GOS 1492010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1092955318284
Annotathon code: GOS_1492010
Sample :
  • GPS :5°55'48s; 108°41'13w
  • Tropical South Pacific: Tropical South Pacific - International
  • Open Ocean (-2m, 28°C, 0.1-0.8 microns)
Authors
Team : Algarve
Username : Cverde1
Annotated on : 2010-07-04 17:53:54
  • a32605 LilianaIsabelSantosPereira
  • a35663 ClaudiaJassicaGonçalvesMoreno
  • a35664 HéliaReginaTavresSanchesDeCarvalho

Synopsis

  • Taxonomy: Wolbachia (NCBI info)
    Rank: genus - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 953
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order: Rickettsiales
    Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; Rickettsiaceae; Wolbachieae; Wolbachia;

Genomic Sequence

>JCVI_READ_1092955318284 GOS_1492010 Genomic DNA
TCCTTTAAGTATATGAAAGAAATCATAAGTATTGTAAATGAAATACCAGATCTTATACCTGAGGCGAATAAATTCGATACCATAGGTGTAAAGAAGATCA
TAAGAAATATAGGTAATATATAAATCAAATACTTTGTAGATCTGATATGTATTGCATATATGCAAAAAATCAAAGATGACATTATGAAAGCGAAATAACT
TAATACTGTTATAGGCTCCAAATTAAAGTAATTACCTATAAAAATAACTAAGACGCGAAATACTCCATCGCCTCTAATTGAATATTCATTATATGTAGTA
AAAATATCAATATCTTCAAAAAAATCTATATAAGCATTGATGTCTCCACTGCCTACAGAATATAAGTACTGTAGGGATCCAACTATAAAAAACCCATAGA
TTAATGCAAAAGATAATCCGATAAATTTATATAAAGAATATCTTTTTACGGTGTATATGCTCATACTAACTCGATACTATTTATAGAATTTTTACAAATT
TGTATGAAATTCTTCATAGCATTTAATTAAATGCTCTCCTAAATTAAAATTTTTATTTTCATTTTTTAGTCCGCAGTAAGCGAGGGCTTCATCTGATATT
TCTAATTTTTTACTTTCCAAAAAGGATTGTAAGCTTTCCTCACTGTTTATTAGCATAGTAGCTTTGTAATTAACAAGATAGTCATAATGACCATTATCAA
ATTTATCTATAATGCCAGCTTTCACACCTAACATTAATGCTTGAAGTATTG

Translation

[276 - 749/751]   indirect strand
>GOS_1492010 Translation [276-749   indirect strand]
YRVSMSIYTVKRYSLYKFIGLSFALIYGFFIVGSLQYLYSVGSGDINAYIDFFEDIDIFTTYNEYSIRGDGVFRVLVIFIGNYFNLEPITVLSYFAFIMS
SLIFCIYAIHIRSTKYLIYILPIFLMIFFTPMVSNLFASGIRSGISFTILMISFIYLK

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

The DNA fragment contains ORFs and the largest ORF contains more than 150 amino acids (158 aa), has homology known, although with results much little significant and very small, we consider coding.


The ORF has any known homology, and results of BLAST emphasize that this is a hypothetical protein, or has unknown function, but this does not mean that she has not function only at this time are not yet known and in the future, maybe they show more results, and a list of results with homologies significative and larger.


It probable that the DNA fragment belonging to the class of beta-proteobacteria, although with little results Significatives, (0.46, 0.56, 0.75, 1.5, 1.7, 2.5, 3.6, 7.3, 7.4 and 9.9 for BLASTp and too for BLASTx 0.43, 3.6, 6.2 and 8.0), according to the results of the lineage report (BLAST).


The results to possible function of DNA fragment, only was based in the results found in the BLAST, since that we found protein domain, but the results was not conclusive due to lack of information and the taxonomy was possible only in the lineage report (BLAST), since was practically not possible to determine the tree by limited numbers of data values and quite few significatives.

ORF finding

PROTOCOL


a) SMS ORFinder / direct strand / frames 1, 2 & 3 / 60 AA / "any codon" initiation / "standard(1)" genetic code

b) SMS ORFinder / reverse strand / frmaes 1 , 2 & 3 / 60 AA / "any codon" initiation / "standard(1)" genetic code




RESULTS ANALYSIS


For this DNA fragment we found 3 ORFs, all on the reverse strand (1 in reading frame 2, from base 530 to base 751 and 2 in reading frame 3, from base 3 to base 260 and from base 276 to base 749), we do not find no ORF on the direct strand, in none of the reading frame.


The chosen ORF meets in reading frame 3 (ORF number two) on the reverse strand, is a open-ended sequences (3' incomplete: does not contain stop codons), what it will not allow to calculate its molecular weight, because is a incomplete ORF. Does not contain internal stop codons and contains more than 150 codons. Is likely to be a true positive ORF for existing protein homologs (BLAST) and for its size (more than 150 codons). For exist homologous proteins, we concludes that the sequence is coding. It was chosen for to be the longest ORF.


The list of results of the BLAST is very very reduced, and I do not have significant E_Value (0.46, 0.56, 0.75, 1.5, 1.7, 2.5, 3.6, 7.3, 7.4 and 9.9) what it does not allow to make the multiple alignment where could determine if the chosen ORF contained start codon or not and its localization. It is probable that the ORF has start codon, but have no results significant and enough to prove it.


RAW RESULTS:

  a)  direct strand

  No ORFs were found in reading frame 1.

  No ORFs were found in reading frame 2.

  No ORFs were found in reading frame 3.

--------------------------------------------------------------------------------------------------------------------------                                                                                                                                                                                      
  b) reverse strand
 
  No ORFs were found in reading frame 1.

  >ORF number 1 in reading frame 2 on the reverse strand extends from base 530 to base 751.

  TTTGGAGCCTATAACAGTATTAAGTTATTTCGCTTTCATAATGTCATCTTTGATTTTTTG
  CATATATGCAATACATATCAGATCTACAAAGTATTTGATTTATATATTACCTATATTTCT
  TATGATCTTCTTTACACCTATGGTATCGAATTTATTCGCCTCAGGTATAAGATCTGGTAT
  TTCATTTACAATACTTATGATTTCTTTCATATACTTAAAGGA

  >Translation of ORF number 1 in reading frame 2 on the reverse strand.
  FGAYNSIKLFRFHNVIFDFLHICNTYQIYKVFDLYITYISYDLLYTYGIEFIRLRYKIWY
  FIYNTYDFFHILKG

  >ORF number 1 in reading frame 3 on the reverse strand extends from base 3 to base 260.

  ATACTTCAAGCATTAATGTTAGGTGTGAAAGCTGGCATTATAGATAAATTTGATAATGGT
  CATTATGACTATCTTGTTAATTACAAAGCTACTATGCTAATAAACAGTGAGGAAAGCTTA
  CAATCCTTTTTGGAAAGTAAAAAATTAGAAATATCAGATGAAGCCCTCGCTTACTGCGGA
  CTAAAAAATGAAAATAAAAATTTTAATTTAGGAGAGCATTTAATTAAATGCTATGAAGAA
  TTTCATACAAATTTGTAA

  >Translation of ORF number 1 in reading frame 3 on the reverse strand.
  ILQALMLGVKAGIIDKFDNGHYDYLVNYKATMLINSEESLQSFLESKKLEISDEALAYCG
  LKNENKNFNLGEHLIKCYEEFHTNL*

  >ORF number 2 in reading frame 3 on the reverse strand extends from base 276 to base 749.

  TATCGAGTTAGTATGAGCATATACACCGTAAAAAGATATTCTTTATATAAATTTATCGGA
  TTATCTTTTGCATTAATCTATGGGTTTTTTATAGTTGGATCCCTACAGTACTTATATTCT
  GTAGGCAGTGGAGACATCAATGCTTATATAGATTTTTTTGAAGATATTGATATTTTTACT
  ACATATAATGAATATTCAATTAGAGGCGATGGAGTATTTCGCGTCTTAGTTATTTTTATA
  GGTAATTACTTTAATTTGGAGCCTATAACAGTATTAAGTTATTTCGCTTTCATAATGTCA
  TCTTTGATTTTTTGCATATATGCAATACATATCAGATCTACAAAGTATTTGATTTATATA
  TTACCTATATTTCTTATGATCTTCTTTACACCTATGGTATCGAATTTATTCGCCTCAGGT
  ATAAGATCTGGTATTTCATTTACAATACTTATGATTTCTTTCATATACTTAAAG

  >Translation of ORF number 2 in reading frame 3 on the reverse strand.
  YRVSMSIYTVKRYSLYKFIGLSFALIYGFFIVGSLQYLYSVGSGDINAYIDFFEDIDIFT
  TYNEYSIRGDGVFRVLVIFIGNYFNLEPITVLSYFAFIMSSLIFCIYAIHIRSTKYLIYI
  LPIFLMIFFTPMVSNLFASGIRSGISFTILMISFIYLK

Multiple Alignement

PROTOCOL



RESULTS ANALYSIS:


Once the list of results is very very reduced and the values are not very significant (0.46, 0.56, 0.75, 1.5, 1.7, 2.5, 3.6, 7.3, 7.4 and 9.9 for BLASTp and too for BLASTx 0.43, 3.6, 6.2 and 8.0), the possibility of alignment are practically zero, there is no possibility of studying the ingroup nor ougroup, ie the data are limited and insufficient to the aligment.

RAW RESULTS

Protein Domains

PROTOCOL


InterPro, default parameters at EBI



RESULTS ANALYSIS:


The results found in the protein domain not they seem to be true nor sigificantes, does not contain access number, without GO terms, nor E_Values,... show only that is probable that the protein is a signal-peptide and have 3 transmembrane_regions.


The results, not allow us to conclude about the function of the protein, maybe to reinforce the results of BLAST, where the results consider it a hypothetical protein.

RAW RESULTS

Translation	4E80403CBD644AF9	158	SignalPHMM	SignalP	signal-peptide	1	34	NA	?	17-Mar-2010	NULL	NULL
Translation	4E80403CBD644AF9	158	TMHMM	tmhmm	transmembrane_regions	21	41	NA	?	17-Mar-2010	NULL	NULL
Translation	4E80403CBD644AF9	158	TMHMM	tmhmm	transmembrane_regions	91	111	NA	?	17-Mar-2010	NULL	NULL
Translation	4E80403CBD644AF9	158	TMHMM	tmhmm	transmembrane_regions	113	131	NA	?	17-Mar-2010	NULL	NULL
Translation	4E80403CBD644AF9	158	TMHMM	tmhmm	transmembrane_regions	137	157	NA	?	17-Mar-2010	NULL	NULL

Phylogeny

PROTOCOL



RESULTS ANALYSIS:


The possibilities for making the trees are also virtually zero, since we do not have sufficient results and significant the enough to do the tree, the data are limited and E_Value much few significant. There are not results, for to do the ingroup, the outgroup the alignment and consequently much less the tree.





RAW RESULTS

Taxonomy report

PROTOCOL


BLASTp versus NR, defaut NCBI parametrs apart from "numbre of descrpitions _1000"




RESULTS ANALYSIS:


Probably the sequence belongs the class of alpha-proteobacteria or has some relationship with alpha-proteobacteria, but the possibilities are very low, since the list of BLAST (x and p) are very very reduced and E_Values are not very significant. Seeing by value of the score (37) can to have some significance.

RAW RESULTS: of BLASTp 

Lineage Report

cellular organisms
. Bacteria           [bacteria]
. . Rickettsiaceae     [a-proteobacteria]
. . . Wolbachia          [a-proteobacteria]
. . . . Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24 -   37 1 hit  [a-proteobacteria]  hypothetical protein Wendoof_01000008 [Wolbachia endosymbio
. . . . Wolbachia endosymbiont of Drosophila melanogaster .................   37 2 hits [a-proteobacteria]  hypothetical protein WD0854 [Wolbachia endosymbiont of Dros
. . . . Wolbachia sp. wRi .................................................   34 2 hits [a-proteobacteria]  Type IV secretion system protein VirB6, putative [Wolbachia
. . . Rickettsia massiliae MTU5 -------------------------------------------   33 2 hits [a-proteobacteria]  VirB6 [Rickettsia massiliae MTU5] >gi|157843947|gb|ABV84448
. . . Rickettsia felis URRWXCal2 ..........................................   33 2 hits [a-proteobacteria]  TrbL/VirB6 plasmid conjugative transfer protein [Rickettsia
. . . Rickettsia felis ....................................................   33 1 hit  [a-proteobacteria]  TrbL/VirB6 plasmid conjugative transfer protein [Rickettsia
. . Bacillus licheniformis ATCC 14580 -------------------------------------   36 4 hits [firmicutes]        butyrate kinase [Bacillus licheniformis ATCC 14580] >gi|527
. . Streptococcus mutans UA159 ............................................   35 2 hits [firmicutes]        putative cell division protein FtsH [Streptococcus mutans U
. . Bacillus pumilus SAFR-032 .............................................   33 2 hits [firmicutes]        butyrate kinase [Bacillus pumilus SAFR-032] >gi|157681671|g
. . Bacillus pumilus ATCC 7061 ............................................   33 2 hits [firmicutes]        butyrate kinase [Bacillus pumilus ATCC 7061] >gi|194011488|
. Anopheles gambiae str. PEST ---------------------------------------------   35 2 hits [flies]             AGAP009004-PA [Anopheles gambiae str. PEST] >gi|157013641|g
. Magnaporthe oryzae 70-15 ................................................   35 4 hits [ascomycetes]       hypothetical protein MGG_12697 [Magnaporthe grisea 70-15] >

BLAST

PROTOCOL


1) BLASTp versus NR, defaut NCBI parametrs apart from "numbre of descrpitions _1000"


2) BLASTx versus NR, defaut NCBI parametrs apart from "number of descptions _1000"


RESULTS ANALYSIS


To search for homologous proteins, we try to blastp (using the Translation of the chosen ORF) and BLASTX (using the DNA fragment).


The list of results of the BLAST was very very reduced, and E_Value are not significant (0.46, 0.56, 0.75, 1.5, 1.7, 2.5, 3.6, 7.3, 7.4 and 9.9 for BLASTp and too for BLASTx 0.43, 3.6, 6.2 and 8.0) what can to mean that the probability to have some homology with our sequence is low.


The few numbers of results, and despite of the E_Value not be significant, both in the BLASTp as in the BLASTX we can say that the ORF, contains homologus proteins with unknown function (protein hypothetical) and this values not allow have a significant conclusion .


We have the list of results for BLASTx and for BLASTp, followed after, by first 12 alignments

RAW RESULTS: 

1)BLASTp

Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_01315145.1|  hypothetical protein Wendoof_01000008 [Wol...  37.4    0.46 
ref|NP_966604.1|  hypothetical protein WD0854 [Wolbachia endos...  37.4    0.56 
ref|YP_079736.1|  butyrate kinase [Bacillus licheniformis ATCC...  37.0    0.75 
ref|XP_319753.4|  AGAP009004-PA [Anopheles gambiae str. PEST] ...  35.8    1.5  
ref|XP_001410347.1|  hypothetical protein MGG_12697 [Magnaport...  35.4    1.7  
ref|NP_720500.1|  putative cell division protein FtsH [Strepto...  35.0    2.5  
ref|YP_002727349.1|  Type IV secretion system protein VirB6, p...  34.7    3.6  
ref|YP_001487375.1|  butyrate kinase [Bacillus pumilus SAFR-03...  33.5    7.3  
ref|ZP_03055495.1|  butyrate kinase [Bacillus pumilus ATCC 706...  33.5    7.4  
ref|YP_001498995.1|  VirB6 [Rickettsia massiliae MTU5] >gb|ABV...  33.1    9.9  
ref|YP_246105.1|  TrbL/VirB6 plasmid conjugative transfer prot...  33.1    9.9  

ALIGNMENTS
>ref|ZP_01315145.1| hypothetical protein Wendoof_01000008 [Wolbachia endosymbiont 
of Drosophila willistoni TSC#14030-0811.24]
Length=1141

 Score = 37.4 bits (85),  Expect = 0.46, Method: Composition-based stats.
 Identities = 35/124 (28%), Positives = 55/124 (44%), Gaps = 14/124 (11%)

Query  40   SVGSGDINAYIDFFEDIDIFTTYNEYSIRGDGVFRVLVIFIGNYFNLEPITVLSYFAFIM  99
            S+  GD      F ED+  F  +  YS     V++    F+        + + + F  I+
Sbjct  323  SIAQGDEAKLFSFMEDM--FNKFFAYS-----VWKKFAAFLHYQMWASLLMIPAIFIGIV  375

Query  100  SSLIFCIYAIHI-----RSTKYLIYILPIFLM-IFFTPMVSNLFASGIRSGISFTILMIS  153
               + C+YA  I         +LI I+P+FL+ I F+P+ S LF   I+  ISF +  I 
Sbjct  376  LYFLLCLYAYIIFLSGFMGIAFLIAIMPLFLISILFSPLKS-LFEGWIKFCISFCLQSIM  434

Query  154  FIYL  157
               L
Sbjct  435  IFTL  438


>ref|NP_966604.1| hypothetical protein WD0854 [Wolbachia endosymbiont of Drosophila 
melanogaster]
 gb|AAS14538.1| membrane protein, putative [Wolbachia endosymbiont of Drosophila 
melanogaster]
Length=1242

 Score = 37.4 bits (85),  Expect = 0.56, Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 59/127 (46%), Gaps = 17/127 (13%)

Query  40   SVGSGDINAYIDFFEDIDIFTTYNEYSIRGDGVFRVLVIFIGNYFNLEPITVLSYFAFIM  99
            S+  GD      F ED+  F  +  YS     V++    F+        + + + F  I+
Sbjct  424  SIAQGDEAKLFSFMEDM--FNKFFAYS-----VWKKFAAFLHYQMWASLLMIPAIFIGIV  476

Query  100  SSLIFCIYAIHI-----RSTKYLIYILPIFLM-IFFTPMVSNLFASGIRSGISF---TIL  150
               + C+YA  I         +LI I+P+FL+ I F+P+ S LF   I+  ISF   +I+
Sbjct  477  LYFLLCLYAYIIFLSGFMGIAFLIAIMPLFLISILFSPLKS-LFEGWIKFCISFFLQSIM  535

Query  151  MISFIYL  157
            + + + L
Sbjct  536  IFTLLSL  542


>ref|YP_079736.1| butyrate kinase [Bacillus licheniformis ATCC 14580]
 ref|YP_092151.1| butyrate kinase [Bacillus licheniformis ATCC 14580]
 gb|AAU24098.1| branched-chain fatty-acid kinase (butyrate kinase) [Bacillus 
licheniformis ATCC 14580]
 gb|AAU41458.1| Buk [Bacillus licheniformis ATCC 14580]
Length=368

 Score = 37.0 bits (84),  Expect = 0.75, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 5/74 (6%)

Query  7    IYTVKRYSLYKFIGLSFALIYG----FFIVGSLQYLYSVGSGDINAYIDFFEDIDIFTTY  62
            IY    Y + K IG + A++ G      + G L Y  S  S  I  YID+  D+ +F   
Sbjct  277  IYEAMAYQIAKEIGAASAVLKGEVDVIILTGGLAYGKSFIS-SIRQYIDWISDVVVFPGE  335

Query  63   NEYSIRGDGVFRVL  76
            NE     +G FRVL
Sbjct  336  NELQALAEGAFRVL  349


>ref|XP_319753.4| AGAP009004-PA [Anopheles gambiae str. PEST]
 gb|EAA14843.4| AGAP009004-PA [Anopheles gambiae str. PEST]
Length=2137

 Score = 35.8 bits (81),  Expect = 1.5, Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 5/60 (8%)

Query  98    IMSSLIFCIYAIHIRSTKYLIYILPIFLMIFFTPMVSNLFASGIRSGISFTILMISFIYL  157
             I+SSLI CI  +      Y I  LP F+     PMVS    + ++SG  F IL  S + L
Sbjct  1690  ILSSLILCIGELCSHLGPYSINFLPRFM-----PMVSKFLHAQLQSGEPFDILTSSIVLL  1744


>ref|XP_001410347.1| hypothetical protein MGG_12697 [Magnaporthe grisea 70-15]
 ref|XP_001522072.1| hypothetical protein MGCH7_ch7g189 [Magnaporthe grisea 70-15]
 gb|EAQ70782.1| hypothetical protein MGCH7_ch7g189 [Magnaporthe grisea 70-15]
 gb|EDK02108.1| hypothetical protein MGG_12697 [Magnaporthe grisea 70-15]
Length=1019

 Score = 35.4 bits (80),  Expect = 1.7, Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 3/73 (4%)

Query  3    VSMSIYTVKRYSLYKFIGLSFALIYGFFIVGSLQYLYS-VGSGDINAYIDFFE--DIDIF  59
            +SM  Y V  YS   F G   + + G F +G L  +YS +G    N Y+DF +  D+ + 
Sbjct  786  ISMLGYVVNLYSATAFPGGQISNMLGAFTIGILANMYSRLGRHVYNYYLDFLDWWDVKVR  845

Query  60   TTYNEYSIRGDGV  72
              +   S R +GV
Sbjct  846  PRFQSASRRRNGV  858


>ref|NP_720500.1| putative cell division protein FtsH [Streptococcus mutans UA159]
 gb|AAN57806.1|AE014853_13 putative cell division protein FtsH [Streptococcus mutans UA159]
Length=656

 Score = 35.0 bits (79),  Expect = 2.5, Method: Composition-based stats.
 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 0/32 (0%)

Query  116  YLIYILPIFLMIFFTPMVSNLFASGIRSGISF  147
            +L+  LPIF+MIFF  M+ N    G R  +SF
Sbjct  137  FLMSFLPIFIMIFFFTMMLNQSGGGARGAMSF  168


>ref|YP_002727349.1| Type IV secretion system protein VirB6, putative [Wolbachia sp. 
wRi]
 gb|ACN95558.1| Type IV secretion system protein VirB6, putative [Wolbachia sp. 
wRi]
Length=1245

 Score = 34.7 bits (78),  Expect = 3.6, Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 54/124 (43%), Gaps = 14/124 (11%)

Query  40   SVGSGDINAYIDFFEDIDIFTTYNEYSIRGDGVFRVLVIFIGNYFNLEPITVLSYFAFIM  99
            S+   D      F ED+  F  +  YS     V++    F+        + + + F  I+
Sbjct  426  SIAQEDEAKLFSFMEDM--FNKFFAYS-----VWKKFAAFLHYQMWASLLMIPAIFIGIV  478

Query  100  SSLIFCIYAIHI-----RSTKYLIYILPIFLM-IFFTPMVSNLFASGIRSGISFTILMIS  153
               + C+YA  I         +LI I+P+FL+ I F+P+ S LF   I+  ISF +  I 
Sbjct  479  LYFLLCLYAYIIFLSGFMGIAFLIAIMPLFLISILFSPLKS-LFEGWIKFCISFCLQSIM  537

Query  154  FIYL  157
               L
Sbjct  538  IFTL  541


>ref|YP_001487375.1| butyrate kinase [Bacillus pumilus SAFR-032]
 gb|ABV62815.1| butyrate kinase [Bacillus pumilus SAFR-032]
Length=373

 Score = 33.5 bits (75),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 5/74 (6%)

Query  7    IYTVKRYSLYKFIGLSFALIYG----FFIVGSLQYLYSVGSGDINAYIDFFEDIDIFTTY  62
            IY    Y + K IG + A++ G      + G L Y   + S  I  +ID+  D+ ++   
Sbjct  277  IYEAMCYQIAKEIGAASAVLKGAVDVIVLTGGLAYSKQITS-SIRGHIDWISDVVVYPGE  335

Query  63   NEYSIRGDGVFRVL  76
            NE     +G  R+L
Sbjct  336  NELQSLAEGALRIL  349


>ref|ZP_03055495.1| butyrate kinase [Bacillus pumilus ATCC 7061]
 gb|EDW21057.1| butyrate kinase [Bacillus pumilus ATCC 7061]
Length=373

 Score = 33.5 bits (75),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 5/74 (6%)

Query  7    IYTVKRYSLYKFIGLSFALIYG----FFIVGSLQYLYSVGSGDINAYIDFFEDIDIFTTY  62
            IY    Y + K IG + A++ G      + G L Y   + S  I  +ID+  D+ ++   
Sbjct  277  IYEAMCYQIAKEIGAASAVLKGAVDVIVLTGGLAYSKQITS-SIRGHIDWISDVVVYPGE  335

Query  63   NEYSIRGDGVFRVL  76
            NE     +G  R+L
Sbjct  336  NELQSLAEGALRIL  349


>ref|YP_001498995.1| VirB6 [Rickettsia massiliae MTU5]
 gb|ABV84448.1| VirB6 [Rickettsia massiliae MTU5]
Length=1136

 Score = 33.1 bits (74),  Expect = 9.9, Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 5/62 (8%)

Query  88   PITVLSYFAFIMSSLIFCIYAIHIRSTKYLIYILPIFLMIFFTPMVSNLFASGIRSGISF  147
            P+ V+S  AF++++ I C+ +I I     L  + P+F+ +F      N F S ++  ISF
Sbjct  503  PLLVISVAAFMVNATIMCMISIVI-----LGILAPLFVPMFLFAYTRNYFDSWVKLMISF  557

Query  148  TI  149
             +
Sbjct  558  LL  559


>ref|YP_246105.1| TrbL/VirB6 plasmid conjugative transfer protein [Rickettsia felis 
URRWXCal2]
 sp|Q4UNB8.1|Y089_RICFE RecName: Full=Uncharacterized protein RF_0089; Flags: Precursor
 gb|AAY60940.1| TrbL/VirB6 plasmid Conjugative transfer protein [Rickettsia felis 
URRWXCal2]
Length=1138

 Score = 33.1 bits (74),  Expect = 9.9, Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 5/62 (8%)

Query  88   PITVLSYFAFIMSSLIFCIYAIHIRSTKYLIYILPIFLMIFFTPMVSNLFASGIRSGISF  147
            P+ V+S  AF++++ I C+ +I I     L  + P+F+ +F      N F S ++  ISF
Sbjct  503  PLLVISVAAFMVNATIMCMISIVI-----LGILAPLFVPMFLFTYTRNYFDSWVKLMISF  557

Query  148  TI  149
             +
Sbjct  558  LL  559

---------------------------------------------------------------------------------------------------------------------------------
2)BLASTX

Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|XP_726526.1|  hypothetical protein [Plasmodium yoelii yoel...  39.3    0.43 
ref|XP_746285.1|  hypothetical protein [Plasmodium chabaudi ch...  36.2    3.6  
ref|ZP_05108370.1|  peptidase family M23 [Polaribacter sp. MED...  35.4    6.2  
ref|XP_001350143.1|  hypothetical protein [Plasmodium falcipar...  35.0    8.0  

ALIGNMENTS
>ref|XP_726526.1| hypothetical protein [Plasmodium yoelii yoelii str. 17XNL]
 gb|EAA18091.1| hypothetical protein [Plasmodium yoelii yoelii]
Length=328

 Score = 39.3 bits (90),  Expect = 0.43
 Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 16/97 (16%)
 Frame = -2

Query  264  SISRLSYFYR*LL*FGAYNSIKLFRFHNVIFDFLHICNTYQIYKVFDLYITYISYDLLYT  85
            +I  L YF++ +  +   N   L    N IFD   ICN ++    FD+     SY+ LY 
Sbjct  190  NIHNLKYFFQHIEEYDMENLEHLDLSFNCIFDITPICNKFKNLIHFDM-----SYNYLYD  244

Query  84   Y-----------GIEFIRLRYKIWYFIYNTYDFFHIL  7
            Y            I+++ ++    YF  N YD  HIL
Sbjct  245  YKQIMNFSINHQKIQYLSIKCNSIYFNQNYYDHVHIL  281


>ref|XP_746285.1| hypothetical protein [Plasmodium chabaudi chabaudi]
 emb|CAH78883.1| conserved hypothetical protein [Plasmodium chabaudi chabaudi]
Length=1053

 Score = 36.2 bits (82),  Expect = 3.6
 Identities = 28/97 (28%), Positives = 43/97 (44%), Gaps = 16/97 (16%)
 Frame = -2

Query  264  SISRLSYFYR*LL*FGAYNSIKLFRFHNVIFDFLHICNTYQIYKVFDLYITYISYDLLYT  85
            +I  L +F++ +  +   N  KL    N IFD   I N ++    FD+     SY+ LY 
Sbjct  381  NIHNLKHFFQYIEEYDMENLEKLDLSFNCIFDITPIYNKFKNLIHFDM-----SYNYLYD  435

Query  84   Y-----------GIEFIRLRYKIWYFIYNTYDFFHIL  7
            Y            I+++ ++    YF  N YD  HIL
Sbjct  436  YKQIMNFSVNHQKIQYLSIKCNSIYFSQNDYDHVHIL  472


>ref|ZP_05108370.1| peptidase family M23 [Polaribacter sp. MED152]
 gb|EAQ40958.2| peptidase family M23 [Polaribacter sp. MED152]
Length=274

 Score = 35.4 bits (80),  Expect = 6.2
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 8/58 (13%)
 Frame = -2

Query  210  NSIKLFRFHNVIFDFLHICNTYQIYKVFDLYI---TYISYDLLYTYGIEFIR-LRYKI  49
            +SI++ +F     D L I N Y+    F+LY       SYD LY YG+ F++  RYKI
Sbjct  69   DSIRVLKFSTTEIDTLAILNKYK----FNLYYGESNLKSYDTLYNYGLPFLKGKRYKI  122


>ref|XP_001350143.1| hypothetical protein [Plasmodium falciparum 3D7]
 emb|CAD52552.1| conserved Plasmodium membrane protein, unknown function [Plasmodium 
falciparum 3D7]
Length=972

 Score = 35.0 bits (79),  Expect = 8.0
 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 12/82 (14%)
 Frame = -2

Query  210  NSIKLFRFHNVIFDFLHICNTYQIYKVFDLYITYIS--------YDLLYTYGIEFIRLRY  55
            NSIK     N+   F +IC  Y    +F+  I Y S        Y+L YTY  + + +++
Sbjct  379  NSIKYLNIINIKKSFYYICYLYYNSYIFNKSIYYCSLIFYLLQKYNLHYTYLYQILLIKF  438

Query  54   KIWYF----IYNTYDFFHILKG  1
             ++      IYN Y+   +L G
Sbjct  439  NLFLLKDRKIYNDYNKHILLYG  460