GOS 1511030

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1093025574893
Annotathon code: GOS_1511030
Sample :
  • GPS :8°24'54s; 124°14'23w
  • Tropical South Pacific: 600 miles from F. Polynesia - International
  • Open Ocean (-2m, 27.6°C, 0.1-0.8 microns)
Authors
Team : Algarve
Username : 16011_24171_1
Annotated on : 2010-07-05 20:50:50
  • 16011 AnaCatarinaCordeiroDosSantos
  • 24171 AndreiaCarinaPereiraDaSilva

Synopsis

  • Taxonomy: Proteobacteria (NCBI info)
    Rank: phylum - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 1224
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: - Order:
    Bacteria; Proteobacteria;

Genomic Sequence

>JCVI_READ_1093025574893 GOS_1511030 Genomic DNA
AGGCACCTAAGCTTCTGTAAGCCGCGTTTCGATGAAACGCTGTATCTCGCTAGCTGGCCATCCAACGAGGCCAGGTGAGATTTGTACGCGCTTCAACGCA
CCTTCGTTTGTAAGCTTGTAGAGAGTAGGGCGGCTAATTGAGAGTGCTTGGCAAGCGTCGCGCCAGTTAAGGATTTTTTGCATGTCTGATCCTCTGCAAA
ATCAAGGATCACTTTAGTAGTCTCATATTTTGAAAAAACGCAACGCACATTTGTGCAATTTGAATCAAAAAGAACGACCTCTTATCGTGAGAGACCGCCC
CTTTGATCAGATGGTGGTGGCTATGGTTGACGCTGTGTGGTCATCATAATTATCTAGCTCTTCAGAGCAGAACCAAACCATCTCAAATTTGAATTTATAT
ATAGCTACGCACCGTGCAGCATTTGGACACTCTTATGCTCGATGTTTTCAACCACATAATGCCATTGAACTAGCGCCAAACTTTTGCGCTTGATGTGATA
AGGCCGATCATAAATTCCCGTTACACTGCTGTCTTTATGATTGAGTGCACACTTGACCGAAAAGCGGTCTATTCCCTCGTCAGAAAGCAAAGTGGCAAAA
CTTCGCCTGAAGTCATGAAAGTTCCAGTCAGTCACGCCACTTAATTTTGAGAGGATAGCTTTGATCTGAGAGAAACCAGAGATCGGTCTCGTTCCATCTC
CTGTTGTAAATAAATACGAGCCTTCTTGTTGCGGGTATTTTTCTAAGATCTGGGGCAGCGAGGGAAGAAGCGGGGTTATCAATGTCTCGCCAGATTTGTT
TCTGAGGCCAGGTATTTCCAGACGGTCTTCTTTGACTTCATCCCAGGTAAGCCTGGCGACTTCATTCAAGCGTTGGCCACTCAGTAATAGGAATTCGATC
AAACGGCCCTGCGGGCCACCCATTTGGC

Translation

[3 - 521/928]   indirect strand
>GOS_1511030 Translation [3-521   indirect strand]
QMGGPQGRLIEFLLLSGQRLNEVARLTWDEVKEDRLEIPGLRNKSGETLITPLLPSLPQILEKYPQQEGSYLFTTGDGTRPISGFSQIKAILSKLSGVTD
WNFHDFRRSFATLLSDEGIDRFSVKCALNHKDSSVTGIYDRPYHIKRKSLALVQWHYVVENIEHKSVQMLHGA

[ Warning ] 5' incomplete: does not start with a Methionine

Annotator commentaries

Due to the fact that BLASTp returned lower E-values than BLASTx, 4e-23 for the first hit, all the work was based in the BLASTp results.

According to the ORFind assay, the coding ORF is located on frame 3 of the reverse strand and extends from base 3 to 524. This result is confirmed by BLASTp, which bears prove that the coding ORF is in fact the longest one, composed by 173aa. The homologies found are for possible phage-related integrase, which are proteins that cleave DNA substrates. This result is averred by the InterPro results that show a domain of DNA breaking-rejoining enzymes with an E-value of 6.1e-24, once again, consistent with the fact that the ORF is coding. InterPro also gave results for the molecular function and biological process: DNA binding for the first one, and DNA recombination and DNA integration for the second one. Since there were two hits for the biological process, one chose to put on the respective entry DNA metabolic process, which includes any cellular process involving DNA. As for the taxonomy, despite of the inconclusiveness of the trees plotted at class level, the trees obtained at phylum level were quite accurate, since it was possible to separate into diferent branches the ingroups from the outgroups, with significant bootstrap values of 0.79 for the NeighbourJoining tree and 0.65 for the MaximumLikelihood tree, althought the bootstarp value in the MaximumLikelihood is slightly under 0.7, the trees still seem to indicate that the protein in analysis does, indeed, belong to a proteobacteria.




ORF finding

PROTOCOL


NCBI ORFinder / forward strand / frames 1, 2 § 3 / min 60AA / "any codon" initiation / "standard" genetic code


NCBI ORFinder / reverse strand /frames 1, 2 § 3 / min 60AA / "any codon" initiation / "standard" genetic code


RESULTS ANALYSIS


->1 ORF was found in reading frame 1 on the DIRECT STRAND, it extends from base 670 to base 927.

No mention, by SMS ORFinder, was made to the remaining reading frames 2 and 3.

->4 ORFs were found on the REVERSE STRAND, with the following characteristics:

ORF number 1 in reading frame 2 on the reverse strand extends from base 92 to base 301.

ORF number 2 in reading frame 2 on the reverse strand extends from base 728 to base 922.

ORF number 1 in reading frame 3 on the reverse strand extends from base 3 to base 524.

ORF number 2 in reading frame 3 on the reverse strand extends from base 648 to base 836.

No ORFs were found in reading frame 1.

The longest ORF is on frame 3 of the reverse strand and extends from base 3 to 524.


Having selected the longest ORF and applying BLAStp one obtains statistically significant E-values. BLASTx was applied to the sequence for two reasons:

1st to certify that the ORF chosen has in fact the homology with lower E-values;

2nd to avoid dismissing smaller ORFs that may also be coding;

Both BLASTp and BLASTx returned the same result: homology to possible phage-related integrase (ZP_01004335.1), with an E-value of 4e-23 for BLASTp and 3e-21 for BLASTx. The coding ORF is on frame 3 of the reverse strand, coinciding with the longest ORF. The ORF doesn't seem to contain a START codon, although it seems to present a stop codon.


RAW RESULTS

>DIRECT STRAND
>ORF number 1 in reading frame 1 on the direct strand extends from base 670 to base 927.
GAGAAACCAGAGATCGGTCTCGTTCCATCTCCTGTTGTAAATAAATACGAGCCTTCTTGT
TGCGGGTATTTTTCTAAGATCTGGGGCAGCGAGGGAAGAAGCGGGGTTATCAATGTCTCG
CCAGATTTGTTTCTGAGGCCAGGTATTTCCAGACGGTCTTCTTTGACTTCATCCCAGGTA
AGCCTGGCGACTTCATTCAAGCGTTGGCCACTCAGTAATAGGAATTCGATCAAACGGCCC
TGCGGGCCACCCATTTGG

>Translation of ORF number 1 in reading frame 1 on the direct strand.
EKPEIGLVPSPVVNKYEPSCCGYFSKIWGSEGRSGVINVSPDLFLRPGISRRSSLTSSQV
SLATSFKRWPLSNRNSIKRPCGPPIW




>REVERSE STRAND
No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 92 to base 301.
AGTCAAAGAAGACCGTCTGGAAATACCTGGCCTCAGAAACAAATCTGGCGAGACATTGAT
AACCCCGCTTCTTCCCTCGCTGCCCCAGATCTTAGAAAAATACCCGCAACAAGAAGGCTC
GTATTTATTTACAACAGGAGATGGAACGAGACCGATCTCTGGTTTCTCTCAGATCAAAGC
TATCCTCTCAAAATTAAGTGGCGTGACTGA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
SQRRPSGNTWPQKQIWRDIDNPASSLAAPDLRKIPATRRLVFIYNRRWNETDLWFLSDQS
YPLKIKWRD*

>ORF number 2 in reading frame 2 on the reverse strand extends from base 728 to base 922.
TTTTGCAGAGGATCAGACATGCAAAAAATCCTTAACTGGCGCGACGCTTGCCAAGCACTC
TCAATTAGCCGCCCTACTCTCTACAAGCTTACAAACGAAGGTGCGTTGAAGCGCGTACAA
ATCTCACCTGGCCTCGTTGGATGGCCAGCTAGCGAGATACAGCGTTTCATCGAAACGCGG
CTTACAGAAGCTTAG

>Translation of ORF number 2 in reading frame 2 on the reverse strand.
FCRGSDMQKILNWRDACQALSISRPTLYKLTNEGALKRVQISPGLVGWPASEIQRFIETR
LTEA*

>ORF number 1 in reading frame 3 on the reverse strand extends from base 3 to base 524.
CAAATGGGTGGCCCGCAGGGCCGTTTGATCGAATTCCTATTACTGAGTGGCCAACGCTTG
AATGAAGTCGCCAGGCTTACCTGGGATGAAGTCAAAGAAGACCGTCTGGAAATACCTGGC
CTCAGAAACAAATCTGGCGAGACATTGATAACCCCGCTTCTTCCCTCGCTGCCCCAGATC
TTAGAAAAATACCCGCAACAAGAAGGCTCGTATTTATTTACAACAGGAGATGGAACGAGA
CCGATCTCTGGTTTCTCTCAGATCAAAGCTATCCTCTCAAAATTAAGTGGCGTGACTGAC
TGGAACTTTCATGACTTCAGGCGAAGTTTTGCCACTTTGCTTTCTGACGAGGGAATAGAC
CGCTTTTCGGTCAAGTGTGCACTCAATCATAAAGACAGCAGTGTAACGGGAATTTATGAT
CGGCCTTATCACATCAAGCGCAAAAGTTTGGCGCTAGTTCAATGGCATTATGTGGTTGAA
AACATCGAGCATAAGAGTGTCCAAATGCTGCACGGTGCGTAG

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
QMGGPQGRLIEFLLLSGQRLNEVARLTWDEVKEDRLEIPGLRNKSGETLITPLLPSLPQI
LEKYPQQEGSYLFTTGDGTRPISGFSQIKAILSKLSGVTDWNFHDFRRSFATLLSDEGID
RFSVKCALNHKDSSVTGIYDRPYHIKRKSLALVQWHYVVENIEHKSVQMLHGA*

>ORF number 2 in reading frame 3 on the reverse strand extends from base 648 to base 836.
GAGGTCGTTCTTTTTGATTCAAATTGCACAAATGTGCGTTGCGTTTTTTCAAAATATGAG
ACTACTAAAGTGATCCTTGATTTTGCAGAGGATCAGACATGCAAAAAATCCTTAACTGGC
GCGACGCTTGCCAAGCACTCTCAATTAGCCGCCCTACTCTCTACAAGCTTACAAACGAAG
GTGCGTTGA

>Translation of ORF number 2 in reading frame 3 on the reverse strand.
EVVLFDSNCTNVRCVFSKYETTKVILDFAEDQTCKKSLTGATLAKHSQLAALLSTSLQTK
VR*

Multiple Alignement

PROTOCOL


Phylogeny.fr/Clustalw2/default values


RESULTS ANALYSIS


The nomenclature used may not be exactly the recommended; however this was the simplest way to work on the sequence. At class level the nomenclature is composed by the initial of the class defined as Ingroup, followed by the first name of the homolog selected from both the BLASTp and lineage report (example: bNitrosomonas _ beta-proteobacteria Nitrosomonas), since the rest of the information in the FASTA file was not deleted (second taxa name and gi) it was quite easy to transform the nomenclature used into scientific name and respective gi, as requested for the phylogeny tree. The Outgroups were named by exactly the same criteria plus the indication '(OUT)'. Once again the rest of the information in the FASTA file was not deleted, enabling an easy conversion to the respective scientific name and gi, as requested for the phylogeny tree.


According to the MSA, the sequence in analysis does not seem to present a START codon. The sequence seems incomplete on the start when in contrast with the rest of the sequences in the multiple alignment, starting 300aa after. On the other hand the sequence ends, more or less, at the same point as the others, which indicates a STOP codon at the end of the DNA sequence corresponding to the chosen coding ORF.



RAW RESULTS

AT CLASS LEVEL 
Ingroup - Proteobacteria alpha class 
Outgroup - Proteobacteria(beta, delta, epsilon, gamma and enterobacterea)

Gblocks 0.91b Results
Processed file: input.fasta
Number of sequences: 12
Alignment assumed to be: Protein
New number of positions: 43 (selected positions are underlined in blue)



                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
aJannaschia      -----MKKKLTEMAVSKIAPEAGRRLEVFDTLTPGLALRVTERGKKSWSVMYRVAGRGRE
aMethylocella    -----MAKNLTIKGIAALKPQA-KRCEVPDGHTRGLYFVVQPSGAKSWAYRFSFEGKPK-
aBradyrhizobium  ----MAKGMLTATAVLKLKPGE-HRVEVPDSGAPGLRLVVHPSGRKVWAMRFRRPGGKQ-
aLoktanella      MPKLSTVRLTDTFIRSLRPKDQRYD--VFDASQPGFGVRVATSGALSWVLLTRENGRRKR
aRoseobacter     ------------------------------------------------------------
aAcidiphilium    ------MRFTMNRIAALTCPEGRKDALFFDEELPGFGVRVTSTGSKTYLAQYRGATGVRR
aRhodobacter     ----MKKPLNDSFVRALEVP-TDGRLEVSDTVRPGLRLRIYPNGRKVWSFEKRIKGGPKR
GOS_1511030      ------------------------------------------------------------
dGeobacter(OUT)  ---------MKQFTDRYLTSLKPQDKKYVVREGRGFAIQVLPSGTKTFMYIFELNKQKG-
bThiobacillu(OUT)----------MALSDSKLRTLKPADRVFSESDGGGLYIEIMPTGKRRWGLKYRIPTGKQE
gVibrio(OUT)     -----MAKKVQPLTATQIKQAKPKEKEYNLGDGDGLSLKIKPIGTKLWRFSYYHPISRKR
eSulfurovum(OUT) ------------------------------------------------------------
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
aJannaschia      GIRGPLRRMTLGAYP-------------LIDLKAARERARAAIDLADRGEDPADKRKDEM
aMethylocella    -------KLTIGSYP-------------AIDLSRARSIALASATKVANGRNPAAEKKVER
aBradyrhizobium  ------GNLTLGPLDTTGDETRAPQIGHPLTLTAARVLANEIARQRAQDIDVIAVQRSDR
aLoktanella      --------ITLGGYP-------------AISLSKAREAARLALSEIQEG-----------
aRoseobacter     -----------------------------MSLAEARVAATEALKAMRDG-----------
aAcidiphilium    --------VSLGKHG-------------VISLADARNAARAILGQVASGGDPIAERRAKD
aRhodobacter     K-------HLLGTYP-------------DTSIKEARAAALEIELEASKG-VDRVAEAEKA
GOS_1511030      ------------------------------------------------------------
dGeobacter(OUT)  -------YLLLGNYP-------------AMSLGDARIAYNDAYKLVKNGIDPREEKRTAI
bThiobacillu(OUT)-------TIRLGDYP-------------AYSLADARTWRDDCKALAGRGLSPMALKRGDP
gVibrio(OUT)     ------LNLALGKYP-------------DVSLAKARTKAIEARELLADGIDPKEHRDATL
eSulfurovum(OUT) ------------------------------------------------------------
                                                                             


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
aJannaschia      RKKGE-------RVFEVICARFIELHAKAHT-----------------------------
aMethylocella    EKARKPSD---LDLVDVVVAQFVVKHVEPKTRP---------------------------
aBradyrhizobium  HRKRLQIEERSANSFADAAKLFIQERTTRKTGEKPRRWI-----------------EEAR
aLoktanella      ---TFGRKNAPATFETAVEEWYA-REQRAKKSF---------------------------
aRoseobacter     ---VFSSDKASRLFEDVLSDWYD-REQRNRKSF---------------------------
aAcidiphilium    EAARQAQSEAAFTVEALIAAWVADRQESRRASY---------------------------
aRhodobacter     KLDAEERKRKAVLVADVVEAHRALHLANLRS-----------------------------
GOS_1511030      ------------------------------------------------------------
dGeobacter(OUT)  EEQSRLANEARLQAEAAALAAEKLEKDSFDSLIEDELPEGYTPITVEQLAAIWYVKYSKE
bThiobacillu(OUT)IPEDAAPAAKELAQFFIRNWCMKAVEKAKAKEAEAKAADTVEAFAWR-------WYAEIV
gVibrio(OUT)     REKQLELAN---TLQSVFDDWIEVKRTSVKEQT---------------------------
eSulfurovum(OUT) ------------MNNEKLKEYIETFLDYLLDVR---------------------------
                                                                             


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
aJannaschia      ----VKWRDTERLLDTYAVPAWRGKPIDQIDRAAAHELLDDIAMEHGTGAAR--------
aMethylocella    ----QSAKEMKRILKREILSRWSGRRLTEITRSDIRDLLEAIADRAPIMAN---------
aBradyrhizobium  LLGWDFSKDEPAIVKGGLADRFRDKPVLDFDGDEIYALIAEARRHGVPGMARRSAAPSDA
aLoktanella      -------RQVEQAMRLHVLPFLGRHQLDQIKKADLMRVIDRVAERGKLTQAN--------
aRoseobacter     -------RQVENAMKLHALPHLKGREIQDIRKADLVRIIDRVADSGARTQAN--------
aAcidiphilium    -------LKVAAAALRTHLAHLLTVPASAMTVRQAVAALDRVKAAAGPVAGN--------
aRhodobacter     -------QRDRLRTLKEALAPHMDQPVRELRRADLQAAIDRKAAAGALIQAN--------
GOS_1511030      ------------------------------------------------------------
dGeobacter(OUT)  NHSVRWRETILSAIKTHIIPGIGKMEISSVRHKHAVSLIEQIASKVPGSARN--------
bThiobacillu(OUT)EPANSNPRNIKRILDKDAIPAIGSKQIADVTVTDILAITDKIKNRGADQMAL--------
gVibrio(OUT)     ------AKKLKQRIEKYLLPDLGKFPLSDITAPQAIKTIKPIANQGKLETVG--------
eSulfurovum(OUT) -------GYSEVSVTTYEIALRQMSGVSHFYEEDGISVLDITPFRFNIVKNSK-------
                                                                             


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
aJannaschia      ---EVRKHITKLFNWSVDRGLLAASPVAGMRR--PELGYTPRERVLTMDELRAVWAAAGK
aMethylocella    ---RVFEVISSLINWSISMEMLSASPIAGLRK--PSPAKR-RDRILSEKELTDVWQASER
aBradyrhizobium  RGRHMAAALSALFKWLHRERRIKVNPVLGLSK--PPNSPS-RRRFLSDAEIKKFWAACTT
aLoktanella      ---RVRAFITRFFNFAIERDLLMSSPAAALPR--PAVEIS-RDRVLSRDELCAVWETAEQ
aRoseobacter     ---RVRAFIKRYFAWACERDLLDFSPAASLPK--VGGEQS-RDRVLTESELRSVWYAADA
aAcidiphilium    ---RLLAYARACFGWACKRQRLAMNPFAGLER--PAREKS-RDRVLTDAEIGAIWRAAAL
aRhodobacter     ---RTKAALSKFAKFAWQRGYTDDHIGLGLEK--AVQEQP-RDRVMSLEEVRAVYDATFQ
GOS_1511030      -----------------------------------------------------------Q
dGeobacter(OUT)  ----VMKFGRQMFKYACRQEWAEIQPFQEITASVPKIAPKTDDRHLDDDEIVKAWKEISK
bThiobacillu(OUT)---QTRNVLKRLFAYAIAREKTTFNPAAAIEAKFIAQAKS-RDVALSPEEIGRLLRAIYQ
gVibrio(OUT)     ---RLCRNLNEIMTFAVNTGVIEHNKLAGIGKAFETAKVT-NQASLAPDELPELLKTINY
eSulfurovum(OUT) --KTIVKKLSAVRSFVKYLEDQCNIPVKLIADESIKVPQS-LPKPIEEQYIEEVLAKANV
                                                                             


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
aJannaschia      MGY--PFGPMVRLLILTAQRRAEVANLERGWLLPDHQAFEVPASHY-KTDRPQVVPLSAP
aMethylocella    AGW--PYGSMIKVLILSGQRRSEVSDMTWSEIDFEERSWTLPAVRT-KNGKGHIIPLSPT
aBradyrhizobium  LGS--PFGPMLKLLLLTGQRLNEIARLHDTELT--DEAIRLPGSRT-KNALPHDVPLSSL
aLoktanella      MGF--PFGRITQLLILTAQRRDEVAGMRWSELDLDRARWIISKERA-KNGKAHIVHLSPQ
aRoseobacter     IGY--PFGPIVKLLILTAQRRDEVAGMTWSELDLDRGTWTIGAERA-KNGQTHTVHLSPA
aAcidiphilium    LDY--PAGQFTRMLMLTLGRRDEVASMRWTEIAADGLTWSLPADRA-KNGKSHVVHLSEP
aRhodobacter     MGS--LWGPLVRMLVLTLQRRSEVAGLKWSEVDFDGECMTVAGGRT-KNRKMHKTHLAPP
GOS_1511030      MGG--PQGRLIEFLLLSGQRLNEVARLTWDEVK--EDRLEIPGLRN-KSGETLITPLLPS
dGeobacter(OUT)  GPSSTEVKRALKLILVTAQRPGEVAQIHRDQIK--DRWWTIPAEVAGKNEREHRVYLTDT
bThiobacillu(OUT)SSMKRAHKLALHLLILCMVRKSELTEAKWEELDLEKAEWAIPGERM-KKDKPHLVPLSRQ
gVibrio(OUT)     ASIKPITRCLLEWQLHTMTRPAETAGARWDEIDREKMLWVIPAERM-KKGRVHTVPLTKQ
eSulfurovum(OUT) EEK-----LLISMLYGLGLRISELSGLKLEDIK--GEWIQIHGKGN----KVRELPLMKS
                              ##################                             


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
aJannaschia      ALALVEG-----LPKWNSGDFMLSTTAGKRPVS------------GFSKAKARLD-----
aMethylocella    IIDVLLT-----LPRIGSESGFVFTTNGFSPIR------------NFARRKKALM-----
aBradyrhizobium  AKEVLAE-----VQRVPNSK-YVFSTNGRAPVS------------GFSKAKSRID-----
aLoktanella      ALALLST-----IPRQNGVD-LIFTTTGRSAVS------------GFSKAKAALD-----
aRoseobacter     AQAILEQ-----IPQRSDSD-FVFTTTGTSAVS------------GFSKAKARLD-----
aAcidiphilium    ARGILSA-----LPRFENSD-FLFTTTGERPIS------------GFSGFKLAIDRAIEA
aRhodobacter     VLADLRE-----LRAASSVE-QVFTTTGTTPVS------------GFSKVKERLD----V
GOS_1511030      LPQILEK-----YPQQEGSY-LFTTGDGTRPIS------------GFSQIKAILS-----
dGeobacter(OUT)  ALELIGQGKGYIFSSGRGKRGHISENTLSQAINRGYLDEDVVKVVGNRKIKARKE-----
bThiobacillu(OUT)AVAMFEE-----LKGLASGSEWVFPSRSSLKKP-----------IAHNALNTVVR-----
gVibrio(OUT)     TLDLLET-----IDFITGDSEYLFPADKSNKNHIN----------KETANKALVR-----
eSulfurovum(OUT) LQKLIGV-----YMDQNGPKRYLFE-KGNAPMN-------------AAQLRYKLT----K
                                                                             


                        430       440       450       460       470       480
                 =========+=========+=========+=========+=========+=========+
aJannaschia      KLSEVEG-WTLHDLRRSAATHMAR-LGVAQEHIERVLGH-----AIEGVAGTYNRYSYLP
aMethylocella    MSCQSENNWTLHDLRRTFATGMAR-LKVELPVVEKLLNHSSG--TFGGVQGVYQQYDFQS
aBradyrhizobium  DLLNIEP-WVFHDLRRSAATGMAE-IGIQPHVIEAILNHISG--HKASVAGIYNRAAYAN
aLoktanella      -ARSHVSDWRFHDLRRSAATFMAEELRITPVVVDRILNHVSG--TVRGVTAVYLRGEHLA
aRoseobacter     -QLSAVNEWRLHDLRRTAATMMAERLEVGHAVVDKVLNHRSG--AIRGVAAVYLRGQFLK
aAcidiphilium    DLGRGIADWRFHDFRRAGVTWLAG-AGFPPHVADKLLNHMSG--SIQGVAAVYQRAEFLP
aRhodobacter     LLPEDMEPWTFHDLRTAFATQMAE-DGESEAVIDRILNHVASGSAPSSVARVYNRSEHLG
GOS_1511030      -KLSGVTDWNFHDFRRSFATLLSD-EGIDRFSVKCALNHKDS-----SVTGIYDRPYHIK
dGeobacter(OUT)  -PYFGMKPWSPHDLRRTARTNMAR-VGITDEVGEEVINHIKP-----GIVGVYNKYRYDN
bThiobacillu(OUT)ALEADVRDFVIHDFRRTASTHLHE-AGFNSDWIEKALAHETK-----GIRGVYNRAQYAD
gVibrio(OUT)     --MGMKGRQTSHGLRALASTTLNE-QNFDPDIIEAALSHVDR----DKVRSAYNRTDYLE
eSulfurovum(OUT) LFKKEGLKVTPHQLRHSFATHLLN-HGARIADVSELLGHETM-----ATTQVYTKLGSVK
                            ############   #############                     


                        490       500       510       520       530
                 =========+=========+=========+=========+=========+====
aJannaschia      EKRAALDAWGQEWN----------------------------------------
aMethylocella    EKREAMNLWASYVNKITNKLDTIK------------------------------
aBradyrhizobium  EKREALEKWAEHLRRVVS------------------------------------
aLoktanella      DREAALAAWGQLVENLVNSNK---------------------------------
aRoseobacter     ERQSALFRWGTFVHELVNLDN---------------------------------
aAcidiphilium    ERERALDAWASHVISAAAGGTTAGNVIALRA-----------------------
aRhodobacter     QRRRILNRWAALVTRDEAASGNVVSLADRDRIEGDAAGGCRGAAAEKRRVRDAS
GOS_1511030      RKSLALVQWHYVVENIEHKSVQMLHGA---------------------------
dGeobacter(OUT)  EKKDALLKWEALLLNILSPKPQDSNADGE-------------------------
bThiobacillu(OUT)QRRDMLQWWADFVDSQIQDGRGKVIIGPFGKAYQSAA-----------------
gVibrio(OUT)     RRKVLMAWWSDHIEEAASGSLSMSGKKSLKVVG---------------------
eSulfurovum(OUT) KMQEYMSAHPLADKNL


Parameters used
Minimum Number Of Sequences For A Conserved Position: 7
Minimum Number Of Sequences For A Flanking Position: 10
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes

Flank positions of the 3 selected block(s)
Flanks: [314  331]  [432  443]  [447  459]  

New number of positions in input.fasta-gb:  43  (8% of the original 534 positions)







AT PHYLUM LEVEL
Ingroup - all Proteobacteria class (alpha, beta, delta, epsilon, gamma and enterobacterea)
Outgroup - Phylum Bacteria  (cyanobacterea, CFB's, green sulfur, firmicutes... and so on... according to FAQ 
           http://annotathon.univ-mrs.fr/Metagenes/index.php/Image:TreeOfLife.png )


Gblocks 0.91b Results
Processed file: input.fasta
Number of sequences: 11
Alignment assumed to be: Protein
New number of positions: 43 (selected positions are underlined in blue) 

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
aLoktanella      -------MPKLSTVRLTDTFIRSLRPKD-QRYDVFDASQPGFGVRVATSGALSWVLLTRE
aRoseobacter     ------------------------------------------------------------
aJannaschia      -----------MKKKLTEMAVSKIAPEAGRRLEVFDTLTPGLALRVTERGKKSWSVMYRV
gCongregibacter  ----------MPRVKLTATSVPHLKTDR-TQVDYFDSYLPGFGVRVTRGGTRTYIVMTRE
GOS_1511030      ------------------------------------------------------------
bThiobacillus    MRDCQKSHTVTRKERAVALTDTAVKKAKPGDKPYKMADEKGLYLLVNQAG-KYWRMDYRF
entEscherichia   ----------------MALTDIQIKRAKPQDKPYTLNDGQGLSLLINPDGSKGWRFRFRF
dDesulfonatrono  ---------MPRQNLTPKFVTNPPKPTDKPKTDYFDTQVSGFLLEVRSSGKATYYLRYRD
Hydrogenivi(OUT) ---------------------MPRKPKKRGKTALGDN-------LYIIHGSHWFRFTYRG
Robiginital(OUT) ------------------------------------------------------------
Clostridium(OUT) ------------------------------------------------------------
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
aLoktanella      NGRRK--------RITLGGYPAISLSKAREAARLALSEIQEG------------TFGRKN
aRoseobacter     ----------------------MSLAEARVAATEALKAMRDG------------VFSSDK
aJannaschia      AGRGREGIRGPLRRMTLGAYPLIDLKAARERARAAIDLADRGEDPADKR----KDEMRKK
gCongregibacter  LANGHWRKR----RVKLGRTSELTLADARVRARAILTAASEGKHLDDVAPPTPRDLLVEQ
GOS_1511030      ------------------------------------------------------------
bThiobacillus    LGKRK--------TLALGVYSDVSLARARQKRDDARAMLADGTDPGEQRK-ETKRANQAA
entEscherichia   AGKAR--------LMSFGSYDLVSLAEAREKRDIARKQVANGIDPVEERK-ALRLAQKLS
dDesulfonatrono  NTGQLK-------QVKLGTPETLSLDEARTRARATKSQTLIGFDPKAEQE-------KIK
Hydrogenivi(OUT) KTYTKR----------LGRVNELPLTSAKHIAGKLRTQIIEN------------QYLEKK
Robiginital(OUT) --------------------------------------------------------MSLE
Clostridium(OUT) ----------------------------------------------------------MT
                                                                             


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
aLoktanella      APATFETAVEEWYAREQ-----RAKKS-FRQVEQAMRLHVLPFLGRHQLDQIKKADLMRV
aRoseobacter     ASRLFEDVLSDWYDREQ-----RNRKS-FRQVENAMKLHALPHLKGREIQDIRKADLVRI
aJannaschia      GERVFEVICARFIELHA-----KAHTVKWRDTERLLDTYAVPAWRGKPIDQIDRAAAHEL
gCongregibacter  SKQTFAKERERFLSSYRGRGGRRPVESTLGEYRRCLQHNVLESWTDVPVQEITHDDVKTA
GOS_1511030      ------------------------------------------------------------
bThiobacillus    QANSFEAVAREWHAMKLKRK---WTQSTADKTMAQLEAYVFPEMGHLPIASVKASQLLAM
entEscherichia   TENSFEAICREWHTNKADR----WTVAYREEIIKTFEQDVFPFIGKRPISEIKPLELLEV
dDesulfonatrono  AIPTFKDFVYDSYLPYAK-----TYKKSWEQDQTMIEQRMLRVWGRRKLNSINTHDLIEF
Hydrogenivi(OUT) EVPLFSEVAEKYFEWYKTER-ANASRRTIRETERRVKK-LVEVFGDKTLDYFSEFLIDSY
Robiginital(OUT) AFAKYLTLEKKYAAHTVK---------AYLADLDAFSEYCREEQGEFALADQPYPVIRSW
Clostridium(OUT) IHDYFEDFINFLKAEKDAS---AFTIANYTSDFSIFSSFVESQGIKPTVDAITTPLLRKY
                                                                             


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
aLoktanella      IDRV-AERGKLTQANRVRAF-ITRFFNFAIERDLLMSSPAAALPRPAVEIS-RDRVLSR-
aRoseobacter     IDRV-ADSGARTQANRVRAF-IKRYFAWACERDLLDFSPAASLPKVGGEQS-RDRVLTE-
aJannaschia      LDDI-AMEHGTGAAREVRKH-ITKLFNWSVDRGLLAASPVAGMRRPELGYTPRERVLTM-
gCongregibacter  LQTV-MDDGHESRAVKIYTV-LKLLFGWLCDENLISISPLSQVKRP-AHIGVRERVLSE-
GOS_1511030      ------------------------------------------------------------
bThiobacillus    LRKV-ENRGIAYTAVRLREV-CGQIFRYGVATGRAEDNPAAHLLGALHKPEVNHRPAITD
entEscherichia   LRRI-EKRGALEKTRKVRQR-CGEVYRYAIITGRAEYNPAPDLAIALAVPKQKHHPFLS-
dDesulfonatrono  QNNL-VKGGLKAGSVNRYMA-LVKYIFNLAERWEIIDKAPTRNARKLEDNGARERYLNQ-
Hydrogenivi(OUT) KQDR-IKEGVKPSTVNRELN-ILRAILRKVKEWGMYSGDLPRIKTYKVDDE-RVRYLSP-
Robiginital(OUT) IIHL-MESGLNNRSVNRKVASLKSYYKYQLRQGRIDASPLAAHKPLKIPRRVEIPFSES-
Clostridium(OUT) TTFLKIDKKYEVETIRRKINSLRSFFSFLISQEYIDKNPMAPITAPKKPDRLPIYLKPD-
                                                                             


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
aLoktanella      ----DELCAVWETAEQMGFPFGRITQLLILTAQRRDEVAGMRWSELDLDRARWIISKERA
aRoseobacter     ----SELRSVWYAADAIGYPFGPIVKLLILTAQRRDEVAGMTWSELDLDRGTWTIGAERA
aJannaschia      ----DELRAVWAAAGKMGYPFGPMVRLLILTAQRRAEVANLERGWLLPDHQAFEVPASHY
gCongregibacter  ----EELILIWNHAGEG--IYANIVRIMMLTGQRRQEVAGMCWSEINLDKRRWDIPGQRT
GOS_1511030      ---------------QMGGPQGRLIEFLLLSGQRLNEVARLTWDEVKEDR--LEIPGLRN
bThiobacillus    RRGFGAFLRDLREATGYDAVTRHAAYFALLTFVRAQEFRYAKWEEIDWQAKEWKVPAKRM
entEscherichia   AEELPHFIRDLEAYTG-SIITKNATKIVMLTGVRTQEMRFATWEEVDLEKGIWEIPAERM
dDesulfonatrono  ---EEVYRLLEALNSCKSQVVPDLIEFLLLTGARKTEAAELTWQEVDMERGIWELPAQRN
Hydrogenivi(OUT) -------EELKALIDACPDWFKPVVKFACLTGLRASELFSLTWDMVNLSEGYITVPAKYS
Robiginital(OUT) -EMEGLLGEWEPSEGYEAHRDKLVVELLYTTGMRRAELIGLKLGDVDLEQGTLRVTGKRD
Clostridium(OUT) -EIKLLISMPMKHSRDNKLRDKCIIETLVFTGLRRSELLSLNWQNIDFGSNTITVLNGKG
                                              ###################            


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
aLoktanella      KNGK----AHIVHLSPQALALLSTIPRQNG-----VDLIFTTTG----RSAVSGFSKAKA
aRoseobacter     KNGQ----THTVHLSPAAQAILEQIPQRSD-----SDFVFTTTG----TSAVSGFSKAKA
aJannaschia      KTDR----PQVVPLSAPALALVEGLPKWNS-----GDFMLSTTAG---KRPVSGFSKAKA
gCongregibacter  KNHR----PHVVPLSSAVISILHYHRSLQASTNMQTDLVFTTNG----KAVFAGWSKSKE
GOS_1511030      KSGE----TLITPLLPSLPQILEKYPQQEG------SYLFTTGDG---TRPISGFSQIKA
bThiobacillus    KTGKA-LPAHTVPLSQQALALLTELKNLTG----HSPYLFPKVKGY-GDAEVISENTVGK
entEscherichia   KMRR----PHIVPLSTQVVDLFKQLKPITG----HYPYIFIGRN---NRNKPISKESVSQ
dDesulfonatrono  KAGK----PKTVPLSEAAIKVLKRRADNGS------RWVFPNPET---GKPLRHFHNTWD
Hydrogenivi(OUT) KTKE----TKRIPLHPKALEVLREVKARQEERWIDYGYVFTNRMGKPYSVEGQGYKRVFK
Robiginital(OUT) KERILPLLPGIVREIRAYLELRGAHFKSGS-----EPHLFLTSRGN-KLYENLVYRIINR
Clostridium(OUT) KKQR--VVPITEPLISDLWAYLQTRLPLHD------NAVFISGNG--TRLSTTPLNQLFR
                                                                             


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
aLoktanella      ALDARSHVS--DWRFHDLRRSAATFMAEELRITPVVVDRILNHVSG-TVRGVTAVYLRGE
aRoseobacter     RLDQLSAVN--EWRLHDLRRTAATMMAERLEVGHAVVDKVLNHRSG-AIRGVAAVYLRGQ
aJannaschia      RLDKLSEVE--GWTLHDLRRSAATHMAR-LGVAQEHIERVLGH----AIEGVAGTYNRYS
gCongregibacter  RLDRRVASA--DWQLRDLRRSFATHANE-LGYEPHVIESALNHVSGSAKRGIAGVYNRAT
GOS_1511030      ILSKLSGVT--DWNFHDFRRSFATLLSD-EGIDRFSVKCALNHKDS----SVTGIYDRPY
bThiobacillus    MLNKMGYQG--RQCVHGFRASARSILSE-QGWSREAMERQLDHKET---DSTVAAYARSE
entEscherichia   VIESLGYKG--RATGHGFRHTMSTILHE-QGFDSAWIEMQLAHVDK---NSIRGTYNHAQ
dDesulfonatrono  RIRKQAGIP--SARLHDLRHSFASFLVN-SGRSLYEVQKLLGHSQL----STTQRYAHLT
Hydrogenivi(OUT) TACEKAGIR--DFRFHDLRHTFASYLVM-SGVDFYTVQELMRHSSP----RMTKRYAHLS
Robiginital(OUT) YLSMVSAKS--KRSPHILRHTFATHLLN-QGADMNSVKELLGHSSL----ASTQVYTHNS
Clostridium(OUT) RYLKLAGLTGKGYTIHKLRHSYGTLLLQ-NGADLISIQSLMGHNDL----NTTKIYTHVD
                                ###########    #############                 


                        430       440       450
                 =========+=========+=========+==
aLoktanella      HLADREAALAAWGQLVENLVNSNK--------
aRoseobacter     FLKERQSALFRWGTFVHELVNLDN--------
aJannaschia      YLPEKRAALDAWGQEWN---------------
gCongregibacter  YIRQRIRLIQRWSRHLLLLVAQARRS------
GOS_1511030      HIKRKSLALVQWHYVVENIEHKSVQMLHGA--
bThiobacillus    HLPERRNMMQAWADTCDALETGAEIILLPRTA
entEscherichia   YLEGRKKMMNWYAN--HIFNIG-----VPK--
dDesulfonatrono  EDTLKEATEIAGSLVGIRKVENGE--------
Hydrogenivi(OUT) PEHIRKELEKVGEVF-----------------
Robiginital(OUT) IAELKRIHGTSHPRNKTK--------------
Clostridium(OUT) MKHLKQEVKKFPLSI-----------------
                                                 





Parameters used
Minimum Number Of Sequences For A Conserved Position: 6
Minimum Number Of Sequences For A Flanking Position: 9
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes

Flank positions of the 3 selected block(s)
Flanks: [270  288]  [376  386]  [391  403]  

New number of positions in input.fasta-gb:  43  (9% of the original 452 positions)









Protein Domains

PROTOCOL


Interpro, default parameters at EBI


RESULTS ANALYSIS


InterPro returned three domains. IPR011010 corresponds to a domain that contains the other two, IPR002104 (E-value_ 8e-17) and IPR013762 (E-value_ 1.4e-15). All three have DNA binding activity.IPR011010 matches to a superfamily of DNA breaking-rejoining enzymes, and have an E-value of 6.1e-24. This results are coherent with the BLAST information since the most singnificant E-values were obtained for possible phage-related integrase, and the domains contained in IPR011010 are both for integrase-like, catalytic core, phage.

RAW RESULTS

GOS_1511030	55D947BE99268A07	162	superfamily	SSF56349	DNA breaking-rejoining enzymes	9	151	6.1e-24	T	23-Mar-2010	IPR011010	DNA breaking-rejoining enzyme, catalytic core	Molecular Function: DNA binding (GO:0003677)
GOS_1511030	55D947BE99268A07	162	Gene3D	G3DSA:1.10.443.10	no description	5	141	1.4e-15	T	23-Mar-2010	IPR013762	Integrase-like, catalytic core, phage	Molecular Function: DNA binding (GO:0003677), Biological Process: DNA recombination (GO:0006310), Biological Process: DNA integration (GO:0015074)
GOS_1511030	55D947BE99268A07	162	HMMPfam	PF00589	Phage_integrase	9	142	6.4e-17	T	23-Mar-2010	IPR002104	Integrase, catalytic core, phage	Molecular Function: DNA binding (GO:0003677), Biological Process: DNA recombination (GO:0006310), Biological Process: DNA integration (GO:0015074)

Phylogeny

PROTOCOL


At class level

a) Phylogeny.fr / BioNJ method / boostrap: 100/ Ingroup: a-proteobacteria/ Outgroup: b,d,e,g-proteobacteria

b) Phylogeny.fr / PhyML method / bootstrap: 100/ Ingroup: a-proteobacteria/ Outgroup: b,d,e,g-proteobacteria

At phylum level

a)Phylogeny.fr / BioNJ method / boostrap: 100/ Ingroup: all proteobacteria/ Outgroup: classes that compose the bacteria phylum

b) Phylogeny.fr / PhyML method /bootstrap: 100 / Ingroup: all proteobacteria/ Outgroup: classes that compose the bacteria phylum



RESULTS ANALYSIS


Note: For each tree presented according to the rule book there is a matching one, with the work nomenclature mentioned in the above MSA analysis result, for an easier result analysis.


As mentioned previously in taxonomy report result analysis, a first attempt to determine the taxonomic setting of the protein in analysis at class level, failed. According to the NeighbourJoining trees plotted beneath, it is impossible, at this level, to separate Ingroups from Outgroups, furthermore the bootstrap values are not significant (about 0.38) showing poor statistical significance of the trees. The respective MaximumLikelihood trees also show a lack of separation between Ingroups and Outgroups, in both trees the protein seems to be structurally closer to the Outgroups than to the Ingroups.


At bacteria phylum level, both resulting trees (NJ and PhyML) allow a clear distinction between In and Outgroups with high bootstrap values overall. The tree knot containing the sequence in analyses has a bootstrap value of 0.79 for the NeighbourJoining tree and 0.65 for the MaximumLikelihood tree, meaning a reliable statistical significance, for that branch. Both trees seem to indicate that the protein in analysis does, indeed, belong to a proteobacteria. All trees were rerooted at the branch that contains all Outgoups, to facilitate their assessment.





RAW RESULTS

AT CLASS LEVEL 
Ingroup - Proteobacteria alpha class 
Outgroup - Proteobacteria(beta, delta, epsilon, gamma and enterobacteria)
 
     a) NeighbourJoining - Species and gi according to GENBANK info, as requested in the rule book.

                                                                                              -----0.2---
 
               +---------------Rhodobacter_sphaeroides KD131_gi_221640425      
               |
           0.19|   +-------------Methylocella_silvestris_BL2_gi_217978247
            +--++--+0.42
            |  ||  |
            |  ||  +------Roseobacter_sp._AzwK-3b_gi_149912617
            |  ++0.13
         0.5|   |+------Loktanella_vestfoldensis_SKA53_gi_84516978
           ++   ++0.16
           ||    +-----------------------Acidiphilium_cryptum_JF-5_gi_148260174
           ||
       0.15||   +--------------Jannaschia_sp._CCS1_gi_89055391
       +---++---+0.47
       |   |    |
       |   |    +-------------------------Geobacter_sulfurreducens_PCA_gi_39997217
  0.38 |   |
 +-----+   +--------------Bradyrhizobium_sp._BTAi1_gi_148258572 
 |     |
 |     |                  +-----------------Thiobacillus_denitrificans_ATCC_25259_gi_74318023
 |     +------------------+0.85
 |                        +-----------------------------Vibrio_splendidus_LGP32_gi_218709659
 |
 |
 |------------------GOS_1511030.62
 |
 +------------------------------------------------------Sulfurovum_sp._NBC37-1_gi_152993773



     a) NeighbourJoining - Work nomenclature                                                               -----0.2----
   

               +---------------aRhodobacter_IN_gi_221640425_ref_YP_002526687.1_phage-related_integrase_Rh
               |
           0.19|   +-------------aMethylocella_IN_gi_217978247_ref_YP_002362394.1_integrase_famil
            +--++--+0.43
            |  ||  |
            |  ||  +------aRoseobacter_IN_gi_149912617_149912617_ref_ZP_01901151.1_site-sp
            |  ++0.13
        0.05|   |+------aLoktanella_IN_gi_84516978_ref_ZP_01004335.1_possible_phage-rela
           ++   ++0.18
           ||    +-----------------------aAcidiphilium_IN_gi_148260174_ref_YP_001234301.1_phage_integrase
           ||
           ||   +--------------aJannaschia_IN_gi_89055391_ref_YP_510842.1_phage_integrase_Janna
       +---++---+0.47
       |   |    |
       |   |    +-------------------------dGeobacter_OUT_gi_39997217_ref_NP_953168.1_integrative_genetic_e
 0.38  |   |
 +-----+   +--------------aBradyrhizobium_IN_gi_148258572_ref_YP_001240859.1_putative_phage-like_int
 |     |
 |     | 0.15             +-----------------bThiobacillus_OUT_gi_74318023_ref_YP_316581.1_putative_phage_integrase_Th
 |     +------------------+0.85
 |                        +-----------------------------gVibrio_OUT_gi_218709659_ref_YP_002417280.1_phage_integrase_Vibrio_splendi
 |
 |
 |------------------GOS_1511030.62
 |
 +------------------------------------------------------eSulfurovum_OUT_gi_152993773_ref_YP_001359494.1_phage_integrase_family_sit



      b) Maximumlikelyhood - Species and gi according to GENBANK info, as requested in the rule book.

                                                                                              -------0.5------
 
                  +--------------------------Geobacter_sulfurreducens_PCA_gi_39997217
              +---+0.3
              |   +--------Bradyrhizobium_sp._BTAi1_gi_148258572
              |
           +--+0.08
           |  |           +-------Jannaschia_sp._CCS1_gi_89055391
           |  |           |
           |  |           |     +------------------Methylocella_silvestris_BL2_gi_217978247
           |  +-----------+0.09 |
           |              |     |                    +----Loktanella_vestfoldensis_SKA53_gi_84516978
           |              |     |             +------+0.48
           |              +-----+ 0.12        |      +-----------Roseobacter_sp._AzwK-3b_gi_149912617
           |                    |      +------+0.58
           |                    |      |      |
 +---------+                    |      |      +----Acidiphilium_cryptum_JF-5_gi_148260174
 |         |                    +------+0.12
 |         |                           |   +---------Rhodobacter_sphaeroides_KD131_gi_221640425
 |         |                           |   |
 |         |                           +---+0.1     +------------------Thiobacillus_denitrificans_ATCC_25259_gi_74318023
 |         |                               +--------+0.34
 |         |                                        +------------------------Vibrio_splendidus_LGP32_gi_218709659
 |         |
 |         |
 |         +--------------------------GOS_1511030.62
 |
 +---------------------------------------------------------------------------Sulfurovum_sp._NBC37-1_gi_152993773


      b) MaximumLikelihood - Work nomencluture

                                                                                                 -----0.5----
 
             +-------------------dGeobacter_OUT_gi_39997217_ref_NP_953168.1_integrative_genetic_e
           +-+0.3
           | +------aBradyrhizobium_IN_gi_148258572_ref_YP_001243157.1_putative_inte
           |
        +--+0.08
        |  |       +-----aJannaschia_IN_gi_89055391_ref_YP_510842.1_phage_integrase_Janna
        |  |       |
        |  |       |    +------------aMethylocella_IN_gi_217978247_ref_YP_002362394.1_integrase_famil
        |  +-------+0.09|
        |          |    |              +---aLoktanella_IN_gi_84516978_ref_ZP_01004335.1_possible_phage-rela
        |          |    |         +----+0.48
        |          +----+ 0.12    |    +--------aRoseobacter_IN_gi_149912617_ref_ZP_01901151.1_site-specific_rec
        |               |   +-----+0.58
        |               |   |     |
 +------+               |   |     +--aAcidiphilium_IN_gi_148260174_ref_YP_001234301.1_phage_integrase
 |      |               +---+0.12
 |      |                   |   +------aRhodobacter_IN_gi_221640425_ref_YP_002526687.1_phage-related_in
 |      |                   |   |
 |      |                   +---+ 0.1 +-------------bThiobacillus_OUT_gi_74318023_ref_YP_315763.1_cp4-like_integrase
 |      |                       +-----+0.34
 |      |                             +-----------------gVibrio_OUT_gi_218709659_ref_YP_002417280.1_phage_integrase_Vibr
 |      |
 |      |
 |      +-------------------GOS_1511030.62
 |
 +------------------------------------------------------eSulfurovum_OUT_gi_152993773_ref_YP_001359494.1_phage_integrase
       





AT PHYLUM LEVEL
Ingroup - all Proteobacteria class (alpha, beta, delta, epsilon, gamma and enterobacteria)
Outgroup - Phylum Bacteria  (cyanobacterea, CFB's, green sulfur, firmicutes... and so on... according to FAQ 
           http://annotathon.univ-mrs.fr/Metagenes/index.php/Image:TreeOfLife.png )


     a) NeighbourJoining - Species and gi according to GENBANK info, as requested in the rule book.

                                                                                                      -----0.2----
 
     +-------------------Desulfonatronospira_thiodismutans_ASO3-1_gi_225199863
     |
     |                             0.65 +---------Loktanella_vestfoldensis_SKA53_gi_84516978
     |                            +-----+
     |                       0.73 |     |
0.72 |                     +------+     +------Roseobacter_sp._AzwK-3b_gi_149912617
 +---+               0.76  |      |
 |   |            +--------+      +-----------------------Jannaschia_sp._CCS1_gi_89055391
 |   |     0.79   |        |
 |   |   +--------+        +-----------------Congregibacter_litoralis_KT71_gi_88704889
 |   |   |        |
 |   |   |        +----------------------GOS_1511030.62
 |   +---+
 |   0.56|
 |       |            1                +--------------------------------Thiobacillus_denitrificans_ATCC_25259_gi_74318023
 |       +----------------------------+
 |                                    +-----------Escherichia_coli_042_gi_284923720
 |
 |   +-----------------Hydrogenivirga_sp._128-5-R1-1_gi_163782910
 |   |
 +---+
0.72 |   +---------------------Robiginitalea_biformata_HTCC2501_gi_260063566
     +---+
     0.54+---------------------Clostridium_papyrosolvens_DSM_2782_gi_256754539



    a) NeighbourJoining - Work nomenclature


                                                                                                     -----0.2----
    +---------------dDesulfonatronospira_IN_gi_225199863_ref_ZP_03738976.1_integrase
    |
    |                      0.65 +-------aLoktanella_IN_gi_84516978_ref_ZP_01004335.1_possible_phage-rela
    |                      +----+
    |                 0.73 |    |
0.72|                 +----+    +-----aRoseobacter_IN_gi_149912617_149912617_ref_ZP_01901151.1_site-sp
 +--+           0.76  |    |
 |  |          +------+    +-------------------aJannaschia_IN_gi_89055391_ref_YP_510842.1_phage_integrase_Janna
 |  |    0.79  |      |
 |  |  +-------+      +-------------gCongregibacter_IN_gi_88704889_ref_ZP_01102601.1_phage_integrase
 |  |  |       |
 |  |  |       +-----------------GOS_1511030.62
 |  +--+
 | 0.56|
 |     |         1             +-------------------------bThiobacillus_IN_gi_74318023_ref_YP_315763.1_cp4-like_integrase
 |     +-----------------------+
 |                             +---------entEscherichia_IN_gi_284923720_emb_CBG36817.1_integrase_Escheric
 |
 |  +--------------Hydrogenivirga_OUT_gi_163782910_ref_ZP_02177906.1_phage_integras
 |  |
 +--+
0.72|  +-----------------Robiginitalea_OUT_gi_260063566_ref_YP_003196646.1_putative_site-
    +--+
   0.54+-----------------Clostridium_OUT_gi_256754539_ref_ZP_05495323.1_integrase_family





     b) Maximumlikelyhood - Species and gi according to GENBANK info, as requested in the rule book.

                                                                                                      ---0.2--
 
                                     +----Loktanella_vestfoldensis_SKA53_gi_84516978
                                   +-+0.63
                                   | +------Roseobacter_sp._AzwK-3b_gi_149912617
                          +--------+0.71
                          |        |
                  +-------+0.73    +----------------------Jannaschia_sp._CCS1_gi_89055391
                  |       |
      +-----------+0.65   +------------Congregibacter_litoralis_KT71_gi_88704889
      |           |
  +---+0.28       +----------------GOS_1511030
  |   |
  |   +-------------Desulfonatronospira_thiodismutans_ASO3-1_gi_225199863
 ++
 ||0.54
 ||                                  0.99+-----------------------------Thiobacillus_denitrificans_ATCC_25259_gi_74318023
 |+--------------------------------------+
 |                                       +Escherichia_coli_042_gi_284923720
 |
 |+-------------------Robiginitalea_biformata_HTCC2501_gi_260063566
 ||
 ++0.54
  | +-----------Hydrogenivirga_sp._128-5-R1-1_gi_163782910
  +-+0.3
    +--------------------Clostridium_papyrosolvens_DSM_2782_gi_256754539




      b) Maximumlikelyhood - Work nomencluture

                                                                                                -------0.5-----
 
                             +----aLoktanella_IN_gi_84516978_ref_ZP_01004335.1_possible_phage-rela
                            ++0.63
                            |+-----aRoseobacter_IN_gi_149912617_149912617_ref_ZP_01901151.1_site-sp
                     +------+0.71
                     |      |
              +------+0.73  +------------------aJannaschia_IN_gi_89055391_ref_YP_510842.1_phage_integrase_Janna
              |      |
     +--------+0.65  +---------gCongregibacter_IN_gi_88704889_ref_ZP_01102601.1_phage_integrase
     |        |
  +--+0.28    +-------------GOS_1511030
  |  |
  |  +-----------dDesulfonatronospira_IN_gi_225199863_ref_ZP_03738976.1_integrase
 ++0.34
 ||
 ||                          0.99+-----------------------bThiobacillus_IN_gi_74318023_ref_YP_315763.1_cp4-like_integrase
 |+------------------------------+
 |                               +entEscherichia_IN_gi_284923720_emb_CBG36817.1_integrase_Escheric
 |
 |+---------------Robiginitalea_OUT_gi_260063566_ref_YP_003196646.1_putative_site-
 ||
 ++0.34
  |+---------Hydrogenivirga_OUT_gi_163782910_ref_ZP_02177906.1_phage_integras
  ++0.3
   +----------------Clostridium_OUT_gi_256754539_ref_ZP_05495323.1_integrase_family
                                                                                               
  

 

Taxonomy report

PROTOCOL


BLASTp versus NR.NCBI/ default parameters except for "max target sequences _ 1000"/lineage report


BLASTx versus NR.NCBI/ default parameters except for "max target sequences _ 1000"/lineage report



RESULTS ANALYSIS


The lineage report for BLASTp returned coherent results, indicating that the phage related integrase in analysis is very likely to belong to alpha-proteobacteria class, due to the number of hits matching the refered class and its low E-values.

To further investigate the taxonomy of the protein it was necessary to determine In and Outgroups according to the criteria in the Rule Book and the FAQ. In this case, since the protein is very likely to belong to alpha-proteobacteria class, according to the lineage report obtained, this class was selected has Ingroup(7).An assortment of beta, delta, epsilon and gamma proteobacteria were selected has Outgroup(4).However after the MSA and by analysing the phylogenetic tree, one cannot discern between Ingroups and Outgroups, it seems like the protein is too conserved to be pointed out as belonging to alpha-proteobacteria class. This last fact lead to a redesign of strategy: the protein is still very likely to be a proteobacteria, therefore selecting this class as Ingroup and the rest of the classes in the bacteria phylum as Outgroups (according to the tree of life presented in the FAQ cyanobacteria, CFB’s, green sulphur, firmicutes, etc.)











RAW RESULTS

>PROTEIN BLAST
Lineage Report

root
. cellular organisms
. . Bacteria            [bacteria]
. . . Proteobacteria      [proteobacteria]
. . . . Alphaproteobacteria [a-proteobacteria]
. . . . . Rhodobacterales     [a-proteobacteria]
. . . . . . Rhodobacteraceae    [a-proteobacteria]
. . . . . . . Loktanella vestfoldensis SKA53 -------------------------------------  111  8 hits [a-proteobacteria]    possible phage-related integrase [Loktanella vestfoldensis 
. . . . . . . Roseobacter sp. AzwK-3b ............................................  103  4 hits [a-proteobacteria]    site-specific recombinase, phage integrase family protein [
. . . . . . . Octadecabacter antarcticus 238 .....................................  102 18 hits [a-proteobacteria]    putative phage-related integrase [Octadecabacter antarcticu
. . . . . . . Roseobacter sp. MED193 .............................................   95  4 hits [a-proteobacteria]    site-specific recombinase, phage integrase family protein [
. . . . . . . Jannaschia sp. CCS1 ................................................   95  2 hits [a-proteobacteria]    phage integrase [Jannaschia sp. CCS1] >gi|88864940|gb|ABD55
. . . . . . . Labrenzia alexandrii DFL-11 ........................................   92  6 hits [a-proteobacteria]    site-specific recombinase, phage integrase family protein [
. . . . . . . Rhodobacter sphaeroides ATCC 17025 .................................   88  2 hits [a-proteobacteria]    phage integrase family protein [Rhodobacter sphaeroides ATC
. . . . . . . Ruegeria pomeroyi DSS-3 ............................................   87  2 hits [a-proteobacteria]    phage integrase family site specific recombinase [Ruegeria 
. . . . . . . Rhodobacter sphaeroides KD131 ......................................   83  2 hits [a-proteobacteria]    phage-related integrase [Rhodobacter sphaeroides KD131] >gi
. . . . . . . Rhodobacter sphaeroides 2.4.1 ......................................   80  2 hits [a-proteobacteria]    phage-related integrase [Rhodobacter sphaeroides 2.4.1] >gi
. . . . . . . Oceanicola granulosus HTCC2516 .....................................   78  2 hits [a-proteobacteria]    site-specific recombinase, phage integrase family protein [
. . . . . . . Octadecabacter antarcticus 307 .....................................   77 22 hits [a-proteobacteria]    site-specific recombinase, phage integrase family protein [
. . . . . . . Silicibacter lacuscaerulensis ITI-1157 .............................   66  2 hits [a-proteobacteria]    phage integrase family protein [Silicibacter lacuscaerulens
. . . . . . . Roseobacter sp. SK209-2-6 ..........................................   49  2 hits [a-proteobacteria]    Integrase [Roseobacter sp. SK209-2-6] >gi|126721660|gb|EBA1
. . . . . . . Roseobacter litoralis Och 149 ......................................   49  2 hits [a-proteobacteria]    phage-related integrase [Roseobacter litoralis Och 149] >gi
. . . . . . . Roseovarius sp. TM1035 .............................................   48  2 hits [a-proteobacteria]    putative integrase [Roseovarius sp. TM1035] >gi|149142520|g
. . . . . . . Roseovarius nubinhibens ISM ........................................   47  2 hits [a-proteobacteria]    Phage integrase [Roseovarius nubinhibens ISM] >gi|83837504|
. . . . . . . Pseudovibrio sp. JE062 .............................................   47  2 hits [a-proteobacteria]    phage integrase [Pseudovibrio sp. JE062] >gi|211961117|gb|E
. . . . . . . Labrenzia aggregata IAM 12614 ......................................   47  4 hits [a-proteobacteria]    hypothetical protein SIAM614_12908 [Stappia aggregata IAM 1
. . . . . . . Paracoccus denitrificans PD1222 ....................................   47  2 hits [a-proteobacteria]    phage integrase family protein [Paracoccus denitrificans PD
. . . . . . . Sulfitobacter sp. NAS-14.1 .........................................   46  2 hits [a-proteobacteria]    site-specific integrase/recombinase-like [Sulfitobacter sp.
. . . . . . Rhodobacterales bacterium HTCC2654 -----------------------------------   83  4 hits [a-proteobacteria]    site-specific recombinase, phage integrase family protein [
. . . . . . Rhodobacterales bacterium HTCC2083 ...................................   71  2 hits [a-proteobacteria]    phage-related integrase [Rhodobacterales bacterium HTCC2083
. . . . . . Rhodobacterales bacterium Y4I ........................................   59  2 hits [a-proteobacteria]    phage integrase [Rhodobacterales bacterium Y4I] >gi|2066863
. . . . . . Hirschia baltica ATCC 49814 ..........................................   46  2 hits [a-proteobacteria]    integrase family protein [Hirschia baltica ATCC 49814] >gi|
. . . . . Bradyrhizobium sp. BTAi1 -----------------------------------------------  102  8 hits [a-proteobacteria]    putative phage-like integrase [Bradyrhizobium sp. BTAi1] >g
. . . . . Methylocella silvestris BL2 ............................................   90  2 hits [a-proteobacteria]    integrase family protein [Methylocella silvestris BL2] >gi|
. . . . . Acidiphilium cryptum JF-5 ..............................................   87  2 hits [a-proteobacteria]    phage integrase family protein [Acidiphilium cryptum JF-5] 
. . . . . Methylobacterium sp. 4-46 ..............................................   83  4 hits [a-proteobacteria]    integrase family protein [Methylobacterium sp. 4-46] >gi|16
. . . . . Oligotropha carboxidovorans OM5 ........................................   80  6 hits [a-proteobacteria]    phage integrase family protein [Oligotropha carboxidovorans
. . . . . Magnetospirillum magnetotacticum MS-1 ..................................   80  3 hits [a-proteobacteria]    COG0582: Integrase [Magnetospirillum magnetotacticum MS-1]
. . . . . Rhodomicrobium vannielii ATCC 17100 ....................................   79  6 hits [a-proteobacteria]    integrase family protein [Rhodomicrobium vannielii ATCC 171
. . . . . Magnetospirillum magneticum AMB-1 ......................................   76  6 hits [a-proteobacteria]    integrase [Magnetospirillum magneticum AMB-1] >gi|82944594|
. . . . . Azospirillum sp. B510 ..................................................   75  6 hits [a-proteobacteria]    phage integrase family protein [Azospirillum sp. B510] >gi|
. . . . . Methylobacterium extorquens PA1 ........................................   75  4 hits [a-proteobacteria]    integrase family protein [Methylobacterium extorquens PA1] 
. . . . . Nitrobacter sp. Nb-311A ................................................   75  2 hits [a-proteobacteria]    possible phage-related integrase [Nitrobacter sp. Nb-311A] 
. . . . . Ochrobactrum anthropi ATCC 49188 .......................................   73  8 hits [a-proteobacteria]    phage integrase family protein [Ochrobactrum anthropi ATCC 
. . . . . Methylobacterium chloromethanicum CM4 ..................................   70  6 hits [a-proteobacteria]    integrase family protein [Methylobacterium chloromethanicum
. . . . . Rhodopseudomonas palustris DX-1 ........................................   70  4 hits [a-proteobacteria]    integrase family protein [Rhodopseudomonas palustris DX-1] 
. . . . . Rhizobium sp. NGR234 ...................................................   69  2 hits [a-proteobacteria]    DNA integration/recombination/invertion protein [Rhizobium 
. . . . . Rhodopseudomonas palustris BisB18 ......................................   65  2 hits [a-proteobacteria]    phage integrase [Rhodopseudomonas palustris BisB18] >gi|901
. . . . . alpha proteobacterium IMCC1322 .........................................   65  4 hits [a-proteobacteria]    phage integrase family protein [alpha proteobacterium IMCC1
. . . . . Novosphingobium aromaticivorans DSM 12444 ..............................   64  4 hits [a-proteobacteria]    phage integrase [Novosphingobium aromaticivorans DSM 12444]
. . . . . Rhodopseudomonas palustris HaA2 ........................................   62  2 hits [a-proteobacteria]    Phage integrase [Rhodopseudomonas palustris HaA2] >gi|86573
. . . . . Rhodopseudomonas palustris BisA53 ......................................   61  4 hits [a-proteobacteria]    phage integrase family protein [Rhodopseudomonas palustris 
. . . . . Parvularcula bermudensis HTCC2503 ......................................   61  2 hits [a-proteobacteria]    Phage integrase [Parvularcula bermudensis HTCC2503] >gi|846
. . . . . Bradyrhizobium sp. ORS278 ..............................................   60  2 hits [a-proteobacteria]    putative phage-like integrase [Bradyrhizobium sp. ORS278] >
. . . . . Acetobacter pasteurianus IFO 3283-01 ...................................   60  2 hits [a-proteobacteria]    phage DNA recombinase [Acetobacter pasteurianus IFO 3283-01
. . . . . Acetobacter pasteurianus IFO 3283-03 ...................................   60  1 hit  [a-proteobacteria]    phage DNA recombinase [Acetobacter pasteurianus IFO 3283-01
. . . . . Acetobacter pasteurianus IFO 3283-07 ...................................   60  1 hit  [a-proteobacteria]    phage DNA recombinase [Acetobacter pasteurianus IFO 3283-01
. . . . . Acetobacter pasteurianus IFO 3283-22 ...................................   60  1 hit  [a-proteobacteria]    phage DNA recombinase [Acetobacter pasteurianus IFO 3283-01
. . . . . Acetobacter pasteurianus IFO 3283-26 ...................................   60  1 hit  [a-proteobacteria]    phage DNA recombinase [Acetobacter pasteurianus IFO 3283-01
. . . . . Acetobacter pasteurianus IFO 3283-32 ...................................   60  1 hit  [a-proteobacteria]    phage DNA recombinase [Acetobacter pasteurianus IFO 3283-01
. . . . . Acetobacter pasteurianus IFO 3283-01-42C ...............................   60  1 hit  [a-proteobacteria]    phage DNA recombinase [Acetobacter pasteurianus IFO 3283-01
. . . . . Acetobacter pasteurianus IFO 3283-12 ...................................   60  1 hit  [a-proteobacteria]    phage DNA recombinase [Acetobacter pasteurianus IFO 3283-01
. . . . . Orientia tsutsugamushi str. Ikeda ......................................   59 24 hits [a-proteobacteria]    putative integrase [Orientia tsutsugamushi str. Ikeda] >gi|
. . . . . Rhodopseudomonas palustris CGA009 ......................................   58  2 hits [a-proteobacteria]    phage-like integrase [Rhodopseudomonas palustris CGA009] >g
. . . . . alpha proteobacterium BAL199 ...........................................   58  4 hits [a-proteobacteria]    phage integrase [alpha proteobacterium BAL199] >gi|15918035
. . . . . Magnetospirillum gryphiswaldense MSR-1 .................................   56  3 hits [a-proteobacteria]    phage integrase [Magnetospirillum gryphiswaldense MSR-1]
. . . . . Ehrlichia ruminantium str. Gardel ......................................   55  2 hits [a-proteobacteria]    integrase/recombinase [Ehrlichia ruminantium str. Gardel] >
. . . . . Ehrlichia ruminantium str. Welgevonden .................................   55  4 hits [a-proteobacteria]    integrase/recombinase [Ehrlichia ruminantium str. Welgevond
. . . . . Nitrobacter hamburgensis X14 ...........................................   51  2 hits [a-proteobacteria]    phage integrase [Nitrobacter hamburgensis X14] >gi|91800168
. . . . . Bradyrhizobium japonicum USDA 110 ......................................   50  6 hits [a-proteobacteria]    site-specific integrase/recombinase [Bradyrhizobium japonic
. . . . . Agrobacterium vitis S4 .................................................   50  2 hits [a-proteobacteria]    Integrase protein [Agrobacterium vitis S4] >gi|221734539|gb
. . . . . Erythrobacter litoralis HTCC2594 .......................................   50  4 hits [a-proteobacteria]    site-specific recombinase, phage integrase family protein [
. . . . . Xanthobacter autotrophicus Py2 .........................................   49  6 hits [a-proteobacteria]    integrase family protein [Xanthobacter autotrophicus Py2] >
. . . . . Orientia tsutsugamushi str. Boryong ....................................   49  2 hits [a-proteobacteria]    phage-related integrase [Orientia tsutsugamushi str. Boryon
. . . . . Caulobacter crescentus CB15 ............................................   47  2 hits [a-proteobacteria]    phage integrase family integrase/recombinase [Caulobacter c
. . . . . Caulobacter crescentus NA1000 ..........................................   47  2 hits [a-proteobacteria]    phage integrase family integrase/recombinase [Caulobacter c
. . . . . Rhizobium etli Kim 5 ...................................................   47  1 hit  [a-proteobacteria]    phage integrase [Rhizobium etli Kim 5]
. . . . . Methylobacterium populi BJ001 ..........................................   46  2 hits [a-proteobacteria]    integrase family protein [Methylobacterium populi BJ001] >g
. . . . . Rickettsia bellii RML369-C .............................................   46  2 hits [a-proteobacteria]    integrase [Rickettsia bellii RML369-C] >gi|239947373|ref|ZP
. . . . . Rickettsia endosymbiont of Ixodes scapularis ...........................   46  2 hits [a-proteobacteria]    integrase [Rickettsia bellii RML369-C] >gi|239947373|ref|ZP
. . . . . Rickettsia bellii OSU 85-389 ...........................................   46  2 hits [a-proteobacteria]    integrase [Rickettsia bellii OSU 85-389] >gi|157802708|gb|A
. . . . . Mesorhizobium loti MAFF303099 ..........................................   46  2 hits [a-proteobacteria]    prbable integrase [Mesorhizobium loti MAFF303099] >gi|14021
. . . . Congregibacter litoralis KT71 --------------------------------------------   82  2 hits [g-proteobacteria]    phage integrase [Congregibacter litoralis KT71] >gi|8870058
. . . . Desulfonatronospira thiodismutans ASO3-1 .................................   78 12 hits [d-proteobacteria]    integrase family protein [Desulfonatronospira thiodismutans
. . . . delta proteobacterium MLMS-1 .............................................   75  4 hits [d-proteobacteria]    Phage integrase [delta proteobacterium MLMS-1] >gi|93452099
. . . . Legionella pneumophila str. Corby ........................................   69  4 hits [g-proteobacteria]    integrase, phage related [Legionella pneumophila str. Corby
. . . . Escherichia coli 042 .....................................................   67  3 hits [enterobacteria]      putative prophage terminase, large subunit [Escherichia col
. . . . Thioalkalivibrio sp. HL-EbGR7 ............................................   64  2 hits [g-proteobacteria]    integrase family protein [Thioalkalivibrio sp. HL-EbGR7] >g
. . . . Thiobacillus denitrificans ATCC 25259 ....................................   64  8 hits [b-proteobacteria]    hypothetical protein Tbd_2675 [Thiobacillus denitrificans A
. . . . Serratia odorifera DSM 4582 ..............................................   63  4 hits [enterobacteria]      phage integrase family site-specific recombinase [Serratia 
. . . . Legionella longbeachae D-4968 ............................................   63  6 hits [g-proteobacteria]    phage integrase family site-specific recombinase [Legionell
. . . . Psychromonas ingrahamii 37 ...............................................   62  2 hits [g-proteobacteria]    phage integrase family protein [Psychromonas ingrahamii 37]
. . . . Legionella pneumophila str. Paris ........................................   62  4 hits [g-proteobacteria]    hypothetical protein lpp0072 [Legionella pneumophila str. P
. . . . Vibrio cholerae CT 5369-93 ...............................................   61  2 hits [g-proteobacteria]    site-specific recombinase phage integrase family [Vibrio ch
. . . . Vibrio cholerae O395 .....................................................   61  3 hits [g-proteobacteria]    phage integrase family site specific recombinase [Vibrio ch
. . . . Vibrio cholerae RC27 .....................................................   61  2 hits [g-proteobacteria]    phage integrase family site specific recombinase [Vibrio ch
. . . . Arsenophonus nasoniae ....................................................   61  1 hit  [enterobacteria]      phage integrase [Arsenophonus nasoniae]
. . . . Vibrio cholerae TMA 21 ...................................................   60  4 hits [g-proteobacteria]    site-specific recombinase phage integrase family [Vibrio ch
. . . . Methylophaga thiooxidans DMS010 ..........................................   60  4 hits [g-proteobacteria]    site-specific recombinase, phage integrase family protein [
. . . . Geobacter sp. M21 ........................................................   59  6 hits [d-proteobacteria]    integrase family protein [Geobacter sp. M21] >gi|251774297|
. . . . Escherichia coli 83972 ...................................................   58  4 hits [enterobacteria]      integrase [Escherichia coli 83972] >gi|227839091|gb|EEJ4955
. . . . Shigella dysenteriae Sd197 ...............................................   58  2 hits [enterobacteria]      integrase [Shigella dysenteriae Sd197] >gi|6759954|gb|AAF28
. . . . Shigella dysenteriae .....................................................   58  1 hit  [enterobacteria]      integrase [Shigella dysenteriae Sd197] >gi|6759954|gb|AAF28
. . . . Shewanella baltica OS223 .................................................   58  6 hits [g-proteobacteria]    integrase family protein [Shewanella baltica OS223] >gi|217
. . . . Shewanella baltica OS185 .................................................   58  2 hits [g-proteobacteria]    phage integrase family protein [Shewanella baltica OS185] >
. . . . Methylibium petroleiphilum PM1 ...........................................   58  6 hits [b-proteobacteria]    hypothetical protein Mpe_A0548 [Methylibium petroleiphilum 
. . . . Polaromonas naphthalenivorans CJ2 ........................................   58  2 hits [b-proteobacteria]    phage integrase family protein [Polaromonas naphthalenivora
. . . . Shewanella baltica OS195 .................................................   58  2 hits [g-proteobacteria]    phage integrase family protein [Shewanella baltica OS195] >
. . . . Acidovorax sp. JS42 ......................................................   58  2 hits [b-proteobacteria]    phage integrase family protein [Acidovorax sp. JS42] >gi|12
. . . . Shewanella baltica OS155 .................................................   57  2 hits [g-proteobacteria]    phage integrase family protein [Shewanella baltica OS155] >
. . . . Pantoea sp. At-9b ........................................................   57  2 hits [enterobacteria]      integrase family protein [Pantoea sp. At-9b] >gi|258534010|
. . . . Vibrio mimicus VM573 .....................................................   56  4 hits [g-proteobacteria]    Integrase [Vibrio mimicus VM573] >gi|258587083|gb|EEW11795.
. . . . Pelobacter propionicus DSM 2379 ..........................................   56  4 hits [d-proteobacteria]    phage integrase family protein [Pelobacter propionicus DSM 
. . . . Shewanella sp. W3-18-1 ...................................................   56  2 hits [g-proteobacteria]    phage integrase family protein [Shewanella sp. W3-18-1] >gi
. . . . Legionella drancourtii LLAP12 ............................................   56  6 hits [g-proteobacteria]    conserved hypothetical protein [Legionella drancourtii LLAP
. . . . Desulfovibrio aespoeensis Aspo-2 .........................................   56  4 hits [d-proteobacteria]    integrase family protein [Desulfovibrio aespoeensis Aspo-2]
. . . . Escherichia coli F11 .....................................................   56  4 hits [enterobacteria]      integrase [Escherichia coli F11] >gi|190909270|gb|EDV68856.
. . . . Escherichia albertii TW07627 .............................................   56  4 hits [enterobacteria]      phage integrase [Escherichia albertii TW07627] >gi|17012351
. . . . Escherichia coli O127:H6 str. E2348/69 ...................................   56  4 hits [enterobacteria]      predicted integrase [Escherichia coli O127:H6 str. E2348/69
. . . . Shewanella denitrificans OS217 ...........................................   56  4 hits [g-proteobacteria]    phage integrase [Shewanella denitrificans OS217] >gi|917165
. . . . Thioalkalivibrio sp. K90mix ..............................................   56  2 hits [g-proteobacteria]    integrase family protein [Thioalkalivibrio sp. K90mix] >gi|
. . . . Yersinia pseudotuberculosis YPIII ........................................   56  8 hits [enterobacteria]      integrase family protein [Yersinia pseudotuberculosis YPIII
. . . . Desulfuromonas acetoxidans DSM 684 .......................................   56  2 hits [d-proteobacteria]    phage integrase [Desulfuromonas acetoxidans DSM 684] >gi|95
. . . . Escherichia coli O157:H7 str. EC4501 .....................................   55  2 hits [enterobacteria]      site-specific recombinase, phage integrase family [Escheric
. . . . Escherichia coli O157:H7 str. TW14588 ....................................   55  2 hits [enterobacteria]      site-specific recombinase, phage integrase family [Escheric
. . . . Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ........   55  2 hits [enterobacteria]      hypothetical protein SPAB_00970 [Salmonella enterica subsp.
. . . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480 ....   55  8 hits [enterobacteria]      hypothetical protein SPAB_00970 [Salmonella enterica subsp.
. . . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .   55  8 hits [enterobacteria]      hypothetical protein SPAB_00970 [Salmonella enterica subsp.
. . . . Nitrosococcus halophilus Nc4 .............................................   55  2 hits [g-proteobacteria]    integrase family protein [Nitrosococcus halophilus Nc4] >gi
. . . . Pseudomonas putida KT2440 ................................................   55  4 hits [g-proteobacteria]    phage integrase, putative [Pseudomonas putida KT2440] >gi|2
. . . . Providencia rettgeri DSM 1131 ............................................   55 12 hits [enterobacteria]      phage integrase [Providencia rettgeri DSM 1131] >gi|2913109
. . . . Acinetobacter baumannii AB900 ............................................   55  1 hit  [g-proteobacteria]    putative integrase from bacteriophage [Acinetobacter bauman
. . . . Enterobacter cancerogenus ATCC 35316 .....................................   55  2 hits [enterobacteria]      site-specific recombinase, phage integrase family [Enteroba
. . . . Acinetobacter baumannii AB307-0294 .......................................   55  2 hits [g-proteobacteria]    Putative prophage CP4-6 integrase [Acinetobacter baumannii 
. . . . Escherichia coli ATCC 8739 ...............................................   55  2 hits [enterobacteria]      integrase family protein [Escherichia coli ATCC 8739] >gi|1
. . . . Campylobacter jejuni subsp. jejuni BH-01-0142 ............................   54  2 hits [e-proteobacteria]    putative Bacteriophage P4 integrase [Campylobacter jejuni s
. . . . Yersinia pseudotuberculosis IP 31758 .....................................   54  4 hits [enterobacteria]      phage integrase family site specific recombinase [Yersinia 
. . . . Erwinia pyrifoliae Ep1/96 ................................................   54  2 hits [enterobacteria]      phage integrase, probably fragment [Erwinia pyrifoliae Ep1/
. . . . Erwinia pyrifoliae DSM 12163 .............................................   54  1 hit  [enterobacteria]      phage integrase, probably fragment [Erwinia pyrifoliae Ep1/
. . . . Acinetobacter baumannii ATCC 19606 .......................................   54  2 hits [g-proteobacteria]    integrase [Acinetobacter baumannii ATCC 19606] >gi|26040897
. . . . Shewanella sp. ANA-3 .....................................................   54  4 hits [g-proteobacteria]    phage integrase family protein [Shewanella sp. ANA-3] >gi|1
. . . . Acinetobacter baumannii ACICU ............................................   54  2 hits [g-proteobacteria]    integrase [Acinetobacter baumannii ACICU] >gi|183208989|gb|
. . . . Ralstonia pickettii 12D ..................................................   54  2 hits [b-proteobacteria]    integrase family protein [Ralstonia pickettii 12D] >gi|2408
. . . . Syntrophus aciditrophicus SB .............................................   54  2 hits [d-proteobacteria]    integrase [Syntrophus aciditrophicus SB] >gi|85722960|gb|AB
. . . . Citrobacter youngae ATCC 29220 ...........................................   54  4 hits [enterobacteria]      site-specific recombinase, phage integrase family [Citrobac
. . . . Escherichia coli O157:H7 str. EC869 ......................................   54  6 hits [enterobacteria]      integrase [Escherichia coli O157:H7 str. EC869] >gi|2612241
. . . . Escherichia coli O157:H7 str. FRIK2000 ...................................   54  3 hits [enterobacteria]      integrase [Escherichia coli O157:H7 str. EC869] >gi|2612241
. . . . Escherichia coli O157:H7 str. FRIK966 ....................................   54  2 hits [enterobacteria]      integrase [Escherichia coli O157:H7 str. EC869] >gi|2612241
. . . . Escherichia coli O157:H7 .................................................   54  1 hit  [enterobacteria]      integrase [Escherichia coli O157:H7 str. EC869] >gi|2612241
. . . . Vibrio sp. 0908 ..........................................................   53  2 hits [g-proteobacteria]    phage integrase, putative [Vibrio sp. 0908] >gi|161761434|g
. . . . Alcanivorax sp. DG881 ....................................................   53  2 hits [g-proteobacteria]    site-specific recombinase, phage integrase family protein [
. . . . Vibrio splendidus 12B01 ..................................................   53  6 hits [g-proteobacteria]    Site-specific recombinase XerD-like [Vibrio splendidus 12B0
. . . . Desulfococcus oleovorans Hxd3 ............................................   53  2 hits [d-proteobacteria]    integrase family protein [Desulfococcus oleovorans Hxd3] >g
. . . . Edwardsiella tarda EIB202 ................................................   53  4 hits [enterobacteria]      putative integrase [Edwardsiella tarda EIB202] >gi|26798643
. . . . Acinetobacter baumannii AYE ..............................................   53  1 hit  [g-proteobacteria]    putative integrase from bacteriophage [Acinetobacter bauman
. . . . Acinetobacter baumannii ..................................................   53  1 hit  [g-proteobacteria]    putative integrase from bacteriophage [Acinetobacter bauman
. . . . Escherichia sp. 4_1_40B ..................................................   53  1 hit  [enterobacteria]      integrase [Escherichia sp. 4_1_40B]
. . . . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ........................   53  2 hits [enterobacteria]      putative phage integrase [Klebsiella pneumoniae subsp. pneu
. . . . Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .................   53  2 hits [enterobacteria]      hypothetical protein SARI_03887 [Salmonella enterica subsp.
. . . . Erwinia amylovora ........................................................   53  1 hit  [enterobacteria]      Integrase [Erwinia amylovora] >gi|292897795|ref|YP_00353716
. . . . Erwinia amylovora ATCC 49946 .............................................   53  2 hits [enterobacteria]      Integrase [Erwinia amylovora] >gi|292897795|ref|YP_00353716
. . . . Erwinia amylovora CFBP1430 ...............................................   53  1 hit  [enterobacteria]      Integrase [Erwinia amylovora] >gi|292897795|ref|YP_00353716
. . . . Escherichia coli .........................................................   53  2 hits [enterobacteria]      phage integrase [Escherichia coli]
. . . . Pectobacterium atrosepticum SCRI1043 .....................................   53  2 hits [enterobacteria]      prophage integrase [Pectobacterium atrosepticum SCRI1043] >
. . . . Xenorhabdus bovienii SS-2004 .............................................   53  8 hits [enterobacteria]      Putative integrase (fragment) [Xenorhabdus bovienii SS-2004
. . . . marine gamma proteobacterium HTCC2148 ....................................   52  2 hits [g-proteobacteria]    site-specific recombinase, phage integrase family [marine g
. . . . Dickeya zeae Ech1591 .....................................................   52  2 hits [enterobacteria]      integrase family protein [Dickeya zeae Ech1591] >gi|2475401
. . . . Vibrio sp. AND4 ..........................................................   52  2 hits [g-proteobacteria]    phage integrase [Vibrio sp. AND4] >gi|159176074|gb|EDP60868
. . . . Vibrio mimicus MB-451 ....................................................   52  2 hits [g-proteobacteria]    phage integrase [Vibrio mimicus MB-451] >gi|261890263|gb|EE
. . . . Escherichia coli E110019 .................................................   52  4 hits [enterobacteria]      integrase [Escherichia coli E110019] >gi|192955766|gb|EDV86
. . . . Vibrio parahaemolyticus 16 ...............................................   52  4 hits [g-proteobacteria]    site-specific recombinase, phage integrase family [Vibrio p
. . . . Geobacter sulfurreducens PCA .............................................   52  2 hits [d-proteobacteria]    integrative genetic element Gsu56, integrase [Geobacter sul
. . . . Oxalobacter formigenes HOxBLS ............................................   52  2 hits [b-proteobacteria]    phage integrase [Oxalobacter formigenes HOxBLS] >gi|2293771
. . . . Shewanella oneidensis MR-1 ...............................................   52  6 hits [g-proteobacteria]    phage integrase family site specific recombinase [Shewanell
. . . . Enterobacter sp. 638 .....................................................   52  2 hits [enterobacteria]      phage integrase family protein [Enterobacter sp. 638] >gi|1
. . . . Geobacter lovleyi SZ .....................................................   52  4 hits [d-proteobacteria]    integrase family protein [Geobacter lovleyi SZ] >gi|1894207
. . . . Pseudomonas syringae pv. tomato T1 .......................................   51  2 hits [g-proteobacteria]    phage integrase [Pseudomonas syringae pv. tomato T1] >gi|21
. . . . Geobacter sp. M18 ........................................................   51  2 hits [d-proteobacteria]    integrase family protein [Geobacter sp. M18] >gi|254985309|
. . . . Shewanella sp. MR-7 ......................................................   51  4 hits [g-proteobacteria]    phage integrase family protein [Shewanella sp. MR-7] >gi|11
. . . . Aliivibrio salmonicida LFI1238 ...........................................   51  2 hits [g-proteobacteria]    shufflon-specific DNA recombinase [Aliivibrio salmonicida L
. . . . Mariprofundus ferrooxydans PV-1 ..........................................   51  2 hits [proteobacteria]      integrative genetic element Gsu32, integrase [Mariprofundus
. . . . Vibrio cholerae AM-19226 .................................................   51  2 hits [g-proteobacteria]    phage integrase [Vibrio cholerae AM-19226] >gi|150424934|gb
. . . . Legionella longbeachae NSW150 ............................................   51  2 hits [g-proteobacteria]    phage-related integrase [Legionella longbeachae NSW150] >gi
. . . . Thiomonas intermedia K12 .................................................   51  2 hits [b-proteobacteria]    integrase family protein [Thiomonas intermedia K12] >gi|256
. . . . Shewanella frigidimarina NCIMB 400 .......................................   51  4 hits [g-proteobacteria]    phage integrase family protein [Shewanella frigidimarina NC
. . . . Janthinobacterium sp. Marseille ..........................................   51  2 hits [b-proteobacteria]    integrase [Janthinobacterium sp. Marseille] >gi|151283442|g
. . . . Pseudomonas aeruginosa PA7 ...............................................   51  2 hits [g-proteobacteria]    phage integrase family site specific recombinase [Pseudomon
. . . . Pectobacterium carotovorum subsp. brasiliensis PBR1692 ...................   51  1 hit  [enterobacteria]      prophage integrase [Pectobacterium carotovorum subsp. brasi
. . . . Pectobacterium wasabiae WPP163 ...........................................   51  4 hits [enterobacteria]      integrase family protein [Pectobacterium wasabiae WPP163] >
. . . . Shigella sp. D9 ..........................................................   51  2 hits [enterobacteria]      integrase family protein [Shigella sp. D9]
. . . . Dickeya dadantii Ech586 ..................................................   51  2 hits [enterobacteria]      integrase family protein [Dickeya dadantii Ech586] >gi|2703
. . . . Legionella pneumophila str. Lens .........................................   51  6 hits [g-proteobacteria]    hypothetical protein lpl2486 [Legionella pneumophila str. L
. . . . Pseudoalteromonas tunicata D2 ............................................   50  4 hits [g-proteobacteria]    phage integrase, putative [Pseudoalteromonas tunicata D2] >
. . . . Burkholderia thailandensis E264 ..........................................   50  2 hits [b-proteobacteria]    phage integrase family site specific recombinase [Burkholde
. . . . Serratia proteamaculans 568 ..............................................   50  2 hits [enterobacteria]      integrase family protein [Serratia proteamaculans 568] >gi|
. . . . Shigella dysenteriae 1012 ................................................   50  4 hits [enterobacteria]      integrase [Shigella dysenteriae 1012] >gi|194419078|gb|EDX3
. . . . Pseudomonas resinovorans .................................................   50  3 hits [g-proteobacteria]    integrase [Pseudomonas resinovorans] >gi|219856987|ref|YP_0
. . . . Pseudomonas putida .......................................................   50  5 hits [g-proteobacteria]    integrase [Pseudomonas resinovorans] >gi|219856987|ref|YP_0
. . . . Desulfobacterium autotrophicum HRM2 ......................................   50  4 hits [d-proteobacteria]    hypothetical protein HRM2_17930 [Desulfobacterium autotroph
. . . . Yersinia kristensenii ATCC 33638 .........................................   50  4 hits [enterobacteria]      Integrase [Yersinia kristensenii ATCC 33638] >gi|238763485|
. . . . Escherichia fergusonii ATCC 35469 ........................................   50  2 hits [enterobacteria]      integrase [Escherichia fergusonii ATCC 35469] >gi|218356964
. . . . Vibrio sp. Ex25 ..........................................................   50  4 hits [g-proteobacteria]    site-specific recombinase, phage integrase family protein [
. . . . Pseudomonas sp. ND6 ......................................................   50  4 hits [g-proteobacteria]    putative integrase [Pseudomonas putida] >gi|38638597|ref|NP
. . . . Pseudomonas fluorescens ..................................................   50  2 hits [g-proteobacteria]    putative integrase [Pseudomonas putida] >gi|38638597|ref|NP
. . . . Haliangium ochraceum DSM 14365 ...........................................   50  2 hits [d-proteobacteria]    tyrosine recombinase XerD [Haliangium ochraceum DSM 14365] 
. . . . Vibrio cholerae V51 ......................................................   50  2 hits [g-proteobacteria]    Integrase [Vibrio cholerae V51] >gi|125622583|gb|EAZ50902.1
. . . . Escherichia coli O111:H- str. 11128 ......................................   50  4 hits [enterobacteria]      putative integrase [Escherichia coli O111:H- str. 11128] >g
. . . . Photorhabdus asymbiotica .................................................   50  4 hits [enterobacteria]      putative phage integrase [Photorhabdus asymbiotica] >gi|253
. . . . Actinobacillus minor 202 .................................................   50  2 hits [g-proteobacteria]    prophage CP4-57-like integrase [Actinobacillus minor 202] >
. . . . Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191 ....   50  1 hit  [enterobacteria]      putative phage integrase [Salmonella enterica subsp. enteri
. . . . Escherichia coli SE15 ....................................................   50  1 hit  [enterobacteria]      putative phage integrase [Escherichia coli SE15]
. . . . Escherichia coli O157:H7 str. EC4113 .....................................   50  6 hits [enterobacteria]      phage integrase family protein [Escherichia coli O157:H7 st
. . . . Escherichia coli O157:H7 str. EC4401 .....................................   50  8 hits [enterobacteria]      phage integrase family protein [Escherichia coli O157:H7 st
. . . . Escherichia coli O157:H7 str. EC4486 .....................................   50  8 hits [enterobacteria]      phage integrase family protein [Escherichia coli O157:H7 st
. . . . Escherichia coli O157:H7 str. EC4196 .....................................   50  6 hits [enterobacteria]      phage integrase family protein [Escherichia coli O157:H7 st
. . . . Escherichia coli O157:H7 str. EC4076 .....................................   50  6 hits [enterobacteria]      phage integrase family protein [Escherichia coli O157:H7 st
. . . . Escherichia coli O157:H7 str. EC508 ......................................   50  8 hits [enterobacteria]      phage integrase family protein [Escherichia coli O157:H7 st
. . . . Escherichia coli O157:H7 str. EC4024 .....................................   50  4 hits [enterobacteria]      phage integrase family protein [Escherichia coli O157:H7 st
. . . . Escherichia coli O157:H7 str. EC4206 .....................................   50  6 hits [enterobacteria]      phage integrase family protein [Escherichia coli O157:H7 st
. . . . Escherichia coli O157:H7 str. EC4045 .....................................   50  6 hits [enterobacteria]      phage integrase family protein [Escherichia coli O157:H7 st
. . . . Escherichia coli O157:H7 str. EC4042 .....................................   50  6 hits [enterobacteria]      phage integrase family protein [Escherichia coli O157:H7 st
. . . . Escherichia coli O157:H7 str. EC4115 .....................................   50  6 hits [enterobacteria]      phage integrase family protein [Escherichia coli O157:H7 st
. . . . Escherichia coli O157:H7 str. TW14359 ....................................   50  6 hits [enterobacteria]      phage integrase family protein [Escherichia coli O157:H7 st
. . . . Xylella fastidiosa Temecula1 .............................................   50  2 hits [g-proteobacteria]    phage-related integrase [Xylella fastidiosa Temecula1] >gi|
. . . . Xylella fastidiosa M23 ...................................................   50  2 hits [g-proteobacteria]    phage-related integrase [Xylella fastidiosa Temecula1] >gi|
. . . . Shigella boydii CDC 3083-94 ..............................................   50  2 hits [enterobacteria]      site-specific recombinase, phage integrase family [Shigella
. . . . Escherichia coli IAI39 ...................................................   50  2 hits [enterobacteria]      putative integrase of prophage [Escherichia coli IAI39] >gi
. . . . Shigella boydii Sb227 ....................................................   50  4 hits [enterobacteria]      putative integrase [Shigella boydii Sb227] >gi|81247419|gb|
. . . . Burkholderia thailandensis TXDOH .........................................   50  1 hit  [b-proteobacteria]    Integrase or site-specific recombinase [Burkholderia thaila
. . . . Pseudomonas putida F1 ....................................................   50  2 hits [g-proteobacteria]    phage integrase family protein [Pseudomonas putida F1] >gi|
. . . . Cardiobacterium hominis ATCC 15826 .......................................   50  2 hits [g-proteobacteria]    phage integrase family site-specific recombinase [Cardiobac
. . . . Dickeya dadantii Ech703 ..................................................   49  2 hits [enterobacteria]      integrase family protein [Dickeya dadantii Ech703] >gi|2421
. . . . Allochromatium vinosum DSM 180 ...........................................   49  4 hits [g-proteobacteria]    integrase family protein [Allochromatium vinosum DSM 180] >
. . . . Erwinia tasmaniensis Et1/99 ..............................................   49  2 hits [enterobacteria]      Prophage integrase [Erwinia tasmaniensis Et1/99] >gi|188029
. . . . Shewanella woodyi ATCC 51908 .............................................   49  2 hits [g-proteobacteria]    integron integrase [Shewanella woodyi ATCC 51908] >gi|16981
. . . . Burkholderia oklahomensis EO147 ..........................................   49  1 hit  [b-proteobacteria]    Integrase or site-specific recombinase [Burkholderia oklaho
. . . . Nitrosomonas sp. AL212 ...................................................   49  2 hits [b-proteobacteria]    integrase family protein [Nitrosomonas sp. AL212] >gi|25497
. . . . Escherichia coli HS ......................................................   49  2 hits [enterobacteria]      site-specific recombinase, phage integrase family protein [
. . . . Polaromonas sp. JS666 ....................................................   49  6 hits [b-proteobacteria]    phage integrase [Polaromonas sp. JS666] >gi|91699880|gb|ABE
. . . . Escherichia coli E24377A .................................................   49  2 hits [enterobacteria]      phage integrase family protein [Escherichia coli E24377A] >
. . . . Escherichia coli 536 .....................................................   49  2 hits [enterobacteria]      phage integrase [Escherichia coli 536] >gi|110342139|gb|ABG
. . . . Alkalilimnicola ehrlichii MLHE-1 .........................................   48  2 hits [g-proteobacteria]    phage integrase family protein [Alkalilimnicola ehrlichii M
. . . . Burkholderia xenovorans LB400 ............................................   48  2 hits [b-proteobacteria]    putative phage integrase [Burkholderia xenovorans LB400] >g
. . . . Hahella chejuensis KCTC 2396 .............................................   48  2 hits [g-proteobacteria]    integrase [Hahella chejuensis KCTC 2396] >gi|83631558|gb|AB
. . . . Vibrio alginolyticus 40B .................................................   48  2 hits [g-proteobacteria]    hypothetical protein VMC_02840 [Vibrio alginolyticus 40B] >
. . . . Yersinia mollaretii ATCC 43969 ...........................................   48  6 hits [enterobacteria]      Site-specific recombinase, phage integrase family [Yersinia
. . . . Pseudomonas syringae pv. tomato str. DC3000 ..............................   48  2 hits [g-proteobacteria]    site-specific recombinase, phage integrase family [Pseudomo
. . . . Yersinia frederiksenii ATCC 33641 ........................................   48  4 hits [enterobacteria]      Integrase [Yersinia frederiksenii ATCC 33641] >gi|238724113
. . . . Escherichia coli SMS-3-5 .................................................   48  2 hits [enterobacteria]      phage integrase family site specific recombinase [Escherich
. . . . Verminephrobacter eiseniae EF01-2 ........................................   48  2 hits [b-proteobacteria]    phage integrase family protein [Verminephrobacter eiseniae 
. . . . Escherichia coli O103:H2 str. 12009 ......................................   48  2 hits [enterobacteria]      phage integrase [Escherichia coli O157:H7 str. EC508] >gi|2
. . . . Syntrophobacter fumaroxidans MPOB ........................................   48  2 hits [d-proteobacteria]    phage integrase family protein [Syntrophobacter fumaroxidan
. . . . Burkholderia pseudomallei 7894 ...........................................   48  1 hit  [b-proteobacteria]    Integrase or site-specific recombinase [Burkholderia pseudo
. . . . Burkholderia pseudomallei 305 ............................................   48  2 hits [b-proteobacteria]    site-specific recombinase, phage integrase family [Burkhold
. . . . Burkholderia pseudomallei 1106a ..........................................   48  2 hits [b-proteobacteria]    phage integrase family site specific recombinase [Burkholde
. . . . Burkholderia pseudomallei 9 ..............................................   48  1 hit  [b-proteobacteria]    phage integrase family site specific recombinase [Burkholde
. . . . Burkholderia pseudomallei Pakistan 9 .....................................   48  2 hits [b-proteobacteria]    phage integrase family site specific recombinase [Burkholde
. . . . Burkholderia pseudomallei 1106b ..........................................   48  2 hits [b-proteobacteria]    phage integrase family site specific recombinase [Burkholde
. . . . Burkholderia pseudomallei 1710b ..........................................   48  2 hits [b-proteobacteria]    integrase or site-specific recombinase [Burkholderia pseudo
. . . . Shewanella halifaxensis HAW-EB4 ..........................................   48  2 hits [g-proteobacteria]    integrase family protein [Shewanella halifaxensis HAW-EB4] 
. . . . Burkholderia pseudomallei 668 ............................................   48  2 hits [b-proteobacteria]    phage integrase family site specific recombinase [Burkholde
. . . . Sodalis glossinidius .....................................................   48  2 hits [enterobacteria]      hypothetical protein pSG3GP_12 [Sodalis glossinidius] >gi|6
. . . . Burkholderia pseudomallei K96243 .........................................   48  2 hits [b-proteobacteria]    putative phage integrase [Burkholderia pseudomallei K96243]
. . . . Burkholderia pseudomallei 14 .............................................   48  1 hit  [b-proteobacteria]    putative phage integrase [Burkholderia pseudomallei K96243]
. . . . Burkholderia pseudomallei 91 .............................................   48  1 hit  [b-proteobacteria]    putative phage integrase [Burkholderia pseudomallei K96243]
. . . . Burkholderia pseudomallei B7210 ..........................................   48  1 hit  [b-proteobacteria]    putative phage integrase [Burkholderia pseudomallei K96243]
. . . . Burkholderia pseudomallei Pasteur 52237 ..................................   48  2 hits [b-proteobacteria]    putative phage integrase [Burkholderia pseudomallei K96243]
. . . . Burkholderia pseudomallei 1710a ..........................................   48  2 hits [b-proteobacteria]    putative phage integrase [Burkholderia pseudomallei K96243]
. . . . Escherichia coli 101-1 ...................................................   48  2 hits [enterobacteria]      phage integrase family protein [Escherichia coli 101-1] >gi
. . . . Vibrio vulnificus YJ016 ..................................................   48  2 hits [g-proteobacteria]    phage integrase [Vibrio vulnificus YJ016] >gi|37201059|dbj|
. . . . Desulfovibrio vulgaris DP4 ...............................................   48  2 hits [d-proteobacteria]    phage integrase family protein [Desulfovibrio vulgaris subs
. . . . Achromobacter piechaudii ATCC 43553 ......................................   48  2 hits [b-proteobacteria]    phage integrase family site-specfic recombinase [Achromobac
. . . . Sulfurovum sp. NBC37-1 ...................................................   48  2 hits [e-proteobacteria]    phage integrase family site specific recombinase [Sulfurovu
. . . . Escherichia coli 55989 ...................................................   48  2 hits [enterobacteria]      putative prophage CPS-53 integrase [Escherichia coli 55989]
. . . . Legionella pneumophila subsp. pneumophila str. Philadelphia 1 ............   48  6 hits [g-proteobacteria]    integrase, phage related [Legionella pneumophila subsp. pne
. . . . Photobacterium damselae subsp. damselae CIP 102761 .......................   48  4 hits [g-proteobacteria]    hypothetical protein VDA_002035 [Photobacterium damselae su
. . . . Variovorax paradoxus S110 ................................................   48  2 hits [b-proteobacteria]    integrase family protein [Variovorax paradoxus S110] >gi|23
. . . . Escherichia coli SE11 ....................................................   47  2 hits [enterobacteria]      putative phage integrase [Escherichia coli SE11] >gi|209910
. . . . Yersinia rohdei ATCC 43380 ...............................................   47  2 hits [enterobacteria]      Integrase [Yersinia rohdei ATCC 43380] >gi|238710773|gb|EEQ
. . . . Burkholderia pseudomallei MSHR346 ........................................   47  2 hits [b-proteobacteria]    integrase or site-specific recombinase [Burkholderia pseudo
. . . . Burkholderia pseudomallei 1655 ...........................................   47  2 hits [b-proteobacteria]    integrase or site-specific recombinase [Burkholderia pseudo
. . . . Geobacter uraniireducens Rf4 .............................................   47  2 hits [d-proteobacteria]    phage integrase family protein [Geobacter uraniireducens Rf
. . . . Nitrosospira multiformis ATCC 25196 ......................................   47  2 hits [b-proteobacteria]    Phage integrase [Nitrosospira multiformis ATCC 25196] >gi|8
. . . . Klebsiella pneumoniae NTUH-K2044 .........................................   47  2 hits [enterobacteria]      phage integrase family protein [Klebsiella pneumoniae NTUH-
. . . . Burkholderia phymatum STM815 .............................................   47  2 hits [b-proteobacteria]    integrase family protein [Burkholderia phymatum STM815] >gi
. . . . Escherichia coli ED1a ....................................................   47  4 hits [enterobacteria]      Integrase from prophage [Escherichia coli ED1a] >gi|2184285
. . . . Pseudomonas syringae pv. oryzae str. 1_6 .................................   47  1 hit  [g-proteobacteria]    phage integrase, putative [Pseudomonas syringae pv. oryzae 
. . . . Vibrio mimicus VM223 .....................................................   47  2 hits [g-proteobacteria]    phage integrase family protein [Vibrio mimicus VM223] >gi|2
. . . . Desulfatibacillum alkenivorans AK-01 .....................................   47  2 hits [d-proteobacteria]    integrase family protein [Desulfatibacillum alkenivorans AK
. . . . Xylella fastidiosa Dixon .................................................   47  6 hits [g-proteobacteria]    Phage integrase [Xylella fastidiosa Dixon] >gi|71898068|ref
. . . . Xylella fastidiosa subsp. sandyi Ann-1 ...................................   47  6 hits [g-proteobacteria]    Phage integrase [Xylella fastidiosa Dixon] >gi|71898068|ref
. . . . Xylella fastidiosa M12 ...................................................   47  2 hits [g-proteobacteria]    Phage integrase [Xylella fastidiosa Dixon] >gi|71898068|ref
. . . . Vibrio sp. RC341 .........................................................   47  2 hits [g-proteobacteria]    phage integrase family protein [Vibrio sp. RC341] >gi|26084
. . . . Nitrosococcus oceani ATCC 19707 ..........................................   47  2 hits [g-proteobacteria]    Phage integrase [Nitrosococcus oceani ATCC 19707] >gi|25443
. . . . Nitrosococcus oceani AFC27 ...............................................   47  2 hits [g-proteobacteria]    Phage integrase [Nitrosococcus oceani ATCC 19707] >gi|25443
. . . . Yersinia pestis KIM 10 ...................................................   47  4 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443140|ref|NP_9946
. . . . Yersinia pestis biovar Microtus str. 91001 ...............................   47  4 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443140|ref|NP_9946
. . . . Yersinia pestis Antiqua ..................................................   47  4 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443140|ref|NP_9946
. . . . Yersinia pestis Nepal516 .................................................   47  8 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443140|ref|NP_9946
. . . . Yersinia pestis Pestoides F ..............................................   47  4 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443140|ref|NP_9946
. . . . Yersinia pestis CA88-4125 ................................................   47  4 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443140|ref|NP_9946
. . . . Yersinia pestis biovar Orientalis str. F1991016 ..........................   47  4 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443140|ref|NP_9946
. . . . Yersinia pestis biovar Orientalis str. IP275 .............................   47  4 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443140|ref|NP_9946
. . . . Yersinia pestis biovar Antiqua str. E1979001 .............................   47  4 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443140|ref|NP_9946
. . . . Yersinia pestis biovar Antiqua str. B42003004 ............................   47  4 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443140|ref|NP_9946
. . . . Yersinia pestis biovar Antiqua str. UG05-0454 ............................   47  4 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443140|ref|NP_9946
. . . . Yersinia pestis biovar Orientalis str. MG05-1020 .........................   47  4 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443140|ref|NP_9946
. . . . Yersinia pestis biovar Mediaevalis str. K1973002 .........................   47  4 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443140|ref|NP_9946
. . . . Yersinia pestis FV-1 .....................................................   47  2 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443140|ref|NP_9946
. . . . Yersinia pestis CO92 .....................................................   47  4 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443140|ref|NP_9946
. . . . Yersinia pestis Pestoides A ..............................................   47  4 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443140|ref|NP_9946
. . . . Yersinia pestis biovar Orientalis str. PEXU2 .............................   47  4 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443140|ref|NP_9946
. . . . Yersinia pestis biovar Orientalis str. India 195 .........................   47  4 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443140|ref|NP_9946
. . . . Yersinia pestis KIM D27 ..................................................   47  4 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443140|ref|NP_9946
. . . . Yersinia pestis D106004 ..................................................   47  2 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443140|ref|NP_9946
. . . . Yersinia pestis D182038 ..................................................   47  2 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443140|ref|NP_9946
. . . . Vibrio metschnikovii CIP 69.14 ...........................................   46  2 hits [g-proteobacteria]    site-specific recombinase phage integrase family [Vibrio me
. . . . Bordetella bronchiseptica RB50 ...........................................   46  2 hits [b-proteobacteria]    phage-related integrase [Bordetella bronchiseptica RB50] >g
. . . . Yersinia pestis Angola ...................................................   46  4 hits [enterobacteria]      phage integrase family site specific recombinase [Yersinia 
. . . . Pectobacterium carotovorum subsp. carotovorum PC1 ........................   46  4 hits [enterobacteria]      integrase family protein [Pectobacterium carotovorum subsp.
. . . . Escherichia sp. 1_1_43 ...................................................   46  2 hits [enterobacteria]      integrase [Escherichia sp. 1_1_43] >gi|226838824|gb|EEH7085
. . . . Escherichia coli B171 ....................................................   46  2 hits [enterobacteria]      phage integrase family protein [Escherichia coli B171] >gi|
. . . . Escherichia coli O111:H- .................................................   46  1 hit  [enterobacteria]      phage integrase family protein [Escherichia coli B171] >gi|
. . . . Burkholderia ambifaria MEX-5 .............................................   46  2 hits [b-proteobacteria]    integrase family protein [Burkholderia ambifaria MEX-5] >gi
. . . . Yersinia aldovae ATCC 35236 ..............................................   46  2 hits [enterobacteria]      Integrase [Yersinia aldovae ATCC 35236] >gi|238702699|gb|EE
. . . . Cronobacter sakazakii ATCC BAA-894 .......................................   46  4 hits [enterobacteria]      hypothetical protein ESA_04087 [Cronobacter sakazakii ATCC 
. . . . Eikenella corrodens ATCC 23834 ...........................................   46  2 hits [b-proteobacteria]    hypothetical protein EIKCOROL_00560 [Eikenella corrodens AT
. . . . Pseudomonas syringae pv. aesculi str. NCPPB3681 ..........................   46  1 hit  [g-proteobacteria]    phage integrase family site specific recombinase [Pseudomon
. . . . Desulfurivibrio alkaliphilus AHT2 ........................................   46  2 hits [d-proteobacteria]    integrase family protein [Desulfurivibrio alkaliphilus AHT2
. . . . Pseudomonas putida W619 ..................................................   46  2 hits [g-proteobacteria]    integrase family protein [Pseudomonas putida W619] >gi|1697
. . . . Halorhodospira halophila SL1 .............................................   46  2 hits [g-proteobacteria]    phage integrase family protein [Halorhodospira halophila SL
. . . . Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 .................   46  2 hits [enterobacteria]      phage integrase family site-specific recombinase [Klebsiell
. . . . Photorhabdus luminescens subsp. laumondii TTO1 ...........................   46  2 hits [enterobacteria]      hypothetical protein plu0125 [Photorhabdus luminescens subs
. . . . Yersinia pestis Z176003 ..................................................   46  2 hits [enterobacteria]      integrase [Yersinia pestis KIM 10] >gi|45443318|ref|NP_9948
. . . . Yersinia pseudotuberculosis IP 32953 .....................................   46  2 hits [enterobacteria]      putative phage integrase. [Yersinia pseudotuberculosis IP 3
. . . . Yersinia pseudotuberculosis PB1/+ ........................................   46  2 hits [enterobacteria]      putative phage integrase. [Yersinia pseudotuberculosis IP 3
. . . . gamma proteobacterium NOR51-B ............................................   46  2 hits [g-proteobacteria]    phage integrase family protein [gamma proteobacterium NOR51
. . . . Kingella oralis ATCC 51147 ...............................................   46  2 hits [b-proteobacteria]    hypothetical protein GCWU000324_00320 [Kingella oralis ATCC
. . . . Anaeromyxobacter sp. Fw109-5 .............................................   46  2 hits [d-proteobacteria]    phage integrase family protein [Anaeromyxobacter sp. Fw109-
. . . . Delftia acidovorans SPH-1 ................................................   46  2 hits [b-proteobacteria]    integrase family protein [Delftia acidovorans SPH-1] >gi|16
. . . . Vibrio splendidus LGP32 ..................................................   46  2 hits [g-proteobacteria]    phage integrase [Vibrio splendidus LGP32] >gi|218322678|emb
. . . . Escherichia coli O26:H11 str. 11368 ......................................   46  2 hits [enterobacteria]      prophage integrase [Shigella dysenteriae 1012] >gi|26085616
. . . . Escherichia coli APEC O1 .................................................   46  2 hits [enterobacteria]      integrase-like protein [Escherichia coli APEC O1] >gi|11551
. . . . Xylella fastidiosa 9a5c ..................................................   46  2 hits [g-proteobacteria]    phage-related integrase [Xylella fastidiosa 9a5c] >gi|91055
. . . . Citrobacter sp. 30_2 .....................................................   46  2 hits [enterobacteria]      site-specific recombinase [Citrobacter sp. 30_2] >gi|226905
. . . . Actinobacillus minor NM305 ...............................................   45  2 hits [g-proteobacteria]    phage integrase family protein [Actinobacillus minor NM305]
. . . . Acinetobacter haemolyticus ATCC 19194 ....................................   45  2 hits [g-proteobacteria]    phage integrase family site-specific recombinase [Acinetoba
. . . Hydrogenivirga sp. 128-5-R1-1 ----------------------------------------------   68  8 hits [aquificales]         phage integrase family protein [Hydrogenivirga sp. 128-5-R1
. . . Psychroflexus torquis ATCC 700755 ..........................................   56  2 hits [CFB group bacteria]  putative site-specific recombinase [Psychroflexus torquis A
. . . Candidatus Desulforudis audaxviator MP104C .................................   55  2 hits [firmicutes]          phage integrase family protein [Candidatus Desulforudis aud
. . . Denitrovibrio acetiphilus DSM 12809 ........................................   53  2 hits [bacteria]            integrase family protein [Denitrovibrio acetiphilus DSM 128
. . . Clostridium papyrosolvens DSM 2782 .........................................   53  2 hits [firmicutes]          integrase family protein [Clostridium papyrosolvens DSM 278
. . . Ammonifex degensii KC4 .....................................................   52  2 hits [firmicutes]          integrase family protein [Ammonifex degensii KC4] >gi|26086
. . . uncultured bacterium .......................................................   51  4 hits [bacteria]            integrase [uncultured bacterium] >gi|116235022|dbj|BAF34951
. . . Leptospirillum ferrodiazotrophum ...........................................   51  3 hits [bacteria]            phage integrase family protein [Leptospirillum ferrodiazotr
. . . Thermodesulfovibrio yellowstonii DSM 11347 .................................   51  2 hits [bacteria]            site specific recombinase [Thermodesulfovibrio yellowstonii
. . . Bacillus clausii KSM-K16 ...................................................   50  2 hits [firmicutes]          site-specific tyrosine recombinase [Bacillus clausii KSM-K1
. . . Bacteroides cellulosilyticus DSM 14838 .....................................   50  2 hits [CFB group bacteria]  hypothetical protein BACCELL_02310 [Bacteroides cellulosily
. . . Candidatus Kuenenia stuttgartiensis ........................................   49  1 hit  [planctomycetes]      similar to site-specific tyrosine recombinase [Candidatus K
. . . Caldicellulosiruptor saccharolyticus DSM 8903 ..............................   49  2 hits [firmicutes]          phage integrase family protein [Caldicellulosiruptor saccha
. . . Dyadobacter fermentans DSM 18053 ...........................................   49  2 hits [CFB group bacteria]  integrase family protein [Dyadobacter fermentans DSM 18053]
. . . Brevibacillus brevis NBRC 100599 ...........................................   48  2 hits [firmicutes]          hypothetical protein BBR47_54120 [Brevibacillus brevis NBRC
. . . Staphylococcus capitis SK14 ................................................   48  2 hits [firmicutes]          tyrosine recombinase XerC [Staphylococcus capitis SK14] >gi
. . . Leptospirillum sp. Group II '5-way CG' .....................................   48  2 hits [bacteria]            Integrase [Leptospirillum sp. Group II '5-way CG']
. . . Flavobacteria bacterium BBFL7 ..............................................   48  2 hits [CFB group bacteria]  site-specific integrase/recombinase XerD protein [Flavobact
. . . Catenulispora acidiphila DSM 44928 .........................................   48  2 hits [high GC Gram+]       tyrosine recombinase XerD [Catenulispora acidiphila DSM 449
. . . Synechocystis sp. PCC 6803 .................................................   48  6 hits [cyanobacteria]       hypothetical protein slr5010 [Synechocystis sp. PCC 6803] >
. . . Prevotella sp. oral taxon 299 str. F0039 ...................................   48  2 hits [CFB group bacteria]  tyrosine type site-specific recombinase [Prevotella sp. ora
. . . Bacteroides capillosus ATCC 29799 ..........................................   48  2 hits [CFB group bacteria]  hypothetical protein BACCAP_04089 [Bacteroides capillosus A
. . . Capnocytophaga sputigena ATCC 33612 ........................................   48  2 hits [CFB group bacteria]  tyrosine recombinase XerC [Capnocytophaga sputigena Capno] 
. . . Elusimicrobium minutum Pei191 ..............................................   47  2 hits [bacteria]            integrase family protein [Elusimicrobium minutum Pei191] >g
. . . Ruminococcus flavefaciens FD-1 .............................................   47  1 hit  [firmicutes]          phage integrase family site specific recombinase [Ruminococ
. . . Listeria grayi DSM 20601 ...................................................   47  2 hits [firmicutes]          possible integrase/recombinase XerD [Listeria grayi DSM 206
. . . Capnocytophaga ochracea DSM 7271 ...........................................   47  2 hits [CFB group bacteria]  integrase family protein [Capnocytophaga ochracea DSM 7271]
. . . Algoriphagus sp. PR1 .......................................................   47  2 hits [CFB group bacteria]  putative site-specific recombinase [Algoriphagus sp. PR1] >
. . . Staphylococcus epidermidis M23864:W1 .......................................   47  2 hits [firmicutes]          tyrosine recombinase XerC [Staphylococcus epidermidis M2386
. . . Bacteroides stercoris ATCC 43183 ...........................................   47  2 hits [CFB group bacteria]  hypothetical protein BACSTE_02226 [Bacteroides stercoris AT
. . . Bacillus cellulosilyticus DSM 2522 .........................................   47  2 hits [firmicutes]          tyrosine recombinase XerD [Bacillus cellulosilyticus DSM 25
. . . Porphyromonas endodontalis ATCC 35406 ......................................   47  2 hits [CFB group bacteria]  tyrosine recombinase XerD [Porphyromonas endodontalis ATCC 
. . . Bacteroides eggerthii DSM 20697 ............................................   47  2 hits [CFB group bacteria]  hypothetical protein BACEGG_01212 [Bacteroides eggerthii DS
. . . Listeria welshimeri serovar 6b str. SLCC5334 ...............................   47  2 hits [firmicutes]          integrase/recombinase [Listeria welshimeri serovar 6b str. 
. . . Bacillus mycoides DSM 2048 .................................................   47  2 hits [firmicutes]          Integrase/recombinase [Bacillus mycoides DSM 2048] >gi|2287
. . . Flavobacteriales bacterium HTCC2170 ........................................   46  2 hits [CFB group bacteria]  putative site-specific recombinase [Flavobacteriales bacter
. . . Lysinibacillus sphaericus ..................................................   46  2 hits [firmicutes]          putative XerD-like integrase/recombinase [Bacillus sphaeric
. . . Clostridium ramosum DSM 1402 ...............................................   46  2 hits [firmicutes]          hypothetical protein CLORAM_02507 [Clostridium ramosum DSM 
. . . Subdoligranulum variabile DSM 15176 ........................................   46  2 hits [firmicutes]          tyrosine recombinase XerC [Subdoligranulum variabile DSM 15
. . . Mollicutes bacterium D7 ....................................................   46  2 hits [mycoplasmas]         site-specific tyrosine recombinase xerD [Mollicutes bacteri
. . . Robiginitalea biformata HTCC2501 ...........................................   46  2 hits [CFB group bacteria]  putative site-specific recombinase [Robiginitalea biformata
. . . Flavobacteria bacterium MS024-2A ...........................................   46  2 hits [CFB group bacteria]  integrase family protein [Flavobacteria bacterium MS024-2A]
. . . Pedobacter heparinus DSM 2366 ..............................................   46  2 hits [CFB group bacteria]  tyrosine recombinase XerD [Pedobacter heparinus DSM 2366] >
. . . Prevotella ruminicola 23 ...................................................   46  1 hit  [CFB group bacteria]  prophage PRU01, site-specific recombinase, phage integrase 
. . . Bacillus cereus Q1 .........................................................   46  2 hits [firmicutes]          site-specific integrase/recombinase [Bacillus cereus Q1] >g
. . . Bacillus cereus AH676 ......................................................   46  2 hits [firmicutes]          site-specific integrase/recombinase [Bacillus cereus Q1] >g
. . . Fibrobacter succinogenes subsp. succinogenes S85 ...........................   46  2 hits [bacteria]            integrase family protein [Fibrobacter succinogenes subsp. s
. . . Bacillus cereus NVH0597-99 .................................................   46  2 hits [firmicutes]          integrase/recombinase [Bacillus cereus NVH0597-99] >gi|1960
. . . Staphylococcus lugdunensis HKU09-01 ........................................   46  2 hits [firmicutes]          Site-specific tyrosine recombinase [Staphylococcus lugdunen
. . . Clostridium sp. L2-50 ......................................................   46  2 hits [firmicutes]          hypothetical protein CLOL250_00082 [Clostridium sp. L2-50] 
. . . Listeria monocytogenes HCC23 ...............................................   46  2 hits [firmicutes]          tyrosine recombinase XerD [Listeria monocytogenes HCC23] >g
. . . Listeria monocytogenes FSL N1-017 ..........................................   46  1 hit  [firmicutes]          tyrosine recombinase XerD [Listeria monocytogenes HCC23] >g
. . . Listeria monocytogenes FSL J2-071 ..........................................   46  2 hits [firmicutes]          tyrosine recombinase XerD [Listeria monocytogenes HCC23] >g
. . . Listeria monocytogenes str. 4b F2365 .......................................   46  3 hits [firmicutes]          integrase/recombinase XerD [Listeria monocytogenes str. 4b 
. . . Listeria monocytogenes str. 4b H7858 .......................................   46  2 hits [firmicutes]          integrase/recombinase XerD [Listeria monocytogenes str. 4b 
. . . Listeria monocytogenes Clip80459 ...........................................   46  2 hits [firmicutes]          integrase/recombinase XerD [Listeria monocytogenes str. 4b 
. . . Listeria monocytogenes FSL J1-194 ..........................................   46  2 hits [firmicutes]          integrase/recombinase XerD [Listeria monocytogenes str. 4b 
. . . Listeria monocytogenes FSL R2-503 ..........................................   46  2 hits [firmicutes]          integrase/recombinase XerD [Listeria monocytogenes str. 4b 
. . . Listeria monocytogenes HPB2262 .............................................   46  2 hits [firmicutes]          integrase/recombinase XerD [Listeria monocytogenes str. 4b 
. . . Listeria monocytogenes FSL J2-064 ..........................................   46  1 hit  [firmicutes]          integrase/recombinase XerD [Listeria monocytogenes str. 4b 
. . . Listeria monocytogenes FSL J1-175 ..........................................   46  1 hit  [firmicutes]          integrase/recombinase XerD [Listeria monocytogenes str. 4b 
. . . Staphylococcus carnosus subsp. carnosus TM300 ..............................   46  3 hits [firmicutes]          putative site-specific recombinase XerC [Staphylococcus car
. . . Listeria monocytogenes FSL J2-003 ..........................................   45  1 hit  [firmicutes]          hypothetical protein LmonocytFSL_08880 [Listeria monocytoge
. . . Listeria monocytogenes 10403S ..............................................   45  1 hit  [firmicutes]          hypothetical protein Lmon1_08823 [Listeria monocytogenes 10
. . . Listeria monocytogenes 08-5578 .............................................   45  2 hits [firmicutes]          hypothetical protein Lmon1_08823 [Listeria monocytogenes 10
. . . Listeria monocytogenes 08-5923 .............................................   45  2 hits [firmicutes]          hypothetical protein Lmon1_08823 [Listeria monocytogenes 10
. . . Listeria monocytogenes EGD-e ...............................................   45  2 hits [firmicutes]          hypothetical protein lmo1955 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes str. 1/2a F6854 .....................................   45  2 hits [firmicutes]          hypothetical protein lmo1955 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes Finland 1988 ........................................   45  1 hit  [firmicutes]          hypothetical protein lmo1955 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes FSL R2-561 ..........................................   45  1 hit  [firmicutes]          hypothetical protein lmo1955 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes FSL N3-165 ..........................................   45  2 hits [firmicutes]          hypothetical protein lmo1955 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes J0161 ...............................................   45  1 hit  [firmicutes]          hypothetical protein lmo1955 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes J2818 ...............................................   45  2 hits [firmicutes]          hypothetical protein lmo1955 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes F6900 ...............................................   45  2 hits [firmicutes]          hypothetical protein lmo1955 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes LO28 ................................................   45  1 hit  [firmicutes]          hypothetical protein lmo1955 [Listeria monocytogenes EGD-e]
. . . Listeria monocytogenes .....................................................   45  1 hit  [firmicutes]          hypothetical protein lmo1955 [Listeria monocytogenes EGD-e]
. . Aciduliprofundum boonei T469 -------------------------------------------------   50  4 hits [euryarchaeotes]      site-specific recombinase, phage integrase family protein [
. Plasmid pFKY1 ------------------------------------------------------------------   51  1 hit  [other sequences]     integrase [uncultured bacterium] >gi|116235022|dbj|BAF34951
. Enterobacteria phage 2851 ......................................................   51  1 hit  [viruses]             putative prophage integrase. [Enterobacteria phage 2851]
. Stx2-converting phage 1717 .....................................................   50  2 hits [viruses]             phage integrase family protein [Escherichia coli O157:H7 st
. Sodalis phage phiSG1 ...........................................................   48  3 hits [viruses]             hypothetical protein SGPHI_0037 [Sodalis phage phiSG1] >gi|
. Stx2-converting phage 86 .......................................................   48  2 hits [viruses]             integrase [Stx2-converting phage 86] >gi|168757392|ref|ZP_0

BLAST

PROTOCOL


BLASTp versus NR.NCBI/ default parameters except for "max target sequences _ 1000"


BLASTx versus NR.NCBI/ default parameters except for "max target sequences _ 1000"



RESULTS ANALYSIS


As mentioned in the ORFind Result Analysis, both BLASTp and BLASTx returned low E-values, 4e-23 and 3e-21 for the first hits and score values equal to 111 and 106, respectively, indicating that the homologies returned have fairly high statistical significance. In this case the first hits are homologies to possible phage-related integrase, results that indeed match protein domains output.Since the better E-value (4e-23) was obtained for BLASTp the following work was developed using solely BLASTp results.



RAW RESULTS

>PROTEIN BLAST
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_01004335.1|  possible phage-related integrase [Loktanel...   111    4e-23
ref|ZP_01901151.1|  site-specific recombinase, phage integrase...   103    6e-21
ref|YP_001240859.1|  putative phage-like integrase [Bradyrhizo...   102    1e-20
ref|ZP_05065481.1|  putative phage-related integrase [Octadeca...   102    2e-20
ref|ZP_01056028.1|  site-specific recombinase, phage integrase...  95.9    1e-18
ref|YP_510842.1|  phage integrase [Jannaschia sp. CCS1] >gb|AB...  95.1    3e-18
ref|ZP_05113718.1|  site-specific recombinase, phage integrase...  92.0    2e-17
ref|YP_002362394.1|  integrase family protein [Methylocella si...  90.1    7e-17
ref|YP_001166328.1|  phage integrase family protein [Rhodobact...  89.0    2e-16
ref|YP_164918.1|  phage integrase family site specific recombi...  87.8    4e-16
ref|YP_001234301.1|  phage integrase family protein [Acidiphil...  87.0    6e-16
ref|YP_002526687.1|  phage-related integrase [Rhodobacter spha...  83.6    8e-15
ref|YP_001773406.1|  integrase family protein [Methylobacteriu...  83.2    1e-14
ref|ZP_01011628.1|  site-specific recombinase, phage integrase...  83.2    1e-14
ref|ZP_01102601.1|  phage integrase [Congregibacter litoralis ...  82.8    1e-14
ref|YP_002290412.1|  phage integrase family protein [Oligotrop...  80.9    4e-14
ref|YP_353289.1|  phage-related integrase [Rhodobacter sphaero...  80.9    5e-14
ref|ZP_00053692.1|  COG0582: Integrase [Magnetospirillum magne...  80.1    9e-14
ref|ZP_06349028.1|  integrase family protein [Rhodomicrobium v...  79.7    1e-13
ref|ZP_01157942.1|  site-specific recombinase, phage integrase...  79.0    2e-13
ref|ZP_03738976.1|  integrase family protein [Desulfonatronosp...  78.6    2e-13
ref|ZP_05055230.1|  site-specific recombinase, phage integrase...  77.0    7e-13
ref|YP_420017.1|  integrase [Magnetospirillum magneticum AMB-1...  76.6    9e-13
ref|YP_003448049.1|  phage integrase family protein [Azospiril...  75.5    2e-12
ref|ZP_01290806.1|  Phage integrase [delta proteobacterium MLM...  75.1    3e-12
ref|YP_001639926.1|  integrase family protein [Methylobacteriu...  75.1    3e-12
ref|ZP_01047462.1|  possible phage-related integrase [Nitrobac...  75.1    3e-12
ref|YP_001370389.1|  phage integrase family protein [Ochrobact...  73.6    8e-12
ref|ZP_01292090.1|  Phage integrase [delta proteobacterium MLM...  72.0    2e-11
ref|ZP_05073527.1|  phage-related integrase [Rhodobacterales b...  71.6    3e-11
ref|YP_002422144.1|  integrase family protein [Methylobacteriu...  70.9    5e-11
ref|ZP_06360748.1|  integrase family protein [Rhodopseudomonas...  70.1    9e-11
ref|YP_002825704.1|  DNA integration/recombination/invertion p...  69.7    1e-10
ref|YP_001249431.1|  integrase, phage related [Legionella pneu...  69.7    1e-10
ref|ZP_03738738.1|  integrase family protein [Desulfonatronosp...  69.3    1e-10
ref|ZP_03739246.1|  integrase family protein [Desulfonatronosp...  69.3    1e-10
ref|ZP_02177906.1|  phage integrase family protein [Hydrogeniv...  68.2    3e-10
ref|ZP_06351642.1|  integrase family protein [Rhodomicrobium v...  68.2    3e-10
emb|CBG34996.1|  putative prophage terminase, large subunit [E...  67.8    4e-10
ref|ZP_05786981.1|  phage integrase family protein [Silicibact...  66.6    9e-10
ref|YP_533717.1|  phage integrase [Rhodopseudomonas palustris ...  65.9    2e-09
ref|YP_002513830.1|  integrase family protein [Thioalkalivibri...  64.7    3e-09
ref|YP_495588.1|  phage integrase [Novosphingobium aromaticivo...  64.7    4e-09
ref|YP_316433.1|  hypothetical protein Tbd_2675 [Thiobacillus ...  64.3    4e-09
ref|ZP_06186309.1|  phage integrase family site-specific recom...  63.2    1e-08
ref|YP_486913.1|  Phage integrase [Rhodopseudomonas palustris ...  62.8    1e-08
ref|YP_941865.1|  phage integrase family protein [Psychromonas...  62.8    2e-08
ref|ZP_01015423.1|  Phage integrase [Rhodobacterales bacterium...  62.0    2e-08
ref|YP_122423.1|  hypothetical protein lpp0072 [Legionella pne...  62.0    2e-08
ref|YP_782900.1|  phage integrase family protein [Rhodopseudom...  61.6    3e-08
ref|ZP_06050688.1|  site-specific recombinase phage integrase ...  61.6    3e-08
ref|YP_001218546.1|  phage integrase family site specific reco...  61.6    3e-08
emb|CBA73984.1|  phage integrase [Arsenophonus nasoniae]           61.2    4e-08
ref|ZP_01017021.1|  Phage integrase [Parvularcula bermudensis ...  61.2    4e-08
ref|ZP_05051673.1|  site-specific recombinase, phage integrase...  60.5    6e-08
ref|YP_001203398.1|  putative phage-like integrase [Bradyrhizo...  60.5    6e-08
ref|ZP_04402179.1|  site-specific recombinase phage integrase ...  60.5    7e-08
ref|YP_003188786.1|  phage DNA recombinase [Acetobacter pasteu...  60.1    9e-08
ref|ZP_05104443.1|  site-specific recombinase, phage integrase...  60.1    9e-08
ref|ZP_03739174.1|  integrase family protein [Desulfonatronosp...  59.7    1e-07
ref|ZP_05078878.1|  phage integrase [Rhodobacterales bacterium...  59.7    1e-07
ref|YP_001938392.1|  putative integrase [Orientia tsutsugamush...  59.7    1e-07
ref|YP_001937628.1|  putative integrase [Orientia tsutsugamush...  59.3    2e-07
ref|YP_003020636.1|  integrase family protein [Geobacter sp. M...  59.3    2e-07
ref|NP_949418.1|  phage-like integrase [Rhodopseudomonas palus...  58.9    2e-07
ref|ZP_04001618.1|  integrase [Escherichia coli 83972] >gb|EEJ...  58.9    2e-07
ref|YP_001938289.1|  putative integrase [Orientia tsutsugamush...  58.9    2e-07
ref|ZP_02188156.1|  phage integrase [alpha proteobacterium BAL...  58.9    2e-07
ref|YP_403016.1|  integrase [Shigella dysenteriae Sd197] >gb|A...  58.5    2e-07
ref|YP_002356739.1|  integrase family protein [Shewanella balt...  58.5    2e-07
ref|YP_001364993.1|  phage integrase family protein [Shewanell...  58.5    2e-07
ref|YP_001019745.1|  hypothetical protein Mpe_A0548 [Methylibi...  58.2    3e-07
ref|YP_982512.1|  phage integrase family protein [Polaromonas ...  58.2    3e-07
ref|YP_001553243.1|  phage integrase family protein [Shewanell...  58.2    4e-07
ref|YP_985243.1|  phage integrase family protein [Acidovorax s...  58.2    4e-07
ref|YP_001051930.1|  phage integrase family protein [Shewanell...  57.8    4e-07
ref|ZP_05729394.1|  integrase family protein [Pantoea sp. At-9...  57.8    4e-07
ref|YP_497483.1|  phage integrase [Novosphingobium aromaticivo...  57.4    5e-07
ref|ZP_02179335.1|  Phage integrase [Hydrogenivirga sp. 128-5-...  57.4    6e-07
ref|ZP_05715605.1|  Integrase [Vibrio mimicus VM573] >gb|EEW11...  57.0    7e-07
ref|YP_900808.1|  phage integrase family protein [Pelobacter p...  57.0    8e-07
ref|ZP_01252171.1|  putative site-specific recombinase [Psychr...  57.0    8e-07
ref|YP_963907.1|  phage integrase family protein [Shewanella s...  56.6    9e-07
ref|ZP_05109875.1|  conserved hypothetical protein [Legionella...  56.6    9e-07
ref|ZP_06233889.1|  integrase family protein [Desulfovibrio ae...  56.6    9e-07
ref|ZP_02177727.1|  phage integrase family protein [Hydrogeniv...  56.6    1e-06
ref|ZP_03032015.1|  integrase [Escherichia coli F11] >gb|EDV68...  56.6    1e-06
emb|CAM76363.1|  phage integrase [Magnetospirillum gryphiswald...  56.6    1e-06
ref|ZP_03738730.1|  integrase family protein [Desulfonatronosp...  56.2    1e-06
ref|ZP_02901637.1|  phage integrase [Escherichia albertii TW07...  56.2    1e-06
ref|YP_002330291.1|  predicted integrase [Escherichia coli O12...  56.2    1e-06
ref|YP_564232.1|  phage integrase [Shewanella denitrificans OS...  56.2    1e-06
ref|YP_003460472.1|  integrase family protein [Thioalkalivibri...  56.2    1e-06
ref|YP_001722874.1|  integrase family protein [Yersinia pseudo...  56.2    1e-06
ref|ZP_01311269.1|  phage integrase [Desulfuromonas acetoxidan...  56.2    1e-06
ref|ZP_02784749.2|  site-specific recombinase, phage integrase...  55.8    2e-06
ref|YP_001587225.1|  hypothetical protein SPAB_00970 [Salmonel...  55.8    2e-06
ref|NP_746019.1|  phage integrase, putative [Pseudomonas putid...  55.8    2e-06
ref|ZP_06127521.1|  putative integrase [Providencia rettgeri D...  55.8    2e-06
ref|ZP_03739118.1|  integrase family protein [Desulfonatronosp...  55.5    2e-06
ref|ZP_04662660.1|  putative integrase from bacteriophage [Aci...  55.5    2e-06
ref|YP_196608.1|  integrase/recombinase [Ehrlichia ruminantium...  55.5    2e-06
ref|ZP_05970596.1|  site-specific recombinase, phage integrase...  55.5    2e-06
ref|ZP_05104946.1|  site-specific recombinase, phage integrase...  55.5    2e-06
ref|YP_180523.1|  integrase/recombinase [Ehrlichia ruminantium...  55.5    2e-06
ref|ZP_06186284.1|  phage integrase family site-specific recom...  55.5    2e-06
ref|YP_002326413.1|  Putative prophage CP4-6 integrase [Acinet...  55.1    2e-06
ref|YP_002358563.1|  integrase family protein [Shewanella balt...  55.1    2e-06
ref|YP_001716694.1|  phage integrase family protein [Candidatu...  55.1    2e-06
ref|YP_197567.1|  integrase/recombinase [Ehrlichia ruminantium...  55.1    3e-06
ref|YP_001723066.1|  integrase family protein [Escherichia col...  55.1    3e-06
ref|ZP_03217802.1|  putative Bacteriophage P4 integrase [Campy...  54.7    3e-06
ref|YP_001399055.1|  phage integrase family site specific reco...  54.7    4e-06
ref|YP_002647105.1|  phage integrase, probably fragment [Erwin...  54.7    4e-06
ref|ZP_05829559.1|  integrase [Acinetobacter baumannii ATCC 19...  54.7    4e-06
ref|ZP_01004604.1|  Site-specific recombinase XerD-like [Lokta...  54.7    4e-06
ref|YP_870585.1|  phage integrase family protein [Shewanella s...  54.7    4e-06
ref|YP_001845734.1|  integrase [Acinetobacter baumannii ACICU]...  54.3    4e-06
ref|YP_002980987.1|  integrase family protein [Ralstonia picke...  54.3    4e-06
ref|YP_462071.1|  integrase [Syntrophus aciditrophicus SB] >gb...  54.3    5e-06
ref|ZP_06354166.1|  site-specific recombinase, phage integrase...  54.3    5e-06
ref|ZP_05114311.1|  site-specific recombinase, phage integrase...  54.3    5e-06
ref|ZP_02810544.2|  integrase [Escherichia coli O157:H7 str. E...  54.3    5e-06
ref|YP_003449073.1|  integrase [Azospirillum sp. B510] >dbj|BA...  54.3    5e-06
ref|YP_001595746.1|  phage integrase, putative [Vibrio sp. 090...  53.9    6e-06
ref|ZP_05041922.1|  site-specific recombinase, phage integrase...  53.9    6e-06
ref|ZP_00990859.1|  Site-specific recombinase XerD-like [Vibri...  53.9    6e-06
gb|ADD67486.1|  integrase family protein [Denitrovibrio acetip...  53.9    6e-06
ref|YP_001528523.1|  integrase family protein [Desulfococcus o...  53.9    6e-06
ref|YP_003297470.1|  putative integrase [Edwardsiella tarda EI...  53.9    7e-06
ref|YP_001714491.1|  putative integrase from bacteriophage [Ac...  53.5    7e-06
ref|ZP_05436162.1|  integrase [Escherichia sp. 4_1_40B]            53.5    9e-06
ref|YP_001337761.1|  putative phage integrase [Klebsiella pneu...  53.5    9e-06
ref|ZP_05495323.1|  integrase family protein [Clostridium papy...  53.5    9e-06
ref|YP_001572823.1|  hypothetical protein SARI_03887 [Salmonel...  53.5    9e-06
ref|YP_420267.1|  integrase [Magnetospirillum magneticum AMB-1...  53.1    1e-05
gb|ACG59714.1|  phage integrase [Escherichia coli]                 53.1    1e-05
ref|ZP_06126932.1|  phage integrase family site specific recom...  53.1    1e-05
ref|YP_871403.1|  phage integrase family protein [Shewanella s...  53.1    1e-05
ref|YP_050841.1|  prophage integrase [Pectobacterium atrosepti...  53.1    1e-05
ref|YP_003470229.1|  Putative integrase (fragment) [Xenorhabdu...  53.1    1e-05
ref|ZP_05094120.1|  site-specific recombinase, phage integrase...  52.8    1e-05
ref|YP_003006276.1|  integrase family protein [Dickeya zeae Ec...  52.8    1e-05
ref|ZP_02194532.1|  phage integrase [Vibrio sp. AND4] >gb|EDP6...  52.8    1e-05
ref|ZP_05063507.1|  phage integrase, putative [Octadecabacter ...  52.8    1e-05
ref|ZP_06041759.1|  phage integrase [Vibrio mimicus MB-451] >g...  52.8    1e-05
ref|YP_003238709.1|  integrase family protein [Ammonifex degen...  52.8    1e-05
ref|ZP_03051843.1|  integrase [Escherichia coli E110019] >gb|E...  52.8    1e-05
ref|ZP_05118530.1|  site-specific recombinase, phage integrase...  52.4    2e-05
ref|NP_953168.1|  integrative genetic element Gsu56, integrase...  52.4    2e-05
ref|ZP_04576234.1|  phage integrase [Oxalobacter formigenes HO...  52.4    2e-05
ref|ZP_05065908.1|  phage integrase family protein, putative [...  52.4    2e-05
ref|ZP_05064742.1|  site-specific recombinase, phage integrase...  52.4    2e-05
ref|NP_717087.1|  phage integrase family site specific recombi...  52.4    2e-05
ref|YP_001177344.1|  phage integrase family protein [Enterobac...  52.4    2e-05
ref|ZP_00208415.1|  COG0582: Integrase [Magnetospirillum magne...  52.4    2e-05
ref|YP_001951669.1|  integrase family protein [Geobacter lovle...  52.4    2e-05
ref|ZP_03398704.1|  phage integrase [Pseudomonas syringae pv. ...  52.0    2e-05
ref|ZP_05311044.1|  integrase family protein [Geobacter sp. M1...  52.0    2e-05
ref|YP_736802.1|  phage integrase family protein [Shewanella s...  52.0    2e-05
ref|ZP_05050897.1|  site-specific recombinase, phage integrase...  52.0    2e-05
ref|YP_002261927.1|  shufflon-specific DNA recombinase [Aliivi...  52.0    2e-05
ref|ZP_01453398.1|  integrative genetic element Gsu32, integra...  52.0    2e-05
dbj|BAF30931.1|  integrase [uncultured bacterium] >dbj|BAF3495...  52.0    2e-05
ref|ZP_04959897.1|  phage integrase [Vibrio cholerae AM-19226]...  52.0    3e-05
ref|YP_003020642.1|  integrase family protein [Geobacter sp. M...  52.0    3e-05
ref|ZP_06231214.1|  integrase family protein [Desulfovibrio ae...  52.0    3e-05
ref|YP_903214.1|  phage integrase family protein [Pelobacter p...  52.0    3e-05
ref|YP_003454139.1|  phage-related integrase [Legionella longb...  52.0    3e-05
ref|ZP_05499644.1|  integrase family protein [Thiomonas interm...  52.0    3e-05
ref|NP_716026.1|  phage integrase family site specific recombi...  51.6    3e-05
ref|YP_750328.1|  phage integrase family protein [Shewanella f...  51.6    3e-05
ref|YP_001354856.1|  integrase [Janthinobacterium sp. Marseill...  51.6    3e-05
ref|ZP_05110173.1|  phage related integrase [Legionella dranco...  51.6    3e-05
ref|ZP_05064470.1|  site-specific recombinase, phage integrase...  51.6    3e-05
emb|CAQ81988.1|  putative prophage integrase. [Enterobacteria ...  51.6    3e-05
ref|YP_577003.1|  phage integrase [Nitrobacter hamburgensis X1...  51.6    3e-05
ref|YP_001350479.1|  phage integrase family site specific reco...  51.6    3e-05
ref|ZP_03829037.1|  prophage integrase [Pectobacterium carotov...  51.6    3e-05
ref|YP_003259289.1|  integrase family protein [Pectobacterium ...  51.6    3e-05
ref|ZP_05435202.1|  integrase family protein [Shigella sp. D9]     51.6    3e-05
ref|YP_003334387.1|  integrase family protein [Dickeya dadanti...  51.2    4e-05
ref|ZP_05065577.1|  site-specific recombinase, phage integrase...  51.2    4e-05
gb|EES53290.1|  phage integrase family protein [Leptospirillum...  51.2    4e-05
ref|YP_127815.1|  hypothetical protein lpl2486 [Legionella pne...  51.2    4e-05
ref|ZP_02901072.1|  phage integrase [Escherichia albertii TW07...  51.2    4e-05
ref|YP_002248163.1|  site specific recombinase [Thermodesulfov...  51.2    4e-05
ref|ZP_05064034.1|  site-specific recombinase, phage integrase...  51.2    4e-05
ref|ZP_01135053.1|  phage integrase, putative [Pseudoalteromon...  50.8    5e-05
ref|YP_443726.1|  phage integrase family site specific recombi...  50.8    5e-05
ref|YP_175278.1|  site-specific tyrosine recombinase [Bacillus...  50.8    5e-05
ref|YP_001476346.1|  integrase family protein [Serratia protea...  50.8    5e-05
ref|ZP_04875223.1|  site-specific recombinase, phage integrase...  50.8    5e-05
ref|YP_002289130.1|  phage integrase [Oligotropha carboxidovor...  50.8    5e-05
ref|ZP_03064803.1|  integrase [Shigella dysenteriae 1012] >gb|...  50.8    5e-05
ref|NP_758615.1|  integrase [Pseudomonas resinovorans] >ref|YP...  50.8    6e-05
ref|YP_002603059.1|  hypothetical protein HRM2_17930 [Desulfob...  50.8    6e-05
ref|YP_003469806.1|  Phage integrase [Xenorhabdus bovienii SS-...  50.8    6e-05
ref|NP_773857.1|  site-specific integrase/recombinase [Bradyrh...  50.8    6e-05
ref|NP_743712.1|  phage integrase, putative [Pseudomonas putid...  50.8    6e-05
ref|ZP_04624367.1|  Integrase [Yersinia kristensenii ATCC 3363...  50.8    6e-05
ref|YP_002383214.1|  integrase [Escherichia fergusonii ATCC 35...  50.4    6e-05
ref|YP_003482466.1|  integrase family protein [Aciduliprofundu...  50.4    6e-05
ref|ZP_04922021.1|  site-specific recombinase, phage integrase...  50.4    6e-05
ref|NP_863067.1|  putative integrase [Pseudomonas putida] >ref...  50.4    6e-05
ref|YP_003270013.1|  tyrosine recombinase XerD [Haliangium och...  50.4    6e-05
ref|ZP_04918510.1|  Integrase [Vibrio cholerae V51] >gb|EAZ509...  50.4    7e-05
ref|YP_316581.1|  putative phage integrase [Thiobacillus denit...  50.4    7e-05
ref|YP_003235132.1|  putative integrase [Escherichia coli O111...  50.4    7e-05
ref|YP_003039840.1|  putative phage integrase [Photorhabdus as...  50.4    7e-05
ref|ZP_05629299.1|  prophage CP4-57-like integrase [Actinobaci...  50.4    7e-05
ref|ZP_05051497.1|  site-specific recombinase, phage integrase...  50.4    7e-05
ref|ZP_06186351.1|  phage integrase family protein [Legionella...  50.4    7e-05
ref|ZP_04656933.1|  putative phage integrase [Salmonella enter...  50.4    7e-05
ref|YP_738896.1|  phage integrase family protein [Shewanella s...  50.4    7e-05
dbj|BAI55764.1|  putative phage integrase [Escherichia coli SE15]  50.4    7e-05
ref|ZP_02776684.1|  phage integrase family protein [Escherichi...  50.4    7e-05
ref|YP_002548508.1|  Integrase protein [Agrobacterium vitis S4...  50.4    7e-05
ref|YP_002289153.1|  phage integrase [Oligotropha carboxidovor...  50.4    7e-05
ref|ZP_05066927.1|  site-specific recombinase, phage integrase...  50.4    8e-05
ref|YP_001937632.1|  putative integrase [Orientia tsutsugamush...  50.4    8e-05
ref|YP_002331356.1|  predicted integrase [Escherichia coli O12...  50.4    8e-05
ref|YP_001243157.1|  putative integrase [Bradyrhizobium sp. BT...  50.4    8e-05
ref|NP_779202.1|  phage-related integrase [Xylella fastidiosa ...  50.1    8e-05
ref|ZP_00991903.1|  site-specific recombinase, phage integrase...  50.1    8e-05
ref|YP_001882342.1|  site-specific recombinase, phage integras...  50.1    8e-05
ref|YP_782175.1|  phage integrase family protein [Rhodopseudom...  50.1    8e-05
ref|YP_002406534.1|  putative integrase of prophage [Escherich...  50.1    8e-05
ref|YP_409955.1|  putative integrase [Shigella boydii Sb227] >...  50.1    9e-05
ref|ZP_03677971.1|  hypothetical protein BACCELL_02310 [Bacter...  50.1    9e-05
ref|ZP_02375637.1|  Integrase or site-specific recombinase [Bu...  50.1    9e-05
ref|YP_001269434.1|  phage integrase family protein [Pseudomon...  50.1    9e-05
ref|YP_457707.1|  site-specific recombinase, phage integrase f...  50.1    9e-05
ref|YP_002358523.1|  integrase family protein [Shewanella balt...  50.1    1e-04
ref|ZP_05704275.1|  phage integrase family site-specific recom...  50.1    1e-04
ref|YP_001938443.1|  putative integrase [Orientia tsutsugamush...  50.1    1e-04
emb|CBG36775.1|  integrase [Escherichia coli 042]                  50.1    1e-04
emb|CAJ75136.1|  similar to site-specific tyrosine recombinase...  49.7    1e-04
ref|YP_001180235.1|  phage integrase family protein [Caldicell...  49.7    1e-04
ref|YP_003088297.1|  integrase family protein [Dyadobacter fer...  49.7    1e-04
ref|YP_534847.1|  integrase TnpI [Pseudomonas putida] >dbj|BAE...  49.7    1e-04
ref|ZP_01752810.1|  Integrase [Roseobacter sp. SK209-2-6] >gb|...  49.7    1e-04
ref|ZP_05052834.1|  site-specific recombinase, phage integrase...  49.7    1e-04
ref|YP_002987967.1|  integrase family protein [Dickeya dadanti...  49.7    1e-04
ref|YP_001415359.1|  integrase family protein [Xanthobacter au...  49.7    1e-04
ref|YP_003443659.1|  integrase family protein [Allochromatium ...  49.7    1e-04
ref|YP_001908356.1|  Prophage integrase [Erwinia tasmaniensis ...  49.7    1e-04
ref|YP_001762656.1|  integron integrase [Shewanella woodyi ATC...  49.7    1e-04
ref|ZP_02353915.1|  Integrase or site-specific recombinase [Bu...  49.3    1e-04
ref|ZP_06124130.1|  putative integrase [Providencia rettgeri D...  49.3    1e-04
ref|YP_123415.1|  hypothetical protein lpp1088 [Legionella pne...  49.3    1e-04
ref|ZP_06124033.1|  putative prophage CPS-53 integrase [Provid...  49.3    1e-04
ref|ZP_05316514.1|  integrase family protein [Nitrosomonas sp....  49.3    1e-04
ref|ZP_02142526.1|  phage-related integrase [Roseobacter litor...  49.3    1e-04
ref|ZP_04002545.1|  integrase [Escherichia coli 83972] >gb|EEJ...  49.3    1e-04
ref|ZP_05050266.1|  site-specific recombinase, phage integrase...  49.3    1e-04
ref|YP_001457101.1|  site-specific recombinase, phage integras...  49.3    1e-04
ref|YP_551607.1|  phage integrase [Polaromonas sp. JS666] >gb|...  49.3    2e-04
emb|CAD66211.1|  putative phage integrase [Escherichia coli]       49.3    2e-04
ref|ZP_03032837.1|  phage integrase [Escherichia coli F11] >gb...  49.3    2e-04
ref|ZP_05050674.1|  site-specific recombinase, phage integrase...  49.3    2e-04
ref|YP_001461446.1|  phage integrase family protein [Escherich...  49.3    2e-04
ref|YP_668275.1|  phage integrase [Escherichia coli 536] >gb|A...  49.3    2e-04
emb|CAM75029.1|  Phage integrase [Magnetospirillum gryphiswald...  49.3    2e-04
ref|YP_001249216.1|  phage-related integrase [Orientia tsutsug...  49.3    2e-04
ref|ZP_05050513.1|  site-specific recombinase, phage integrase...  48.9    2e-04
ref|YP_125443.1|  hypothetical protein lpl0065 [Legionella pne...  48.9    2e-04
ref|YP_741481.1|  phage integrase family protein [Alkalilimnic...  48.9    2e-04
ref|YP_559298.1|  putative phage integrase [Burkholderia xenov...  48.9    2e-04
ref|NP_943130.1|  AGR-L-2007p integrase [Pseudomonas sp. ND6] ...  48.9    2e-04
ref|ZP_02179942.1|  phage integrase family protein [Hydrogeniv...  48.9    2e-04
ref|YP_002774893.1|  hypothetical protein BBR47_54120 [Breviba...  48.9    2e-04
ref|YP_431950.1|  integrase [Hahella chejuensis KCTC 2396] >gb...  48.9    2e-04
ref|ZP_06178854.1|  hypothetical protein VMC_02840 [Vibrio alg...  48.9    2e-04
ref|ZP_04640573.1|  Site-specific recombinase, phage integrase...  48.9    2e-04
ref|YP_001722474.1|  integrase family protein [Yersinia pseudo...  48.9    2e-04
ref|ZP_00054261.1|  COG0582: Integrase [Magnetospirillum magne...  48.9    2e-04
ref|NP_790137.1|  site-specific recombinase, phage integrase f...  48.9    2e-04
ref|ZP_06350519.1|  integrase family protein [Rhodomicrobium v...  48.9    2e-04
ref|ZP_05063110.1|  phage integrase family protein, putative [...  48.9    2e-04
ref|ZP_04631567.1|  Integrase [Yersinia frederiksenii ATCC 336...  48.9    2e-04
ref|YP_549776.1|  phage integrase [Polaromonas sp. JS666] >gb|...  48.9    2e-04
ref|YP_001937440.1|  putative integrase [Orientia tsutsugamush...  48.9    2e-04
ref|ZP_02781440.1|  prophage integrase [Escherichia coli O157:...  48.9    2e-04
ref|YP_001745965.1|  phage integrase family site specific reco...  48.9    2e-04
ref|YP_998883.1|  phage integrase family protein [Verminephrob...  48.9    2e-04
ref|ZP_02823597.1|  phage integrase [Escherichia coli O157:H7 ...  48.9    2e-04
ref|ZP_03614266.1|  tyrosine recombinase XerC [Staphylococcus ...  48.9    2e-04
ref|YP_846613.1|  phage integrase family protein [Syntrophobac...  48.5    2e-04
ref|ZP_02479611.1|  Integrase or site-specific recombinase [Bu...  48.5    2e-04
ref|ZP_01768330.1|  site-specific recombinase, phage integrase...  48.5    2e-04
ref|YP_001064397.1|  phage integrase family site specific reco...  48.5    2e-04
ref|YP_003294117.1|  putative integrase [Edwardsiella tarda EI...  48.5    2e-04
ref|YP_331724.1|  integrase or site-specific recombinase [Burk...  48.5    2e-04
ref|YP_001372869.1|  phage integrase family protein [Ochrobact...  48.5    2e-04
ref|YP_001674009.1|  integrase family protein [Shewanella hali...  48.5    2e-04
gb|EDZ39517.1|  Integrase [Leptospirillum sp. Group II '5-way ...  48.5    3e-04
ref|YP_001057152.1|  phage integrase family site specific reco...  48.5    3e-04
ref|YP_257121.1|  hypothetical protein pSG3GP_12 [Sodalis glos...  48.5    3e-04
ref|YP_106707.1|  putative phage integrase [Burkholderia pseud...  48.5    3e-04
ref|YP_001936733.1|  putative integrase [Orientia tsutsugamush...  48.5    3e-04
ref|ZP_01201695.1|  site-specific integrase/recombinase XerD p...  48.5    3e-04
ref|ZP_05433561.1|  phage integrase family protein [Shigella s...  48.5    3e-04
ref|ZP_05053217.1|  site-specific recombinase, phage integrase...  48.5    3e-04
ref|ZP_01133623.1|  site-specific recombinase, phage integrase...  48.5    3e-04
ref|ZP_03069361.1|  phage integrase family protein [Escherichi...  48.5    3e-04
ref|NP_936913.1|  phage integrase [Vibrio vulnificus YJ016] >d...  48.5    3e-04
ref|YP_003113211.1|  tyrosine recombinase XerD [Catenulispora ...  48.5    3e-04
ref|YP_001251474.1|  integrase, phage related [Legionella pneu...  48.5    3e-04
ref|ZP_03048126.1|  site-specific recombinase, phage integrase...  48.5    3e-04
ref|ZP_01881046.1|  putative integrase [Roseovarius sp. TM1035...  48.5    3e-04
ref|ZP_01004585.1|  Phage integrase [Loktanella vestfoldensis ...  48.5    3e-04
ref|YP_516215.1|  hypothetical protein SGPHI_0037 [Sodalis pha...  48.5    3e-04
ref|ZP_02664613.1|  site-specific recombinase, phage integrase...  48.1    3e-04
ref|YP_968007.1|  phage integrase family protein [Desulfovibri...  48.1    3e-04
gb|EES53851.1|  phage integrase family protein [Leptospirillum...  48.1    3e-04
ref|NP_942166.1|  hypothetical protein slr5010 [Synechocystis ...  48.1    3e-04
ref|ZP_06405292.1|  tyrosine type site-specific recombinase [P...  48.1    3e-04
ref|ZP_02186786.1|  integrase/recombinase XerD [alpha proteoba...  48.1    3e-04
ref|YP_001359494.1|  phage integrase family site specific reco...  48.1    3e-04
ref|ZP_02038455.1|  hypothetical protein BACCAP_04089 [Bactero...  48.1    3e-04
ref|YP_002401394.1|  putative prophage CPS-53 integrase [Esche...  48.1    3e-04
ref|YP_794083.1|  integrase [Stx2-converting phage 86] >ref|ZP...  48.1    3e-04
ref|YP_095103.1|  integrase, phage related [Legionella pneumop...  48.1    3e-04
ref|ZP_06155306.1|  hypothetical protein VDA_002035 [Photobact...  48.1    3e-04
ref|YP_001372218.1|  phage integrase family protein [Ochrobact...  48.1    3e-04
ref|YP_001953716.1|  integrase family protein [Geobacter lovle...  48.1    4e-04
ref|YP_003258785.1|  integrase family protein [Pectobacterium ...  48.1    4e-04
ref|YP_002945685.1|  integrase family protein [Variovorax para...  48.1    4e-04
ref|ZP_02797826.2|  integrase [Escherichia coli O157:H7 str. E...  48.1    4e-04
ref|ZP_03392435.1|  tyrosine recombinase XerC [Capnocytophaga ...  48.1    4e-04
ref|YP_420854.1|  integrase [Magnetospirillum magneticum AMB-1...  48.1    4e-04
ref|YP_126420.1|  hypothetical protein lpl1066 [Legionella pne...  48.1    4e-04
ref|ZP_01004578.1|  Phage integrase [Loktanella vestfoldensis ...  48.1    4e-04
ref|YP_003467233.1|  hypothetical protein XBJ1_1313 [Xenorhabd...  47.8    4e-04
emb|CBG36817.1|  integrase [Escherichia coli 042]                  47.8    4e-04
ref|ZP_00958338.1|  Phage integrase [Roseovarius nubinhibens I...  47.8    4e-04
ref|ZP_05082687.1|  phage integrase [Pseudovibrio sp. JE062] >...  47.8    4e-04
ref|YP_002291539.1|  putative phage integrase [Escherichia col...  47.8    4e-04
ref|YP_001875879.1|  integrase family protein [Elusimicrobium ...  47.8    4e-04
ref|NP_421479.1|  phage integrase family integrase/recombinase...  47.8    4e-04
ref|ZP_05717091.1|  phage integrase family protein [Vibrio mim...  47.8    4e-04
ref|ZP_04640595.1|  Integrase [Yersinia mollaretii ATCC 43969]...  47.8    4e-04
ref|ZP_06145539.1|  phage integrase family site specific recom...  47.8    4e-04
ref|ZP_06355785.1|  site-specific recombinase, phage integrase...  47.8    4e-04
ref|ZP_04612579.1|  Integrase [Yersinia rohdei ATCC 43380] >gb...  47.8    4e-04
ref|ZP_04444106.1|  possible integrase/recombinase XerD [Liste...  47.8    4e-04
ref|ZP_01546359.1|  hypothetical protein SIAM614_12908 [Stappi...  47.8    4e-04
ref|YP_003141662.1|  integrase family protein [Capnocytophaga ...  47.8    4e-04
ref|YP_002894739.1|  integrase or site-specific recombinase [B...  47.8    4e-04
ref|ZP_01718919.1|  putative site-specific recombinase [Algori...  47.8    4e-04
ref|ZP_04819117.1|  tyrosine recombinase XerC [Staphylococcus ...  47.8    5e-04
ref|ZP_02435973.1|  hypothetical protein BACSTE_02226 [Bactero...  47.8    5e-04
ref|YP_001231826.1|  phage integrase family protein [Geobacter...  47.8    5e-04
ref|ZP_06364899.1|  tyrosine recombinase XerD [Bacillus cellul...  47.8    5e-04
ref|YP_411617.1|  Phage integrase [Nitrosospira multiformis AT...  47.8    5e-04
ref|YP_917857.1|  phage integrase family protein [Paracoccus d...  47.8    5e-04
ref|ZP_01054441.1|  hypothetical protein MED193_17104 [Roseoba...  47.8    5e-04
ref|ZP_04390628.1|  tyrosine recombinase XerD [Porphyromonas e...  47.8    5e-04
ref|YP_003022217.1|  integrase family protein [Geobacter sp. M...  47.8    5e-04
ref|YP_002921868.1|  phage integrase family protein [Klebsiell...  47.4    5e-04
ref|YP_001859624.1|  integrase family protein [Burkholderia ph...  47.4    5e-04
ref|NP_774814.1|  site-specific integrase/recombinase [Bradyrh...  47.4    5e-04
ref|ZP_03458439.1|  hypothetical protein BACEGG_01212 [Bactero...  47.4    5e-04
ref|ZP_03501997.1|  phage integrase [Rhizobium etli Kim 5]         47.4    5e-04
ref|YP_457033.1|  site-specific recombinase, phage integrase f...  47.4    5e-04
ref|ZP_01546914.1|  phage-related integrase [Stappia aggregata...  47.4    5e-04
ref|YP_002399202.1|  Integrase from prophage [Escherichia coli...  47.4    6e-04
ref|YP_001938314.1|  putative integrase [Orientia tsutsugamush...  47.4    6e-04
ref|YP_001023011.1|  phage-related integrase [Methylibium petr...  47.4    6e-04
ref|ZP_06125437.1|  integrase family protein [Providencia rett...  47.4    6e-04
ref|NP_942552.1|  hypothetical protein sll6109 [Synechocystis ...  47.4    6e-04
ref|ZP_04591292.1|  phage integrase, putative [Pseudomonas syr...  47.4    6e-04
ref|YP_001415700.1|  integrase family protein [Xanthobacter au...  47.4    6e-04
ref|ZP_06031614.1|  phage integrase family protein [Vibrio mim...  47.4    6e-04
ref|YP_001417938.1|  integrase family protein [Xanthobacter au...  47.4    6e-04
ref|ZP_05054372.1|  site-specific recombinase, phage integrase...  47.4    6e-04
ref|YP_561335.1|  phage integrase [Shewanella denitrificans OS...  47.4    6e-04
ref|YP_002433929.1|  integrase family protein [Desulfatibacill...  47.4    6e-04
ref|ZP_00650817.1|  Phage integrase [Xylella fastidiosa Dixon]...  47.4    6e-04
ref|YP_850178.1|  integrase/recombinase [Listeria welshimeri s...  47.4    6e-04
ref|ZP_05924659.1|  phage integrase family protein [Vibrio sp....  47.4    6e-04
emb|CAM78106.1|  Phage-related integrase, fragment [Magnetospi...  47.4    6e-04
ref|ZP_04172177.1|  Integrase/recombinase [Bacillus mycoides D...  47.4    6e-04
ref|YP_344228.1|  Phage integrase [Nitrosococcus oceani ATCC 1...  47.4    6e-04
ref|NP_671345.1|  integrase [Yersinia pestis KIM 10] >ref|NP_9...  47.4    6e-04
ref|YP_315763.1|  cp4-like integrase protein [Thiobacillus den...  47.4    6e-04
ref|ZP_05883393.1|  site-specific recombinase phage integrase ...  47.0    7e-04
ref|NP_890672.1|  phage-related integrase [Bordetella bronchis...  47.0    7e-04
ref|ZP_00964023.1|  site-specific integrase/recombinase-like [...  47.0    7e-04
ref|ZP_01107115.1|  putative site-specific recombinase [Flavob...  47.0    7e-04
ref|YP_001608430.1|  phage integrase family site specific reco...  47.0    7e-04
ref|YP_096565.1|  integrase of prophage CP-933C [Legionella pn...  47.0    7e-04
ref|YP_001938197.1|  putative integrase [Orientia tsutsugamush...  47.0    7e-04
ref|ZP_04634676.1|  Integrase [Yersinia frederiksenii ATCC 336...  47.0    7e-04
ref|ZP_04638950.1|  Integrase [Yersinia mollaretii ATCC 43969]...  47.0    7e-04
ref|YP_003018833.1|  integrase family protein [Pectobacterium ...  47.0    7e-04
ref|ZP_04872911.1|  integrase [Escherichia sp. 1_1_43] >gb|EEH...  47.0    7e-04
ref|ZP_03059365.1|  phage integrase family protein [Escherichi...  47.0    7e-04
emb|CAI29284.1|  putative XerD-like integrase/recombinase [Bac...  47.0    7e-04
ref|ZP_02907083.1|  integrase family protein [Burkholderia amb...  47.0    7e-04
ref|ZP_02429085.1|  hypothetical protein CLORAM_02507 [Clostri...  47.0    7e-04
ref|ZP_05979829.1|  tyrosine recombinase XerC [Subdoligranulum...  47.0    8e-04
ref|YP_003444355.1|  integrase family protein [Allochromatium ...  47.0    8e-04
ref|ZP_04620192.1|  Integrase [Yersinia aldovae ATCC 35236] >g...  47.0    8e-04
ref|ZP_04563426.1|  site-specific tyrosine recombinase xerD [M...  47.0    8e-04
ref|YP_002603000.1|  tyrosine recombinase XerD [Desulfobacteri...  47.0    8e-04
ref|ZP_05053572.1|  site-specific recombinase, phage integrase...  47.0    8e-04
ref|YP_001440104.1|  hypothetical protein ESA_04087 [Enterobac...  47.0    8e-04
ref|YP_003196646.1|  putative site-specific recombinase [Robig...  47.0    8e-04
emb|CAI29290.1|  putative XerD-like integrase/recombinase [Bac...  47.0    8e-04
ref|ZP_06155335.1|  phage integrase [Photobacterium damselae s...  47.0    8e-04
ref|ZP_02220760.1|  site-specific recombinase, phage integrase...  47.0    8e-04
ref|NP_771643.1|  site-specific integrase/recombinase [Bradyrh...  47.0    8e-04
ref|YP_001937697.1|  putative integrase [Orientia tsutsugamush...  47.0    8e-04
ref|YP_001769774.1|  integrase family protein [Methylobacteriu...  47.0    8e-04
ref|ZP_02661991.1|  phage integrase family protein [Salmonella...  47.0    8e-04
ref|ZP_02773129.1|  phage integrase family protein [Escherichi...  47.0    8e-04
ref|ZP_01905048.1|  Site-specific recombinase XerD-like protei...  47.0    8e-04
ref|ZP_05110867.1|  phage related integrase [Legionella dranco...  47.0    8e-04
ref|ZP_04402055.1|  site-specific recombinase phage integrase ...  47.0    8e-04
ref|ZP_03712888.1|  hypothetical protein EIKCOROL_00560 [Eiken...  47.0    8e-04
ref|ZP_02660399.1|  site-specific recombinase, phage integrase...  47.0    8e-04
ref|ZP_06461197.1|  phage integrase family site specific recom...  47.0    8e-04
ref|ZP_05710230.1|  integrase family protein [Desulfurivibrio ...  47.0    9e-04
ref|ZP_03703077.1|  integrase family protein [Flavobacteria ba...  47.0    9e-04
ref|YP_003039846.1|  putative phage integrase [Photorhabdus as...  46.6    9e-04
ref|YP_001236764.1|  putative phage integrase [Bradyrhizobium ...  46.6    9e-04
ref|YP_003466695.1|  CPS-53 (KpLE1) prophage; Sf6-like integra...  46.6    9e-04
dbj|BAH89608.1|  tyrosine recombinase [uncultured bacterium] >...  46.6    9e-04
ref|YP_001370706.1|  phage integrase family protein [Ochrobact...  46.6    9e-04
ref|YP_003092441.1|  tyrosine recombinase XerD [Pedobacter hep...  46.6    9e-04
ref|YP_001751203.1|  integrase family protein [Pseudomonas put...  46.6    0.001
ref|YP_001001918.1|  phage integrase family protein [Halorhodo...  46.6    0.001
ref|NP_718547.1|  prophage LambdaSo, site-specific recombinase...  46.6    0.001
gb|EES53930.1|  phage integrase family protein [Leptospirillum...  46.6    0.001
ref|ZP_06016555.1|  phage integrase family site-specific recom...  46.6    0.001
ref|NP_927495.1|  hypothetical protein plu0125 [Photorhabdus l...  46.6    0.001
ref|ZP_06123565.1|  putative integrase [Providencia rettgeri D...  46.6    0.001
ref|ZP_05113288.1|  site-specific recombinase, phage integrase...  46.6    0.001
ref|NP_670570.1|  integrase [Yersinia pestis KIM 10] >ref|NP_9...  46.6    0.001
ref|YP_002528333.1|  site-specific integrase/recombinase [Baci...  46.6    0.001
ref|YP_071664.1|  putative phage integrase. [Yersinia pseudotu...  46.6    0.001
ref|YP_003250354.1|  integrase family protein [Fibrobacter suc...  46.6    0.001
ref|YP_001021898.1|  putative prophage integrase [Methylibium ...  46.6    0.001
ref|YP_003061248.1|  integrase family protein [Hirschia baltic...  46.6    0.001
ref|ZP_04958584.1|  phage integrase family protein [gamma prot...  46.6    0.001
gb|EDZ38387.1|  Putative phage integrase [Leptospirillum sp. G...  46.6    0.001
ref|YP_001926515.1|  integrase family protein [Methylobacteriu...  46.6    0.001
ref|YP_650298.1|  integrase [Yersinia pestis Antiqua] >ref|ZP_...  46.6    0.001
ref|YP_002398550.1|  integrase from prophage [Escherichia coli...  46.2    0.001
ref|ZP_05121003.1|  integrase [Vibrio parahaemolyticus 16] >gb...  46.2    0.001
ref|YP_001721873.1|  integrase family protein [Yersinia pseudo...  46.2    0.001
ref|YP_002424007.1|  integrase family protein [Methylobacteriu...  46.2    0.001
ref|ZP_04600865.1|  hypothetical protein GCWU000324_00320 [Kin...  46.2    0.001
ref|YP_750344.1|  phage integrase family protein [Shewanella f...  46.2    0.001
ref|YP_001439090.1|  hypothetical protein ESA_03025 [Enterobac...  46.2    0.001
ref|ZP_03108592.1|  integrase/recombinase [Bacillus cereus NVH...  46.2    0.001
ref|YP_548422.1|  phage integrase [Polaromonas sp. JS666] >gb|...  46.2    0.001
ref|YP_001381142.1|  phage integrase family protein [Anaeromyx...  46.2    0.001
ref|YP_003471861.1|  Site-specific tyrosine recombinase [Staph...  46.2    0.001
ref|YP_001564216.1|  integrase family protein [Delftia acidovo...  46.2    0.001
ref|YP_002417280.1|  Phage integrase [Vibrio splendidus LGP32]...  46.2    0.001
ref|ZP_00651242.1|  Phage integrase [Xylella fastidiosa Dixon]...  46.2    0.001
ref|YP_003235292.1|  putative integrase [Escherichia coli O111...  46.2    0.001
ref|YP_003018435.1|  integrase family protein [Pectobacterium ...  46.2    0.001
ref|YP_537610.1|  integrase [Rickettsia bellii RML369-C] >ref|...  46.2    0.001
ref|ZP_02073343.1|  hypothetical protein CLOL250_00082 [Clostr...  46.2    0.001
ref|ZP_06356706.1|  integrase family protein [Rhodopseudomonas...  46.2    0.001
ref|YP_001639334.1|  integrase family protein [Methylobacteriu...  46.2    0.001
ref|ZP_03066490.1|  prophage integrase [Shigella dysenteriae 1...  46.2    0.001
ref|YP_853646.1|  integrase-like protein [Escherichia coli APE...  46.2    0.001
ref|NP_942293.1|  hypothetical protein slr7005 [Synechocystis ...  46.2    0.001
ref|YP_003447403.1|  hypothetical protein AZL_002210 [Azospiri...  46.2    0.001
ref|NP_297921.1|  phage-related integrase [Xylella fastidiosa ...  46.2    0.001
ref|YP_002349571.1|  tyrosine recombinase XerD [Listeria monoc...  46.2    0.001
ref|YP_014578.1|  integrase/recombinase XerD [Listeria monocyt...  46.2    0.001
ref|YP_002633981.1|  putative site-specific recombinase XerC [...  46.2    0.001
ref|YP_001496468.1|  integrase [Rickettsia bellii OSU 85-389] ...  46.2    0.001
ref|YP_095260.1|  site specific recombinase [Legionella pneumo...  46.2    0.001
ref|ZP_04560714.1|  site-specific recombinase [Citrobacter sp....  46.2    0.001
ref|YP_408540.1|  putative CP4-57-type integrase [Shigella boy...  46.2    0.001
ref|NP_102646.1|  prbable integrase [Mesorhizobium loti MAFF30...  46.2    0.001
ref|ZP_05298396.1|  hypothetical protein LmonocytFSL_08880 [Li...  45.8    0.001
ref|ZP_00989468.1|  site-specific recombinase, phage integrase...  45.8    0.001
ref|ZP_05236099.1|  hypothetical protein Lmon1_08823 [Listeria...  45.8    0.001
ref|ZP_04752588.1|  phage integrase family protein [Actinobaci...  45.8    0.001
ref|YP_001162011.1|  integrase [Yersinia pestis Pestoides F] >...  45.8    0.001
ref|YP_001243551.1|  putative phage integrase [Bradyrhizobium ...  45.8    0.002
ref|NP_465479.1|  hypothetical protein lmo1955 [Listeria monoc...  45.8    0.002
ref|YP_315329.1|  site-specific integrase/recombinase [Thiobac...  45.8    0.002
ref|YP_595615.1|  integrase [Lawsonia intracellularis PHE/MN1-...  45.8    0.002
ref|YP_001181376.1|  phage integrase family protein [Caldicell...  45.8    0.002
ref|ZP_04433002.1|  tyrosine recombinase XerD [Bacillus coagul...  45.8    0.002
ref|NP_471403.1|  hypothetical protein lin2069 [Listeria innoc...  45.8    0.002
ref|YP_001685779.1|  integrase family protein [Caulobacter sp....  45.8    0.002
ref|YP_422072.1|  integrase [Magnetospirillum magneticum AMB-1...  45.8    0.002
ref|YP_919149.1|  phage integrase family protein [Thermofilum ...  45.8    0.002
ref|ZP_00050146.2|  COG0582: Integrase [Magnetospirillum magne...  45.8    0.002
ref|ZP_04056388.1|  tyrosine recombinase XerC [Capnocytophaga ...  45.8    0.002
ref|YP_385229.1|  Phage integrase [Geobacter metallireducens G...  45.8    0.002
ref|ZP_04848460.1|  integrase [Bacteroides sp. 1_1_6] >gb|EES6...  45.8    0.002
ref|ZP_05085911.1|  phage integrase [Pseudovibrio sp. JE062] >...  45.8    0.002
ref|ZP_02364571.1|  putative bacteriophage integrase [Burkhold...  45.8    0.002
ref|YP_001499410.1|  integrase [Rickettsia massiliae MTU5] >gb...  45.8    0.002
ref|YP_166466.1|  phage integrase family site specific recombi...  45.8    0.002
ref|ZP_01104279.1|  integrase [Congregibacter litoralis KT71] ...  45.8    0.002
ref|YP_003258809.1|  integrase family protein [Pectobacterium ...  45.8    0.002
ref|ZP_02903160.1|  integrase [Escherichia albertii TW07627] >...  45.8    0.002
ref|YP_002311531.1|  Integrase [Shewanella piezotolerans WP3] ...  45.8    0.002
ref|ZP_03268275.1|  integrase family protein [Burkholderia sp....  45.8    0.002
ref|ZP_03676608.1|  hypothetical protein BACCELL_00934 [Bacter...  45.4    0.002
gb|EAY57565.1|  putative phage integrase [Leptospirillum rubarum]  45.4    0.002
ref|YP_001464377.1|  site-specific recombinase, phage integras...  45.4    0.002
ref|YP_003242226.1|  integrase family protein [Geobacillus sp....  45.4    0.002
ref|ZP_01860154.1|  site-specific tyrosine recombinase XerD [B...  45.4    0.002
ref|ZP_01736697.1|  hypothetical protein MELB17_04087 [Marinob...  45.4    0.002
gb|ADD69309.1|  integrase family protein [Denitrovibrio acetip...  45.4    0.002
ref|YP_003465175.1|  integrase/recombinase XerD [Listeria seel...  45.4    0.002
ref|YP_001745129.1|  site-specific recombinase, phage integras...  45.4    0.002
ref|YP_267112.1|  phage integrase family site specific recombi...  45.4    0.002
ref|ZP_05624432.1|  DNA integration/recombination/inversion pr...  45.4    0.002
ref|YP_001929695.1|  putative site-specific recombinase [Porph...  45.4    0.002
ref|YP_003051858.1|  integrase family protein [Methylovorus sp...  45.4    0.002
ref|YP_002324169.1|  Tyrosine recombinase xerC [Acinetobacter ...  45.4    0.002
gb|EAY57114.1|  putative phage integrase [Leptospirillum rubarum]  45.4    0.002
ref|YP_737811.1|  phage integrase family protein [Shewanella s...  45.4    0.002
ref|YP_157407.1|  phage integrase [Aromatoleum aromaticum EbN1...  45.4    0.002
ref|ZP_01045332.1|  site-specific recombinase, phage integrase...  45.4    0.002
gb|EES52264.1|  phage integrase family protein [Leptospirillum...  45.4    0.002
ref|YP_001501143.1|  integrase family protein [Shewanella peal...  45.4    0.002
ref|YP_001195046.1|  phage integrase family protein [Flavobact...  45.4    0.002
ref|ZP_04615674.1|  Integrase [Yersinia ruckeri ATCC 29473] >g...  45.4    0.002
ref|ZP_03851763.1|  phage integrase family protein [Chryseobac...  45.4    0.002
ref|YP_963873.1|  phage integrase family protein [Shewanella s...  45.4    0.002
ref|ZP_06127288.1|  integrase [Providencia rettgeri DSM 1131]      45.4    0.002
ref|ZP_02041754.1|  hypothetical protein RUMGNA_02526 [Ruminoc...  45.4    0.002
ref|ZP_05031969.1|  site-specific recombinase, phage integrase...  45.4    0.002
ref|ZP_03842673.1|  integrase family protein [Proteus mirabili...  45.4    0.002
ref|ZP_01864766.1|  Putative phage integrase [Erythrobacter sp...  45.4    0.002
ref|YP_965540.1|  phage integrase family protein [Desulfovibri...  45.4    0.002
ref|NP_971812.1|  integrase/recombinase XerD [Treponema dentic...  45.4    0.002
ref|ZP_04754382.1|  Prophage CP4-57 integrase [Actinobacillus ...  45.4    0.002
ref|ZP_04797571.1|  bacteriophage integrase [Staphylococcus ep...  45.4    0.002
ref|ZP_05031487.1|  site-specific recombinase, phage integrase...  45.4    0.002
dbj|BAG74735.1|  putative integrase [Vibrio parahaemolyticus]      45.4    0.002
ref|ZP_06191913.1|  DNA integration/recombination/invertion pr...  45.4    0.002
ref|NP_904693.1|  phage integrase family site specific recombi...  45.4    0.002
ref|ZP_05740856.1|  putative phage integrase [Silicibacter sp....  45.4    0.002
ref|YP_002290562.1|  probable integrase [Oligotropha carboxido...  45.4    0.002
ref|ZP_06172465.1|  integrase family protein [Brevundimonas su...  45.4    0.002
ref|ZP_04796979.1|  tyrosine recombinase XerC [Staphylococcus ...  45.4    0.002
ref|NP_347802.1|  site-specific tyrosine recombinase XerC [Clo...  45.1    0.003
ref|ZP_06187603.1|  phage integrase family protein [Legionella...  45.1    0.003
ref|ZP_02465213.1|  putative bacteriophage integrase [Burkhold...  45.1    0.003
gb|ABA24691.1|  Phage integrase [Anabaena variabilis ATCC 29413]   45.1    0.003
ref|ZP_02774128.1|  integrase [Escherichia coli O157:H7 str. E...  45.1    0.003
gb|ADD79080.1|  Int [Pantoea ananatis LMG 20103]                   45.1    0.003
ref|ZP_05570380.1|  phage integrase family protein [Ferroplasm...  45.1    0.003
ref|NP_934570.1|  integrase [Vibrio vulnificus YJ016] >dbj|BAC...  45.1    0.003
ref|ZP_04825156.1|  tyrosine recombinase XerC [Staphylococcus ...  45.1    0.003
ref|ZP_04677272.1|  tyrosine recombinase XerC [Staphylococcus ...  45.1    0.003
ref|YP_003390104.1|  integrase family protein [Spirosoma lingu...  45.1    0.003
ref|YP_423405.1|  integrase [Magnetospirillum magneticum AMB-1...  45.1    0.003
ref|YP_048780.1|  putative phage integrase [Pectobacterium atr...  45.1    0.003
ref|NP_764483.1|  xerC protein [Staphylococcus epidermidis ATC...  45.1    0.003
ref|YP_001415530.1|  integrase family protein [Xanthobacter au...  45.1    0.003
ref|ZP_03827026.1|  Tyrosine recombinase xerD [Pectobacterium ...  45.1    0.003
ref|ZP_06374598.1|  hypothetical protein C1336_000800005 [Camp...  45.1    0.003
ref|YP_001242435.1|  putative prophage integrase [Bradyrhizobi...  45.1    0.003
ref|ZP_06244646.1|  integrase family protein [Victivallis vade...  45.1    0.003
ref|ZP_02067779.1|  hypothetical protein BACOVA_04789 [Bactero...  45.1    0.003
ref|YP_253577.1|  hypothetical protein SH1662 [Staphylococcus ...  45.1    0.003
ref|ZP_00544598.1|  Phage integrase:Phage integrase, N-termina...  45.1    0.003
ref|YP_001252065.1|  site specific recombinase [Legionella pne...  45.1    0.003
ref|ZP_00991626.1|  phage integrase [Vibrio splendidus 12B01] ...  45.1    0.003
ref|ZP_02436000.1|  hypothetical protein BACSTE_02254 [Bactero...  45.1    0.003
ref|YP_001411637.1|  integrase family protein [Parvibaculum la...  45.1    0.003
ref|ZP_05828022.1|  integrase [Acinetobacter baumannii ATCC 19...  45.1    0.003
ref|ZP_04699186.1|  integrase [Rickettsia endosymbiont of Ixod...  45.1    0.003
ref|YP_001250694.1|  phage related integrase [Legionella pneum...  45.1    0.003
ref|ZP_06200493.1|  transposase [Bacteroides sp. D20] >gb|EFA2...  44.7    0.003
ref|ZP_03833197.1|  phage integrase [Pectobacterium carotovoru...  44.7    0.003
ref|YP_001937555.1|  putative integrase [Orientia tsutsugamush...  44.7    0.003
ref|YP_001742404.1|  phage integrase family site specific reco...  44.7    0.003
ref|YP_460667.1|  integrase family protein [Syntrophus aciditr...  44.7    0.003
ref|ZP_01039291.1|  site-specific recombinase, phage integrase...  44.7    0.003
ref|YP_003279049.1|  phage integrase [Comamonas testosteroni C...  44.7    0.003
ref|YP_002475706.1|  phage integrase [Haemophilus parasuis SH0...  44.7    0.003
ref|YP_829270.1|  phage integrase family protein [Arthrobacter...  44.7    0.003
gb|ABZ06093.1|  putative Phage integrase family protein [uncul...  44.7    0.004
gb|AAA50502.1|  integrase [Bergeyella zoohelcum] >prf||2115270...  44.7    0.004
ref|ZP_05984435.2|  tyrosine recombinase XerD [Neisseria subfl...  44.7    0.004
ref|YP_001480111.1|  integrase family protein [Serratia protea...  44.7    0.004
ref|YP_001362867.1|  phage integrase family protein [Kineococc...  44.7    0.004
ref|YP_002991274.1|  integrase family protein [Desulfovibrio s...  44.7    0.004
ref|YP_001775679.1|  phage integrase [Xylella fastidiosa M12] ...  44.7    0.004
ref|ZP_02478181.1|  phage integrase family protein [Haemophilu...  44.7    0.004
ref|YP_916899.1|  phage integrase family protein [Paracoccus d...  44.7    0.004
ref|ZP_04855480.1|  conserved hypothetical protein [Ruminococc...  44.7    0.004
ref|YP_001917398.1|  integrase family protein [Natranaerobius ...  44.7    0.004
ref|YP_147583.1|  integrase/recombinase [Geobacillus kaustophi...  44.7    0.004
ref|ZP_03720367.1|  hypothetical protein NEIFLAOT_02223 [Neiss...  44.7    0.004
ref|YP_806623.1|  integrase [Lactobacillus casei ATCC 334] >re...  44.7    0.004
ref|YP_001125735.1|  integrase/recombinase [Geobacillus thermo...  44.7    0.004
ref|ZP_03965162.1|  site-specific recombinase XerD [Lactobacil...  44.7    0.004
ref|ZP_04674542.1|  tyrosine recombinase XerC subunit [Lactoba...  44.7    0.004
ref|YP_002795679.1|  Site-specific recombinase, phage integras...  44.7    0.004
ref|ZP_00956910.1|  site-specific integrase/recombinase [Sulfi...  44.7    0.004
ref|ZP_05283549.1|  putative tyrosine recombinase [Bacteroides...  44.7    0.004
ref|YP_002949692.1|  integrase family protein [Geobacillus sp....  44.7    0.004
ref|NP_242395.1|  integrase/recombinase [Bacillus halodurans C...  44.7    0.004
ref|ZP_04756775.1|  tyrosine recombinase XerD [Neisseria flave...  44.7    0.004
ref|ZP_04600703.1|  hypothetical protein GCWU000324_00153 [Kin...  44.7    0.004
ref|YP_443767.1|  phage integrase family site specific recombi...  44.7    0.004
ref|ZP_05360440.1|  integrase [Acinetobacter radioresistens SK...  44.7    0.004
ref|YP_003323296.1|  integrase family protein [Thermobaculum t...  44.7    0.004
ref|YP_001269458.1|  phage integrase family protein [Pseudomon...  44.7    0.004
ref|YP_001714701.1|  putative site-specific recombinase, integ...  44.7    0.004
gb|ADD44074.1|  tyrosine recombinase XerD [Stackebrandtia nass...  44.7    0.004
ref|ZP_03957421.1|  bacteriophage integrase [Lactobacillus rum...  44.7    0.004
ref|ZP_05785630.1|  phage integrase family protein [Silicibact...  44.7    0.004
ref|ZP_03683812.1|  hypothetical protein CATMIT_02473 [Catenib...  44.7    0.004
ref|ZP_01065091.1|  site-specific recombinase, phage integrase...  44.7    0.004
ref|ZP_05729680.1|  integrase family protein [Pantoea sp. At-9...  44.7    0.004
gb|AAQ06901.1|AF496235_1  integrase/recombinase [Lactobacillus...  44.7    0.004
ref|YP_002268886.1|  site-specific recombinase, phage integras...  44.7    0.004
ref|YP_393472.1|  Phage integrase [Sulfurimonas denitrificans ...  44.3    0.004
ref|NP_285976.1|  integrase protein for prophage CP-933I [Esch...  44.3    0.004
ref|YP_869430.1|  phage integrase family protein [Shewanella s...  44.3    0.004
ref|YP_001743018.1|  phage integrase family site specific reco...  44.3    0.004
emb|CBG35255.1|  integrase [Escherichia coli 042]                  44.3    0.004
ref|YP_001890224.1|  integrase family protein [Burkholderia ph...  44.3    0.004
gb|ADD54990.1|  Integrase protein for prophage CP-933I [Escher...  44.3    0.004
ref|ZP_03083123.1|  putative integrase [Escherichia coli O157:...  44.3    0.004
ref|NP_308316.1|  putative integrase [Escherichia coli O157:H7...  44.3    0.004
ref|ZP_06050132.1|  phage integrase [Vibrio cholerae CT 5369-9...  44.3    0.005
ref|YP_810597.1|  tyrosine recombinase XerC subunit [Oenococcu...  44.3    0.005
ref|ZP_06187155.1|  phage integrase family site-specific recom...  44.3    0.005
ref|ZP_02041463.1|  hypothetical protein RUMGNA_02232 [Ruminoc...  44.3    0.005
ref|YP_733819.1|  phage integrase family protein [Shewanella s...  44.3    0.005
ref|ZP_06229890.1|  integrase family protein [Burkholderia sp....  44.3    0.005
ref|YP_003231837.1|  putative integrase [Escherichia coli O26:...  44.3    0.005
ref|ZP_01004592.1|  Phage integrase [Loktanella vestfoldensis ...  44.3    0.005
ref|ZP_04700026.1|  integrase [Rickettsia endosymbiont of Ixod...  44.3    0.005
ref|ZP_02532114.1|  tyrosine recombinase XerD [Endoriftia pers...  44.3    0.005
ref|ZP_04770089.1|  integrase family protein [Asticcacaulis ex...  44.3    0.005
ref|YP_001598184.1|  Int2 [Salmonella enterica subsp. enterica...  44.3    0.005
ref|ZP_01451128.1|  site-specific recombinase, phage integrase...  44.3    0.005
ref|YP_209473.1|  integrase/recombinase [Salmonella enterica s...  44.3    0.005
ref|YP_003187317.1|  phage DNA recombinase XerD [Acetobacter p...  44.3    0.005
ref|ZP_01614768.1|  site-specific recombinase, phage integrase...  44.3    0.005
ref|ZP_04843877.1|  tyrosine type site-specific recombinase [B...  44.3    0.005
ref|YP_002991032.1|  integrase family protein [Desulfovibrio s...  44.3    0.005
ref|YP_101755.1|  tyrosine type site-specific recombinase [Bac...  44.3    0.005
ref|ZP_05550588.1|  integrase/recombinase [Fusobacterium sp. 3...  44.3    0.005
ref|YP_001958291.1|  hypothetical protein Aasi_1239 [Candidatu...  44.3    0.005
ref|YP_001721831.1|  integrase [Yersinia pseudotuberculosis YP...  44.3    0.005
gb|EDZ39824.1|  integrase INT P4 [Leptospirillum sp. Group II ...  44.3    0.005
ref|ZP_03051190.1|  site-specific recombinase, phage integrase...  44.3    0.005
ref|NP_761299.1|  integrase [Vibrio vulnificus CMCP6] >gb|AAO1...  44.3    0.005
ref|ZP_01885034.1|  integrase [Pedobacter sp. BAL39] >gb|EDM35...  44.3    0.005
ref|ZP_04922053.1|  site-specific recombinase, phage integrase...  44.3    0.005
ref|YP_002015220.1|  integrase family protein [Prosthecochlori...  44.3    0.005
ref|ZP_05779669.1|  phage integrase family protein [Citreicell...  44.3    0.005
ref|ZP_03697976.1|  integrase family protein [Lutiella nitrofe...  44.3    0.005
ref|YP_003007015.1|  hypothetical protein NT05HA_0516 [Aggrega...  44.3    0.005
ref|ZP_04762300.1|  integrase family protein [Acidovorax delaf...  43.9    0.006
ref|ZP_05032765.1|  site-specific recombinase, phage integrase...  43.9    0.006
ref|YP_309845.1|  putative integrase [Shigella sonnei Ss046] >...  43.9    0.006
ref|YP_003143427.1|  site-specific recombinase XerD [Slackia h...  43.9    0.006
ref|ZP_02436648.1|  hypothetical protein BACSTE_02916 [Bactero...  43.9    0.006
ref|ZP_06145262.1|  integrase family protein [Ruminococcus fla...  43.9    0.006
ref|YP_002048369.1|  integrase [Salmonella enterica subsp. ent...  43.9    0.006
ref|YP_001120510.1|  phage integrase family protein [Burkholde...  43.9    0.006
ref|YP_051550.1|  phage integrase [Pectobacterium atrosepticum...  43.9    0.006
ref|YP_002407994.1|  integrase of prophage [Escherichia coli I...  43.9    0.006
ref|NP_720381.2|  phage integrase family site specific recombi...  43.9    0.006
ref|ZP_04055444.1|  tyrosine recombinase XerD [Porphyromonas u...  43.9    0.006
ref|YP_003221206.1|  integrase [Escherichia coli O103:H2 str. ...  43.9    0.006
ref|YP_003228685.1|  integrase [Escherichia coli O26:H11 str. ...  43.9    0.006
ref|ZP_04752856.1|  phage integrase [Actinobacillus minor NM30...  43.9    0.006
ref|YP_002603349.1|  phage integrase protein (DNA breaking and...  43.9    0.006
ref|YP_002480931.1|  integrase family protein [Desulfovibrio d...  43.9    0.006
ref|ZP_00684136.1|  Phage integrase [Xylella fastidiosa Ann-1]...  43.9    0.006
ref|YP_001143174.1|  phage integrase [Aeromonas salmonicida su...  43.9    0.007
ref|ZP_04653673.1|  integrase family protein [Salmonella enter...  43.9    0.007
ref|YP_001928501.1|  putative integrase/recombinase XerD [Porp...  43.9    0.007
ref|ZP_03517463.1|  phage integrase family protein [Rhizobium ...  43.9    0.007
ref|YP_001641228.1|  integrase family protein [Methylobacteriu...  43.9    0.007
ref|YP_001764578.1|  integrase family protein [Burkholderia ce...  43.9    0.007
ref|YP_002455812.1|  integrase [Lactobacillus phage Lv-1] >gb|...  43.5    0.007
ref|NP_905840.1|  integrase/recombinase XerD [Porphyromonas gi...  43.5    0.007
ref|ZP_04635151.1|  Integrase [Yersinia intermedia ATCC 29909]...  43.5    0.007
ref|YP_001800486.1|  integrase/recombinase [Corynebacterium ur...  43.5    0.008
ref|ZP_04769629.1|  integrase family protein [Asticcacaulis ex...  43.5    0.008
ref|ZP_04450311.1|  hypothetical protein GCWU000282_01546 [Cat...  43.5    0.008
ref|NP_603734.1|  integrase/recombinase [Fusobacterium nucleat...  43.5    0.008
ref|ZP_04699824.1|  integrase [Rickettsia endosymbiont of Ixod...  43.5    0.008
ref|YP_002130261.1|  integrase/recombinase, phage integrase [P...  43.5    0.008
ref|YP_001957317.1|  integrase family protein [Candidatus Amoe...  43.5    0.008
ref|ZP_01707556.1|  phage integrase [Shewanella putrefaciens 2...  43.5    0.008
ref|YP_562147.1|  phage integrase [Shewanella denitrificans OS...  43.5    0.008
ref|ZP_02788531.1|  integrase [Escherichia coli O157:H7 str. E...  43.5    0.008
ref|YP_003229316.1|  putative integrase [Escherichia coli O26:...  43.5    0.008
ref|YP_001280169.1|  phage integrase family protein [Psychroba...  43.5    0.008
ref|NP_942502.1|  hypothetical protein sll6059 [Synechocystis ...  43.5    0.008
ref|YP_676338.1|  phage integrase [Mesorhizobium sp. BNC1] >gb...  43.5    0.008
ref|ZP_06552342.1|  phage integrase family site-specific recom...  43.5    0.008
ref|ZP_04699157.1|  integrase [Rickettsia endosymbiont of Ixod...  43.5    0.008
ref|YP_002360280.1|  integrase family protein [Shewanella balt...  43.5    0.008
ref|YP_001248335.1|  phage-related integrase [Orientia tsutsug...  43.5    0.008
ref|ZP_04629335.1|  Integrase [Yersinia bercovieri ATCC 43970]...  43.5    0.008
ref|ZP_01017052.1|  Phage integrase [Parvularcula bermudensis ...  43.5    0.008
ref|ZP_06200005.1|  conserved hypothetical protein [Bacteroide...  43.5    0.008
ref|ZP_06011604.1|  tyrosine recombinase XerD [Leptotrichia go...  43.5    0.008
ref|YP_878186.1|  integrase/recombinase, putative [Clostridium...  43.5    0.008
ref|YP_003449703.1|  phage integrase [Azospirillum sp. B510] >...  43.5    0.009
ref|YP_001248998.1|  phage-related integrase [Orientia tsutsug...  43.5    0.009
ref|YP_003333945.1|  integrase family protein [Dickeya dadanti...  43.5    0.009
ref|YP_002238964.1|  site-specific recombinase, phage integras...  43.5    0.009
ref|YP_001415977.1|  integrase family protein [Xanthobacter au...  43.5    0.009
gb|ABN68939.1|  integrase [Enterobacteria phage phi24B]            43.5    0.009
ref|YP_001877983.1|  integrase family protein [Akkermansia muc...  43.5    0.009
ref|NP_933070.1|  phage integrase family site specific recombi...  43.5    0.009
ref|YP_001415970.1|  integrase family protein [Xanthobacter au...  43.5    0.009
ref|YP_003428153.1|  integrase family protein [Bacillus pseudo...  43.5    0.009
ref|ZP_04059763.1|  tyrosine recombinase XerC [Staphylococcus ...  43.5    0.009
ref|ZP_03065828.1|  site-specific recombinase, phage integrase...  43.5    0.009
ref|YP_862412.1|  tyrosine recombinase XerC [Gramella forsetii...  43.5    0.009
ref|YP_001167040.1|  phage integrase family protein [Rhodobact...  43.5    0.009
ref|ZP_01895695.1|  putative integrase [Marinobacter algicola ...  43.5    0.009
ref|YP_001052063.1|  phage integrase family protein [Shewanell...  43.5    0.009
sp|Q48733.1|XERC_LACLE  RecName: Full=Tyrosine recombinase xer...  43.5    0.009
ref|YP_001181098.1|  tyrosine recombinase XerD [Caldicellulosi...  43.5    0.009
ref|ZP_04552336.1|  transposase [Bacteroides sp. 2_2_4] >gb|EE...  43.5    0.009
ref|YP_001682770.1|  integrase family protein [Caulobacter sp....  43.5    0.009
ref|YP_926199.1|  hypothetical protein Sama_0318 [Shewanella a...  43.5    0.009
ref|ZP_04916677.1|  site-specific recombinase, phage integrase...  43.5    0.009
ref|ZP_06341195.1|  phage integrase, N-terminal SAM domain pro...  43.5    0.009
ref|ZP_01034018.1|  putative P4-family integrase [Roseovarius ...  43.5    0.009
ref|ZP_04850494.1|  conserved hypothetical protein [Bacteroide...  43.5    0.009
ref|ZP_04770793.1|  integrase family protein [Asticcacaulis ex...  43.5    0.009
ref|ZP_02403360.1|  integrase family protein [Burkholderia pse...  43.1    0.010
ref|YP_001467745.1|  30S ribosomal protein S15 [Campylobacter ...  43.1    0.010
ref|YP_512286.1|  putative integrase [Escherichia phage phiV10...  43.1    0.010
ref|ZP_04545308.1|  site-specific recombinase [Bacteroides sp....  43.1    0.010
ref|ZP_04443309.1|  integrase/recombinase XerD [Listeria grayi...  43.1    0.010
gb|EDZ39894.1|  Putative integrase [Leptospirillum sp. Group I...  43.1    0.010
ref|ZP_02959572.1|  hypothetical protein PROSTU_01438 [Provide...  43.1    0.010
ref|YP_001343346.1|  phage integrase family protein [Actinobac...  43.1    0.010
ref|ZP_00144452.1|  DNA integration/recombination/invertion pr...  43.1    0.010
ref|ZP_05366727.1|  tyrosine recombinase XerD [Corynebacterium...  43.1    0.010
ref|NP_903521.1|  prophage integrase [Chromobacterium violaceu...  43.1    0.010
ref|ZP_03217914.1|  integrase [Salmonella enterica subsp. ente...  43.1    0.010
ref|ZP_03055682.1|  DNA integration/recombination [Bacillus pu...  43.1    0.010
ref|YP_806588.1|  integrase [Lactobacillus casei ATCC 334] >re...  43.1    0.010
ref|YP_002339973.1|  prophage LambdaBa02, site-specific recomb...  43.1    0.010
ref|YP_001051903.1|  phage integrase family protein [Shewanell...  43.1    0.010
ref|YP_003132870.1|  tyrosine recombinase XerC subunit [Saccha...  43.1    0.010
ref|ZP_04541335.1|  tyrosine type site-specific recombinase [B...  43.1    0.010
ref|ZP_03475692.1|  hypothetical protein PRABACTJOHN_01354 [Pa...  43.1    0.010
ref|YP_003094801.1|  Integrase, site-specific recombinase [Fla...  43.1    0.010
ref|ZP_05122267.1|  phage integrase [Rhodobacteraceae bacteriu...  43.1    0.010
ref|ZP_02901872.1|  prophage integrase [Escherichia albertii T...  43.1    0.010
ref|ZP_04575059.1|  integrase/recombinase [Fusobacterium sp. 7...  43.1    0.011
ref|ZP_02162945.1|  integrase, site-specific recombinase [Kord...  43.1    0.011
ref|YP_617442.1|  phage integrase [Sphingopyxis alaskensis RB2...  43.1    0.011
ref|ZP_05500934.1|  tyrosine recombinase XerD [Thiomonas inter...  43.1    0.011
ref|YP_289262.1|  site-specific tyrosine recombinase XerD [The...  43.1    0.011
ref|ZP_04579503.1|  tyrosine recombinase XerD [Oxalobacter for...  43.1    0.011
ref|YP_227613.1|  putative integrase [Haemophilus phage Aaphi2...  43.1    0.011
ref|YP_002277118.1|  integrase family protein [Gluconacetobact...  43.1    0.011
ref|ZP_05814587.1|  integrase/recombinase [Fusobacterium sp. 3...  43.1    0.011
ref|YP_003018394.1|  integrase family protein [Pectobacterium ...  43.1    0.011
ref|YP_001637748.1|  integrase family protein [Methylobacteriu...  43.1    0.011
ref|YP_001751196.1|  integrase family protein [Pseudomonas put...  43.1    0.011
ref|YP_001327298.1|  phage integrase family protein [Sinorhizo...  43.1    0.011
ref|YP_002507587.1|  integrase family protein [Clostridium cel...  43.1    0.011
ref|YP_818649.1|  tyrosine recombinase XerC subunit [Leuconost...  43.1    0.011
ref|YP_002892380.1|  integrase family protein [Tolumonas auens...  43.1    0.012
ref|ZP_03310932.1|  hypothetical protein DESPIG_00836 [Desulfo...  43.1    0.012
ref|YP_001209685.1|  bacteriophage P4-like integrase [Dichelob...  43.1    0.012
ref|ZP_04548948.1|  conserved hypothetical protein [Bacteroide...  43.1    0.012
ref|YP_001430203.1|  integrase family protein [Roseiflexus cas...  43.1    0.012
ref|YP_002548629.1|  phage-related integrase [Agrobacterium vi...  43.1    0.012
ref|ZP_03052364.1|  site-specific recombinase, phage integrase...  43.1    0.012
ref|ZP_03913636.1|  site-specific recombinase XerD [Leuconosto...  43.1    0.012
ref|YP_001685419.1|  integrase family protein [Caulobacter sp....  43.1    0.012
ref|ZP_04921628.1|  Integrase [Vibrio sp. Ex25] >ref|YP_003285...  43.1    0.012
ref|ZP_03921924.1|  site-specific tyrosine recombinase XerD [C...  43.1    0.012
emb|CBA74615.1|  phage integrase [Arsenophonus nasoniae]           43.1    0.012
ref|ZP_05941494.1|  putative integrase of prophage CP-933C [Es...  43.1    0.012
ref|ZP_04820619.1|  phage integrase family protein [Clostridiu...  43.1    0.012
ref|YP_002046450.1|  integrase [Salmonella enterica subsp. ent...  43.1    0.012
ref|ZP_01745570.1|  hypothetical protein SSE37_04765 [Sagittul...  42.7    0.012
ref|ZP_01690979.1|  integrase, site-specific recombinase [Micr...  42.7    0.013
ref|NP_707043.1|  putative integrase of prophage CP-933C [Shig...  42.7    0.013
ref|ZP_03919321.1|  site-specific tyrosine recombinase XerD [C...  42.7    0.013
ref|ZP_03791789.1|  phage integrase family protein [Burkholder...  42.7    0.013
ref|ZP_03636278.1|  hypothetical protein HOLDEFILI_03588 [Hold...  42.7    0.013
ref|ZP_03064279.1|  site-specific recombinase, phage integrase...  42.7    0.013
ref|ZP_03972048.1|  site-specific tyrosine recombinase XerD [C...  42.7    0.013
ref|ZP_01445855.1|  Integrase [Roseovarius sp. HTCC2601] >gb|E...  42.7    0.013
ref|YP_285542.1|  Phage integrase [Dechloromonas aromatica RCB...  42.7    0.013
ref|ZP_05951314.1|  putative integrase of prophage CP-933C [Es...  42.7    0.013
ref|YP_827617.1|  tyrosine recombinase XerD subunit [Solibacte...  42.7    0.013
ref|ZP_02065149.1|  hypothetical protein BACOVA_02123 [Bactero...  42.7    0.013
ref|YP_981208.1|  phage integrase family protein [Polaromonas ...  42.7    0.013
ref|ZP_05902225.1|  integrase [Leptotrichia hofstadii F0254] >...  42.7    0.013
ref|YP_615898.1|  phage integrase [Sphingopyxis alaskensis RB2...  42.7    0.013
ref|ZP_05571490.1|  site-specific integrase/recombinase [Ferro...  42.7    0.013
ref|ZP_05454342.1|  phage-related integrase [Brucella melitens...  42.7    0.013
ref|ZP_02455170.1|  phage integrase family protein [Burkholder...  42.7    0.013
ref|YP_001531745.1|  phage integrase family protein [Dinoroseo...  42.7    0.013
ref|ZP_02812591.1|  site-specific recombinase, phage integrase...  42.7    0.013
ref|ZP_04971214.1|  site-specific recombinase [Fusobacterium n...  42.7    0.013
ref|ZP_05309588.1|  integrase family protein [Geobacter sp. M1...  42.7    0.014
ref|YP_003017208.1|  integrase family protein [Pectobacterium ...  42.7    0.014
ref|YP_003338689.1|  tyrosine recombinase XerD [Streptosporang...  42.7    0.014
ref|YP_002408642.1|  putative integrase [Escherichia coli IAI3...  42.7    0.014
ref|ZP_00953553.1|  site-specfic recombinase, phage integrase ...  42.7    0.014
ref|ZP_03728936.1|  integrase family protein [Dethiobacter alk...  42.7    0.014
ref|ZP_03149621.1|  integrase family protein [Geobacillus sp. ...  42.7    0.014
ref|ZP_03003178.1|  site-specific recombinase, phage integrase...  42.7    0.014
ref|ZP_01868766.1|  phage integrase family protein [Vibrio shi...  42.7    0.014
ref|NP_287321.1|  putative integrase of prophage CP-933C [Esch...  42.7    0.014
ref|YP_002240225.1|  site-specific recombinase, phage integras...  42.7    0.014
ref|ZP_04576167.1|  phage integrase [Oxalobacter formigenes HO...  42.7    0.014
ref|NP_149244.1|  site-specific tyrosine recombinase XerC [Clo...  42.7    0.014
ref|YP_002936005.1|  putative phage integrase/recombinase [Eub...  42.7    0.014
ref|YP_002247908.1|  tyrosine recombinase XerD [Thermodesulfov...  42.7    0.014
ref|YP_003222786.1|  integrase [Escherichia coli O103:H2 str. ...  42.7    0.014
ref|YP_688661.1|  putative integrase of prophage [Shigella fle...  42.7    0.014
ref|YP_001249008.1|  phage-related integrase [Orientia tsutsug...  42.7    0.015
ref|ZP_05865576.1|  integrase [Lactobacillus jensenii SJ-7A-US...  42.7    0.015
ref|YP_002923620.1|  integrase [Candidatus Hamiltonella defens...  42.7    0.015
ref|ZP_05065653.1|  integrase [Octadecabacter antarcticus 238]...  42.7    0.015
gb|ABM65820.1|  IntA [Mesorhizobium sp. R88B]                      42.7    0.015
ref|ZP_02997294.1|  site-specific recombinase, phage integrase...  42.7    0.015
ref|YP_518404.1|  hypothetical protein DSY2171 [Desulfitobacte...  42.7    0.015
ref|NP_842193.1|  integron integrase [Nitrosomonas europaea AT...  42.7    0.015
ref|YP_356232.1|  site-specific recombinase/integrase [Pelobac...  42.7    0.015
ref|YP_003147834.1|  integrase family protein [Cyanothece sp. ...  42.7    0.016
ref|YP_144805.1|  putative phage integrase/recombinase [Thermu...  42.7    0.016
ref|NP_309601.1|  putative integrase [Escherichia coli O157:H7...  42.7    0.016
ref|ZP_03250923.1|  site-specific recombinase, phage integrase...  42.7    0.016
ref|YP_001879477.1|  prophage integrase [Shigella boydii CDC 3...  42.7    0.016
ref|ZP_01904587.1|  hypothetical integrase [Roseobacter sp. Az...  42.7    0.016
ref|ZP_01091437.1|  integrase/recombinase [Blastopirellula mar...  42.7    0.016
ref|ZP_03624943.1|  integrase family protein [Streptococcus su...  42.7    0.016
ref|ZP_05311328.1|  integrase family protein [Geobacter sp. M1...  42.4    0.016
ref|YP_002397757.1|  integrase of prophage [Escherichia coli E...  42.4    0.016
ref|ZP_02807454.1|  site-specific recombinase, phage integrase...  42.4    0.016
ref|ZP_05711090.1|  integrase family protein [Desulfurivibrio ...  42.4    0.017
ref|ZP_06057580.1|  integrase [Acinetobacter calcoaceticus RUH...  42.4    0.017
ref|YP_002971738.1|  phage-related integrase/recombinase [Bart...  42.4    0.017
ref|ZP_06013049.1|  phage integrase family site-specific recom...  42.4    0.017
ref|YP_003212645.1|  hypothetical protein Ctu_1p00690 [Cronoba...  42.4    0.017
ref|ZP_01813782.1|  site-specific recombinase, phage integrase...  42.4    0.017
ref|ZP_03033594.1|  site-specific recombinase, phage integrase...  42.4    0.017
ref|ZP_03013971.1|  hypothetical protein BACINT_01531 [Bactero...  42.4    0.017
ref|ZP_06370720.1|  integrase family protein [Desulfovibrio sp...  42.4    0.018
ref|ZP_03678057.1|  hypothetical protein BACCELL_02397 [Bacter...  42.4    0.018
ref|YP_001302301.1|  transposase [Parabacteroides distasonis A...  42.4    0.018
ref|YP_524281.1|  phage integrase [Rhodoferax ferrireducens T1...  42.4    0.018
gb|EFE22352.1|  site-specific recombinase, phage integrase fam...  42.4    0.018
ref|ZP_04335582.1|  site-specific recombinase XerD [Nocardiops...  42.4    0.018
ref|ZP_01904824.1|  site-specific recombinase, phage integrase...  42.4    0.018
ref|ZP_01288837.1|  Phage integrase [delta proteobacterium MLM...  42.4    0.018
ref|NP_840329.1|  Phage integrase [Nitrosomonas europaea ATCC ...  42.4    0.018
ref|YP_003445333.1|  site-specific recombinase, phage integras...  42.4    0.018
ref|ZP_05441196.1|  integrase/recombinase [Fusobacterium sp. D...  42.4    0.018
ref|YP_830490.1|  phage integrase family protein [Arthrobacter...  42.4    0.018
ref|YP_303296.1|  Phage integrase, N-terminal SAM- like [Ehrli...  42.4    0.018
ref|ZP_05649197.1|  phage integrase [Enterococcus gallinarum E...  42.4    0.018
ref|ZP_06496227.1|  phage integrase, putative [Pseudomonas syr...  42.4    0.019
ref|ZP_04570987.1|  integrase/recombinase [Fusobacterium sp. 2...  42.4    0.019
ref|ZP_03460327.1|  hypothetical protein BACEGG_03142 [Bactero...  42.4    0.019
ref|YP_001678944.1|  tyrosine recombinase xerd, putative [Heli...  42.4    0.019
ref|YP_003294855.1|  putative site specific integrase [Edwards...  42.4    0.019
ref|ZP_04617515.1|  Integrase [Yersinia ruckeri ATCC 29473] >g...  42.4    0.019
ref|YP_002364713.1|  integrase family protein [Cyanothece sp. ...  42.4    0.019
ref|ZP_05759955.1|  transposase [Bacteroides sp. D2]               42.4    0.019
ref|ZP_05656209.1|  phage integrase [Enterococcus casseliflavu...  42.4    0.019
ref|YP_916868.1|  phage integrase family protein [Paracoccus d...  42.4    0.019
ref|YP_002796454.1|  Integrase [Laribacter hongkongensis HLHK9...  42.4    0.020
ref|YP_001379304.1|  tyrosine recombinase XerD [Anaeromyxobact...  42.4    0.020
ref|ZP_06124663.1|  putative integrase [Providencia rettgeri D...  42.4    0.020
ref|YP_002732704.1|  phage-related integrase [Brucella meliten...  42.4    0.020
ref|ZP_05647301.1|  phage integrase [Enterococcus casseliflavu...  42.4    0.020
ref|ZP_05166092.1|  Phage integrase [Brucella suis bv. 3 str. ...  42.4    0.020
ref|NP_697976.1|  phage integrase family site specific recombi...  42.4    0.020
ref|ZP_01905077.1|  site-specific recombinase, phage integrase...  42.4    0.020
ref|YP_941859.1|  phage integrase family protein [Psychromonas...  42.4    0.020
ref|ZP_06031488.1|  site-specific recombinase phage integrase ...  42.4    0.020
ref|YP_002425983.1|  site-specific recombinase, phage integras...  42.4    0.020
ref|YP_001083115.1|  site-specific tyrosine recombinase [Acine...  42.4    0.020
ref|YP_156036.1|  integrase [Idiomarina loihiensis L2TR] >gb|A...  42.4    0.020
ref|ZP_05050265.1|  site-specific recombinase, phage integrase...  42.4    0.021
ref|ZP_05447534.1|  phage-related integrase [Brucella melitens...  42.4    0.021
ref|YP_002219716.1|  integrase family protein [Acidithiobacill...  42.4    0.021
ref|ZP_05121098.1|  phage integrase family protein [Vibrio par...  42.4    0.021
ref|YP_001049966.1|  phage integrase family protein [Shewanell...  42.4    0.021
gb|EAY57768.1|  putative phage integrase family protein [Lepto...  42.4    0.021
gb|AAS99039.1|  Tgh84 [Campylobacter jejuni]                       42.4    0.021
ref|YP_433045.1|  tyrosine recombinase XerD [Hahella chejuensi...  42.0    0.021
ref|ZP_06069292.1|  predicted protein [Acinetobacter lwoffii S...  42.0    0.021
ref|ZP_05910748.1|  phage integrase family protein [Vibrio par...  42.0    0.021
ref|ZP_04552285.1|  integrase [Bacteroides sp. 2_2_4] >gb|EEO5...  42.0    0.021
ref|YP_461218.1|  phage integrase family protein [Syntrophus a...  42.0    0.021
ref|NP_753392.1|  putative integrase of prophage [Escherichia ...  42.0    0.021
ref|ZP_03212128.1|  Integrase [Lactobacillus rhamnosus HN001] ...  42.0    0.022
ref|YP_002128335.1|  site-specific recombinase, phage integras...  42.0    0.022
ref|ZP_05163550.1|  Phage integrase [Brucella suis bv. 5 str. ...  42.0    0.022
ref|ZP_05155513.1|  Phage integrase [Brucella abortus bv. 3 st...  42.0    0.022
ref|YP_794973.1|  integrase [Lactobacillus brevis ATCC 367] >g...  42.0    0.022
ref|YP_356929.1|  site-specific recombinase [Pelobacter carbin...  42.0    0.022
ref|ZP_06114653.1|  integrase/recombinase XerD [Clostridium ha...  42.0    0.022
ref|ZP_05376295.1|  tyrosine recombinase XerD [Hyphomicrobium ...  42.0    0.022
ref|ZP_01289825.1|  Phage integrase [delta proteobacterium MLM...  42.0    0.022
ref|YP_002298867.1|  tyrosine recombinase XerD [Rhodospirillum...  42.0    0.023
ref|ZP_00513833.1|  Phage integrase:Phage integrase, N-termina...  42.0    0.023
ref|ZP_04553677.1|  transposase [Bacteroides sp. 2_2_4] >gb|EE...  42.0    0.023
ref|YP_002989933.1|  integrase family protein [Desulfovibrio s...  42.0    0.023
ref|ZP_05084016.1|  phage integrase family protein [Pseudovibr...  42.0    0.023
ref|ZP_01872494.1|  Integrase [Caminibacter mediatlanticus TB-...  42.0    0.023
ref|YP_002954982.1|  phage integrase family protein [Desulfovi...  42.0    0.024
ref|ZP_04011312.1|  integrase-recombinase [Lactobacillus ultun...  42.0    0.024
ref|ZP_06244215.1|  tyrosine recombinase XerD [Victivallis vad...  42.0    0.024
ref|YP_001093396.1|  phage integrase family protein [Shewanell...  42.0    0.024
ref|ZP_04537634.1|  conserved hypothetical protein [Escherichi...  42.0    0.024
ref|ZP_02783804.1|  site-specific recombinase, phage integrase...  42.0    0.024
ref|ZP_06027165.1|  integrase/recombinase [Fusobacterium perio...  42.0    0.024
ref|ZP_05813415.1|  integrase family protein [Mesorhizobium op...  42.0    0.024
ref|YP_250655.1|  integrase/recombinase [Corynebacterium jeike...  42.0    0.024
ref|ZP_05932968.1|  conserved hypothetical protein [Brucella c...  42.0    0.024
ref|YP_002287248.1|  phage integrase [Oligotropha carboxidovor...  42.0    0.025
ref|ZP_02478913.1|  prophage CP4-57-like integrase [Haemophilu...  42.0    0.025
ref|YP_900824.1|  tyrosine recombinase XerD [Pelobacter propio...  42.0    0.025
ref|YP_003106899.1|  site-specific recombinase, phage integras...  42.0    0.025
ref|ZP_05342175.1|  phage integrase family protein [Thalassiob...  42.0    0.025
ref|ZP_05171868.1|  Phage integrase [Brucella pinnipedialis B2...  42.0    0.025
ref|NP_841499.1|  phage integrase domain/SAM domain-containing...  42.0    0.025
ref|ZP_01904787.1|  Phage integrase [Roseobacter sp. AzwK-3b] ...  42.0    0.025
ref|ZP_05861093.1|  xylulose-5-phosphate/fructose-6-phosphate ...  42.0    0.025
dbj|BAH79202.1|  putative integrase [Escherichia coli O157:H7]     42.0    0.025
ref|ZP_05846565.1|  integrase/recombinase XerD [Corynebacteriu...  42.0    0.026
ref|ZP_01289843.1|  Phage integrase [delta proteobacterium MLM...  42.0    0.026
ref|YP_410765.1|  Phage integrase [Nitrosospira multiformis AT...  42.0    0.026
ref|NP_218831.1|  integrase/recombinase (codV) [Treponema pall...  42.0    0.026
ref|YP_148766.1|  integrase/recombinase [Geobacillus kaustophi...  42.0    0.026
ref|YP_124435.1|  hypothetical protein lpp2123 [Legionella pne...  42.0    0.026
ref|ZP_04920611.1|  site-specific recombinase, phage integrase...  42.0    0.026
ref|ZP_06089623.1|  transposase [Bacteroides sp. 3_1_33FAA] >g...  42.0    0.026
ref|ZP_05152456.1|  Phage integrase [Brucella abortus bv. 6 st...  42.0    0.026
dbj|BAI54705.1|  phage integrase [Escherichia coli SE15]           42.0    0.027
ref|ZP_06370193.1|  tyrosine recombinase XerD [Desulfovibrio s...  42.0    0.027
ref|ZP_05901640.1|  tyrosine recombinase XerD [Leptotrichia ho...  42.0    0.027
ref|ZP_04569095.1|  phage integrase [Fusobacterium sp. 2_1_31]...  42.0    0.028
ref|YP_001937919.1|  putative integrase [Orientia tsutsugamush...  42.0    0.028
ref|ZP_05956802.1|  conserved hypothetical protein [Brucella p...  41.6    0.028
ref|YP_002606689.1|  phage integrase [Nautilia profundicola Am...  41.6    0.028
ref|ZP_01732572.1|  Phage integrase [Cyanothece sp. CCY0110] >...  41.6    0.028
ref|YP_996489.1|  tyrosine recombinase XerD [Verminephrobacter...  41.6    0.028
ref|YP_301606.1|  putative integrase recombinase [Staphylococc...  41.6    0.028
ref|ZP_05377142.1|  integrase family protein [Hyphomicrobium d...  41.6    0.028
ref|ZP_05175869.1|  Phage integrase [Brucella ceti M644/93/1] ...  41.6    0.028
ref|ZP_05125198.1|  phage integrase family protein [Rhodobacte...  41.6    0.028
ref|ZP_01871307.1|  Phage integrase [Caminibacter mediatlantic...  41.6    0.028
ref|NP_520665.1|  site-specific tyrosine recombinase XerD [Ral...  41.6    0.028
ref|ZP_03012108.1|  hypothetical protein BACCOP_04040 [Bactero...  41.6    0.029
ref|YP_003456809.1|  phage-related integrase [Legionella longb...  41.6    0.029
ref|YP_129903.1|  hypothetical protein PBPRA1694 [Photobacteri...  41.6    0.029
ref|ZP_04840908.1|  integrase [Bacteroides sp. 3_2_5] >gb|EES8...  41.6    0.029
ref|YP_734905.1|  phage integrase family protein [Shewanella s...  41.6    0.029
ref|YP_611817.1|  phage integrase [Ruegeria sp. TM1040] >gb|AB...  41.6    0.029
ref|ZP_06233462.1|  tyrosine recombinase XerC [Desulfovibrio a...  41.6    0.029
ref|YP_002521382.1|  transposase [Thermomicrobium roseum DSM 5...  41.6    0.029
ref|YP_003051445.1|  integrase family protein [Methylovorus sp...  41.6    0.030
ref|ZP_05124619.1|  phage integrase family protein [Rhodobacte...  41.6    0.030
ref|ZP_02507223.1|  phage integrase [Burkholderia pseudomallei...  41.6    0.030
ref|YP_001352164.1|  integrase/recombinase [Janthinobacterium ...  41.6    0.030
ref|YP_001060060.1|  phage integrase [Burkholderia pseudomalle...  41.6    0.030
ref|ZP_05727554.1|  integrase family protein [Pantoea sp. At-9...  41.6    0.030
ref|YP_998899.1|  hypothetical protein Veis_4176 [Verminephrob...  41.6    0.030
ref|YP_001890220.1|  integrase family protein [Burkholderia ph...  41.6    0.030
ref|ZP_05989385.1|  putative bacteriophage integrase [Mannheim...  41.6    0.031
ref|YP_001101253.1|  CP4-6 prophage; phage integrase [Herminii...  41.6    0.031
ref|YP_002545984.1|  tyrosine recombinase XerC [Agrobacterium ...  41.6    0.031
ref|ZP_02620986.1|  putative integrase/recombinase [Clostridiu...  41.6    0.031
ref|ZP_02068395.1|  hypothetical protein BACOVA_05411 [Bactero...  41.6    0.031
ref|ZP_02360229.1|  phage integrase family protein [Burkholder...  41.6    0.031
ref|YP_001468682.1|  gp43 [Listeria phage B025] >gb|AAY53083.1...  41.6    0.031
ref|YP_578085.1|  phage integrase [Nitrobacter hamburgensis X1...  41.6    0.031
ref|YP_001959022.1|  integrase family protein [Chlorobium phae...  41.6    0.031
ref|ZP_01734466.1|  site-specific recombinase [Flavobacteria b...  41.6    0.032
ref|ZP_04012785.1|  site-specific DNA tyrosine recombinase, Xe...  41.6    0.032
ref|NP_813528.1|  integrase [Bacteroides thetaiotaomicron VPI-...  41.6    0.032
ref|ZP_02030751.1|  hypothetical protein PARMER_00727 [Parabac...  41.6    0.032

ALIGNMENTS
>ref|ZP_01004335.1| possible phage-related integrase [Loktanella vestfoldensis SKA53]
 gb|EAQ05556.1| possible phage-related integrase [Loktanella vestfoldensis SKA53]
Length=386

 Score =  111 bits (277),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/168 (39%), Positives = 90/168 (53%), Gaps = 6/168 (3%)

Query  1    QMGGPQGRLIEFLLLSGQRLNEVARLTWDEVKEDRLE--IPGLRNKSGETLITPLLPSLP  58
            QMG P GR+ + L+L+ QR +EVA + W E+  DR    I   R K+G+  I  L P   
Sbjct  214  QMGFPFGRITQLLILTAQRRDEVAGMRWSELDLDRARWIISKERAKNGKAHIVHLSPQAL  273

Query  59   QILEKYPQQEGSYLFTTGDGTRPISGFSQIKAILSKLSGVTDWNFHDFRRSFATLLSDE-  117
             +L   P+Q G  L  T  G   +SGFS+ KA L   S V+DW FHD RRS AT +++E 
Sbjct  274  ALLSTIPRQNGVDLIFTTTGRSAVSGFSKAKAALDARSHVSDWRFHDLRRSAATFMAEEL  333

Query  118  GIDRFSVKCALNHKDSS---VTGIYDRPYHIKRKSLALVQWHYVVENI  162
             I    V   LNH   +   VT +Y R  H+  +  AL  W  +VEN+
Sbjct  334  RITPVVVDRILNHVSGTVRGVTAVYLRGEHLADREAALAAWGQLVENL  381


>ref|ZP_01901151.1| site-specific recombinase, phage integrase family protein [Roseobacter 
sp. AzwK-3b]
 gb|EDM72849.1| site-specific recombinase, phage integrase family protein [Roseobacter 
sp. AzwK-3b]
Length=320

 Score =  103 bits (258),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 60/167 (35%), Positives = 92/167 (55%), Gaps = 6/167 (3%)

Query  2    MGGPQGRLIEFLLLSGQRLNEVARLTWDEVKEDR--LEIPGLRNKSGETLITPLLPSLPQ  59
            +G P G +++ L+L+ QR +EVA +TW E+  DR    I   R K+G+T    L P+   
Sbjct  149  IGYPFGPIVKLLILTAQRRDEVAGMTWSELDLDRGTWTIGAERAKNGQTHTVHLSPAAQA  208

Query  60   ILEKYPQQEGSYLFTTGDGTRPISGFSQIKAILSKLSGVTDWNFHDFRRSFATLLSDE-G  118
            ILE+ PQ+  S    T  GT  +SGFS+ KA L +LS V +W  HD RR+ AT++++   
Sbjct  209  ILEQIPQRSDSDFVFTTTGTSAVSGFSKAKARLDQLSAVNEWRLHDLRRTAATMMAERLE  268

Query  119  IDRFSVKCALNHKDSSVTG---IYDRPYHIKRKSLALVQWHYVVENI  162
            +    V   LNH+  ++ G   +Y R   +K +  AL +W   V  +
Sbjct  269  VGHAVVDKVLNHRSGAIRGVAAVYLRGQFLKERQSALFRWGTFVHEL  315


>ref|YP_001240859.1| putative phage-like integrase [Bradyrhizobium sp. BTAi1]
 gb|ABQ36953.1| putative phage-like integrase [Bradyrhizobium sp. BTAi1]
Length=434

 Score =  102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 92/158 (58%), Gaps = 5/158 (3%)

Query  2    MGGPQGRLIEFLLLSGQRLNEVARLTWDEVKEDRLEIPGLRNKSGETLITPLLPSLPQIL  61
            +G P G +++ LLL+GQRLNE+ARL   E+ ++ + +PG R K+      PL     ++L
Sbjct  269  LGSPFGPMLKLLLLTGQRLNEIARLHDTELTDEAIRLPGSRTKNALPHDVPLSSLAKEVL  328

Query  62   EKYPQQEGS-YLFTTGDGTRPISGFSQIKAILSKLSGVTDWNFHDFRRSFATLLSDEGID  120
             +  +   S Y+F+T +G  P+SGFS+ K+ +  L  +  W FHD RRS AT +++ GI 
Sbjct  329  AEVQRVPNSKYVFST-NGRAPVSGFSKAKSRIDDLLNIEPWVFHDLRRSAATGMAEIGIQ  387

Query  121  RFSVKCALNH---KDSSVTGIYDRPYHIKRKSLALVQW  155
               ++  LNH     +SV GIY+R  +   K  AL +W
Sbjct  388  PHVIEAILNHISGHKASVAGIYNRAAYANEKREALEKW  425


>ref|ZP_05065481.1| putative phage-related integrase [Octadecabacter antarcticus 
238]
 gb|EDY90720.1| putative phage-related integrase [Octadecabacter antarcticus 
238]
Length=385

 Score =  102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 89/168 (52%), Gaps = 6/168 (3%)

Query  1    QMGGPQGRLIEFLLLSGQRLNEVARLTWDEVK--EDRLEIPGLRNKSGETLITPLLPSLP  58
            QMG P G + + LLL+G RL EV++ +W EV   +  L +P  R K+G      L     
Sbjct  214  QMGYPWGPIFQLLLLTGARLREVSQASWGEVSIADGTLNLPARRTKNGRAHQIQLSDQAI  273

Query  59   QILEKYPQQEGSYLFTTGDGTRPISGFSQIKAILSKLSGVTDWNFHDFRRSFATLLSDE-  117
             I++  P+ EG  L  T +GT  +SGFS++K  L  +SGV DW FHD RRSFAT  ++  
Sbjct  274  NIIQALPKVEGQDLIFTTNGTTAVSGFSKVKKRLDIISGVADWRFHDLRRSFATHSTERL  333

Query  118  GIDRFSVKCALNHKDSSVTG---IYDRPYHIKRKSLALVQWHYVVENI  162
            GI        LNH    V G   IY    +++ +  +L +W   ++ +
Sbjct  334  GISPVVADKILNHVTGQVRGVAAIYQHGEYLEERRASLQKWGNFIQGL  381


>ref|ZP_01056028.1| site-specific recombinase, phage integrase family protein [Roseobacter 
sp. MED193]
 gb|EAQ45984.1| site-specific recombinase, phage integrase family protein [Roseobacter 
sp. MED193]
Length=367

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 84/151 (55%), Gaps = 7/151 (4%)

Query  7    GRLIEFLLLSGQRLNEVARLTWDEVKEDRLEIPG-----LRNKSGETLITPLLPSLPQIL  61
            G    FL+LS QR + VA + WDE++ +   IP       + +S +    PL P+L +IL
Sbjct  213  GAYFRFLMLSAQRKDNVASMKWDEIQGNLWTIPAEKFKATKKESAKAHEVPLTPALMEIL  272

Query  62   EKYPQQEGSYLFTTGDGTRPISGFSQIKAILSKLSGVTDWNFHDFRRSFATLLSDEGIDR  121
            E  P++ G ++F    G + +   S+ K  L+K +GV DW  HD RR+ AT +++  I R
Sbjct  273  ENQPKR-GPFVFGP-TGLKQLRLGSREKDRLAKKAGVDDWRLHDLRRTAATRMTENKIPR  330

Query  122  FSVKCALNHKDSSVTGIYDRPYHIKRKSLAL  152
            F V+  L H D SVT +YDR  + + K  AL
Sbjct  331  FIVERVLGHADRSVTAVYDRANYREEKRQAL  361


>ref|YP_510842.1| phage integrase [Jannaschia sp. CCS1]
 gb|ABD55817.1| phage integrase [Jannaschia sp. CCS1]
Length=391

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/158 (34%), Positives = 80/158 (50%), Gaps = 3/158 (1%)

Query  1    QMGGPQGRLIEFLLLSGQRLNEVARLT--WDEVKEDRLEIPGLRNKSGETLITPLLPSLP  58
            +MG P G ++  L+L+ QR  EVA L   W        E+P    K+    + PL     
Sbjct  229  KMGYPFGPMVRLLILTAQRRAEVANLERGWLLPDHQAFEVPASHYKTDRPQVVPLSAPAL  288

Query  59   QILEKYPQ-QEGSYLFTTGDGTRPISGFSQIKAILSKLSGVTDWNFHDFRRSFATLLSDE  117
             ++E  P+   G ++ +T  G RP+SGFS+ KA L KLS V  W  HD RRS AT ++  
Sbjct  289  ALVEGLPKWNSGDFMLSTTAGKRPVSGFSKAKARLDKLSEVEGWTLHDLRRSAATHMARL  348

Query  118  GIDRFSVKCALNHKDSSVTGIYDRPYHIKRKSLALVQW  155
            G+ +  ++  L H    V G Y+R  ++  K  AL  W
Sbjct  349  GVAQEHIERVLGHAIEGVAGTYNRYSYLPEKRAALDAW  386


>ref|ZP_05113718.1| site-specific recombinase, phage integrase family protein [Labrenzia 
alexandrii DFL-11]
 gb|EEE44317.1| site-specific recombinase, phage integrase family protein [Labrenzia 
alexandrii DFL-11]
Length=397

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 84/166 (50%), Gaps = 12/166 (7%)

Query  1    QMGGPQGRLIEFLLLSGQRLNEVARLTWDEVKEDRLE--IPGLRNKSGETLITPLLPSLP  58
            +MG P G  ++ L L+ QR  EV+ + W E+  D     IP  R K+G+  +  L  +  
Sbjct  223  KMGFPFGYYVKLLFLTAQRRGEVSGMRWSEINLDSATWTIPAERAKNGKAHVVHLSQASL  282

Query  59   QILEKYPQ------QEGSYLFTTGDGTRPISGFSQIKAILSKLSGVTDWNFHDFRRSFAT  112
             +L+  P+       E   +FTT +G   ISGFS+ K  L +LSGVTDW  HD RR+  T
Sbjct  283  DVLQSIPKFANANGTESDLVFTT-NGKTSISGFSKAKKQLDELSGVTDWRIHDIRRTVVT  341

Query  113  LLSDEGIDRFSVKCALNHKDSSVTG---IYDRPYHIKRKSLALVQW  155
             ++  G+        LNHK  +++G   +Y R   +  +  AL  W
Sbjct  342  QMAAMGVWHHVADAILNHKTGAISGVAAVYQRHEFLDDRKRALDDW  387


>ref|YP_002362394.1| integrase family protein [Methylocella silvestris BL2]
 gb|ACK51032.1| integrase family protein [Methylocella silvestris BL2]
Length=400

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 57/173 (32%), Positives = 93/173 (53%), Gaps = 9/173 (5%)

Query  1    QMGGPQGRLIEFLLLSGQRLNEVARLTWDEV--KEDRLEIPGLRNKSGETLITPLLPSLP  58
            + G P G +I+ L+LSGQR +EV+ +TW E+  +E    +P +R K+G+  I PL P++ 
Sbjct  224  RAGWPYGSMIKVLILSGQRRSEVSDMTWSEIDFEERSWTLPAVRTKNGKGHIIPLSPTII  283

Query  59   QILEKYPQ--QEGSYLFTTGDGTRPISGFS-QIKAILSKLSGVTDWNFHDFRRSFATLLS  115
             +L   P+   E  ++FTT +G  PI  F+ + KA++       +W  HD RR+FAT ++
Sbjct  284  DVLLTLPRIGSESGFVFTT-NGFSPIRNFARRKKALMMSCQSENNWTLHDLRRTFATGMA  342

Query  116  DEGIDRFSVKCALNHKDSS---VTGIYDRPYHIKRKSLALVQWHYVVENIEHK  165
               ++   V+  LNH   +   V G+Y +      K  A+  W   V  I +K
Sbjct  343  RLKVELPVVEKLLNHSSGTFGGVQGVYQQYDFQSEKREAMNLWASYVNKITNK  395


>ref|YP_001166328.1| phage integrase family protein [Rhodobacter sphaeroides ATCC 
17025]
 gb|ABP69023.1| phage integrase family protein [Rhodobacter sphaeroides ATCC 
17025]
Length=413

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 87/177 (49%), Gaps = 20/177 (11%)

Query  1    QMGGPQGRLIEFLLLSGQRLNEVARLTWDEVKEDRLEIPGLRNKSGETLITPLLPSLPQI  60
            +MG P G +   LLL+GQRL EVA L W E+      +PG R+K+G+  + PL P   +I
Sbjct  219  KMGYPFGDIYRLLLLTGQRLREVAELPWREIDGATWTLPGPRSKNGDEHVIPLSPEAREI  278

Query  61   LEKYPQQEGSYLFTTGDGTRPISGFSQIKAILSKLSG---------------VTDWNFHD  105
            +E  P+  G ++F+T  G  P+SGF++ K  L  L                 V  +  HD
Sbjct  279  IEAAPKV-GRFVFST-TGLTPVSGFTRAKERLDGLMADAANEDLPAGAEPVTVPPFTIHD  336

Query  106  FRRSFATLLSDEGIDRFSVKCALNHKDSS---VTGIYDRPYHIKRKSLALVQWHYVV  159
             RR+ AT ++        V+  LNH+  +   V G+Y+R  +   K  AL  W   V
Sbjct  337  LRRTAATGMAGLRFPPHVVEAVLNHRSGTRRGVAGVYNRFDYADEKRQALETWARCV  393


>ref|YP_164918.1| phage integrase family site specific recombinase [Ruegeria pomeroyi 
DSS-3]
 gb|AAV97225.1| site-specific recombinase, phage integrase family [Ruegeria pomeroyi 
DSS-3]
Length=400

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 87/162 (53%), Gaps = 9/162 (5%)

Query  3    GGPQGRLIEFLLLSGQRLNEVARLTWDEVK-EDRL-EIPGLRNKSGETLITPLLPSLPQI  60
            G P G  ++ L+LSGQR  EVA + W E+  E RL  +P  R K+G     P+  ++  +
Sbjct  216  GYPFGDCMKLLILSGQRRAEVAEMRWTELDLEKRLWTLPSQRAKNGRQHTVPITDAMIDV  275

Query  61   LEKYPQQEGS-YLFTTGDGTRPISGFSQIKAILSKL--SGVTDWNFHDFRRSFATLLSDE  117
            L + P+  GS Y+FTT  G  P+SGF ++K  L K    G   W  HD RR+ +T ++  
Sbjct  276  LRRVPRFLGSDYVFTT-TGKSPVSGFGRLKDRLDKALPEGTEPWIIHDLRRTMSTNMAML  334

Query  118  GIDRFSVKCALNHKDSSVTG---IYDRPYHIKRKSLALVQWH  156
            G+ +   +  LNHK   V+G   IY+   +   K  AL QW+
Sbjct  335  GVPQPVTEALLNHKTGVVSGVAAIYNVYSYTDEKCEALEQWN  376


>ref|YP_001234301.1| phage integrase family protein [Acidiphilium cryptum JF-5]
 gb|ABQ30382.1| phage integrase family protein [Acidiphilium cryptum JF-5]
Length=412

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 60/163 (36%), Positives = 81/163 (49%), Gaps = 13/163 (7%)

Query  5    PQGRLIEFLLLSGQRLNEVARLTWDEVKEDRL--EIPGLRNKSGETLITPLLPSLPQILE  62
            P G+    L+L+  R +EVA + W E+  D L   +P  R K+G++ +  L      IL 
Sbjct  229  PAGQFTRMLMLTLGRRDEVASMRWTEIAADGLTWSLPADRAKNGKSHVVHLSEPARGILS  288

Query  63   KYPQQEGS-YLFTTGDGTRPISGFSQIK-----AILSKLS-GVTDWNFHDFRRSFATLLS  115
              P+ E S +LFTT  G RPISGFS  K     AI + L  G+ DW FHDFRR+  T L+
Sbjct  289  ALPRFENSDFLFTT-TGERPISGFSGFKLAIDRAIEADLGRGIADWRFHDFRRAGVTWLA  347

Query  116  DEGIDRFSVKCALNHKDSSVTG---IYDRPYHIKRKSLALVQW  155
              G         LNH   S+ G   +Y R   +  +  AL  W
Sbjct  348  GAGFPPHVADKLLNHMSGSIQGVAAVYQRAEFLPERERALDAW  390


>ref|YP_002526687.1| phage-related integrase [Rhodobacter sphaeroides KD131]
 gb|ACM02186.1| phage-related integrase [Rhodobacter sphaeroides KD131]
Length=432

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 88/176 (50%), Gaps = 11/176 (6%)

Query  1    QMGGPQGRLIEFLLLSGQRLNEVARLTWDEVKEDR--LEIPGLRNKSGETLITPLLPS-L  57
            QMG   G L+  L+L+ QR +EVA L W EV  D   + + G R K+ +   T L P  L
Sbjct  224  QMGSLWGPLVRMLVLTLQRRSEVAGLKWSEVDFDGECMTVAGGRTKNRKMHKTHLAPPVL  283

Query  58   PQILEKYPQQEGSYLFTTGDGTRPISGFSQIKAILSKL--SGVTDWNFHDFRRSFATLLS  115
              + E         +FTT  GT P+SGFS++K  L  L    +  W FHD R +FAT ++
Sbjct  284  ADLRELRAASSVEQVFTTT-GTTPVSGFSKVKERLDVLLPEDMEPWTFHDLRTAFATQMA  342

Query  116  DEG-----IDRFSVKCALNHKDSSVTGIYDRPYHIKRKSLALVQWHYVVENIEHKS  166
            ++G     IDR     A     SSV  +Y+R  H+ ++   L +W  +V   E  S
Sbjct  343  EDGESEAVIDRILNHVASGSAPSSVARVYNRSEHLGQRRRILNRWAALVTRDEAAS  398









>BLASTX
                                                                  Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_01004335.1|  possible phage-related integrase [Loktanel...   106    3e-21
ref|ZP_05065481.1|  putative phage-related integrase [Octadeca...   103    2e-20
ref|YP_001240859.1|  putative phage-like integrase [Bradyrhizo...   102    5e-20
ref|ZP_01901151.1|  site-specific recombinase, phage integrase...   101    1e-19
ref|YP_510842.1|  phage integrase [Jannaschia sp. CCS1] >gb|AB...  92.8    5e-17
ref|ZP_01056028.1|  site-specific recombinase, phage integrase...  92.4    6e-17
ref|ZP_05113718.1|  site-specific recombinase, phage integrase...  90.1    3e-16
ref|YP_002362394.1|  integrase family protein [Methylocella si...  88.2    1e-15
ref|YP_001166328.1|  phage integrase family protein [Rhodobact...  86.3    4e-15
ref|YP_164918.1|  phage integrase family site specific recombi...  85.9    6e-15
ref|YP_001234301.1|  phage integrase family protein [Acidiphil...  84.7    1e-14
ref|ZP_01011628.1|  site-specific recombinase, phage integrase...  83.6    3e-14
ref|YP_002526687.1|  phage-related integrase [Rhodobacter spha...  82.8    5e-14
ref|ZP_01102601.1|  phage integrase [Congregibacter litoralis ...  81.6    1e-13
ref|YP_002290412.1|  phage integrase family protein [Oligotrop...  79.7    4e-13
ref|YP_353289.1|  phage-related integrase [Rhodobacter sphaero...  79.0    7e-13
ref|YP_001773406.1|  integrase family protein [Methylobacteriu...  78.6    9e-13
ref|ZP_03738976.1|  integrase family protein [Desulfonatronosp...  77.8    2e-12
ref|ZP_01157942.1|  site-specific recombinase, phage integrase...  77.8    2e-12
ref|ZP_06349028.1|  integrase family protein [Rhodomicrobium v...  76.6    4e-12
ref|ZP_00053692.1|  COG0582: Integrase [Magnetospirillum magne...  76.6    4e-12
ref|ZP_05055230.1|  site-specific recombinase, phage integrase...  75.9    6e-12
ref|YP_003448049.1|  phage integrase family protein [Azospiril...  75.5    8e-12
ref|ZP_01290806.1|  Phage integrase [delta proteobacterium MLM...  75.5    8e-12
ref|YP_420017.1|  integrase [Magnetospirillum magneticum AMB-1...  75.5    8e-12
ref|YP_001639926.1|  integrase family protein [Methylobacteriu...  73.2    4e-11
ref|ZP_06351642.1|  integrase family protein [Rhodomicrobium v...  72.4    7e-11
ref|ZP_01047462.1|  possible phage-related integrase [Nitrobac...  72.4    7e-11
ref|ZP_01292090.1|  Phage integrase [delta proteobacterium MLM...  72.0    9e-11
ref|YP_001370389.1|  phage integrase family protein [Ochrobact...  71.2    1e-10
ref|ZP_05073527.1|  phage-related integrase [Rhodobacterales b...  70.9    2e-10
ref|ZP_03739246.1|  integrase family protein [Desulfonatronosp...  69.7    4e-10
ref|ZP_06360748.1|  integrase family protein [Rhodopseudomonas...  68.9    7e-10
ref|YP_001249431.1|  integrase, phage related [Legionella pneu...  68.9    7e-10
ref|ZP_03738738.1|  integrase family protein [Desulfonatronosp...  68.6    1e-09
ref|YP_002422144.1|  integrase family protein [Methylobacteriu...  67.8    2e-09
ref|YP_002825704.1|  DNA integration/recombination/invertion p...  67.0    3e-09
ref|ZP_02177906.1|  phage integrase family protein [Hydrogeniv...  67.0    3e-09
ref|ZP_05786981.1|  phage integrase family protein [Silicibact...  66.6    4e-09
emb|CBG34996.1|  putative prophage terminase, large subunit [E...  66.2    5e-09
ref|YP_533717.1|  phage integrase [Rhodopseudomonas palustris ...  64.3    2e-08
ref|ZP_06186309.1|  phage integrase family site-specific recom...  63.9    2e-08
ref|YP_495588.1|  phage integrase [Novosphingobium aromaticivo...  63.9    2e-08
ref|YP_316433.1|  hypothetical protein Tbd_2675 [Thiobacillus ...  63.9    2e-08
ref|ZP_06050688.1|  site-specific recombinase phage integrase ...  63.5    3e-08
ref|YP_001218546.1|  phage integrase family site specific reco...  63.5    3e-08
ref|ZP_04402179.1|  site-specific recombinase phage integrase ...  63.2    4e-08
ref|ZP_01017021.1|  Phage integrase [Parvularcula bermudensis ...  63.2    4e-08
ref|ZP_01015423.1|  Phage integrase [Rhodobacterales bacterium...  63.2    4e-08
ref|YP_941865.1|  phage integrase family protein [Psychromonas...  62.8    5e-08
ref|YP_002513830.1|  integrase family protein [Thioalkalivibri...  61.6    1e-07
ref|YP_486913.1|  Phage integrase [Rhodopseudomonas palustris ...  61.6    1e-07
ref|YP_122423.1|  hypothetical protein lpp0072 [Legionella pne...  61.6    1e-07
emb|CBA73984.1|  phage integrase [Arsenophonus nasoniae]           61.2    2e-07
ref|ZP_05104443.1|  site-specific recombinase, phage integrase...  61.2    2e-07
ref|ZP_03739174.1|  integrase family protein [Desulfonatronosp...  60.8    2e-07
ref|ZP_05051673.1|  site-specific recombinase, phage integrase...  60.5    3e-07
ref|YP_003188786.1|  phage DNA recombinase [Acetobacter pasteu...  60.1    3e-07
emb|CAM76363.1|  phage integrase [Magnetospirillum gryphiswald...  60.1    3e-07
ref|ZP_05078878.1|  phage integrase [Rhodobacterales bacterium...  59.7    4e-07
ref|YP_782900.1|  phage integrase family protein [Rhodopseudom...  59.7    4e-07
ref|YP_001203398.1|  putative phage-like integrase [Bradyrhizo...  58.9    8e-07
ref|ZP_03738730.1|  integrase family protein [Desulfonatronosp...  58.5    1e-06
ref|YP_003020636.1|  integrase family protein [Geobacter sp. M...  58.5    1e-06
ref|ZP_03032015.1|  integrase [Escherichia coli F11] >gb|EDV68...  58.5    1e-06
ref|YP_001587225.1|  hypothetical protein SPAB_00970 [Salmonel...  58.5    1e-06
ref|ZP_04001618.1|  integrase [Escherichia coli 83972] >gb|EEJ...  58.2    1e-06
ref|ZP_01252171.1|  putative site-specific recombinase [Psychr...  58.2    1e-06
ref|YP_002330291.1|  predicted integrase [Escherichia coli O12...  57.8    2e-06
ref|ZP_02901637.1|  phage integrase [Escherichia albertii TW07...  57.8    2e-06
ref|YP_002356739.1|  integrase family protein [Shewanella balt...  57.8    2e-06
ref|YP_001364993.1|  phage integrase family protein [Shewanell...  57.8    2e-06
ref|ZP_05715605.1|  Integrase [Vibrio mimicus VM573] >gb|EEW11...  57.4    2e-06
ref|ZP_05495323.1|  integrase family protein [Clostridium papy...  57.4    2e-06
ref|YP_001019745.1|  hypothetical protein Mpe_A0548 [Methylibi...  57.4    2e-06
ref|YP_963907.1|  phage integrase family protein [Shewanella s...  57.4    2e-06
ref|YP_900808.1|  phage integrase family protein [Pelobacter p...  57.4    2e-06
ref|YP_001051930.1|  phage integrase family protein [Shewanell...  57.4    2e-06
ref|ZP_05970596.1|  site-specific recombinase, phage integrase...  57.0    3e-06
ref|ZP_02188156.1|  phage integrase [alpha proteobacterium BAL...  57.0    3e-06
ref|YP_001553243.1|  phage integrase family protein [Shewanell...  57.0    3e-06
ref|ZP_06233889.1|  integrase family protein [Desulfovibrio ae...  56.6    4e-06
ref|ZP_05109875.1|  conserved hypothetical protein [Legionella...  56.6    4e-06
ref|ZP_03739118.1|  integrase family protein [Desulfonatronosp...  56.6    4e-06
ref|ZP_02177727.1|  phage integrase family protein [Hydrogeniv...  56.6    4e-06
ref|YP_403016.1|  integrase [Shigella dysenteriae Sd197] >gb|A...  56.6    4e-06
ref|YP_982512.1|  phage integrase family protein [Polaromonas ...  56.6    4e-06
ref|ZP_06350519.1|  integrase family protein [Rhodomicrobium v...  56.2    5e-06
ref|ZP_06186284.1|  phage integrase family site-specific recom...  56.2    5e-06
ref|YP_003460472.1|  integrase family protein [Thioalkalivibri...  56.2    5e-06
ref|ZP_02810544.2|  integrase [Escherichia coli O157:H7 str. E...  56.2    5e-06
ref|YP_001938392.1|  putative integrase [Orientia tsutsugamush...  56.2    5e-06
ref|YP_001723066.1|  integrase family protein [Escherichia col...  56.2    5e-06
ref|YP_985243.1|  phage integrase family protein [Acidovorax s...  56.2    5e-06
ref|YP_497483.1|  phage integrase [Novosphingobium aromaticivo...  56.2    5e-06
ref|YP_564232.1|  phage integrase [Shewanella denitrificans OS...  56.2    5e-06
ref|NP_949418.1|  phage-like integrase [Rhodopseudomonas palus...  56.2    5e-06
ref|YP_003449073.1|  integrase [Azospirillum sp. B510] >dbj|BA...  55.8    6e-06
ref|ZP_06354166.1|  site-specific recombinase, phage integrase...  55.8    6e-06
ref|ZP_05729394.1|  integrase family protein [Pantoea sp. At-9...  55.8    6e-06
ref|ZP_02784749.2|  site-specific recombinase, phage integrase...  55.8    6e-06
ref|YP_001938289.1|  putative integrase [Orientia tsutsugamush...  55.8    6e-06
ref|YP_001937628.1|  putative integrase [Orientia tsutsugamush...  55.8    6e-06
ref|YP_002358563.1|  integrase family protein [Shewanella balt...  55.5    8e-06
ref|NP_746019.1|  phage integrase, putative [Pseudomonas putid...  55.5    8e-06
ref|YP_003297470.1|  putative integrase [Edwardsiella tarda EI...  55.1    1e-05
ref|ZP_05436162.1|  integrase [Escherichia sp. 4_1_40B]            55.1    1e-05
ref|ZP_04576234.1|  phage integrase [Oxalobacter formigenes HO...  55.1    1e-05
ref|ZP_05104946.1|  site-specific recombinase, phage integrase...  55.1    1e-05
ref|ZP_03398704.1|  phage integrase [Pseudomonas syringae pv. ...  55.1    1e-05
ref|ZP_03217802.1|  putative Bacteriophage P4 integrase [Campy...  55.1    1e-05
ref|YP_001595746.1|  phage integrase, putative [Vibrio sp. 090...  55.1    1e-05
ref|ZP_02179335.1|  Phage integrase [Hydrogenivirga sp. 128-5-...  55.1    1e-05
ref|ZP_01311269.1|  phage integrase [Desulfuromonas acetoxidan...  55.1    1e-05
ref|ZP_06126932.1|  phage integrase family site specific recom...  54.7    1e-05
ref|ZP_06041759.1|  phage integrase [Vibrio mimicus MB-451] >g...  54.7    1e-05
ref|ZP_04662660.1|  putative integrase from bacteriophage [Aci...  54.7    1e-05
ref|ZP_06127521.1|  putative integrase [Providencia rettgeri D...  54.7    1e-05
gb|ACG59714.1|  phage integrase [Escherichia coli]                 54.7    1e-05
ref|YP_001722874.1|  integrase family protein [Yersinia pseudo...  54.7    1e-05
ref|YP_001572823.1|  hypothetical protein SARI_03887 [Salmonel...  54.7    1e-05
ref|ZP_05114311.1|  site-specific recombinase, phage integrase...  54.3    2e-05
ref|YP_002326413.1|  Putative prophage CP4-6 integrase [Acinet...  54.3    2e-05
ref|YP_001528523.1|  integrase family protein [Desulfococcus o...  54.3    2e-05
ref|YP_197567.1|  integrase/recombinase [Ehrlichia ruminantium...  54.3    2e-05
ref|YP_196608.1|  integrase/recombinase [Ehrlichia ruminantium...  54.3    2e-05
ref|YP_180523.1|  integrase/recombinase [Ehrlichia ruminantium...  54.3    2e-05
ref|ZP_01004604.1|  Site-specific recombinase XerD-like [Lokta...  54.3    2e-05
ref|YP_870585.1|  phage integrase family protein [Shewanella s...  54.3    2e-05
ref|YP_003238709.1|  integrase family protein [Ammonifex degen...  53.9    2e-05
ref|ZP_05829559.1|  integrase [Acinetobacter baumannii ATCC 19...  53.9    2e-05
ref|ZP_05435202.1|  integrase family protein [Shigella sp. D9]     53.9    2e-05
ref|YP_003443659.1|  integrase family protein [Allochromatium ...  53.9    2e-05
gb|ADD67486.1|  integrase family protein [Denitrovibrio acetip...  53.9    2e-05
ref|YP_002647105.1|  phage integrase, probably fragment [Erwin...  53.9    2e-05
ref|ZP_05065908.1|  phage integrase family protein, putative [...  53.9    2e-05
ref|ZP_05050897.1|  site-specific recombinase, phage integrase...  53.9    2e-05
ref|ZP_03051843.1|  integrase [Escherichia coli E110019] >gb|E...  53.9    2e-05
ref|YP_001845734.1|  integrase [Acinetobacter baumannii ACICU]...  53.9    2e-05
ref|YP_001716694.1|  phage integrase family protein [Candidatu...  53.9    2e-05
ref|YP_001372218.1|  phage integrase family protein [Ochrobact...  53.9    2e-05
ref|ZP_03064803.1|  integrase [Shigella dysenteriae 1012] >gb|...  53.9    2e-05
ref|YP_001269434.1|  phage integrase family protein [Pseudomon...  53.9    2e-05
ref|YP_003447403.1|  hypothetical protein AZL_002210 [Azospiri...  53.5    3e-05
emb|CAQ81988.1|  putative prophage integrase. [Enterobacteria ...  53.5    3e-05
ref|ZP_05064742.1|  site-specific recombinase, phage integrase...  53.5    3e-05
ref|ZP_05063507.1|  phage integrase, putative [Octadecabacter ...  53.5    3e-05
ref|YP_001714491.1|  putative integrase from bacteriophage [Ac...  53.5    3e-05
ref|YP_001399055.1|  phage integrase family site specific reco...  53.5    3e-05
ref|YP_002980987.1|  integrase family protein [Ralstonia picke...  53.5    3e-05
ref|YP_420267.1|  integrase [Magnetospirillum magneticum AMB-1...  53.5    3e-05
ref|YP_003006276.1|  integrase family protein [Dickeya zeae Ec...  53.1    4e-05
ref|YP_002248163.1|  site specific recombinase [Thermodesulfov...  53.1    4e-05
ref|ZP_05064470.1|  site-specific recombinase, phage integrase...  53.1    4e-05
ref|ZP_05041922.1|  site-specific recombinase, phage integrase...  53.1    4e-05
ref|YP_001177344.1|  phage integrase family protein [Enterobac...  53.1    4e-05
ref|YP_001350479.1|  phage integrase family site specific reco...  53.1    4e-05
ref|YP_871403.1|  phage integrase family protein [Shewanella s...  53.1    4e-05
ref|YP_736802.1|  phage integrase family protein [Shewanella s...  53.1    4e-05
ref|YP_750328.1|  phage integrase family protein [Shewanella f...  53.1    4e-05
ref|YP_003334387.1|  integrase family protein [Dickeya dadanti...  52.8    5e-05
ref|ZP_04624367.1|  Integrase [Yersinia kristensenii ATCC 3363...  52.8    5e-05
ref|ZP_03842673.1|  integrase family protein [Proteus mirabili...  52.8    5e-05
ref|ZP_05065577.1|  site-specific recombinase, phage integrase...  52.8    5e-05
ref|ZP_05064034.1|  site-specific recombinase, phage integrase...  52.8    5e-05
ref|NP_717087.1|  phage integrase family site specific recombi...  52.8    5e-05
ref|YP_050841.1|  prophage integrase [Pectobacterium atrosepti...  52.8    5e-05
ref|ZP_00990859.1|  Site-specific recombinase XerD-like [Vibri...  52.8    5e-05
ref|YP_003235132.1|  putative integrase [Escherichia coli O111...  52.4    7e-05
gb|EES53290.1|  phage integrase family protein [Leptospirillum...  52.4    7e-05
ref|YP_002383214.1|  integrase [Escherichia fergusonii ATCC 35...  52.4    7e-05
ref|ZP_05094120.1|  site-specific recombinase, phage integrase...  52.4    7e-05
ref|ZP_05082687.1|  phage integrase [Pseudovibrio sp. JE062] >...  52.4    7e-05
ref|ZP_02776684.1|  phage integrase family protein [Escherichi...  52.4    7e-05
ref|NP_953168.1|  integrative genetic element Gsu56, integrase...  52.4    7e-05
ref|YP_001021898.1|  putative prophage integrase [Methylibium ...  52.4    7e-05
ref|ZP_00208415.1|  COG0582: Integrase [Magnetospirillum magne...  52.4    7e-05
ref|YP_003454139.1|  phage-related integrase [Legionella longb...  52.0    9e-05
dbj|BAI55764.1|  putative phage integrase [Escherichia coli SE15]  52.0    9e-05
ref|ZP_04002545.1|  integrase [Escherichia coli 83972] >gb|EEJ...  52.0    9e-05
ref|YP_002406534.1|  putative integrase of prophage [Escherich...  52.0    9e-05
ref|ZP_05051497.1|  site-specific recombinase, phage integrase...  52.0    9e-05
ref|YP_001951669.1|  integrase family protein [Geobacter lovle...  52.0    9e-05
ref|YP_001476346.1|  integrase family protein [Serratia protea...  52.0    9e-05
ref|YP_462071.1|  integrase [Syntrophus aciditrophicus SB] >gb...  52.0    9e-05
ref|NP_743712.1|  phage integrase, putative [Pseudomonas putid...  52.0    9e-05
ref|YP_003469806.1|  Phage integrase [Xenorhabdus bovienii SS-...  51.6    1e-04
ref|ZP_06405292.1|  tyrosine type site-specific recombinase [P...  51.6    1e-04
ref|ZP_06231214.1|  integrase family protein [Desulfovibrio ae...  51.6    1e-04
ref|ZP_05629299.1|  prophage CP4-57-like integrase [Actinobaci...  51.6    1e-04
ref|YP_003039846.1|  putative phage integrase [Photorhabdus as...  51.6    1e-04
ref|ZP_03829037.1|  prophage integrase [Pectobacterium carotov...  51.6    1e-04
ref|YP_001337761.1|  putative phage integrase [Klebsiella pneu...  51.6    1e-04
ref|ZP_04959897.1|  phage integrase [Vibrio cholerae AM-19226]...  51.6    1e-04
ref|ZP_01453398.1|  integrative genetic element Gsu32, integra...  51.6    1e-04
emb|CAJ75136.1|  similar to site-specific tyrosine recombinase...  51.6    1e-04
ref|YP_316581.1|  putative phage integrase [Thiobacillus denit...  51.6    1e-04
ref|NP_716026.1|  phage integrase family site specific recombi...  51.6    1e-04
ref|YP_123415.1|  hypothetical protein lpp1088 [Legionella pne...  51.6    1e-04
ref|ZP_01135053.1|  phage integrase, putative [Pseudoalteromon...  51.6    1e-04
ref|ZP_04922021.1|  site-specific recombinase, phage integrase...  51.6    1e-04
ref|ZP_06186351.1|  phage integrase family protein [Legionella...  51.2    2e-04
ref|ZP_06124130.1|  putative integrase [Providencia rettgeri D...  51.2    2e-04
ref|ZP_05704275.1|  phage integrase family site-specific recom...  51.2    2e-04
ref|ZP_05499644.1|  integrase family protein [Thiomonas interm...  51.2    2e-04
ref|YP_003259289.1|  integrase family protein [Pectobacterium ...  51.2    2e-04
ref|ZP_05113288.1|  site-specific recombinase, phage integrase...  51.2    2e-04
ref|YP_003020642.1|  integrase family protein [Geobacter sp. M...  51.2    2e-04
ref|ZP_02788531.1|  integrase [Escherichia coli O157:H7 str. E...  51.2    2e-04
ref|NP_773857.1|  site-specific integrase/recombinase [Bradyrh...  51.2    2e-04
ref|ZP_00991903.1|  site-specific recombinase, phage integrase...  51.2    2e-04
ref|YP_001180235.1|  phage integrase family protein [Caldicell...  51.2    2e-04
ref|YP_001457101.1|  site-specific recombinase, phage integras...  51.2    2e-04
ref|ZP_04631567.1|  Integrase [Yersinia frederiksenii ATCC 336...  51.2    2e-04
ref|YP_003470229.1|  Putative integrase (fragment) [Xenorhabdu...  50.8    2e-04
emb|CBG36775.1|  integrase [Escherichia coli 042]                  50.8    2e-04
ref|ZP_06178854.1|  hypothetical protein VMC_02840 [Vibrio alg...  50.8    2e-04
ref|ZP_05311044.1|  integrase family protein [Geobacter sp. M1...  50.8    2e-04
ref|ZP_05110173.1|  phage related integrase [Legionella dranco...  50.8    2e-04
ref|YP_003039840.1|  putative phage integrase [Photorhabdus as...  50.8    2e-04
ref|ZP_05118530.1|  site-specific recombinase, phage integrase...  50.8    2e-04
ref|YP_002401394.1|  putative prophage CPS-53 integrase [Esche...  50.8    2e-04
ref|ZP_05050674.1|  site-specific recombinase, phage integrase...  50.8    2e-04
ref|ZP_05050513.1|  site-specific recombinase, phage integrase...  50.8    2e-04
ref|YP_001908356.1|  Prophage integrase [Erwinia tasmaniensis ...  50.8    2e-04
ref|ZP_02797826.2|  integrase [Escherichia coli O157:H7 str. E...  50.8    2e-04
ref|YP_001882342.1|  site-specific recombinase, phage integras...  50.8    2e-04
ref|YP_001745965.1|  phage integrase family site specific reco...  50.8    2e-04
ref|YP_001674009.1|  integrase family protein [Shewanella hali...  50.8    2e-04
ref|YP_001506102.1|  integrase family protein [Frankia sp. EAN...  50.8    2e-04
ref|YP_001359494.1|  phage integrase family site specific reco...  50.8    2e-04
ref|ZP_01752810.1|  Integrase [Roseobacter sp. SK209-2-6] >gb|...  50.8    2e-04
gb|ABN68939.1|  integrase [Enterobacteria phage phi24B]            50.8    2e-04
ref|YP_794083.1|  integrase [Stx2-converting phage 86] >ref|ZP...  50.8    2e-04
dbj|BAF30931.1|  integrase [uncultured bacterium] >dbj|BAF3495...  50.8    2e-04
ref|YP_577003.1|  phage integrase [Nitrobacter hamburgensis X1...  50.8    2e-04
ref|NP_790137.1|  site-specific recombinase, phage integrase f...  50.8    2e-04
ref|YP_409955.1|  putative integrase [Shigella boydii Sb227] >...  50.8    2e-04
ref|YP_126420.1|  hypothetical protein lpl1066 [Legionella pne...  50.8    2e-04
ref|YP_127815.1|  hypothetical protein lpl2486 [Legionella pne...  50.8    2e-04
ref|ZP_03048126.1|  site-specific recombinase, phage integrase...  50.8    2e-04
ref|YP_003482466.1|  integrase family protein [Aciduliprofundu...  50.4    3e-04
ref|YP_003222786.1|  integrase [Escherichia coli O103:H2 str. ...  50.4    3e-04
ref|ZP_04591292.1|  phage integrase, putative [Pseudomonas syr...  50.4    3e-04
ref|YP_002261927.1|  shufflon-specific DNA recombinase [Aliivi...  50.4    3e-04
ref|ZP_05066927.1|  site-specific recombinase, phage integrase...  50.4    3e-04
ref|ZP_05063110.1|  phage integrase family protein, putative [...  50.4    3e-04
ref|ZP_05053217.1|  site-specific recombinase, phage integrase...  50.4    3e-04
ref|ZP_05050266.1|  site-specific recombinase, phage integrase...  50.4    3e-04
ref|ZP_04875223.1|  site-specific recombinase, phage integrase...  50.4    3e-04
ref|YP_002358523.1|  integrase family protein [Shewanella balt...  50.4    3e-04
ref|YP_903214.1|  phage integrase family protein [Pelobacter p...  50.4    3e-04
ref|ZP_05717091.1|  phage integrase family protein [Vibrio mim...  50.1    4e-04
gb|EES53930.1|  phage integrase family protein [Leptospirillum...  50.1    4e-04
ref|YP_003018833.1|  integrase family protein [Pectobacterium ...  50.1    4e-04
ref|ZP_04656933.1|  putative phage integrase [Salmonella enter...  50.1    4e-04
ref|YP_002603059.1|  hypothetical protein HRM2_17930 [Desulfob...  50.1    4e-04
gb|EDZ39517.1|  Integrase [Leptospirillum sp. Group II '5-way ...  50.1    4e-04
ref|YP_002289130.1|  phage integrase [Oligotropha carboxidovor...  50.1    4e-04
ref|ZP_02901072.1|  phage integrase [Escherichia albertii TW07...  50.1    4e-04
ref|YP_001722474.1|  integrase family protein [Yersinia pseudo...  50.1    4e-04
ref|ZP_02664613.1|  site-specific recombinase, phage integrase...  50.1    4e-04
ref|ZP_02186786.1|  integrase/recombinase XerD [alpha proteoba...  50.1    4e-04
ref|YP_001926515.1|  integrase family protein [Methylobacteriu...  50.1    4e-04
ref|ZP_04918510.1|  Integrase [Vibrio cholerae V51] >gb|EAZ509...  50.1    4e-04
ref|YP_551607.1|  phage integrase [Polaromonas sp. JS666] >gb|...  50.1    4e-04
ref|YP_443726.1|  phage integrase family site specific recombi...  50.1    4e-04
ref|YP_410765.1|  Phage integrase [Nitrosospira multiformis AT...  50.1    4e-04
ref|NP_779202.1|  phage-related integrase [Xylella fastidiosa ...  50.1    4e-04
ref|ZP_00054261.1|  COG0582: Integrase [Magnetospirillum magne...  50.1    4e-04
ref|YP_003466695.1|  CPS-53 (KpLE1) prophage; Sf6-like integra...  49.7    5e-04
emb|CBG36817.1|  integrase [Escherichia coli 042]                  49.7    5e-04
ref|ZP_06124033.1|  putative prophage CPS-53 integrase [Provid...  49.7    5e-04
ref|ZP_06155335.1|  phage integrase [Photobacterium damselae s...  49.7    5e-04
ref|ZP_06155306.1|  hypothetical protein VDA_002035 [Photobact...  49.7    5e-04
ref|ZP_06016555.1|  phage integrase family site-specific recom...  49.7    5e-04
ref|YP_003258785.1|  integrase family protein [Pectobacterium ...  49.7    5e-04
ref|YP_003088297.1|  integrase family protein [Dyadobacter fer...  49.7    5e-04
ref|ZP_04640573.1|  Site-specific recombinase, phage integrase...  49.7    5e-04
ref|ZP_04617515.1|  Integrase [Yersinia ruckeri ATCC 29473] >g...  49.7    5e-04
ref|YP_002945685.1|  integrase family protein [Variovorax para...  49.7    5e-04
ref|YP_002331356.1|  predicted integrase [Escherichia coli O12...  49.7    5e-04
ref|ZP_05054372.1|  site-specific recombinase, phage integrase...  49.7    5e-04
ref|ZP_02375637.1|  Integrase or site-specific recombinase [Bu...  49.7    5e-04
ref|ZP_02142526.1|  phage-related integrase [Roseobacter litor...  49.7    5e-04
ref|ZP_02194532.1|  phage integrase [Vibrio sp. AND4] >gb|EDP6...  49.7    5e-04
ref|YP_001354856.1|  integrase [Janthinobacterium sp. Marseill...  49.7    5e-04
ref|YP_095103.1|  integrase, phage related [Legionella pneumop...  49.7    5e-04
ref|YP_457707.1|  site-specific recombinase, phage integrase f...  49.7    5e-04
ref|YP_125443.1|  hypothetical protein lpl0065 [Legionella pne...  49.7    5e-04
ref|NP_758615.1|  integrase [Pseudomonas resinovorans] >ref|YP...  49.7    5e-04
ref|YP_741481.1|  phage integrase family protein [Alkalilimnic...  49.7    5e-04
ref|ZP_04640595.1|  Integrase [Yersinia mollaretii ATCC 43969]...  49.7    5e-04
ref|ZP_06187155.1|  phage integrase family site-specific recom...  49.3    6e-04
ref|ZP_05316514.1|  integrase family protein [Nitrosomonas sp....  49.3    6e-04
ref|ZP_04612579.1|  Integrase [Yersinia rohdei ATCC 43380] >gb...  49.3    6e-04
ref|YP_002921868.1|  phage integrase family protein [Klebsiell...  49.3    6e-04
ref|YP_003092441.1|  tyrosine recombinase XerD [Pedobacter hep...  49.3    6e-04
ref|YP_003270013.1|  tyrosine recombinase XerD [Haliangium och...  49.3    6e-04
ref|ZP_03614266.1|  tyrosine recombinase XerC [Staphylococcus ...  49.3    6e-04
ref|YP_002291539.1|  putative phage integrase [Escherichia col...  49.3    6e-04
ref|ZP_05052834.1|  site-specific recombinase, phage integrase...  49.3    6e-04
ref|ZP_02353915.1|  Integrase or site-specific recombinase [Bu...  49.3    6e-04
ref|YP_001564216.1|  integrase family protein [Delftia acidovo...  49.3    6e-04
ref|ZP_02038455.1|  hypothetical protein BACCAP_04089 [Bactero...  49.3    6e-04
ref|YP_001251474.1|  integrase, phage related [Legionella pneu...  49.3    6e-04
ref|NP_863067.1|  putative integrase [Pseudomonas putida] >ref...  49.3    6e-04
ref|YP_561335.1|  phage integrase [Shewanella denitrificans OS...  49.3    6e-04
ref|YP_548422.1|  phage integrase [Polaromonas sp. JS666] >gb|...  49.3    6e-04
ref|YP_175278.1|  site-specific tyrosine recombinase [Bacillus...  49.3    6e-04
ref|ZP_01004585.1|  Phage integrase [Loktanella vestfoldensis ...  49.3    6e-04
ref|ZP_00958338.1|  Phage integrase [Roseovarius nubinhibens I...  49.3    6e-04
ref|YP_738896.1|  phage integrase family protein [Shewanella s...  49.3    6e-04
ref|YP_001608430.1|  phage integrase family site specific reco...  49.3    6e-04
ref|NP_671345.1|  integrase [Yersinia pestis KIM 10] >ref|NP_9...  49.3    6e-04
ref|YP_002987967.1|  integrase family protein [Dickeya dadanti...  48.9    8e-04
ref|YP_003444355.1|  integrase family protein [Allochromatium ...  48.9    8e-04
ref|ZP_04620192.1|  Integrase [Yersinia aldovae ATCC 35236] >g...  48.9    8e-04
ref|ZP_04872911.1|  integrase [Escherichia sp. 1_1_43] >gb|EEH...  48.9    8e-04
ref|ZP_02823597.1|  phage integrase [Escherichia coli O157:H7 ...  48.9    8e-04
ref|ZP_02781440.1|  prophage integrase [Escherichia coli O157:...  48.9    8e-04
ref|YP_001231826.1|  phage integrase family protein [Geobacter...  48.9    8e-04
ref|YP_968007.1|  phage integrase family protein [Desulfovibri...  48.9    8e-04
ref|YP_534847.1|  integrase TnpI [Pseudomonas putida] >dbj|BAE...  48.9    8e-04
ref|YP_095260.1|  site specific recombinase [Legionella pneumo...  48.9    8e-04
ref|YP_431950.1|  integrase [Hahella chejuensis KCTC 2396] >gb...  48.9    8e-04
ref|NP_718547.1|  prophage LambdaSo, site-specific recombinase...  48.9    8e-04
ref|NP_936913.1|  phage integrase [Vibrio vulnificus YJ016] >d...  48.9    8e-04
ref|ZP_01133623.1|  site-specific recombinase, phage integrase...  48.9    8e-04
ref|ZP_00964023.1|  site-specific integrase/recombinase-like [...  48.9    8e-04
ref|YP_001243157.1|  putative integrase [Bradyrhizobium sp. BT...  48.9    8e-04
ref|YP_001023011.1|  phage-related integrase [Methylibium petr...  48.9    8e-04
ref|ZP_06355785.1|  site-specific recombinase, phage integrase...  48.5    0.001
ref|ZP_06374598.1|  hypothetical protein C1336_000800005 [Camp...  48.5    0.001
ref|YP_003113211.1|  tyrosine recombinase XerD [Catenulispora ...  48.5    0.001
gb|EES53851.1|  phage integrase family protein [Leptospirillum...  48.5    0.001
ref|ZP_04819117.1|  tyrosine recombinase XerC [Staphylococcus ...  48.5    0.001
ref|ZP_03677971.1|  hypothetical protein BACCELL_02310 [Bacter...  48.5    0.001
ref|ZP_03032837.1|  phage integrase [Escherichia coli F11] >gb...  48.5    0.001
emb|CAM75029.1|  Phage integrase [Magnetospirillum gryphiswald...  48.5    0.001
ref|YP_001953716.1|  integrase family protein [Geobacter lovle...  48.5    0.001
ref|YP_998883.1|  phage integrase family protein [Verminephrob...  48.5    0.001
ref|YP_668275.1|  phage integrase [Escherichia coli 536] >gb|A...  48.5    0.001
ref|ZP_01201695.1|  site-specific integrase/recombinase XerD p...  48.5    0.001
emb|CAD66211.1|  putative phage integrase [Escherichia coli]       48.5    0.001
ref|NP_971812.1|  integrase/recombinase XerD [Treponema dentic...  48.5    0.001
ref|NP_927495.1|  hypothetical protein plu0125 [Photorhabdus l...  48.5    0.001
ref|ZP_01004578.1|  Phage integrase [Loktanella vestfoldensis ...  48.5    0.001
ref|ZP_00989468.1|  site-specific recombinase, phage integrase...  48.5    0.001
ref|ZP_04634676.1|  Integrase [Yersinia frederiksenii ATCC 336...  48.5    0.001
ref|ZP_06145539.1|  phage integrase family site specific recom...  48.1    0.001
ref|YP_003294117.1|  putative integrase [Edwardsiella tarda EI...  48.1    0.001
ref|YP_003018435.1|  integrase family protein [Pectobacterium ...  48.1    0.001
ref|ZP_04444106.1|  possible integrase/recombinase XerD [Liste...  48.1    0.001
ref|ZP_03501997.1|  phage integrase [Rhizobium etli Kim 5]         48.1    0.001
ref|ZP_03392435.1|  tyrosine recombinase XerC [Capnocytophaga ...  48.1    0.001
ref|ZP_05053572.1|  site-specific recombinase, phage integrase...  48.1    0.001
ref|ZP_02220760.1|  site-specific recombinase, phage integrase...  48.1    0.001
ref|YP_001875879.1|  integrase family protein [Elusimicrobium ...  48.1    0.001
ref|ZP_02041754.1|  hypothetical protein RUMGNA_02526 [Ruminoc...  48.1    0.001
gb|EAY57114.1|  putative phage integrase [Leptospirillum rubarum]  48.1    0.001
ref|YP_782175.1|  phage integrase family protein [Rhodopseudom...  48.1    0.001
ref|YP_650298.1|  integrase [Yersinia pestis Antiqua] >ref|ZP_...  48.1    0.001
ref|YP_356232.1|  site-specific recombinase/integrase [Pelobac...  48.1    0.001
ref|YP_420854.1|  integrase [Magnetospirillum magneticum AMB-1...  48.1    0.001
ref|YP_051550.1|  phage integrase [Pectobacterium atrosepticum...  48.1    0.001
ref|NP_890672.1|  phage-related integrase [Bordetella bronchis...  48.1    0.001
ref|YP_963873.1|  phage integrase family protein [Shewanella s...  48.1    0.001
ref|ZP_04638950.1|  Integrase [Yersinia mollaretii ATCC 43969]...  48.1    0.001
ref|YP_071664.1|  putative phage integrase. [Yersinia pseudotu...  48.1    0.001
ref|NP_670570.1|  integrase [Yersinia pestis KIM 10] >ref|NP_9...  48.1    0.001
ref|YP_003467233.1|  hypothetical protein XBJ1_1313 [Xenorhabd...  47.8    0.002
ref|ZP_06356706.1|  integrase family protein [Rhodopseudomonas...  47.8    0.002
ref|YP_003141662.1|  integrase family protein [Capnocytophaga ...  47.8    0.002
ref|YP_003258809.1|  integrase family protein [Pectobacterium ...  47.8    0.002
ref|ZP_03833197.1|  phage integrase [Pectobacterium carotovoru...  47.8    0.002
ref|ZP_06125437.1|  integrase family protein [Providencia rett...  47.8    0.002
ref|YP_002548508.1|  Integrase protein [Agrobacterium vitis S4...  47.8    0.002
ref|YP_002399202.1|  Integrase from prophage [Escherichia coli...  47.8    0.002
ref|YP_003022217.1|  integrase family protein [Geobacter sp. M...  47.8    0.002
ref|YP_001938443.1|  putative integrase [Orientia tsutsugamush...  47.8    0.002
ref|YP_001937632.1|  putative integrase [Orientia tsutsugamush...  47.8    0.002
ref|YP_001721873.1|  integrase family protein [Yersinia pseudo...  47.8    0.002
ref|YP_001439090.1|  hypothetical protein ESA_03025 [Enterobac...  47.8    0.002
ref|ZP_01881046.1|  putative integrase [Roseovarius sp. TM1035...  47.8    0.002
ref|YP_001252065.1|  site specific recombinase [Legionella pne...  47.8    0.002
ref|YP_001249216.1|  phage-related integrase [Orientia tsutsug...  47.8    0.002
ref|YP_001162011.1|  integrase [Yersinia pestis Pestoides F] >...  47.8    0.002
ref|ZP_01718919.1|  putative site-specific recombinase [Algori...  47.8    0.002
gb|EAY57768.1|  putative phage integrase family protein [Lepto...  47.8    0.002
ref|ZP_01546359.1|  hypothetical protein SIAM614_12908 [Stappi...  47.8    0.002
ref|YP_850178.1|  integrase/recombinase [Listeria welshimeri s...  47.8    0.002
ref|YP_853646.1|  integrase-like protein [Escherichia coli APE...  47.8    0.002
ref|YP_595615.1|  integrase [Lawsonia intracellularis PHE/MN1-...  47.8    0.002
ref|ZP_05570380.1|  phage integrase family protein [Ferroplasm...  47.8    0.002
ref|YP_457033.1|  site-specific recombinase, phage integrase f...  47.8    0.002
ref|YP_516215.1|  hypothetical protein SGPHI_0037 [Sodalis pha...  47.8    0.002
ref|YP_257121.1|  hypothetical protein pSG3GP_12 [Sodalis glos...  47.8    0.002
ref|YP_003196646.1|  putative site-specific recombinase [Robig...  47.8    0.002
ref|ZP_06461197.1|  phage integrase family site specific recom...  47.4    0.002
ref|YP_003051858.1|  integrase family protein [Methylovorus sp...  47.4    0.002
ref|ZP_04752588.1|  phage integrase family protein [Actinobaci...  47.4    0.002
ref|ZP_04563426.1|  site-specific tyrosine recombinase xerD [M...  47.4    0.002
ref|ZP_04560714.1|  site-specific recombinase [Citrobacter sp....  47.4    0.002
ref|YP_002774893.1|  hypothetical protein BBR47_54120 [Breviba...  47.4    0.002
ref|ZP_03703077.1|  integrase family protein [Flavobacteria ba...  47.4    0.002
ref|YP_002603000.1|  tyrosine recombinase XerD [Desulfobacteri...  47.4    0.002
ref|ZP_04958584.1|  phage integrase family protein [gamma prot...  47.4    0.002
ref|ZP_05085911.1|  phage integrase [Pseudovibrio sp. JE062] >...  47.4    0.002
ref|ZP_02429085.1|  hypothetical protein CLORAM_02507 [Clostri...  47.4    0.002
ref|ZP_02041463.1|  hypothetical protein RUMGNA_02232 [Ruminoc...  47.4    0.002
ref|ZP_01860154.1|  site-specific tyrosine recombinase XerD [B...  47.4    0.002
ref|ZP_01768330.1|  site-specific recombinase, phage integrase...  47.4    0.002
ref|YP_001064397.1|  phage integrase family site specific reco...  47.4    0.002
ref|YP_001057152.1|  phage integrase family site specific reco...  47.4    0.002
ref|YP_001859624.1|  integrase family protein [Burkholderia ph...  47.4    0.002
ref|YP_737811.1|  phage integrase family protein [Shewanella s...  47.4    0.002
ref|YP_331724.1|  integrase or site-specific recombinase [Burk...  47.4    0.002
ref|YP_106707.1|  putative phage integrase [Burkholderia pseud...  47.4    0.002
ref|NP_471403.1|  hypothetical protein lin2069 [Listeria innoc...  47.4    0.002
ref|YP_001181376.1|  phage integrase family protein [Caldicell...  47.4    0.002
ref|ZP_03624943.1|  integrase family protein [Streptococcus su...  47.4    0.002
ref|YP_001243551.1|  putative phage integrase [Bradyrhizobium ...  47.4    0.002
gb|ADD54990.1|  Integrase protein for prophage CP-933I [Escher...  47.0    0.003
ref|YP_003456809.1|  phage-related integrase [Legionella longb...  47.0    0.003
ref|ZP_06191913.1|  DNA integration/recombination/invertion pr...  47.0    0.003
ref|ZP_05883393.1|  site-specific recombinase phage integrase ...  47.0    0.003
ref|ZP_05298396.1|  hypothetical protein LmonocytFSL_08880 [Li...  47.0    0.003
ref|ZP_05236099.1|  hypothetical protein Lmon1_08823 [Listeria...  47.0    0.003
ref|ZP_04843877.1|  tyrosine type site-specific recombinase [B...  47.0    0.003
ref|ZP_04390628.1|  tyrosine recombinase XerD [Porphyromonas e...  47.0    0.003
ref|ZP_06127288.1|  integrase [Providencia rettgeri DSM 1131]      47.0    0.003
ref|ZP_03712888.1|  hypothetical protein EIKCOROL_00560 [Eiken...  47.0    0.003
ref|YP_002349571.1|  tyrosine recombinase XerD [Listeria monoc...  47.0    0.003
ref|YP_002268886.1|  site-specific recombinase, phage integras...  47.0    0.003
ref|ZP_02907083.1|  integrase family protein [Burkholderia amb...  47.0    0.003
ref|ZP_03083123.1|  putative integrase [Escherichia coli O157:...  47.0    0.003
ref|ZP_02774128.1|  integrase [Escherichia coli O157:H7 str. E...  47.0    0.003
ref|YP_001769774.1|  integrase family protein [Methylobacteriu...  47.0    0.003
ref|YP_001745129.1|  site-specific recombinase, phage integras...  47.0    0.003
ref|ZP_02479611.1|  Integrase or site-specific recombinase [Bu...  47.0    0.003
ref|YP_001381142.1|  phage integrase family protein [Anaeromyx...  47.0    0.003
ref|YP_001762656.1|  integron integrase [Shewanella woodyi ATC...  47.0    0.003
ref|YP_965540.1|  phage integrase family protein [Desulfovibri...  47.0    0.003
ref|YP_559298.1|  putative phage integrase [Burkholderia xenov...  47.0    0.003
ref|NP_943130.1|  AGR-L-2007p integrase [Pseudomonas sp. ND6] ...  47.0    0.003
ref|YP_344228.1|  Phage integrase [Nitrosococcus oceani ATCC 1...  47.0    0.003
ref|YP_309845.1|  putative integrase [Shigella sonnei Ss046] >...  47.0    0.003
ref|YP_267112.1|  phage integrase family site specific recombi...  47.0    0.003
ref|NP_285976.1|  integrase protein for prophage CP-933I [Esch...  47.0    0.003
ref|YP_101755.1|  tyrosine type site-specific recombinase [Bac...  47.0    0.003
ref|NP_942166.1|  hypothetical protein slr5010 [Synechocystis ...  47.0    0.003
ref|NP_308316.1|  putative integrase [Escherichia coli O157:H7...  47.0    0.003
ref|ZP_01107115.1|  putative site-specific recombinase [Flavob...  47.0    0.003
ref|ZP_00991626.1|  phage integrase [Vibrio splendidus 12B01] ...  47.0    0.003
ref|YP_001464377.1|  site-specific recombinase, phage integras...  47.0    0.003
ref|YP_917857.1|  phage integrase family protein [Paracoccus d...  47.0    0.003
ref|YP_014578.1|  integrase/recombinase XerD [Listeria monocyt...  47.0    0.003
ref|NP_465479.1|  hypothetical protein lmo1955 [Listeria monoc...  47.0    0.003
ref|YP_003471861.1|  Site-specific tyrosine recombinase [Staph...  46.6    0.004
ref|YP_003465175.1|  integrase/recombinase XerD [Listeria seel...  46.6    0.004
ref|ZP_06364899.1|  tyrosine recombinase XerD [Bacillus cellul...  46.6    0.004
ref|ZP_06200005.1|  conserved hypothetical protein [Bacteroide...  46.6    0.004
ref|ZP_06123565.1|  putative integrase [Providencia rettgeri D...  46.6    0.004
ref|YP_003279049.1|  phage integrase [Comamonas testosteroni C...  46.6    0.004
ref|YP_003235292.1|  putative integrase [Escherichia coli O111...  46.6    0.004
ref|YP_003231837.1|  putative integrase [Escherichia coli O26:...  46.6    0.004
ref|ZP_05110867.1|  phage related integrase [Legionella dranco...  46.6    0.004
ref|YP_002936005.1|  putative phage integrase/recombinase [Eub...  46.6    0.004
ref|YP_002869874.1|  putative phage integrase [Pseudomonas flu...  46.6    0.004
gb|ADD69309.1|  integrase family protein [Denitrovibrio acetip...  46.6    0.004
ref|YP_002892380.1|  integrase family protein [Tolumonas auens...  46.6    0.004
ref|YP_002398550.1|  integrase from prophage [Escherichia coli...  46.6    0.004
ref|ZP_03066490.1|  prophage integrase [Shigella dysenteriae 1...  46.6    0.004
ref|YP_001937440.1|  putative integrase [Orientia tsutsugamush...  46.6    0.004
ref|YP_001936733.1|  putative integrase [Orientia tsutsugamush...  46.6    0.004
ref|YP_002894739.1|  integrase or site-specific recombinase [B...  46.6    0.004
ref|ZP_02435973.1|  hypothetical protein BACSTE_02226 [Bactero...  46.6    0.004
ref|ZP_01872494.1|  Integrase [Caminibacter mediatlanticus TB-...  46.6    0.004
ref|YP_001236764.1|  putative phage integrase [Bradyrhizobium ...  46.6    0.004
emb|CAM78106.1|  Phage-related integrase, fragment [Magnetospi...  46.6    0.004
ref|YP_411617.1|  Phage integrase [Nitrosospira multiformis AT...  46.6    0.004
ref|YP_408540.1|  putative CP4-57-type integrase [Shigella boy...  46.6    0.004
ref|YP_001415530.1|  integrase family protein [Xanthobacter au...  46.6    0.004
ref|YP_001550266.1|  site-specific recombinase XerD [Prochloro...  46.6    0.004
ref|YP_733819.1|  phage integrase family protein [Shewanella s...  46.6    0.004
ref|YP_869430.1|  phage integrase family protein [Shewanella s...  46.6    0.004
ref|ZP_05283549.1|  putative tyrosine recombinase [Bacteroides...  46.2    0.005
ref|ZP_04848460.1|  integrase [Bacteroides sp. 1_1_6] >gb|EES6...  46.2    0.005
ref|ZP_04615674.1|  Integrase [Yersinia ruckeri ATCC 29473] >g...  46.2    0.005
ref|ZP_04433002.1|  tyrosine recombinase XerD [Bacillus coagul...  46.2    0.005
ref|YP_002991274.1|  integrase family protein [Desulfovibrio s...  46.2    0.005
ref|YP_002324169.1|  Tyrosine recombinase xerC [Acinetobacter ...  46.2    0.005
ref|YP_002311531.1|  Integrase [Shewanella piezotolerans WP3] ...  46.2    0.005
ref|ZP_05031969.1|  site-specific recombinase, phage integrase...  46.2    0.005
ref|ZP_03051190.1|  site-specific recombinase, phage integrase...  46.2    0.005
ref|YP_002289153.1|  phage integrase [Oligotropha carboxidovor...  46.2    0.005
ref|ZP_03217914.1|  integrase [Salmonella enterica subsp. ente...  46.2    0.005
ref|YP_001742404.1|  phage integrase family site specific reco...  46.2    0.005
ref|ZP_02364571.1|  putative bacteriophage integrase [Burkhold...  46.2    0.005
ref|YP_001372869.1|  phage integrase family protein [Ochrobact...  46.2    0.005
ref|ZP_01736697.1|  hypothetical protein MELB17_04087 [Marinob...  46.2    0.005
ref|ZP_01546914.1|  phage-related integrase [Stappia aggregata...  46.2    0.005
ref|YP_001195046.1|  phage integrase family protein [Flavobact...  46.2    0.005
ref|YP_549776.1|  phage integrase [Polaromonas sp. JS666] >gb|...  46.2    0.005
ref|YP_096565.1|  integrase of prophage CP-933C [Legionella pn...  46.2    0.005
ref|YP_315763.1|  cp4-like integrase protein [Thiobacillus den...  46.2    0.005
ref|YP_423405.1|  integrase [Magnetospirillum magneticum AMB-1...  46.2    0.005
ref|YP_253577.1|  hypothetical protein SH1662 [Staphylococcus ...  46.2    0.005
ref|NP_942552.1|  hypothetical protein sll6109 [Synechocystis ...  46.2    0.005
ref|ZP_01054441.1|  hypothetical protein MED193_17104 [Roseoba...  46.2    0.005
ref|ZP_06050132.1|  phage integrase [Vibrio cholerae CT 5369-9...  45.8    0.007
ref|ZP_05846565.1|  integrase/recombinase XerD [Corynebacteriu...  45.8    0.007
ref|ZP_05710230.1|  integrase family protein [Desulfurivibrio ...  45.8    0.007
ref|YP_003221206.1|  integrase [Escherichia coli O103:H2 str. ...  45.8    0.007
ref|YP_003228685.1|  integrase [Escherichia coli O26:H11 str. ...  45.8    0.007
ref|YP_003018394.1|  integrase family protein [Pectobacterium ...  45.8    0.007
ref|YP_003250354.1|  integrase family protein [Fibrobacter suc...  45.8    0.007
ref|ZP_04677272.1|  tyrosine recombinase XerC [Staphylococcus ...  45.8    0.007
ref|YP_003007015.1|  hypothetical protein NT05HA_0516 [Aggrega...  45.8    0.007
ref|ZP_03697976.1|  integrase family protein [Lutiella nitrofe...  45.8    0.007
ref|ZP_03678057.1|  hypothetical protein BACCELL_02397 [Bacter...  45.8    0.007
ref|YP_002633981.1|  putative site-specific recombinase XerC [...  45.8    0.007
ref|YP_002407994.1|  integrase of prophage [Escherichia coli I...  45.8    0.007
ref|YP_002046450.1|  integrase [Salmonella enterica subsp. ent...  45.8    0.007
ref|YP_001929695.1|  putative site-specific recombinase [Porph...  45.8    0.007
ref|YP_001928501.1|  putative integrase/recombinase XerD [Porp...  45.8    0.007
ref|ZP_02903160.1|  integrase [Escherichia albertii TW07627] >...  45.8    0.007
ref|ZP_02660399.1|  site-specific recombinase, phage integrase...  45.8    0.007
ref|ZP_02436000.1|  hypothetical protein BACSTE_02254 [Bactero...  45.8    0.007
ref|ZP_02179942.1|  phage integrase family protein [Hydrogeniv...  45.8    0.007
ref|YP_001440104.1|  hypothetical protein ESA_04087 [Enterobac...  45.8    0.007
ref|YP_002424007.1|  integrase family protein [Methylobacteriu...  45.8    0.007
ref|ZP_01905048.1|  Site-specific recombinase XerD-like protei...  45.8    0.007
ref|ZP_01895695.1|  putative integrase [Marinobacter algicola ...  45.8    0.007
ref|YP_878186.1|  integrase/recombinase, putative [Clostridium...  45.8    0.007
ref|YP_001480111.1|  integrase family protein [Serratia protea...  45.8    0.007
ref|YP_829270.1|  phage integrase family protein [Arthrobacter...  45.8    0.007
ref|YP_941859.1|  phage integrase family protein [Psychromonas...  45.8    0.007
ref|NP_905840.1|  integrase/recombinase XerD [Porphyromonas gi...  45.8    0.007
ref|NP_904693.1|  phage integrase family site specific recombi...  45.8    0.007
ref|NP_421479.1|  phage integrase family integrase/recombinase...  45.8    0.007
ref|YP_250655.1|  integrase/recombinase [Corynebacterium jeike...  45.8    0.007
ref|YP_157407.1|  phage integrase [Aromatoleum aromaticum EbN1...  45.8    0.007
ref|YP_048780.1|  putative phage integrase [Pectobacterium atr...  45.8    0.007
ref|NP_102646.1|  prbable integrase [Mesorhizobium loti MAFF30...  45.8    0.007
gb|AAA50502.1|  integrase [Bergeyella zoohelcum] >prf||2115270...  45.8    0.007
ref|YP_001415970.1|  integrase family protein [Xanthobacter au...  45.8    0.007
ref|YP_001415977.1|  integrase family protein [Xanthobacter au...  45.8    0.007
ref|YP_001415359.1|  integrase family protein [Xanthobacter au...  45.8    0.007
ref|YP_001001918.1|  phage integrase family protein [Halorhodo...  45.8    0.007
ref|ZP_01117985.1|  putative site-specific recombinase [Polari...  45.8    0.007
ref|ZP_00956910.1|  site-specific integrase/recombinase [Sulfi...  45.8    0.007
ref|ZP_04635151.1|  Integrase [Yersinia intermedia ATCC 29909]...  45.8    0.007
ref|YP_750344.1|  phage integrase family protein [Shewanella f...  45.8    0.007
ref|ZP_05979829.1|  tyrosine recombinase XerC [Subdoligranulum...  45.4    0.009
ref|ZP_06124663.1|  putative integrase [Providencia rettgeri D...  45.4    0.009
ref|ZP_04825156.1|  tyrosine recombinase XerC [Staphylococcus ...  45.4    0.009
ref|ZP_04796979.1|  tyrosine recombinase XerC [Staphylococcus ...  45.4    0.009
ref|ZP_04797571.1|  bacteriophage integrase [Staphylococcus ep...  45.4    0.009
ref|ZP_04629335.1|  Integrase [Yersinia bercovieri ATCC 43970]...  45.4    0.009
ref|ZP_04172177.1|  Integrase/recombinase [Bacillus mycoides D...  45.4    0.009
ref|ZP_03957421.1|  bacteriophage integrase [Lactobacillus rum...  45.4    0.009
ref|ZP_03268275.1|  integrase family protein [Burkholderia sp....  45.4    0.009
gb|EDZ39824.1|  integrase INT P4 [Leptospirillum sp. Group II ...  45.4    0.009
ref|YP_003242226.1|  integrase family protein [Geobacillus sp....  45.4    0.009
ref|ZP_03013971.1|  hypothetical protein BACINT_01531 [Bactero...  45.4    0.009
ref|ZP_02783804.1|  site-specific recombinase, phage integrase...  45.4    0.009
ref|ZP_02634015.1|  putative integrase/recombinase [Clostridiu...  45.4    0.009
ref|YP_001743018.1|  phage integrase family site specific reco...  45.4    0.009
ref|ZP_02436648.1|  hypothetical protein BACSTE_02916 [Bactero...  45.4    0.009
ref|ZP_02067779.1|  hypothetical protein BACOVA_04789 [Bactero...  45.4    0.009
ref|YP_001411637.1|  integrase family protein [Parvibaculum la...  45.4    0.009
ref|YP_001764578.1|  integrase family protein [Burkholderia ce...  45.4    0.009
ref|YP_919149.1|  phage integrase family protein [Thermofilum ...  45.4    0.009
ref|YP_512286.1|  putative integrase [Escherichia phage phiV10...  45.4    0.009
ref|NP_603734.1|  integrase/recombinase [Fusobacterium nucleat...  45.4    0.009
ref|NP_764483.1|  xerC protein [Staphylococcus epidermidis ATC...  45.4    0.009
ref|NP_771643.1|  site-specific integrase/recombinase [Bradyrh...  45.4    0.009
ref|YP_001415700.1|  integrase family protein [Xanthobacter au...  45.4    0.009
ref|ZP_01045332.1|  site-specific recombinase, phage integrase...  45.4    0.009
ref|ZP_00544598.1|  Phage integrase:Phage integrase, N-termina...  45.4    0.009
ref|YP_806588.1|  integrase [Lactobacillus casei ATCC 334] >re...  45.4    0.009
gb|ADD79080.1|  Int [Pantoea ananatis LMG 20103]                   45.1    0.011
ref|ZP_06031488.1|  site-specific recombinase phage integrase ...  45.1    0.011
ref|ZP_05951314.1|  putative integrase of prophage CP-933C [Es...  45.1    0.011
ref|ZP_05941494.1|  putative integrase of prophage CP-933C [Es...  45.1    0.011
ref|ZP_05828022.1|  integrase [Acinetobacter baumannii ATCC 19...  45.1    0.011
ref|ZP_05740856.1|  putative phage integrase [Silicibacter sp....  45.1    0.011
ref|ZP_06013049.1|  phage integrase family site-specific recom...  45.1    0.011
ref|ZP_05729680.1|  integrase family protein [Pantoea sp. At-9...  45.1    0.011
ref|ZP_05656209.1|  phage integrase [Enterococcus casseliflavu...  45.1    0.011
ref|ZP_05647301.1|  phage integrase [Enterococcus casseliflavu...  45.1    0.011
ref|YP_003229316.1|  putative integrase [Escherichia coli O26:...  45.1    0.011
ref|ZP_05550588.1|  integrase/recombinase [Fusobacterium sp. 3...  45.1    0.011
ref|ZP_05360440.1|  integrase [Acinetobacter radioresistens SK...  45.1    0.011
ref|YP_003061248.1|  integrase family protein [Hirschia baltic...  45.1    0.011
ref|ZP_04762300.1|  integrase family protein [Acidovorax delaf...  45.1    0.011
ref|ZP_04600703.1|  hypothetical protein GCWU000324_00153 [Kin...  45.1    0.011
ref|ZP_04548948.1|  conserved hypothetical protein [Bacteroide...  45.1    0.011
ref|YP_002548629.1|  phage-related integrase [Agrobacterium vi...  45.1    0.011
ref|ZP_05121003.1|  integrase [Vibrio parahaemolyticus 16] >gb...  45.1    0.011
ref|YP_002408642.1|  putative integrase [Escherichia coli IAI3...  45.1    0.011
ref|ZP_03250923.1|  site-specific recombinase, phage integrase...  45.1    0.011
ref|YP_002240225.1|  site-specific recombinase, phage integras...  45.1    0.011
ref|YP_001938197.1|  putative integrase [Orientia tsutsugamush...  45.1    0.011
ref|YP_001937697.1|  putative integrase [Orientia tsutsugamush...  45.1    0.011
ref|ZP_02997294.1|  site-specific recombinase, phage integrase...  45.1    0.011
ref|YP_002277118.1|  integrase family protein [Gluconacetobact...  45.1    0.011
ref|YP_001800486.1|  integrase/recombinase [Corynebacterium ur...  45.1    0.011
ref|ZP_02812591.1|  site-specific recombinase, phage integrase...  45.1    0.011
ref|ZP_02807454.1|  site-specific recombinase, phage integrase...  45.1    0.011
ref|YP_002048369.1|  integrase [Salmonella enterica subsp. ent...  45.1    0.011
ref|ZP_02065149.1|  hypothetical protein BACOVA_02123 [Bactero...  45.1    0.011
gb|EAY57565.1|  putative phage integrase [Leptospirillum rubarum]  45.1    0.011
ref|YP_001751203.1|  integrase family protein [Pseudomonas put...  45.1    0.011
ref|ZP_01451128.1|  site-specific recombinase, phage integrase...  45.1    0.011
ref|YP_001467745.1|  30S ribosomal protein S15 [Campylobacter ...  45.1    0.011
ref|YP_393472.1|  Phage integrase [Sulfurimonas denitrificans ...  45.1    0.011
ref|NP_942293.1|  hypothetical protein slr7005 [Synechocystis ...  45.1    0.011
ref|NP_934570.1|  integrase [Vibrio vulnificus YJ016] >dbj|BAC...  45.1    0.011
ref|ZP_01039291.1|  site-specific recombinase, phage integrase...  45.1    0.011
ref|ZP_03064279.1|  site-specific recombinase, phage integrase...  45.1    0.011
ref|YP_926199.1|  hypothetical protein Sama_0318 [Shewanella a...  45.1    0.011
ref|YP_916899.1|  phage integrase family protein [Paracoccus d...  45.1    0.011
ref|ZP_00144452.1|  DNA integration/recombination/invertion pr...  45.1    0.011
ref|ZP_06370193.1|  tyrosine recombinase XerD [Desulfovibrio s...  44.7    0.015
ref|ZP_06341195.1|  phage integrase, N-terminal SAM domain pro...  44.7    0.015
ref|YP_003294855.1|  putative site specific integrase [Edwards...  44.7    0.015
ref|ZP_05814587.1|  integrase/recombinase [Fusobacterium sp. 3...  44.7    0.015
ref|ZP_06013489.1|  phage integrase family site-specific recom...  44.7    0.015
ref|ZP_05649197.1|  phage integrase [Enterococcus gallinarum E...  44.7    0.015
ref|ZP_05624432.1|  DNA integration/recombination/inversion pr...  44.7    0.015
ref|ZP_04756775.1|  tyrosine recombinase XerD [Neisseria flave...  44.7    0.015
ref|ZP_04770089.1|  integrase family protein [Asticcacaulis ex...  44.7    0.015
ref|ZP_04600865.1|  hypothetical protein GCWU000324_00320 [Kin...  44.7    0.015
ref|ZP_04552285.1|  integrase [Bacteroides sp. 2_2_4] >gb|EEO5...  44.7    0.015
ref|ZP_04575059.1|  integrase/recombinase [Fusobacterium sp. 7...  44.7    0.015
ref|ZP_04569095.1|  phage integrase [Fusobacterium sp. 2_1_31]...  44.7    0.015
ref|ZP_04059763.1|  tyrosine recombinase XerC [Staphylococcus ...  44.7    0.015
ref|ZP_03851763.1|  phage integrase family protein [Chryseobac...  44.7    0.015
ref|YP_002795679.1|  Site-specific recombinase, phage integras...  44.7    0.015
ref|ZP_05984435.2|  tyrosine recombinase XerD [Neisseria subfl...  44.7    0.015
ref|ZP_03720367.1|  hypothetical protein NEIFLAOT_02223 [Neiss...  44.7    0.015
ref|ZP_03676608.1|  hypothetical protein BACCELL_00934 [Bacter...  44.7    0.015
ref|YP_002475706.1|  phage integrase [Haemophilus parasuis SH0...  44.7    0.015
ref|YP_002455812.1|  integrase [Lactobacillus phage Lv-1] >gb|...  44.7    0.015
ref|YP_002397757.1|  integrase of prophage [Escherichia coli E...  44.7    0.015
ref|ZP_03458439.1|  hypothetical protein BACEGG_01212 [Bactero...  44.7    0.015
ref|ZP_01052592.2|  phage integrase family protein [Polaribact...  44.7    0.015
ref|YP_002037966.1|  integrase [Streptococcus pneumoniae G54] ...  44.7    0.015
ref|ZP_03003178.1|  site-specific recombinase, phage integrase...  44.7    0.015
ref|YP_002884829.1|  tyrosine recombinase XerD [Exiguobacteriu...  44.7    0.015
ref|ZP_02959572.1|  hypothetical protein PROSTU_01438 [Provide...  44.7    0.015
ref|YP_001958291.1|  hypothetical protein Aasi_1239 [Candidatu...  44.7    0.015
ref|YP_001714701.1|  putative site-specific recombinase, integ...  44.7    0.015
ref|ZP_02478181.1|  phage integrase family protein [Haemophilu...  44.7    0.015
ref|ZP_02465213.1|  putative bacteriophage integrase [Burkhold...  44.7    0.015
ref|YP_001639334.1|  integrase family protein [Methylobacteriu...  44.7    0.015
ref|ZP_01823501.1|  tyrosine recombinase [Streptococcus pneumo...  44.7    0.015
ref|YP_001890224.1|  integrase family protein [Burkholderia ph...  44.7    0.015
ref|YP_001685779.1|  integrase family protein [Caulobacter sp....  44.7    0.015
ref|YP_688661.1|  putative integrase of prophage [Shigella fle...  44.7    0.015
ref|YP_001496468.1|  integrase [Rickettsia bellii OSU 85-389] ...  44.7    0.015
ref|YP_594550.1|  prophage DLP12 integrase [Lawsonia intracell...  44.7    0.015
ref|ZP_01289843.1|  Phage integrase [delta proteobacterium MLM...  44.7    0.015
ref|ZP_01289825.1|  Phage integrase [delta proteobacterium MLM...  44.7    0.015
ref|YP_537610.1|  integrase [Rickettsia bellii RML369-C] >ref|...  44.7    0.015
emb|CAI29284.1|  putative XerD-like integrase/recombinase [Bac...  44.7    0.015
emb|CAI29290.1|  putative XerD-like integrase/recombinase [Bac...  44.7    0.015
ref|NP_707043.1|  putative integrase of prophage CP-933C [Shig...  44.7    0.015
ref|YP_166466.1|  phage integrase family site specific recombi...  44.7    0.015
ref|NP_287321.1|  putative integrase of prophage CP-933C [Esch...  44.7    0.015
ref|YP_072362.1|  putative integrase [Yersinia pseudotuberculo...  44.7    0.015
ref|NP_309601.1|  putative integrase [Escherichia coli O157:H7...  44.7    0.015
ref|NP_774814.1|  site-specific integrase/recombinase [Bradyrh...  44.7    0.015
ref|YP_001417938.1|  integrase family protein [Xanthobacter au...  44.7    0.015
ref|ZP_01017052.1|  Phage integrase [Parvularcula bermudensis ...  44.7    0.015
ref|ZP_04922053.1|  site-specific recombinase, phage integrase...  44.7    0.015
ref|YP_001120510.1|  phage integrase family protein [Burkholde...  44.7    0.015
ref|YP_810597.1|  tyrosine recombinase XerC subunit [Oenococcu...  44.7    0.015
ref|ZP_06552342.1|  phage integrase family site-specific recom...  44.3    0.019
ref|ZP_06187603.1|  phage integrase family protein [Legionella...  44.3    0.019
ref|ZP_06069292.1|  predicted protein [Acinetobacter lwoffii S...  44.3    0.019
ref|ZP_05571490.1|  site-specific integrase/recombinase [Ferro...  44.3    0.019
ref|ZP_05500934.1|  tyrosine recombinase XerD [Thiomonas inter...  44.3    0.019
ref|ZP_05454342.1|  phage-related integrase [Brucella melitens...  44.3    0.019
ref|YP_003094801.1|  Integrase, site-specific recombinase [Fla...  44.3    0.019
dbj|BAH89608.1|  tyrosine recombinase [uncultured bacterium] >...  44.3    0.019
ref|ZP_05288296.1|  integrase [Bacteroides sp. 2_1_7]              44.3    0.019
ref|ZP_05292504.1|  site-specific recombinase, phage integrase...  44.3    0.019
ref|YP_003041563.1|  putative prophage integrase [Photorhabdus...  44.3    0.019
ref|ZP_04840908.1|  integrase [Bacteroides sp. 3_2_5] >gb|EES8...  44.3    0.019
ref|ZP_04769629.1|  integrase family protein [Asticcacaulis ex...  44.3    0.019
ref|ZP_04653673.1|  integrase family protein [Salmonella enter...  44.3    0.019
ref|ZP_04056388.1|  tyrosine recombinase XerC [Capnocytophaga ...  44.3    0.019
ref|ZP_03703483.1|  integrase family protein [Flavobacteria ba...  44.3    0.019
ref|ZP_03643374.1|  hypothetical protein BACCOPRO_01742 [Bacte...  44.3    0.019
ref|YP_002528333.1|  site-specific integrase/recombinase [Baci...  44.3    0.019
ref|YP_002330279.1|  predicted integrase [Escherichia coli O12...  44.3    0.019
gb|EDZ39894.1|  Putative integrase [Leptospirillum sp. Group I...  44.3    0.019
gb|EDZ38387.1|  Putative phage integrase [Leptospirillum sp. G...  44.3    0.019
ref|YP_002238964.1|  site-specific recombinase, phage integras...  44.3    0.019
ref|ZP_03212128.1|  Integrase [Lactobacillus rhamnosus HN001] ...  44.3    0.019
gb|ABZ06093.1|  putative Phage integrase family protein [uncul...  44.3    0.019
ref|ZP_03052364.1|  site-specific recombinase, phage integrase...  44.3    0.019
ref|YP_001938314.1|  putative integrase [Orientia tsutsugamush...  44.3    0.019
ref|YP_001937555.1|  putative integrase [Orientia tsutsugamush...  44.3    0.019
ref|YP_002290562.1|  probable integrase [Oligotropha carboxido...  44.3    0.019
ref|YP_001608874.1|  phage-related integrase/recombinase [Bart...  44.3    0.019
ref|ZP_02068395.1|  hypothetical protein BACOVA_05411 [Bactero...  44.3    0.019
ref|ZP_01904587.1|  hypothetical integrase [Roseobacter sp. Az...  44.3    0.019
ref|ZP_04971214.1|  site-specific recombinase [Fusobacterium n...  44.3    0.019
ref|YP_001250694.1|  phage related integrase [Legionella pneum...  44.3    0.019
ref|ZP_01828836.1|  hypothetical protein CGSSp14BS69_06827 [St...  44.3    0.019
ref|YP_001143174.1|  phage integrase [Aeromonas salmonicida su...  44.3    0.019
ref|YP_001501143.1|  integrase family protein [Shewanella peal...  44.3    0.019
ref|NP_848235.1|  integrase [Enterobacteria phage epsilon15] >...  44.3    0.019
ref|YP_562147.1|  phage integrase [Shewanella denitrificans OS...  44.3    0.019
ref|YP_385229.1|  Phage integrase [Geobacter metallireducens G...  44.3    0.019
ref|NP_813528.1|  integrase [Bacteroides thetaiotaomicron VPI-...  44.3    0.019
ref|NP_734706.1|  hypothetical protein gbs0237 [Streptococcus ...  44.3    0.019
ref|ZP_01004592.1|  Phage integrase [Loktanella vestfoldensis ...  44.3    0.019
ref|YP_989344.1|  integrase [Bartonella bacilliformis KC583] >...  44.3    0.019
ref|YP_002015220.1|  integrase family protein [Prosthecochlori...  44.3    0.019
ref|ZP_06496227.1|  phage integrase, putative [Pseudomonas syr...  43.9    0.025
ref|YP_003449703.1|  phage integrase [Azospirillum sp. B510] >...  43.9    0.025
ref|YP_003445333.1|  site-specific recombinase, phage integras...  43.9    0.025
ref|ZP_06199194.1|  putative integrase/recombinase XerD [Strep...  43.9    0.025
ref|ZP_05956802.1|  conserved hypothetical protein [Brucella p...  43.9    0.025
ref|ZP_05932968.1|  conserved hypothetical protein [Brucella c...  43.9    0.025
ref|ZP_05447534.1|  phage-related integrase [Brucella melitens...  43.9    0.025
ref|ZP_05441196.1|  integrase/recombinase [Fusobacterium sp. D...  43.9    0.025
ref|YP_003106899.1|  site-specific recombinase, phage integras...  43.9    0.025
ref|ZP_05366727.1|  tyrosine recombinase XerD [Corynebacterium...  43.9    0.025
ref|ZP_05175869.1|  Phage integrase [Brucella ceti M644/93/1] ...  43.9    0.025
ref|ZP_05171868.1|  Phage integrase [Brucella pinnipedialis B2...  43.9    0.025
ref|ZP_05166092.1|  Phage integrase [Brucella suis bv. 3 str. ...  43.9    0.025
ref|ZP_05163550.1|  Phage integrase [Brucella suis bv. 5 str. ...  43.9    0.025
ref|ZP_05155513.1|  Phage integrase [Brucella abortus bv. 3 st...  43.9    0.025
ref|ZP_04850494.1|  conserved hypothetical protein [Bacteroide...  43.9    0.025
ref|ZP_04820619.1|  phage integrase family protein [Clostridiu...  43.9    0.025
ref|ZP_04770793.1|  integrase family protein [Asticcacaulis ex...  43.9    0.025
dbj|BAH79202.1|  putative integrase [Escherichia coli O157:H7]     43.9    0.025
gb|ADD44074.1|  tyrosine recombinase XerD [Stackebrandtia nass...  43.9    0.025
ref|ZP_04545308.1|  site-specific recombinase [Bacteroides sp....  43.9    0.025
ref|ZP_03921924.1|  site-specific tyrosine recombinase XerD [C...  43.9    0.025
ref|ZP_04537634.1|  conserved hypothetical protein [Escherichi...  43.9    0.025
ref|YP_002732704.1|  phage-related integrase [Brucella meliten...  43.9    0.025
ref|YP_002603349.1|  phage integrase protein (DNA breaking and...  43.9    0.025
ref|YP_002606689.1|  phage integrase [Nautilia profundicola Am...  43.9    0.025
ref|ZP_05122267.1|  phage integrase [Rhodobacteraceae bacteriu...  43.9    0.025
ref|ZP_05121098.1|  phage integrase family protein [Vibrio par...  43.9    0.025
ref|YP_002479810.1|  integrase family protein [Desulfovibrio d...  43.9    0.025
ref|ZP_03475692.1|  hypothetical protein PRABACTJOHN_01354 [Pa...  43.9    0.025
ref|ZP_03460327.1|  hypothetical protein BACEGG_03142 [Bactero...  43.9    0.025
dbj|BAG74735.1|  putative integrase [Vibrio parahaemolyticus]      43.9    0.025
ref|YP_002247908.1|  tyrosine recombinase XerD [Thermodesulfov...  43.9    0.025
ref|ZP_05065653.1|  integrase [Octadecabacter antarcticus 238]...  43.9    0.025
ref|ZP_03012108.1|  hypothetical protein BACCOP_04040 [Bactero...  43.9    0.025
ref|ZP_02620986.1|  putative integrase/recombinase [Clostridiu...  43.9    0.025
ref|ZP_02532114.1|  tyrosine recombinase XerD [Endoriftia pers...  43.9    0.025
ref|YP_001499410.1|  integrase [Rickettsia massiliae MTU5] >gb...  43.9    0.025
ref|YP_001641228.1|  integrase family protein [Methylobacteriu...  43.9    0.025
ref|ZP_01871307.1|  Phage integrase [Caminibacter mediatlantic...  43.9    0.025
ref|ZP_01864766.1|  Putative phage integrase [Erythrobacter sp...  43.9    0.025
ref|YP_001083115.1|  site-specific tyrosine recombinase [Acine...  43.9    0.025
ref|YP_001751196.1|  integrase family protein [Pseudomonas put...  43.9    0.025
ref|YP_862412.1|  tyrosine recombinase XerC [Gramella forsetii...  43.9    0.025
ref|YP_001280169.1|  phage integrase family protein [Psychroba...  43.9    0.025
ref|NP_761299.1|  integrase [Vibrio vulnificus CMCP6] >gb|AAO1...  43.9    0.025
ref|YP_460667.1|  integrase family protein [Syntrophus aciditr...  43.9    0.025
ref|YP_303296.1|  Phage integrase, N-terminal SAM- like [Ehrli...  43.9    0.025
ref|YP_124435.1|  hypothetical protein lpp2123 [Legionella pne...  43.9    0.025
ref|NP_697976.1|  phage integrase family site specific recombi...  43.9    0.025
ref|YP_001213526.1|  phage integrase family protein [Dehalococ...  43.9    0.025
ref|YP_734905.1|  phage integrase family protein [Shewanella s...  43.9    0.025
ref|ZP_03033594.1|  site-specific recombinase, phage integrase...  43.9    0.025
ref|YP_001185048.1|  phage integrase family protein [Shewanell...  43.9    0.025
emb|CBG35255.1|  integrase [Escherichia coli 042]                  43.5    0.033
ref|ZP_06172465.1|  integrase family protein [Brevundimonas su...  43.5    0.033
ref|ZP_05910748.1|  phage integrase family protein [Vibrio par...  43.5    0.033
ref|YP_003489184.1|  putative integrase [Streptomyces scabiei ...  43.5    0.033
ref|ZP_05785630.1|  phage integrase family protein [Silicibact...  43.5    0.033
ref|YP_003187317.1|  phage DNA recombinase XerD [Acetobacter p...  43.5    0.033
ref|ZP_05152456.1|  Phage integrase [Brucella abortus bv. 6 st...  43.5    0.033
ref|ZP_04699186.1|  integrase [Rickettsia endosymbiont of Ixod...  43.5    0.033
ref|YP_002937089.1|  putative phage integrase/recombinase [Eub...  43.5    0.033
ref|YP_003143427.1|  site-specific recombinase XerD [Slackia h...  43.5    0.033
ref|ZP_04570987.1|  integrase/recombinase [Fusobacterium sp. 2...  43.5    0.033
ref|ZP_04443309.1|  integrase/recombinase XerD [Listeria grayi...  43.5    0.033
ref|ZP_03827026.1|  Tyrosine recombinase xerD [Pectobacterium ...  43.5    0.033
ref|YP_003323296.1|  integrase family protein [Thermobaculum t...  43.5    0.033
ref|ZP_03791789.1|  phage integrase family protein [Burkholder...  43.5    0.033
ref|YP_002521382.1|  transposase [Thermomicrobium roseum DSM 5...  43.5    0.033
ref|YP_002507587.1|  integrase family protein [Clostridium cel...  43.5    0.033
ref|YP_002434784.1|  tyrosine recombinase XerD [Desulfovibrio ...  43.5    0.033
ref|ZP_03320437.1|  hypothetical protein PROVALCAL_03397 [Prov...  43.5    0.033
gb|EDZ39098.1|  Putative phage integrase [Leptospirillum sp. G...  43.5    0.033
gb|EDZ37975.1|  Recombinase [Leptospirillum sp. Group II '5-wa...  43.5    0.033
ref|YP_001957317.1|  integrase family protein [Candidatus Amoe...  43.5    0.033
ref|ZP_03108592.1|  integrase/recombinase [Bacillus cereus NVH...  43.5    0.033
ref|ZP_02455170.1|  phage integrase family protein [Burkholder...  43.5    0.033
ref|ZP_01544306.1|  integrase/recombinase [Oenococcus oeni ATC...  43.5    0.033
ref|YP_001430203.1|  integrase family protein [Roseiflexus cas...  43.5    0.033
ref|YP_830490.1|  phage integrase family protein [Arthrobacter...  43.5    0.033
gb|AAS99039.1|  Tgh84 [Campylobacter jejuni]                       43.5    0.033
ref|YP_561760.1|  tyrosine recombinase XerD [Shewanella denitr...  43.5    0.033
ref|YP_443767.1|  phage integrase family site specific recombi...  43.5    0.033
ref|YP_256611.1|  ISC1913-like resolvase [Sulfolobus acidocald...  43.5    0.033
ref|YP_156036.1|  integrase [Idiomarina loihiensis L2TR] >gb|A...  43.5    0.033
ref|NP_753392.1|  putative integrase of prophage [Escherichia ...  43.5    0.033
ref|YP_422072.1|  integrase [Magnetospirillum magneticum AMB-1...  43.5    0.033
ref|NP_840329.1|  Phage integrase [Nitrosomonas europaea ATCC ...  43.5    0.033
sp|Q48733.1|XERC_LACLE  RecName: Full=Tyrosine recombinase xer...  43.5    0.033
ref|NP_242395.1|  integrase/recombinase [Bacillus halodurans C...  43.5    0.033
ref|YP_001093396.1|  phage integrase family protein [Shewanell...  43.5    0.033
ref|YP_001362867.1|  phage integrase family protein [Kineococc...  43.5    0.033
ref|ZP_00050146.2|  COG0582: Integrase [Magnetospirillum magne...  43.5    0.033
ref|YP_810577.1|  tyrosine recombinase XerD subunit [Oenococcu...  43.5    0.033
ref|YP_003423453.1|  tyrosine recombinase XerC [Methanobreviba...  43.1    0.043
ref|ZP_06145262.1|  integrase family protein [Ruminococcus fla...  43.1    0.043
ref|ZP_06076599.1|  integrase [Bacteroides sp. 2_1_33B] >gb|EE...  43.1    0.043
ref|ZP_06027165.1|  integrase/recombinase [Fusobacterium perio...  43.1    0.043
ref|YP_003333945.1|  integrase family protein [Dickeya dadanti...  43.1    0.043
ref|ZP_05711090.1|  integrase family protein [Desulfurivibrio ...  43.1    0.043
ref|ZP_05546337.1|  integrase [Parabacteroides sp. D13] >gb|EE...  43.1    0.043
ref|ZP_05394346.1|  integrase family protein [Clostridium carb...  43.1    0.043
ref|ZP_05376295.1|  tyrosine recombinase XerD [Hyphomicrobium ...  43.1    0.043
ref|ZP_04848891.1|  integrase [Bacteroides sp. 1_1_6] >gb|EES6...  43.1    0.043
ref|YP_003017208.1|  integrase family protein [Pectobacterium ...  43.1    0.043
ref|ZP_04700026.1|  integrase [Rickettsia endosymbiont of Ixod...  43.1    0.043
ref|YP_002953579.1|  tyrosine recombinase XerD [Desulfovibrio ...  43.1    0.043
ref|ZP_04579503.1|  tyrosine recombinase XerD [Oxalobacter for...  43.1    0.043
ref|ZP_04012785.1|  site-specific DNA tyrosine recombinase, Xe...  43.1    0.043
ref|ZP_03924164.1|  possible integrase/recombinase XerD [Mobil...  43.1    0.043
ref|ZP_03840278.1|  integrase family protein [Proteus mirabili...  43.1    0.043
ref|ZP_03728938.1|  integrase family protein [Dethiobacter alk...  43.1    0.043
ref|YP_002991032.1|  integrase family protein [Desulfovibrio s...  43.1    0.043
gb|EDZ39029.1|  Putative integrase [Leptospirillum sp. Group I...  43.1    0.043
ref|YP_002130261.1|  integrase/recombinase, phage integrase [P...  43.1    0.043
ref|ZP_03065828.1|  site-specific recombinase, phage integrase...  43.1    0.043
ref|ZP_03055682.1|  DNA integration/recombination [Bacillus pu...  43.1    0.043
ref|YP_002287248.1|  phage integrase [Oligotropha carboxidovor...  43.1    0.043
ref|ZP_02144711.1|  site-specific recombinase, phage integrase...  43.1    0.043
ref|YP_001357738.1|  site-specific DNA tyrosine recombinase Xe...  43.1    0.043
ref|ZP_04916677.1|  site-specific recombinase, phage integrase...  43.1    0.043
ref|ZP_01885034.1|  integrase [Pedobacter sp. BAL39] >gb|EDM35...  43.1    0.043
ref|ZP_01958461.1|  hypothetical protein BACCAC_00029 [Bactero...  43.1    0.043
ref|ZP_01734466.1|  site-specific recombinase [Flavobacteria b...  43.1    0.043
gb|EAY56621.1|  putative phage integrase [Leptospirillum rubar...  43.1    0.043
gb|ABM65820.1|  IntA [Mesorhizobium sp. R88B]                      43.1    0.043
ref|YP_001531745.1|  phage integrase family protein [Dinoroseo...  43.1    0.043
ref|YP_771377.1|  putative phage integrase/recombinase [Rhizob...  43.1    0.043
ref|YP_001327298.1|  phage integrase family protein [Sinorhizo...  43.1    0.043
ref|YP_356237.1|  site-specific recombinase/integrase [Pelobac...  43.1    0.043
ref|NP_218831.1|  integrase/recombinase (codV) [Treponema pall...  43.1    0.043
ref|YP_129903.1|  hypothetical protein PBPRA1694 [Photobacteri...  43.1    0.043
ref|NP_933070.1|  phage integrase family site specific recombi...  43.1    0.043
ref|NP_867103.1|  putative integrase/recombinase [Rhodopirellu...  43.1    0.043
ref|NP_867792.1|  putative integrase/recombinase Y4QK [Rhodopi...  43.1    0.043
ref|NP_864139.1|  integrase [Rhodopirellula baltica SH 1] >emb...  43.1    0.043
ref|NP_785437.1|  integrase/recombinase [Lactobacillus plantar...  43.1    0.043
ref|NP_520665.1|  site-specific tyrosine recombinase XerD [Ral...  43.1    0.043
sp|Q93C64.1|XERD_LACCA  RecName: Full=Tyrosine recombinase xer...  43.1    0.043
ref|ZP_01048091.1|  probable integrase protein [Nitrobacter sp...  43.1    0.043
ref|ZP_04920611.1|  site-specific recombinase, phage integrase...  43.1    0.043
ref|ZP_06200493.1|  transposase [Bacteroides sp. D20] >gb|EFA2...  42.7    0.057
ref|ZP_05902225.1|  integrase [Leptotrichia hofstadii F0254] >...  42.7    0.057
ref|ZP_05779669.1|  phage integrase family protein [Citreicell...  42.7    0.057
ref|ZP_05759481.1|  integrase [Bacteroides sp. D2]                 42.7    0.057
ref|ZP_05834466.1|  phage integrase [Brucella melitensis bv. 1...  42.7    0.057
ref|ZP_05747004.1|  integrase/recombinase XerD [Erysipelothrix...  42.7    0.057
ref|YP_003169147.1|  integrase family protein [Candidatus Accu...  42.7    0.057
ref|ZP_05375459.1|  integrase family protein [Hyphomicrobium d...  42.7    0.057
ref|YP_002971738.1|  phage-related integrase/recombinase [Bart...  42.7    0.057
ref|ZP_04450311.1|  hypothetical protein GCWU000282_01546 [Cat...  42.7    0.057
ref|ZP_04547681.1|  integrase [Bacteroides sp. D1] >ref|ZP_060...  42.7    0.057
ref|ZP_04576167.1|  phage integrase [Oxalobacter formigenes HO...  42.7    0.057
ref|YP_002837082.1|  DNA binding domain protein, excisionase f...  42.7    0.057
ref|ZP_03850808.1|  tyrosine recombinase [Chryseobacterium gle...  42.7    0.057
ref|ZP_04645361.1|  integrase [Lactobacillus jensenii 269-3] >...  42.7    0.057
ref|ZP_03310932.1|  hypothetical protein DESPIG_00836 [Desulfo...  42.7    0.057
ref|ZP_03310921.1|  hypothetical protein DESPIG_00823 [Desulfo...  42.7    0.057
ref|ZP_03302307.1|  hypothetical protein BACDOR_03705 [Bactero...  42.7    0.057
ref|ZP_04875688.1|  site-specific recombinase, phage integrase...  42.7    0.057
ref|ZP_02901872.1|  prophage integrase [Escherichia albertii T...  42.7    0.057
ref|YP_001727952.1|  site-specific recombinase XerD [Leuconost...  42.7    0.057
ref|YP_001917398.1|  integrase family protein [Natranaerobius ...  42.7    0.057
ref|ZP_02426537.1|  hypothetical protein ALIPUT_02704 [Alistip...  42.7    0.057
ref|YP_002841167.1|  DNA binding domain protein, excisionase f...  42.7    0.057
ref|YP_002839445.1|  DNA binding domain protein, excisionase f...  42.7    0.057
ref|YP_002841248.1|  DNA binding domain protein, excisionase f...  42.7    0.057
ref|YP_002841134.1|  DNA binding domain protein, excisionase f...  42.7    0.057
ref|ZP_02073343.1|  hypothetical protein CLOL250_00082 [Clostr...  42.7    0.057
ref|ZP_06244215.1|  tyrosine recombinase XerD [Victivallis vad...  42.7    0.057
ref|ZP_01985110.1|  site-specific recombinase, phage integrase...  42.7    0.057
ref|YP_001248998.1|  phage-related integrase [Orientia tsutsug...  42.7    0.057
ref|YP_001248335.1|  phage-related integrase [Orientia tsutsug...  42.7    0.057
ref|ZP_01813782.1|  site-specific recombinase, phage integrase...  42.7    0.057
ref|ZP_01707556.1|  phage integrase [Shewanella putrefaciens 2...  42.7    0.057
ref|ZP_01690979.1|  integrase, site-specific recombinase [Micr...  42.7    0.057
ref|ZP_03072447.1|  integrase family protein [Lactobacillus re...  42.7    0.057
gb|AAQ06901.1|AF496235_1  integrase/recombinase [Lactobacillus...  42.7    0.057
emb|CAB57348.1|  integrase [Dichelobacter nodosus]                 42.7    0.057
ref|YP_524281.1|  phage integrase [Rhodoferax ferrireducens T1...  42.7    0.057
ref|YP_461218.1|  phage integrase family protein [Syntrophus a...  42.7    0.057
ref|YP_285542.1|  Phage integrase [Dechloromonas aromatica RCB...  42.7    0.057
ref|NP_539929.1|  integrase/recombinase [Brucella melitensis 1...  42.7    0.057
ref|NP_343365.1|  transposon ISC1913 Orf1 [Sulfolobus solfatar...  42.7    0.057
ref|YP_065776.1|  integrase [Desulfotalea psychrophila LSv54] ...  42.7    0.057
ref|NP_841499.1|  phage integrase domain/SAM domain-containing...  42.7    0.057
ref|ZP_00953222.1|  integrase/recombinase XerD [Oceanicaulis a...  42.7    0.057
ref|YP_001181098.1|  tyrosine recombinase XerD [Caldicellulosi...  42.7    0.057
ref|YP_001343346.1|  phage integrase family protein [Actinobac...  42.7    0.057
ref|YP_753532.1|  hypothetical protein Swol_0842 [Syntrophomon...  42.7    0.057
ref|YP_003428153.1|  integrase family protein [Bacillus pseudo...  42.4    0.074
ref|YP_003338689.1|  tyrosine recombinase XerD [Streptosporang...  42.4    0.074
ref|ZP_06057580.1|  integrase [Acinetobacter calcoaceticus RUH...  42.4    0.074
ref|ZP_05865576.1|  integrase [Lactobacillus jensenii SJ-7A-US...  42.4    0.074
gb|ACX40947.1|  integrase family protein [Escherichia coli DH1]    42.4    0.074
ref|ZP_05616906.1|  integrase/recombinase, phage integrase fam...  42.4    0.074
ref|YP_003051445.1|  integrase family protein [Methylovorus sp...  42.4    0.074
gb|EES53473.1|  putative phage integrase [Leptospirillum ferro...  42.4    0.074
gb|EES53141.1|  putative phage integrase [Leptospirillum ferro...  42.4    0.074
ref|YP_003387255.1|  tyrosine recombinase XerD [Spirosoma ling...  42.4    0.074
ref|ZP_04335582.1|  site-specific recombinase XerD [Nocardiops...  42.4    0.074
ref|YP_002837074.1|  DNA binding domain protein, excisionase f...  42.4    0.074
ref|YP_002836743.1|  DNA binding domain protein, excisionase f...  42.4    0.074
ref|YP_002836737.1|  DNA binding domain protein, excisionase f...  42.4    0.074
ref|ZP_03913636.1|  site-specific recombinase XerD [Leuconosto...  42.4    0.074
ref|ZP_03853649.1|  integrase [Chryseobacterium gleum ATCC 359...  42.4    0.074
ref|ZP_03788023.1|  site-specific recombinase, phage integrase...  42.4    0.074
ref|ZP_05104568.1|  site-specific recombinase, phage integrase...  42.4    0.074
ref|ZP_03636278.1|  hypothetical protein HOLDEFILI_03588 [Hold...  42.4    0.074
ref|YP_002992755.1|  integrase family protein [Desulfovibrio s...  42.4    0.074
ref|ZP_05084016.1|  phage integrase family protein [Pseudovibr...  42.4    0.074
ref|YP_002298867.1|  tyrosine recombinase XerD [Rhodospirillum...  42.4    0.074
ref|ZP_03209919.1|  hypothetical protein BACPLE_03600 [Bactero...  42.4    0.074
ref|ZP_04875392.1|  site-specific recombinase, phage integrase...  42.4    0.074
ref|ZP_05032765.1|  site-specific recombinase, phage integrase...  42.4    0.074
ref|YP_001995804.1|  integrase family protein [Chloroherpeton ...  42.4    0.074
ref|YP_001814355.1|  integrase family protein [Exiguobacterium...  42.4    0.074
ref|ZP_02403360.1|  integrase family protein [Burkholderia pse...  42.4    0.074
ref|YP_001598184.1|  Int2 [Salmonella enterica subsp. enterica...  42.4    0.074
ref|YP_002841440.1|  DNA binding domain protein, excisionase f...  42.4    0.074
ref|ZP_02071398.1|  hypothetical protein BACUNI_02836 [Bactero...  42.4    0.074
ref|YP_001468682.1|  gp43 [Listeria phage B025] >gb|AAY53083.1...  42.4    0.074
ref|YP_001300374.1|  integrase [Bacteroides vulgatus ATCC 8482...  42.4    0.074
ref|YP_002360280.1|  integrase family protein [Shewanella balt...  42.4    0.074
ref|YP_804248.1|  integrase [Pediococcus pentosaceus ATCC 2574...  42.4    0.074
ref|YP_001682770.1|  integrase family protein [Caulobacter sp....  42.4    0.074
ref|NP_720381.2|  phage integrase family site specific recombi...  42.4    0.074
ref|ZP_01385352.1|  Phage integrase:Phage integrase, N-termina...  42.4    0.074
ref|YP_095118.1|  phage related integrase [Legionella pneumoph...  42.4    0.074
ref|YP_209473.1|  integrase/recombinase [Salmonella enterica s...  42.4    0.074
ref|YP_395639.1|  site-specific DNA tyrosine recombinase, XerD...  42.4    0.074
ref|NP_942502.1|  hypothetical protein sll6059 [Synechocystis ...  42.4    0.074
ref|NP_414815.1|  CP4-6 prophage; predicted phage integrase [E...  42.4    0.074
ref|NP_221166.1|  site-specific tyrosine recombinase XerC [Ric...  42.4    0.074
ref|NP_797456.1|  phage family integrase [Vibrio parahaemolyti...  42.4    0.074
ref|ZP_01058849.1|  putative site-specific recombinase [Leeuwe...  42.4    0.074
ref|YP_001051903.1|  phage integrase family protein [Shewanell...  42.4    0.074
ref|YP_615898.1|  phage integrase [Sphingopyxis alaskensis RB2...  42.4    0.074
ref|YP_001052063.1|  phage integrase family protein [Shewanell...  42.4    0.074
ref|ZP_01312082.1|  phage integrase [Desulfuromonas acetoxidan...  42.4    0.074
ref|YP_818649.1|  tyrosine recombinase XerC subunit [Leuconost...  42.4    0.074
ref|YP_003413438.1|  hypothetical protein LM5578_1326 [Listeri...  42.0    0.097
emb|CBA74104.1|  phage integrase [Arsenophonus nasoniae]           42.0    0.097
dbj|BAI54705.1|  phage integrase [Escherichia coli SE15]           42.0    0.097
ref|ZP_06069334.1|  predicted protein [Acinetobacter lwoffii S...  42.0    0.097
ref|ZP_05861093.1|  xylulose-5-phosphate/fructose-6-phosphate ...  42.0    0.097
ref|ZP_05727554.1|  integrase family protein [Pantoea sp. At-9...  42.0    0.097
ref|ZP_05623450.1|  tyrosine recombinase XerD [Treponema vince...  42.0    0.097
ref|ZP_05309588.1|  integrase family protein [Geobacter sp. M1...  42.0    0.097
ref|YP_003034141.1|  putative integrase/recombinase [Clostridi...  42.0    0.097
ref|ZP_04855480.1|  conserved hypothetical protein [Ruminococc...  42.0    0.097
ref|ZP_04783309.1|  integrase/recombinase [Weissella paramesen...  42.0    0.097
ref|ZP_04699824.1|  integrase [Rickettsia endosymbiont of Ixod...  42.0    0.097
ref|ZP_04699157.1|  integrase [Rickettsia endosymbiont of Ixod...  42.0    0.097
ref|ZP_04543915.1|  mobilizable transposon [Bacteroides sp. D1...  42.0    0.097
ref|ZP_04541335.1|  tyrosine type site-specific recombinase [B...  42.0    0.097
ref|ZP_04566878.1|  LOW QUALITY PROTEIN: conserved hypothetica...  42.0    0.097
ref|ZP_04161916.1|  Integrase/recombinase [Bacillus mycoides R...  42.0    0.097
ref|ZP_04049268.1|  site-specific recombinase XerD [Brachyspir...  42.0    0.097
ref|ZP_03957095.1|  site-specific recombinase XerD [Lactobacil...  42.0    0.097
ref|ZP_03965162.1|  site-specific recombinase XerD [Lactobacil...  42.0    0.097
ref|ZP_03728936.1|  integrase family protein [Dethiobacter alk...  42.0    0.097
ref|ZP_03683812.1|  hypothetical protein CATMIT_02473 [Catenib...  42.0    0.097
ref|ZP_04674542.1|  tyrosine recombinase XerC subunit [Lactoba...  42.0    0.097
ref|ZP_05125198.1|  phage integrase family protein [Rhodobacte...  42.0    0.097
ref|ZP_05124619.1|  phage integrase family protein [Rhodobacte...  42.0    0.097
ref|YP_002479028.1|  hypothetical protein Ddes_0438 [Desulfovi...  42.0    0.097
ref|ZP_03517463.1|  phage integrase family protein [Rhizobium ...  42.0    0.097
ref|YP_002425983.1|  site-specific recombinase, phage integras...  42.0    0.097
ref|YP_002383909.1|  Integrase [Escherichia fergusonii ATCC 35...  42.0    0.097
ref|ZP_03458457.1|  hypothetical protein BACEGG_01230 [Bactero...  42.0    0.097
ref|ZP_03312194.1|  hypothetical protein DESPIG_02121 [Desulfo...  42.0    0.097
gb|EAY56334.1|  putative phage integrase [Leptospirillum rubarum]  40.0    0.37 
gb|EAY56157.1|  putative phage integrase [Leptospirillum rubar...  39.7    0.48 

ALIGNMENTS
>ref|ZP_01004335.1| possible phage-related integrase [Loktanella vestfoldensis SKA53]
 gb|EAQ05556.1| possible phage-related integrase [Loktanella vestfoldensis SKA53]
Length=386

 Score =  106 bits (265),  Expect = 3e-21
 Identities = 67/168 (39%), Positives = 90/168 (53%), Gaps = 6/168 (3%)
 Frame = -3

Query  926  QMGGPQGRLIEFLLLSGQRLNEVARLTWDEVKEDRLE--IPGLRNKSGETLITPLLPSLP  753
            QMG P GR+ + L+L+ QR +EVA + W E+  DR    I   R K+G+  I  L P   
Sbjct  214  QMGFPFGRITQLLILTAQRRDEVAGMRWSELDLDRARWIISKERAKNGKAHIVHLSPQAL  273

Query  752  QILEKYPQQEGSYLFTTGDGTRPISGFSQIKAILSKLSGVTDWNFHDFRRSFATLLSDE-  576
             +L   P+Q G  L  T  G   +SGFS+ KA L   S V+DW FHD RRS AT +++E 
Sbjct  274  ALLSTIPRQNGVDLIFTTTGRSAVSGFSKAKAALDARSHVSDWRFHDLRRSAATFMAEEL  333

Query  575  GIDRFSVKCALNHKDSS---VTGIYDRPYHIKRKSLALVQWHYVVENI  441
             I    V   LNH   +   VT +Y R  H+  +  AL  W  +VEN+
Sbjct  334  RITPVVVDRILNHVSGTVRGVTAVYLRGEHLADREAALAAWGQLVENL  381


>ref|ZP_05065481.1| putative phage-related integrase [Octadecabacter antarcticus 
238]
 gb|EDY90720.1| putative phage-related integrase [Octadecabacter antarcticus 
238]
Length=385

 Score =  103 bits (258),  Expect = 2e-20
 Identities = 61/168 (36%), Positives = 89/168 (52%), Gaps = 6/168 (3%)
 Frame = -3

Query  926  QMGGPQGRLIEFLLLSGQRLNEVARLTWDEVK--EDRLEIPGLRNKSGETLITPLLPSLP  753
            QMG P G + + LLL+G RL EV++ +W EV   +  L +P  R K+G      L     
Sbjct  214  QMGYPWGPIFQLLLLTGARLREVSQASWGEVSIADGTLNLPARRTKNGRAHQIQLSDQAI  273

Query  752  QILEKYPQQEGSYLFTTGDGTRPISGFSQIKAILSKLSGVTDWNFHDFRRSFATLLSDE-  576
             I++  P+ EG  L  T +GT  +SGFS++K  L  +SGV DW FHD RRSFAT  ++  
Sbjct  274  NIIQALPKVEGQDLIFTTNGTTAVSGFSKVKKRLDIISGVADWRFHDLRRSFATHSTERL  333

Query  575  GIDRFSVKCALNHKDSSVTG---IYDRPYHIKRKSLALVQWHYVVENI  441
            GI        LNH    V G   IY    +++ +  +L +W   ++ +
Sbjct  334  GISPVVADKILNHVTGQVRGVAAIYQHGEYLEERRASLQKWGNFIQGL  381


>ref|YP_001240859.1| putative phage-like integrase [Bradyrhizobium sp. BTAi1]
 gb|ABQ36953.1| putative phage-like integrase [Bradyrhizobium sp. BTAi1]
Length=434

 Score =  102 bits (255),  Expect = 5e-20
 Identities = 59/158 (37%), Positives = 92/158 (58%), Gaps = 5/158 (3%)
 Frame = -3

Query  923  MGGPQGRLIEFLLLSGQRLNEVARLTWDEVKEDRLEIPGLRNKSGETLITPLLPSLPQIL  744
            +G P G +++ LLL+GQRLNE+ARL   E+ ++ + +PG R K+      PL     ++L
Sbjct  269  LGSPFGPMLKLLLLTGQRLNEIARLHDTELTDEAIRLPGSRTKNALPHDVPLSSLAKEVL  328

Query  743  EKYPQQEGS-YLFTTGDGTRPISGFSQIKAILSKLSGVTDWNFHDFRRSFATLLSDEGID  567
             +  +   S Y+F+T +G  P+SGFS+ K+ +  L  +  W FHD RRS AT +++ GI 
Sbjct  329  AEVQRVPNSKYVFST-NGRAPVSGFSKAKSRIDDLLNIEPWVFHDLRRSAATGMAEIGIQ  387

Query  566  RFSVKCALNH---KDSSVTGIYDRPYHIKRKSLALVQW  462
               ++  LNH     +SV GIY+R  +   K  AL +W
Sbjct  388  PHVIEAILNHISGHKASVAGIYNRAAYANEKREALEKW  425


>ref|ZP_01901151.1| site-specific recombinase, phage integrase family protein [Roseobacter 
sp. AzwK-3b]
 gb|EDM72849.1| site-specific recombinase, phage integrase family protein [Roseobacter 
sp. AzwK-3b]
Length=320

 Score =  101 bits (251),  Expect = 1e-19
 Identities = 60/167 (35%), Positives = 92/167 (55%), Gaps = 6/167 (3%)
 Frame = -3

Query  923  MGGPQGRLIEFLLLSGQRLNEVARLTWDEVKEDR--LEIPGLRNKSGETLITPLLPSLPQ  750
            +G P G +++ L+L+ QR +EVA +TW E+  DR    I   R K+G+T    L P+   
Sbjct  149  IGYPFGPIVKLLILTAQRRDEVAGMTWSELDLDRGTWTIGAERAKNGQTHTVHLSPAAQA  208

Query  749  ILEKYPQQEGSYLFTTGDGTRPISGFSQIKAILSKLSGVTDWNFHDFRRSFATLLSDE-G  573
            ILE+ PQ+  S    T  GT  +SGFS+ KA L +LS V +W  HD RR+ AT++++   
Sbjct  209  ILEQIPQRSDSDFVFTTTGTSAVSGFSKAKARLDQLSAVNEWRLHDLRRTAATMMAERLE  268

Query  572  IDRFSVKCALNHKDSSVTG---IYDRPYHIKRKSLALVQWHYVVENI  441
            +    V   LNH+  ++ G   +Y R   +K +  AL +W   V  +
Sbjct  269  VGHAVVDKVLNHRSGAIRGVAAVYLRGQFLKERQSALFRWGTFVHEL  315


>ref|YP_510842.1| phage integrase [Jannaschia sp. CCS1]
 gb|ABD55817.1| phage integrase [Jannaschia sp. CCS1]
Length=391

 Score = 92.8 bits (229),  Expect = 5e-17
 Identities = 55/158 (34%), Positives = 80/158 (50%), Gaps = 3/158 (1%)
 Frame = -3

Query  926  QMGGPQGRLIEFLLLSGQRLNEVARLT--WDEVKEDRLEIPGLRNKSGETLITPLLPSLP  753
            +MG P G ++  L+L+ QR  EVA L   W        E+P    K+    + PL     
Sbjct  229  KMGYPFGPMVRLLILTAQRRAEVANLERGWLLPDHQAFEVPASHYKTDRPQVVPLSAPAL  288

Query  752  QILEKYPQ-QEGSYLFTTGDGTRPISGFSQIKAILSKLSGVTDWNFHDFRRSFATLLSDE  576
             ++E  P+   G ++ +T  G RP+SGFS+ KA L KLS V  W  HD RRS AT ++  
Sbjct  289  ALVEGLPKWNSGDFMLSTTAGKRPVSGFSKAKARLDKLSEVEGWTLHDLRRSAATHMARL  348

Query  575  GIDRFSVKCALNHKDSSVTGIYDRPYHIKRKSLALVQW  462
            G+ +  ++  L H    V G Y+R  ++  K  AL  W
Sbjct  349  GVAQEHIERVLGHAIEGVAGTYNRYSYLPEKRAALDAW  386


>ref|ZP_01056028.1| site-specific recombinase, phage integrase family protein [Roseobacter 
sp. MED193]
 gb|EAQ45984.1| site-specific recombinase, phage integrase family protein [Roseobacter 
sp. MED193]
Length=367

 Score = 92.4 bits (228),  Expect = 6e-17
 Identities = 56/151 (37%), Positives = 84/151 (55%), Gaps = 7/151 (4%)
 Frame = -3

Query  908  GRLIEFLLLSGQRLNEVARLTWDEVKEDRLEIPG-----LRNKSGETLITPLLPSLPQIL  744
            G    FL+LS QR + VA + WDE++ +   IP       + +S +    PL P+L +IL
Sbjct  213  GAYFRFLMLSAQRKDNVASMKWDEIQGNLWTIPAEKFKATKKESAKAHEVPLTPALMEIL  272

Query  743  EKYPQQEGSYLFTTGDGTRPISGFSQIKAILSKLSGVTDWNFHDFRRSFATLLSDEGIDR  564
            E  P++ G ++F    G + +   S+ K  L+K +GV DW  HD RR+ AT +++  I R
Sbjct  273  ENQPKR-GPFVFGP-TGLKQLRLGSREKDRLAKKAGVDDWRLHDLRRTAATRMTENKIPR  330

Query  563  FSVKCALNHKDSSVTGIYDRPYHIKRKSLAL  471
            F V+  L H D SVT +YDR  + + K  AL
Sbjct  331  FIVERVLGHADRSVTAVYDRANYREEKRQAL  361


>ref|ZP_05113718.1| site-specific recombinase, phage integrase family protein [Labrenzia 
alexandrii DFL-11]
 gb|EEE44317.1| site-specific recombinase, phage integrase family protein [Labrenzia 
alexandrii DFL-11]
Length=397

 Score = 90.1 bits (222),  Expect = 3e-16
 Identities = 56/166 (33%), Positives = 84/166 (50%), Gaps = 12/166 (7%)
 Frame = -3

Query  926  QMGGPQGRLIEFLLLSGQRLNEVARLTWDEVKEDRLE--IPGLRNKSGETLITPLLPSLP  753
            +MG P G  ++ L L+ QR  EV+ + W E+  D     IP  R K+G+  +  L  +  
Sbjct  223  KMGFPFGYYVKLLFLTAQRRGEVSGMRWSEINLDSATWTIPAERAKNGKAHVVHLSQASL  282

Query  752  QILEKYPQ------QEGSYLFTTGDGTRPISGFSQIKAILSKLSGVTDWNFHDFRRSFAT  591
             +L+  P+       E   +FTT +G   ISGFS+ K  L +LSGVTDW  HD RR+  T
Sbjct  283  DVLQSIPKFANANGTESDLVFTT-NGKTSISGFSKAKKQLDELSGVTDWRIHDIRRTVVT  341

Query  590  LLSDEGIDRFSVKCALNHKDSSVTG---IYDRPYHIKRKSLALVQW  462
             ++  G+        LNHK  +++G   +Y R   +  +  AL  W
Sbjct  342  QMAAMGVWHHVADAILNHKTGAISGVAAVYQRHEFLDDRKRALDDW  387


>ref|YP_002362394.1| integrase family protein [Methylocella silvestris BL2]
 gb|ACK51032.1| integrase family protein [Methylocella silvestris BL2]
Length=400

 Score = 88.2 bits (217),  Expect = 1e-15
 Identities = 57/171 (33%), Positives = 92/171 (53%), Gaps = 9/171 (5%)
 Frame = -3

Query  920  GGPQGRLIEFLLLSGQRLNEVARLTWDEV--KEDRLEIPGLRNKSGETLITPLLPSLPQI  747
            G P G +I+ L+LSGQR +EV+ +TW E+  +E    +P +R K+G+  I PL P++  +
Sbjct  226  GWPYGSMIKVLILSGQRRSEVSDMTWSEIDFEERSWTLPAVRTKNGKGHIIPLSPTIIDV  285

Query  746  LEKYPQ--QEGSYLFTTGDGTRPISGFS-QIKAILSKLSGVTDWNFHDFRRSFATLLSDE  576
            L   P+   E  ++FTT +G  PI  F+ + KA++       +W  HD RR+FAT ++  
Sbjct  286  LLTLPRIGSESGFVFTT-NGFSPIRNFARRKKALMMSCQSENNWTLHDLRRTFATGMARL  344

Query  575  GIDRFSVKCALNHKDSS---VTGIYDRPYHIKRKSLALVQWHYVVENIEHK  432
             ++   V+  LNH   +   V G+Y +      K  A+  W   V  I +K
Sbjct  345  KVELPVVEKLLNHSSGTFGGVQGVYQQYDFQSEKREAMNLWASYVNKITNK  395


>ref|YP_001166328.1| phage integrase family protein [Rhodobacter sphaeroides ATCC 
17025]
 gb|ABP69023.1| phage integrase family protein [Rhodobacter sphaeroides ATCC 
17025]
Length=413

 Score = 86.3 bits (212),  Expect = 4e-15
 Identities = 58/173 (33%), Positives = 86/173 (49%), Gaps = 20/173 (11%)
 Frame = -3

Query  926  QMGGPQGRLIEFLLLSGQRLNEVARLTWDEVKEDRLEIPGLRNKSGETLITPLLPSLPQI  747
            +MG P G +   LLL+GQRL EVA L W E+      +PG R+K+G+  + PL P   +I
Sbjct  219  KMGYPFGDIYRLLLLTGQRLREVAELPWREIDGATWTLPGPRSKNGDEHVIPLSPEAREI  278

Query  746  LEKYPQQEGSYLFTTGDGTRPISGFSQIKAILSKLSG---------------VTDWNFHD  612
            +E  P + G ++F+T  G  P+SGF++ K  L  L                 V  +  HD
Sbjct  279  IEAAP-KVGRFVFST-TGLTPVSGFTRAKERLDGLMADAANEDLPAGAEPVTVPPFTIHD  336

Query  611  FRRSFATLLSDEGIDRFSVKCALNHKDSS---VTGIYDRPYHIKRKSLALVQW  462
             RR+ AT ++        V+  LNH+  +   V G+Y+R  +   K  AL  W
Sbjct  337  LRRTAATGMAGLRFPPHVVEAVLNHRSGTRRGVAGVYNRFDYADEKRQALETW  389


>ref|YP_164918.1| phage integrase family site specific recombinase [Ruegeria pomeroyi 
DSS-3]
 gb|AAV97225.1| site-specific recombinase, phage integrase family [Ruegeria pomeroyi 
DSS-3]
Length=400

 Score = 85.9 bits (211),  Expect = 6e-15
 Identities = 59/162 (36%), Positives = 87/162 (53%), Gaps = 9/162 (5%)
 Frame = -3

Query  920  GGPQGRLIEFLLLSGQRLNEVARLTWDEVK-EDRL-EIPGLRNKSGETLITPLLPSLPQI  747
            G P G  ++ L+LSGQR  EVA + W E+  E RL  +P  R K+G     P+  ++  +
Sbjct  216  GYPFGDCMKLLILSGQRRAEVAEMRWTELDLEKRLWTLPSQRAKNGRQHTVPITDAMIDV  275

Query  746  LEKYPQQEGS-YLFTTGDGTRPISGFSQIKAILSKL--SGVTDWNFHDFRRSFATLLSDE  576
            L + P+  GS Y+FTT  G  P+SGF ++K  L K    G   W  HD RR+ +T ++  
Sbjct  276  LRRVPRFLGSDYVFTT-TGKSPVSGFGRLKDRLDKALPEGTEPWIIHDLRRTMSTNMAML  334

Query  575  GIDRFSVKCALNHKDSSVTG---IYDRPYHIKRKSLALVQWH  459
            G+ +   +  LNHK   V+G   IY+   +   K  AL QW+
Sbjct  335  GVPQPVTEALLNHKTGVVSGVAAIYNVYSYTDEKCEALEQWN  376


>ref|YP_001234301.1| phage integrase family protein [Acidiphilium cryptum JF-5]
 gb|ABQ30382.1| phage integrase family protein [Acidiphilium cryptum JF-5]
Length=412

 Score = 84.7 bits (208),  Expect = 1e-14
 Identities = 57/163 (34%), Positives = 79/163 (48%), Gaps = 13/163 (7%)
 Frame = -3

Query  914  PQGRLIEFLLLSGQRLNEVARLTWDEVKEDRL--EIPGLRNKSGETLITPLLPSLPQILE  741
            P G+    L+L+  R +EVA + W E+  D L   +P  R K+G++ +  L      IL 
Sbjct  229  PAGQFTRMLMLTLGRRDEVASMRWTEIAADGLTWSLPADRAKNGKSHVVHLSEPARGILS  288

Query  740  KYPQQEGS-YLFTTGDGTRPISGFSQIKAILSKL------SGVTDWNFHDFRRSFATLLS  582
              P+ E S +LFTT  G RPISGFS  K  + +        G+ DW FHDFRR+  T L+
Sbjct  289  ALPRFENSDFLFTT-TGERPISGFSGFKLAIDRAIEADLGRGIADWRFHDFRRAGVTWLA  347

Query  581  DEGIDRFSVKCALNHKDSSVTG---IYDRPYHIKRKSLALVQW  462
              G         LNH   S+ G   +Y R   +  +  AL  W
Sbjct  348  GAGFPPHVADKLLNHMSGSIQGVAAVYQRAEFLPERERALDAW  390


>ref|ZP_01011628.1| site-specific recombinase, phage integrase family protein [Rhodobacterales 
bacterium HTCC2654]
 gb|EAQ14935.1| site-specific recombinase, phage integrase family protein [Rhodobacterales 
bacterium HTCC2654]
Length=392

 Score = 83.6 bits (205),  Expect = 3e-14
 Identities = 56/166 (33%), Positives = 83/166 (50%), Gaps = 9/166 (5%)
 Frame = -3

Query  914  PQGRLIEFLLLSGQRLNEVARLTWDEVKEDR--LEIPGLRNKSGETLITPLLPSLPQILE  741
            P G  ++ LL+SGQR +EVA + W E+  D    E+P  R K+    I PL      IL 
Sbjct  225  PFGPFLKLLLISGQRRSEVAGMRWSELNLDEGIWELPANRVKNARLHIVPLPVQAVDILR  284

Query  740  KYPQ-QEGSYLFTTGDGTRPISGFSQIKAILSKL--SGVTDWNFHDFRRSFATLLSDEGI  570
               +  +  ++FTT  G   ISGF ++K  +      G  DW FHDFRR+ +T ++  G+
Sbjct  285  GLHRFLDSDFVFTT-TGRSAISGFGRLKERVDTALPEGTPDWRFHDFRRTASTGMAKLGV  343

Query  569  DRFSVKCALNHKDSSVTGI---YDRPYHIKRKSLALVQWHYVVENI  441
                +    NHK   V+G+   Y+R  +   K  AL QW   ++ I
Sbjct  344  MPHVIDAVTNHKSGVVSGVGATYNRYTYFNEKREALAQWAAHIDEI  389


>ref|YP_002526687.1| phage-related integrase [Rhodobacter sphaeroides KD131]
 gb|ACM02186.1| phage-related integrase [Rhodobacter sphaeroides KD131]
Length=432

 Score = 82.8 bits (203),  Expect = 5e-14
 Identities = 62/176 (35%), Positives = 88/176 (50%), Gaps = 11/176 (6%)
 Frame = -3

Query  926  QMGGPQGRLIEFLLLSGQRLNEVARLTWDEVKEDR--LEIPGLRNKSGETLITPLLPS-L  756
            QMG   G L+  L+L+ QR +EVA L W EV  D   + + G R K+ +   T L P  L
Sbjct  224  QMGSLWGPLVRMLVLTLQRRSEVAGLKWSEVDFDGECMTVAGGRTKNRKMHKTHLAPPVL  283

Query  755  PQILEKYPQQEGSYLFTTGDGTRPISGFSQIKAILSKL--SGVTDWNFHDFRRSFATLLS  582
              + E         +FTT  GT P+SGFS++K  L  L    +  W FHD R +FAT ++
Sbjct  284  ADLRELRAASSVEQVFTT-TGTTPVSGFSKVKERLDVLLPEDMEPWTFHDLRTAFATQMA  342

Query  581  DEG-----IDRFSVKCALNHKDSSVTGIYDRPYHIKRKSLALVQWHYVVENIEHKS  429
            ++G     IDR     A     SSV  +Y+R  H+ ++   L +W  +V   E  S
Sbjct  343  EDGESEAVIDRILNHVASGSAPSSVARVYNRSEHLGQRRRILNRWAALVTRDEAAS  398


>ref|ZP_01102601.1| phage integrase [Congregibacter litoralis KT71]
 gb|EAQ97691.1| phage integrase [Congregibacter litoralis KT71]
Length=410

 Score = 81.6 bits (200),  Expect = 1e-13
 Identities = 50/164 (30%), Positives = 84/164 (51%), Gaps = 13/164 (7%)
 Frame = -3

Query  917  GPQGRLIEFLLLSGQRLNEVARLTWDEVKED--RLEIPGLRNKSGETLITPLLPSLPQIL  744
            G    ++  ++L+GQR  EVA + W E+  D  R +IPG R K+    + PL  ++  IL
Sbjct  234  GIYANIVRIMMLTGQRRQEVAGMCWSEINLDKRRWDIPGQRTKNHRPHVVPLSSAVISIL  293

Query  743  EKYPQQEGS------YLFTTGDGTRPISGFSQIKAILSKLSGVTDWNFHDFRRSFATLLS  582
              +   + S       +FTT +G    +G+S+ K  L +     DW   D RRSFAT  +
Sbjct  294  HYHRSLQASTNMQTDLVFTT-NGKAVFAGWSKSKERLDRRVASADWQLRDLRRSFATHAN  352

Query  581  DEGIDRFSVKCALNHKDSS----VTGIYDRPYHIKRKSLALVQW  462
            + G +   ++ ALNH   S    + G+Y+R  +I+++   + +W
Sbjct  353  ELGYEPHVIESALNHVSGSAKRGIAGVYNRATYIRQRIRLIQRW  396