [Francisella tularensis subsp. holarct
. . . Francisella tularensis subsp. holarctica FTNF002-00 ......................  350  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Francisella tularensis subsp. holarc
. . . Francisella tularensis subsp. tularensis WY96-3418 .......................  350  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Francisella tularensis subsp. tulare
. . . Francisella tularensis subsp. tularensis MA00-2987 .......................  350  3 hits [g-proteobacteria]  DNA gyrase, B subunit [Francisella tularensis subsp. tulare
. . . Francisella tularensis subsp. tularensis FSC033 ..........................  350  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Francisella tularensis subsp. tulare
. . . Francisella tularensis subsp. tularensis NE061598 ........................  350  1 hit  [g-proteobacteria]  DNA gyrase, B subunit [Francisella tularensis subsp. tulare
. . . Francisella novicida U112 ................................................  350  2 hits [g-proteobacteria]  DNA gyrase subunit B [Francisella tularensis subsp. novicid
. . . Francisella novicida FTE .................................................  350  2 hits [g-proteobacteria]  DNA gyrase subunit B [Francisella tularensis subsp. novicid
. . . Francisella novicida GA99-3549 ...........................................  350  2 hits [g-proteobacteria]  DNA gyrase subunit B [Francisella tularensis subsp. novicid
. . . Vibrio parahaemolyticus 16 ...............................................  350  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Vibrio parahaemolyticus 16] >gi|2195
. . . Vibrio sp. MED222 ........................................................  350  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio sp. MED222] >gi|218708101|ref|
. . . Vibrio splendidus LGP32 ..................................................  350  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio sp. MED222] >gi|218708101|ref|
. . . Francisella tularensis subsp. tularensis SCHU S4 .........................  350  2 hits [g-proteobacteria]  DNA gyrase subunit B [Francisella tularensis subsp. tularen
. . . Francisella tularensis subsp. tularensis FSC198 ..........................  350  2 hits [g-proteobacteria]  DNA gyrase subunit B [Francisella tularensis subsp. tularen
. . . Yersinia rohdei ATCC 43380 ...............................................  350  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia rohdei ATCC 43380] >gi|23871
. . . Erwinia tasmaniensis Et1/99 ..............................................  350  2 hits [enterobacteria]    DNA gyrase subunit B [Erwinia tasmaniensis Et1/99] >gi|1880
. . . Acinetobacter lwoffii SH145 ..............................................  349  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Acinetobacter lwoffii SH145] >gi|262
. . . Pantoea sp. At-9b ........................................................  349  2 hits [enterobacteria]    DNA gyrase, B subunit [Pantoea sp. At-9b] >gi|258533651|gb|
. . . Escherichia coli O127:H6 str. E2348/69 ...................................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O127:H6 str. E2348/6
. . . Vibrionales bacterium SWAT-3 .............................................  349  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrionales bacterium SWAT-3] >gi|145
. . . Yersinia pseudotuberculosis IP 32953 .....................................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pestis Antiqua ..................................................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pestis Nepal516 .................................................  349  4 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pestis Pestoides F ..............................................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pestis CA88-4125 ................................................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pseudotuberculosis IP 31758 .....................................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pestis Angola ...................................................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pestis biovar Orientalis str. F1991016 ..........................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pestis biovar Orientalis str. IP275 .............................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pestis biovar Antiqua str. E1979001 .............................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pestis biovar Antiqua str. B42003004 ............................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pestis biovar Antiqua str. UG05-0454 ............................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pestis biovar Orientalis str. MG05-1020 .........................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pestis biovar Mediaevalis str. K1973002 .........................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pseudotuberculosis YPIII ........................................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pseudotuberculosis PB1/+ ........................................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pestis CO92 .....................................................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pestis biovar Orientalis str. PEXU2 .............................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pestis biovar Orientalis str. India 195 .........................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pestis Pestoides A ..............................................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pestis KIM D27 ..................................................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pestis D106004 ..................................................  349  1 hit  [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pestis D182038 ..................................................  349  1 hit  [enterobacteria]    DNA gyrase subunit B [Yersinia pseudotuberculosis IP 32953]
. . . Yersinia pestis KIM 10 ...................................................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pestis KIM 10] >gi|45443725|
. . . Yersinia pestis biovar Microtus str. 91001 ...............................  349  2 hits [enterobacteria]    DNA gyrase subunit B [Yersinia pestis KIM 10] >gi|45443725|
. . . Pseudoalteromonas tunicata D2 ............................................  348  2 hits [g-proteobacteria]  DNA gyrase, subunit B (type II topoisomerase) [Pseudoaltero
. . . Vibrio coralliilyticus ATCC BAA-450 ......................................  348  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio coralliilyticus ATCC BAA-450] 
. . . Vibrio cholerae 2740-80 ..................................................  348  2 hits [g-proteobacteria]  DNA gyrase, subunit B [Vibrio cholerae 2740-80] >gi|1215484
. . . Vibrio shilonii AK1 ......................................................  348  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio shilonii AK1] >gi|148834271|gb
. . . Vibrio cholerae 1587 .....................................................  348  2 hits [g-proteobacteria]  DNA gyrase, subunit B [Vibrio cholerae 1587] >gi|124116182|
. . . Pectobacterium carotovorum subsp. carotovorum PC1 ........................  348  2 hits [enterobacteria]    DNA gyrase, B subunit [Pectobacterium carotovorum subsp. ca
. . . Vibrio cholerae 12129(1) .................................................  348  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio cholerae 12129(1)] >gi|2293323
. . . Francisella tularensis subsp. mediasiatica FSC147 ........................  348  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Francisella tularensis subsp. medias
. . . Nitrococcus mobilis Nb-231 ...............................................  348  2 hits [g-proteobacteria]  DNA gyrase subunit B [Nitrococcus mobilis Nb-231] >gi|88789
. . . Vibrio cholerae V51 ......................................................  348  2 hits [g-proteobacteria]  DNA gyrase, subunit B [Vibrio cholerae V51] >gi|254291124|r
. . . Vibrio cholerae AM-19226 .................................................  348  2 hits [g-proteobacteria]  DNA gyrase, subunit B [Vibrio cholerae V51] >gi|254291124|r
. . . Vibrio cholerae TM 11079-80 ..............................................  348  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio cholerae TM 11079-80] >gi|2293
. . . Vibrio fischeri ES114 ....................................................  348  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio fischeri ES114] >gi|59478720|g
. . . Thioalkalivibrio sp. HL-EbGR7 ............................................  348  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Thioalkalivibrio sp. HL-EbGR7] >gi|2
. . . Serratia proteamaculans 568 ..............................................  348  2 hits [enterobacteria]    DNA gyrase subunit B [Serratia proteamaculans 568] >gi|1573
. . . Sodalis glossinidius str. 'morsitans' ....................................  348  2 hits [enterobacteria]    DNA gyrase subunit B [Sodalis glossinidius str. 'morsitans'
. . . Mannheimia haemolytica serotype A2 str. OVINE ............................  348  2 hits [g-proteobacteria]  DNA gyrase subunit B [Mannheimia haemolytica serotype A2 st
. . . Vibrio mimicus MB-451 ....................................................  347  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio mimicus MB-451] >gi|261893857|
. . . Vibrio mimicus VM573 .....................................................  347  2 hits [g-proteobacteria]  DNA gyrase, subunit B [Vibrio mimicus VM573] >gi|258626085|
. . . Vibrio mimicus VM603 .....................................................  347  2 hits [g-proteobacteria]  DNA gyrase, subunit B [Vibrio mimicus VM573] >gi|258626085|
. . . Shewanella sp. MR-7 ......................................................  347  2 hits [g-proteobacteria]  DNA gyrase subunit B [Shewanella sp. MR-7] >gi|113886959|gb
. . . Vibrio cholerae O1 biovar El Tor str. N16961 .............................  347  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio cholerae O1 biovar El Tor str.
. . . Vibrio cholerae V52 ......................................................  347  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio cholerae O1 biovar El Tor str.
. . . Vibrio cholerae O395 .....................................................  347  3 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio cholerae O1 biovar El Tor str.
. . . Vibrio cholerae MAK 757 ..................................................  347  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio cholerae O1 biovar El Tor str.
. . . Vibrio cholerae NCTC 8457 ................................................  347  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio cholerae O1 biovar El Tor str.
. . . Vibrio cholerae B33 ......................................................  347  4 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio cholerae O1 biovar El Tor str.
. . . Vibrio cholerae M66-2 ....................................................  347  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio cholerae O1 biovar El Tor str.
. . . Vibrio cholerae BX 330286 ................................................  347  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio cholerae O1 biovar El Tor str.
. . . Vibrio cholerae RC9 ......................................................  347  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio cholerae O1 biovar El Tor str.
. . . Vibrio cholerae MJ-1236 ..................................................  347  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio cholerae O1 biovar El Tor str.
. . . Vibrio cholerae MO10 .....................................................  347  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio cholerae O1 biovar El Tor str.
. . . Vibrio cholera CIRS 101 ..................................................  347  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio cholerae O1 biovar El Tor str.
. . . Vibrio cholerae INDRE 91/1 ...............................................  347  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio cholerae O1 biovar El Tor str.
. . . Vibrio cholerae RC27 .....................................................  347  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio cholerae O1 biovar El Tor str.
. . . Vibrio cholerae ..........................................................  347  1 hit  [g-proteobacteria]  DNA gyrase subunit B [Vibrio cholerae O1 biovar El Tor str.
. . . Shewanella sp. MR-4 ......................................................  347  2 hits [g-proteobacteria]  DNA gyrase subunit B [Shewanella sp. MR-4] >gi|113883034|gb
. . . Vibrio cholerae bv. albensis VL426 .......................................  347  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio cholerae bv. albensis VL426] >
. . . Marinobacter algicola DG893 ..............................................  347  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Marinobacter algicola DG893] >gi|149
. . . Mannheimia haemolytica PHL213 ............................................  347  2 hits [g-proteobacteria]  DNA topoisomerase (ATP-hydrolyzing) subunit B [Mannheimia h
. . . Mannheimia haemolytica serotype A2 str. BOVINE ...........................  347  2 hits [g-proteobacteria]  DNA topoisomerase (ATP-hydrolyzing) subunit B [Mannheimia h
. . . Photobacterium damselae subsp. damselae CIP 102761 .......................  347  2 hits [g-proteobacteria]  DNA gyrase subunit B [Photobacterium damselae subsp. damsel
. . . Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum) ................  347  2 hits [enterobacteria]    DNA gyrase, subunit B (type II topoisomerase) [Candidatus H
. . . Shewanella sp. ANA-3 .....................................................  347  2 hits [g-proteobacteria]  DNA gyrase subunit B [Shewanella sp. ANA-3] >gi|117610803|g
. . . Vibrio splendidus 12B01 ..................................................  347  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio splendidus 12B01] >gi|84375268
. . . Erwinia pyrifoliae DSM 12163 .............................................  347  1 hit  [enterobacteria]    DNA gyrase subunit B [Erwinia pyrifoliae DSM 12163]
. . . Vibrio sp. RC341 .........................................................  347  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio sp. RC341] >gi|262402079|ref|Z
. . . Vibrio sp. RC586 .........................................................  347  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio sp. RC341] >gi|262402079|ref|Z
. . . Pectobacterium carotovorum subsp. carotovorum WPP14 ......................  347  1 hit  [enterobacteria]    DNA gyrase subunit B [Pectobacterium carotovorum subsp. car
. . . Serratia odorifera 4Rx13 .................................................  347  2 hits [enterobacteria]    DNA gyrase subunit B [Serratia odorifera 4Rx13] >gi|2700417
. . . Erwinia pyrifoliae Ep1/96 ................................................  347  2 hits [enterobacteria]    DNA gyrase subunit B [Erwinia pyrifoliae Ep1/96] >gi|224965
. . . Pectobacterium wasabiae WPP163 ...........................................  347  2 hits [enterobacteria]    DNA gyrase, B subunit [Pectobacterium wasabiae WPP163] >gi|
. . . Pectobacterium carotovorum subsp. brasiliensis PBR1692 ...................  346  1 hit  [enterobacteria]    DNA gyrase subunit B [Pectobacterium carotovorum subsp. bra
. . . Alkalilimnicola ehrlichii MLHE-1 .........................................  346  2 hits [g-proteobacteria]  DNA gyrase subunit B [Alkalilimnicola ehrlichii MLHE-1] >gi
. . . Vibrio cholerae MZO-2 ....................................................  346  2 hits [g-proteobacteria]  DNA gyrase, subunit B [Vibrio cholerae MZO-2] >gi|229515946
. . . Vibrio cholerae TMA 21 ...................................................  346  2 hits [g-proteobacteria]  DNA gyrase, subunit B [Vibrio cholerae MZO-2] >gi|229515946
. . . Alteromonas macleodii ATCC 27126 .........................................  346  1 hit  [g-proteobacteria]  DNA gyrase subunit B [Alteromonas macleodii ATCC 27126]
. . . Vibrio cholerae MZO-3 ....................................................  346  2 hits [g-proteobacteria]  DNA gyrase, subunit B [Vibrio cholerae MZO-3] >gi|124121961
. . . Pseudoalteromonas haloplanktis TAC125 ....................................  346  2 hits [g-proteobacteria]  DNA gyrase subunit B [Pseudoalteromonas haloplanktis TAC125
. . . Vibrio parahaemolyticus RIMD 2210633 .....................................  346  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio parahaemolyticus RIMD 2210633]
. . . Vibrio parahaemolyticus AQ3810 ...........................................  346  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio parahaemolyticus RIMD 2210633]
. . . Vibrio parahaemolyticus K5030 ............................................  346  1 hit  [g-proteobacteria]  DNA gyrase subunit B [Vibrio parahaemolyticus RIMD 2210633]
. . . Vibrio parahaemolyticus AN-5034 ..........................................  346  1 hit  [g-proteobacteria]  DNA gyrase subunit B [Vibrio parahaemolyticus RIMD 2210633]
. . . Vibrio parahaemolyticus Peru-466 .........................................  346  1 hit  [g-proteobacteria]  DNA gyrase subunit B [Vibrio parahaemolyticus RIMD 2210633]
. . . Vibrio parahaemolyticus AQ4037 ...........................................  346  1 hit  [g-proteobacteria]  DNA gyrase subunit B [Vibrio parahaemolyticus RIMD 2210633]
. . . Vibrio parahaemolyticus ..................................................  346  1 hit  [g-proteobacteria]  DNA gyrase subunit B [Vibrio parahaemolyticus RIMD 2210633]
. . . Dickeya dadantii Ech586 ..................................................  346  2 hits [enterobacteria]    DNA gyrase, B subunit [Dickeya dadantii Ech586] >gi|2703421
. . . Dickeya dadantii Ech703 ..................................................  345  2 hits [enterobacteria]    DNA gyrase, B subunit [Dickeya dadantii Ech703] >gi|2421295
. . . Vibrio mimicus VM223 .....................................................  345  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio mimicus VM223] >gi|262026503|g
. . . Shewanella amazonensis SB2B ..............................................  345  2 hits [g-proteobacteria]  DNA topoisomerase (ATP-hydrolyzing) [Shewanella amazonensis
. . . Vibrio vulnificus CMCP6 ..................................................  345  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio vulnificus CMCP6] >gi|37678198
. . . Vibrio vulnificus YJ016 ..................................................  345  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio vulnificus CMCP6] >gi|37678198
. . . Dickeya zeae Ech1591 .....................................................  345  2 hits [enterobacteria]    DNA gyrase, B subunit [Dickeya zeae Ech1591] >gi|247536277|
. . . Grimontia hollisae CIP 101886 ............................................  345  2 hits [g-proteobacteria]  DNA gyrase subunit B [Grimontia hollisae CIP 101886] >gi|26
. . . Photobacterium sp. SKA34 .................................................  345  2 hits [g-proteobacteria]  DNA gyrase subunit B [Photobacterium sp. SKA34] >gi|8904946
. . . Cronobacter sakazakii ATCC BAA-894 .......................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Enterobacter sakazakii ATCC BAA-894] 
. . . Citrobacter sp. 30_2 .....................................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Citrobacter sp. 30_2] >gi|226909643|g
. . . Neisseria meningitidis MC58 ..............................................  345  2 hits [b-proteobacteria]  DNA gyrase subunit B [Neisseria meningitidis MC58] >gi|7225
. . . Cronobacter turicensis z3032 .............................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Cronobacter turicensis z3032] >gi|260
. . . Neisseria meningitidis alpha14 ...........................................  345  2 hits [b-proteobacteria]  DNA gyrase subunit B [Neisseria meningitidis alpha14] >gi|2
. . . Neisseria meningitidis Z2491 .............................................  345  2 hits [b-proteobacteria]  DNA gyrase subunit B [Neisseria meningitidis Z2491] >gi|121
. . . Alteromonadales bacterium TW-7 ...........................................  345  2 hits [g-proteobacteria]  DNA gyrase, subunit B (type II topoisomerase) [Alteromonada
. . . Actinobacillus pleuropneumoniae serovar 1 str. 4074 ......................  345  1 hit  [g-proteobacteria]  COG0187: Type IIA topoisomerase (DNA gyrase/topo II, topois
. . . Actinobacillus pleuropneumoniae serovar 3 str. JL03 ......................  345  2 hits [g-proteobacteria]  COG0187: Type IIA topoisomerase (DNA gyrase/topo II, topois
. . . Actinobacillus pleuropneumoniae serovar 7 str. AP76 ......................  345  2 hits [g-proteobacteria]  COG0187: Type IIA topoisomerase (DNA gyrase/topo II, topois
. . . Neisseria meningitidis alpha153 ..........................................  345  1 hit  [b-proteobacteria]  DNA gyrase subunit B [Neisseria meningitidis alpha153]
. . . Actinobacillus pleuropneumoniae L20 ......................................  345  2 hits [g-proteobacteria]  DNA gyrase subunit B [Actinobacillus pleuropneumoniae L20] 
. . . Vibrio fischeri MJ11 .....................................................  345  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Vibrio fischeri MJ11] >gi|197315574|
. . . Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 ...  345  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 ...  345  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Kangiella koreensis DSM 16069 ............................................  345  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Kangiella koreensis DSM 16069] >gi|2
. . . Coxiella burnetii Dugway 5J108-111 .......................................  345  2 hits [g-proteobacteria]  DNA gyrase subunit B [Coxiella burnetii Dugway 5J108-111] >
. . . Haemophilus ducreyi 35000HP ..............................................  345  2 hits [g-proteobacteria]  DNA gyrase subunit B [Haemophilus ducreyi 35000HP] >gi|3314
. . . Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. arizonae s
. . . Listonella anguillarum ...................................................  345  1 hit  [g-proteobacteria]  DNA gyrase subunit B [Listonella anguillarum]
. . . Shewanella sediminis HAW-EB3 .............................................  345  2 hits [g-proteobacteria]  DNA topoisomerase (ATP-hydrolyzing) [Shewanella sediminis H
. . . Escherichia coli O157:H7 EDL933 ..........................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 EDL933] >gi|
. . . Escherichia coli .........................................................  345 11 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 EDL933] >gi|
. . . Escherichia coli 042 .....................................................  345  1 hit  [enterobacteria]    DNA gyrase subunit B [Escherichia coli 042]
. . . Coxiella burnetii CbuG_Q212 ..............................................  345  2 hits [g-proteobacteria]  DNA gyrase subunit B [Coxiella burnetii CbuG_Q212] >gi|2120
. . . Escherichia coli O157:H7 str. Sakai ......................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Shigella flexneri 2a str. 2457T ..........................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli str. K-12 substr. MG1655 ................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Shigella flexneri 2a str. 301 ............................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Shigella sonnei Ss046 ....................................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli str. K-12 substr. W3110 .................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Shigella flexneri 5 str. 8401 ............................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli E24377A .................................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli HS ......................................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli O157:H7 str. EC4113 .....................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli O157:H7 str. EC4401 .....................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli O157:H7 str. EC4501 .....................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli O157:H7 str. EC4486 .....................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli O157:H7 str. EC4196 .....................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli O157:H7 str. EC4076 .....................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli O157:H7 str. EC869 ......................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli O157:H7 str. EC508 ......................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli ATCC 8739 ...............................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli 53638 ...................................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli B7A .....................................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli E22 .....................................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli E110019 .................................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli B171 ....................................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli 101-1 ...................................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli O157:H7 str. EC4024 .....................................  345  1 hit  [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli O157:H7 str. EC4206 .....................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli O157:H7 str. EC4045 .....................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli O157:H7 str. EC4042 .....................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli SE11 ....................................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli IAI1 ....................................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli 55989 ...................................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli BW2952 ..................................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli BL21(DE3) ...............................................  345  4 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli B str. REL606 ...........................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli O157:H7 str. TW14359 ....................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia sp. 4_1_40B ..................................................  345  1 hit  [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli O103:H2 str. 12009 ......................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli O26:H11 str. 11368 ......................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli O111:H- str. 11128 ......................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli O157:H7 str. FRIK2000 ...................................  345  1 hit  [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli O157:H7 str. FRIK966 ....................................  345  1 hit  [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli O157:H7 .................................................  345  1 hit  [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli K-12 ....................................................  345  1 hit  [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Shigella flexneri ........................................................  345  1 hit  [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli DH1 .....................................................  345  1 hit  [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Shigella flexneri 2002017 ................................................  345  1 hit  [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Escherichia coli O55:H7 str. CB9615 ......................................  345  1 hit  [enterobacteria]    DNA gyrase subunit B [Escherichia coli O157:H7 str. Sakai] 
. . . Coxiella burnetii RSA 493 ................................................  345  2 hits [g-proteobacteria]  DNA gyrase subunit B [Coxiella burnetii RSA 493] >gi|206583
. . . Escherichia coli O157:H7 str. EC4115 .....................................  345  2 hits [enterobacteria]    DNA gyrase, B subunit [Escherichia coli O157:H7 str. EC4115
. . . Escherichia coli O157:H7 str. TW14588 ....................................  345  2 hits [enterobacteria]    DNA gyrase, B subunit [Escherichia coli O157:H7 str. EC4115
. . . Escherichia sp. 1_1_43 ...................................................  345  2 hits [enterobacteria]    DNA gyrase, B subunit [Escherichia coli O157:H7 str. EC4115
. . . Shigella sp. D9 ..........................................................  345  1 hit  [enterobacteria]    DNA gyrase subunit B [Shigella sp. D9]
. . . Shigella boydii Sb227 ....................................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Shigella boydii Sb227] >gi|187731654|
. . . Shigella boydii CDC 3083-94 ..............................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Shigella boydii Sb227] >gi|187731654|
. . . Escherichia albertii TW07627 .............................................  345  2 hits [enterobacteria]    DNA gyrase, B subunit [Escherichia albertii TW07627] >gi|17
. . . Neisseria meningitidis 053442 ............................................  345  2 hits [b-proteobacteria]  DNA gyrase subunit B [Neisseria meningitidis 053442] >gi|16
. . . Vibrio harveyi 1DA3 ......................................................  345  2 hits [g-proteobacteria]  DNA gyrase, subunit B [Vibrio harveyi 1DA3] >gi|269832617|g
. . . Escherichia coli UMN026 ..................................................  345  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli UMN026] >gi|21843444
. . . Coxiella burnetii RSA 331 ................................................  344  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Coxiella burnetii RSA 331] >gi|16176
. . . Salmonella enterica subsp. enterica serovar Typhi str. CT18 ..............  344  1 hit  [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 .........  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Typhi str. Ty2 ...............  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ........  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29 ........  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701 ...  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191 ........  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480 ....  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL486 ........  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066 .........  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Newport str. SL317 ...........  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537 ..  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Newport str. SL254 ...........  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ........  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 .......  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23 ........  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ......  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Virchow str. SL491 ...........  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433 ...  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .......  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 .....  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Typhi str. E02-1180 ..........  344  1 hit  [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191 ....  344  1 hit  [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Typhi str. E98-3139 ..........  344  1 hit  [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Typhimurium ..................  344  3 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Typhi ........................  344  5 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Typhimurium str. D23580 ......  344  1 hit  [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S ......  344  1 hit  [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Vibrio harveyi HY01 ......................................................  344  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Vibrio harveyi HY01] >gi|148868403|g
. . . Shigella dysenteriae Sd197 ...............................................  344  2 hits [enterobacteria]    DNA gyrase subunit B [Shigella dysenteriae Sd197] >gi|81243
. . . Escherichia coli SE15 ....................................................  344  1 hit  [enterobacteria]    DNA gyrase subunit B [Shigella dysenteriae Sd197] >gi|81243
. . . Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 .....  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Shigella dysenteriae 1012 ................................................  344  2 hits [enterobacteria]    DNA gyrase, B subunit [Shigella dysenteriae 1012] >gi|19442
. . . Vibrio harveyi ATCC BAA-1116 .............................................  344  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio harveyi ATCC BAA-1116] >gi|156
. . . Escherichia coli IAI39 ...................................................  344  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli IAI39] >gi|218372534
. . . Vibrio sp. AND4 ..........................................................  344  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio sp. AND4] >gi|159173941|gb|EDP
. . . Coxiella burnetii CbuK_Q154 ..............................................  344  2 hits [g-proteobacteria]  DNA gyrase subunit B [Coxiella burnetii CbuK_Q154] >gi|2120
. . . Salmonella enterica subsp. enterica serovar Agona str. SL483 .............  344  2 hits [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Pectobacterium atrosepticum SCRI1043 .....................................  344  2 hits [enterobacteria]    DNA gyrase subunit B [Pectobacterium atrosepticum SCRI1043]
. . . Photobacterium profundum 3TCK ............................................  344  2 hits [g-proteobacteria]  DNA gyrase subunit B [Photobacterium profundum 3TCK] >gi|90
. . . Vibrio sp. Ex25 ..........................................................  344  4 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio sp. Ex25] >gi|262336374|gb|ACY
. . . Coxiella burnetii 'MSU Goat Q177' ........................................  344  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Coxiella burnetii 'MSU Goat Q177'] >
. . . Salmonella enterica subsp. enterica serovar Typhi str. J185 ..............  344  1 hit  [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Neisseria meningitidis FAM18 .............................................  344  2 hits [b-proteobacteria]  DNA gyrase subunit B [Neisseria meningitidis FAM18] >gi|120
. . . Neisseria gonorrhoeae FA19 ...............................................  344  3 hits [b-proteobacteria]  DNA gyrase subunit B [Neisseria gonorrhoeae FA19] >gi|26868
. . . Neisseria gonorrhoeae PID332 .............................................  344  3 hits [b-proteobacteria]  DNA gyrase subunit B [Neisseria gonorrhoeae FA19] >gi|26868
. . . Neisseria gonorrhoeae FA 1090 ............................................  344  2 hits [b-proteobacteria]  DNA gyrase subunit B [Neisseria gonorrhoeae FA 1090] >gi|25
. . . Neisseria gonorrhoeae 1291 ...............................................  344  2 hits [b-proteobacteria]  DNA gyrase subunit B [Neisseria gonorrhoeae FA 1090] >gi|25
. . . Neisseria gonorrhoeae DGI2 ...............................................  344  3 hits [b-proteobacteria]  DNA gyrase subunit B [Neisseria gonorrhoeae FA 1090] >gi|25
. . . Neisseria gonorrhoeae 35/02 ..............................................  344  3 hits [b-proteobacteria]  DNA gyrase subunit B [Neisseria gonorrhoeae FA 1090] >gi|25
. . . Neisseria gonorrhoeae MS11 ...............................................  344  3 hits [b-proteobacteria]  DNA gyrase subunit B [Neisseria gonorrhoeae FA 1090] >gi|25
. . . Neisseria gonorrhoeae PID18 ..............................................  344  3 hits [b-proteobacteria]  DNA gyrase subunit B [Neisseria gonorrhoeae FA 1090] >gi|25
. . . Neisseria gonorrhoeae SK-92-679 ..........................................  344  3 hits [b-proteobacteria]  DNA gyrase subunit B [Neisseria gonorrhoeae FA 1090] >gi|25
. . . Neisseria gonorrhoeae SK-93-1035 .........................................  344  3 hits [b-proteobacteria]  DNA gyrase subunit B [Neisseria gonorrhoeae FA 1090] >gi|25
. . . Mannheimia succiniciproducens MBEL55E ....................................  344  2 hits [g-proteobacteria]  DNA gyrase subunit B [Mannheimia succiniciproducens MBEL55E
. . . Neisseria gonorrhoeae PID1 ...............................................  344  3 hits [b-proteobacteria]  DNA gyrase subunit B [Neisseria gonorrhoeae PID1] >gi|26858
. . . Vibrio alginolyticus 12G01 ...............................................  344  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio alginolyticus 12G01] >gi|26996
. . . Vibrio alginolyticus 40B .................................................  344  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio alginolyticus 12G01] >gi|26996
. . . Salmonella enterica subsp. enterica serovar Typhi str. E98-0664 ..........  344  1 hit  [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Citrobacter youngae ATCC 29220 ...........................................  344  1 hit  [enterobacteria]    DNA gyrase subunit B [Citrobacter youngae ATCC 29220]
. . . Escherichia coli CFT073 ..................................................  344  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli CFT073] >gi|91213221
. . . Escherichia coli UTI89 ...................................................  344  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli CFT073] >gi|91213221
. . . Escherichia sp. 3_2_53FAA ................................................  344  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli CFT073] >gi|91213221
. . . Escherichia coli 536 .....................................................  344  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli 536] >gi|117625975|r
. . . Escherichia coli APEC O1 .................................................  344  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli 536] >gi|117625975|r
. . . Escherichia coli F11 .....................................................  344  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli 536] >gi|117625975|r
. . . Escherichia coli S88 .....................................................  344  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli 536] >gi|117625975|r
. . . Escherichia coli ED1a ....................................................  344  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli 536] >gi|117625975|r
. . . Escherichia coli 83972 ...................................................  344  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia coli 536] >gi|117625975|r
. . . Escherichia fergusonii ATCC 35469 ........................................  343  2 hits [enterobacteria]    DNA gyrase subunit B [Escherichia fergusonii ATCC 35469] >g
. . . Escherichia coli SMS-3-5 .................................................  343  2 hits [enterobacteria]    DNA gyrase, B subunit [Escherichia coli SMS-3-5] >gi|170518
. . . Salmonella enterica subsp. enterica serovar Typhi str. 404ty .............  343  1 hit  [enterobacteria]    DNA gyrase subunit B [Salmonella enterica subsp. enterica s
. . . Shewanella frigidimarina NCIMB 400 .......................................  343  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Shewanella frigidimarina NCIMB 400] 
. . . Shewanella oneidensis MR-1 ...............................................  343  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Shewanella oneidensis MR-1] >gi|2434
. . . Neisseria meningitidis 8013 ..............................................  343  1 hit  [b-proteobacteria]  DNA gyrase subunit B [Neisseria meningitidis 8013]
. . . Neisseria gonorrhoeae NCCP11945 ..........................................  343  2 hits [b-proteobacteria]  DNA gyrase subunit B [Neisseria gonorrhoeae NCCP11945] >gi|
. . . Neisseria flavescens SK114 ...............................................  343  2 hits [b-proteobacteria]  DNA gyrase, B subunit [Neisseria flavescens SK114] >gi|2413
. . . Neisseria gonorrhoeae DGI18 ..............................................  343  1 hit  [b-proteobacteria]  DNA gyrase subunit B [Neisseria gonorrhoeae DGI18] >gi|2400
. . . Neisseria gonorrhoeae PID24-1 ............................................  343  1 hit  [b-proteobacteria]  DNA gyrase subunit B [Neisseria gonorrhoeae DGI18] >gi|2400
. . . Neisseria lactamica ATCC 23970 ...........................................  343  2 hits [b-proteobacteria]  DNA gyrase, B subunit [Neisseria lactamica ATCC 23970] >gi|
. . . Alteromonas macleodii 'Deep ecotype' .....................................  343  2 hits [g-proteobacteria]  DNA gyrase subunit B [Alteromonas macleodii 'Deep ecotype']
. . . Neisseria gonorrhoeae FA6140 .............................................  343  1 hit  [b-proteobacteria]  DNA gyrase subunit B [Neisseria gonorrhoeae 35/02] >gi|2400
. . . beta proteobacterium KB13 ................................................  343  2 hits [b-proteobacteria]  DNA gyrase, B subunit [beta proteobacterium KB13] >gi|20708
. . . Citrobacter koseri ATCC BAA-895 ..........................................  343  2 hits [enterobacteria]    DNA gyrase subunit B [Citrobacter koseri ATCC BAA-895] >gi|
. . . Actinobacillus minor 202 .................................................  343  2 hits [g-proteobacteria]  DNA gyrase subunit B [Actinobacillus minor 202] >gi|2574502
. . . Actinobacillus minor NM305 ...............................................  343  2 hits [g-proteobacteria]  DNA gyrase subunit B [Actinobacillus minor NM305] >gi|24029
. . . Magnetococcus sp. MC-1 ...................................................  343  2 hits [proteobacteria]    DNA gyrase subunit B [Magnetococcus sp. MC-1] >gi|117607080
. . . gamma proteobacterium NOR5-3 .............................................  343  2 hits [g-proteobacteria]  DNA gyrase, B subunit [gamma proteobacterium NOR5-3] >gi|21
. . . Acinetobacter sp. ATCC 27244 .............................................  343  2 hits [g-proteobacteria]  DNA gyrase, subunit B (type II topoisomerase) [Acinetobacte
. . . Neisseria cinerea ATCC 14685 .............................................  343  2 hits [b-proteobacteria]  DNA gyrase, B subunit [Neisseria cinerea ATCC 14685] >gi|26
. . . Idiomarina loihiensis L2TR ...............................................  342  2 hits [g-proteobacteria]  DNA gyrase subunit B [Idiomarina loihiensis L2TR] >gi|56178
. . . Acinetobacter johnsonii SH046 ............................................  342  2 hits [g-proteobacteria]  conserved hypothetical protein [Acinetobacter johnsonii SH0
. . . Neisseria gonorrhoeae ....................................................  342  2 hits [b-proteobacteria]  RecName: Full=DNA gyrase subunit B >gi|150257|gb|AAA88327.1
. . . Citrobacter rodentium ICC168 .............................................  342  2 hits [enterobacteria]    DNA gyrase subunit B [Citrobacter rodentium ICC168] >gi|282
. . . Dichelobacter nodosus VCS1703A ...........................................  342  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Dichelobacter nodosus VCS1703A] >gi|
. . . Neisseria sicca ATCC 29256 ...............................................  342  2 hits [b-proteobacteria]  DNA gyrase, B subunit [Neisseria sicca ATCC 29256] >gi|2550
. . . Cellvibrio japonicus Ueda107 .............................................  341  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Cellvibrio japonicus Ueda107] >gi|19
. . . Enterobacter cancerogenus ATCC 35316 .....................................  341  2 hits [enterobacteria]    hypothetical protein ENTCAN_08109 [Enterobacter cancerogenu
. . . Neisseria mucosa ATCC 25996 ..............................................  341  2 hits [b-proteobacteria]  DNA gyrase, B subunit [Neisseria mucosa ATCC 25996] >gi|288
. . . Glaciecola sp. HTCC2999 ..................................................  341  1 hit  [g-proteobacteria]  DNA gyrase, subunit B (type II topoisomerase) [alpha proteo
. . . Shewanella piezotolerans WP3 .............................................  341  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Shewanella piezotolerans WP3] >gi|21
. . . Proteus mirabilis HI4320 .................................................  341  2 hits [enterobacteria]    DNA gyrase subunit B [Proteus mirabilis HI4320] >gi|2273548
. . . Proteus mirabilis ATCC 29906 .............................................  341  2 hits [enterobacteria]    DNA gyrase subunit B [Proteus mirabilis HI4320] >gi|2273548
. . . Acinetobacter baumannii AYE ..............................................  341  1 hit  [g-proteobacteria]  DNA gyrase, subunit B (type II topoisomerase) [Acinetobacte
. . . Acinetobacter baumannii AB307-0294 .......................................  341  2 hits [g-proteobacteria]  DNA gyrase, subunit B (type II topoisomerase) [Acinetobacte
. . . Acinetobacter baumannii ..................................................  341  2 hits [g-proteobacteria]  DNA gyrase, subunit B (type II topoisomerase) [Acinetobacte
. . . Acinetobacter baumannii ACICU ............................................  340  2 hits [g-proteobacteria]  Type IIA topoisomerase (DNA gyrase/topo II) [Acinetobacter 
. . . Klebsiella pneumoniae NTUH-K2044 .........................................  340  2 hits [enterobacteria]    DNA gyrase subunit B [Klebsiella pneumoniae NTUH-K2044] >gi
. . . Aeromonas salmonicida subsp. salmonicida A449 ............................  340  2 hits [g-proteobacteria]  DNA gyrase subunit B [Aeromonas salmonicida subsp. salmonic
. . . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ........................  340  2 hits [enterobacteria]    DNA gyrase subunit B [Klebsiella pneumoniae subsp. pneumoni
. . . Acinetobacter baumannii AB900 ............................................  340  1 hit  [g-proteobacteria]  DNA gyrase, B subunit [Acinetobacter baumannii AB900]
. . . Photobacterium angustum S14 ..............................................  340  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio angustum S14] >gi|90437642|gb|
. . . Acinetobacter baumannii AB0057 ...........................................  340  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Acinetobacter baumannii AB0057] >gi|
. . . Acinetobacter baumannii ATCC 19606 .......................................  340  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Acinetobacter baumannii AB0057] >gi|
. . . Hahella chejuensis KCTC 2396 .............................................  340  2 hits [g-proteobacteria]  DNA gyrase subunit B [Hahella chejuensis KCTC 2396] >gi|836
. . . Shewanella violacea ......................................................  340  1 hit  [g-proteobacteria]  DNA topoisomerase chain B [Shewanella violacea]
. . . Haemophilus parasuis 29755 ...............................................  340  2 hits [g-proteobacteria]  DNA gyrase subunit B [Haemophilus parasuis 29755] >gi|16785
. . . Acinetobacter baumannii SDF ..............................................  340  1 hit  [g-proteobacteria]  DNA gyrase, subunit B (type II topoisomerase) [Acinetobacte
. . . Enterobacter sp. 638 .....................................................  340  2 hits [enterobacteria]    DNA gyrase subunit B [Enterobacter sp. 638] >gi|145316547|g
. . . Acinetobacter baumannii ATCC 17978 .......................................  340  1 hit  [g-proteobacteria]  DNA gyrase [Acinetobacter baumannii ATCC 17978]
. . . Methylococcus capsulatus str. Bath .......................................  340  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Methylococcus capsulatus str. Bath] 
. . . Acidithiobacillus caldus ATCC 51756 ......................................  340  2 hits [g-proteobacteria]  DNA gyrase subunit B [Acidithiobacillus caldus ATCC 51756] 
. . . Congregibacter litoralis KT71 ............................................  340  2 hits [g-proteobacteria]  DNA gyrase subunit B [Congregibacter litoralis KT71] >gi|88
. . . Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 .................  340  2 hits [enterobacteria]    DNA gyrase subunit B [Klebsiella pneumoniae subsp. rhinoscl
. . . Photorhabdus asymbiotica .................................................  339  2 hits [enterobacteria]    DNA gyrase subunit B [Photorhabdus asymbiotica] >gi|2537789
. . . Pseudoalteromonas atlantica T6c ..........................................  339  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Pseudoalteromonas atlantica T6c] >gi
. . . Vibrio orientalis CIP 102891 .............................................  339  2 hits [g-proteobacteria]  DNA gyrase subunit B [Vibrio orientalis CIP 102891] >gi|260
. . . Photobacterium profundum SS9 .............................................  339  2 hits [g-proteobacteria]  DNA gyrase subunit B [Photobacterium profundum SS9] >gi|469
. . . Haemophilus parasuis SH0165 ..............................................  339  2 hits [g-proteobacteria]  DNA gyrase subunit B [Haemophilus parasuis SH0165] >gi|2196
. . . Alcanivorax borkumensis SK2 ..............................................  339  2 hits [g-proteobacteria]  DNA gyrase, subunit B [Alcanivorax borkumensis SK2] >gi|110
. . . Klebsiella variicola At-22 ...............................................  339  2 hits [enterobacteria]    DNA gyrase, B subunit [Klebsiella variicola At-22] >gi|2888
. . . Klebsiella sp. 1_1_55 ....................................................  338  2 hits [enterobacteria]    DNA gyrase, B subunit [Klebsiella sp. 1_1_55] >gi|289775482
. . . Klebsiella pneumoniae 342 ................................................  338  2 hits [enterobacteria]    DNA gyrase, B subunit [Klebsiella pneumoniae 342] >gi|20656
. . . Shewanella baltica OS185 .................................................  338  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Shewanella baltica OS185] >gi|160873
. . . Shewanella baltica OS195 .................................................  338  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Shewanella baltica OS185] >gi|160873
. . . Shewanella baltica OS223 .................................................  338  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Shewanella baltica OS185] >gi|160873
. . . Photorhabdus luminescens subsp. laumondii TTO1 ...........................  338  2 hits [enterobacteria]    DNA gyrase subunit B [Photorhabdus luminescens subsp. laumo
. . . Shewanella woodyi ATCC 51908 .............................................  338  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Shewanella woodyi ATCC 51908] >gi|16
. . . Idiomarina baltica OS145 .................................................  338  2 hits [g-proteobacteria]  DNA gyrase subunit B [Idiomarina baltica OS145] >gi|8569542
. . . Marinobacter sp. ELB17 ...................................................  338  2 hits [g-proteobacteria]  DNA gyrase subunit B [Marinobacter sp. ELB17] >gi|126627368
. . . Reinekea blandensis MED297 ...............................................  338  2 hits [g-proteobacteria]  DNA gyrase subunit B [Reinekea sp. MED297] >gi|88778636|gb|
. . . Shewanella baltica OS155 .................................................  338  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Shewanella baltica OS155] >gi|125995
. . . Aeromonas hydrophila subsp. hydrophila ATCC 7966 .........................  338  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Aeromonas hydrophila subsp. hydrophi
. . . Kingella oralis ATCC 51147 ...............................................  338  2 hits [b-proteobacteria]  hypothetical protein GCWU000324_03159 [Kingella oralis ATCC
. . . Chromohalobacter salexigens DSM 3043 .....................................  338  2 hits [g-proteobacteria]  DNA gyrase subunit B [Chromohalobacter salexigens DSM 3043]
. . . Providencia rustigianii DSM 4541 .........................................  338  2 hits [enterobacteria]    DNA gyrase, B subunit [Providencia rustigianii DSM 4541] >g
. . . gamma proteobacterium HTCC2207 ...........................................  337  2 hits [g-proteobacteria]  DNA gyrase subunit B [marine gamma proteobacterium HTCC2207
. . . Shewanella halifaxensis HAW-EB4 ..........................................  337  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Shewanella halifaxensis HAW-EB4] >gi
. . . Providencia rettgeri DSM 1131 ............................................  337  1 hit  [enterobacteria]    DNA gyrase subunit B [Providencia rettgeri DSM 1131]
. . . Shewanella pealeana ATCC 700345 ..........................................  337  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Shewanella pealeana ATCC 700345] >gi
. . . Providencia stuartii ATCC 25827 ..........................................  337  2 hits [enterobacteria]    hypothetical protein PROSTU_00412 [Providencia stuartii ATC
. . . Psychromonas sp. CNPT3 ...................................................  337  2 hits [g-proteobacteria]  DNA gyrase subunit B [Psychromonas sp. CNPT3] >gi|90310429|
. . . Acinetobacter sp. ADP1 ...................................................  337  2 hits [g-proteobacteria]  DNA gyrase, subunit B (type II topoisomerase) [Acinetobacte
. . . marine gamma proteobacterium HTCC2143 ....................................  337  2 hits [g-proteobacteria]  DNA gyrase subunit B [marine gamma proteobacterium HTCC2143
. . . Shewanella sp. W3-18-1 ...................................................  337  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Shewanella sp. W3-18-1] >gi|12454898
. . . Shewanella putrefaciens 200 ..............................................  337  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Shewanella sp. W3-18-1] >gi|12454898
. . . Shewanella putrefaciens CN-32 ............................................  337  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Shewanella sp. W3-18-1] >gi|12454898
. . . Acinetobacter radioresistens SH164 .......................................  337  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Acinetobacter radioresistens SH164] 
. . . Acinetobacter radioresistens SK82 ........................................  337  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Acinetobacter radioresistens SK82] >
. . . Thiomicrospira crunogena XCL-2 ...........................................  337  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Thiomicrospira crunogena XCL-2] >gi|
. . . Bermanella marisrubri ....................................................  337  2 hits [g-proteobacteria]  DNA gyrase subunit B [Oceanobacter sp. RED65] >gi|94425665|
. . . Shewanella denitrificans OS217 ...........................................  337  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Shewanella denitrificans OS217] >gi|
. . . Enhydrobacter aerosaccus SK60 ............................................  336  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Enhydrobacter aerosaccus SK60] >gi|2
. . . Xenorhabdus bovienii SS-2004 .............................................  336  2 hits [enterobacteria]    DNA gyrase, subunit B (type II topoisomerase) [Xenorhabdus 
. . . Candidatus Vesicomyosocius okutanii HA ...................................  336  2 hits [g-proteobacteria]  DNA gyrase subunit B GyrB [Candidatus Vesicomyosocius okuta
. . . Moritella sp. PE36 .......................................................  336  2 hits [g-proteobacteria]  Putative DNA gyrase, subunit B [Moritella sp. PE36] >gi|149
. . . Vibrio mimicus ...........................................................  336  1 hit  [g-proteobacteria]  DNA gyrase subunit B [Vibrio mimicus]
. . . Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica) ..............  335  2 hits [g-proteobacteria]  DNA gyrase subunit B [Candidatus Ruthia magnifica str. Cm (
. . . Shewanella loihica PV-4 ..................................................  335  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Shewanella loihica PV-4] >gi|1266362
. . . Eikenella corrodens ATCC 23834 ...........................................  335  2 hits [b-proteobacteria]  hypothetical protein EIKCOROL_00586 [Eikenella corrodens AT
. . . Legionella pneumophila str. Corby ........................................  335  2 hits [g-proteobacteria]  DNA gyrase, subunit B [Legionella pneumophila str. Corby] >
. . . Teredinibacter turnerae T7901 ............................................  335  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Teredinibacter turnerae T7901] >gi|2
. . . gamma proteobacterium NOR51-B ............................................  335  2 hits [g-proteobacteria]  DNA gyrase, B subunit [gamma proteobacterium NOR51-B] >gi|2
. . . Pseudomonas syringae pv. oryzae str. 1_6 .................................  335  1 hit  [g-proteobacteria]  DNA gyrase subunit B [Pseudomonas syringae pv. oryzae str. 
. . . Alcanivorax sp. DG881 ....................................................  335  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Alcanivorax sp. DG881] >gi|196195471
. . . Tolumonas auensis DSM 9187 ...............................................  335  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Tolumonas auensis DSM 9187] >gi|2374
. . . Methylobacillus flagellatus KT ...........................................  335  2 hits [b-proteobacteria]  DNA gyrase subunit B [Methylobacillus flagellatus KT] >gi|9
. . . Halothiobacillus neapolitanus c2 .........................................  335  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Halothiobacillus neapolitanus c2] >g
. . . Pseudomonas syringae pv. aesculi str. NCPPB3681 ..........................  334  1 hit  [g-proteobacteria]  DNA gyrase subunit B [Pseudomonas syringae pv. aesculi str.
. . . Pseudomonas syringae pv. aesculi str. 2250 ...............................  334  1 hit  [g-proteobacteria]  DNA gyrase subunit B [Pseudomonas syringae pv. aesculi str.
. . . Providencia alcalifaciens DSM 30120 ......................................  334  2 hits [enterobacteria]    hypothetical protein PROVALCAL_03710 [Providencia alcalifac
. . . Acinetobacter sp. RUH2624 ................................................  334  2 hits [g-proteobacteria]  type IIA topoisomerase [Acinetobacter sp. RUH2624] >gi|2604
. . . Psychrobacter arcticus 273-4 .............................................  334  2 hits [g-proteobacteria]  DNA gyrase subunit B [Psychrobacter arcticus 273-4] >gi|710
. . . Pseudomonas syringae pv. phaseolicola 1448A ..............................  334  2 hits [g-proteobacteria]  DNA gyrase subunit B [Pseudomonas syringae pv. phaseolicola
. . . Pseudomonas syringae pv. tabaci ATCC 11528 ...............................  334  1 hit  [g-proteobacteria]  DNA gyrase subunit B [Pseudomonas syringae pv. tabaci ATCC 
. . . Nitrosococcus oceani ATCC 19707 ..........................................  334  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Nitrosococcus oceani ATCC 19707] >gi
. . . Nitrosococcus oceani AFC27 ...............................................  334  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Nitrosococcus oceani ATCC 19707] >gi
. . . Acinetobacter junii SH205 ................................................  334  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Acinetobacter junii SH205] >gi|26231
. . . Legionella pneumophila subsp. pneumophila str. Philadelphia 1 ............  334  2 hits [g-proteobacteria]  DNA gyrase subunit B [Legionella pneumophila subsp. pneumop
. . . Pseudomonas syringae pv. syringae B728a ..................................  334  2 hits [g-proteobacteria]  DNA gyrase subunit B [Pseudomonas syringae pv. syringae B72
. . . Pseudomonas syringae pv. syringae FF5 ....................................  334  1 hit  [g-proteobacteria]  DNA gyrase subunit B [Pseudomonas syringae pv. syringae B72
. . . Pseudomonas syringae pv. tomato str. DC3000 ..............................  334  2 hits [g-proteobacteria]  DNA gyrase, subunit B [Pseudomonas syringae pv. tomato str.
. . . Pseudomonas syringae pv. tomato T1 .......................................  334  2 hits [g-proteobacteria]  DNA gyrase, subunit B [Pseudomonas syringae pv. tomato str.
. . . Legionella pneumophila str. Lens .........................................  334  2 hits [g-proteobacteria]  DNA gyrase, subunit B (type II topoisomerase) [Legionella p
. . . Legionella pneumophila str. Paris ........................................  334  2 hits [g-proteobacteria]  DNA gyrase, subunit B (type II topoisomerase) [Legionella p
. . . Acinetobacter calcoaceticus RUH2202 ......................................  333  2 hits [g-proteobacteria]  type IIA topoisomerase [Acinetobacter calcoaceticus RUH2202
. . . Vibrio alginolyticus .....................................................  333  1 hit  [g-proteobacteria]  DNA gyrase subunit B [Vibrio alginolyticus]
. . . Methylophilales bacterium HTCC2181 .......................................  333  2 hits [b-proteobacteria]  DNA gyrase subunit B [Methylophilales bacterium HTCC2181] >
. . . Vibrio campbellii ........................................................  333  1 hit  [g-proteobacteria]  DNA gyrase subunit B [Vibrio campbellii]
. . . Thioalkalivibrio sp. K90mix ..............................................  333  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Thioalkalivibrio sp. K90mix] >gi|288
. . . Legionella longbeachae D-4968 ............................................  332  2 hits [g-proteobacteria]  DNA gyrase B subunit [Legionella longbeachae D-4968] >gi|28
. . . Legionella longbeachae NSW150 ............................................  332  2 hits [g-proteobacteria]  DNA gyrase B subunit [Legionella longbeachae D-4968] >gi|28
. . . Psychrobacter sp. PRwf-1 .................................................  332  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Psychrobacter sp. PRwf-1] >gi|148570
. . . Buchnera aphidicola str. Bp (Baizongia pistaciae) ........................  332  2 hits [enterobacteria]    putative DNA gyrase subunit b [Buchnera aphidicola str. Bp 
. . . Buchnera aphidicola (Baizongia pistaciae) ................................  332  1 hit  [enterobacteria]    putative DNA gyrase subunit b [Buchnera aphidicola str. Bp 
. . . Neptuniibacter caesariensis ..............................................  332  2 hits [g-proteobacteria]  DNA gyrase subunit B [Oceanospirillum sp. MED92] >gi|890833
. . . Marinomonas sp. MED121 ...................................................  331  2 hits [g-proteobacteria]  DNA gyrase, B subunit [Marinomonas sp. MED121] >gi|86163864
. . . Pseudomonas putida KT2440 ................................................  331  2 hits [g-proteobacteria]  DNA gyrase subunit B [Pseudomonas putida KT2440] >gi|148545
. . . Pseudomonas putida F1 ....................................................  331  2 hits [g-proteobacteria]  DNA gyrase subunit B [Pseudomonas putida KT2440] >gi|148545
. . . Pseudomonas putida GB-1 ..................................................  331  2 hits [g-proteobacteria]  DNA gyrase subunit B [Pseudomonas putida GB-1] >gi|16685751
. . . Arsenophonus nasoniae ....................................................  331  1 hit  [enterobacteria]    DNA gyrase subunit B [Arsenophonus nasoniae]
. . . Nitrosomonas sp. AL212 ...................................................  331  2 hits [b-proteobacteria]  DNA gyrase, B subunit [Nitrosomonas sp. AL212] >gi|25498229
. . bacterium MBIC3367 ---------------------------------------------------------  348  1 hit  [bacteria]          DNA gyrase subunit B [bacterium MBIC3367]
. . bacterium PC2 ..............................................................  347  1 hit  [bacteria]          DNA gyrase subunit B [bacterium PC2]
. . bacterium SD212 ............................................................  343  1 hit  [bacteria]          DNA gyrase subunit B [bacterium SD212]
. . bacterium MBIC3368 .........................................................  341  1 hit  [bacteria]          DNA gyrase subunit B [bacterium MBIC3368]
. . bacterium PC4 ..............................................................  336  1 hit  [bacteria]          DNA gyrase subunit B [bacterium PC4]
. . bacterium MBIC3369 .........................................................  335  1 hit  [bacteria]          DNA gyrase subunit B [bacterium MBIC3369]
. uncultured marine microorganism HF4000_137B17 --------------------------------  343  1 hit  [unclassified]      putative histidine kinase-, DNA gyrase B-, and HSP90-like A

BLAST

PROTOCOL


1)BLASTp vs NR, default NCBI parameters * "1000 max target sequences"


RESULTS ANALYSIS


By the e-value of the 1st twelve sequences, we noticed that they are all quite low, between 2e-114 and 3e-112 and without much variation, which leads us to want, that the ORF in this study has homology with these 12 sequences. However, the identity of these with the ORF is on average 67% for all, which is a low value of identity, despite the results of Lineage Report suggests that we are dealing with a Rueger (genus), with 8 hits reference, so we cannot infer much about the taxonomy os the metagenomic sequence, and we should stay for the Class, a-proteobacteria.

The blastp results suggest that the protein studied is DNA gyrase, the enzyme catalyzes the DNA supercoiling, which requires energy, converting the free energy of ATP in energy of torsional supercoiling, thus justifying the ATPase domain showed up in Protein Domains.


Ingroups: a-proteobacteria


Ruegeria sp. R11 [a-proteobacteria] taxid 439497

ref|ZP_05090405.1| DNA gyrase, B subunit [Ruegeria sp. R11] 416 2e-114

gb|EEB72097.1| DNA gyrase, B subunit [Ruegeria sp. R11] 416 2e-114


Roseobacter sp. SK209-2-6 [a-proteobacteria] taxid 388739

ref|ZP_01754327.1| DNA gyrase subunit B [Roseobacter sp. S... 414 8e-114

gb|EBA17127.1| DNA gyrase subunit B [Roseobacter sp. SK209... 414 8e-114


Silicibacter sp. TrichCH4B [a-proteobacteria] taxid 644076

ref|ZP_05741527.1| DNA gyrase, B subunit [Silicibacter sp.... 412 2e-113

gb|EEW58328.1| DNA gyrase, B subunit [Silicibacter sp. Tri... 412 2e-113


Jannaschia sp. CCS1 [a-proteobacteria] taxid 290400

ref|YP_507946.1| DNA gyrase subunit B [Jannaschia sp. CCS1] 411 5e-113

gb|ABD52921.1| DNA gyrase subunit B [Jannaschia sp. CCS1] 411 5e-113


Roseovarius sp. TM1035 [a-proteobacteria] taxid 391613

ref|ZP_01881255.1| DNA gyrase subunit B [Roseovarius sp. T... 410 1e-112

gb|EDM30220.1| DNA gyrase subunit B [Roseovarius sp. TM1035] 410 1e-112


Rhodobacterales bacterium Y4I [a-proteobacteria] taxid 439496

ref|ZP_05078934.1| DNA gyrase, B subunit [Rhodobacterales ... 409 2e-112

gb|EDZ46913.1| DNA gyrase, B subunit [Rhodobacterales bact... 409 2e-112


Dinoroseobacter shibae DFL 12 [a-proteobacteria] taxid 398580

ref|YP_001534689.1| DNA gyrase subunit B [Dinoroseobacter ... 408 3e-112

gb|ABV95088.1| DNA gyrase subunit B [Dinoroseobacter shiba... 408 3e-112


Sulfitobacter sp. NAS-14.1 [a-proteobacteria] taxid 314267

ref|ZP_00948676.1| DNA gyrase subunit B [Sulfitobacter sp.... 407 6e-112

gb|EAP82156.1| DNA gyrase subunit B [Sulfitobacter sp. NAS... 407 6e-112


Phaeobacter gallaeciensis BS107 [a-proteobacteria] taxid 391619

ref|ZP_02145556.1| DNA gyrase, B subunit [Phaeobacter gall... 407 8e-112

gb|EDQ13109.1| DNA gyrase, B subunit [Phaeobacter gallaeci... 407 8e-112


Oceanicola granulosus HTCC2516 [a-proteobacteria] taxid 314256

ref|ZP_01157178.1| DNA gyrase subunit B [Oceanicola granul... 405 4e-111

gb|EAR50760.1| DNA gyrase subunit B [Oceanicola granulosus... 405 4e-111


Sagittula stellata E-37 [a-proteobacteria] taxid 388399

ref|ZP_01745971.1| DNA gyrase subunit B [Sagittula stellat... 404 5e-111

gb|EBA08593.1| DNA gyrase subunit B [Sagittula stellata E-37] 404 5e-111


Oceanibulbus indolifex HEL-45 [a-proteobacteria] taxid 391624

ref|ZP_02152399.1| DNA gyrase subunit B [Oceanibulbus indo... 402 3e-110

gb|EDQ06266.1| DNA gyrase subunit B [Oceanibulbus indolife... 402 3e-110


Methylobacterium radiotolerans JCM 2831 [a-proteobacteria] taxid 426355

ref|YP_001753026.1| DNA gyrase, B subunit [Methylobacteriu... 400 9e-110

gb|ACB22343.1| DNA gyrase, B subunit [Methylobacterium rad... 400 9e-110


Citreicella sp. SE45 [a-proteobacteria] taxid 501479

ref|ZP_05783406.1| DNA gyrase, B subunit [Citreicella sp. ... 397 5e-109

gb|EEX13305.1| DNA gyrase, B subunit [Citreicella sp. SE45] 397 5e-109


Hoeflea phototrophica DFL-43 [a-proteobacteria] taxid 411684

ref|ZP_02164617.1| DNA gyrase subunit B [Hoeflea phototrop... 396 2e-108

gb|EDQ35312.1| DNA gyrase subunit B [Hoeflea phototrophica... 396 2e-108


Octadecabacter antarcticus 307 [a-proteobacteria] taxid 391626

ref|ZP_05052886.1| DNA gyrase, B subunit [Octadecabacter a... 395 2e-108

gb|EDY79152.1| DNA gyrase, B subunit [Octadecabacter antar... 395 2e-108


Beijerinckia indica subsp. indica ATCC 9039 [a-proteobacteria] taxid 395963

ref|YP_001831958.1| DNA gyrase, B subunit [Beijerinckia in... 395 3e-108

gb|ACB94469.1| DNA gyrase, B subunit [Beijerinckia indica ... 395 3e-108


Rhizobium etli IE4771 [a-proteobacteria] taxid 526946

ref|ZP_03518089.1| DNA gyrase subunit B [Rhizobium etli IE... 381 4e-104


alpha proteobacterium BAL199 [a-proteobacteria] taxid 331869

ref|ZP_02191266.1| Type IIA topoisomerase [alpha proteobac... 374 5e-102

gb|EDP61960.1| Type IIA topoisomerase [alpha proteobacteri... 374 5e-102


Outgroups: b-proteobacteria e g-proteobacteria


Aggregatibacter aphrophilus NJ8700 [g-proteobacteria] taxid 634176

ref|YP_003008439.1| DNA gyrase, B subunit [Aggregatibacter... 365 3e-99

gb|ACS98352.1| DNA gyrase, B subunit [Aggregatibacter aphr... 365 3e-99


Haemophilus influenzae PittEE [g-proteobacteria] taxid 374930

ref|YP_001289907.1| DNA gyrase subunit B [Haemophilus infl... 362 3e-98

gb|ABQ97524.1| DNA gyrase subunit B [Haemophilus influenza... 362 3e-98


Neisseria meningitidis MC58 [b-proteobacteria] taxid 122586

ref|NP_273269.1| DNA gyrase subunit B [Neisseria meningiti... 345 3e-93

gb|AAF40668.1| DNA gyrase subunit B [Neisseria meningitidi... 345 3e-93


Coxiella burnetii RSA 493 [g-proteobacteria] taxid 227377

ref|NP_819060.2| DNA gyrase subunit B [Coxiella burnetii R... 345 4e-93

gb|AAO89574.2| DNA gyrase subunit B [Coxiella burnetii RSA... 345 4e-93


beta proteobacterium KB13 [b-proteobacteria] taxid 314607

ref|ZP_05081866.1| DNA gyrase, B subunit [beta proteobacte... 343 1e-92

gb|EDZ64553.1| DNA gyrase, B subunit [beta proteobacterium... 343 1e-92


RAW RESULTS

Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_05090405.1|  DNA gyrase, B subunit [Ruegeria sp. R11] >...   416    2e-114
ref|ZP_01754327.1|  DNA gyrase subunit B [Roseobacter sp. SK20...   414    7e-114
ref|ZP_05741527.1|  DNA gyrase, B subunit [Silicibacter sp. Tr...   412    2e-113
ref|YP_507946.1|    DNA gyrase subunit B [Jannaschia sp. CCS1] >... 411    5e-113
ref|ZP_01012416.1|  DNA gyrase subunit B [Rhodobacterales bact...   410    8e-113
ref|YP_612002.1|    DNA gyrase subunit B [Ruegeria sp. TM1040] >... 410    9e-113
ref|ZP_01881255.1|  DNA gyrase subunit B [Roseovarius sp. TM10...   410    1e-112
ref|ZP_05785664.1|  DNA gyrase, B subunit [Silicibacter lacusc...   409    1e-112
ref|ZP_05078934.1|  DNA gyrase, B subunit [Rhodobacterales bac...   409    2e-112
ref|ZP_01057982.1|  DNA gyrase subunit B [Roseobacter sp. MED1...   409    3e-112
ref|ZP_05123806.1|  DNA gyrase, B subunit [Rhodobacteraceae ba...   408    3e-112
ref|YP_001534689.1| DNA gyrase subunit B [Dinoroseobacter shi...    408    3e-112
ref|ZP_00948676.1|  DNA gyrase subunit B [Sulfitobacter sp. NA...   407    6e-112
ref|ZP_02145556.1|  DNA gyrase, B subunit [Phaeobacter gallaec...   407    7e-112
ref|ZP_00959320.1|  DNA gyrase subunit B [Roseovarius nubinhib...   407    9e-112
ref|YP_680627.1|    DNA gyrase subunit B [Roseobacter denitrific... 406    1e-111
ref|ZP_01740354.1|  DNA gyrase subunit B [Rhodobacterales bact...   406    1e-111
ref|ZP_01157178.1|  DNA gyrase subunit B [Oceanicola granulosu...   405    4e-111
ref|ZP_01745971.1|  DNA gyrase subunit B [Sagittula stellata E...   404    5e-111
ref|ZP_05099371.1|  DNA gyrase, B subunit [Roseobacter sp. GAI...   404    8e-111
ref|ZP_02140710.1|  DNA gyrase subunit B [Roseobacter litorali...   403    1e-110
ref|ZP_01749823.1|  DNA gyrase, B subunit [Roseobacter sp. CCS...   402    2e-110
ref|ZP_02152399.1|  DNA gyrase subunit B [Oceanibulbus indolif...   402    3e-110
ref|ZP_01441607.1|  DNA gyrase subunit B [Roseovarius sp. HTCC...   400    7e-110
ref|YP_165427.1|  DNA gyrase subunit B [Ruegeria pomeroyi DSS-...   400    8e-110
ref|YP_001753026.1|  DNA gyrase, B subunit [Methylobacterium r...   400    9e-110
ref|YP_001772085.1|  DNA gyrase, B subunit [Methylobacterium s...   399    1e-109
ref|YP_002527107.1|  DNA gyrase subunit B [Rhodobacter sphaero...   399    1e-109
ref|YP_354428.1|  DNA gyrase subunit B [Rhodobacter sphaeroide...   399    2e-109
ref|YP_001166223.1|  DNA gyrase subunit B [Rhodobacter sphaero...   398    3e-109
ref|ZP_05783406.1|  DNA gyrase, B subunit [Citreicella sp. SE4...   397    5e-109
ref|ZP_01447250.1|  DNA gyrase subunit B [alpha proteobacteriu...   397    6e-109
ref|ZP_05074610.1|  DNA gyrase, B subunit [Rhodobacterales bac...   397    7e-109
ref|YP_002421567.1|  DNA gyrase, B subunit [Methylobacterium c...   397    1e-108
ref|YP_002963601.1|  DNA gyrase, subunit B (type II topoisomer...   396    1e-108
ref|YP_001640041.1|  DNA gyrase, B subunit [Methylobacterium e...   396    1e-108
ref|ZP_02164617.1|  DNA gyrase subunit B [Hoeflea phototrophic...   396    2e-108
ref|ZP_05052886.1|  DNA gyrase, B subunit [Octadecabacter anta...   395    2e-108
ref|ZP_05842434.1|  DNA gyrase, B subunit [Rhodobacter sp. SW2...   395    2e-108
ref|YP_001831958.1|  DNA gyrase, B subunit [Beijerinckia indic...   395    2e-108
ref|YP_001411287.1|  DNA gyrase, B subunit [Parvibaculum lavam...   395    3e-108
ref|YP_002500985.1|  DNA gyrase, B subunit [Methylobacterium n...   395    3e-108
ref|YP_002362212.1|  DNA gyrase, B subunit [Methylocella silve...   394    5e-108
ref|ZP_01901342.1|  DNA gyrase, B subunit [Roseobacter sp. Azw...   394    6e-108
ref|YP_001925205.1|  DNA gyrase, B subunit [Methylobacterium p...   394    7e-108
ref|ZP_01547859.1|  DNA gyrase subunit B [Stappia aggregata IA...   394    8e-108
ref|YP_002971107.1|  DNA gyrase subunit B [Bartonella grahamii...   392    2e-107
ref|ZP_00999460.1|  DNA gyrase subunit B [Oceanicola batsensis...   392    2e-107
ref|ZP_05340793.1|  DNA gyrase, B subunit [Thalassiobium sp. R...   392    3e-107
ref|YP_914226.1|  DNA gyrase subunit B [Paracoccus denitrifica...   391    4e-107
ref|YP_031763.1|  DNA gyrase subunit B [Bartonella quintana st...   390    8e-107
ref|YP_001608539.1|  DNA gyrase subunit B [Bartonella tribocor...   389    2e-106
ref|YP_676137.1|  DNA gyrase subunit B [Mesorhizobium sp. BNC1...   389    2e-106
ref|YP_001976194.1|  DNA gyrase protein, B subunit [Rhizobium ...   389    2e-106
ref|ZP_01228395.1|  DNA gyrase, subunit B [Aurantimonas mangan...   389    3e-106
ref|YP_755248.1|  DNA gyrase subunit B [Maricaulis maris MCS10...   389    3e-106
ref|YP_002547984.1|  DNA gyrase subunit B [Agrobacterium vitis...   388    3e-106
ref|YP_316624.1|  DNA gyrase subunit B [Nitrobacter winogradsk...   388    4e-106
ref|NP_384118.1|  DNA gyrase subunit B [Sinorhizobium meliloti...   388    4e-106
ref|ZP_06357370.1|  DNA gyrase, B subunit [Rhodopseudomonas pa...   388    4e-106
ref|ZP_05112402.1|  DNA gyrase, B subunit [Labrenzia alexandri...   387    5e-106
ref|YP_467573.1|  DNA gyrase subunit B [Rhizobium etli CFN 42]...   386    1e-105
ref|ZP_01437628.1|  DNA gyrase subunit B [Fulvimarina pelagi H...   386    1e-105
ref|ZP_01044957.1|  DNA gyrase, B subunit [Nitrobacter sp. Nb-...   386    1e-105
ref|YP_032908.1|  DNA gyrase subunit B [Bartonella henselae st...   386    1e-105
ref|YP_778946.1|  DNA gyrase subunit B [Rhodopseudomonas palus...   386    1e-105
ref|YP_002283434.1|  DNA gyrase subunit B [Rhizobium leguminos...   385    2e-105
ref|YP_001592000.1|  DNA gyrase subunit B [Brucella canis ATCC...   385    3e-105
ref|ZP_05180156.1|  DNA gyrase subunit B [Brucella sp. 83/13] ...   385    4e-105
ref|YP_001626804.1|  DNA gyrase subunit B [Brucella suis ATCC ...   385    4e-105
ref|NP_697166.1|  DNA gyrase subunit B [Brucella suis 1330] >g...   384    4e-105
ref|ZP_05153688.1|  DNA gyrase subunit B [Brucella abortus bv....   384    4e-105
ref|YP_220899.1|  DNA gyrase subunit B [Brucella abortus bv. 1...   384    4e-105
ref|YP_001934148.1|  DNA gyrase subunit B [Brucella abortus S1...   384    4e-105
ref|YP_001328879.1|  DNA gyrase subunit B [Sinorhizobium medic...   384    6e-105
ref|NP_945360.1|  DNA gyrase subunit B [Rhodopseudomonas palus...   384    6e-105
ref|YP_002827844.1|  DNA gyrase, subunit B [Rhizobium sp. NGR2...   384    7e-105
ref|YP_001989042.1|  DNA gyrase, B subunit [Rhodopseudomonas p...   384    7e-105
ref|YP_529903.1|  DNA gyrase subunit B [Rhodopseudomonas palus...   384    8e-105
ref|YP_002542739.1|  DNA gyrase, B subunit [Agrobacterium radi...   384    8e-105
ref|YP_001258162.1|  DNA gyrase subunit B [Brucella ovis ATCC ...   383    9e-105
ref|YP_483628.1|  DNA gyrase subunit B [Rhodopseudomonas palus...   383    1e-104
ref|YP_001368699.1|  DNA gyrase subunit B [Ochrobactrum anthro...   383    1e-104
ref|YP_989593.1|  DNA gyrase subunit B [Bartonella bacilliform...   383    1e-104
ref|NP_540740.1|  DNA gyrase subunit B [Brucella melitensis 16...   382    2e-104
ref|YP_765616.1|  DNA gyrase subunit B [Rhizobium leguminosaru...   382    2e-104
ref|YP_002287542.1|  DNA gyrase, B subunit [Oligotropha carbox...   382    3e-104
ref|ZP_04679306.1|  DNA gyrase, B subunit [Ochrobactrum interm...   382    3e-104
ref|ZP_04760506.1|  DNA gyrase, B subunit [Zymomonas mobilis s...   382    3e-104
ref|YP_567145.1|  DNA gyrase subunit B [Rhodopseudomonas palus...   381    4e-104
ref|ZP_05085658.1|  DNA gyrase, B subunit [Pseudovibrio sp. JE...   381    4e-104
ref|ZP_03518089.1|  DNA gyrase subunit B [Rhizobium etli IE4771]    381    4e-104
ref|YP_163318.1|  DNA gyrase, B subunit [Zymomonas mobilis sub...   381    4e-104
gb|AAF18271.1|  DNA gyrase subunit B [Zymomonas mobilis subsp....   381    4e-104
ref|ZP_05175111.1|  DNA gyrase subunit B [Brucella ceti M644/9...   381    5e-104
ref|YP_001523925.1|  DNA gyrase B subunit [Azorhizobium caulin...   380    6e-104
ref|YP_575366.1|  DNA gyrase subunit B [Nitrobacter hamburgens...   380    7e-104
ref|NP_353052.2|  DNA gyrase subunit B [Agrobacterium tumefaci...   380    7e-104
ref|NP_767463.1|  DNA gyrase subunit B [Bradyrhizobium japonic...   380    1e-103
ref|YP_002978051.1|  DNA gyrase, B subunit [Rhizobium legumino...   379    1e-103
ref|ZP_06350000.1|  DNA gyrase, B subunit [Rhodomicrobium vann...   379    2e-103
ref|YP_001236219.1|  DNA gyrase subunit B [Bradyrhizobium sp. ...   379    2e-103
ref|ZP_05034342.1|  DNA gyrase, B subunit [Brevundimonas sp. B...   379    3e-103
ref|NP_418979.1|  DNA gyrase subunit B [Caulobacter crescentus...   378    3e-103
ref|ZP_01036777.1|  DNA gyrase subunit B [Roseovarius sp. 217]...   378    5e-103
ref|ZP_05811332.1|  DNA gyrase, B subunit [Mesorhizobium oppor...   377    5e-103
ref|YP_002132208.1|  DNA gyrase, B subunit [Phenylobacterium z...   377    6e-103
ref|ZP_06171193.1|  DNA gyrase, B subunit [Brevundimonas subvi...   376    1e-102
ref|YP_618010.1|  DNA gyrase, B subunit [Sphingopyxis alaskens...   375    2e-102
ref|YP_001416775.1|  DNA gyrase, B subunit [Xanthobacter autot...   375    2e-102
ref|ZP_01002014.1|  DNA gyrase subunit B [Loktanella vestfolde...   375    2e-102
ref|ZP_02191266.1|  Type IIA topoisomerase [alpha proteobacter...   374    5e-102
ref|ZP_06119816.1|  DNA gyrase, B subunit [Caulobacter segnis ...   374    5e-102
ref|ZP_00957393.1|  DNA gyrase subunit B [Oceanicaulis alexand...   374    6e-102
ref|ZP_03528210.1|  DNA gyrase subunit B [Rhizobium etli CIAT ...   374    7e-102
ref|YP_001202227.1|  DNA gyrase subunit B [Bradyrhizobium sp. ...   374    9e-102
ref|NP_105894.1|  DNA gyrase subunit B [Mesorhizobium loti MAF...   373    1e-101
ref|ZP_03523018.1|  DNA gyrase subunit B [Rhizobium etli GR56]      371    6e-101
ref|YP_498579.1|  DNA gyrase subunit B [Novosphingobium aromat...   370    9e-101
ref|YP_001263293.1|  DNA gyrase subunit B [Sphingomonas wittic...   370    9e-101
ref|YP_425096.1|  DNA gyrase subunit B [Rhodospirillum rubrum ...   370    9e-101
ref|YP_459235.1|  type IIA topoisomeraseb subunit [Erythrobact...   370    1e-100
emb|CAM75022.1|  DNA topoisomerase II [Magnetospirillum gryphi...   369    2e-100
ref|ZP_05065394.1|  DNA gyrase, B subunit [Octadecabacter anta...   368    3e-100
ref|YP_001681792.1|  DNA gyrase subunit B [Caulobacter sp. K31...   368    4e-100
ref|YP_003061400.1|  DNA gyrase, B subunit [Hirschia baltica A...   367    1e-99 
ref|ZP_04769768.1|  DNA gyrase, B subunit [Asticcacaulis excen...   366    1e-99 
ref|YP_003008439.1|  DNA gyrase, B subunit [Aggregatibacter ap...   365    2e-99 
ref|YP_003449910.1|  DNA gyrase subunit B [Azospirillum sp. B5...   364    6e-99 
ref|YP_001785179.1|  DNA gyrase, B subunit [Haemophilus somnus...   362    3e-98 
ref|YP_001289907.1|  DNA gyrase subunit B [Haemophilus influen...   362    3e-98 
ref|YP_719913.1|  DNA gyrase subunit B [Haemophilus somnus 129...   361    4e-98 
ref|ZP_05377281.1|  DNA gyrase, B subunit [Hyphomicrobium deni...   361    4e-98 
ref|YP_003255340.1|  DNA gyrase, B subunit [Aggregatibacter ac...   361    5e-98 
dbj|BAB83771.1|  DNA gyrase subunit B [Rhodobacter veldkampii]      361    6e-98 
ref|ZP_01863378.1|  type IIA topoisomeraseB subunit [Erythroba...   361    6e-98 
ref|ZP_01789206.1|  DNA gyrase subunit B [Haemophilus influenz...   360    8e-98 
ref|YP_759281.1|  DNA gyrase subunit B [Hyphomonas neptunium A...   360    1e-97 
ref|ZP_00156385.2|  COG0187: Type IIA topoisomerase (DNA gyras...   360    1e-97 
ref|YP_248279.1|  DNA gyrase subunit B [Haemophilus influenzae...   360    1e-97 
ref|YP_001292512.1|  DNA gyrase subunit B [Haemophilus influen...   360    1e-97 
ref|ZP_01791048.1|  DNA gyrase subunit B [Haemophilus influenz...   360    1e-97 
ref|ZP_05848836.1|  DNA gyrase, B subunit [Haemophilus influen...   360    1e-97 
ref|ZP_04466765.1|  DNA gyrase subunit B [Haemophilus influenz...   360    1e-97 
ref|ZP_01784749.1|  DNA gyrase subunit B [Haemophilus influenz...   360    1e-97 
ref|ZP_01303122.1|  DNA gyrase, B subunit [Sphingomonas sp. SK...   360    1e-97 
ref|ZP_00155559.2|  COG0187: Type IIA topoisomerase (DNA gyras...   360    1e-97 
ref|YP_003065227.1|  DNA gyrase subunit B [Candidatus Liberiba...   359    1e-97 
ref|ZP_05850516.1|  DNA gyrase, B subunit [Haemophilus influen...   359    1e-97 
ref|ZP_01793569.1|  DNA gyrase subunit B [Haemophilus influenz...   359    2e-97 
ref|YP_002299243.1|  DNA gyrase, B subunit, putative [Rhodospi...   359    2e-97 
dbj|BAB83770.1|  DNA gyrase subunit B [Rhodobacter azotoformans]    358    2e-97 
gb|EFE01416.1|  DNA gyrase, B subunit [Aggregatibacter actinom...   358    3e-97 
ref|ZP_01016158.1|  DNA gyrase subunit B [Parvularcula bermude...   358    3e-97 
ref|ZP_01041137.1|  type IIA topoisomerase B subunit [Erythrob...   358    3e-97 
ref|ZP_01787514.1|  DNA gyrase subunit B [Haemophilus influenz...   358    5e-97 
ref|ZP_05706499.1|  DNA gyrase subunit B [Cardiobacterium homi...   357    8e-97 
ref|ZP_04620749.1|  DNA gyrase subunit B [Yersinia aldovae ATC...   357    1e-96 
ref|ZP_05069479.1|  DNA gyrase, B subunit [Candidatus Pelagiba...   356    2e-96 
ref|ZP_05920001.1|  DNA topoisomerase (ATP-hydrolyzing) subuni...   356    2e-96 
ref|NP_438724.1|  DNA gyrase subunit B [Haemophilus influenzae...   356    2e-96 
ref|ZP_01264383.1|  DNA topoisomerase (ATP-hydrolyzing) chain ...   355    3e-96 
ref|YP_265871.1|  DNA topoisomerase (ATP-hydrolyzing) chain B ...   355    3e-96 
ref|ZP_01796127.1|  DNA gyrase subunit B [Haemophilus influenz...   355    4e-96 
ref|ZP_04636774.1|  DNA gyrase subunit B [Yersinia intermedia ...   355    4e-96 
ref|NP_246415.1|  DNA gyrase subunit B [Pasteurella multocida ...   354    7e-96 
ref|ZP_04641334.1|  DNA gyrase subunit B [Yersinia mollaretii ...   353    8e-96 
ref|YP_001002801.1|  DNA gyrase, B subunit [Halorhodospira hal...   353    9e-96 
ref|ZP_04627078.1|  DNA gyrase subunit B [Yersinia bercovieri ...   353    9e-96 
ref|YP_246963.1|  DNA gyrase subunit B [Rickettsia felis URRWX...   353    1e-95 
ref|YP_001343447.1|  DNA gyrase subunit B [Actinobacillus succ...   353    1e-95 
ref|YP_002931501.1|  DNA gyrase, B subunit, putative [Edwardsi...   353    2e-95 
ref|YP_067518.1|  DNA gyrase subunit B [Rickettsia typhi str. ...   352    2e-95 
ref|ZP_05061004.1|  DNA gyrase, B subunit [gamma proteobacteri...   352    2e-95 
ref|ZP_04615367.1|  DNA gyrase subunit B [Yersinia ruckeri ATC...   352    3e-95 
ref|YP_506597.1|  DNA gyrase, B subunit [Neorickettsia sennets...   352    3e-95 
ref|ZP_04989505.1|  hypothetical protein FTDG_00183 [Francisel...   352    3e-95 
ref|ZP_03246338.1|  DNA gyrase, B subunit [Francisella novicid...   352    4e-95 
ref|YP_001494984.1|  DNA gyrase subunit B [Rickettsia ricketts...   351    5e-95 
ref|YP_001676958.1|  DNA topoisomerase (ATP-hydrolyzing) [Fran...   351    5e-95 
ref|ZP_04756468.1|  DNA topoisomerase (ATP-hydrolyzing) [Franc...   351    6e-95 
gb|ACH96434.1|  DNA gyrase subunit B [Edwardsiella tarda]           350    7e-95 
ref|YP_003294062.1|  DNA gyrase subunit B [Edwardsiella tarda ...   350    7e-95 
ref|NP_220951.1|  DNA gyrase subunit B [Rickettsia prowazekii ...   350    8e-95 
ref|YP_001008304.1|  DNA gyrase subunit B [Yersinia enterocoli...   350    8e-95 
ref|ZP_04626002.1|  DNA gyrase subunit B [Yersinia kristenseni...   350    8e-95 
ref|YP_514193.1|  DNA gyrase subunit B [Francisella tularensis...   350    8e-95 
dbj|BAB88753.1|  subunit B protein of DNA gyrase [Bradyrhizobi...   350    8e-95 
ref|ZP_04985724.1|  DNA gyrase subunit B [Francisella tularens...   350    9e-95 
ref|YP_001429063.2|  DNA gyrase, B subunit [Francisella tulare...   350    9e-95 
ref|YP_001122388.1|  DNA gyrase, B subunit [Francisella tulare...   350    1e-94 
ref|YP_898249.1|  DNA gyrase subunit B [Francisella tularensis...   350    1e-94 
ref|ZP_05119487.1|  DNA gyrase, B subunit [Vibrio parahaemolyt...   350    1e-94 
ref|ZP_01065494.1|  DNA gyrase subunit B [Vibrio sp. MED222] >...   350    1e-94 
ref|YP_169545.1|  DNA gyrase subunit B [Francisella tularensis...   350    1e-94 
ref|YP_538165.1|  DNA gyrase subunit B [Rickettsia bellii RML3...   350    1e-94 
ref|ZP_00142963.1|  DNA gyrase subunit B [Rickettsia sibirica ...   350    1e-94 
ref|ZP_04611788.1|  DNA gyrase subunit B [Yersinia rohdei ATCC...   350    1e-94 
ref|YP_001909356.1|  DNA gyrase subunit B [Erwinia tasmaniensi...   350    1e-94 
ref|YP_001499543.1|  DNA gyrase subunit B [Rickettsia massilia...   349    1e-94 
ref|ZP_06070882.1|  DNA gyrase, B subunit [Acinetobacter lwoff...   349    2e-94 
ref|ZP_06055532.1|  DNA gyrase, B subunit [alpha proteobacteri...   349    2e-94 
ref|ZP_05729638.1|  DNA gyrase, B subunit [Pantoea sp. At-9b] ...   349    2e-94 
ref|YP_002845418.1|  DNA gyrase subunit B [Rickettsia africae ...   349    2e-94 
ref|YP_002331470.1|  DNA gyrase subunit B [Escherichia coli O1...   349    2e-94 
ref|ZP_01815901.1|  DNA gyrase subunit B [Vibrionales bacteriu...   349    2e-94 
ref|NP_360521.1|  DNA gyrase subunit B [Rickettsia conorii str...   349    2e-94 
dbj|BAB85508.1|  DNA gyrase subunit B [Bradyrhizobium japonicum]    349    2e-94 
ref|YP_002916494.1|  DNA gyrase subunit B [Rickettsia peacocki...   349    2e-94 
dbj|BAB85511.1|  DNA gyrase subunit B [Bradyrhizobium japonicu...   349    2e-94 
ref|YP_072415.1|  DNA gyrase subunit B [Yersinia pseudotubercu...   349    2e-94 
ref|NP_671401.1|  DNA gyrase subunit B [Yersinia pestis KIM 10...   349    2e-94 
ref|ZP_01135250.1|  DNA gyrase, subunit B (type II topoisomera...   348    3e-94 
dbj|BAB85509.1|  DNA gyrase subunit B [Bradyrhizobium liaoning...   348    3e-94 
ref|ZP_05883884.1|  DNA gyrase subunit B [Vibrio coralliilytic...   348    3e-94 
ref|ZP_01677017.1|  DNA gyrase, subunit B [Vibrio cholerae 274...   348    3e-94 
ref|YP_001975845.1|  DNA gyrase, B subunit [Wolbachia endosymb...   348    3e-94 
ref|YP_001492123.1|  DNA gyrase subunit B [Rickettsia canadens...   348    4e-94 
dbj|BAB87077.1|  DNA gyrase subunit B [Rhodomicrobium vannielii]    348    4e-94 
ref|ZP_01870113.1|  DNA gyrase subunit B [Vibrio shilonii AK1]...   348    4e-94 
ref|ZP_01948550.1|  DNA gyrase, subunit B [Vibrio cholerae 158...   348    4e-94 
ref|YP_003015603.1|  DNA gyrase, B subunit [Pectobacterium car...   348    4e-94 
ref|ZP_04419588.1|  DNA gyrase subunit B [Vibrio cholerae 1212...   348    4e-94 
ref|YP_001892009.1|  DNA gyrase, B subunit [Francisella tulare...   348    4e-94 
ref|ZP_01128269.1|  DNA gyrase subunit B [Nitrococcus mobilis ...   348    4e-94 
ref|ZP_04919156.1|  DNA gyrase, subunit B [Vibrio cholerae V51...   348    4e-94 
ref|ZP_04409614.1|  DNA gyrase subunit B [Vibrio cholerae TM 1...   348    4e-94 
ref|YP_203395.1|  DNA gyrase subunit B [Vibrio fischeri ES114]...   348    4e-94 
ref|YP_002512096.1|  DNA gyrase, B subunit [Thioalkalivibrio s...   348    5e-94 
ref|YP_001476273.1|  DNA gyrase subunit B [Serratia proteamacu...   348    5e-94 
emb|CAJ43811.1|  gyrase subunit beta [Candidatus Midichloria m...   348    5e-94 
ref|YP_453684.1|  DNA gyrase subunit B [Sodalis glossinidius s...   348    5e-94 
dbj|BAB87067.1|  DNA gyrase subunit B [bacterium MBIC3367]          348    5e-94 
ref|ZP_05990959.1|  DNA gyrase subunit B [Mannheimia haemolyti...   348    5e-94 
dbj|BAB87032.1|  DNA gyrase subunit B [Paracoccus sp.]              348    5e-94 
ref|ZP_06040459.1|  DNA gyrase subunit B [Vibrio mimicus MB-45...   347    6e-94 
ref|ZP_05717976.1|  DNA gyrase, subunit B [Vibrio mimicus VM57...   347    6e-94 
dbj|BAB88762.1|  subunit B protein of DNA gyrase [Bradyrhizobi...   347    6e-94 
ref|YP_736067.1|  DNA gyrase subunit B [Shewanella sp. MR-7] >...   347    6e-94 
ref|NP_062599.1|  DNA gyrase subunit B [Vibrio cholerae O1 bio...   347    6e-94 
dbj|BAB88754.1|  subunit B protein of DNA gyrase [Bradyrhizobi...   347    6e-94 
ref|YP_732143.1|  DNA gyrase subunit B [Shewanella sp. MR-4] >...   347    6e-94 
ref|ZP_04414321.1|  DNA gyrase subunit B [Vibrio cholerae bv. ...   347    6e-94 
ref|ZP_01893401.1|  DNA gyrase, B subunit [Marinobacter algico...   347    6e-94 
ref|ZP_04976919.1|  DNA topoisomerase (ATP-hydrolyzing) subuni...   347    7e-94 
ref|YP_003187756.1|  DNA gyrase subunit B Hsp90-like ATPase [A...   347    7e-94 
ref|ZP_06156520.1|  DNA gyrase subunit B [Photobacterium damse...   347    8e-94 
ref|YP_002924491.1|  DNA gyrase, subunit B (type II topoisomer...   347    8e-94 
dbj|BAB87063.1|  DNA gyrase subunit B [bacterium PC2]               347    8e-94 
ref|YP_867663.1|  DNA gyrase subunit B [Shewanella sp. ANA-3] ...   347    8e-94 
ref|ZP_00992856.1|  DNA gyrase subunit B [Vibrio splendidus 12...   347    8e-94 
emb|CAY76332.1|  DNA gyrase subunit B [Erwinia pyrifoliae DSM ...   347    9e-94 
ref|ZP_05927542.1|  DNA gyrase subunit B [Vibrio sp. RC341] >r...   347    1e-93 
ref|ZP_03832566.1|  DNA gyrase subunit B [Pectobacterium carot...   347    1e-93 
dbj|BAB85518.1|  DNA gyrase subunit B [Bradyrhizobium japonicum]    347    1e-93 
ref|ZP_06192389.1|  DNA gyrase subunit B [Serratia odorifera 4...   347    1e-93 
ref|YP_002650648.1|  DNA gyrase subunit B [Erwinia pyrifoliae ...   347    1e-93 
ref|YP_003257480.1|  DNA gyrase, B subunit [Pectobacterium was...   347    1e-93 
ref|ZP_03826769.1|  DNA gyrase subunit B [Pectobacterium carot...   346    1e-93 
ref|YP_740853.1|  DNA gyrase subunit B [Alkalilimnicola ehrlic...   346    1e-93 
ref|ZP_01979101.1|  DNA gyrase, subunit B [Vibrio cholerae MZO...   346    2e-93 
ref|ZP_04714277.1|  DNA gyrase subunit B [Alteromonas macleodi...   346    2e-93 
ref|ZP_01957077.1|  DNA gyrase, subunit B [Vibrio cholerae MZO...   346    2e-93 
ref|YP_338561.1|  DNA gyrase subunit B [Pseudoalteromonas halo...   346    2e-93 
ref|YP_744142.1|  DNA gyrase subunit B [Granulibacter bethesde...   346    2e-93 
dbj|BAB85513.1|  DNA gyrase subunit B [Bradyrhizobium japonicum]    346    2e-93 
ref|NP_796393.1|  DNA gyrase subunit B [Vibrio parahaemolyticu...   346    2e-93 
dbj|BAB85507.1|  DNA gyrase subunit B [Bradyrhizobium japonicu...   346    2e-93 
ref|YP_003331607.1|  DNA gyrase, B subunit [Dickeya dadantii E...   346    2e-93 
dbj|BAB85501.1|  DNA gyrase subunit B [Rhodopseudomonas sp. B29]    346    2e-93 
ref|YP_002985645.1|  DNA gyrase, B subunit [Dickeya dadantii E...   345    2e-93 
ref|ZP_06034524.1|  DNA gyrase subunit B [Vibrio mimicus VM223...   345    2e-93 
ref|YP_925898.1|  DNA topoisomerase (ATP-hydrolyzing) [Shewane...   345    2e-93 
ref|NP_759958.1|  DNA gyrase subunit B [Vibrio vulnificus CMCP...   345    2e-93 
ref|YP_003002377.1|  DNA gyrase, B subunit [Dickeya zeae Ech15...   345    2e-93 
ref|ZP_06050950.1|  DNA gyrase subunit B [Grimontia hollisae C...   345    2e-93 
ref|ZP_01161157.1|  DNA gyrase subunit B [Photobacterium sp. S...   345    2e-93 
ref|YP_001439995.1|  DNA gyrase subunit B [Enterobacter sakaza...   345    2e-93 
ref|ZP_04559502.1|  DNA gyrase subunit B [Citrobacter sp. 30_2...   345    3e-93 
ref|NP_273269.1|  DNA gyrase subunit B [Neisseria meningitidis...   345    3e-93 
ref|YP_003208404.1|  DNA gyrase subunit B [Cronobacter turicen...   345    3e-93 
ref|YP_003083967.1|  DNA gyrase subunit B [Neisseria meningiti...   345    3e-93 
ref|YP_002341611.1|  DNA gyrase subunit B [Neisseria meningiti...   345    3e-93 
dbj|BAB86968.1|  DNA gyrase subunit B [Caulobacter sp.]             345    3e-93 
ref|YP_190459.1|  DNA gyrase subunit B [Gluconobacter oxydans ...   345    3e-93 
dbj|BAB85499.1|  DNA gyrase subunit B [Rhizobium leguminosarum]     345    3e-93 
ref|ZP_01614046.1|  DNA gyrase, subunit B (type II topoisomera...   345    3e-93 
dbj|BAB86967.1|  DNA gyrase subunit B [Caulobacter sp.]             345    3e-93 
ref|ZP_00135256.2|  COG0187: Type IIA topoisomerase (DNA gyras...   345    3e-93 
emb|CBA05114.1|  DNA gyrase subunit B [Neisseria meningitidis ...   345    3e-93 
ref|YP_001053522.1|  DNA gyrase subunit B [Actinobacillus pleu...   345    3e-93 
ref|YP_002154784.1|  DNA gyrase, B subunit [Vibrio fischeri MJ...   345    3e-93 
ref|YP_001235995.1|  DNA gyrase, B subunit [Acidiphilium crypt...   345    3e-93 
ref|YP_152783.1|  DNA gyrase subunit B [Salmonella enterica su...   345    3e-93 
ref|YP_003145195.1|  DNA gyrase, B subunit [Kangiella koreensi...   345    4e-93 
dbj|BAB87043.1|  DNA gyrase subunit B [Paracoccus aminophilus]      345    4e-93 
ref|YP_001423444.2|  DNA gyrase subunit B [Coxiella burnetii D...   345    4e-93 
ref|NP_874028.1|  DNA gyrase subunit B [Haemophilus ducreyi 35...   345    4e-93 
ref|YP_001572746.1|  DNA gyrase subunit B [Salmonella enterica...   345    4e-93 
dbj|BAB85505.1|  DNA gyrase subunit B [Bradyrhizobium japonicu...   345    4e-93 
dbj|BAF33490.1|  DNA gyrase subunit B [Listonella anguillarum]      345    4e-93 
ref|YP_001471750.1|  DNA topoisomerase (ATP-hydrolyzing) [Shew...   345    4e-93 
ref|NP_290332.1|  DNA gyrase subunit B [Escherichia coli O157:...   345    4e-93 
emb|CBG36880.1|  DNA gyrase subunit B [Escherichia coli 042]        345    4e-93 
ref|YP_002302609.1|  DNA gyrase subunit B [Coxiella burnetii C...   345    4e-93 
ref|NP_312661.1|  DNA gyrase subunit B [Escherichia coli O157:...   345    4e-93 
ref|NP_819060.2|  DNA gyrase subunit B [Coxiella burnetii RSA ...   345    4e-93 
ref|YP_002273225.1|  DNA gyrase, B subunit [Escherichia coli O...   345    4e-93 
ref|ZP_05435148.1|  DNA gyrase subunit B [Shigella sp. D9]          345    4e-93 
ref|YP_409984.1|  DNA gyrase subunit B [Shigella boydii Sb227]...   345    4e-93 
ref|ZP_02901298.1|  DNA gyrase, B subunit [Escherichia alberti...   345    4e-93 
ref|YP_001600023.1|  DNA gyrase subunit B [Neisseria meningiti...   345    4e-93 
gb|ACI75376.1|  DNA repair and genetic recombination protein R...   345    5e-93 
ref|ZP_06177039.1|  DNA gyrase, subunit B [Vibrio harveyi 1DA3...   345    5e-93 
ref|YP_002414864.1|  DNA gyrase subunit B [Escherichia coli UM...   345    5e-93 
ref|YP_001595905.1|  DNA gyrase, B subunit [Coxiella burnetii ...   344    5e-93 
ref|NP_458107.1|  DNA gyrase subunit B [Salmonella enterica su...   344    5e-93 
ref|ZP_01987798.1|  DNA gyrase, B subunit [Vibrio harveyi HY01...   344    5e-93 
ref|YP_405577.1|  DNA gyrase subunit B [Shigella dysenteriae S...   344    5e-93 
ref|YP_218740.1|  DNA gyrase subunit B [Salmonella enterica su...   344    5e-93 
ref|YP_001493680.1|  DNA gyrase subunit B [Rickettsia akari st...   344    5e-93 
emb|CAA69221.1|  subunit B of DNA gyrase [Salmonella typhimurium]   344    5e-93 
ref|ZP_03063402.1|  DNA gyrase, B subunit [Shigella dysenteria...   344    5e-93 
gb|AAA62050.1|  DNA gyrase, subunit B [Escherichia coli]            344    5e-93 
ref|YP_001443687.1|  DNA gyrase subunit B [Vibrio harveyi ATCC...   344    5e-93 
ref|YP_002410177.1|  DNA gyrase subunit B [Escherichia coli IA...   344    5e-93 
ref|ZP_02196031.1|  DNA gyrase subunit B [Vibrio sp. AND4] >gb...   344    5e-93 
ref|YP_002304479.1|  DNA gyrase subunit B [Coxiella burnetii C...   344    5e-93 
emb|CAA69665.1|  subunit B of DNA gyrase [Salmonella typhimurium]   344    6e-93 
dbj|BAA20341.1|  DNA gyrase subunit B [Escherichia coli]            344    6e-93 
ref|YP_002148773.1|  DNA gyrase subunit B [Salmonella enterica...   344    6e-93 
ref|YP_052523.1|  DNA gyrase subunit B [Pectobacterium atrosep...   344    6e-93 
ref|ZP_01221717.1|  DNA gyrase subunit B [Photobacterium profu...   344    6e-93 
ref|YP_003284634.1|  DNA gyrase subunit B [Vibrio sp. Ex25] >g...   344    6e-93 
ref|ZP_01947513.1|  DNA gyrase, B subunit [Coxiella burnetii '...   344    6e-93 
ref|ZP_03376884.1|  DNA gyrase subunit B [Salmonella enterica ...   344    6e-93 
ref|YP_974328.1|  DNA gyrase subunit B [Neisseria meningitidis...   344    6e-93 
ref|ZP_06131875.1|  DNA gyrase subunit B [Neisseria gonorrhoea...   344    6e-93 
ref|YP_208803.1|  DNA gyrase subunit B [Neisseria gonorrhoeae ...   344    6e-93 
ref|YP_089441.1|  DNA gyrase subunit B [Mannheimia succinicipr...   344    7e-93 
ref|ZP_06138724.1|  DNA gyrase subunit B [Neisseria gonorrhoea...   344    7e-93 
ref|ZP_01262273.1|  DNA gyrase subunit B [Vibrio alginolyticus...   344    7e-93 
dbj|BAB88760.1|  subunit B protein of DNA gyrase [Bradyrhizobi...   344    7e-93 
ref|ZP_03366634.1|  DNA gyrase subunit B [Salmonella enterica ...   344    7e-93 
ref|ZP_06355873.1|  DNA gyrase subunit B [Citrobacter youngae ...   344    7e-93 
ref|NP_756480.1|  DNA gyrase subunit B [Escherichia coli CFT07...   344    7e-93 
ref|YP_671772.1|  DNA gyrase subunit B [Escherichia coli 536] ...   344    8e-93 
ref|YP_002385021.1|  DNA gyrase subunit B [Escherichia ferguso...   343    9e-93 
ref|YP_001746027.1|  DNA gyrase, B subunit [Escherichia coli S...   343    9e-93 
ref|ZP_03341330.1|  DNA gyrase subunit B [Salmonella enterica ...   343    9e-93 
ref|YP_748705.1|  DNA gyrase, B subunit [Shewanella frigidimar...   343    1e-92 
ref|ZP_04923732.1|  DNA gyrase, B subunit [Vibrio sp. Ex25] >g...   343    1e-92 
ref|NP_715653.1|  DNA gyrase, B subunit [Shewanella oneidensis...   343    1e-92 
gb|ABZ06666.1|  putative histidine kinase-, DNA gyrase B-, and...   343    1e-92 
emb|CAX49196.1|  DNA gyrase subunit B [Neisseria meningitidis ...   343    1e-92 
dbj|BAB87064.1|  DNA gyrase subunit B [bacterium SD212]             343    1e-92 
ref|YP_002003129.1|  DNA gyrase subunit B [Neisseria gonorrhoe...   343    1e-92 
ref|ZP_04757250.1|  DNA gyrase, B subunit [Neisseria flavescen...   343    1e-92 
ref|ZP_04732912.1|  DNA gyrase subunit B [Neisseria gonorrhoea...   343    1e-92 
ref|ZP_04721938.1|  DNA gyrase subunit B [Neisseria gonorrhoea...   343    1e-92 
ref|ZP_05987071.1|  DNA gyrase, B subunit [Neisseria lactamica...   343    1e-92 
ref|YP_002124320.1|  DNA gyrase subunit B [Alteromonas macleod...   343    1e-92 
ref|ZP_04717921.1|  DNA gyrase subunit B [Neisseria gonorrhoea...   343    1e-92 
ref|ZP_05081866.1|  DNA gyrase, B subunit [beta proteobacteriu...   343    1e-92 
dbj|BAB87065.1|  DNA gyrase subunit B [Paracoccus sp.]              343    1e-92 
ref|YP_001451660.1|  DNA gyrase subunit B [Citrobacter koseri ...   343    1e-92 
ref|ZP_05628976.1|  DNA gyrase subunit B [Actinobacillus minor...   343    1e-92 
ref|ZP_04753941.1|  DNA gyrase subunit B [Actinobacillus minor...   343    2e-92 
ref|YP_863941.1|  DNA gyrase subunit B [Magnetococcus sp. MC-1...   343    2e-92 
ref|ZP_05127926.1|  DNA gyrase, B subunit [gamma proteobacteri...   343    2e-92 
ref|ZP_03823297.1|  DNA gyrase, subunit B (type II topoisomera...   343    2e-92 
ref|ZP_05983026.1|  DNA gyrase, B subunit [Neisseria cinerea A...   343    2e-92 
ref|YP_154397.1|  DNA gyrase subunit B [Idiomarina loihiensis ...   342    2e-92 
ref|ZP_06064491.1|  conserved hypothetical protein [Acinetobac...   342    3e-92 
sp|P22118.1|GYRB_NEIGO  RecName: Full=DNA gyrase subunit B >gb...   342    3e-92 
ref|YP_003367466.1|  DNA gyrase subunit B [Citrobacter rodenti...   342    3e-92 
pdb|1EI1|A  Chain A, Dimerization Of E. Coli Dna Gyrase B Prov...   342    3e-92 
ref|YP_001209522.1|  DNA gyrase, B subunit [Dichelobacter nodo...   342    4e-92 
ref|ZP_05319915.1|  DNA gyrase, B subunit [Neisseria sicca ATC...   342    4e-92 
ref|YP_001980528.1|  DNA gyrase, B subunit [Cellvibrio japonic...   341    4e-92 
ref|ZP_05969499.1|  hypothetical protein ENTCAN_08109 [Enterob...   341    4e-92 
dbj|BAB87068.1|  DNA gyrase subunit B [bacterium MBIC3368]          341    4e-92 
ref|ZP_05977683.1|  DNA gyrase, B subunit [Neisseria mucosa AT...   341    5e-92 
ref|ZP_01450614.1|  DNA gyrase, subunit B (type II topoisomera...   341    6e-92 
ref|YP_002309453.1|  DNA gyrase, B subunit [Shewanella piezoto...   341    6e-92 
ref|YP_002152825.1|  DNA gyrase subunit B [Proteus mirabilis H...   341    6e-92 
ref|YP_001712003.1|  DNA gyrase, subunit B (type II topoisomer...   341    7e-92 
ref|YP_001844661.1|  Type IIA topoisomerase (DNA gyrase/topo I...   340    7e-92 
ref|YP_002921957.1|  DNA gyrase subunit B [Klebsiella pneumoni...   340    7e-92 
dbj|BAB85504.1|  DNA gyrase subunit B [Bradyrhizobium elkanii ...   340    7e-92 
ref|YP_001139969.1|  DNA gyrase subunit B [Aeromonas salmonici...   340    7e-92 
ref|YP_001337752.1|  DNA gyrase subunit B [Klebsiella pneumoni...   340    7e-92 
ref|ZP_04663216.1|  DNA gyrase, B subunit [Acinetobacter bauma...   340    7e-92 
ref|ZP_01236920.1|  DNA gyrase subunit B [Vibrio angustum S14]...   340    7e-92 
ref|YP_002317432.1|  DNA gyrase, B subunit [Acinetobacter baum...   340    8e-92 
ref|YP_431356.1|  DNA gyrase subunit B [Hahella chejuensis KCT...   340    8e-92 
dbj|BAC16536.1|  DNA topoisomerase chain B [Shewanella violacea]    340    8e-92 
ref|ZP_02478872.1|  DNA gyrase subunit B [Haemophilus parasuis...   340    8e-92 
ref|YP_001705769.1|  DNA gyrase, subunit B (type II topoisomer...   340    9e-92 
ref|YP_001174745.1|  DNA gyrase subunit B [Enterobacter sp. 63...   340    9e-92 
gb|ABO10501.2|  DNA gyrase [Acinetobacter baumannii ATCC 17978]     340    9e-92 
ref|YP_115417.1|  DNA gyrase, B subunit [Methylococcus capsula...   340    9e-92 
ref|ZP_05292281.1|  DNA gyrase subunit B [Acidithiobacillus ca...   340    1e-91 
ref|ZP_01103108.1|  DNA gyrase subunit B [Congregibacter litor...   340    1e-91 
ref|ZP_06013706.1|  DNA gyrase subunit B [Klebsiella pneumonia...   340    1e-91 
ref|YP_003038843.1|  DNA gyrase subunit B [Photorhabdus asymbi...   339    2e-91 
ref|YP_659591.1|  DNA gyrase, B subunit [Pseudoalteromonas atl...   339    2e-91 
ref|ZP_05943211.1|  DNA gyrase subunit B [Vibrio orientalis CI...   339    2e-91 
ref|YP_128268.1|  DNA gyrase subunit B [Photobacterium profund...   339    2e-91 
ref|YP_002474961.1|  DNA gyrase subunit B [Haemophilus parasui...   339    2e-91 
ref|YP_691724.1|  DNA gyrase, subunit B [Alcanivorax borkumens...   339    2e-91 
ref|YP_003436955.1|  DNA gyrase, B subunit [Klebsiella variico...   339    2e-91 
dbj|BAB85503.1|  DNA gyrase subunit B [Bradyrhizobium elkanii ...   338    3e-91 
ref|ZP_06551060.1|  DNA gyrase, B subunit [Klebsiella sp. 1_1_...   338    3e-91 
ref|YP_002235889.1|  DNA gyrase, B subunit [Klebsiella pneumon...   338    3e-91 
ref|YP_001364240.1|  DNA gyrase, B subunit [Shewanella baltica...   338    3e-91 
ref|NP_927380.1|  DNA gyrase subunit B [Photorhabdus luminesce...   338    3e-91 
ref|YP_001758400.1|  DNA gyrase, B subunit [Shewanella woodyi ...   338    3e-91 
dbj|BAB83772.1|  DNA gyrase subunit B [Rhodobacter blasticus]       338    3e-91 
ref|ZP_01042079.1|  DNA gyrase subunit B [Idiomarina baltica O...   338    3e-91 
ref|YP_002274421.1|  DNA gyrase, B subunit [Gluconacetobacter ...   338    3e-91 
ref|ZP_01739180.1|  DNA gyrase subunit B [Marinobacter sp. ELB...   338    3e-91 
ref|YP_001602019.1|  putative DNA gyrase subunit B [Gluconacet...   338    3e-91 
ref|ZP_01114120.1|  DNA gyrase subunit B [Reinekea sp. MED297]...   338    3e-91 
ref|YP_001048410.1|  DNA gyrase, B subunit [Shewanella baltica...   338    4e-91 
dbj|BAB88764.1|  subunit B protein of DNA gyrase [Bradyrhizobi...   338    4e-91 
ref|YP_854532.1|  DNA gyrase, B subunit [Aeromonas hydrophila ...   338    5e-91 
ref|ZP_04603658.1|  hypothetical protein GCWU000324_03159 [Kin...   338    6e-91 
ref|YP_572068.1|  DNA gyrase subunit B [Chromohalobacter salex...   338    6e-91 
ref|ZP_05974383.1|  DNA gyrase, B subunit [Providencia rustigi...   338    6e-91 
ref|ZP_01223309.1|  DNA gyrase subunit B [marine gamma proteob...   337    6e-91 
ref|YP_001672239.1|  DNA gyrase, B subunit [Shewanella halifax...   337    6e-91 
ref|ZP_06127712.1|  DNA gyrase subunit B [Providencia rettgeri...   337    7e-91 
ref|YP_001499868.1|  DNA gyrase, B subunit [Shewanella pealean...   337    7e-91 
ref|ZP_02958662.1|  hypothetical protein PROSTU_00412 [Provide...   337    7e-91 
ref|YP_198594.1|  DNA gyrase, topoisomerase II, B subunit, Gyr...   337    7e-91 
ref|ZP_01216605.1|  DNA gyrase subunit B [Psychromonas sp. CNP...   337    8e-91 
ref|YP_044811.1|  DNA gyrase, subunit B (type II topoisomerase...   337    8e-91 
ref|ZP_01615592.1|  DNA gyrase subunit B [marine gamma proteob...   337    8e-91 
ref|YP_001937517.1|  DNA gyrase subunit B [Orientia tsutsugamu...   337    8e-91 
ref|YP_961411.1|  DNA gyrase, B subunit [Shewanella sp. W3-18-...   337    9e-91 
ref|ZP_06073823.1|  DNA gyrase, B subunit [Acinetobacter radio...   337    1e-90 
ref|ZP_05361876.1|  DNA gyrase, B subunit [Acinetobacter radio...   337    1e-90 
ref|YP_390283.1|  DNA gyrase, B subunit [Thiomicrospira crunog...   337    1e-90 
ref|ZP_01308699.1|  DNA gyrase subunit B [Oceanobacter sp. RED...   337    1e-90 
ref|YP_561024.1|  DNA gyrase, B subunit [Shewanella denitrific...   337    1e-90 
ref|ZP_05620405.1|  DNA gyrase, B subunit [Enhydrobacter aeros...   336    1e-90 
ref|YP_003465959.1|  DNA gyrase, subunit B (type II topoisomer...   336    1e-90 
ref|YP_001248856.1|  DNA gyrase subunit B [Orientia tsutsugamu...   336    1e-90 
ref|YP_001218866.1|  DNA gyrase subunit B GyrB [Candidatus Ves...   336    2e-90 
dbj|BAB87029.1|  DNA gyrase subunit B [bacterium PC4]               336    2e-90 
ref|ZP_01900656.1|  Putative DNA gyrase, subunit B [Moritella ...   336    2e-90 
gb|ACD49736.1|  DNA gyrase subunit B [Vibrio mimicus]               336    2e-90 
ref|YP_903278.1|  DNA gyrase subunit B [Candidatus Ruthia magn...   335    2e-90 
ref|YP_001092136.1|  DNA gyrase, B subunit [Shewanella loihica...   335    2e-90 
ref|ZP_03712914.1|  hypothetical protein EIKCOROL_00586 [Eiken...   335    3e-90 
ref|YP_001249350.1|  DNA gyrase, subunit B [Legionella pneumop...   335    3e-90 
ref|YP_003071705.1|  DNA gyrase, B subunit [Teredinibacter tur...   335    3e-90 
ref|ZP_04958610.1|  DNA gyrase, B subunit [gamma proteobacteri...   335    3e-90 
ref|ZP_04590122.1|  DNA gyrase subunit B [Pseudomonas syringae...   335    4e-90 
ref|ZP_05043009.1|  DNA gyrase, B subunit [Alcanivorax sp. DG8...   335    4e-90 
ref|YP_002891220.1|  DNA gyrase, B subunit [Tolumonas auensis ...   335    4e-90 
ref|YP_544115.1|  DNA gyrase subunit B [Methylobacillus flagel...   335    4e-90 
ref|YP_002726779.1|  DNA gyrase, B subunit [Wolbachia sp. wRi]...   335    4e-90 
dbj|BAB87069.1|  DNA gyrase subunit B [bacterium MBIC3369]          335    4e-90 
ref|YP_003261917.1|  DNA gyrase, B subunit [Halothiobacillus n...   335    4e-90 
ref|ZP_06461165.1|  DNA gyrase subunit B [Pseudomonas syringae...   334    5e-90 
ref|ZP_03320743.1|  hypothetical protein PROVALCAL_03710 [Prov...   334    5e-90 
ref|ZP_05826039.1|  type IIA topoisomerase [Acinetobacter sp. ...   334    5e-90 
ref|YP_263312.1|  DNA gyrase subunit B [Psychrobacter arcticus...   334    5e-90 
ref|YP_272319.1|  DNA gyrase subunit B [Pseudomonas syringae p...   334    5e-90 
ref|ZP_05639637.1|  DNA gyrase subunit B [Pseudomonas syringae...   334    6e-90 
ref|YP_342091.1|  DNA gyrase, B subunit [Nitrosococcus oceani ...   334    6e-90 
ref|ZP_06067994.1|  DNA gyrase, B subunit [Acinetobacter junii...   334    7e-90 
ref|YP_094059.1|  DNA gyrase subunit B [Legionella pneumophila...   334    7e-90 
ref|YP_233116.1|  DNA gyrase subunit B [Pseudomonas syringae p...   334    7e-90 
ref|NP_789866.1|  DNA gyrase, subunit B [Pseudomonas syringae ...   334    7e-90 
ref|YP_125383.1|  DNA gyrase, subunit B (type II topoisomerase...   334    8e-90 
ref|YP_122356.1|  DNA gyrase, subunit B (type II topoisomerase...   334    8e-90 
ref|NP_965933.1|  DNA gyrase, B subunit [Wolbachia endosymbion...   333    1e-89 
dbj|BAB86965.1|  DNA gyrase subunit B [Caulobacter fusiformis]      333    1e-89 
ref|ZP_06059344.1|  type IIA topoisomerase [Acinetobacter calc...   333    1e-89 
gb|ACD49734.1|  DNA gyrase subunit B [Vibrio alginolyticus]         333    1e-89 
ref|ZP_01551563.1|  DNA gyrase subunit B [Methylophilales bact...   333    1e-89 
ref|YP_303058.1|  DNA gyrase subunit B [Ehrlichia canis str. J...   333    1e-89 
gb|ACD49735.1|  DNA gyrase subunit B [Vibrio campbellii]            333    2e-89 
ref|YP_003459257.1|  DNA gyrase, B subunit [Thioalkalivibrio s...   333    2e-89 
dbj|BAF75804.1|  DNA gyrase subunit B [Bradyrhizobium canariense]   333    2e-89 
ref|ZP_00545017.1|  DNA gyrase, B subunit [Ehrlichia chaffeens...   332    2e-89 
ref|ZP_06187056.1|  DNA gyrase B subunit [Legionella longbeach...   332    2e-89 
dbj|BAB86964.1|  DNA gyrase subunit B [Caulobacter crescentus]      332    2e-89 
ref|ZP_03788155.1|  DNA gyrase, B subunit [Wolbachia endosymbi...   332    2e-89 
ref|YP_001278915.1|  DNA gyrase, B subunit [Psychrobacter sp. ...   332    3e-89 
ref|NP_777649.1|  putative DNA gyrase subunit b [Buchnera aphi...   332    4e-89 
ref|ZP_01165221.1|  DNA gyrase subunit B [Oceanospirillum sp. ...   332    4e-89 
ref|ZP_01076918.1|  DNA gyrase, B subunit [Marinomonas sp. MED...   331    5e-89 
ref|NP_742183.1|  DNA gyrase subunit B [Pseudomonas putida KT2...   331    5e-89 
ref|YP_001666258.1|  DNA gyrase subunit B [Pseudomonas putida ...   331    5e-89 
emb|CBA72341.1|  DNA gyrase subunit B [Arsenophonus nasoniae]       331    5e-89 
ref|ZP_05313863.1|  DNA gyrase, B subunit [Nitrosomonas sp. AL...   331    6e-89 
ref|YP_002869701.1|  DNA gyrase subunit B [Pseudomonas fluores...   331    7e-89 
sp|P13364.2|GYRB_PSEPU  RecName: Full=DNA gyrase subunit B >em...   331    7e-89 
ref|YP_001746879.1|  DNA gyrase subunit B [Pseudomonas putida ...   330    7e-89 
ref|YP_579274.1|  DNA gyrase, B subunit [Psychrobacter cryohal...   330    7e-89 
ref|YP_525480.1|  DNA gyrase subunit B [Saccharophagus degrada...   330    7e-89 
ref|YP_002797247.1|  DNA gyrase protein, subunit B [Azotobacte...   330    8e-89 
ref|ZP_01625659.1|  DNA gyrase subunit B [marine gamma proteob...   330    9e-89 
ref|NP_660371.1|  DNA gyrase subunit B [Buchnera aphidicola st...   330    9e-89 
ref|YP_002218473.1|  DNA gyrase, B subunit [Acidithiobacillus ...   330    9e-89 
ref|YP_002424518.1|  DNA gyrase, B subunit [Acidithiobacillus ...   330    1e-88 
ref|YP_605818.1|  DNA gyrase subunit B [Pseudomonas entomophil...   330    1e-88 
ref|YP_257156.1|  DNA gyrase subunit B [Pseudomonas fluorescen...   330    1e-88 
ref|YP_002261574.1|  DNA gyrase subunit B [Aliivibrio salmonic...   330    1e-88 
ref|YP_957300.1|  DNA gyrase subunit B [Marinobacter aquaeolei...   330    2e-88 
ref|ZP_04829956.1|  DNA gyrase, B subunit [Gallionella ferrugi...   329    2e-88 
gb|ACD38218.1|  DNA gyrase subunit B [Vibrio harveyi]               329    2e-88 
ref|YP_196364.1|  DNA gyrase subunit B [Ehrlichia ruminantium ...   329    2e-88 
ref|YP_180292.1|  DNA gyrase subunit B [Ehrlichia ruminantium ...   329    2e-88 
gb|AAC38108.1|  DNA gyrase subunit B [Buchnera aphidicola]          328    3e-88 
ref|ZP_05109597.1|  DNA gyrase, subunit B (type II topoisomera...   328    4e-88 
ref|NP_899673.2|  DNA gyrase subunit B [Chromobacterium violac...   328    6e-88 
ref|YP_944991.1|  DNA gyrase, B subunit [Psychromonas ingraham...   327    6e-88 
ref|YP_420002.1|  DNA gyrase subunit B [Magnetospirillum magne...   327    8e-88 
ref|YP_001170554.1|  DNA gyrase subunit B [Pseudomonas stutzer...   327    1e-87 
dbj|BAF95668.1|  DNA gyrase subunit B [Bradyrhizobium sp. KO3H]     327    1e-87 
dbj|BAF95665.1|  DNA gyrase subunit B [Bradyrhizobium sp. KO3E]     327    1e-87 
ref|ZP_03700283.1|  DNA gyrase, B subunit [Lutiella nitroferru...   326    1e-87 
dbj|BAB87027.1|  DNA gyrase subunit B [Erythrobacter sp.]           326    2e-87 
ref|YP_266786.1|  DNA gyrase, B subunit [Colwellia psychreryth...   326    2e-87 
ref|YP_001338882.1|  DNA gyrase, B subunit [Marinomonas sp. MW...   326    2e-87 
ref|ZP_00207872.1|  COG0187: Type IIA topoisomerase (DNA gyras...   325    2e-87 
ref|ZP_05278122.1|  DNA gyrase subunit B (gyrB2) [Anaplasma ma...   325    3e-87 
ref|YP_001185511.1|  DNA gyrase subunit B [Pseudomonas mendoci...   325    3e-87 
ref|YP_002563592.1|  DNA gyrase subunit B (gyrB2) [Anaplasma m...   325    4e-87 
ref|YP_588600.1|  DNA gyrase, B subunit [Baumannia cicadellini...   325    4e-87 
gb|AAY81979.1|  DNA gyrase beta subunit [Wolbachia pipientis]       324    5e-87 
ref|YP_345737.1|  DNA gyrase subunit B [Pseudomonas fluorescen...   324    8e-87 
ref|NP_635399.1|  DNA gyrase subunit B [Xanthomonas campestris...   324    8e-87 
gb|AAL30092.1|  DNA gyrase subunit B [Xanthomonas campestris p...   323    1e-86 
dbj|BAB87028.1|  DNA gyrase subunit B [Erythrobacter sp.]           323    1e-86 
ref|YP_001228795.1|  DNA gyrase, B subunit [Geobacter uraniire...   323    1e-86 
ref|YP_003047441.1|  DNA gyrase, B subunit [Methylotenera mobi...   323    1e-86 
ref|YP_001950263.1|  DNA gyrase, B subunit [Geobacter lovleyi ...   323    2e-86 
ref|YP_153886.1|  DNA gyrase subunit B [Anaplasma marginale st...   322    2e-86 
ref|NP_871019.1|  hypothetical protein WGLp016 [Wigglesworthia...   322    2e-86 
ref|YP_746261.1|  DNA gyrase subunit B [Nitrosomonas eutropha ...   322    2e-86 
ref|YP_002797228.1|  GyrB [Laribacter hongkongensis HLHK9] >gb...   322    3e-86 
ref|YP_003328553.1|  DNA gyrase subunit B [Anaplasma centrale ...   322    3e-86 
ref|NP_640360.1|  DNA gyrase subunit B [Xanthomonas axonopodis...   322    3e-86 
ref|NP_297298.1|  DNA gyrase subunit B [Xylella fastidiosa 9a5...   322    3e-86 
dbj|BAF95661.1|  DNA gyrase subunit B [Bradyrhizobium sp. KO3A]     321    4e-86 
ref|YP_361735.1|  DNA gyrase subunit B [Xanthomonas campestris...   321    4e-86 
gb|ABB69895.1|  DNA gyrase subunit B [Nitrosomonas sp. CNS332]      321    4e-86 
ref|YP_003081909.1|  DNA gyrase, B subunit [Neorickettsia rist...   321    4e-86 
gb|AAC34893.1|  DNA gyrase B subunit [Methylovorus sp. SS1]         321    4e-86 
ref|YP_003049779.1|  DNA gyrase, B subunit [Methylovorus sp. S...   321    4e-86 
gb|ABB69901.1|  DNA gyrase subunit B [Nitrosomonas sp. OZK11]       321    5e-86 
ref|ZP_05879978.1|  DNA gyrase subunit B [Vibrio furnissii CIP...   321    5e-86 
ref|ZP_06488721.1|  DNA gyrase subunit B [Xanthomonas campestr...   321    6e-86 
dbj|BAB87055.1|  DNA gyrase subunit B [bacterium PC3]               321    6e-86 
ref|ZP_06483861.1|  DNA gyrase subunit B [Xanthomonas campestr...   321    6e-86 
gb|ABB69898.1|  DNA gyrase subunit B [Nitrosomonas sp. IWT310]      321    6e-86 
ref|ZP_02241106.1|  DNA gyrase subunit B [Xanthomonas oryzae p...   321    7e-86 
ref|ZP_04931076.1|  DNA gyrase subunit B [Pseudomonas aerugino...   320    8e-86 
ref|YP_003442035.1|  transcriptional regulator, XRE family [Al...   320    8e-86 
ref|ZP_00651817.1|  DNA gyrase, B subunit [Xylella fastidiosa ...   320    9e-86 
ref|NP_064724.1|  DNA gyrase subunit B [Pseudomonas aeruginosa...   320    9e-86 
ref|YP_002535483.1|  DNA gyrase, B subunit [Geobacter sp. FRC-...   320    1e-85 
ref|NP_886525.1|  DNA gyrase subunit B [Bordetella parapertuss...   320    1e-85 
ref|ZP_02061690.1|  DNA gyrase, B subunit [Rickettsiella gryll...   320    1e-85 
ref|YP_001345400.1|  DNA gyrase subunit B [Pseudomonas aerugin...   320    1e-85 
ref|NP_840104.1|  DNA gyrase subunit B [Nitrosomonas europaea ...   320    1e-85 
ref|NP_891521.1|  DNA gyrase subunit B [Bordetella bronchisept...   320    1e-85 
ref|YP_001911203.1|  DNA gyrase subunit B [Xanthomonas oryzae ...   320    1e-85 
ref|YP_449033.1|  DNA gyrase subunit B [Xanthomonas oryzae pv....   320    1e-85 
ref|NP_778264.1|  DNA gyrase subunit B [Xylella fastidiosa Tem...   319    2e-85 
ref|NP_879342.1|  DNA gyrase subunit B [Bordetella pertussis T...   319    2e-85 
ref|ZP_00681884.1|  DNA gyrase, B subunit [Xylella fastidiosa ...   319    2e-85 
gb|AAZ67933.1|  DNA gyrase subunit B [Psychrobacter submarinus]     318    3e-85 
gb|ABB69883.1|  DNA gyrase subunit B [Nitrosospira sp. NIJS16]      318    3e-85 
dbj|BAA85765.1|  DNA gyrase subunit B [Pseudomonas aeruginosa]      318    3e-85 
gb|ACV40280.1|  DNA gyrase subunit B [Yersinia intermedia]          318    3e-85 
ref|YP_198643.1|  DNA gyrase subunit B [Xanthomonas oryzae pv....   318    4e-85 
dbj|BAF75803.1|  DNA gyrase subunit B [Bradyrhizobium betae]        318    5e-85 
ref|YP_505297.1|  DNA gyrase, B subunit [Anaplasma phagocytoph...   318    5e-85 
ref|ZP_05104420.1|  DNA gyrase, B subunit [Methylophaga thioox...   318    6e-85 
ref|YP_002966766.1|  DNA gyrase, subunit B [Methylobacterium e...   317    6e-85 
ref|ZP_02219674.1|  DNA gyrase, B subunit [Coxiella burnetii R...   317    9e-85 
ref|YP_787904.1|  DNA gyrase subunit B [Bordetella avium 197N]...   317    9e-85 
ref|NP_951065.1|  DNA gyrase, B subunit [Geobacter sulfurreduc...   317    1e-84 
gb|ACV40236.1|  DNA gyrase subunit B [Yersinia aldovae]             317    1e-84 
gb|AAZ67936.1|  DNA gyrase subunit B [Psychrobacter glacincola]     316    1e-84 
gb|AAZ67929.1|  DNA gyrase subunit B [Psychrobacter marincola]      316    2e-84 
gb|ACV40299.1|  DNA gyrase subunit B [Yersinia intermedia]          316    2e-84 
gb|ACV40255.1|  DNA gyrase subunit B [Yersinia intermedia] >gb...   316    2e-84 
gb|AAZ67932.1|  DNA gyrase subunit B [Psychrobacter cryohalole...   316    2e-84 
dbj|BAF95677.1|  DNA gyrase subunit B [Bradyrhizobium sp. MAFF...   316    2e-84 
gb|ABB69886.1|  DNA gyrase subunit B [Nitrosospira sp. NIJS18]      315    2e-84 
ref|YP_001083103.1|  DNA gyrase [Acinetobacter baumannii ATCC ...   315    2e-84 
ref|ZP_02158925.1|  DNA gyrase, B subunit [Shewanella benthica...   315    3e-84 
dbj|BAF95676.1|  DNA gyrase subunit B [Mesorhizobium loti]          315    4e-84 
gb|ACV40268.1|  DNA gyrase subunit B [Yersinia mollaretii]          315    4e-84 
ref|ZP_05883451.1|  DNA gyrase subunit B [Vibrio metschnikovii...   315    4e-84 
gb|AAZ67928.1|  DNA gyrase subunit B [Psychrobacter jeotgali]       315    4e-84 
dbj|BAF95669.1|  DNA gyrase subunit B [Bradyrhizobium sp. KO5]      315    5e-84 
dbj|BAF62102.1|  DNA gyrase subunit B [Bradyrhizobium iriomote...   315    5e-84 
gb|ACV40238.1|  DNA gyrase subunit B [Yersinia bercovieri] >gb...   314    5e-84 
gb|ACV40252.1|  DNA gyrase subunit B [Yersinia frederiksenii]       314    6e-84 
ref|NP_878332.1|  DNA gyrase subunit B [Candidatus Blochmannia...   314    6e-84 
gb|ABB69860.1|  DNA gyrase subunit B [Nitrosospira sp. HBN8222...   314    7e-84 
gb|ACV40287.1|  DNA gyrase subunit B [Yersinia intermedia]          314    7e-84 
ref|YP_001628605.1|  DNA gyrase subunit B [Bordetella petrii D...   314    7e-84 
gb|ACV40237.1|  DNA gyrase subunit B [Yersinia aleksiciae] >gb...   314    8e-84 
gb|ABB69874.1|  DNA gyrase subunit B [Nitrosospira sp. GS832]       314    8e-84 
gb|ABB69880.1|  DNA gyrase subunit B [Nitrosospira sp. TYM9]        314    8e-84 
gb|ABB69877.1|  DNA gyrase subunit B [Nitrosospira sp. NRS527]      314    8e-84 
gb|ABB69871.1|  DNA gyrase subunit B [Nitrosospira sp. PJA1]        314    8e-84 
gb|ACV40274.1|  DNA gyrase subunit B [Yersinia ruckeri] >gb|AC...   313    9e-84 
dbj|BAF95673.1|  DNA gyrase subunit B [Bradyrhizobium sp. KO19A]    313    1e-83 
gb|ACV40281.1|  DNA gyrase subunit B [Yersinia intermedia]          313    1e-83 
dbj|BAG70958.1|  DNA gyrase subunit B [Psychrobacter pulmonis]      313    1e-83 
dbj|BAF95671.1|  DNA gyrase subunit B [Bradyrhizobium sp. KO13]     313    1e-83 
ref|YP_002468339.1|  DNA gyrase subunit B [Buchnera aphidicola...   313    1e-83 
dbj|BAF95674.1|  DNA gyrase subunit B [Bradyrhizobium sp. KO20A]    313    2e-83 
dbj|BAF95666.1|  DNA gyrase subunit B [Bradyrhizobium sp. KO3F]     313    2e-83 
dbj|BAC53887.1|  DNA gyrase B subunit [Tatlockia micdadei]          313    2e-83 
ref|YP_410704.1|  DNA gyrase subunit B [Nitrosospira multiform...   312    2e-83 
dbj|BAF95663.1|  DNA gyrase subunit B [Bradyrhizobium sp. KO3C]     312    2e-83 
gb|ABB69892.1|  DNA gyrase subunit B [Nitrosovibrio sp. RY3C]       312    2e-83 
gb|ACV40239.1|  DNA gyrase subunit B [Yersinia enterocolitica]...   312    2e-83 
dbj|BAF95672.1|  DNA gyrase subunit B [Bradyrhizobium sp. KO17]     312    3e-83 
gb|ABB69854.1|  DNA gyrase subunit B [Nitrosospira multiformis]     312    3e-83 
gb|ABC36375.1|  DNA gyrase, B subunit [Burkholderia thailanden...   311    4e-83 
gb|ACV40240.1|  DNA gyrase subunit B [Yersinia enterocolitica]...   311    4e-83 
ref|YP_443735.2|  DNA gyrase subunit B [Burkholderia thailande...   311    4e-83 
dbj|BAG84634.1|  DNA gyrase subunit B [Psychrobacter fulvigene...   311    4e-83 
dbj|BAF95662.1|  DNA gyrase subunit B [Bradyrhizobium sp. KO3B]     311    4e-83 
ref|YP_277538.1|  DNA gyrase, subunit B [Candidatus Blochmanni...   311    4e-83 
dbj|BAF95664.1|  DNA gyrase subunit B [Bradyrhizobium sp. KO3D]     311    5e-83 
gb|ACV40264.1|  DNA gyrase subunit B [Yersinia kristensenii] >...   311    5e-83 
gb|AAZ67924.1|  DNA gyrase subunit B [Psychrobacter pacificensis]   311    5e-83 
ref|ZP_04577637.1|  DNA gyrase subunit B [Oxalobacter formigen...   311    6e-83 
ref|YP_002467784.1|  DNA gyrase subunit B [Buchnera aphidicola...   311    6e-83 
gb|ACV40251.1|  DNA gyrase subunit B [Yersinia frederiksenii] ...   311    6e-83 
gb|ACV40265.1|  DNA gyrase subunit B [Yersinia kristensenii]        311    6e-83 
ref|ZP_00372279.1|  DNA gyrase, B subunit [Wolbachia endosymbi...   311    6e-83 
gb|ABB69863.1|  DNA gyrase subunit B [Nitrosospira sp. KAN8]        311    6e-83 
ref|ZP_02375842.1|  DNA gyrase subunit B [Burkholderia thailan...   311    6e-83 
gb|ACV40273.1|  DNA gyrase subunit B [Yersinia rohdei]              311    7e-83 
gb|ADC53568.1|  DNA gyrase subunit beta [Pseudomonas syringae ...   310    8e-83 
gb|ABB69889.1|  DNA gyrase subunit B [Nitrosovibrio sp. FJI82]      310    1e-82 
dbj|BAB83058.1|  DNA gyrase subunit B [Alcanivorax sp. I4]          310    1e-82 
gb|ACV40249.1|  DNA gyrase subunit B [Yersinia enterocolitica]      310    1e-82 
gb|ACV40253.1|  DNA gyrase subunit B [Yersinia frederiksenii]       310    2e-82 
ref|NP_239852.1|  DNA gyrase subunit B [Buchnera aphidicola st...   310    2e-82 
gb|ACV40250.1|  DNA gyrase subunit B [Yersinia frederiksenii]       309    2e-82 
ref|YP_001741394.1|  DNA gyrase subunit B [Candidatus Cloacamo...   309    2e-82 
ref|YP_294229.1|  DNA gyrase subunit B [Ralstonia eutropha JMP...   309    3e-82 
ref|ZP_05096553.1|  DNA gyrase, B subunit [marine gamma proteo...   309    3e-82 
gb|ABB69857.1|  DNA gyrase subunit B [Nitrosospira sp. 9SS1]        309    3e-82 
gb|ABE02213.1|  gyrase B [Pseudorhodobacter incheonensis]           308    3e-82 
dbj|BAF95679.1|  DNA gyrase subunit B [Bradyrhizobium sp. MAFF...   308    4e-82 
ref|ZP_03264757.1|  DNA gyrase, B subunit [Burkholderia sp. H1...   308    4e-82 
ref|ZP_02461810.1|  DNA gyrase subunit B [Burkholderia thailan...   308    4e-82 
dbj|BAB83065.1|  DNA gyrase subunit B [Alcanivorax sp. ST-T3]       308    5e-82 
ref|ZP_02353904.1|  DNA gyrase subunit B [Burkholderia oklahom...   308    5e-82 
ref|YP_001795398.1|  DNA gyrase subunit B [Cupriavidus taiwane...   308    5e-82 
ref|YP_802581.1|  DNA gyrase subunit B [Buchnera aphidicola st...   308    6e-82 
ref|YP_002136833.1|  DNA gyrase, B subunit [Geobacter bemidjie...   307    8e-82 
ref|YP_001893680.1|  DNA gyrase subunit B [Burkholderia phytof...   307    8e-82 
ref|ZP_02453585.1|  DNA gyrase subunit B [Burkholderia pseudom...   307    8e-82 
ref|YP_106698.1|  DNA gyrase subunit B [Burkholderia pseudomal...   307    8e-82 
dbj|BAC55028.1|  DNA gyrase B subunit [Legionella quinlivanii]      307    8e-82 
dbj|BAH28875.1|  DNA gyrase subunit B [Psychrobacter aquimaris]     306    1e-81 
ref|YP_556593.1|  DNA gyrase subunit B [Burkholderia xenovoran...   306    1e-81 
ref|YP_821304.1|  DNA gyrase subunit B [Solibacter usitatus El...   306    1e-81 
ref|YP_367430.1|  DNA gyrase subunit B [Burkholderia sp. 383] ...   306    1e-81 
ref|YP_001117866.1|  DNA gyrase subunit B [Burkholderia vietna...   306    1e-81 
ref|ZP_02885223.1|  DNA gyrase, B subunit [Burkholderia gramin...   306    1e-81 
ref|YP_001763306.1|  DNA gyrase subunit B [Burkholderia cenoce...   306    2e-81 
ref|YP_622427.1|  DNA gyrase subunit B [Burkholderia cenocepac...   306    2e-81 
ref|YP_002229583.1|  DNA gyrase subunit B [Burkholderia cenoce...   306    2e-81 
ref|YP_001019200.1|  DNA gyrase subunit B [Methylibium petrole...   306    2e-81 
dbj|BAB87022.1|  DNA gyrase subunit B [Vibrio diazotrophicus]       306    2e-81 
ref|NP_521559.1|  DNA gyrase subunit B [Ralstonia solanacearum...   305    3e-81 
ref|ZP_04940146.1|  Type IIA topoisomerase (DNA gyrase/topo II...   305    3e-81 
ref|YP_001856246.1|  DNA gyrase, B subunit [Burkholderia phyma...   305    3e-81 
ref|ZP_02382091.1|  DNA gyrase subunit B [Burkholderia ubonens...   305    3e-81 
dbj|BAF95680.1|  DNA gyrase subunit B [Bradyrhizobium sp. EPxn1]    305    3e-81 
ref|ZP_04944368.1|  Type IIA topoisomerase [Burkholderia dolos...   305    3e-81 
ref|YP_001578195.1|  DNA gyrase subunit B [Burkholderia multiv...   305    3e-81 
ref|YP_003019849.1|  DNA gyrase, B subunit [Geobacter sp. M21]...   305    3e-81 
ref|ZP_06403842.1|  DNA gyrase, B subunit [bacterium S5] >gb|E...   305    4e-81 
emb|CAM32658.1|  DNA gyrase subunit B, type II topoisomerase, ...   305    4e-81 
ref|ZP_06226056.1|  DNA gyrase subunit B [Burkholderia sp. CCG...   305    5e-81 
ref|YP_382979.1|  DNA gyrase subunit B [Geobacter metallireduc...   305    5e-81 
ref|ZP_04579796.1|  DNA gyrase subunit B [Oxalobacter formigen...   305    5e-81 
ref|YP_724523.1|  DNA gyrase subunit B [Ralstonia eutropha H16...   304    5e-81 
ref|YP_002255870.1|  dna gyrase (subunit b) protein [Ralstonia...   304    6e-81 
ref|ZP_00946713.1|  DNA gyrase subunit B [Ralstonia solanacear...   304    6e-81 
ref|ZP_06466193.1|  DNA gyrase subunit B [Burkholderia sp. CCG...   304    7e-81 
ref|YP_899703.1|  DNA gyrase, B subunit [Pelobacter propionicu...   304    8e-81 
dbj|BAC55031.1|  DNA gyrase B subunit [Legionella spiritensis]      304    9e-81 
ref|YP_582158.1|  DNA gyrase subunit B [Ralstonia metalliduran...   303    9e-81 
ref|YP_002909918.1|  DNA gyrase, B subunit [Burkholderia gluma...   303    1e-80 
ref|ZP_06292964.1|  DNA gyrase, B subunit [Burkholderia sp. CC...   303    1e-80 
ref|YP_001806722.1|  DNA gyrase subunit B [Burkholderia ambifa...   303    1e-80 
dbj|BAC53883.1|  DNA gyrase B subunit [Legionella hackeliae]        303    1e-80 
ref|ZP_02905563.1|  DNA gyrase, B subunit [Burkholderia ambifa...   303    1e-80 
ref|YP_771898.1|  DNA gyrase subunit B [Burkholderia ambifaria...   303    1e-80 
dbj|BAB87021.1|  DNA gyrase subunit B [Vibrio campbellii]           303    1e-80 
ref|ZP_02888843.1|  DNA gyrase, B subunit [Burkholderia ambifa...   303    1e-80 
gb|AAQ57683.1|  DNA gyrase subunit B [Chromobacterium violaceu...   303    2e-80 
gb|AAZ67925.1|  DNA gyrase subunit B [Psychrobacter proteolyti...   303    2e-80 
ref|YP_843808.1|  DNA gyrase, B subunit [Methanosaeta thermoph...   303    2e-80 
dbj|BAB87025.1|  DNA gyrase subunit B [Listonella pelagia]          303    2e-80 
ref|YP_002433264.1|  DNA gyrase, B subunit [Desulfatibacillum ...   302    2e-80 
dbj|BAF95678.1|  DNA gyrase subunit B [Bradyrhizobium sp. MAFF...   302    3e-80 
dbj|BAB83071.1|  DNA gyrase subunit B [Alcanivorax sp. ST-1]        302    3e-80 
ref|YP_001351693.1|  DNA gyrase subunit B [Janthinobacterium s...   302    3e-80 
dbj|BAC55030.1|  DNA gyrase B subunit [Legionella erythra]          302    3e-80 
dbj|BAC53885.1|  DNA gyrase B subunit [Legionella rubrilucens]      301    4e-80 
ref|YP_001527982.1|  DNA gyrase, B subunit [Desulfococcus oleo...   301    4e-80 
ref|ZP_05313288.1|  DNA gyrase, B subunit [Geobacter sp. M18] ...   301    4e-80 
dbj|BAF95667.1|  DNA gyrase subunit B [Bradyrhizobium sp. KO3G]     301    5e-80 
ref|YP_001789044.1|  DNA gyrase, B subunit [Leptothrix cholodn...   301    8e-80 
ref|YP_001178861.1|  DNA gyrase, B subunit [Caldicellulosirupt...   300    1e-79 
ref|YP_355437.1|  DNA gyrase, B subunit [Pelobacter carbinolic...   300    1e-79 
dbj|BAH28874.1|  DNA gyrase subunit B [Psychrobacter nivimaris]     300    1e-79 
ref|ZP_01312729.1|  DNA gyrase, B subunit [Desulfuromonas acet...   300    1e-79 
dbj|BAB86996.1|  DNA gyrase subunit B [Halomonas pacifica]          300    2e-79 
ref|YP_001897602.1|  DNA gyrase, B subunit [Ralstonia picketti...   299    2e-79 
dbj|BAB83055.1|  DNA gyrase subunit B [Marinobacterium georgie...   299    2e-79 
ref|ZP_01288026.1|  DNA gyrase, B subunit [delta proteobacteri...   299    2e-79 
ref|NP_970619.1|  DNA gyrase, B subunit [Treponema denticola A...   299    2e-79 
ref|ZP_01289914.1|  DNA gyrase, B subunit [delta proteobacteri...   299    2e-79 
dbj|BAB86986.1|  DNA gyrase subunit B [Caulobacter leidyia]         299    3e-79 
ref|ZP_05338866.1|  DNA gyrase, B subunit [Sideroxydans lithot...   298    4e-79 
dbj|BAF37224.1|  DNA gyrase subunit B [Marinobacter hydrocarbo...   298    4e-79 
dbj|BAI66713.1|  DNA gyrase B [Borrelia sp. Tick98M]                298    4e-79 
ref|NP_219443.1|  DNA gyrase, subunit B (gyrB) [Treponema pall...   298    5e-79 
ref|YP_003264539.1|  DNA gyrase, B subunit [Haliangium ochrace...   298    5e-79 
dbj|BAC55032.1|  DNA gyrase B subunit [Legionella waltersii]        297    7e-79 
ref|NP_616517.1|  DNA topoisomerase (ATP-hydrolyzing), subunit...   297    9e-79 
ref|YP_001098373.1|  DNA gyrase subunit B [Herminiimonas arsen...   297    1e-78 
ref|ZP_05134771.1|  DNA gyrase, B subunit [Stenotrophomonas sp...   297    1e-78 
dbj|BAF75805.1|  DNA gyrase subunit B [Bradyrhizobium yuanming...   296    2e-78 
ref|ZP_04389826.1|  DNA gyrase, B subunit [Porphyromonas endod...   296    2e-78 
dbj|BAH28873.1|  DNA gyrase subunit B [Psychrobacter piscatorii]    296    2e-78 
ref|ZP_05735263.1|  DNA gyrase, B subunit [Prevotella tannerae...   296    2e-78 
ref|YP_002026392.1|  DNA gyrase, B subunit [Stenotrophomonas m...   296    2e-78 
ref|YP_001734595.1|  DNA gyrase, B subunit [Synechococcus sp. ...   296    2e-78 
dbj|BAD82891.1|  GyrB [Burkholderia multivorans]                    296    2e-78 
ref|YP_001969941.1|  putative DNA gyrase subunit B [Stenotroph...   295    2e-78 
ref|ZP_01451991.1|  DNA gyrase, B subunit [Mariprofundus ferro...   295    3e-78 
gb|ACA52058.1|  DNA gyrase B subunit [Shewanella sp. JG353]         295    3e-78 
ref|YP_001154789.1|  DNA gyrase, B subunit [Polynucleobacter n...   295    4e-78 
ref|YP_001518793.1|  DNA gyrase subunit B [Acaryochloris marin...   295    5e-78 
dbj|BAC53884.1|  DNA gyrase B subunit [Legionella jamestownien...   294    6e-78 
ref|YP_089690.1|  DNA gyrase subunit B [Bacillus licheniformis...   294    6e-78 
dbj|BAI66712.1|  DNA gyrase B [Borrelia turcica]                    294    6e-78 
ref|YP_077288.1|  DNA gyrase subunit B [Bacillus licheniformis...   294    6e-78 
ref|YP_003321796.1|  DNA gyrase, B subunit [Thermobaculum terr...   294    8e-78 
ref|ZP_06386476.1|  DNA gyrase, B subunit [Candidatus Poribact...   294    9e-78 
ref|YP_002507764.1|  DNA gyrase, B subunit [Halothermothrix or...   293    9e-78 
ref|ZP_05037826.1|  DNA gyrase, B subunit [Synechococcus sp. P...   293    1e-77 
ref|YP_521296.1|  DNA gyrase, B subunit [Rhodoferax ferrireduc...   293    1e-77 
sp|Q9ZFK1.1|GYRB_BORHE  RecName: Full=DNA gyrase subunit B >gb...   293    1e-77 
ref|YP_002571945.1|  DNA gyrase, B subunit [Anaerocellum therm...   293    1e-77 
ref|YP_001883864.1|  DNA gyrase subunit B [Borrelia hermsii DA...   293    1e-77 
ref|NP_681436.1|  DNA gyrase subunit B [Thermosynechococcus el...   293    1e-77 
gb|ADD63785.1|  DNA gyrase subunit B [Borrelia hermsii] >gb|AD...   293    2e-77 
ref|YP_984330.1|  DNA gyrase, B subunit [Polaromonas naphthale...   293    2e-77 
ref|YP_001796948.1|  DNA gyrase, B subunit [Polynucleobacter n...   293    2e-77 
ref|ZP_02031548.1|  hypothetical protein PARMER_01552 [Parabac...   293    2e-77 
ref|YP_001837428.1|  DNA gyrase subunit B [Leptospira biflexa ...   292    2e-77 
ref|NP_621723.1|  DNA gyrase subunit B [Thermoanaerobacter ten...   292    2e-77 
ref|YP_002940080.1|  DNA gyrase, B subunit [Kosmotoga olearia ...   292    2e-77 
ref|ZP_05092278.1|  DNA gyrase, B subunit [Carboxydibrachium p...   292    2e-77 
ref|ZP_06440753.1|  DNA gyrase, B subunit [Anaerobaculum hydro...   292    2e-77 
dbj|BAI66714.1|  DNA gyrase B [Borrelia sp. Tortoise14H1]           292    3e-77 
gb|AAY17144.1|  DNA gyrase B [Borrelia turicatae] >gb|AAY17145...   292    3e-77 
gb|AAT99972.1|  DNA gyrase subunit B [Borrelia hermsii] >gb|AA...   292    3e-77 
gb|AAY17151.1|  DNA gyrase B [Borrelia turicatae]                   292    3e-77 
ref|YP_945433.1|  DNA gyrase subunit B [Borrelia turicatae 91E...   292    3e-77 
dbj|BAB86995.1|  DNA gyrase subunit B [Halomonas halmophila]        292    3e-77 
ref|YP_988323.1|  DNA gyrase subunit B [Acidovorax sp. JS42] >...   292    4e-77 
ref|ZP_05500799.1|  DNA gyrase, B subunit [Thiomonas intermedi...   291    4e-77 
ref|YP_546868.1|  DNA gyrase subunit B [Polaromonas sp. JS666]...   291    4e-77 
dbj|BAB86994.1|  DNA gyrase subunit B [Halomonas cupida]            291    4e-77 
ref|YP_003291976.1|  DNA gyrase, B subunit [Rhodothermus marin...   291    4e-77 
dbj|BAI66711.1|  DNA gyrase B [Borrelia sp. BF16]                   291    5e-77 
ref|ZP_05336862.1|  DNA topoisomerase IV, B subunit [Thermoana...   291    5e-77 
ref|YP_460050.1|  DNA gyrase subunit B [Syntrophus aciditrophi...   291    5e-77 
ref|YP_001874910.1|  DNA gyrase, B subunit [Elusimicrobium min...   291    5e-77 
ref|ZP_03478430.1|  hypothetical protein PRABACTJOHN_04139 [Pa...   291    6e-77 
ref|YP_002551492.1|  DNA gyrase, B subunit [Acidovorax ebreus ...   291    7e-77 
ref|ZP_03054979.1|  DNA gyrase, B subunit [Bacillus pumilus AT...   291    7e-77 
dbj|BAI79515.1|  DNA gyrase, B subunit [Deferribacter desulfur...   290    9e-77 
ref|YP_846802.1|  DNA gyrase, B subunit [Syntrophobacter fumar...   290    1e-76 
gb|AAZ67937.1|  DNA gyrase subunit B [Psychrobacter immobilis]      290    1e-76 
dbj|BAA78433.1|  subunit B protein of DNA gyrase [bacterium rJ4]    290    2e-76 
dbj|BAA78434.1|  subunit B protein of DNA gyrase [bacterium rJ5]    289    2e-76 
ref|YP_386499.1|  DNA gyrase subunit B [Desulfovibrio desulfur...   289    2e-76 
ref|ZP_05544463.1|  DNA gyrase, B subunit [Parabacteroides sp....   289    2e-76 
ref|NP_634443.1|  DNA gyrase, subunit B [Methanosarcina mazei ...   289    2e-76 
ref|YP_001304873.1|  DNA gyrase, B subunit [Parabacteroides di...   289    2e-76 
ref|YP_001958180.1|  hypothetical protein Aasi_1109 [Candidatu...   289    2e-76 
ref|YP_001038771.1|  DNA gyrase subunit B [Clostridium thermoc...   289    2e-76 
gb|AAY17138.1|  DNA gyrase B [Borrelia parkeri]                     289    3e-76 
ref|YP_064385.1|  DNA gyrase, subunit B [Desulfotalea psychrop...   289    3e-76 
ref|YP_003248945.1|  DNA gyrase, B subunit [Fibrobacter succin...   289    3e-76 
ref|YP_001618816.1|  DNA gyrase subunit B [Sorangium cellulosu...   289    3e-76 
ref|ZP_05710276.1|  DNA gyrase, B subunit [Desulfurivibrio alk...   289    3e-76 
ref|ZP_04046773.1|  DNA gyrase subunit B [Brachyspira murdochi...   288    3e-76 
ref|YP_283232.1|  DNA gyrase subunit B [Dechloromonas aromatic...   288    3e-76 
dbj|BAB86993.1|  DNA gyrase subunit B [Halomonas aquamarina]        288    3e-76 
dbj|BAB87023.1|  DNA gyrase subunit B [Vibrio gazogenes]            288    4e-76 
gb|AAY17139.1|  DNA gyrase B [Borrelia parkeri] >gb|AAY17140.1...   288    4e-76 
ref|YP_968395.1|  DNA gyrase subunit B [Acidovorax avenae subs...   288    5e-76 
ref|ZP_04781977.1|  DNA topoisomerase (ATP-hydrolyzing) [Sphin...   288    5e-76 
ref|ZP_06208518.1|  DNA gyrase, B subunit [Acidovorax avenae s...   288    5e-76 
ref|YP_002720801.1|  D Gyrase B subunit [Brachyspira hyodysent...   288    5e-76 
ref|YP_001485266.1|  DNA gyrase subunit B [Bacillus pumilus SA...   288    6e-76 
ref|YP_003316652.1|  DNA gyrase, B subunit [Thermanaerovibrio ...   288    6e-76 
dbj|BAC53882.1|  DNA gyrase B subunit [Legionella cherrii]          288    6e-76 
ref|YP_002222084.1|  DNA gyrase, subunit B [Borrelia duttonii ...   288    6e-76 
ref|YP_003374536.1|  probable dna topoisomerase II (dna gyrase...   287    7e-76 
ref|ZP_03773277.1|  DNA gyrase, B subunit [Borrelia sp. SV1] >...   287    7e-76 
ref|ZP_05898754.1|  DNA gyrase, B subunit [Selenomonas sputige...   287    7e-76 
ref|ZP_03991465.1|  DNA topoisomerase (ATP-hydrolyzing) [Oriba...   287    8e-76 
gb|AAZ67935.1|  DNA gyrase subunit B [Psychrobacter luti]           287    8e-76 
dbj|BAB87057.1|  DNA gyrase subunit B [Aquaspirillum serpens] ...   287    8e-76 
ref|NP_829372.1|  DNA gyrase subunit B [Chlamydophila caviae G...   287    9e-76 
ref|NP_212570.1|  DNA gyrase, subunit B (gyrB) [Borrelia burgd...   287    1e-75 
gb|AAB67237.1|  DNA gyrase subunit B [Borrelia burgdorferi]         287    1e-75 
ref|ZP_03673139.1|  DNA gyrase, B subunit [Borrelia burgdorfer...   287    1e-75 
ref|ZP_03087398.1|  DNA gyrase, subunit B (gyrB) [Borrelia bur...   287    1e-75 
ref|YP_684896.1|  type II DNA topoisomerase II (gyrase), subun...   286    1e-75 
ref|YP_002436494.1|  DNA gyrase, B subunit [Desulfovibrio vulg...   286    1e-75 
ref|ZP_01873352.1|  DNA gyrase subunit B [Lentisphaera araneos...   286    1e-75 
dbj|BAB87049.1|  DNA gyrase subunit B [Pseudomonas sp.]             286    1e-75 
ref|YP_002941932.1|  DNA gyrase, B subunit [Variovorax paradox...   286    1e-75 
ref|YP_001679675.1|  DNA gyrase, b subunit [Heliobacterium mod...   286    2e-75 
ref|ZP_03311883.1|  hypothetical protein DESPIG_01803 [Desulfo...   286    2e-75 
ref|ZP_03968366.1|  DNA topoisomerase [Sphingobacterium spirit...   286    2e-75 
ref|NP_710186.1|  DNA gyrase subunit B [Leptospira interrogans...   286    2e-75 
gb|AAO39047.1|  coumermycin-resistant GyrB [synthetic construct]    286    2e-75 
ref|ZP_01471639.1|  DNA topoisomerase IV subunit B [Synechococ...   286    2e-75 
gb|AAN64015.1|AF434658_12  DNA gyrase subunit B [Leptospira in...   286    2e-75 
ref|ZP_03734588.1|  DNA gyrase, B subunit [Dethiobacter alkali...   286    2e-75 
ref|ZP_04658364.1|  DNA gyrase subunit B [Selenomonas flueggei...   286    2e-75 
ref|YP_002222893.1|  DNA gyrase, subunit B [Borrelia recurrent...   286    2e-75 
ref|YP_313761.1|  DNA gyrase subunit B [Thiobacillus denitrifi...   285    3e-75 
dbj|BAA78454.1|  subunit B protein of DNA gyrase [bacterium rM17]   285    3e-75 
ref|ZP_03672420.1|  DNA gyrase, B subunit [Borrelia valaisiana...   285    3e-75 
ref|ZP_06392375.1|  DNA gyrase, B subunit [Dethiosulfovibrio p...   285    4e-75 
ref|YP_219906.1|  DNA gyrase subunit B [Chlamydophila abortus ...   285    4e-75 
gb|AAZ67927.1|  DNA gyrase subunit B [Psychrobacter frigidicola]    285    4e-75 
ref|ZP_04763750.1|  DNA gyrase, B subunit [Acidovorax delafiel...   285    5e-75 
ref|ZP_03539351.1|  DNA gyrase, B subunit [Borrelia garinii PB...   285    5e-75 
ref|ZP_03539980.1|  DNA gyrase, B subunit [Borrelia garinii Fa...   285    5e-75 
ref|ZP_05623062.1|  DNA gyrase, B subunit [Treponema vincentii...   284    6e-75 
ref|YP_001916194.1|  DNA gyrase subunit B [Natranaerobius ther...   284    6e-75 
ref|YP_001465928.1|  DNA gyrase subunit B [Campylobacter conci...   284    6e-75 
ref|ZP_02093811.1|  hypothetical protein PEPMIC_00566 [Parvimo...   284    6e-75 
dbj|BAB87031.1|  DNA gyrase subunit B [Arhodomonas aquaeolei]       284    7e-75 
ref|NP_387887.1|  DNA gyrase subunit B [Bacillus subtilis subs...   284    7e-75 
ref|ZP_01733001.1|  DNA gyrase, B subunit [Flavobacteria bacte...   284    7e-75 
ref|YP_709881.1|  DNA gyrase, subunit B [Borrelia afzelii PKo]...   284    7e-75 
ref|YP_678024.1|  DNA gyrase subunit B [Cytophaga hutchinsonii...   284    7e-75 
ref|ZP_02326645.1|  DNA gyrase subunit B [Paenibacillus larvae...   284    7e-75 
ref|YP_003151781.1|  DNA gyrase, B subunit [Anaerococcus prevo...   284    8e-75 
ref|YP_072878.1|  DNA gyrase, subunit B [Borrelia garinii PBi]...   284    8e-75 
ref|ZP_05473309.1|  DNA gyrase, B subunit [Anaerococcus vagina...   284    8e-75 
ref|ZP_00373051.1|  DNA gyrase, B subunit [Wolbachia endosymbi...   284    8e-75 
ref|NP_905814.1|  DNA gyrase, B subunit [Porphyromonas gingiva...   284    8e-75 
ref|YP_003165307.1|  DNA gyrase, B subunit [Candidatus Accumul...   284    9e-75 
ref|YP_931508.1|  DNA gyrase subunit B [Azoarcus sp. BH72] >em...   284    9e-75 
ref|ZP_03013333.1|  hypothetical protein BACINT_00891 [Bactero...   284    9e-75 
ref|YP_994814.1|  DNA gyrase, B subunit [Verminephrobacter eis...   284    1e-74 
ref|ZP_03435490.1|  DNA gyrase, B subunit [Borrelia afzelii AC...   283    1e-74 
ref|YP_002049097.1|  DNA topoisomerase IV subunit B [Paulinell...   283    1e-74 
gb|AAZ67930.1|  DNA gyrase subunit B [Psychrobacter okhotskensis]   283    1e-74 
ref|ZP_05758836.1|  DNA gyrase subunit B [Bacteroides sp. D2]       283    1e-74 
ref|ZP_02064913.1|  hypothetical protein BACOVA_01884 [Bactero...   283    1e-74 
ref|ZP_03305512.1|  hypothetical protein ANHYDRO_01954 [Anaero...   283    1e-74 
ref|ZP_05416642.1|  DNA gyrase, B subunit [Bacteroides finegol...   283    2e-74 
ref|ZP_03677162.1|  hypothetical protein BACCELL_01499 [Bacter...   283    2e-74 
ref|YP_589087.1|  DNA gyrase subunit B [Candidatus Koribacter ...   283    2e-74 
gb|AAZ67938.1|  DNA gyrase subunit B [Psychrobacter arcticus]       283    2e-74 
ref|ZP_03675377.1|  DNA gyrase, B subunit [Borrelia spielmanii...   283    2e-74 
ref|YP_001938816.1|  DNA gyrase subunit B [Methylacidiphilum i...   283    2e-74 
ref|YP_516238.1|  DNA gyrase subunit B [Desulfitobacterium haf...   282    2e-74 
ref|YP_009228.1|  DNA gyrase, B subunit [Desulfovibrio vulgari...   282    2e-74 
ref|ZP_01913638.1|  DNA gyrase, B subunit [Limnobacter sp. MED...   282    3e-74 
ref|ZP_06265249.1|  DNA gyrase, B subunit [Pyramidobacter pisc...   282    3e-74 
ref|ZP_05496905.1|  DNA gyrase, B subunit [Clostridium papyros...   282    3e-74 
ref|ZP_01059741.1|  DNA gyrase subunit B [Leeuwenhoekiella bla...   282    3e-74 
ref|YP_003179037.1|  DNA gyrase, B subunit [Atopobium parvulum...   282    3e-74 
ref|ZP_03608802.1|  DNA gyrase, B subunit [Campylobacter rectu...   282    3e-74 
ref|ZP_01961842.1|  hypothetical protein BACCAC_03484 [Bactero...   282    3e-74 
ref|NP_296839.1|  DNA gyrase subunit B [Chlamydia muridarum Ni...   282    3e-74 
ref|YP_515419.1|  DNA gyrase subunit B [Chlamydophila felis Fe...   282    4e-74 
ref|YP_001955949.1|  DNA gyrase subunit B [uncultured Termite ...   282    4e-74 
gb|ABE73747.1|  DNA gyrase subunit B [Azoarcus communis]            282    4e-74 
ref|ZP_01202122.1|  DNA  gyrase subunit B [Flavobacteria bacte...   281    4e-74 
ref|YP_565157.1|  DNA gyrase subunit B [Methanococcoides burto...   281    4e-74 
ref|ZP_04547146.1|  subunit B [Bacteroides sp. D1] >ref|ZP_045...   281    4e-74 
gb|ACZ33250.1|  DNA gyrase, B subunit [Chlamydophila pneumonia...   281    4e-74 
ref|ZP_05044281.1|  DNA gyrase, B subunit [Cyanobium sp. PCC 7...   281    4e-74 
ref|NP_812341.1|  DNA gyrase subunit B [Bacteroides thetaiotao...   281    4e-74 
ref|ZP_05282223.1|  DNA gyrase subunit B [Bacteroides fragilis...   281    5e-74 
ref|YP_001688947.1|  DNA topoisomerase (ATP-hydrolyzing) subun...   281    5e-74 
ref|YP_003091146.1|  DNA gyrase, B subunit [Pedobacter heparin...   281    5e-74 
dbj|BAA78440.1|  subunit B protein of DNA gyrase [bacterium rM1]    281    5e-74 
ref|ZP_05364737.1|  DNA gyrase, B subunit [Campylobacter showa...   281    5e-74 
ref|YP_794978.1|  DNA topoisomerase IV subunit B [Lactobacillu...   281    6e-74 
ref|YP_001015908.1|  DNA gyrase subunit B [Prochlorococcus mar...   281    6e-74 
ref|YP_446507.1|  DNA gyrase, B subunit [Salinibacter ruber DS...   281    6e-74 
ref|YP_003120102.1|  DNA gyrase, B subunit [Chitinophaga pinen...   281    8e-74 
ref|YP_327395.1|  DNA topoisomerase II subunit B (DNA gyrase) ...   281    8e-74 
gb|AAF36388.1|AF221694_1  GyrB [Yersinia pestis]                    281    8e-74 
gb|AAN87404.1|  DNA gyrase subunit B [Heliobacillus mobilis]        280    9e-74 
ref|YP_008074.1|  DNA gyrase subunit B [Candidatus Protochlamy...   280    9e-74 
ref|YP_292406.1|  DNA gyrase subunit B [Prochlorococcus marinu...   280    9e-74 
ref|ZP_05427708.1|  DNA gyrase, B subunit [Eubacterium saphenu...   280    1e-73 
ref|YP_002760325.1|  DNA gyrase subunit B [Gemmatimonas aurant...   280    1e-73 
ref|ZP_04569042.1|  DNA gyrase subunit B [Fusobacterium sp. 2_...   280    1e-73 
ref|ZP_02072434.1|  hypothetical protein BACUNI_03882 [Bactero...   280    1e-73 
ref|ZP_04055124.1|  DNA gyrase, B subunit [Porphyromonas uenon...   280    1e-73 
ref|YP_002601289.1|  GyrB [Desulfobacterium autotrophicum HRM2...   280    1e-73 
ref|YP_002308700.1|  DNA gyrase subunit B [Candidatus Azobacte...   280    1e-73 
ref|ZP_02436274.1|  hypothetical protein BACSTE_02530 [Bactero...   280    1e-73 
ref|YP_001419685.1|  DNA gyrase subunit B [Bacillus amylolique...   280    1e-73 
dbj|BAA78461.1|  subunit B protein of DNA gyrase [bacterium rA9]    280    1e-73 
ref|YP_002478603.1|  DNA gyrase, B subunit [Desulfovibrio desu...   280    1e-73 
ref|ZP_01079099.1|  DNA gyrase, B subunit [Synechococcus sp. R...   280    1e-73 
ref|YP_799525.1|  DNA gyrase subunit B [Leptospira borgpeterse...   280    1e-73 
ref|YP_001012137.1|  DNA gyrase subunit B [Prochlorococcus mar...   280    1e-73 
gb|AAA58940.1|  DNA gyrase b subunit [Borrelia burgdorferi]         280    1e-73 
ref|ZP_06003334.1|  DNA gyrase, B subunit [Selenomonas noxia A...   280    2e-73 
ref|NP_224480.1|  DNA gyrase subunit B [Chlamydophila pneumoni...   280    2e-73 
ref|YP_796580.1|  DNA gyrase subunit B [Leptospira borgpeterse...   280    2e-73 
ref|ZP_00372145.1|  DNA gyrase, B subunit [Campylobacter upsal...   279    2e-73 
ref|NP_441040.1|  DNA gyrase B subunit [Synechocystis sp. PCC ...   279    2e-73 
ref|YP_097580.1|  DNA gyrase B subunit [Bacteroides fragilis Y...   279    2e-73 
ref|YP_002755762.1|  DNA gyrase, B subunit [Acidobacterium cap...   279    2e-73 
ref|ZP_05649345.1|  topoisomerase IV B subunit [Enterococcus g...   279    2e-73 
dbj|BAA84773.1|  DNA gyrase B subunit [Bacteroides fragilis]        279    3e-73 
ref|ZP_01084512.1|  DNA topoisomerase IV subunit B [Synechococ...   279    3e-73 
ref|ZP_03568305.1|  DNA gyrase, B subunit [Atopobium rimae ATC...   279    3e-73 
ref|ZP_03011720.1|  hypothetical protein BACCOP_03637 [Bactero...   278    3e-73 
ref|YP_001659837.1|  DNA gyrase subunit B [Microcystis aerugin...   278    3e-73 
emb|CAO87426.1|  unnamed protein product [Microcystis aerugino...   278    3e-73 
ref|ZP_01885012.1|  DNA topoisomerase (ATP-hydrolyzing), subun...   278    3e-73 
ref|NP_876187.1|  DNA gyrase subunit B [Prochlorococcus marinu...   278    3e-73 
ref|YP_003008773.1|  DNA gyrase, B subunit [Paenibacillus sp. ...   278    4e-73 
ref|YP_001111383.1|  DNA gyrase, B subunit [Desulfotomaculum r...   278    4e-73 
ref|YP_001124137.1|  DNA gyrase subunit B [Geobacillus thermod...   278    4e-73 
ref|YP_002504374.1|  DNA gyrase, B subunit [Clostridium cellul...   278    4e-73 
ref|YP_003397733.1|  DNA gyrase, B subunit [Acidaminococcus fe...   278    4e-73 
ref|YP_002353702.1|  DNA gyrase, B subunit [Thauera sp. MZ1T] ...   278    4e-73 
ref|ZP_03148594.1|  DNA gyrase, B subunit [Geobacillus sp. G11...   278    4e-73 
ref|YP_729329.1|  DNA gyrase subunit B [Synechococcus sp. CC93...   278    4e-73 
ref|ZP_04809384.1|  DNA gyrase subunit B [Helicobacter pulloru...   278    5e-73 
ref|YP_001226348.1|  DNA gyrase subunit B [Synechococcus sp. R...   278    6e-73 
ref|ZP_05382404.1|  DNA gyrase subunit B [Chlamydia trachomati...   278    6e-73 
gb|ACJ37010.1|  DNA gyrase subunit B [Xylella fastidiosa]           278    6e-73 
ref|ZP_05647470.1|  topoisomerase IV B subunit [Enterococcus c...   278    6e-73 
ref|ZP_05380554.1|  DNA gyrase subunit B [Chlamydia trachomati...   278    6e-73 
ref|ZP_01544922.1|  DNA gyrase, B subunit [Oenococcus oeni ATC...   278    7e-73 
ref|ZP_03849976.1|  DNA topoisomerase (ATP-hydrolyzing) [Chrys...   277    7e-73 
ref|ZP_05656362.1|  topoisomerase IV B subunit [Enterococcus c...   277    7e-73 
ref|ZP_05618285.1|  DNA gyrase subunit B [Fusobacterium sp. 3_...   277    8e-73 
ref|ZP_02088792.1|  hypothetical protein CLOBOL_06348 [Clostri...   277    8e-73 
dbj|BAA78453.1|  subunit B protein of DNA gyrase [bacterium rM16]   277    8e-73 
gb|ABB46483.1|  DNA gyrase subunit B [Acholeplasma laidlawii]       277    9e-73 
gb|AAC33551.1|  gyrase subunit B [Chlamydia trachomatis]            277    1e-72 
ref|ZP_02180561.1|  DNA gyrase subunit B [Flavobacteriales bac...   277    1e-72 
ref|YP_158625.1|  DNA gyrase subunit B [Aromatoleum aromaticum...   277    1e-72 
ref|NP_346653.1|  DNA gyrase subunit B [Clostridium acetobutyl...   277    1e-72 
ref|NP_785393.1|  DNA topoisomerase IV subunit B [Lactobacillu...   277    1e-72 
ref|YP_001654518.1|  DNA gyrase subunit B [Chlamydia trachomat...   277    1e-72 
gb|AAB41130.1|  DNA gyrase subunit B [Clostridium acetobutylic...   277    1e-72 
ref|YP_002887808.1|  DNA gyrase subunit B [Chlamydia trachomat...   276    1e-72 
ref|YP_003096010.1|  DNA gyrase subunit B [Flavobacteriaceae b...   276    1e-72 
ref|ZP_03545850.1|  DNA gyrase, B subunit [Comamonas testoster...   276    1e-72 
ref|ZP_05626244.1|  DNA gyrase, B subunit [Campylobacter graci...   276    1e-72 
ref|ZP_03460644.1|  hypothetical protein BACEGG_03461 [Bactero...   276    1e-72 
ref|YP_003089351.1|  DNA gyrase, B subunit [Dyadobacter fermen...   276    1e-72 
ref|ZP_05552130.1|  DNA gyrase, B subunit [Fusobacterium sp. 3...   276    1e-72 
ref|YP_003141560.1|  DNA gyrase, B subunit [Capnocytophaga och...   276    1e-72 
ref|NP_219694.1|  DNA gyrase subunit B [Chlamydia trachomatis ...   276    1e-72 
ref|ZP_06371193.1|  DNA gyrase, B subunit [Campylobacter jejun...   276    1e-72 
ref|YP_327998.1|  DNA gyrase subunit B [Chlamydia trachomatis ...   276    1e-72 
ref|ZP_03294149.1|  hypothetical protein CLOHIR_02101 [Clostri...   276    1e-72 
ref|ZP_05626872.1|  DNA gyrase subunit B [Fusobacterium sp. D12]    276    1e-72 
ref|ZP_04571493.1|  DNA gyrase subunit B [Fusobacterium sp. 4_...   276    2e-72 
ref|ZP_04000627.1|  DNA gyrase subunit B [Halogeometricum bori...   276    2e-72 

ALIGNMENTS
>ref|ZP_05090405.1| DNA gyrase, B subunit [Ruegeria sp. R11]
 gb|EEB72097.1| DNA gyrase, B subunit [Ruegeria sp. R11]
Length=805

 Score =  416 bits (1068),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 188/279 (67%), Positives = 231/279 (82%), Gaps = 0/279 (0%)

Query  1    KVLKGLEAVKKRPGMYIGDTDDGSGLHHMVYEVVDNCVDEALAGHCSEITVSLFDGSLVT  60
            KVLKGLEAV+KRPGMYIGDTDDGSGLHHMVYEVVDN +DEALAGH   + V +   S V+
Sbjct  17   KVLKGLEAVRKRPGMYIGDTDDGSGLHHMVYEVVDNGIDEALAGHADRVVVKIHADSSVS  76

Query  61   VRDNGRGIPTDIHPGEGISAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSEYL  120
            V DNGRGIP DIHP EG+SAAEVIMTQLHAGGKFD NSYKVSGGLHGVGVSVVNALS++L
Sbjct  77   VSDNGRGIPVDIHPEEGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDWL  136

Query  121  KLTIWRDGKEHCATFKNGNTEQSLEIIGNSNSLTGTEITFQPSTDIFTNINFNFKTLESR  180
            +L IWR+GKEH A F+ G+T + L ++G+    TGTE+ F  STD F+N+ ++F+TLE R
Sbjct  137  ELRIWRNGKEHVARFERGDTAKHLTVVGDCGDQTGTEVRFLASTDTFSNLEYSFETLEKR  196

Query  181  LRELAFLNAGLKIKLTDNRNDQSKTIDMFYEGGVSEFVKFIDKSRTPLMNKPIFISGIKD  240
            LRELAFLN+G++I L D R  +  T ++FYEGGV EFVK++D+S+TP+M+ P++I+G KD
Sbjct  197  LRELAFLNSGVRIILEDERPAEKLTAELFYEGGVKEFVKYLDRSKTPVMDAPVYITGEKD  256

Query  241  NIQIDTALWWNDGYNENVFPFTNNIPQRDGGTHLAGLRG  279
            +I ++ A+WWND Y+E V PFTNNIPQRDGGTH+AG RG
Sbjct  257  DIGVEVAMWWNDSYHETVLPFTNNIPQRDGGTHVAGFRG  295


>ref|ZP_01754327.1| DNA gyrase subunit B [Roseobacter sp. SK209-2-6]
 gb|EBA17127.1| DNA gyrase subunit B [Roseobacter sp. SK209-2-6]
Length=805

 Score =  414 bits (1063),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 188/279 (67%), Positives = 230/279 (82%), Gaps = 0/279 (0%)

Query  1    KVLKGLEAVKKRPGMYIGDTDDGSGLHHMVYEVVDNCVDEALAGHCSEITVSLFDGSLVT  60
            KVLKGLEAV+KRPGMYIGDTDDGSGLHHMVYEVVDN +DEALAGH   +TV +   S V+
Sbjct  17   KVLKGLEAVRKRPGMYIGDTDDGSGLHHMVYEVVDNGIDEALAGHADHVTVKIHADSSVS  76

Query  61   VRDNGRGIPTDIHPGEGISAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSEYL  120
            V DNGRGIP DIHP EG+SAAEVIMTQLHAGGKFD NSYKVSGGLHGVGVSVVNALS++L
Sbjct  77   VGDNGRGIPVDIHPEEGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDWL  136

Query  121  KLTIWRDGKEHCATFKNGNTEQSLEIIGNSNSLTGTEITFQPSTDIFTNINFNFKTLESR  180
            +L IWR+GKEH A F+ G+T + LE++G+    TGTE+ F  STD F+N+ ++F+TLE R
Sbjct  137  ELRIWRNGKEHVARFERGDTAKHLEVVGDCGDRTGTEVRFMASTDTFSNLEYSFETLEKR  196

Query  181  LRELAFLNAGLKIKLTDNRNDQSKTIDMFYEGGVSEFVKFIDKSRTPLMNKPIFISGIKD  240
            LRELAFLN+G++I L D R  +  T ++FY+GGV EFVK++D+ +TP+M  P++I G KD
Sbjct  197  LRELAFLNSGVRIILEDERPAEKLTAELFYDGGVKEFVKYLDRHKTPVMEAPVYIVGEKD  256

Query  241  NIQIDTALWWNDGYNENVFPFTNNIPQRDGGTHLAGLRG  279
            +I ++ A+WWND Y+E V PFTNNIPQRDGGTH+AG RG
Sbjct  257  DIGVEIAMWWNDSYHETVLPFTNNIPQRDGGTHVAGFRG  295


>ref|ZP_05741527.1| DNA gyrase, B subunit [Silicibacter sp. TrichCH4B]
 gb|EEW58328.1| DNA gyrase, B subunit [Silicibacter sp. TrichCH4B]
Length=805

 Score =  412 bits (1059),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 189/279 (67%), Positives = 232/279 (83%), Gaps = 0/279 (0%)

Query  1    KVLKGLEAVKKRPGMYIGDTDDGSGLHHMVYEVVDNCVDEALAGHCSEITVSLFDGSLVT  60
            KVLKGLEAV+KRPGMYIGDTDDGSGLHHMVYEVVDN +DEALAGH   +TV++   S V+
Sbjct  17   KVLKGLEAVRKRPGMYIGDTDDGSGLHHMVYEVVDNGIDEALAGHADRVTVTIHADSSVS  76

Query  61   VRDNGRGIPTDIHPGEGISAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSEYL  120
            V DNGRGIP DIH  EG+SAAEVIMTQLHAGGKFD NSYKVSGGLHGVGVSVVNALS++L
Sbjct  77   VSDNGRGIPVDIHAEEGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDWL  136

Query  121  KLTIWRDGKEHCATFKNGNTEQSLEIIGNSNSLTGTEITFQPSTDIFTNINFNFKTLESR  180
            +L IWR+GKEH A F+ G+T + L ++G+    TGTE+ F  STD F+N+ ++F+TLE R
Sbjct  137  ELRIWRNGKEHVARFERGDTVKHLAVVGDCGDRTGTEVRFLASTDTFSNLEYSFETLEKR  196

Query  181  LRELAFLNAGLKIKLTDNRNDQSKTIDMFYEGGVSEFVKFIDKSRTPLMNKPIFISGIKD  240
            LRELAFLN+G++I +TD R  +    ++FYEGGV+EFVK++D+S+TP+M+ PI+I G KD
Sbjct  197  LRELAFLNSGVRIVVTDERPAERLESELFYEGGVNEFVKYLDRSKTPVMDAPIYIKGEKD  256

Query  241  NIQIDTALWWNDGYNENVFPFTNNIPQRDGGTHLAGLRG  279
            +I I+ A+WWND Y+E V PFTNNIPQRDGGTH+AG RG
Sbjct  257  DIGIEIAMWWNDSYHETVLPFTNNIPQRDGGTHVAGFRG  295


>ref|YP_507946.1| DNA gyrase subunit B [Jannaschia sp. CCS1]
 gb|ABD52921.1| DNA gyrase subunit B [Jannaschia sp. CCS1]
Length=805

 Score =  411 bits (1056),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 191/279 (68%), Positives = 229/279 (82%), Gaps = 0/279 (0%)

Query  1    KVLKGLEAVKKRPGMYIGDTDDGSGLHHMVYEVVDNCVDEALAGHCSEITVSLFDGSLVT  60
            KVLKGLEAV+KRPGMYIGDTDDGSGLHHMVYEVVDN +DEALAGH   +TV+L   S V+
Sbjct  17   KVLKGLEAVRKRPGMYIGDTDDGSGLHHMVYEVVDNGIDEALAGHADAVTVTLHADSSVS  76

Query  61   VRDNGRGIPTDIHPGEGISAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSEYL  120
            V DNGRGIP  IH  EG+SAAEVIMTQLHAGGKFD NSYKVSGGLHGVGVSVVNALS++L
Sbjct  77   VSDNGRGIPVGIHEEEGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDWL  136

Query  121  KLTIWRDGKEHCATFKNGNTEQSLEIIGNSNSLTGTEITFQPSTDIFTNINFNFKTLESR  180
            +L IWRDGKEH A F+ G T + LE++      TGTE+ F  ST+ F+N+++ FKTLE+R
Sbjct  137  ELRIWRDGKEHIARFEGGFTTKPLEVVSECGDRTGTEVRFMASTETFSNLDYVFKTLENR  196

Query  181  LRELAFLNAGLKIKLTDNRNDQSKTIDMFYEGGVSEFVKFIDKSRTPLMNKPIFISGIKD  240
            LRELAFLN+G++I L D R  ++   D+FYEGGV EFV+++D+S+T  M +PIFI+G KD
Sbjct  197  LRELAFLNSGVRIILRDERPAEALESDLFYEGGVREFVRYLDRSKTSAMEEPIFITGEKD  256

Query  241  NIQIDTALWWNDGYNENVFPFTNNIPQRDGGTHLAGLRG  279
            +I ++ A+WWND Y+ENV PFTNNIPQRDGGTHLAG RG
Sbjct  257  DIGVEVAMWWNDSYHENVLPFTNNIPQRDGGTHLAGFRG  295


>ref|ZP_01012416.1| DNA gyrase subunit B [Rhodobacterales bacterium HTCC2654]
 gb|EAQ13963.1| DNA gyrase subunit B [Rhodobacterales bacterium HTCC2654]
Length=805

 Score =  410 bits (1054),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 188/279 (67%), Positives = 230/279 (82%), Gaps = 0/279 (0%)

Query  1    KVLKGLEAVKKRPGMYIGDTDDGSGLHHMVYEVVDNCVDEALAGHCSEITVSLFDGSLVT  60
            KVLKGLEAV+KRPGMYIGDTDDGSGLHHMVYEVVDN +DEALAGH   +TV++   S V+
Sbjct  17   KVLKGLEAVRKRPGMYIGDTDDGSGLHHMVYEVVDNGIDEALAGHADYVTVTVHADSSVS  76

Query  61   VRDNGRGIPTDIHPGEGISAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSEYL  120
            V DNGRGIP  +H  EG+SAAEVIMTQLHAGGKFD NSYKVSGGLHGVGVSVVNALS++L
Sbjct  77   VYDNGRGIPVGMHAEEGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDWL  136

Query  121  KLTIWRDGKEHCATFKNGNTEQSLEIIGNSNSLTGTEITFQPSTDIFTNINFNFKTLESR  180
            +L IWRDGKEH A F+ G+T + LE++G++N  TGTE+ F  STD F+N+ ++FKTLE+R
Sbjct  137  ELRIWRDGKEHIARFERGDTAKHLEVVGDANGKTGTEVRFLASTDTFSNLEYSFKTLETR  196

Query  181  LRELAFLNAGLKIKLTDNRNDQSKTIDMFYEGGVSEFVKFIDKSRTPLMNKPIFISGIKD  240
            LRELAFLN+G++I L D R  +    ++ YEGGV EFVK++D+ + P++ +PIFI+G +D
Sbjct  197  LRELAFLNSGVRIILKDERPAEPLETELHYEGGVKEFVKYLDRHKQPMIEEPIFITGERD  256

Query  241  NIQIDTALWWNDGYNENVFPFTNNIPQRDGGTHLAGLRG  279
             I I+ A+WWND YNE V PFTNNIPQRDGGTH+AG RG
Sbjct  257  GIGIEVAMWWNDSYNEMVLPFTNNIPQRDGGTHMAGFRG  295


>ref|YP_612002.1| DNA gyrase subunit B [Ruegeria sp. TM1040]
 gb|ABF62740.1| DNA gyrase subunit B [Ruegeria sp. TM1040]
Length=805

 Score =  410 bits (1054),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 187/279 (67%), Positives = 231/279 (82%), Gaps = 0/279 (0%)

Query  1    KVLKGLEAVKKRPGMYIGDTDDGSGLHHMVYEVVDNCVDEALAGHCSEITVSLFDGSLVT  60
            KVLKGLEAV+KRPGMYIGDTDDGSGLHHMVYEVVDN +DEALAGH   +TV++   S V+
Sbjct  17   KVLKGLEAVRKRPGMYIGDTDDGSGLHHMVYEVVDNGIDEALAGHADRVTVTIHADSSVS  76

Query  61   VRDNGRGIPTDIHPGEGISAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSEYL  120
            V DNGRGIP DIH  EG+SAAEVIMTQLHAGGKFD NSYKVSGGLHGVGVSVVNALS++L
Sbjct  77   VSDNGRGIPVDIHAEEGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDWL  136

Query  121  KLTIWRDGKEHCATFKNGNTEQSLEIIGNSNSLTGTEITFQPSTDIFTNINFNFKTLESR  180
            +L IWR+GKEH A F+ G+T + L ++G+    TGTE+ F  STD F+N+ ++F+TLE R
Sbjct  137  ELRIWRNGKEHVARFERGDTVKHLTVVGDCGDRTGTEVRFLASTDTFSNLEYSFETLEKR  196

Query  181  LRELAFLNAGLKIKLTDNRNDQSKTIDMFYEGGVSEFVKFIDKSRTPLMNKPIFISGIKD  240
            LRELAFLN+G++I + D R  +    ++FYEGGV+EFVK++D+S+TP+M+ PI+I G KD
Sbjct  197  LRELAFLNSGVRIVVADERPAERLESELFYEGGVNEFVKYLDRSKTPVMDAPIYIKGEKD  256

Query  241  NIQIDTALWWNDGYNENVFPFTNNIPQRDGGTHLAGLRG  279
            +I ++ A+WWND Y+E V PFTNNIPQRDGGTH+AG RG
Sbjct  257  DIGVEIAMWWNDSYHETVLPFTNNIPQRDGGTHVAGFRG  295


>ref|ZP_01881255.1| DNA gyrase subunit B [Roseovarius sp. TM1035]
 gb|EDM30220.1| DNA gyrase subunit B [Roseovarius sp. TM1035]
Length=805

 Score =  410 bits (1053),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 190/279 (68%), Positives = 229/279 (82%), Gaps = 0/279 (0%)

Query  1    KVLKGLEAVKKRPGMYIGDTDDGSGLHHMVYEVVDNCVDEALAGHCSEITVSLFDGSLVT  60
            KVLKGLEAV+KRPGMYIGDTDDGSGLHHMVYEVVDN +DEALAGH   + V++   S V+
Sbjct  17   KVLKGLEAVRKRPGMYIGDTDDGSGLHHMVYEVVDNGIDEALAGHADAVNVTIHADSSVS  76

Query  61   VRDNGRGIPTDIHPGEGISAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSEYL  120
            V DNGRGIP DIH GEG+SAAEVIMTQLHAGGKFD NSYKVSGGLHGVGVSVVNALSE+L
Sbjct  77   VSDNGRGIPVDIHEGEGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSEWL  136

Query  121  KLTIWRDGKEHCATFKNGNTEQSLEIIGNSNSLTGTEITFQPSTDIFTNINFNFKTLESR  180
            +L IWR+GKEH A F+ G T +SL ++G++N   GTE+ F  ST+ F+N+ + F+TLE R
Sbjct  137  ELRIWRNGKEHYARFEGGFTVESLRVVGDANGRKGTEVRFLASTETFSNLEYIFETLEKR  196

Query  181  LRELAFLNAGLKIKLTDNRNDQSKTIDMFYEGGVSEFVKFIDKSRTPLMNKPIFISGIKD  240
            LRELAFLN+G++I LTD R  +    ++FYEGGV EFVK++D+ ++P M  PIFI+G +D
Sbjct  197  LRELAFLNSGVRIILTDERPTEPLRSELFYEGGVKEFVKYLDRHKSPAMPDPIFITGERD  256

Query  241  NIQIDTALWWNDGYNENVFPFTNNIPQRDGGTHLAGLRG  279
            +I I+ A+WWND Y+E V PFTNNIPQRDGGTHLAG RG
Sbjct  257  DIGIEVAMWWNDSYHETVLPFTNNIPQRDGGTHLAGFRG  295


>ref|ZP_05785664.1| DNA gyrase, B subunit [Silicibacter lacuscaerulensis ITI-1157]
 gb|EEX08780.1| DNA gyrase, B subunit [Silicibacter lacuscaerulensis ITI-1157]
Length=805

 Score =  409 bits (1052),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 187/279 (67%), Positives = 227/279 (81%), Gaps = 0/279 (0%)

Query  1    KVLKGLEAVKKRPGMYIGDTDDGSGLHHMVYEVVDNCVDEALAGHCSEITVSLFDGSLVT  60
            KVLKGLEAV+KRPGMYIGDTDDGSGLHHMVYEVVDN +DEALAGH   +TV +   S V+
Sbjct  17   KVLKGLEAVRKRPGMYIGDTDDGSGLHHMVYEVVDNGIDEALAGHADHVTVKIHADSSVS  76

Query  61   VRDNGRGIPTDIHPGEGISAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSEYL  120
            V DNGRGIP DIHP EG+SAAEVIMTQLHAGGKFD NSYKVSGGLHGVGVSVVNALS++L
Sbjct  77   VSDNGRGIPVDIHPEEGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDWL  136

Query  121  KLTIWRDGKEHCATFKNGNTEQSLEIIGNSNSLTGTEITFQPSTDIFTNINFNFKTLESR  180
            +L IWR+GKEH A F+ G T + L+++G     TGTE+ F  STD F+N+ ++F+TLE R
Sbjct  137  ELRIWRNGKEHFARFERGETVEHLKVVGECGDRTGTEVRFLASTDTFSNLEYSFETLEKR  196

Query  181  LRELAFLNAGLKIKLTDNRNDQSKTIDMFYEGGVSEFVKFIDKSRTPLMNKPIFISGIKD  240
            LRELAFLN+G++I L D R  +    ++FYEGGV EFVK++D+S+TP M +PI+I G +D
Sbjct  197  LRELAFLNSGVRIILVDERPAERLETELFYEGGVKEFVKYLDRSKTPAMPEPIYIKGERD  256

Query  241  NIQIDTALWWNDGYNENVFPFTNNIPQRDGGTHLAGLRG  279
            +I ++ A+WWND Y+E V PFTNNIPQRDGGTH+AG R 
Sbjct  257  DIGVEIAMWWNDSYHETVLPFTNNIPQRDGGTHVAGFRA  295


>ref|ZP_05078934.1| DNA gyrase, B subunit [Rhodobacterales bacterium Y4I]
 gb|EDZ46913.1| DNA gyrase, B subunit [Rhodobacterales bacterium Y4I]
Length=805

 Score =  409 bits (1051),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 187/279 (67%), Positives = 228/279 (81%), Gaps = 0/279 (0%)

Query  1    KVLKGLEAVKKRPGMYIGDTDDGSGLHHMVYEVVDNCVDEALAGHCSEITVSLFDGSLVT  60
            KVLKGLEAV+KRPGMYIGDTDDGSGLHHMVYEVVDN +DEALAGH   +TV +   S V+
Sbjct  17   KVLKGLEAVRKRPGMYIGDTDDGSGLHHMVYEVVDNGIDEALAGHADHVTVKIHADSSVS  76

Query  61   VRDNGRGIPTDIHPGEGISAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSEYL  120
            V DNGRGIP  IH  EG+SAAEVIMTQLHAGGKFD NSYKVSGGLHGVGVSVVNALS++L
Sbjct  77   VSDNGRGIPVGIHEEEGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDWL  136

Query  121  KLTIWRDGKEHCATFKNGNTEQSLEIIGNSNSLTGTEITFQPSTDIFTNINFNFKTLESR  180
            +L IWRDGKEH A F+ G+T + LE++G+    TGTE+ F  STD F+N+ ++F+TLE R
Sbjct  137  ELRIWRDGKEHIARFERGDTVKHLEVVGDCGDRTGTEVRFMASTDTFSNLEYSFETLEKR  196

Query  181  LRELAFLNAGLKIKLTDNRNDQSKTIDMFYEGGVSEFVKFIDKSRTPLMNKPIFISGIKD  240
            LRELAFLN+G++I L D R  +  T +++YEGGV EFVK++D+ +TP+M+ P++I G KD
Sbjct  197  LRELAFLNSGVRIILEDERPAEKITAELYYEGGVREFVKYLDRHKTPVMDAPVYIVGEKD  256

Query  241  NIQIDTALWWNDGYNENVFPFTNNIPQRDGGTHLAGLRG  279
             I ++ A+WWND Y+E V PFTNNIPQRDGGTH+AG RG
Sbjct  257  YIGVEIAMWWNDSYHETVLPFTNNIPQRDGGTHVAGFRG  295


>ref|ZP_01057982.1| DNA gyrase subunit B [Roseobacter sp. MED193]
 gb|EAQ44122.1| DNA gyrase subunit B [Roseobacter sp. MED193]
Length=805

 Score =  409 bits (1050),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 186/279 (66%), Positives = 230/279 (82%), Gaps = 0/279 (0%)

Query  1    KVLKGLEAVKKRPGMYIGDTDDGSGLHHMVYEVVDNCVDEALAGHCSEITVSLFDGSLVT  60
            KVLKGLEAV+KRPGMYIGDTDDGSGLHHMVYEVVDN +DEALA H   + V++   S V+
Sbjct  17   KVLKGLEAVRKRPGMYIGDTDDGSGLHHMVYEVVDNGIDEALAKHADHVRVTIHADSSVS  76

Query  61   VRDNGRGIPTDIHPGEGISAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSEYL  120
            V DNGRGIP  IH  EG+SAAEVIMTQLHAGGKFD NSYKVSGGLHGVGVSVVNALS++L
Sbjct  77   VYDNGRGIPVGIHEEEGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDWL  136

Query  121  KLTIWRDGKEHCATFKNGNTEQSLEIIGNSNSLTGTEITFQPSTDIFTNINFNFKTLESR  180
            +L IWR+GKEH A F+ G+T + L+++G+    TGTE+ F  STD F+N+ ++F+TLE R
Sbjct  137  ELRIWREGKEHVARFERGDTAEHLKVVGDCGDQTGTEVRFMASTDTFSNLEYSFETLEKR  196

Query  181  LRELAFLNAGLKIKLTDNRNDQSKTIDMFYEGGVSEFVKFIDKSRTPLMNKPIFISGIKD  240
            LRELAFLN+G+KI L D R  +    ++FYEGGV EFVK++D+S+TP+M+ P++I+G KD
Sbjct  197  LRELAFLNSGVKIILADERPAERLESELFYEGGVKEFVKYLDRSKTPVMDSPVYITGEKD  256

Query  241  NIQIDTALWWNDGYNENVFPFTNNIPQRDGGTHLAGLRG  279
            +I ++ A+WWND Y+E+V PFTNNIPQRDGGTHLAG RG
Sbjct  257  DIGVEVAMWWNDSYHESVLPFTNNIPQRDGGTHLAGFRG  295


>ref|ZP_05123806.1| DNA gyrase, B subunit [Rhodobacteraceae bacterium KLH11]
 gb|EEE38438.1| DNA gyrase, B subunit [Rhodobacteraceae bacterium KLH11]
Length=805

 Score =  408 bits (1049),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 187/279 (67%), Positives = 226/279 (81%), Gaps = 0/279 (0%)

Query  1    KVLKGLEAVKKRPGMYIGDTDDGSGLHHMVYEVVDNCVDEALAGHCSEITVSLFDGSLVT  60
            KVLKGLEAV+KRPGMYIGDTDDGSGLHHMVYEVVDN +DEALAGH   +TV +   S V+
Sbjct  17   KVLKGLEAVRKRPGMYIGDTDDGSGLHHMVYEVVDNGIDEALAGHADHVTVKIHADSSVS  76

Query  61   VRDNGRGIPTDIHPGEGISAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSEYL  120
            V DNGRGIP DIHP EG+SAAEVIMTQLHAGGKFD NSYKVSGGLHGVGVSVVNALS++L
Sbjct  77   VSDNGRGIPVDIHPEEGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDWL  136

Query  121  KLTIWRDGKEHCATFKNGNTEQSLEIIGNSNSLTGTEITFQPSTDIFTNINFNFKTLESR  180
            +L IWR+GKEH A F+ G T + L+++G     TGTE+ F  ST+ F+N+ + F TLE R
Sbjct  137  ELRIWRNGKEHVARFEGGETAEHLKVVGECGDRTGTEVRFLASTNTFSNLEYAFDTLEKR  196

Query  181  LRELAFLNAGLKIKLTDNRNDQSKTIDMFYEGGVSEFVKFIDKSRTPLMNKPIFISGIKD  240
            LRELAFLN+G++I L D R  +    ++FYEGGV EFVK++D+S+TP M+ PI+I G +D
Sbjct  197  LRELAFLNSGVRIILIDERPAERLETELFYEGGVKEFVKYLDRSKTPAMSDPIYIKGERD  256

Query  241  NIQIDTALWWNDGYNENVFPFTNNIPQRDGGTHLAGLRG  279
            +I ++ A+WWND Y+E V PFTNNIPQRDGGTH+AG RG
Sbjct  257  DIGVEIAMWWNDSYHETVLPFTNNIPQRDGGTHVAGFRG  295


>ref|YP_001534689.1| DNA gyrase subunit B [Dinoroseobacter shibae DFL 12]
 gb|ABV95088.1| DNA gyrase subunit B [Dinoroseobacter shibae DFL 12]
Length=805

 Score =  408 bits (1049),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 188/279 (67%), Positives = 230/279 (82%), Gaps = 0/279 (0%)

Query  1    KVLKGLEAVKKRPGMYIGDTDDGSGLHHMVYEVVDNCVDEALAGHCSEITVSLFDGSLVT  60
            KVLKGLEAV+KRPGMYIGDTDDGSGLHHMVYEVVDN +DEALAGH   + V +   S V+
Sbjct  17   KVLKGLEAVRKRPGMYIGDTDDGSGLHHMVYEVVDNGIDEALAGHADAVNVKIHADSSVS  76

Query  61   VRDNGRGIPTDIHPGEGISAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSEYL  120
            V DNGRGIP  +H  EG+SAAEVIMTQLHAGGKFD NSYKVSGGLHGVGVSVVNALS++L
Sbjct  77   VSDNGRGIPVGVHEEEGVSAAEVIMTQLHAGGKFDSNSYKVSGGLHGVGVSVVNALSDWL  136

Query  121  KLTIWRDGKEHCATFKNGNTEQSLEIIGNSNSLTGTEITFQPSTDIFTNINFNFKTLESR  180
            +L IWRDGKEH A F++G+T + LE+IG++   TGTE+ F  ST  F+N++++FKTLE+R
Sbjct  137  ELRIWRDGKEHVARFEHGDTVKHLEVIGDAGDRTGTEVRFMASTGTFSNLDYSFKTLENR  196

Query  181  LRELAFLNAGLKIKLTDNRNDQSKTIDMFYEGGVSEFVKFIDKSRTPLMNKPIFISGIKD  240
            LRELAFLN+G++I L D R  +    ++FYEGGV EFV+++D+S+T  M +PIFI+G +D
Sbjct  197  LRELAFLNSGVRIILEDERPAEPLRSELFYEGGVREFVRYLDRSKTSAMEEPIFITGERD  256

Query  241  NIQIDTALWWNDGYNENVFPFTNNIPQRDGGTHLAGLRG  279
            +I I+ A+WWND Y+E V PFTNNIPQRDGGTHLAG RG
Sbjct  257  DIGIEVAMWWNDSYHETVLPFTNNIPQRDGGTHLAGFRG  295