GOS 1509010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091143176892
Annotathon code: GOS_1509010
Sample :
  • GPS :5°33'10n; 87°5'16w
  • Eastern Tropical Pacific: Dirty Rock, Cocos Island - Costa Rica
  • Fringing Reef (-1.1m, 28.3°C, 0.8-3.0 microns)
Authors
Team : Algarve
Username : BioinfCMJ1
Annotated on : 2010-07-06 17:10:15
  • a27917 CatarinaPereiraNobre
  • a27931 MónicaSofiaAfonsoBaptistaDeFaria
  • a29849 JoanaRitaLourençoSousa

Synopsis

Genomic Sequence

>JCVI_READ_1091143176892 GOS_1509010 Genomic DNA
TGAGCCAGATTCTACACCCTTGGCGGAGATCGCATCGGAAGCAATGCGCAATGCACCATATATTAGGCATGACTCGGCCTTACATACGCTACCAATAGTA
ACGAAGAAAGAAATTGGAAAACTATTAAAAGACAAAGAATGTTTGGACTTGGATCCAGTAGATCTTCTACCATTTTTTGTAAAACTATTTCGTGTGAATC
GGAACAAGGCATTACATTATATTAGGGACGAGGAAGAGGCAAGTCTTAGTGCACAGGATATTGGTGGTTTGTTGCAACTTTTAACTCAATACTCGGAAGC
CTCTATTGCTAAATTGGTAAAATTTTTGGATGTAAATTGTGATGAACAGATCAGTCTAGACGAATCACTTCATTTTTTCCTGGAAGATTCAAGGCTAAAA
CTTAGAACAGAAATCAATCGTACTTTCCACATGAAATTAATGATGTCAAAAAAAGTTGGTAAGTCAGTTTATTCCAGAGCGTTTTCCATCAAACCATTAA
GCAAAAATTCAACCATACCTTTTGGGATTGCTACGGCGAGCAATGACGGGGTTGTTCGTCTGTGGAGCAGTGGACTGTTACTAAAGTTTAGGCTGCTGGT
TACTAGGTCTAAAGACTTGTTTGGGTATCAATACGAATCTAGTGGTGCAAAACTAAAGAGAGTTCTGCCAACTGATGTCGCAGAAATAAAATTAGATGTT
AATGGTATGAAATCATCAATTGTTATTGGTTACACAGATCGTAAAATTAGAATATTTCATCTTCCTAATTCTTTTGGAGTTGCAGCCACAGTGACCCCAA
GCAAAAAACTGGCAGTAAGAGGAATACCTATGGTGATTGATAGTCATGAGGACTTACTATTTATTGGAGACAATGATGGCTTCATTGAAGTATATAATAC
CAAAAATTGTCTGGAAAAATTGCATACCGTTCAAGCGCACATACATACTCCCGTTAGACAATTAAAGTTTGTGCCGTTCCTGAATGCAATAGTGTCTCAG
ATTAGACGGAGTTTAATTATAA

Translation

[2 - 1021/1022]   direct strand
>GOS_1509010 Translation [2-1021   direct strand]
EPDSTPLAEIASEAMRNAPYIRHDSALHTLPIVTKKEIGKLLKDKECLDLDPVDLLPFFVKLFRVNRNKALHYIRDEEEASLSAQDIGGLLQLLTQYSEA
SIAKLVKFLDVNCDEQISLDESLHFFLEDSRLKLRTEINRTFHMKLMMSKKVGKSVYSRAFSIKPLSKNSTIPFGIATASNDGVVRLWSSGLLLKFRLLV
TRSKDLFGYQYESSGAKLKRVLPTDVAEIKLDVNGMKSSIVIGYTDRKIRIFHLPNSFGVAATVTPSKKLAVRGIPMVIDSHEDLLFIGDNDGFIEVYNT
KNCLEKLHTVQAHIHTPVRQLKFVPFLNAIVSQIRRSLII

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

It was not found any reliable homology with any known protein domain, so we can't correlate the sequence to any known organism or family of organisms neither deduce anything about the protein molecular function or biological process.

ORF finding

PROTOCOL


a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code



RESULTS ANALYSIS


In the forward strand, there are 3 frames. No ORFs were found in reading frame 1 and 3. In the reading frame 2 an ORF were found on the direct strand extends from base 2 to base 1021, this ORF starts with a GAG Glutamic acid (E) and it ends with ATA Isoleucine (I).

In the reverse strand, there are 3 frames. No ORFs were found in reading frame 1 and 2. In the reading frame 3 an ORF were found on the direct strand extends from base 807 to base 1022, this ORF starts with TGT Cysteine (C) and it ends with TCA Serine (S).

The ORF selected for further studies was the one in reading frame 2 on the forward strand.

RAW RESULTS

a) forward strand

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 2 to base 1021.
GAGCCAGATTCTACACCCTTGGCGGAGATCGCATCGGAAGCAATGCGCAATGCACCATAT
ATTAGGCATGACTCGGCCTTACATACGCTACCAATAGTAACGAAGAAAGAAATTGGAAAA
CTATTAAAAGACAAAGAATGTTTGGACTTGGATCCAGTAGATCTTCTACCATTTTTTGTA
AAACTATTTCGTGTGAATCGGAACAAGGCATTACATTATATTAGGGACGAGGAAGAGGCA
AGTCTTAGTGCACAGGATATTGGTGGTTTGTTGCAACTTTTAACTCAATACTCGGAAGCC
TCTATTGCTAAATTGGTAAAATTTTTGGATGTAAATTGTGATGAACAGATCAGTCTAGAC
GAATCACTTCATTTTTTCCTGGAAGATTCAAGGCTAAAACTTAGAACAGAAATCAATCGT
ACTTTCCACATGAAATTAATGATGTCAAAAAAAGTTGGTAAGTCAGTTTATTCCAGAGCG
TTTTCCATCAAACCATTAAGCAAAAATTCAACCATACCTTTTGGGATTGCTACGGCGAGC
AATGACGGGGTTGTTCGTCTGTGGAGCAGTGGACTGTTACTAAAGTTTAGGCTGCTGGTT
ACTAGGTCTAAAGACTTGTTTGGGTATCAATACGAATCTAGTGGTGCAAAACTAAAGAGA
GTTCTGCCAACTGATGTCGCAGAAATAAAATTAGATGTTAATGGTATGAAATCATCAATT
GTTATTGGTTACACAGATCGTAAAATTAGAATATTTCATCTTCCTAATTCTTTTGGAGTT
GCAGCCACAGTGACCCCAAGCAAAAAACTGGCAGTAAGAGGAATACCTATGGTGATTGAT
AGTCATGAGGACTTACTATTTATTGGAGACAATGATGGCTTCATTGAAGTATATAATACC
AAAAATTGTCTGGAAAAATTGCATACCGTTCAAGCGCACATACATACTCCCGTTAGACAA
TTAAAGTTTGTGCCGTTCCTGAATGCAATAGTGTCTCAGATTAGACGGAGTTTAATTATA


>Translation of ORF number 1 in reading frame 2 on the direct strand.
EPDSTPLAEIASEAMRNAPYIRHDSALHTLPIVTKKEIGKLLKDKECLDLDPVDLLPFFV
KLFRVNRNKALHYIRDEEEASLSAQDIGGLLQLLTQYSEASIAKLVKFLDVNCDEQISLD
ESLHFFLEDSRLKLRTEINRTFHMKLMMSKKVGKSVYSRAFSIKPLSKNSTIPFGIATAS
NDGVVRLWSSGLLLKFRLLVTRSKDLFGYQYESSGAKLKRVLPTDVAEIKLDVNGMKSSI
VIGYTDRKIRIFHLPNSFGVAATVTPSKKLAVRGIPMVIDSHEDLLFIGDNDGFIEVYNT
KNCLEKLHTVQAHIHTPVRQLKFVPFLNAIVSQIRRSLII

No ORFs were found in reading frame 3.


b) reverse strand

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 807 to base 1022.
TGTAATGCCTTGTTCCGATTCACACGAAATAGTTTTACAAAAAATGGTAGAAGATCTACT
GGATCCAAGTCCAAACATTCTTTGTCTTTTAATAGTTTTCCAATTTCTTTCTTCGTTACT
ATTGGTAGCGTATGTAAGGCCGAGTCATGCCTAATATATGGTGCATTGCGCATTGCTTCC
GATGCGATCTCCGCCAAGGGTGTAGAATCTGGCTCA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
CNALFRFTRNSFTKNGRRSTGSKSKHSLSFNSFPISFFVTIGSVCKAESCLIYGALRIAS
DAISAKGVESGS

Multiple Alignement

PROTOCOL



RESULTS ANALYSIS


We can't make the multiple alignement because the E-value is very high (0,008), which will give us inconclusive results.


RAW RESULTS

Protein Domains

PROTOCOL



InterProScan, default parameters at EBI




RESULTS ANALYSIS


The InterPro Scan analysis gaves only one result for the translation of ORF number 1, WD40 repeat-like-containing domain and the superfamily is WD40 repeat-like.

WD40 are known to serve as mediator or plattaform for assembly for protein-protein interaction.

RAW RESULTS

Sequence_1	8E90BE6F38F8DB2B	340	superfamily	SSF50978	WD40 repeat-like	176	332	2.7e-07	T	15-Mar-2010	IPR011046	WD40 repeat-like-containing domain	

Phylogeny

PROTOCOL



RESULTS ANALYSIS



We can't make the taxonomy report or the multiple alignement because the E-value is very high (0,008), which makes the results inconclusive. So we don't have any results to build the phylogenetic tree.

RAW RESULTS

Taxonomy report

PROTOCOL

BLASTp versus NR, NCBI default parameters apart from "Number of descriptions_1000"



RESULTS ANALYSIS


We can say that is a Fungus, but we can't make the taxonomy report because the E-value is very high (0,008) which make the results inconclusive.


RAW RESULTS

Lineage Report

root
. cellular organisms
. . Eukaryota           [eukaryotes]
. . . Fungi/Metazoa group [eukaryotes]
. . . . Fungi               [fungi]
. . . . . Dikarya             [fungi]
. . . . . . Ascomycota          [ascomycetes]
. . . . . . . Saccharomyceta      [ascomycetes]
. . . . . . . . Leotiomyceta        [ascomycetes]
. . . . . . . . . Eurotiomycetidae    [ascomycetes]
. . . . . . . . . . Uncinocarpus reesii 1704 ----------------   45  2 hits [ascomycetes]           chromatin assembly factor 1 subunit C [Uncinocarpus reesii 
. . . . . . . . . . Aspergillus terreus NIH2624 .............   37  2 hits [ascomycetes]           conserved hypothetical protein [Aspergillus terreus NIH2624
. . . . . . . . . . Neosartorya fischeri NRRL 181 ...........   36  2 hits [ascomycetes]           F-box and WD40 domain protein, putative [Neosartorya fische
. . . . . . . . . Podospora anserina DSM 980 ----------------   36  1 hit  [ascomycetes]           unnamed protein product [Podospora anserina] >gi|170937597|
. . . . . . . . . Podospora anserina ........................   36  1 hit  [ascomycetes]           unnamed protein product [Podospora anserina] >gi|170937597|
. . . . . . . . Vanderwaltozyma polyspora DSM 70294 ---------   36  2 hits [ascomycetes]           hypothetical protein Kpol_1048p59 [Vanderwaltozyma polyspor
. . . . . . . . Zygosaccharomyces rouxii CBS 732 ............   35  1 hit  [ascomycetes]           ZYRO0F07282p [Zygosaccharomyces rouxii] >gi|238940405|emb|C
. . . . . . . . Zygosaccharomyces rouxii ....................   35  1 hit  [ascomycetes]           ZYRO0F07282p [Zygosaccharomyces rouxii] >gi|238940405|emb|C
. . . . . . . Schizosaccharomyces pombe ---------------------   38  6 hits [ascomycetes]           WD repeat protein Swd3 [Schizosaccharomyces pombe] >gi|7467
. . . . . . Cryptococcus neoformans var. neoformans B-3501A -   36  2 hits [basidiomycetes]        hypothetical protein CNBA0610 [Cryptococcus neoformans var.
. . . . . . Cryptococcus neoformans var. neoformans JEC21 ...   36  2 hits [basidiomycetes]        nuclear mRNA splicing protein [Cryptococcus neoformans var.
. . . . . Nosema ceranae BRL01 ------------------------------   36  1 hit  [microsporidians]       hypothetical protein NCER_102316 [Nosema ceranae BRL01]
. . . . Monosiga brevicollis MX1 ----------------------------   41  2 hits [choanoflagellates]     hypothetical protein [Monosiga brevicollis MX1] >gi|1637749
. . . . Caenorhabditis briggsae .............................   41  3 hits [nematodes]             RecName: Full=Serine/threonine kinase NLK; AltName: Full=Ne
. . . . Drosophila sechellia ................................   37  4 hits [flies]                 GM21242 [Drosophila sechellia] >gi|194125277|gb|EDW47320.1|
. . . . Drosophila melanogaster .............................   37  4 hits [flies]                 RE21021p [Drosophila melanogaster]
. . . . Bos taurus (cow) ....................................   36  1 hit  [even-toed ungulates]   PREDICTED: similar to raptor [Bos taurus]
. . . . Drosophila erecta ...................................   36  2 hits [flies]                 GG17057 [Drosophila erecta] >gi|190651980|gb|EDV49235.1| GG
. . . . Homo sapiens (man) ..................................   36 10 hits [primates]              regulatory-associated protein of mTOR isoform 2 [Homo sapie
. . . . Equus caballus (equine) .............................   36  1 hit  [odd-toed ungulates]    PREDICTED: similar to raptor [Equus caballus]
. . . . Pan troglodytes .....................................   36  2 hits [primates]              PREDICTED: raptor isoform 1 [Pan troglodytes]
. . . . Ailuropoda melanoleuca ..............................   36  1 hit  [carnivores]            hypothetical protein PANDA_010765 [Ailuropoda melanoleuca]
. . . . Macaca mulatta (rhesus macaque) .....................   36  2 hits [primates]              PREDICTED: similar to raptor isoform 2 [Macaca mulatta]
. . . . Canis lupus familiaris (dogs) .......................   36  1 hit  [carnivores]            PREDICTED: similar to raptor [Canis familiaris]
. . . . Mus musculus (mouse) ................................   36 12 hits [rodents]               unnamed protein product [Mus musculus]
. . . . Pediculus humanus corporis (human body lice) ........   36  2 hits [lice]                  WD-repeat protein, putative [Pediculus humanus corporis] >g
. . . . Monodelphis domestica ...............................   36  1 hit  [marsupials]            PREDICTED: hypothetical protein [Monodelphis domestica]
. . . . Drosophila simulans .................................   36  4 hits [flies]                 GD20503 [Drosophila simulans] >gi|194199499|gb|EDX13075.1| 
. . . . Gallus gallus (bantam) ..............................   36  1 hit  [birds]                 PREDICTED: similar to p150 target of rapamycin (TOR)-scaffo
. . . . Drosophila grimshawi ................................   35  2 hits [flies]                 GH24936 [Drosophila grimshawi] >gi|193893598|gb|EDV92464.1|
. . . . Rattus norvegicus (brown rat) .......................   35  1 hit  [rodents]               similar to p150 target of rapamycin (TOR)-scaffold protein 
. . . Trypanosoma brucei gambiense DAL972 -------------------   43  1 hit  [kinetoplastids]        hypothetical protein, conserved [Trypanosoma brucei gambien
. . . Trypanosoma brucei TREU927 ............................   43  1 hit  [kinetoplastids]        hypothetical protein [Trypanosoma brucei TREU927] >gi|70834
. . . Trypanosoma brucei ....................................   43  1 hit  [kinetoplastids]        hypothetical protein [Trypanosoma brucei TREU927] >gi|70834
. . . Paramecium tetraurelia strain d4-2 ....................   39  3 hits [ciliates]              hypothetical protein [Paramecium tetraurelia strain d4-2] >
. . . Paramecium tetraurelia ................................   39  3 hits [ciliates]              hypothetical protein [Paramecium tetraurelia strain d4-2] >
. . . Micromonas pusilla CCMP1545 ...........................   38  1 hit  [green algae]           predicted protein [Micromonas pusilla CCMP1545]
. . . Ostreococcus tauri ....................................   38  1 hit  [green algae]           putative WD-repeat membrane protein (ISS) [Ostreococcus tau
. . . Cryptosporidium muris RN66 ............................   37  2 hits [apicomplexans]         hypothetical protein [Cryptosporidium muris RN66] >gi|20955
. . . Dictyostelium discoideum AX4 ..........................   36  2 hits [cellular slime molds]  WD40 repeat-containing protein [Dictyostelium discoideum AX
. . . Dictyostelium discoideum ..............................   36  1 hit  [cellular slime molds]  WD40 repeat-containing protein [Dictyostelium discoideum AX
. . . Ostreococcus lucimarinus CCE9901 ......................   36  2 hits [green algae]           predicted protein [Ostreococcus lucimarinus CCE9901] >gi|14
. . Cyanothece sp. CCY0110 ----------------------------------   37  2 hits [cyanobacteria]         beta transducin-like protein [Cyanothece sp. CCY0110] >gi|1
. . Hoeflea phototrophica DFL-43 ............................   36  2 hits [a-proteobacteria]      adenylosuccinate synthetase protein [Hoeflea phototrophica 
. . Listeria monocytogenes FSL J1-208 .......................   35  1 hit  [firmicutes]            6-phospho-beta-glucosidase [Listeria monocytogenes FSL J1-2
. synthetic construct ---------------------------------------   35  1 hit  [other sequences]       regulatory-associated protein of mTOR [Mus musculus] >gi|12

BLAST

PROTOCOL

a) BLASTp versus NR, NCBI default parameters apart from "Number of descriptions_1000"

b) BLASTx versus NR, NCBI default parameters apart from "Number of descriptions_1000"



RESULTS ANALYSIS



Since the E values from the BLASTp (0.008) and BLASTx (0.56) are very high, the analysis made from this ORF will have no reliability. The first hit on BLASTp says that it is a chromatin assembly factor 1 subunit C protein so the function of the protein homologous with ours have not been discovered.

RAW RESULTS

a) BLASTp

                                                                  Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|XP_002544394.1|  chromatin assembly factor 1 subunit C [Un...  45.8    0.008
emb|CBH17669.1|  hypothetical protein, conserved [Trypanosoma ...  43.5    0.041
ref|XP_828768.1|  hypothetical protein [Trypanosoma brucei TRE...  43.5    0.042
ref|XP_001746689.1|  hypothetical protein [Monosiga brevicolli...  41.6    0.18 
sp|A8XSC1.2|NLK_CAEBR  RecName: Full=Serine/threonine kinase N...  41.2    0.22 
ref|XP_002642294.1|  C. briggsae CBR-LIT-1 protein [Caenorhabd...  40.4    0.33 
ref|XP_001432665.1|  hypothetical protein [Paramecium tetraure...  39.7    0.58 
ref|XP_001434313.1|  hypothetical protein [Paramecium tetraure...  39.3    0.77 
gb|EEH53906.1|  predicted protein [Micromonas pusilla CCMP1545]    38.9    0.95 
emb|CAL57758.1|  putative WD-repeat membrane protein (ISS) [Os...  38.5    1.3  
ref|NP_595227.1|  WD repeat protein Swd3 [Schizosaccharomyces ...  38.1    1.6  
ref|XP_001213911.1|  conserved hypothetical protein [Aspergill...  37.7    2.3  
ref|XP_001445784.1|  hypothetical protein [Paramecium tetraure...  37.7    2.5  
ref|XP_002033307.1|  GM21242 [Drosophila sechellia] >gb|EDW473...  37.7    2.6  
ref|XP_002139707.1|  hypothetical protein [Cryptosporidium mur...  37.4    2.8  
ref|ZP_01728004.1|  beta transducin-like protein [Cyanothece s...  37.4    3.1  
gb|AAL68278.1|  RE21021p [Drosophila melanogaster]                 37.4    3.4  
gb|ACI16532.1|  FI03249p [Drosophila melanogaster]                 37.4    3.4  
ref|NP_610623.1|  CG6751 [Drosophila melanogaster] >gb|AAF5873...  37.4    3.5  
ref|XP_001646486.1|  hypothetical protein Kpol_1048p59 [Vander...  37.0    3.9  
gb|EEQ81313.1|  hypothetical protein NCER_102316 [Nosema ceran...  37.0    4.3  
ref|NP_596478.1|  WD repeat protein Lub1 [Schizosaccharomyces ...  37.0    4.3  
ref|XP_583606.4|  PREDICTED: similar to raptor [Bos taurus]        37.0    4.3  
ref|XP_001980277.1|  GG17057 [Drosophila erecta] >gb|EDV49235....  37.0    4.4  
ref|XP_001904474.1|  unnamed protein product [Podospora anseri...  37.0    4.5  
ref|XP_640793.1|  WD40 repeat-containing protein [Dictyosteliu...  36.6    4.7  
ref|XP_001421820.1|  predicted protein [Ostreococcus lucimarin...  36.6    4.9  
ref|XP_001263278.1|  F-box and WD40 domain protein, putative [...  36.6    4.9  
ref|NP_001156506.1|  regulatory-associated protein of mTOR iso...  36.6    5.2  
ref|XP_001489653.1|  PREDICTED: similar to raptor [Equus cabal...  36.6    5.3  
ref|XP_001161716.1|  PREDICTED: raptor isoform 1 [Pan troglody...  36.6    5.4  
ref|XP_778058.1|  hypothetical protein CNBA0610 [Cryptococcus ...  36.6    5.4  
gb|EFB20820.1|  hypothetical protein PANDA_010765 [Ailuropoda ...  36.6    5.6  
ref|NP_065812.1|  regulatory-associated protein of mTOR isofor...  36.6    5.6  
ref|XP_566487.1|  nuclear mRNA splicing protein [Cryptococcus ...  36.6    5.8  
ref|XP_001110471.1|  PREDICTED: similar to raptor isoform 2 [M...  36.6    5.9  
ref|XP_850487.1|  PREDICTED: similar to raptor [Canis familiaris]  36.6    6.0  
dbj|BAB29789.1|  unnamed protein product [Mus musculus]            36.2    6.1  
ref|XP_002425511.1|  WD-repeat protein, putative [Pediculus hu...  36.2    6.1  
gb|EDL05868.1|  RIKEN cDNA 4930434E21 [Mus musculus]               36.2    6.2  
ref|NP_083716.2|  hypothetical protein LOC381693 [Mus musculus]    36.2    6.2  
gb|EAW89619.1|  raptor, isoform CRA_b [Homo sapiens]               36.2    6.4  
ref|XP_001370890.1|  PREDICTED: hypothetical protein [Monodelp...  36.2    6.6  
ref|ZP_02165863.1|  adenylosuccinate synthetase protein [Hoefl...  36.2    6.7  
ref|XP_001110429.1|  PREDICTED: similar to raptor isoform 1 [M...  36.2    6.8  
dbj|BAA92541.1|  KIAA1303 protein [Homo sapiens]                   36.2    6.9  
ref|XP_002103572.1|  GD20503 [Drosophila simulans] >gb|EDX1307...  36.2    7.0  
ref|XP_002080964.1|  GD10760 [Drosophila simulans] >gb|EDX0654...  36.2    7.1  
ref|XP_511729.2|  PREDICTED: raptor isoform 2 [Pan troglodytes]    36.2    7.2  
ref|XP_002031336.1|  GM25942 [Drosophila sechellia] >gb|EDW423...  36.2    7.4  
ref|XP_426232.2|  PREDICTED: similar to p150 target of rapamyc...  36.2    7.6  
dbj|BAC39857.1|  unnamed protein product [Mus musculus]            35.8    8.2  
ref|XP_001992757.1|  GH24936 [Drosophila grimshawi] >gb|EDV924...  35.8    8.6  
ref|ZP_05294624.1|  6-phospho-beta-glucosidase [Listeria monoc...  35.8    8.6  
ref|XP_002497512.1|  ZYRO0F07282p [Zygosaccharomyces rouxii] >...  35.8    9.1  
gb|AAI18972.1|  4932417H02Rik protein [Mus musculus]               35.8    9.5  
gb|EDM06799.1|  similar to p150 target of rapamycin (TOR)-scaf...  35.8    9.6  
gb|EDL34713.1|  RIKEN cDNA 4932417H02, isoform CRA_a [Mus musc...  35.8    9.8  
ref|NP_083174.2|  regulatory-associated protein of mTOR [Mus m...  35.8    9.8  

ALIGNMENTS
>ref|XP_002544394.1| chromatin assembly factor 1 subunit C [Uncinocarpus reesii 1704]
 gb|EEP79065.1| chromatin assembly factor 1 subunit C [Uncinocarpus reesii 1704]
Length=470

 Score = 45.8 bits (107),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 78/163 (47%), Gaps = 9/163 (5%)

Query  229  IATASNDGVVRLW-SSGLLLKFRLLVTRSKDLFGYQYESSGAKLKRVLPTDVAEIKLDV-  286
            +AT S D  VRLW    +LL  + ++T S+DL  Y   +   K  R   T  + I  DV 
Sbjct  222  LATGSEDETVRLWFVRSMLLSSKRVLTPSRDLTQYTKGNRALKPVRTY-THHSSIVNDVQ  280

Query  287  -NGMKSSIVIGYTDR---KIRIFHLPNSFGVAATVTPSKKLAVRGIPMVIDSHEDLLFIG  342
             + + SS++   +D    +I     P++   AA+ T   K A+  I     + E +L  G
Sbjct  281  YHPLHSSLIGTVSDDITLQILDIREPDTSRSAASATGQHKDAINSI-AFNPAAETVLATG  339

Query  343  DNDGFIEVYNTKNCLEKLHTVQAHIHTPVRQLKFVPFLNAIVS  385
              D  I +++ +N   KLH ++ H  + V  L + PF  A+++
Sbjct  340  SADKSIGLWDLRNLKSKLHALECHQDS-VTTLAWHPFEEAVLA  381


>emb|CBH17669.1| hypothetical protein, conserved [Trypanosoma brucei gambiense 
DAL972]
Length=541

 Score = 43.5 bits (101),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 7/62 (11%)

Query  293  IVIGYTDRKIRIFHLPNSFGVAATVTPSKKLAVRGIPMVIDSHEDLLFIGDNDGFIEVYN  352
            IV G  DR IR +   +  G A    PS      G+P+ IDS  D L +G  DG + +++
Sbjct  273  IVTGGADRMIRYW--DSGSGAALQCHPSD-----GVPLCIDSVGDRLIVGCTDGVVRIWD  325

Query  353  TK  354
            TK
Sbjct  326  TK  327


>ref|XP_828768.1| hypothetical protein [Trypanosoma brucei TREU927]
 gb|EAN79656.1| hypothetical protein, conserved [Trypanosoma brucei]
Length=541

 Score = 43.5 bits (101),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 7/62 (11%)

Query  293  IVIGYTDRKIRIFHLPNSFGVAATVTPSKKLAVRGIPMVIDSHEDLLFIGDNDGFIEVYN  352
            IV G  DR IR +   +  G A    PS      G+P+ IDS  D L +G  DG + +++
Sbjct  273  IVTGGADRMIRYW--DSGSGAALQCHPSD-----GVPLCIDSVGDRLIVGCTDGVVRIWD  325

Query  353  TK  354
            TK
Sbjct  326  TK  327


>ref|XP_001746689.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ88585.1| predicted protein [Monosiga brevicollis MX1]
Length=1053

 Score = 41.6 bits (96),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 61/141 (43%), Gaps = 25/141 (17%)

Query  229  IATASNDGVVRLW---SSGLLLKFRLLVTRS--KDLFGYQYESSGAKLK-RVLPTDVAEI  282
            IA+AS DG VRLW   ++ LL   +L   R      FG    S GA  +  + P  VA  
Sbjct  401  IASASLDGHVRLWDLDTNRLLAALKLRSARDDPSGSFGTLRASGGASARPSIDPASVAR-  459

Query  283  KLDVNGMKSSIVIGYTDRKIRIFHLPNSFGVAATVTPSKKLAVRGIPMVIDSHEDLLFIG  342
             +   G+ ++              LP   G A + +         +P  ID  ED++ IG
Sbjct  460  AMSGGGLAAA--------------LPTGRGAAPSSSEGNTDESSLVPWCIDIAEDIVAIG  505

Query  343  DNDGFIEVYNTKN----CLEK  359
             +DG + V+ T++    CL +
Sbjct  506  CSDGSVMVWETESGALQCLTQ  526


>sp|A8XSC1.2|NLK_CAEBR RecName: Full=Serine/threonine kinase NLK; AltName: Full=Nemo-like 
kinase; AltName: Full=Loss of intestine protein 1
Length=657

 Score = 41.2 bits (95),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 56/117 (47%), Gaps = 14/117 (11%)

Query  105  PVDLLPFFVKLFRVNRNKALHYIRDEEE-----ASLSAQDIGGLLQLLTQYSEASIAKLV  159
            P++ L   + L      +A+ Y  +  +     A   A ++  L +L  Q ++ ++  LV
Sbjct  473  PIEQLQMIIDLLGTPSQEAMKYACEGAKNHVLRAGPRAPNLQSLYRLSQQTTDDAVDLLV  532

Query  160  KFLDVNCDEQISLDESL-HFFLEDSRLKLRTEINRTFHMKLMMSKKVGKSVYSRAFS  215
            K L  N DE+IS++E+L H +LE+ RL+        FH  +        +V SR FS
Sbjct  533  KLLKFNPDERISVEEALSHPYLEEGRLR--------FHSCMCSCCYTKANVPSRIFS  581


>ref|XP_002642294.1| C. briggsae CBR-LIT-1 protein [Caenorhabditis briggsae]
 emb|CAP35763.1| C. briggsae CBR-LIT-1 protein [Caenorhabditis briggsae]
Length=435

 Score = 40.4 bits (93),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 56/117 (47%), Gaps = 14/117 (11%)

Query  105  PVDLLPFFVKLFRVNRNKALHYIRDEEE-----ASLSAQDIGGLLQLLTQYSEASIAKLV  159
            P++ L   + L      +A+ Y  +  +     A   A ++  L +L  Q ++ ++  LV
Sbjct  251  PIEQLQMIIDLLGTPSQEAMKYACEGAKNHVLRAGPRAPNLQSLYRLSQQTTDDAVDLLV  310

Query  160  KFLDVNCDEQISLDESL-HFFLEDSRLKLRTEINRTFHMKLMMSKKVGKSVYSRAFS  215
            K L  N DE+IS++E+L H +LE+ RL+        FH  +        +V SR FS
Sbjct  311  KLLKFNPDERISVEEALSHPYLEEGRLR--------FHSCMCSCCYTKANVPSRIFS  359


>ref|XP_001432665.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK65268.1| unnamed protein product [Paramecium tetraurelia]
Length=975

 Score = 39.7 bits (91),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 63/129 (48%), Gaps = 12/129 (9%)

Query  244  GLLLKFRLLVTRSKDLFGYQYESSGAKLKRVLPTDVAEIKLDVNGMKSSIVIGYTDRKIR  303
            G +    L+  R + ++  QYE     LK+V+  D     + V+ + +   IG  + K +
Sbjct  596  GAIFIIDLVSYRQELVWKGQYE-----LKKVMFLDTHNCIVSVDSIGNVYFIGVLESKFK  650

Query  304  IFHLPNSFGVAATVTPSKKLAVRGIPMV-IDSHEDLLFIGDNDGFIEVYNTKNCLEK--L  360
               L      A ++T  ++      P+  I+ H+DLL++GD  G ++++N K  L+K  L
Sbjct  651  SKLLLQKTYKAISLTNQEET----FPVTSINYHDDLLYLGDELGNLKIWNIKQVLDKVDL  706

Query  361  HTVQAHIHT  369
            H V+  I T
Sbjct  707  HQVEQKIKT  715


>ref|XP_001434313.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK66916.1| unnamed protein product [Paramecium tetraurelia]
Length=623

 Score = 39.3 bits (90),  Expect = 0.77, Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 49/101 (48%), Gaps = 9/101 (8%)

Query  290  KSSIVIGYTDRKIRIFHLPNSFGVAA--TVTPSKKLAVRGIPMVIDSHEDLLFIGDNDGF  347
            +++ ++   D+ IR +    SF +    +  P  +       ++I+ +EDLLF G  D  
Sbjct  374  QNTFILSSDDKTIRCWQ---SFNLQNWNSSQPYNQHTHYVQCLIINENEDLLFSGSFDNS  430

Query  348  IEVYN---TKNCLEKLHTVQAHIHTPVRQLKFVPFLNAIVS  385
            I+V+N    KNCL   +T+  H + PV  L   P    +VS
Sbjct  431  IKVWNVDFNKNCLTYQYTLNKHTN-PVNGLSLSPSEKVLVS  470


>gb|EEH53906.1| predicted protein [Micromonas pusilla CCMP1545]
Length=1142

 Score = 38.9 bits (89),  Expect = 0.95, Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 91/215 (42%), Gaps = 37/215 (17%)

Query  151  SEASIAKLVKFLDVNCDEQISLDE-SLHFFLEDSRLKLRTEINRTFHMKLMMSKKVGKSV  209
            ++A + +L   +D N D  +  DE S +  LE    +    ++          ++VG + 
Sbjct  108  NDARLRQLFNRVDANADGAVDWDEFSTYVLLEGQAARELRALDAVRKYLPEKEQRVGVAG  167

Query  210  YSRAFS-----IKPLSKNSTIPFGIATASNDGVVRLW--SSGLLLKFRLLVTRSKDLFGY  262
             S   +     +  L+K +++    AT S+DG VRLW  SS   +K+     R  DL   
Sbjct  168  QSDPEAKHRDVVTSLTKMTSLRDTYATTSHDGTVRLWQLSSDGGVKY----VRKVDLRSR  223

Query  263  QYESSGAKLKRVLPTDVAEIKLDVNGMKSSIVIGYTDRKIRIFHLPNSFGVAATVT----  318
             Y ++G               LD +G    + +   DRK++I  L   + V   ++    
Sbjct  224  AYLTAG-------------CHLDTSGR---LAVASHDRKVKI--LDKGWKVCGQLSTFQY  265

Query  319  -PSKKLAVRGIPMVIDSHEDLLFI--GDNDGFIEV  350
             P    + RG   +   H+D+ +I  GD+ G++ V
Sbjct  266  APLCMTSWRGGAKIAPGHKDMDWIAVGDDGGYVHV  300


>emb|CAL57758.1| putative WD-repeat membrane protein (ISS) [Ostreococcus tauri]
Length=1124

 Score = 38.5 bits (88),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 44/88 (50%), Gaps = 8/88 (9%)

Query  293  IVIGYTDRKIRIFHLPNSFGVAATVTPSKKLAVRGIPMVIDSHEDLLFIGDNDGFIEVYN  352
            + +G  D ++ + +L     V  TVTP   L +  +    D  +D+L IGD  G + V++
Sbjct  200  VAVGLEDGRVLLVNLLED-SVLFTVTPDHGLKITALAFRTDDQDDVLCIGDESGRVTVWD  258

Query  353  TKNCLEK--LHTVQAHIH-TPVRQLKFV  377
                LEK  L TV +  H  PV  LKF+
Sbjct  259  ----LEKRSLRTVISQCHEGPVVALKFL  282


>ref|NP_595227.1| WD repeat protein Swd3 [Schizosaccharomyces pombe]
 sp|O43017.1|SWD3_SCHPO RecName: Full=Set1 complex component swd3; Short=Set1C component 
swd3; AltName: Full=COMPASS component swd3; AltName: Full=Complex 
proteins associated with set1 protein swd3
 emb|CAA17803.1| WD repeat protein Swd3 [Schizosaccharomyces pombe]
Length=380

 Score = 38.1 bits (87),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 82/190 (43%), Gaps = 40/190 (21%)

Query  229  IATASNDGVVRLWSSGLLLKFRLLVT---------RSKDLFGYQYESSGAKLKRVLPTDV  279
            IAT+S+DG +++WS+   L FRL  T         + K   G +Y +S +  K +   D 
Sbjct  69   IATSSSDGTIKIWSA---LTFRLECTLFGHYRGISQVKWATGSKYLASASDDKTIRIWDF  125

Query  280  AE--------------IKLDVNGMKSSIVIGYTDRKIRIFHLPNSFGVAATVTPSKKLAV  325
             +                +D N + + +V G  D  +RI++L +  G    + P+    +
Sbjct  126  EKRCSVRCLKGHTNYVSSIDFNPLGTLLVSGSWDETVRIWNLQD--GTCLRMLPAHSEPI  183

Query  326  RGIPMVIDSHEDLLFIGDNDGFIEVYN--TKNCLEKLHTVQAHIHTPVRQLKFVP-----  378
              I + I +   L      DG   +++  +  CL+   T+   I+ P+  L+F       
Sbjct  184  --ISVSISADGTLCATASYDGMARIWDVLSGQCLK---TLVEPINVPLSNLQFTENRKYL  238

Query  379  FLNAIVSQIR  388
             ++ + SQIR
Sbjct  239  LVSNLNSQIR  248


>ref|XP_001213911.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gb|EAU35180.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
Length=661

 Score = 37.7 bits (86),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 20/97 (20%)

Query  229  IATASNDGVVRLW--SSGLLLK-----------------FRLLVTRSKDLFGYQYESSGA  269
            I +AS DGV +LW  +SGL +K                  R ++T   D   YQ++++  
Sbjct  510  IVSASGDGVAKLWNITSGLCVKEFPSKDRGLACVEFSDDARTILTGGNDKVIYQFDANTG  569

Query  270  KLKRVLPTDVAEIK-LDVNGMKSSIVIGYTDRKIRIF  305
             + R L   V  ++ L ++ M   IV G  D  +++F
Sbjct  570  DMVRELKGQVGLVRSLHLDSMNQRIVSGSYDMSVKVF  606


b) BLASTx

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|XP_001432665.1|  hypothetical protein [Paramecium tetraure...  39.7    0.56 
ref|XP_001434313.1|  hypothetical protein [Paramecium tetraure...  38.9    0.95 
emb|CAL57758.1|  putative WD-repeat membrane protein (ISS) [Os...  38.9    0.95 
ref|XP_002139707.1|  hypothetical protein [Cryptosporidium mur...  37.4    2.8  
gb|EEQ81313.1|  hypothetical protein NCER_102316 [Nosema ceran...  37.0    3.6  
emb|CBH17669.1|  hypothetical protein, conserved [Trypanosoma ...  36.6    4.7  
ref|ZP_05294624.1|  6-phospho-beta-glucosidase [Listeria monoc...  36.6    4.7  
sp|A8XSC1.2|NLK_CAEBR  RecName: Full=Serine/threonine kinase N...  36.6    4.7  
gb|EEH53906.1|  predicted protein [Micromonas pusilla CCMP1545]    36.6    4.7  
ref|XP_583606.4|  PREDICTED: similar to raptor [Bos taurus]        36.6    4.7  
ref|XP_001980277.1|  GG17057 [Drosophila erecta] >gb|EDV49235....  36.6    4.7  
ref|XP_001421820.1|  predicted protein [Ostreococcus lucimarin...  36.6    4.7  
ref|XP_002642294.1|  C. briggsae CBR-LIT-1 protein [Caenorhabd...  36.6    4.7  
ref|XP_828768.1|  hypothetical protein [Trypanosoma brucei TRE...  36.6    4.7  
ref|XP_640793.1|  WD40 repeat-containing protein [Dictyosteliu...  36.6    4.7  
gb|EFB20820.1|  hypothetical protein PANDA_010765 [Ailuropoda ...  36.2    6.2  
ref|NP_001156506.1|  regulatory-associated protein of mTOR iso...  36.2    6.2  
ref|XP_001746689.1|  hypothetical protein [Monosiga brevicolli...  36.2    6.2  
ref|XP_001370890.1|  PREDICTED: hypothetical protein [Monodelp...  36.2    6.2  
gb|EAW89619.1|  raptor, isoform CRA_b [Homo sapiens]               36.2    6.2  
ref|XP_511729.2|  PREDICTED: raptor isoform 2 [Pan troglodytes]    36.2    6.2  
ref|XP_001161716.1|  PREDICTED: raptor isoform 1 [Pan troglody...  36.2    6.2  
ref|XP_001213911.1|  conserved hypothetical protein [Aspergill...  36.2    6.2  
ref|XP_001110429.1|  PREDICTED: similar to raptor isoform 1 [M...  36.2    6.2  
ref|XP_001110471.1|  PREDICTED: similar to raptor isoform 2 [M...  36.2    6.2  
ref|XP_566487.1|  nuclear mRNA splicing protein [Cryptococcus ...  36.2    6.2  
gb|AAH33258.1|  Unknown (protein for IMAGE:5457801) [Homo sapi...  36.2    6.2  
ref|XP_850487.1|  PREDICTED: similar to raptor [Canis familiaris]  36.2    6.2  
dbj|BAA92541.1|  KIAA1303 protein [Homo sapiens]                   36.2    6.2  
ref|NP_065812.1|  regulatory-associated protein of mTOR isofor...  36.2    6.2  
ref|XP_778058.1|  hypothetical protein CNBA0610 [Cryptococcus ...  36.2    6.2  
gb|EEU47028.1|  hypothetical protein NECHADRAFT_36093 [Nectria...  35.8    8.1  
ref|XP_001489653.1|  PREDICTED: similar to raptor [Equus cabal...  35.8    8.1  
ref|XP_001455319.1|  hypothetical protein [Paramecium tetraure...  35.8    8.1  
ref|XP_001263278.1|  F-box and WD40 domain protein, putative [...  35.8    8.1  
ref|XP_426232.2|  PREDICTED: similar to p150 target of rapamyc...  35.8    8.1  

ALIGNMENTS
>ref|XP_001432665.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK65268.1| unnamed protein product [Paramecium tetraurelia]
Length=975

 Score = 39.7 bits (91),  Expect = 0.56
 Identities = 33/118 (27%), Positives = 58/118 (49%), Gaps = 10/118 (8%)
 Frame = +1

Query  613  DLFGYQYE---SSGAKLKRVLPTDVAEIKLDVNGMKSSIVIGYTDRKIRIFHLPNSFGVA  783
            DL  Y+ E       +LK+V+  D     + V+ + +   IG  + K +   L      A
Sbjct  602  DLVSYRQELVWKGQYELKKVMFLDTHNCIVSVDSIGNVYFIGVLESKFKSKLLLQKTYKA  661

Query  784  ATVTPSKKLAVRGIPMV-IDSHEDLLFIGDNDGFIEVYNTKNCLEK--LHTVQAHIHT  948
             ++T  ++      P+  I+ H+DLL++GD  G ++++N K  L+K  LH V+  I T
Sbjct  662  ISLTNQEET----FPVTSINYHDDLLYLGDELGNLKIWNIKQVLDKVDLHQVEQKIKT  715


>ref|XP_001434313.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK66916.1| unnamed protein product [Paramecium tetraurelia]
Length=623

 Score = 38.9 bits (89),  Expect = 0.95
 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 4/59 (6%)
 Frame = +1

Query  829  MVIDSHEDLLFIGDNDGFIEVYN---TKNCLEKLHTVQAHIHTPVRQLKFVPFLNAIVS  996
            ++I+ +EDLLF G  D  I+V+N    KNCL   +T+  H + PV  L   P    +VS
Sbjct  413  LIINENEDLLFSGSFDNSIKVWNVDFNKNCLTYQYTLNKHTN-PVNGLSLSPSEKVLVS  470


>emb|CAL57758.1| putative WD-repeat membrane protein (ISS) [Ostreococcus tauri]
Length=1124

 Score = 38.9 bits (89),  Expect = 0.95
 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 4/86 (4%)
 Frame = +1

Query  718  IVIGYTDRKIRIFHLPNSFGVAATVTPSKKLAVRGIPMVIDSHEDLLFIGDNDGFIEVYN  897
            + +G  D ++ + +L     V  TVTP   L +  +    D  +D+L IGD  G + V++
Sbjct  200  VAVGLEDGRVLLVNLLED-SVLFTVTPDHGLKITALAFRTDDQDDVLCIGDESGRVTVWD  258

Query  898  TKNCLEKLHTVQAHIHT-PVRQLKFV  972
             +     L TV +  H  PV  LKF+
Sbjct  259  LEK--RSLRTVISQCHEGPVVALKFL  282


>ref|XP_002139707.1| hypothetical protein [Cryptosporidium muris RN66]
 gb|EEA05358.1| hypothetical protein, conserved [Cryptosporidium muris RN66]
Length=956

 Score = 37.4 bits (85),  Expect = 2.8
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 6/78 (7%)
 Frame = +1

Query  709  KSSIVIGYTDRKIRIFHLPNSFGVAATVTPSKKLAVRGIPMVIDSHEDLLFIGDNDGFIE  888
            ++ + +  TD  IRIF L N+    +   P    ++  +  +    ED +F G +DG I 
Sbjct  185  ETQLAVACTDGSIRIFSLLNNMVTYSYGLPRHSSSILSLTFMT---EDYIFAGSSDGCIL  241

Query  889  VYNTKN--CLEKLHTVQA  936
             YN K+  C+E++ TVQA
Sbjct  242  QYNLKSKICVERM-TVQA  258


>gb|EEQ81313.1| hypothetical protein NCER_102316 [Nosema ceranae BRL01]
Length=323

 Score = 37.0 bits (84),  Expect = 3.6
 Identities = 27/121 (22%), Positives = 56/121 (46%), Gaps = 5/121 (4%)
 Frame = +1

Query  583  KFRLLVTRSKDLFGYQYESSGAKLKRVLPT-DVAEIKLDVNGMKSSIVIGYTDRKIRIFH  759
            +F +LV  + D+F Y  E++G K  + L T +     +  N + +   +G  D  + ++ 
Sbjct  161  RFLILVGDTNDVFVYTIENNGYKFFKKLKTVNDGGFSVTWNNLSNKFAVGTQDGFVCVWD  220

Query  760  LPNS---FGVAATVTPSKKLAVRGIPMVIDSHEDLLFIGDNDGFIEVYNTKNCLEKLHTV  930
            + +    + + +    S + A+R +        DLLF  +   ++ VY+T+    K H V
Sbjct  221  IRSDEKLYTLCSKQQGSHRGAIRNVFFSTKKSLDLLFFTEQSSYLSVYDTRT-FTKRHVV  279

Query  931  Q  933
            +
Sbjct  280  K  280


>emb|CBH17669.1| hypothetical protein, conserved [Trypanosoma brucei gambiense 
DAL972]
Length=541

 Score = 36.6 bits (83),  Expect = 4.7
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 7/62 (11%)
 Frame = +1

Query  718  IVIGYTDRKIRIFHLPNSFGVAATVTPSKKLAVRGIPMVIDSHEDLLFIGDNDGFIEVYN  897
            IV G  DR IR +   +  G A    PS      G+P+ IDS  D L +G  DG + +++
Sbjct  273  IVTGGADRMIRYWD--SGSGAALQCHPSD-----GVPLCIDSVGDRLIVGCTDGVVRIWD  325

Query  898  TK  903
            TK
Sbjct  326  TK  327


>ref|ZP_05294624.1| 6-phospho-beta-glucosidase [Listeria monocytogenes FSL J1-208]
Length=438

 Score = 36.6 bits (83),  Expect = 4.7
 Identities = 20/77 (25%), Positives = 39/77 (50%), Gaps = 3/77 (3%)
 Frame = +1

Query  634  ESSGAKLKRVLPTDVAEIKLDVNGMKSSIVIGYTDRKIRIFHLPNSFGVAATVTPSKKLA  813
            E +G  +K  L  D  E   D + + + + +G  D +++   +PNS+GV    T  +   
Sbjct  60   EKAGVDMKVHLTLDREEALKDADFVTTQLRVGLLDARVKDERIPNSYGVVGQETNGQAAC  119

Query  814  VRG---IPMVIDSHEDL  855
             +G   IP+++D  +D+
Sbjct  120  SKGLRTIPVILDICKDM  136


>sp|A8XSC1.2|NLK_CAEBR RecName: Full=Serine/threonine kinase NLK; AltName: Full=Nemo-like 
kinase; AltName: Full=Loss of intestine protein 1
Length=657

 Score = 36.6 bits (83),  Expect = 4.7
 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 9/80 (11%)
 Frame = +1

Query  250  AQDIGGLLQLLTQYSEASIAKLVKFLDVNCDEQISLDESL-HFFLEDSRLKLRTEINRTF  426
            A ++  L +L  Q ++ ++  LVK L  N DE+IS++E+L H +LE+ RL+        F
Sbjct  510  APNLQSLYRLSQQTTDDAVDLLVKLLKFNPDERISVEEALSHPYLEEGRLR--------F  561

Query  427  HMKLMMSKKVGKSVYSRAFS  486
            H  +        +V SR FS
Sbjct  562  HSCMCSCCYTKANVPSRIFS  581


>gb|EEH53906.1| predicted protein [Micromonas pusilla CCMP1545]
Length=1142

 Score = 36.6 bits (83),  Expect = 4.7
 Identities = 50/215 (23%), Positives = 91/215 (42%), Gaps = 37/215 (17%)
 Frame = +1

Query  292  SEASIAKLVKFLDVNCDEQISLDE-SLHFFLEDSRLKLRTEINRTFHMKLMMSKKVGKSV  468
            ++A + +L   +D N D  +  DE S +  LE    +    ++          ++VG + 
Sbjct  108  NDARLRQLFNRVDANADGAVDWDEFSTYVLLEGQAARELRALDAVRKYLPEKEQRVGVAG  167

Query  469  YSRAFS-----IKPLSKNSTIPFGIATASNDGVVRLW--SSGLLLKFRLLVTRSKDLFGY  627
             S   +     +  L+K +++    AT S+DG VRLW  SS   +K+     R  DL   
Sbjct  168  QSDPEAKHRDVVTSLTKMTSLRDTYATTSHDGTVRLWQLSSDGGVKY----VRKVDLRSR  223

Query  628  QYESSGAKLKRVLPTDVAEIKLDVNGMKSSIVIGYTDRKIRIFHLPNSFGVAATVT----  795
             Y ++G               LD +G    + +   DRK++I  L   + V   ++    
Sbjct  224  AYLTAGC-------------HLDTSG---RLAVASHDRKVKI--LDKGWKVCGQLSTFQY  265

Query  796  -PSKKLAVRGIPMVIDSHEDL--LFIGDNDGFIEV  891
             P    + RG   +   H+D+  + +GD+ G++ V
Sbjct  266  APLCMTSWRGGAKIAPGHKDMDWIAVGDDGGYVHV  300


>ref|XP_583606.4| PREDICTED: similar to raptor [Bos taurus]
Length=1335

 Score = 36.6 bits (83),  Expect = 4.7
 Identities = 38/142 (26%), Positives = 63/142 (44%), Gaps = 15/142 (10%)
 Frame = +1

Query  526   IATASNDGVVRLWSSGL-LLKFRLLVTRSKDLFGYQYESSGAKLKRVLPTDVAEIKLDVN  702
             + TA++DG +R+W +   L K   +VT  + L      + GA +  V+  +     L  +
Sbjct  1084  LLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGM--VVDWEQETGLLMSS  1141

Query  703   GMKSSIVIGYTDRKIRIFHLPNSFGVAATVTPSKKLAVRGIPMVIDSHEDLLFIGDNDGF  882
             G    I I  TDR++++  +P   G  + VT           +  DSH  L+  G  DG 
Sbjct  1142  GDVRIIRIWDTDREMKVQDIPT--GADSCVTS----------LSCDSHRSLIVAGLGDGS  1189

Query  883   IEVYNTKNCLEKLHTVQAHIHT  948
             I VY+ +  L +   +    HT
Sbjct  1190  IRVYDRRMALSECRVMTYREHT  1211


>ref|XP_001980277.1| GG17057 [Drosophila erecta]
 gb|EDV49235.1| GG17057 [Drosophila erecta]
Length=921

 Score = 36.6 bits (83),  Expect = 4.7
 Identities = 19/67 (28%), Positives = 38/67 (56%), Gaps = 2/67 (2%)
 Frame = +1

Query  718  IVIGYTDRKIRIFHLPNSFGVAATVTPSKKLAVRGIPMVIDSHEDLLFIGDNDGFIEVYN  897
            ++IGY+   I  F++ + F  A+  TP  K+AVRG  +  D+    +  G ++G ++ ++
Sbjct  469  VIIGYSSGDIERFNIQSGFRRASYGTPGHKMAVRG--LASDNLNQTVISGCSEGLLKFWS  526

Query  898  TKNCLEK  918
             K  ++K
Sbjct  527  FKGKVDK  533


>ref|XP_001421820.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00114.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=934

 Score = 36.6 bits (83),  Expect = 4.7
 Identities = 24/93 (25%), Positives = 45/93 (48%), Gaps = 2/93 (2%)
 Frame = +1

Query  718  IVIGYTDRKIRIFHLPNSFGVAATVTPSKKLAVRGIPMVIDSHEDLLFIGDNDGFIEVYN  897
            + +G  D ++ + ++     V  T+TP + + V  +    D  +D+L +GD  G + V++
Sbjct  214  VAVGLADGRVLLVNVLED-KVLFTLTPERGVKVTALAFRTDDQDDVLCVGDETGRVTVWD  272

Query  898  TKNCLEKLHTVQAHIHTPVRQLKFVPFLNAIVS  996
             +    +   VQ H   PV  LKF+     +VS
Sbjct  273  LEKRSLRTLIVQCH-EGPVVSLKFLDGQPVMVS  304