GOS 1484010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091118858429
Annotathon code: GOS_1484010
Sample :
  • GPS :1°15'51n; 90°17'42w
  • Galapagos Islands: 134 miles NE of Galapagos - Ecuador
  • Open Ocean (-2m, 27.8°C, 0.1-0.8 microns)
Authors
Team : Algarve
Username : CDL3
Annotated on : 2010-07-12 12:24:42
  • a34619 DallylAymardElKhoury1
  • a37000 CarlaAlexandraTavaresLopesVarela1
  • a37829 LiliaEneidaGóiaMendesCosta1

Synopsis

Genomic Sequence

>JCVI_READ_1091118858429 GOS_1484010 Genomic DNA
TGTTTGAGGTATAAGAGCAAGAAATACAGAAAAAGGTGTCTCAATTTTCAGACTTAATGATCATGTTGATAGATTATTTGCTTCAGCTGATTCATATAAT
TTAAAAATTCCGTACACTAAAGAAGTTATCTTCGAAGCAATAAAAGATGTTGTGAGCAAAAACAAGCTTCAATCGGCATACATCAGACCTTTAGTCTTTT
TTGGTGAAGGAGAAATGGGGCTTCTTCCAAAAGATGTTCCTGTGAGGGTTTCAATAGCAGCGTGGTACTGGGGAGCTTATTTAGGTGACGAGGCAGTCAA
TCAAGGTGTCAATGTTTGTATTTCAAGATGGAGAAGAATTAGTCCAACGAGTTTTATACCTTTAGCTAAAGGTGTGGGAGGCTACATGAACTCCACATTA
GCCAAGATTGATGCTGTTGAGAATGGTTATGATGATGCAATAATGTTGGGTGATGACGGAACAGTTGCTGAGGGCAGTGGACAAAATATTTTTATTGTTA
AAGATAATAATATTTTCACACCTCCAAATTCCACAGGTGCCCTAAATGGAATTACCAGAAGAACAGTAATTGAGATTGCTGAACAGAAAAATATACCAAT
TGAAGAAAAAAACCTTACTGTTGAAGATCTTAAAACTGCAGATGAGGTATTTTTTACTGGAACTGCAACGGGTGTTATTGGAGTAGTAAGTATTGATAAA
GATGATATATCTGATGGGCAGGTTGGAAAAATCACTTCAGACATAATTGATTCATATGAAGATGTGGTTAATGCAAAGGATGATAATTTTAAATCATATA
TAACATTGATTTAATGCCTCAAGAACCAAATATCAATTTAGATAAAATTAAAAGAATAAACGATCCGGTAATGCCTGTCCCGAGGAAAAACTCTAAAAGA
CTTGCAGAAAATCTTGATCCAAACGACAAAGAAGTTTTTGGAAGTACTGGACCAGACAGTG

Translation

[8 - 811/961]   direct strand
>GOS_1484010 Translation [8-811   direct strand]
GIRARNTEKGVSIFRLNDHVDRLFASADSYNLKIPYTKEVIFEAIKDVVSKNKLQSAYIRPLVFFGEGEMGLLPKDVPVRVSIAAWYWGAYLGDEAVNQG
VNVCISRWRRISPTSFIPLAKGVGGYMNSTLAKIDAVENGYDDAIMLGDDGTVAEGSGQNIFIVKDNNIFTPPNSTGALNGITRRTVIEIAEQKNIPIEE
KNLTVEDLKTADEVFFTGTATGVIGVVSIDKDDISDGQVGKITSDIIDSYEDVVNAKDDNFKSYITLI

[ Warning ] 5' incomplete: does not start with a Methionine

Annotator commentaries

Our ORF is responsible for encoding a particular protein belonging to the protein superfamily of aminotransferases, especially the Class IV, we can found two important enzymes,in this class, the aminotrasferase aminotrasferase D-alanine or glutamate pyruvate transaminase and 4-amino-4-deoxicorismato lyase .Both of this protein is involved in catalytic activity on metabolics processes like the proteins degradation and the synthesis of glucose on the liver ,when they are responsible for the transport of the amine group transfer of amino groups of amino acids to aldehydes.


About the molecular weight we can´t conclude, because our protein is incomplete, because it´s sequence does not start with a methionine /the 5' extremity its incomplete.


The BLAST ´s results were very favorables ,the lowest and biggest the e-value was 1e-66 and 8e-20 respectively , but our protein has been largely conserved over the time,and in spite of we have a significant e- value,it was difficult create a phylogenetic tree,because the taxons presented was extremely converged,so we can´t choose outgroups and our phylogenetic tree became less significant. And as such we can´t clearly define the taxonomic group that belongs to our sequence, because the node to which it belongs is not significant and the B value of 0.6 and as we know this to be significant value must be equal or less than 0.7 .





ORF finding

PROTOCOL

a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code


RESULTS ANALYSIS


In the forward strand we didn't found any ORF´s in frame 1 and frame 3, but in frame 2 we found one ORF.That ORF have 806 nucleotides.


In the reverse strand we didn´t found any ORF in frame 3,but we found one ORF in frame 1 and one ORF in frame 2.These Orf´s contains respectively 194 and 401 nucleotides.


The ORF who probably encodes our protein belongs to the first position of frame 2 , because that ORF is the biggest one, containing 806 nucleotides.Although this sequence is coding our protein isn´t complete because the the 5´ extremity sequence is incomplete which means the sequence don´t start with methionine.




RAW RESULTS

a)forward strand

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 8 to base 814.
GGTATAAGAGCAAGAAATACAGAAAAAGGTGTCTCAATTTTCAGACTTAATGATCATGTT
GATAGATTATTTGCTTCAGCTGATTCATATAATTTAAAAATTCCGTACACTAAAGAAGTT
ATCTTCGAAGCAATAAAAGATGTTGTGAGCAAAAACAAGCTTCAATCGGCATACATCAGA
CCTTTAGTCTTTTTTGGTGAAGGAGAAATGGGGCTTCTTCCAAAAGATGTTCCTGTGAGG
GTTTCAATAGCAGCGTGGTACTGGGGAGCTTATTTAGGTGACGAGGCAGTCAATCAAGGT
GTCAATGTTTGTATTTCAAGATGGAGAAGAATTAGTCCAACGAGTTTTATACCTTTAGCT
AAAGGTGTGGGAGGCTACATGAACTCCACATTAGCCAAGATTGATGCTGTTGAGAATGGT
TATGATGATGCAATAATGTTGGGTGATGACGGAACAGTTGCTGAGGGCAGTGGACAAAAT
ATTTTTATTGTTAAAGATAATAATATTTTCACACCTCCAAATTCCACAGGTGCCCTAAAT
GGAATTACCAGAAGAACAGTAATTGAGATTGCTGAACAGAAAAATATACCAATTGAAGAA
AAAAACCTTACTGTTGAAGATCTTAAAACTGCAGATGAGGTATTTTTTACTGGAACTGCA
ACGGGTGTTATTGGAGTAGTAAGTATTGATAAAGATGATATATCTGATGGGCAGGTTGGA
AAAATCACTTCAGACATAATTGATTCATATGAAGATGTGGTTAATGCAAAGGATGATAAT
TTTAAATCATATATAACATTGATTTAA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
GIRARNTEKGVSIFRLNDHVDRLFASADSYNLKIPYTKEVIFEAIKDVVSKNKLQSAYIR
PLVFFGEGEMGLLPKDVPVRVSIAAWYWGAYLGDEAVNQGVNVCISRWRRISPTSFIPLA
KGVGGYMNSTLAKIDAVENGYDDAIMLGDDGTVAEGSGQNIFIVKDNNIFTPPNSTGALN
GITRRTVIEIAEQKNIPIEEKNLTVEDLKTADEVFFTGTATGVIGVVSIDKDDISDGQVG
KITSDIIDSYEDVVNAKDDNFKSYITLI*

No ORFs were found in reading frame 3.

---------------------------------------------------------------------------------------------------

b)reverse strand
>ORF number 1 in reading frame 1 on the reverse strand extends from base 226 to base 420.
AGTGATTTTTCCAACCTGCCCATCAGATATATCATCTTTATCAATACTTACTACTCCAAT
AACACCCGTTGCAGTTCCAGTAAAAAATACCTCATCTGCAGTTTTAAGATCTTCAACAGT
AAGGTTTTTTTCTTCAATTGGTATATTTTTCTGTTCAGCAATCTCAATTACTGTTCTTCT
GGTAATTCCATTTAG

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
SDFSNLPIRYIIFINTYYSNNTRCSSSKKYLICSFKIFNSKVFFFNWYIFLFSNLNYCSS
GNSI*

>ORF number 1 in reading frame 2 on the reverse strand extends from base 152 to base 535.
ATCAATGTTATATATGATTTAAAATTATCATCCTTTGCATTAACCACATCTTCATATGAA
TCAATTATGTCTGAAGTGATTTTTCCAACCTGCCCATCAGATATATCATCTTTATCAATA
CTTACTACTCCAATAACACCCGTTGCAGTTCCAGTAAAAAATACCTCATCTGCAGTTTTA
AGATCTTCAACAGTAAGGTTTTTTTCTTCAATTGGTATATTTTTCTGTTCAGCAATCTCA
ATTACTGTTCTTCTGGTAATTCCATTTAGGGCACCTGTGGAATTTGGAGGTGTGAAAATA
TTATTATCTTTAACAATAAAAATATTTTGTCCACTGCCCTCAGCAACTGTTCCGTCATCA
CCCAACATTATTGCATCATCATAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
INVIYDLKLSSFALTTSSYESIMSEVIFPTCPSDISSLSILTTPITPVAVPVKNTSSAVL
RSSTVRFFSSIGIFFCSAISITVLLVIPFRAPVEFGGVKILLSLTIKIFCPLPSATVPSS
PNIIASS*

No ORFs were found in reading frame 3.

Multiple Alignement

PROTOCOL

a)Phylogeny.fr/CLUSTAL-MUSCLE

b)Phylogeny.fr/Gbbcks.091b


RESULTS ANALYSIS


With these results we can confirm the results of status traslation ,that the protein sequence does not contain start codon, methionine is not present at the 5´.

RAW RESULTS

CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


Methanoc_u      --------------------------------MKIYLDGKFVEKEDAKVSVYDHGLLYGD
Methanoc_c      -----------------------------MSELLIYYNGEFVPKGKATVSIYDHGFLYGD
Archaeoglo      -------------------------------MLYVYMDGEFVPENEAKVSIFDHGFLYGD
GOS_148401      ------------------------------------------------------------
Candidatus      --------------------------MDKSN-LKVWLNGKILDYGGAKVPILTHSLQYGS
Pyrobaculu      --------------------------MKPYA-KYIWLDGRILKWEDAKIHVLTHALHYGT
Nitrosopum      --------------------------MKEVG--KIWMNGKLVPFKDAKVHVLTHALHYST
Halothioba      ------------------------MSMADRD-GFIWFDGELIDWRSAQVHVLTHSLHYGM
Laribacter      ------------------------MSMADRD-GFIWYDGKLVPWRDATTHVLTHTLHYGM
Natrialba       ------------------------MGFDDMDVDTIWMDGEFVDWDDAQVHVLTHGLHYGS
Natronomon      ------------------------MAFEEMDVDTIWMDGEFVDWDEAQTHVLTHSLHYGT
Citrobacte      ------------------------MTTKKAD--YIWFNGEMIRWEDAKVHVMSHALHYGT
Methanothe      MRLWRALYRPPTITYPSKSPEVIIMSCEASG--KIWLNGEMVEWEEATVHVLSHVVHYGS
Methanob_v      ------------------------MAFDENG--KVWMDGEFVALKDAKISVLSHVIHYGS
Methanosph      ------------------------MAFDETG--KIWFNGELVDWKDAQIHVLSHVVHYGS
Methanob_i      ------------------------MAWDDSA-SKIWMDGNMVDWKDAKIHALSHVVHYGT
                                                                            

Methanoc_u      GVFEGIRAYEGV----VFKLEEHIERLYDSADSLAMKIPVSKVEIGEIVIETLKTNDLKD
Methanoc_c      GVFEGIRAYNGR----VFKLDEHVDRLYDSAKAIALEVPLTKAEMTEAILETLRKNNLTD
Archaeoglo      GVFEGIRAYNGR----VFRLKEHIDRLYDSAKAIDLEIPITKEEFMEIILETLRKNNLRD
GOS_148401      ----GIRARNTEKGVSIFRLNDHVDRLFASADSYNLKIPYTKEVIFEAIKDVVSKNKLQS
Candidatus      GIFEGIRAYKTESGPAIFRLSDHVRRFIETAKIYSINLGYGAKEIENAIIEVVLQNKLDS
Pyrobaculu      SIFEGIRGYWNGDNLLVFRLEEHIDRMYRSAKILGINIPYTREEVRQAVLETIKANNFRE
Nitrosopum      SIFEGIRCYNTPNGSAIFRLPEHVDRFFKSAKLYSMKMQFSKKEISDGIIKTVKASGLKE
Halothioba      GCFEGVRAYKTDRGTSIFRLEDHTRRLTNSARILGMPMPYSESVINEAHREVIRSNKLDS
Laribacter      GVFEGVRAYETGSGPAIFRLQDHTDRLFRSAHILGIGLPFSKDEINAAHLEVVKANQLKS
Natrialba       GIFEGARCYDTENGPAIFRWEEHLDRLFQSAKPYEMEIDHSREELTEATLELIRRQDLSS
Natronomon      GVFEGARCYDTEDGPALFRWEEHLDRLFESAKVLDHDIDHTHEEITDATLRLIREQGLES
Citrobacte      SVFEGIRCYDSHKGPVVFRHREHMQRLHDSAKIYRFPVSQSVDELMEACRDVIRKNNLTS
Methanothe      SVFEGIRCYRNSKGSAIFRLREHVKRLFDSAKIYRMDIPYTQEQICDAIVETVRENGLEE
Methanob_v      AVFEGIRCYETENGPAVFRLQDHVHRLFDSAKIYKMDIPFTEEEICDAIIETIKVNNLKS
Methanosph      SVFEGIRCYDTENGPAVFRLKDHMKRLEDSAKVYRMDIPYTRNELCEAVKDTININNIRS
Methanob_i      SVFEGIRAYDNKKGTCIFRLNEHVKRLFNSAKVYKIDIPYTQEEIAQAIRDTVKINELAS
                    * *         :*.  :*  *:  :*      :      .       :  . : .

Methanoc_u      A-YIRLVVTRGIGDLGLDPRKCPVPTVFCIAEAMKPLLGE----DGIKVITSSIRRLPVD
Methanoc_c      A-YIRPIVTRGIGDLGLDPRKCPIPSIYIISQEWGAMYGD-LYEVGLKAITVGIRRNAPD
Archaeoglo      A-YIRPIVTRGIGDLGLDPRKCQNPSIIVITKPWGKLYGD-LYEKGLTAITVAVRRNSFD
GOS_148401      A-YIRPLVFFGEGEMGLLPKDVPV-RVSIAAWYWGAYLGDEAVNQGVNVCISRWRRISPT
Candidatus      C-YIRPFAFYDDDDIGISVANKHV-SVYIAAIPFGKYFGS-AKDAGIRCKISSWKRINSD
Pyrobaculu      DVYIRPVAFVASQTVTLDIRNLEV-SLAVIVFPFGKYLSP----NGIKATIVSWRRVHNT
Nitrosopum      C-YIRPLAYYGYGTMGLTPTQNKV-DASISCWEWKMGESKAGKFSGAKCKVSSWIKIDSR
Halothioba      A-YMRPIVFYGSEGMGLRADNLKV-HVAVAAWEWGAYLGADNIQKGIRIKTSSYSRHHVN
Laribacter      C-YFRPMAFYGSGKLGVAPPANDV-HVIVAAWPWGAYLGEDGMQKGIRVKTSSFSRHHVN
Natrialba       C-YIRPVAFYGYNSLGVSPEDCPT-RTAIAAWPWGTYLGEEALEKGIDVMVSSWRKHASS
Natronomon      C-YIRPLVYYGYNSLGVSPEDCPT-KTMVACWPWGAYLGEDAIENGVDVMVSTWRKHASS
Citrobacte      A-YIRPLVFVGDVGMGVNPPPGYSTDVIIAAFPWGAYLGAEALDQGIDAMVSSWNRAAPN
Methanothe      C-YIRPVVFRGYGEMGVHPVNCPV-DVAVAAWEWGAYLGAEALEVGVDAGVSTWRRMAPN
Methanob_v      C-YIRPITYRGFGELGVNPLNCPV-ETTIAVWEWGAYIGEEEMEQGANIGISTWRKPAPG
Methanosph      C-YIRPVVFRGYKELGVYPMNCPI-ETVIAVWAWGQYLGEDALEQGIDVCTSSWRKMAPD
Methanob_i      C-YIRPIVFRGYGQLGVNPLSCPV-NTVIAAWEWGSYLGEEGMANGVDVGVSSWRKPAPD
                  *:* ..      : :                     .      *         .    

Methanoc_u      VLNPAVKSL-NYLNSILAKIQANYAGVEEAFLLDSEGYVAEGTGDNIFVIKNGKIKTPPL
Methanoc_c      ALSPNIKSL-NYLNNILAKIEANAKGGDEAIFLDQNGFVSEGSGDNIFVIKNGKIYTPPT
Archaeoglo      ALPPNIKSL-NYLNNILAKIEANAKGGDEAIFLDRNGYVSEGSGDNIFVVKNGAITTPPT
GOS_148401      SFIPLAKGVGGYMNSTLAKIDAVENGYDDAIMLGDDGTVAEGSGQNIFIVKDNNIFTPPN
Candidatus      ILPIRAKASGNYINSIIAGNEARASGYDEAILLSHNGYVAEGPGENIFIVRNGRLLTPGA
Pyrobaculu      MLPVMAKIGGIYVNSVLALVEARSRGFDEALLMDVNGYVVEGSGENIFIVRGGRLFTPPV
Nitrosopum      SQPTQAKAASNYANAALARMEALENGYDEAIMLNWHGKVAEGSAENIFVVKDDIIQTPPL
Halothioba      VTMCKAKSTGSYMNSMMALREATHDGYDEAMLLDTQGFVAEGSGENIFLVRDGILYTPDL
Laribacter      ITMCKAKANGNYMNSILANAEATRDGYDEALLLDVDGFVAEGSGENIFIIRRGKVYTPDL
Natrialba       QVPTNAKTTGLYANSLLAGEEARRNGYAEALVLNKEGNVAEGPGENIFLVRDGEIFTPGL
Natronomon      QIPTNVKATGPYINSMLAGEEARRNGYVEAIVLNKEGKVAEGPGENIFMVNDGEIYTTGL
Citrobacte      TIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENLFEVKDGVLFTPPF
Methanothe      TMPNMAKAGGNYLNSQLAKMEAVRHGYDEAIMLDYHGYISEGSGENIFLVSEGEIYTPPV
Methanob_v      TLPVLAKAAANYMNSQLANLEAGEHGYDEAIQLDYHGHVAEGSGENIFIVEKGKIVTPDL
Methanosph      TMPNLAKAGSNYMNSQLAKIEATTNGYKESIMLNYEGTVGEGTGENIFFVEDGELYTPDI
Methanob_i      TFPTLAKCGANYMNSQLAKLEAIDHGYEEAIMLDYEGHVSEGSGENIFIIEDGVLYTPSM
                      *    * .  :.  :*   *  :.: :.  * : **..:*:* :  . : *.  

Methanoc_u      SSSVLKGITRDTVVDLANEAGYTIIEE-KMTLHDLFVADEIFITGTAAELIHVVEIDGRK
Methanoc_c      INN-LKGITRATAIELLEERGYEVVVQ-NLGLFDMYTADEIFVTGTAAEAAPITLLDGRK
Archaeoglo      INN-LRGITREAVIEIINRLGIPFKET-NIGLYDLYTADEVFVTGTAAEIAPIVVIDGRK
GOS_148401      STGALNGITRRTVIEIAEQKNIPIEEK-NLTVEDLKTADEVFFTGTATGVIGVVSIDKDD
Candidatus      DSDILFGVTRDTIIKVAPKLGIPVMEG-NIHKEELYIAEEAFFSGTAAEITPIINIDGIK
Pyrobaculu      HESILEGITRDTVIKLSGDVGLRVEEK-PITREEVYTADEVFLVGTAAEITPVVEVDGRT
Nitrosopum      SAGGLEGITRDSVIQIIEENGGFVIER-DLERDDLYAADEIFMTGTAAEVKSVTQIDKVK
Halothioba      TAA-LDGITRRTIMILAKRFGYEVIEK-RITRDEVYIADEAFFTGTAAEVTPIREVDNRP
Laribacter      TSA-LEGITRDTVCTILADMGLELVEK-RITRDEVYSADEAFFTGTAAEVTPIRELDGRQ
Natrialba       SESILDGITRNTVITLAEDLGYTVHDNVSISRGELNTADELFFTGSAAEVTPIRKIDNVT
Natronomon      SESILDGITRDTVIELARDLGYTVHDEAAIGRGQLYTADELFFTGTAAEVTPIRSVDDTE
Citrobacte      TSSALPGITRDAIIKLAKELDIEVREQ-VLSRESLYLADEVFMSGTAAEITPVRSVDGIQ
Methanothe      SSSLLRGITRDSVIKIARTEGVTVHEE-PITREMLYIADEAFFTGTAAEITPIRSVDGIE
Methanob_v      GSSILQGITRDSIMTIAKDLGYEVSQE-TISRERLYLADEVFFTGSAAEVTPIRAIDNRQ
Methanosph      GSSVLKGITRNTIITIAEDLGYKVREE-TIPRERLYTADEVFFSGTAAELSPIRSIDKIQ
Methanob_i      DSSNLKGITRESIKQLANDLGYEVVEE-RISRERLYFADEVFFSGTAAEVTPIRSIDHKI
                    * *:** :   :    .  .     :    :  *:* *. *:*:    :  :*   

Methanoc_u      IYNGKLGPITKDLSDRFKEIRSKI-GKKYIE---------
Methanoc_c      IGDGSVGPITKAAVAAFEEVTGTI-GTPIFE---------
Archaeoglo      IGDGKPGEITRKLMEEFSKLTESE-GVPIYE---------
GOS_148401      ISDGQVGKITSDIIDSYEDVVNAK-DDNFKSYITLI----
Candidatus      IGSGSSGQITKKISEYYESIVSGK-APESKDWLTKVQ---
Pyrobaculu      IGTGKPGPITTKIAELYSNVVRGK-VEKYLNWITPVY---
Nitrosopum      IGNGKMGHITKALQKSFTDVVMGK-DERFLPWLTYI----
Halothioba      IGSGSRGPITERLQSAYFDIVHGRFDSEFDGWLDFTEVRA
Laribacter      IGAGSRGPITAEIQSRYFAIVKGE-DSTHRDWLTWVK---
Natrialba       IGDGSRGPVTEDVQSRFFDVVERT-TDEYDEWFQYV----
Natronomon      IGNGGRGPVTEEIQQRFFDLVDGK-LDGYDEWFLPVETE-
Citrobacte      VGEGRCGPVTKRIQQAFFGLFTGE-TEDKWGWLDQVNP--
Methanothe      IGAGRRGPVTKLLQDEFFRIIRAE-TEDSFGWLTYI----
Methanob_v      IGIGSRGPVTKELQEKYFDAVNGR-SEDIHNWLTYVE---
Methanosph      IGKGKRGPVTKEIQDSLFDIVNNK-VEDKYGWLDFI----
Methanob_i      IGAGKRGPISEELQKTFFDIVEGK-KEDKFGWLDYV----
                :  *  * ::                              


Processed file: input.fasta
Number of sequences: 16
Alignment assumed to be: Protein
New number of positions: 215 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
Methanococcus_m  --------------------------------MKIYLDGKFVEKEDAKVSVYDHGLLYGD
Methanococcoide  -----------------------------MSELLIYYNGEFVPKGKATVSIYDHGFLYGD
Archaeoglobus_f  -------------------------------MLYVYMDGEFVPENEAKVSIFDHGFLYGD
GOS_1484010_Gen  ------------------------------------------------------------
Candidatus_Micr  --------------------------MDKSN-LKVWLNGKILDYGGAKVPILTHSLQYGS
Pyrobaculum_aer  --------------------------MKPYA-KYIWLDGRILKWEDAKIHVLTHALHYGT
Nitrosopumilus   --------------------------MKEVG--KIWMNGKLVPFKDAKVHVLTHALHYST
Halothiobacillu  ------------------------MSMADRD-GFIWFDGELIDWRSAQVHVLTHSLHYGM
Laribacter_hong  ------------------------MSMADRD-GFIWYDGKLVPWRDATTHVLTHTLHYGM
Natrialba_magad  ------------------------MGFDDMDVDTIWMDGEFVDWDDAQVHVLTHGLHYGS
Natronomonas_ph  ------------------------MAFEEMDVDTIWMDGEFVDWDEAQTHVLTHSLHYGT
Citrobacter_kos  ------------------------MTTKKAD--YIWFNGEMIRWEDAKVHVMSHALHYGT
Methanothermoba  MRLWRALYRPPTITYPSKSPEVIIMSCEASG--KIWLNGEMVEWEEATVHVLSHVVHYGS
Methanobrevib_t  ------------------------MAFDENG--KVWMDGEFVALKDAKISVLSHVIHYGS
Methanosphaera   ------------------------MAFDETG--KIWFNGELVDWKDAQIHVLSHVVHYGS
Methanobrevib_e  ------------------------MAWDDSA-SKIWMDGNMVDWKDAKIHALSHVVHYGT
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
Methanococcus_m  GVFEGIRAYEGV----VFKLEEHIERLYDSADSLAMKIPVSKVEIGEIVIETLKTNDLKD
Methanococcoide  GVFEGIRAYNGR----VFKLDEHVDRLYDSAKAIALEVPLTKAEMTEAILETLRKNNLTD
Archaeoglobus_f  GVFEGIRAYNGR----VFRLKEHIDRLYDSAKAIDLEIPITKEEFMEIILETLRKNNLRD
GOS_1484010_Gen  ----GIRARNTEKGVSIFRLNDHVDRLFASADSYNLKIPYTKEVIFEAIKDVVSKNKLQS
Candidatus_Micr  GIFEGIRAYKTESGPAIFRLSDHVRRFIETAKIYSINLGYGAKEIENAIIEVVLQNKLDS
Pyrobaculum_aer  SIFEGIRGYWNGDNLLVFRLEEHIDRMYRSAKILGINIPYTREEVRQAVLETIKANNFRE
Nitrosopumilus   SIFEGIRCYNTPNGSAIFRLPEHVDRFFKSAKLYSMKMQFSKKEISDGIIKTVKASGLKE
Halothiobacillu  GCFEGVRAYKTDRGTSIFRLEDHTRRLTNSARILGMPMPYSESVINEAHREVIRSNKLDS
Laribacter_hong  GVFEGVRAYETGSGPAIFRLQDHTDRLFRSAHILGIGLPFSKDEINAAHLEVVKANQLKS
Natrialba_magad  GIFEGARCYDTENGPAIFRWEEHLDRLFQSAKPYEMEIDHSREELTEATLELIRRQDLSS
Natronomonas_ph  GVFEGARCYDTEDGPALFRWEEHLDRLFESAKVLDHDIDHTHEEITDATLRLIREQGLES
Citrobacter_kos  SVFEGIRCYDSHKGPVVFRHREHMQRLHDSAKIYRFPVSQSVDELMEACRDVIRKNNLTS
Methanothermoba  SVFEGIRCYRNSKGSAIFRLREHVKRLFDSAKIYRMDIPYTQEQICDAIVETVRENGLEE
Methanobrevib_t  AVFEGIRCYETENGPAVFRLQDHVHRLFDSAKIYKMDIPFTEEEICDAIIETIKVNNLKS
Methanosphaera   SVFEGIRCYDTENGPAVFRLKDHMKRLEDSAKVYRMDIPYTRNELCEAVKDTININNIRS
Methanobrevib_e  SVFEGIRAYDNKKGTCIFRLNEHVKRLFNSAKVYKIDIPYTQEEIAQAIRDTVKINELAS
                                  ###########################################


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
Methanococcus_m  A-YIRLVVTRGIGDLGLDPRKCPVPTVFCIAEAMKPLLGE----DGIKVITSSIRRLPVD
Methanococcoide  A-YIRPIVTRGIGDLGLDPRKCPIPSIYIISQEWGAMYGD-LYEVGLKAITVGIRRNAPD
Archaeoglobus_f  A-YIRPIVTRGIGDLGLDPRKCQNPSIIVITKPWGKLYGD-LYEKGLTAITVAVRRNSFD
GOS_1484010_Gen  A-YIRPLVFFGEGEMGLLPKDVPV-RVSIAAWYWGAYLGDEAVNQGVNVCISRWRRISPT
Candidatus_Micr  C-YIRPFAFYDDDDIGISVANKHV-SVYIAAIPFGKYFGS-AKDAGIRCKISSWKRINSD
Pyrobaculum_aer  DVYIRPVAFVASQTVTLDIRNLEV-SLAVIVFPFGKYLSP----NGIKATIVSWRRVHNT
Nitrosopumilus   C-YIRPLAYYGYGTMGLTPTQNKV-DASISCWEWKMGESKAGKFSGAKCKVSSWIKIDSR
Halothiobacillu  A-YMRPIVFYGSEGMGLRADNLKV-HVAVAAWEWGAYLGADNIQKGIRIKTSSYSRHHVN
Laribacter_hong  C-YFRPMAFYGSGKLGVAPPANDV-HVIVAAWPWGAYLGEDGMQKGIRVKTSSFSRHHVN
Natrialba_magad  C-YIRPVAFYGYNSLGVSPEDCPT-RTAIAAWPWGTYLGEEALEKGIDVMVSSWRKHASS
Natronomonas_ph  C-YIRPLVYYGYNSLGVSPEDCPT-KTMVACWPWGAYLGEDAIENGVDVMVSTWRKHASS
Citrobacter_kos  A-YIRPLVFVGDVGMGVNPPPGYSTDVIIAAFPWGAYLGAEALDQGIDAMVSSWNRAAPN
Methanothermoba  C-YIRPVVFRGYGEMGVHPVNCPV-DVAVAAWEWGAYLGAEALEVGVDAGVSTWRRMAPN
Methanobrevib_t  C-YIRPITYRGFGELGVNPLNCPV-ETTIAVWEWGAYIGEEEMEQGANIGISTWRKPAPG
Methanosphaera   C-YIRPVVFRGYKELGVYPMNCPI-ETVIAVWAWGQYLGEDALEQGIDVCTSSWRKMAPD
Methanobrevib_e  C-YIRPIVFRGYGQLGVNPLSCPV-NTVIAAWEWGSYLGEEGMANGVDVGVSSWRKPAPD
                 # ######################    ###########      ###############


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
Methanococcus_m  VLNPAVKSL-NYLNSILAKIQANYAGVEEAFLLDSEGYVAEGTGDNIFVIKNGKIKTPPL
Methanococcoide  ALSPNIKSL-NYLNNILAKIEANAKGGDEAIFLDQNGFVSEGSGDNIFVIKNGKIYTPPT
Archaeoglobus_f  ALPPNIKSL-NYLNNILAKIEANAKGGDEAIFLDRNGYVSEGSGDNIFVVKNGAITTPPT
GOS_1484010_Gen  SFIPLAKGVGGYMNSTLAKIDAVENGYDDAIMLGDDGTVAEGSGQNIFIVKDNNIFTPPN
Candidatus_Micr  ILPIRAKASGNYINSIIAGNEARASGYDEAILLSHNGYVAEGPGENIFIVRNGRLLTPGA
Pyrobaculum_aer  MLPVMAKIGGIYVNSVLALVEARSRGFDEALLMDVNGYVVEGSGENIFIVRGGRLFTPPV
Nitrosopumilus   SQPTQAKAASNYANAALARMEALENGYDEAIMLNWHGKVAEGSAENIFVVKDDIIQTPPL
Halothiobacillu  VTMCKAKSTGSYMNSMMALREATHDGYDEAMLLDTQGFVAEGSGENIFLVRDGILYTPDL
Laribacter_hong  ITMCKAKANGNYMNSILANAEATRDGYDEALLLDVDGFVAEGSGENIFIIRRGKVYTPDL
Natrialba_magad  QVPTNAKTTGLYANSLLAGEEARRNGYAEALVLNKEGNVAEGPGENIFLVRDGEIFTPGL
Natronomonas_ph  QIPTNVKATGPYINSMLAGEEARRNGYVEAIVLNKEGKVAEGPGENIFMVNDGEIYTTGL
Citrobacter_kos  TIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENLFEVKDGVLFTPPF
Methanothermoba  TMPNMAKAGGNYLNSQLAKMEAVRHGYDEAIMLDYHGYISEGSGENIFLVSEGEIYTPPV
Methanobrevib_t  TLPVLAKAAANYMNSQLANLEAGEHGYDEAIQLDYHGHVAEGSGENIFIVEKGKIVTPDL
Methanosphaera   TMPNLAKAGSNYMNSQLAKIEATTNGYKESIMLNYEGTVGEGTGENIFFVEDGELYTPDI
Methanobrevib_e  TFPTLAKCGANYMNSQLAKLEAIDHGYEEAIMLDYEGHVSEGSGENIFIIEDGVLYTPSM
                 #######   ##################################################


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
Methanococcus_m  SSSVLKGITRDTVVDLANEAGYTIIEE-KMTLHDLFVADEIFITGTAAELIHVVEIDGRK
Methanococcoide  INN-LKGITRATAIELLEERGYEVVVQ-NLGLFDMYTADEIFVTGTAAEAAPITLLDGRK
Archaeoglobus_f  INN-LRGITREAVIEIINRLGIPFKET-NIGLYDLYTADEVFVTGTAAEIAPIVVIDGRK
GOS_1484010_Gen  STGALNGITRRTVIEIAEQKNIPIEEK-NLTVEDLKTADEVFFTGTATGVIGVVSIDKDD
Candidatus_Micr  DSDILFGVTRDTIIKVAPKLGIPVMEG-NIHKEELYIAEEAFFSGTAAEITPIINIDGIK
Pyrobaculum_aer  HESILEGITRDTVIKLSGDVGLRVEEK-PITREEVYTADEVFLVGTAAEITPVVEVDGRT
Nitrosopumilus   SAGGLEGITRDSVIQIIEENGGFVIER-DLERDDLYAADEIFMTGTAAEVKSVTQIDKVK
Halothiobacillu  TAA-LDGITRRTIMILAKRFGYEVIEK-RITRDEVYIADEAFFTGTAAEVTPIREVDNRP
Laribacter_hong  TSA-LEGITRDTVCTILADMGLELVEK-RITRDEVYSADEAFFTGTAAEVTPIRELDGRQ
Natrialba_magad  SESILDGITRNTVITLAEDLGYTVHDNVSISRGELNTADELFFTGSAAEVTPIRKIDNVT
Natronomonas_ph  SESILDGITRDTVIELARDLGYTVHDEAAIGRGQLYTADELFFTGTAAEVTPIRSVDDTE
Citrobacter_kos  TSSALPGITRDAIIKLAKELDIEVREQ-VLSRESLYLADEVFMSGTAAEITPVRSVDGIQ
Methanothermoba  SSSLLRGITRDSVIKIARTEGVTVHEE-PITREMLYIADEAFFTGTAAEITPIRSVDGIE
Methanobrevib_t  GSSILQGITRDSIMTIAKDLGYEVSQE-TISRERLYLADEVFFTGSAAEVTPIRAIDNRQ
Methanosphaera   GSSVLKGITRNTIITIAEDLGYKVREE-TIPRERLYTADEVFFSGTAAELSPIRSIDKIQ
Methanobrevib_e  DSSNLKGITRESIKQLANDLGYEVVEE-RISRERLYFADEVFFSGTAAEVTPIRSIDHKI
                 ### ######################   ###############################


                        310       320       330       340
                 =========+=========+=========+=========+
Methanococcus_m  IYNGKLGPITKDLSDRFKEIRSKI-GKKYIE---------
Methanococcoide  IGDGSVGPITKAAVAAFEEVTGTI-GTPIFE---------
Archaeoglobus_f  IGDGKPGEITRKLMEEFSKLTESE-GVPIYE---------
GOS_1484010_Gen  ISDGQVGKITSDIIDSYEDVVNAK-DDNFKSYITLI----
Candidatus_Micr  IGSGSSGQITKKISEYYESIVSGK-APESKDWLTKVQ---
Pyrobaculum_aer  IGTGKPGPITTKIAELYSNVVRGK-VEKYLNWITPVY---
Nitrosopumilus   IGNGKMGHITKALQKSFTDVVMGK-DERFLPWLTYI----
Halothiobacillu  IGSGSRGPITERLQSAYFDIVHGRFDSEFDGWLDFTEVRA
Laribacter_hong  IGAGSRGPITAEIQSRYFAIVKGE-DSTHRDWLTWVK---
Natrialba_magad  IGDGSRGPVTEDVQSRFFDVVERT-TDEYDEWFQYV----
Natronomonas_ph  IGNGGRGPVTEEIQQRFFDLVDGK-LDGYDEWFLPVETE-
Citrobacter_kos  VGEGRCGPVTKRIQQAFFGLFTGE-TEDKWGWLDQVNP--
Methanothermoba  IGAGRRGPVTKLLQDEFFRIIRAE-TEDSFGWLTYI----
Methanobrevib_t  IGIGSRGPVTKELQEKYFDAVNGR-SEDIHNWLTYVE---
Methanosphaera   IGKGKRGPVTKEIQDSLFDIVNNK-VEDKYGWLDFI----
Methanobrevib_e  IGAGKRGPISEELQKTFFDIVEGK-KEDKFGWLDYV----
                 ##########                              






Parameters used
Minimum Number Of Sequences For A Conserved Position: 9
Minimum Number Of Sequences For A Flanking Position: 14
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes


Flank positions of the 7 selected block(s)
Flanks: [78  121]  [123  144]  [149  159]  [166  187]  [191  243]  [245  266]  [270  310]  

New number of positions in input.fasta-gb:  215  (63% of the original 340 positions)




Protein Domains

PROTOCOL

a)InterPro default parametrs EBI


RESULTS ANALYSIS


After realizing the demand for protein domains in InterPro program we found six results,who pointing to the same biological function of our protein,seems to be that our protein is involved in catalytic activity.


One of these six results don´t present any e - value,but in the outhers five results the e -values found were 4.2e-98,2e-45,3.5e-80,3.5e-80,3.3e-80, which correspond respectively to the serial number of InterPro:IPR005785,IPR001544,IPR001544,IPR001544,IPR018300.


Analyzing all results the only what seems more significant is IPR001544,who has the second lowest e-value (3.3e-80) ,the results indicate that our protein belong to superfamily of Aminotransferase class IV that is associated with the biological process of catalytic activity.

We chose that domanin and no the IPR005785, the domain the the lowest e-value (4.2e-98), because the first result has more information about the sequence.

RAW RESULTS

1)InterPro

GOS_1484010	BAFB2010C54C3F3F	268	PatternScan	PS00770	AA_TRANSFER_CLASS_4	155	184	NA	T	23-Apr-2010	IPR018300	Aminotransferase, class IV, conserved site	Molecular Function: catalytic activity (GO:0003824), Biological Process: metabolic process (GO:0008152)
GOS_1484010	BAFB2010C54C3F3F	268	HMMTigr	TIGR01122	ilvE_I: branched-chain amino acid aminotran	1	268	4.2e-98	T	23-Apr-2010	IPR005785	Branched-chain amino acid aminotransferase I	Molecular Function: branched-chain-amino-acid transaminase activity (GO:0004084), Biological Process: branched chain family amino acid metabolic process (GO:0009081)
GOS_1484010	BAFB2010C54C3F3F	268	HMMPfam	PF01063	Aminotran_4	14	249	2e-45	T	23-Apr-2010	IPR001544	Aminotransferase, class IV	Molecular Function: catalytic activity (GO:0003824), Biological Process: metabolic process (GO:0008152)
GOS_1484010	BAFB2010C54C3F3F	268	Gene3D	G3DSA:3.30.470.10	no description	13	90	2.1e-13	T	23-Apr-2010	NULL	NULL	
GOS_1484010	BAFB2010C54C3F3F	268	Gene3D	G3DSA:3.20.10.10	no description	99	268	5.5e-46	T	23-Apr-2010	NULL	NULL	
GOS_1484010	BAFB2010C54C3F3F	268	superfamily	SSF56752	D-aminoacid aminotransferase-like PLP-dependent enzymes	1	266	3.3e-80	T	23-Apr-2010	IPR001544	Aminotransferase, class IV	Molecular Function: catalytic activity (GO:0003824), Biological Process: metabolic process (GO:0008152)
GOS_1484010	BAFB2010C54C3F3F	268	HMMPanther	PTHR11825:SF7	BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE	1	268	3.5e-80	T	23-Apr-2010	NULL	NULL	
GOS_1484010	BAFB2010C54C3F3F	268	HMMPanther	PTHR11825	SUBGROUP IIII AMINOTRANSFERASE	1	268	3.5e-80	T	23-Apr-2010	IPR001544	Aminotransferase, class IV	Molecular Function: catalytic activity (GO:0003824), Biological Process: metabolic process (GO:0008152)
















































Phylogeny

PROTOCOL

a) Phylogeny.fr / BioNJ method / outgroup :none chosen


RESULTS ANALYSIS


Our results were too converged ,the taxonomic groups founded in the Lineage Report don´t differs much so we don´t can´t chose outgroups.


The fact that this tree has been made without the outgroups, has made little meaningful and how we see the bootsrap that our sequence belongs to has a value of 0.6,this result isn´t significative,so is impossible to diagnose the taxonomic group which belongs to our sequence, althoug the Nitrosopumilus_maritimus belongs to the same nodes.

RAW RESULTS


                ------0.1-----
 
                                 +------------------------------------------Methanococcoides_burtonii_DSM_6242_in         [euryarchaeotes]
                1.0              | 
    +---------------------------+      1.0         +---------------------Methanococcus_maripaludis_C5_in                  [euryarchaeotes]
 0.3|                            +-----------------+
 +-+                                               +----------------------Archaeoglobus_fulgidus_DSM_4304_in              [euryarchaeotes]
 | |
 | |
 | +---------------------------------------------------------Pyrobaculum_aerophilum_str._IM2_in                           [crenarchaeotes]
 |
 |                        +---------------------------Methanothermobacter_thermautotrophicus_str._Delta_H_in              [euryarchaeotes]
 |                    0.7 |
 |                   +----+     +----------------------------Methanobrevibacter_ruminantium_M1_in                         [euryarchaeotes] 
 |                   |    | 0.9 |
 |                0.4|    +-----+0.4+-------------------------------Methanosphaera_stadtmanae_DSM_3091_in                 [euryarchaeotes]
 |                 +-+          +---+
 |                 | |              +-------------------------Methanobrevibacter_smithii_ATCC_35061_in                    [euryarchaeotes]
 |                 | |
 |            0.7  | |
 |         +-------+ +---------------------------------------------------------Citrobacter_koseri_ATCC_BAA-895_in \       [enterobacteria]   
 |         |       |
 |         |       |              1.0                +---------------Natrialba_magadii_ATCC_43099_in                      [euryarchaeotes]
 |      0.3|       +---------------------------------+
 |     +---+                                         +--------------------Natronomonas_pharaonis_DSM_2160_in              [euryarchaeotes]
 |     |   |
 |     |   |   +-----------------------------------------------------------Candidatus_Micrarchaeum_acidiphilum_ARMAN-2_in [euryarchaeotes]
 |     |   |0.1|
 | 0.1 |   +-- +         1.0           +--------------------------------Halothiobacillus_neapolitanus_c2_in                [g-proteobacteria] 
 +-----+       +-----------------------+
       |                               |
       |                               +---------------------------Laribacter_hongkongensis_HLHK9_in                       [b-proteobacteria]
       |
       |  0.6   +-----------------------------------------------------------GOS_1484010_Genomic_DNA
       +--------+
                +-----------------------------------------------------------------Nitrosopumilus_maritimus_SCM1_in        [archaea]  



Taxonomy report

PROTOCOL

a)BLASTP vs NR. default NCBI parameters * '1000 Max target sequence '


RESULTS ANALYSIS


For our study group we chose the reign of Archaea,our ingroups are :


>Methanothermobacter thermautotrophicus str. Delta H

>Methanosphaera stadtmanae DSM 3091

>Methanobrevibacter smithii ATCC 35061

>Methanobrevibacter ruminantium M1

>Natrialba magadii ATCC 43099

>Nitrosopumilus maritimus SCM1

>Halothiobacillus neapolitanus c2

>Laribacter hongkongensis HLHK9

>Natronomonas pharaonis DSM 2160

>Citrobacter koseri ATCC BAA-895

>Candidatus Micrarchaeum acidiphilum ARMAN-2

>Pyrobaculum aerophilum str. IM2

>Methanococcoides burtonii DSM 6242

>Archaeoglobus fulgidus DSM 4304

>Methanococcus maripaludis C5

RAW RESULTS

a)BLASTp

Lineage Report

root
. cellular organisms
. . Archaea             [archaea]
. . . Euryarchaeota       [euryarchaeotes]
. . . . Methanobacteriaceae [euryarchaeotes]
. . . . . Methanothermobacter thermautotrophicus str. Delta H ----------------  257  3 hits [euryarchaeotes]         branched-chain amino-acid aminotransferase [Methanothermoba
. . . . . Methanosphaera stadtmanae DSM 3091 .................................  254  2 hits [euryarchaeotes]         hypothetical protein Msp_0015 [Methanosphaera stadtmanae DS
. . . . . Methanobrevibacter smithii ATCC 35061 ..............................  246  2 hits [euryarchaeotes]         branched-chain-amino-acid aminotransferase, IlvE [Methanobr
. . . . . Methanobrevibacter smithii DSM 2375 ................................  246  2 hits [euryarchaeotes]         hypothetical protein METSMIALI_01133 [Methanobrevibacter sm
. . . . . Methanobrevibacter smithii DSM 2374 ................................  246  2 hits [euryarchaeotes]         hypothetical protein METSMIALI_01133 [Methanobrevibacter sm
. . . . . Methanobrevibacter ruminantium M1 ..................................  241  2 hits [euryarchaeotes]         branched-chain-amino-acid aminotransferase IlvE [Methanobre
. . . . Haloquadratum walsbyi DSM 16790 --------------------------------------  237  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Haloquadratum w
. . . . Halorhabdus utahensis DSM 12940 ......................................  236  4 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Halorhabdus uta
. . . . Haloterrigena turkmenica DSM 5511 ....................................  229  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Haloterrigena t
. . . . Haloarcula marismortui ATCC 43049 ....................................  228  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Haloarcula mari
. . . . Halorubrum lacusprofundi ATCC 49239 ..................................  227  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Halorubrum lacu
. . . . Natrialba magadii ATCC 43099 .........................................  226  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Natrialba magad
. . . . Halogeometricum borinquense DSM 11551 ................................  222  2 hits [euryarchaeotes]         branched chain amino acid aminotransferase [Halogeometricum
. . . . Halomicrobium mukohataei DSM 12286 ...................................  221  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Halomicrobium m
. . . . Halobacterium sp. NRC-1 ..............................................  216  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Halobacterium s
. . . . Halobacterium salinarum R1 ...........................................  216  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Halobacterium s
. . . . Natronomonas pharaonis DSM 2160 ......................................  209  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Natronomonas ph
. . . . Candidatus Micrarchaeum acidiphilum ARMAN-2 ..........................  196  1 hit  [euryarchaeotes]         branched-chain amino acid aminotransferase [Candidatus Micr
. . . . Methanopyrus kandleri AV19 ...........................................  185  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Methanopyrus ka
. . . . Methanoculleus marisnigri JR1 ........................................  182  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Methanoculleus 
. . . . Methanococcoides burtonii DSM 6242 ...................................  179  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Methanococcoide
. . . . Methanosphaerula palustris E1-9c .....................................  178  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Candidatus Meth
. . . . Methanosarcina mazei Go1 .............................................  176  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Methanosarcina 
. . . . Archaeoglobus profundus DSM 5631 .....................................  176  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Archaeoglobus p
. . . . Methanosarcina barkeri str. Fusaro ...................................  175  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Methanosarcina 
. . . . Methanosaeta thermophila PT ..........................................  174  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Methanosaeta th
. . . . Archaeoglobus fulgidus DSM 4304 ......................................  174  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Archaeoglobus f
. . . . Archaeoglobus fulgidus ...............................................  174  1 hit  [euryarchaeotes]         branched-chain amino acid aminotransferase [Archaeoglobus f
. . . . Methanococcus maripaludis C5 .........................................  174  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Methanococcus m
. . . . Methanococcus maripaludis S2 .........................................  171  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Methanococcus m
. . . . Methanosarcina acetivorans C2A .......................................  171  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Methanosarcina 
. . . . Methanococcus maripaludis C7 .........................................  170  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Methanococcus m
. . . . Methanococcus voltae A3 ..............................................  170  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Methanococcus v
. . . . Methanospirillum hungatei JF-1 .......................................  169  2 hits [euryarchaeotes]         branched-chain amino acid aminotransferase [Methanospirillu
. . . uncultured archaeon ----------------------------------------------------  241  1 hit  [archaea]                putative branched-chain-amino-acid aminotransferase [uncult
. . . Nitrosopumilus maritimus SCM1 ..........................................  224  4 hits [archaea]                branched-chain amino acid aminotransferase [Nitrosopumilus 
. . . uncultured crenarchaeote ...............................................  219  1 hit  [crenarchaeotes]         putative branched chain amino acid aminotransferase [uncult
. . . uncultured marine crenarchaeote HF4000_ANIW97P9 ........................  217  1 hit  [archaea]                putative aminotransferase class IV [uncultured marine crena
. . . uncultured marine crenarchaeote HF4000_APKG6D3 .........................  213  1 hit  [archaea]                putative aminotransferase class IV [uncultured marine crena
. . . Cenarchaeum symbiosum A ................................................  200  2 hits [archaea]                branched-chain amino acid aminotransferase/4-amino-4-deoxyc
. . . uncultured marine crenarchaeote HF4000_APKG3H9 .........................  189  1 hit  [archaea]                putative aminotransferase class IV [uncultured marine crena
. . . uncultured marine crenarchaeote HF4000_APKG7F11 ........................  189  1 hit  [archaea]                putative aminotransferase class IV [uncultured marine crena
. . . uncultured marine crenarchaeote HF4000_ANIW133M9 .......................  189  1 hit  [archaea]                putative aminotransferase class IV [uncultured marine crena
. . . Pyrobaculum arsenaticum DSM 13514 ......................................  183  2 hits [crenarchaeotes]         branched-chain amino acid aminotransferase [Pyrobaculum ars
. . . Pyrobaculum calidifontis JCM 11548 .....................................  181  2 hits [crenarchaeotes]         branched-chain amino acid aminotransferase [Pyrobaculum cal
. . . Pyrobaculum aerophilum str. IM2 ........................................  181  2 hits [crenarchaeotes]         branched-chain amino acid aminotransferase [Pyrobaculum aer
. . Conexibacter woesei DSM 14684 --------------------------------------------  256  4 hits [high GC Gram+]          branched-chain amino acid aminotransferase [Conexibacter wo
. . Aromatoleum aromaticum EbN1 ..............................................  240  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Aromatoleum aro
. . Thermodesulfovibrio yellowstonii DSM 11347 ...............................  239  2 hits [bacteria]               branched-chain amino acid aminotransferase [Thermodesulfovi
. . beta proteobacterium KB13 ................................................  238  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [beta proteobact
. . Delftia acidovorans SPH-1 ................................................  238  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Delftia acidovo
. . Azotobacter vinelandii DJ ................................................  238  2 hits [g-proteobacteria]       Branched-chain amino acid aminotransferase I [Azotobacter v
. . Methylobacillus flagellatus KT ...........................................  237  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Methylobacillus
. . Caminibacter mediatlanticus TB-2 .........................................  237  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Caminibacter me
. . Roseiflexus sp. RS-1 .....................................................  236  2 hits [GNS bacteria]           branched-chain amino acid aminotransferase [Roseiflexus sp.
. . Frankia sp. EAN1pec ......................................................  236  2 hits [high GC Gram+]          branched-chain amino acid aminotransferase [Frankia sp. EAN
. . Roseiflexus castenholzii DSM 13941 .......................................  236  2 hits [GNS bacteria]           branched-chain amino acid aminotransferase [Roseiflexus cas
. . Limnobacter sp. MED105 ...................................................  235  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Limnobacter sp.
. . Frankia sp. EUN1f ........................................................  235  2 hits [high GC Gram+]          branched-chain amino acid aminotransferase [Frankia sp. EUN
. . Pseudomonas stutzeri A1501 ...............................................  234  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Pseudomonas stu
. . Methylotenera mobilis JLW8 ...............................................  234  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Methylotenera m
. . Comamonas testosteroni CNB-2 .............................................  234  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Comamonas testo
. . Frankia alni ACN14a ......................................................  233  2 hits [high GC Gram+]          branched-chain amino-acid aminotransferase [Frankia alni AC
. . Campylobacter hominis ATCC BAA-381 .......................................  233  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter h
. . Frankia sp. EuI1c ........................................................  233  2 hits [high GC Gram+]          branched-chain amino acid aminotransferase [Frankia sp. EuI
. . Comamonas testosteroni KF-1 ..............................................  233  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Comamonas testo
. . Nitrosomonas sp. AL212 ...................................................  232  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Nitrosomonas sp
. . Chloroflexus aurantiacus J-10-fl .........................................  232  4 hits [GNS bacteria]           branched-chain amino acid aminotransferase [Chloroflexus au
. . Chloroflexus sp. Y-400-fl ................................................  232  4 hits [GNS bacteria]           branched-chain amino acid aminotransferase [Chloroflexus au
. . Pseudomonas aeruginosa PAO1 ..............................................  232  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Pseudomonas aer
. . Pseudomonas aeruginosa PACS2 .............................................  232  1 hit  [g-proteobacteria]       branched-chain amino acid aminotransferase [Pseudomonas aer
. . Pseudomonas aeruginosa UCBPP-PA14 ........................................  232  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Pseudomonas aer
. . Pseudomonas aeruginosa LESB58 ............................................  232  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Pseudomonas aer
. . Pseudomonas aeruginosa C3719 .............................................  232  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Pseudomonas aer
. . Pseudomonas aeruginosa ...................................................  232  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Pseudomonas aer
. . Salinibacter ruber DSM 13855 .............................................  232  2 hits [CFB group bacteria]     branched-chain amino acid aminotransferase [Salinibacter ru
. . Pseudomonas aeruginosa PA7 ...............................................  231  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Pseudomonas aer
. . Chloroflexus aggregans DSM 9485 ..........................................  231  2 hits [GNS bacteria]           branched-chain amino acid aminotransferase [Chloroflexus ag
. . Acidovorax citrulli AAC00-1 ..............................................  231  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Acidovorax aven
. . Beggiatoa sp. PS .........................................................  230  2 hits [g-proteobacteria]       Aminotransferase, class IV [Beggiatoa sp. PS] >gi|152070876
. . Pseudomonas mendocina ymp ................................................  230  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Pseudomonas men
. . Candidatus Accumulibacter phosphatis clade IIA str. UW-1 .................  230  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Candidatus Accu
. . Frankia symbiont of Datisca glomerata ....................................  230  2 hits [high GC Gram+]          branched-chain amino acid aminotransferase [Frankia symbion
. . Methylibium petroleiphilum PM1 ...........................................  230  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Methylibium pet
. . Hahella chejuensis KCTC 2396 .............................................  230  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Hahella chejuen
. . Lutiella nitroferrum 2002 ................................................  230  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Lutiella nitrof
. . Methylophilales bacterium HTCC2181 .......................................  229  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Methylophilales
. . Gemmatimonas aurantiaca T-27 .............................................  229  2 hits [bacteria]               branched-chain amino-acid aminotransferase [Gemmatimonas au
. . Nautilia profundicola AmH ................................................  229  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Nautilia profun
. . Polaromonas sp. JS666 ....................................................  229  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Polaromonas sp.
. . Sulfurovum sp. NBC37-1 ...................................................  229  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Sulfurovum sp. 
. . Acidovorax avenae subsp. avenae ATCC 19860 ...............................  229  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Acidovorax aven
. . Acidimicrobium ferrooxidans DSM 10331 ....................................  229  2 hits [high GC Gram+]          branched-chain amino acid aminotransferase [Acidimicrobium 
. . Dechloromonas aromatica RCB ..............................................  228  4 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Dechloromonas a
. . Nitratiruptor sp. SB155-2 ................................................  228  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Nitratiruptor s
. . Azoarcus sp. BH72 ........................................................  228  4 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Azoarcus sp. BH
. . Methylovorus sp. SIP3-4 ..................................................  228  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Methylovorus sp
. . Chromobacterium violaceum ATCC 12472 .....................................  227  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Chromobacterium
. . Acidovorax delafieldii 2AN ...............................................  227  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Acidovorax dela
. . Leptothrix cholodnii SP-6 ................................................  227  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Leptothrix chol
. . Alcanivorax borkumensis SK2 ..............................................  227  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Alcanivorax bor
. . Frankia sp. CcI3 .........................................................  227  2 hits [high GC Gram+]          branched chain amino acid aminotransferase / branched chain
. . Acidovorax ebreus TPSY ...................................................  226  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Acidovorax ebre
. . Thiomicrospira crunogena XCL-2 ...........................................  226  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Thiomicrospira 
. . Bordetella parapertussis 12822 ...........................................  226  1 hit  [b-proteobacteria]       branched-chain amino acid aminotransferase [Bordetella para
. . Bordetella bronchiseptica RB50 ...........................................  226  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Bordetella para
. . Bordetella parapertussis .................................................  226  1 hit  [b-proteobacteria]       branched-chain amino acid aminotransferase [Bordetella para
. . Acidithiobacillus caldus ATCC 51756 ......................................  226  2 hits [g-proteobacteria]       Branched-chain amino acid aminotransferase [Acidithiobacill
. . Acidovorax sp. JS42 ......................................................  226  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Acidovorax sp. 
. . Alcanivorax sp. DG881 ....................................................  226  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Alcanivorax sp.
. . Bordetella petrii DSM 12804 ..............................................  226  1 hit  [b-proteobacteria]       branched-chain amino acid aminotransferase [Bordetella petr
. . Bordetella petrii ........................................................  226  1 hit  [b-proteobacteria]       branched-chain amino acid aminotransferase [Bordetella petr
. . Janthinobacterium sp. Marseille ..........................................  226  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Janthinobacteri
. . Polynucleobacter necessarius subsp. necessarius STIR1 ....................  225  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Polynucleobacte
. . Nitrosomonas eutropha C91 ................................................  225  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Nitrosomonas eu
. . Bordetella pertussis Tohama I ............................................  224  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Bordetella pert
. . Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1 ............  224  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Polynucleobacte
. . Campylobacter gracilis RM3268 ............................................  224  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter g
. . gamma proteobacterium HTCC5015 ...........................................  224  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [gamma proteobac
. . Sideroxydans lithotrophicus ES-1 .........................................  224  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Sideroxydans li
. . Thioalkalivibrio sp. HL-EbGR7 ............................................  223  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Thioalkalivibri
. . Gallionella capsiferriformans ES-2 .......................................  223  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Gallionella fer
. . Acidithiobacillus ferrooxidans ATCC 53993 ................................  222  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Acidithiobacill
. . Acidithiobacillus ferrooxidans ATCC 23270 ................................  222  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Acidithiobacill
. . Magnetococcus sp. MC-1 ...................................................  222  2 hits [proteobacteria]         branched chain amino acid aminotransferase / branched chain
. . Nitrosococcus oceani ATCC 19707 ..........................................  222  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Nitrosococcus o
. . Marinomonas sp. MED121 ...................................................  222  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Marinomonas sp.
. . Nitrosococcus oceani AFC27 ...............................................  222  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Nitrosococcus o
. . Nitrosomonas europaea ATCC 19718 .........................................  222  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Nitrosomonas eu
. . Halothiobacillus neapolitanus c2 .........................................  221  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Halothiobacillu
. . Rhodothermus marinus DSM 4252 ............................................  221  2 hits [CFB group bacteria]     branched-chain amino acid aminotransferase [Rhodothermus ma
. . Rhodococcus jostii RHA1 ..................................................  221  2 hits [high GC Gram+]          branched-chain-amino-acid transaminase [Rhodococcus jostii 
. . Thiobacillus denitrificans ATCC 25259 ....................................  221  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Thiobacillus de
. . Curvibacter putative symbiont of Hydra magnipapillata ....................  221  1 hit  [b-proteobacteria]       Branched-chain-amino-acid aminotransferase [Curvibacter put
. . Pseudoalteromonas tunicata D2 ............................................  221  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Pseudoalteromon
. . Campylobacter jejuni subsp. jejuni HB93-13 ...............................  220  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter j
. . Campylobacter jejuni subsp. jejuni 81-176 ................................  220  3 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter j
. . Campylobacter jejuni subsp. jejuni 81116 .................................  220  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter j
. . Campylobacter jejuni subsp. jejuni IA3902 ................................  220  1 hit  [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter j
. . Thioalkalivibrio sp. K90mix ..............................................  220  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Thioalkalivibri
. . uncultured proteobacterium RedeBAC7D11 ...................................  220  1 hit  [proteobacteria]         predicted branched-chain amino acid transferase [uncultured
. . Campylobacter jejuni RM1221 ..............................................  220  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter j
. . Fusobacterium sp. 2_1_31 .................................................  220  2 hits [fusobacteria]           2-keto-4-methylthiobutyrate aminotransferase [Fusobacterium
. . Helicobacter hepaticus ATCC 51449 ........................................  219  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Helicobacter he
. . Verminephrobacter eiseniae EF01-2 ........................................  219  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Verminephrobact
. . Sulfurimonas denitrificans DSM 1251 ......................................  219  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Sulfurimonas de
. . Alkalilimnicola ehrlichii MLHE-1 .........................................  219  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Alkalilimnicola
. . Campylobacter jejuni subsp. jejuni CF93-6 ................................  219  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter j
. . Campylobacter jejuni subsp. jejuni 260.94 ................................  219  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter j
. . Campylobacter jejuni subsp. jejuni 84-25 .................................  219  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter j
. . Campylobacter jejuni subsp. jejuni CG8421 ................................  219  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter j
. . Campylobacter jejuni subsp. jejuni NCTC 11168 ............................  219  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter j
. . Campylobacter fetus subsp. fetus 82-40 ...................................  219  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter f
. . Tolumonas auensis DSM 9187 ...............................................  219  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Tolumonas auens
. . Nitrosospira multiformis ATCC 25196 ......................................  219  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Nitrosospira mu
. . Helicobacter winghamensis ATCC BAA-430 ...................................  219  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Helicobacter wi
. . Variovorax paradoxus S110 ................................................  219  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Variovorax para
. . Allochromatium vinosum DSM 180 ...........................................  219  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Allochromatium 
. . Helicobacter mustelae 12198 ..............................................  219  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Helicobacter mu
. . Polaromonas naphthalenivorans CJ2 ........................................  219  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Polaromonas nap
. . Thauera sp. MZ1T .........................................................  218  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Thauera sp. MZ1
. . Campylobacter jejuni subsp. jejuni CG8486 ................................  218  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter j
. . Oceanicaulis alexandrii HTCC2633 .........................................  218  2 hits [a-proteobacteria]       branched-chain amino acid aminotransferase [Oceanicaulis al
. . Campylobacter jejuni subsp. jejuni 414 ...................................  218  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter j
. . Deferribacter desulfuricans SSM1 .........................................  218  2 hits [bacteria]               branched-chain amino acid aminotransferase [Deferribacter d
. . Thiomonas intermedia K12 .................................................  218  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Thiomonas inter
. . Lawsonia intracellularis PHE/MN1-00 ......................................  217  2 hits [d-proteobacteria]       branched-chain amino acid aminotransferase [Lawsonia intrac
. . Moritella sp. PE36 .......................................................  217  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Moritella sp. P
. . Herminiimonas arsenicoxydans .............................................  217  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Herminiimonas a
. . Campylobacter jejuni subsp. jejuni 1336 ..................................  217  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter j
. . Methylophaga thiooxidans DMS010 ..........................................  216  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Methylophaga th
. . Helicobacter canadensis MIT 98-5491 ......................................  216  3 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Helicobacter ca
. . Candidatus Koribacter versatilis Ellin345 ................................  216  2 hits [bacteria]               branched chain amino acid aminotransferase / branched chain
. . Laribacter hongkongensis HLHK9 ...........................................  216  2 hits [b-proteobacteria]       IlvE [Laribacter hongkongensis HLHK9] >gi|226715991|gb|ACO7
. . Helicobacter pullorum MIT 98-5489 ........................................  216  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Helicobacter pu
. . Acinetobacter lwoffii SH145 ..............................................  216  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Acinetobacter l
. . Campylobacter concisus 13826 .............................................  215  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter c
. . Shewanella benthica KT99 .................................................  215  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Shewanella bent
. . Rhodoferax ferrireducens T118 ............................................  215  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Rhodoferax ferr
. . Campylobacter jejuni subsp. doylei 269.97 ................................  215  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter j
. . Wolinella succinogenes DSM 1740 ..........................................  215  1 hit  [e-proteobacteria]       branched-chain amino acid aminotransferase [Wolinella succi
. . Wolinella succinogenes ...................................................  215  1 hit  [e-proteobacteria]       branched-chain amino acid aminotransferase [Wolinella succi
. . Campylobacter upsaliensis RM3195 .........................................  214  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter u
. . Campylobacter lari RM2100 ................................................  214  2 hits [e-proteobacteria]       branched-chain amino-acid aminotransferase [Campylobacter l
. . Acidobacterium capsulatum ATCC 51196 .....................................  214  2 hits [bacteria]               branched-chain-amino-acid transaminase [Acidobacterium caps
. . Enhydrobacter aerosaccus SK60 ............................................  214  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Enhydrobacter a
. . Shewanella piezotolerans WP3 .............................................  214  2 hits [g-proteobacteria]       Branched-chain amino acid amiotransferase [Shewanella piezo
. . Chlorobaculum parvum NCIB 8327 ...........................................  214  2 hits [green sulfur bacteria]  branched-chain amino acid aminotransferase [Chlorobaculum p
. . Mariprofundus ferrooxydans PV-1 ..........................................  214  2 hits [proteobacteria]         branched-chain amino acid aminotransferase [Mariprofundus f
. . Acinetobacter johnsonii SH046 ............................................  214  2 hits [g-proteobacteria]       branched-chain amino acid transferase [Acinetobacter johnso
. . Campylobacter coli RM2228 ................................................  213  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter c
. . Colwellia psychrerythraea 34H ............................................  213  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Colwellia psych
. . Psychrobacter sp. PRwf-1 .................................................  213  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Psychrobacter s
. . Vibrio parahaemolyticus RIMD 2210633 .....................................  213  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio parahaem
. . Vibrio parahaemolyticus AQ3810 ...........................................  213  4 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio parahaem
. . Vibrio parahaemolyticus K5030 ............................................  213  1 hit  [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio parahaem
. . Vibrio parahaemolyticus AN-5034 ..........................................  213  1 hit  [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio parahaem
. . Vibrio parahaemolyticus Peru-466 .........................................  213  1 hit  [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio parahaem
. . Vibrio parahaemolyticus AQ4037 ...........................................  213  1 hit  [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio parahaem
. . Vibrio orientalis CIP 102891 .............................................  213  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio oriental
. . Ralstonia solanacearum MolK2 .............................................  213  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase protein [Ralston
. . Acinetobacter junii SH205 ................................................  213  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Acinetobacter j
. . Ralstonia solanacearum UW551 .............................................  213  2 hits [b-proteobacteria]       Branched-chain amino acid aminotransferase [Ralstonia solan
. . Ralstonia solanacearum IPO1609 ...........................................  213  2 hits [b-proteobacteria]       Branched-chain amino acid aminotransferase [Ralstonia solan
. . Desulfovibrio salexigens DSM 2638 ........................................  212  2 hits [d-proteobacteria]       branched-chain amino acid aminotransferase [Desulfovibrio s
. . Prosthecochloris aestuarii DSM 271 .......................................  212  2 hits [green sulfur bacteria]  branched-chain amino acid aminotransferase [Prosthecochlori
. . Vibrio coralliilyticus ATCC BAA-450 ......................................  212  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio corallii
. . Vibrio shilonii AK1 ......................................................  212  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio shilonii
. . Burkholderia sp. CCGE1003 ................................................  212  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia sp
. . Nitrococcus mobilis Nb-231 ...............................................  212  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Nitrococcus mob
. . Desulfovibrio magneticus RS-1 ............................................  212  2 hits [d-proteobacteria]       branched-chain-amino-acid aminotransferase [Desulfovibrio m
. . Arcobacter butzleri RM4018 ...............................................  212  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Arcobacter butz
. . Vibrio parahaemolyticus 16 ...............................................  212  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio parahaem
. . Ralstonia solanacearum GMI1000 ...........................................  212  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Ralstonia solan
. . Legionella drancourtii LLAP12 ............................................  212  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Legionella dran
. . Maricaulis maris MCS10 ...................................................  212  2 hits [a-proteobacteria]       branched-chain amino acid aminotransferase [Maricaulis mari
. . Fusobacterium periodonticum ATCC 33693 ...................................  212  1 hit  [fusobacteria]           branched-chain amino-acid aminotransferase [Fusobacterium p
. . Helicobacter bilis ATCC 43879 ............................................  211  2 hits [e-proteobacteria]       branched-chain-amino-acid aminotransferase IlvE [Helicobact
. . Chlorobium tepidum TLS ...................................................  211  2 hits [green sulfur bacteria]  branched-chain amino acid aminotransferase [Chlorobium tepi
. . Vibrio harveyi 1DA3 ......................................................  211  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferasee [Vibrio harveyi
. . Burkholderia xenovorans LB400 ............................................  211  4 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia xe
. . Methylococcus capsulatus str. Bath .......................................  211  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Methylococcus c
. . Desulfovibrio aespoeensis Aspo-2 .........................................  211  2 hits [d-proteobacteria]       branched-chain amino acid aminotransferase [Desulfovibrio a
. . Halorhodospira halophila SL1 .............................................  211  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Halorhodospira 
. . Shewanella loihica PV-4 ..................................................  211  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Shewanella loih
. . Streptosporangium roseum DSM 43021 .......................................  211  2 hits [high GC Gram+]          branched-chain amino acid aminotransferase [Streptosporangi
. . Burkholderia sp. CCGE1001 ................................................  210  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia sp
. . Herpetosiphon aurantiacus ATCC 23779 .....................................  210  2 hits [GNS bacteria]           branched-chain amino acid aminotransferase [Herpetosiphon a
. . Campylobacter curvus 525.92 ..............................................  210  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter c
. . Thermus aquaticus Y51MC23 ................................................  210  2 hits [bacteria]               branched-chain amino acid aminotransferase [Thermus aquatic
. . Leptospirillum ferrodiazotrophum .........................................  210  1 hit  [bacteria]               branched-chain amino acid aminotransferase [Leptospirillum 
. . Shewanella pealeana ATCC 700345 ..........................................  210  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Shewanella peal
. . Vibrio fischeri ES114 ....................................................  210  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio fischeri
. . Shewanella halifaxensis HAW-EB4 ..........................................  210  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Shewanella hali
. . Sulfurospirillum deleyianum DSM 6946 .....................................  209  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Sulfurospirillu
. . Helicobacter cinaedi CCUG 18818 ..........................................  209  1 hit  [e-proteobacteria]       branched-chain amino acid aminotransferase [Helicobacter ci
. . Cupriavidus metallidurans CH34 ...........................................  209  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Cupriavidus met
. . Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica) ..............  209  2 hits [g-proteobacteria]       branched chain amino acid: 2-keto-4-methylthiobutyrate amin
. . Candidatus Solibacter usitatus Ellin6076 .................................  209  2 hits [bacteria]               branched chain amino acid aminotransferase [Solibacter usit
. . Aeromonas salmonicida subsp. salmonicida A449 ............................  209  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Aeromonas salmo
. . Campylobacterales bacterium GD 1 .........................................  209  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacteral
. . Asticcacaulis excentricus CB 48 ..........................................  209  2 hits [a-proteobacteria]       branched-chain amino acid aminotransferase [Asticcacaulis e
. . Desulfovibrio piger ATCC 29098 ...........................................  209  2 hits [d-proteobacteria]       hypothetical protein DESPIG_02375 [Desulfovibrio piger ATCC
. . Chloroherpeton thalassium ATCC 35110 .....................................  209  2 hits [green sulfur bacteria]  branched-chain amino acid aminotransferase [Chloroherpeton 
. . Shewanella sediminis HAW-EB3 .............................................  208  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Shewanella sedi
. . Fusobacterium nucleatum subsp. polymorphum ATCC 10953 ....................  208  2 hits [fusobacteria]           branched-chain-amino-acid transaminase [Fusobacterium nucle
. . Ralstonia eutropha H16 ........................................ ...........  208  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Ralstonia eutro
. . Vibrio fischeri MJ11 .....................................................  208  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio fischeri
. . Marinobacter sp. ELB17 ...................................................  208  2 hits [g-proteobacteria]       branched-chain amino acid transferase [Marinobacter sp. ELB
. . Candidatus Vesicomyosocius okutanii HA ...................................  208  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Candidatus Vesi
. . Vibrio sp. MED222 ........................................................  208  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio sp. MED2
. . Vibrio splendidus LGP32 ..................................................  208  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio splendid
. . Vibrio harveyi HY01 ......................................................  208  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio harveyi 
. . Vibrio harveyi ATCC BAA-1116 .............................................  208  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio harveyi 
. . Psychrobacter arcticus 273-4 .............................................  208  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Psychrobacter a
. . Chlorobium phaeovibrioides DSM 265 .......................................  208  2 hits [green sulfur bacteria]  branched-chain amino acid aminotransferase [Prosthecochlori
. . Psychrobacter cryohalolentis K5 ..........................................  207  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Psychrobacter c
. . Vibrio splendidus 12B01 ..................................................  207  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio splendid
. . Cupriavidus taiwanensis ..................................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Cupriavidus tai
. . Vibrio furnissii CIP 102972 ..............................................  207  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio furnissi
. . Eggerthella lenta DSM 2243 ...............................................  207  2 hits [high GC Gram+]          branched-chain amino acid aminotransferase [Eggerthella len
. . Burkholderia thailandensis E264 ..........................................  207  6 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia th
. . Burkholderia oklahomensis EO147 ..........................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia th
. . Burkholderia oklahomensis C6786 ..........................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia th
. . Burkholderia thailandensis TXDOH .........................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia th
. . Burkholderia thailandensis Bt4 ...........................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia th
. . Burkholderia graminis C4D1M ..............................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia gr
. . Desulfovibrio vulgaris DP4 ...............................................  207  2 hits [d-proteobacteria]       branched-chain amino acid aminotransferase [Desulfovibrio v
. . Vibrio alginolyticus 12G01 ...............................................  207  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio alginoly
. . Vibrio sp. Ex25 ..........................................................  207  4 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio alginoly
. . Vibrio alginolyticus 40B .................................................  207  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio alginoly
. . Burkholderia phymatum STM815 .............................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ph
. . Thermus thermophilus HB8 .................................................  207  2 hits [bacteria]               branched-chain amino acid aminotransferase [Thermus thermop
. . Thermus thermophilus .....................................................  207 21 hits [bacteria]               branched-chain amino acid aminotransferase [Thermus thermop
. . Burkholderia mallei GB8 horse 4 ..........................................  207  2 hits [b-proteobacteria]       branched-chain-amino-acid transaminase [Burkholderia mallei
. . Burkholderia pseudomallei 406e ...........................................  207  4 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia thailandensis MSMB43 ........................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia th
. . Burkholderia pseudomallei K96243 .........................................  207  4 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia mallei ATCC 23344 ...........................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia pseudomallei 1710b ..........................................  207  4 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia mallei SAVP1 ................................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia mallei NCTC 10229 ...........................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia pseudomallei 668 ............................................  207  4 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia mallei NCTC 10247 ...........................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia pseudomallei 1106a ..........................................  207  4 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia pseudomallei 305 ............................................  207  4 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia mallei PRL-20 ...............................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia pseudomallei DM98 ...........................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia pseudomallei 14 .............................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia pseudomallei 91 .............................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia pseudomallei 9 ..............................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia pseudomallei B7210 ..........................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia pseudomallei 7894 ...........................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia pseudomallei NCTC 13177 .....................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia pseudomallei 112 ............................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia pseudomallei BCC215 .........................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia pseudomallei 576 ............................................  207  4 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia pseudomallei Pakistan 9 .....................................  207  4 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia pseudomallei MSHR346 ........................................  207  4 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia pseudomallei 1106b ..........................................  207  4 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia mallei ATCC 10399 ...........................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia pseudomallei 1655 ...........................................  207  4 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia pseudomallei Pasteur 52237 ..................................  207  4 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia pseudomallei S13 ............................................  207  4 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia mallei FMH ..................................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia mallei JHU ..................................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia pseudomallei 1710a ..........................................  207  4 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Burkholderia mallei 2002721280 ...........................................  207  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ps
. . Desulfovibrio vulgaris RCH1 ..............................................  207  2 hits [d-proteobacteria]       branched-chain amino acid aminotransferase [Desulfovibrio v
. . Desulfovibrio vulgaris str. Hildenborough ................................  207  2 hits [d-proteobacteria]       branched-chain amino acid aminotransferase [Desulfovibrio v
. . Desulfovibrio sp. FW1012B ................................................  206  2 hits [d-proteobacteria]       branched-chain amino acid aminotransferase [Desulfovibrio s
. . gamma proteobacterium HTCC2207 ...........................................  206  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [marine gamma pr
. . Vibrionales bacterium SWAT-3 .............................................  206  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrionales bac
. . Burkholderia ubonensis Bu ................................................  206  1 hit  [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ub
. . Burkholderia phytofirmans PsJN ...........................................  206  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ph
. . Thermus thermophilus HB27 ................................................  206  2 hits [bacteria]               branched-chain amino acid aminotransferase [Thermus thermop
. . Oxalobacter formigenes OXCC13 ............................................  206  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Oxalobacter for
. . Aeromonas hydrophila subsp. hydrophila ATCC 7966 .........................  206  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Aeromonas hydro
. . Chlorobium phaeobacteroides DSM 266 ......................................  206  2 hits [green sulfur bacteria]  branched-chain amino acid aminotransferase [Chlorobium phae
. . Vibrio mimicus VM573 .....................................................  205  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferasee [Vibrio mimicus
. . Vibrio mimicus VM603 .....................................................  205  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferasee [Vibrio mimicus
. . Vibrio mimicus VM223 .....................................................  205  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferasee [Vibrio mimicus
. . Leptospirillum rubarum ...................................................  204  1 hit  [bacteria]               Branched-chain amino acid aminotransferase [Leptospirillum 
. . Burkholderia sp. CCGE1002 ................................................  204  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia sp
. . Leptospirillum sp. Group II '5-way CG' ...................................  204  1 hit  [bacteria]               Branched-chain amino acid aminotransferase [Leptospirillum 
. . Chlorobium phaeobacteroides BS1 ..........................................  204  2 hits [green sulfur bacteria]  branched-chain amino acid aminotransferase [Chlorobium phae
. . Cellvibrio japonicus Ueda107 .............................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Cellvibrio japo
. . Vibrio cholerae RC385 ....................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid amiotransferase [Vibrio cholerae 
. . Meiothermus ruber DSM 1279 ...............................................  204  2 hits [bacteria]               branched-chain amino acid aminotransferase [Meiothermus rub
. . Vibrio cholerae O1 biovar El Tor str. N16961 .............................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio cholerae
. . Vibrio cholerae 2740-80 ..................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio cholerae
. . Vibrio cholerae V52 ......................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio cholerae
. . Vibrio cholerae O395 .....................................................  204  3 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio cholerae
. . Vibrio cholerae 1587 .....................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio cholerae
. . Vibrio cholerae MAK 757 ..................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio cholerae
. . Vibrio cholerae MZO-3 ....................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio cholerae
. . Vibrio cholerae NCTC 8457 ................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio cholerae
. . Vibrio cholerae B33 ......................................................  204  4 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio cholerae
. . Vibrio cholerae MZO-2 ....................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio cholerae
. . Vibrio cholerae 623-39 ...................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio cholerae
. . Vibrio cholerae M66-2 ....................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio cholerae
. . Vibrio cholerae BX 330286 ................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio cholerae
. . Vibrio cholerae TMA 21 ...................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio cholerae
. . Vibrio cholerae RC9 ......................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio cholerae
. . Vibrio cholerae TM 11079-80 ..............................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio cholerae
. . Vibrio cholerae 12129(1) .................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio cholerae
. . Vibrio cholerae MJ-1236 ..................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio cholerae
. . Vibrio cholerae V51 ......................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio cholerae
. . Vibrio cholerae AM-19226 .................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio cholerae
. . Burkholderia ambifaria AMMD ..............................................  204  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia am
. . Burkholderia ambifaria IOP40-10 ..........................................  204  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia am
. . Burkholderia ambifaria MC40-6 ............................................  204  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia am
. . Vibrio sp. RC586 .........................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio sp. RC58
. . Vibrio cholerae bv. albensis VL426 .......................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio cholerae
. . Vibrio cholerae MO10 .....................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid amiotransferase [Vibrio cholerae 
. . Vibrio cholera CIRS 101 ..................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid amiotransferase [Vibrio cholerae 
. . Vibrio sp. RC341 .........................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid amiotransferase [Vibrio cholerae 
. . Vibrio cholerae INDRE 91/1 ...............................................  204  2 hits [g-proteobacteria]       branched-chain amino acid amiotransferase [Vibrio cholerae 
. . Vibrio cholerae RC27 .....................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid amiotransferase [Vibrio cholerae 
. . Vibrio cholerae CT 5369-93 ...............................................  204  2 hits [g-proteobacteria]       branched-chain amino acid amiotransferase [Vibrio cholerae 
. . Shewanella woodyi ATCC 51908 .............................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Shewanella wood
. . Oxalobacter formigenes HOxBLS ............................................  204  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Oxalobacter for
. . Edwardsiella tarda ATCC 23685 ............................................  204  1 hit  [enterobacteria]         branched-chain-amino-acid transaminase [Edwardsiella tarda 
. . Vibrio mimicus MB-451 ....................................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio mimicus 
. . Meiothermus silvanus DSM 9946 ............................................  204  2 hits [bacteria]               branched chain amino acid aminotransferase [Meiothermus sil
. . Campylobacter showae RM3277 ..............................................  204  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter s
. . Marinobacter aquaeolei VT8 ...............................................  204  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Marinobacter aq
. . Desulfomicrobium baculatum DSM 4028 ......................................  204  2 hits [d-proteobacteria]       branched-chain amino acid aminotransferase [Desulfomicrobiu
. . Chlorobium chlorochromatii CaD3 ..........................................  203  2 hits [green sulfur bacteria]  branched-chain amino acid aminotransferase [Chlorobium chlo
. . Burkholderia sp. H160 ....................................................  203  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia sp
. . Desulfonatronospira thiodismutans ASO3-1 .................................  203  2 hits [d-proteobacteria]       branched-chain amino acid aminotransferase [Desulfonatronos
. . Desulfovibrio desulfuricans subsp. desulfuricans str. G20 ................  202  2 hits [d-proteobacteria]       branched-chain amino acid aminotransferase [Desulfovibrio d
. . Edwardsiella ictaluri 93-146 .............................................  202  2 hits [enterobacteria]         branched-chain amino acid aminotransferase, putative [Edwar
. . Vibrio vulnificus YJ016 ..................................................  202  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio vulnific
. . Desulfohalobium retbaense DSM 5692 .......................................  202  2 hits [d-proteobacteria]       branched-chain amino acid aminotransferase [Desulfohalobium
. . Pelodictyon phaeoclathratiforme BU-1 .....................................  202  2 hits [green sulfur bacteria]  branched-chain amino acid aminotransferase [Pelodictyon pha
. . Burkholderia ambifaria MEX-5 .............................................  202  4 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia am
. . Chlorobium luteolum DSM 273 ..............................................  202  2 hits [green sulfur bacteria]  branched-chain amino acid aminotransferase [Chlorobium lute
. . Chlorobium limicola DSM 245 ..............................................  202  2 hits [green sulfur bacteria]  branched-chain amino acid aminotransferase [Chlorobium limi
. . Edwardsiella tarda EIB202 ................................................  201  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Edwardsiella ta
. . Burkholderia sp. 383 .....................................................  201  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia sp
. . Burkholderia dolosa AUO158 ...............................................  201  2 hits [b-proteobacteria]       Branched-chain amino acid aminotransferase/4-amino-4-deoxyc
. . Vibrio vulnificus CMCP6 ..................................................  201  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio vulnific
. . Anaeromyxobacter sp. Fw109-5 .............................................  201  2 hits [d-proteobacteria]       branched-chain amino acid aminotransferase [Anaeromyxobacte
. . Vibrio metschnikovii CIP 69.14 ...........................................  201  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio metschni
. . Saccharophagus degradans 2-40 ............................................  201  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Saccharophagus 
. . Photobacterium profundum SS9 .............................................  201  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Photobacterium 
. . Campylobacter rectus RM3267 ..............................................  200  2 hits [e-proteobacteria]       branched-chain amino acid aminotransferase [Campylobacter r
. . Citrobacter koseri ATCC BAA-895 ..........................................  200  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Citrobacter kos
. . Burkholderia multivorans CGD2 ............................................  200  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia mu
. . Burkholderia multivorans ATCC 17616 ......................................  200  4 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia mu
. . Burkholderia multivorans CGD2M ...........................................  200  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia mu
. . Burkholderia multivorans CGD1 ............................................  200  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia mu
. . Photobacterium sp. SKA34 .................................................  200  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Photobacterium 
. . Enterobacter cancerogenus ATCC 35316 .....................................  200  2 hits [enterobacteria]         branched-chain-amino-acid transaminase [Enterobacter cancer
. . Photobacterium profundum 3TCK ............................................  200  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Photobacterium 
. . Providencia rettgeri DSM 1131 ............................................  200  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Providencia ret
. . Photobacterium angustum S14 ..............................................  200  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Vibrio angustum
. . Burkholderia cenocepacia AU 1054 .........................................  200  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ce
. . Burkholderia cenocepacia HI2424 ..........................................  200  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ce
. . Shigella flexneri 5 str. 8401 ............................................  200  2 hits [enterobacteria]         branched-chain amino-acid aminotransferase [Shigella flexne
. . Providencia alcalifaciens DSM 30120 ......................................  199  2 hits [enterobacteria]         hypothetical protein PROVALCAL_01267 [Providencia alcalifac
. . Anaeromyxobacter dehalogenans 2CP-C ......................................  199  2 hits [d-proteobacteria]       branched chain amino acid: 2-keto-4-methylthiobutyrate amin
. . Shigella flexneri ........................................................  199 10 hits [enterobacteria]         IlvE [Shigella flexneri]
. . Burkholderia vietnamiensis G4 ............................................  199  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia vi
. . Shigella boydii ..........................................................  199 17 hits [enterobacteria]         IlvE [Shigella boydii] >gi|87117938|gb|ABD20276.1| IlvE [Sh
. . Shigella flexneri 2a str. 301 ............................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Shigella flexne
. . Shigella flexneri 2a str. 2457T ..........................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Shigella flexne
. . Shigella flexneri 2002017 ................................................  199  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Shigella flexne
. . Escherichia coli UTI89 ...................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli 536 .....................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli APEC O1 .................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli F11 .....................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli S88 .....................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli ED1a ....................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia sp. 3_2_53FAA ................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Burkholderia cenocepacia MC0-3 ...........................................  199  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ce
. . Burkholderia cenocepacia PC184 ...........................................  199  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ce
. . Xenorhabdus bovienii SS-2004 .............................................  199  2 hits [enterobacteria]         branched-chain amino-acid aminotransferase [Xenorhabdus bov
. . gamma proteobacterium NOR5-3 .............................................  199  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [gamma proteobac
. . Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 .........  199  2 hits [d-proteobacteria]       branched-chain amino acid aminotransferase [Desulfovibrio d
. . Escherichia coli .........................................................  199 31 hits [enterobacteria]         aminotransferase,branched chain AA
. . Congregibacter litoralis KT71 ............................................  199  2 hits [g-proteobacteria]       Branched-chain-amino-acid aminotransferase [Congregibacter 
. . Escherichia albertii TW07627 .............................................  199  2 hits [enterobacteria]         branched-chain-amino-acid transaminase [Escherichia alberti
. . Anaeromyxobacter sp. K ...................................................  199  2 hits [d-proteobacteria]       branched-chain amino acid aminotransferase [Anaeromyxobacte
. . Escherichia coli O157:H7 EDL933 ..........................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O157:H7 str. Sakai ......................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli CFT073 ..................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli str. K-12 substr. MG1655 ................................  199  3 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Shigella boydii Sb227 ....................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Shigella dysenteriae Sd197 ...............................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli str. K-12 substr. W3110 .................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli E24377A .................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli HS ......................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O157:H7 str. EC4113 .....................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O157:H7 str. EC4401 .....................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O157:H7 str. EC4501 .....................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O157:H7 str. EC4486 .....................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O157:H7 str. EC4196 .....................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O157:H7 str. EC4076 .....................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O157:H7 str. EC869 ......................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O157:H7 str. EC508 ......................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli ATCC 8739 ...............................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli str. K-12 substr. DH10B .................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli SMS-3-5 .................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Shigella boydii CDC 3083-94 ..............................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli 53638 ...................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli E110019 .................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Shigella dysenteriae 1012 ................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O157:H7 str. EC4024 .....................................  199  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O157:H7 str. EC4206 .....................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O157:H7 str. EC4045 .....................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O157:H7 str. EC4042 .....................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O157:H7 str. EC4115 .....................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli SE11 ....................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O127:H6 str. E2348/69 ...................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O157:H7 str. TW14588 ....................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia fergusonii ATCC 35469 ........................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli IAI1 ....................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli 55989 ...................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli IAI39 ...................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli UMN026 ..................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli 83972 ...................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli BW2952 ..................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia sp. 1_1_43 ...................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O157:H7 str. TW14359 ....................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia sp. 4_1_40B ..................................................  199  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O26:H11 str. 11368 ......................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O111:H- str. 11128 ......................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O157:H7 str. FRIK2000 ...................................  199  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O157:H7 str. FRIK966 ....................................  199  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O55:H7 str. CB9615 ......................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O157:H7 .................................................  199  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli O6 ......................................................  199  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli K-12 ....................................................  199  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli DH1 .....................................................  199  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli SE15 ....................................................  199  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli 042 .....................................................  199  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Escherichia coli B088 ....................................................  199  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Escherichia col
. . Shigella dysenteriae .....................................................  199 12 hits [enterobacteria]         IlvE [Shigella dysenteriae]
. . Providencia rustigianii DSM 4541 .........................................  199  2 hits [enterobacteria]         branched-chain-amino-acid transaminase [Providencia rustigi
. . Salmonella enterica subsp. enterica serovar Typhi str. E00-7866 ..........  199  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Shigella sonnei Ss046 ....................................................  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Shigella sonnei
. . Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 ...  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 ...  199  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Dickeya dadantii Ech586 ..................................................  198  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Dickeya dadanti
. . Salmonella enterica subsp. enterica serovar Typhi str. CT18 ..............  198  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 .........  198  3 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Typhi str. Ty2 ...............  198  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ........  198  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29 ........  198  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701 ...  198  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480 ....  198  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .  198  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Typhi str. E02-1180 ..........  198  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Typhi str. J185 ..............  198  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Typhi str. M223 ..............  198  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Typhi str. AG3 ...............  198  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Typhimurium ..................  198  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Typhi ........................  198  3 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Typhimurium str. D23580 ......  198  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S ......  198  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Escherichia coli B7A .....................................................  198  2 hits [enterobacteria]         branched-chain-amino-acid transaminase [Escherichia coli B7
. . Escherichia coli E22 .....................................................  198  2 hits [enterobacteria]         branched-chain-amino-acid transaminase [Escherichia coli B7
. . Escherichia coli B171 ....................................................  198  2 hits [enterobacteria]         branched-chain-amino-acid transaminase [Escherichia coli B7
. . Escherichia coli 101-1 ...................................................  198  2 hits [enterobacteria]         branched-chain-amino-acid transaminase [Escherichia coli B7
. . Escherichia coli BL21(DE3) ...............................................  198  4 hits [enterobacteria]         branched-chain-amino-acid transaminase [Escherichia coli B7
. . Escherichia coli B str. REL606 ...........................................  198  2 hits [enterobacteria]         branched-chain-amino-acid transaminase [Escherichia coli B7
. . Escherichia coli O103:H2 str. 12009 ......................................  198  2 hits [enterobacteria]         branched-chain-amino-acid transaminase [Escherichia coli B7
. . Dickeya dadantii Ech703 ..................................................  198  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Dickeya dadanti
. . Anaeromyxobacter dehalogenans 2CP-1 ......................................  198  2 hits [d-proteobacteria]       branched-chain amino acid aminotransferase [Anaeromyxobacte
. . Yersinia kristensenii ATCC 33638 .........................................  198  2 hits [enterobacteria]         Branched-chain-amino-acid aminotransferase [Yersinia kriste
. . Desulfovibrio vulgaris str. 'Miyazaki F' .................................  198  2 hits [d-proteobacteria]       branched-chain amino acid aminotransferase [Desulfovibrio v
. . Citrobacter sp. 30_2 .....................................................  198  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Citrobacter sp.
. . Shigella sp. D9 ..........................................................  197  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Shigella sp. D9]
. . Citrobacter youngae ATCC 29220 ...........................................  197  2 hits [enterobacteria]         branched-chain-amino-acid transaminase [Citrobacter youngae
. . Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .......  197  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Citrobacter rodentium ICC168 .............................................  197  2 hits [enterobacteria]         branched-chain amino-acid aminotransferase [Citrobacter rod
. . Pantoea sp. At-9b ........................................................  197  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Pantoea sp. At-
. . Burkholderia cenocepacia J2315 ...........................................  197  2 hits [b-proteobacteria]       branched-chain amino acid aminotransferase [Burkholderia ce
. . Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191 ........  197  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Heidelberg str. SL486 ........  197  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066 .........  197  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Newport str. SL317 ...........  197  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537 ..  197  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Newport str. SL254 ...........  197  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ........  197  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 .......  197  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Agona str. SL483 .............  197  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23 ........  197  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ......  197  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Virchow str. SL491 ...........  197  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433 ...  197  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 .....  197  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Cronobacter turicensis z3032 .............................................  197  2 hits [enterobacteria]         Branched-chain-amino-acid aminotransferase [Cronobacter tur
. . Klebsiella pneumoniae 342 ................................................  197  2 hits [enterobacteria]         branched-chain-amino-acid transaminase [Klebsiella pneumoni
. . Klebsiella variicola At-22 ...............................................  197  2 hits [enterobacteria]         branched-chain-amino-acid transaminase [Klebsiella pneumoni
. . Klebsiella sp. 1_1_55 ....................................................  197  2 hits [enterobacteria]         branched-chain-amino-acid transaminase [Klebsiella pneumoni
. . Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 .....  197  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...  197  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191 ....  197  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Pantoea ananatis LMG 20103 ...............................................  196  1 hit  [enterobacteria]         IlvE [Pantoea ananatis LMG 20103]
. . Erwinia tasmaniensis Et1/99 ..............................................  196  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Erwinia tasmani
. . Erwinia pyrifoliae Ep1/96 ................................................  196  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Erwinia tasmani
. . Erwinia pyrifoliae DSM 12163 .............................................  196  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Erwinia tasmani
. . Chlorobium ferrooxidans DSM 13031 ........................................  196  2 hits [green sulfur bacteria]  branched-chain amino acid aminotransferase [Chlorobium ferr
. . Providencia stuartii ATCC 25827 ..........................................  196  2 hits [enterobacteria]         hypothetical protein PROSTU_03802 [Providencia stuartii ATC
. . Serratia odorifera 4Rx13 .................................................  196  2 hits [enterobacteria]         branched-chain-amino-acid aminotransferase [Serratia odorif
. . Cronobacter sakazakii ATCC BAA-894 .......................................  196  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Enterobacter sa
. . Serratia proteamaculans 568 ..............................................  196  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Serratia protea
. . Acinetobacter sp. ADP1 ...................................................  196  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Acinetobacter s
. . Acinetobacter baumannii AYE ..............................................  196  1 hit  [g-proteobacteria]       branched-chain amino acid aminotransferase [Acinetobacter b
. . Acinetobacter baumannii ATCC 19606 .......................................  196  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Acinetobacter b
. . Acinetobacter baumannii ..................................................  196  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Acinetobacter b
. . Enterobacter sp. 638 .....................................................  196  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Enterobacter sp
. . Yersinia mollaretii ATCC 43969 ...........................................  196  2 hits [enterobacteria]         Branched-chain-amino-acid aminotransferase [Yersinia mollar
. . Dickeya zeae Ech1591 .....................................................  196  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Dickeya zeae Ec
. . Yersinia enterocolitica subsp. enterocolitica 8081 .......................  196  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia entero
. . Acinetobacter baumannii ACICU ............................................  196  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase/4-amino-4-deoxyc
. . Acinetobacter baumannii AB0057 ...........................................  196  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase/4-amino-4-deoxyc
. . Acinetobacter baumannii AB307-0294 .......................................  196  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase/4-amino-4-deoxyc
. . Acinetobacter baumannii ATCC 17978 .......................................  196  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase/4-amino-4-deoxyc
. . Acinetobacter baumannii AB900 ............................................  196  1 hit  [g-proteobacteria]       branched-chain amino acid aminotransferase/4-amino-4-deoxyc
. . Yersinia aldovae ATCC 35236 ..............................................  195  2 hits [enterobacteria]         Branched-chain-amino-acid aminotransferase [Yersinia aldova
. . Acinetobacter baumannii SDF ..............................................  195  1 hit  [g-proteobacteria]       branched-chain amino acid aminotransferase [Acinetobacter b
. . Yersinia intermedia ATCC 29909 ...........................................  195  2 hits [enterobacteria]         Branched-chain-amino-acid aminotransferase [Yersinia interm
. . Yersinia rohdei ATCC 43380 ...............................................  195  2 hits [enterobacteria]         Branched-chain-amino-acid aminotransferase [Yersinia rohdei
. . Yersinia frederiksenii ATCC 33641 ........................................  195  2 hits [enterobacteria]         Branched-chain-amino-acid aminotransferase [Yersinia freder
. . Acinetobacter calcoaceticus RUH2202 ......................................  194  2 hits [g-proteobacteria]       branched-chain amino acid transferase [Acinetobacter calcoa
. . Arsenophonus nasoniae ....................................................  194  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Arsenophonus na
. . Acinetobacter sp. RUH2624 ................................................  194  2 hits [g-proteobacteria]       branched-chain amino acid transferase [Acinetobacter sp. RU
. . Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .................  194  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Salmonella ente
. . Yersinia bercovieri ATCC 43970 ...........................................  194  2 hits [enterobacteria]         Branched-chain-amino-acid aminotransferase [Yersinia bercov
. . Pectobacterium wasabiae WPP163 ...........................................  194  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Pectobacterium 
. . Teredinibacter turnerae T7901 ............................................  193  2 hits [g-proteobacteria]       branched-chain-amino-acid transaminase [Teredinibacter turn
. . Photorhabdus asymbiotica .................................................  193  2 hits [enterobacteria]         branched-chain amino acid aminotransferase (transaminase b)
. . Erwinia amylovora ATCC 49946 .............................................  193  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Erwinia amylovo
. . Photobacterium damselae subsp. damselae CIP 102761 .......................  192  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Photobacterium 
. . Verrucomicrobiae bacterium DG1235 ........................................  192  2 hits [verrucomicrobia]        branched-chain amino acid aminotransferase [Verrucomicrobia
. . Proteus mirabilis HI4320 .................................................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Proteus mirabil
. . Proteus mirabilis ATCC 29906 .............................................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Proteus mirabil
. . Grimontia hollisae CIP 101886 ............................................  192  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Grimontia holli
. . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ........................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Klebsiella pneu
. . Klebsiella pneumoniae NTUH-K2044 .........................................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Klebsiella pneu
. . Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 .................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Klebsiella pneu
. . Acinetobacter sp. ATCC 27244 .............................................  192  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Acinetobacter s
. . Pectobacterium carotovorum subsp. brasiliensis PBR1692 ...................  192  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Pectobacterium 
. . Yersinia pestis KIM 10 ...................................................  192  2 hits [enterobacteria]         branched-chain amino-acid aminotransferase [Yersinia pestis
. . Yersinia pestis biovar Microtus str. 91001 ...............................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pseudotuberculosis IP 32953 .....................................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pestis Antiqua ..................................................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pestis Nepal516 .................................................  192  4 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pestis Pestoides F ..............................................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pseudotuberculosis IP 31758 .....................................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pestis CA88-4125 ................................................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pestis Angola ...................................................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pestis biovar Orientalis str. F1991016 ..........................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pestis biovar Orientalis str. IP275 .............................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pestis biovar Antiqua str. E1979001 .............................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pestis biovar Antiqua str. B42003004 ............................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pestis biovar Antiqua str. UG05-0454 ............................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pestis biovar Orientalis str. MG05-1020 .........................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pestis biovar Mediaevalis str. K1973002 .........................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pestis FV-1 .....................................................  192  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pseudotuberculosis YPIII ........................................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pseudotuberculosis PB1/+ ........................................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pestis CO92 .....................................................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pestis Pestoides A ..............................................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pestis biovar Orientalis str. PEXU2 .............................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pestis biovar Orientalis str. India 195 .........................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pestis KIM D27 ..................................................  192  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pestis D106004 ..................................................  192  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Yersinia pestis D182038 ..................................................  192  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Yersinia pestis
. . Acinetobacter radioresistens SK82 ........................................  191  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Acinetobacter r
. . Pectobacterium carotovorum subsp. carotovorum PC1 ........................  191  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Pectobacterium 
. . Acinetobacter radioresistens SH164 .......................................  191  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [Acinetobacter r
. . marine gamma proteobacterium HTCC2080 ....................................  191  2 hits [g-proteobacteria]       branched-chain amino acid transferase [marine gamma proteob
. . Pectobacterium atrosepticum SCRI1043 .....................................  191  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Pectobacterium 
. . Stigmatella aurantiaca DW4/3-1 ...........................................  191  4 hits [d-proteobacteria]       branched-chain amino acid aminotransferase [Stigmatella aur
. . Pectobacterium carotovorum subsp. carotovorum WPP14 ......................  191  1 hit  [enterobacteria]         branched-chain amino acid aminotransferase [Pectobacterium 
. . Myxococcus xanthus DK 1622 ...............................................  190  2 hits [d-proteobacteria]       branched-chain amino acid aminotransferase [Myxococcus xant
. . Photorhabdus luminescens subsp. laumondii TTO1 ...........................  189  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Photorhabdus lu
. . Exiguobacterium sibiricum 255-15 .........................................  189  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Exiguobacterium
. . Yersinia ruckeri ATCC 29473 ..............................................  186  2 hits [enterobacteria]         Branched-chain-amino-acid aminotransferase [Yersinia rucker
. . Exiguobacterium sp. AT1b .................................................  185  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Exiguobacterium
. . Parvularcula bermudensis HTCC2503 ........................................  185  2 hits [a-proteobacteria]       branched-chain amino acid aminotransferase [Parvularcula be
. . gamma proteobacterium NOR51-B ............................................  184  2 hits [g-proteobacteria]       branched-chain amino acid aminotransferase [gamma proteobac
. . Sodalis glossinidius str. 'morsitans' ....................................  184  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Sodalis glossin
. . Candidatus Blochmannia floridanus ........................................  184  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Candidatus Bloc
. . Bacillus cereus B4264 ....................................................  181  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus cellulosilyticus DSM 2522 .......................................  181  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus cellul
. . Bacillus thuringiensis serovar tochigiensis BGSC 4Y1 .....................  180  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus thurin
. . Bacillus cereus ATCC 4342 ................................................  180  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus cereus m1550 ....................................................  180  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus cereus
. . Anaerocellum thermophilum DSM 6725 .......................................  180  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Anaerocellum th
. . Caldicellulosiruptor saccharolyticus DSM 8903 ............................  180  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Caldicellulosir
. . Bacillus cereus ATCC 10987 ...............................................  178  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus cereus ATCC 14579 ...............................................  178  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus cereus AH676 ....................................................  178  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus cereus BDRD-Cer4 ................................................  178  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus cereus AH1134 ...................................................  178  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus selenitireducens MLS10 ..........................................  178  2 hits [firmicutes]             Branched-chain-amino-acid transaminase [Bacillus selenitire
. . Bacillus thuringiensis serovar kurstaki str. T03a001 .....................  178  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus thurin
. . Bacillus cereus Rock4-2 ..................................................  178  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus thurin
. . Bacillus cereus 172560W ..................................................  178  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus thurin
. . Bacillus cereus ATCC 10876 ...............................................  178  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus thurin
. . Thermoanaerobacter pseudethanolicus ATCC 33223 ...........................  178  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Thermoanaerobac
. . Thermoanaerobacter brockii subsp. finnii Ako-1 ...........................  178  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Thermoanaerobac
. . Bacillus cereus Rock1-15 .................................................  178  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus cereus BDRD-ST24 ................................................  178  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus cereus F65185 ...................................................  178  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus cereus AH1273 ...................................................  178  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus cereus MM3 ......................................................  178  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus cereus AH1272 ...................................................  178  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus cereus
. . Rhodobacterales bacterium HTCC2255 .......................................  177  2 hits [a-proteobacteria]       branched-chain amino acid aminotransferase [alpha proteobac
. . Thermoanaerobacterium thermosaccharolyticum DSM 571 ......................  177  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Thermoanaerobac
. . Thermoanaerobacter sp. X514 ..............................................  177  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Thermoanaerobac
. . Thermoanaerobacter sp. X513 ..............................................  177  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Thermoanaerobac
. . Thermoanaerobacter sp. X561 ..............................................  177  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Thermoanaerobac
. . Thermoanaerobacter ethanolicus CCSD1 .....................................  177  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Thermoanaerobac
. . Thermoanaerobacter italicus Ab9 ..........................................  177  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Thermoanaerobac
. . Bacillus cereus G9241 ....................................................  177  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus cereus H3081.97 .................................................  177  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus cereus AH187 ....................................................  177  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus cereus Q1 .......................................................  177  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus cereus BDRD-ST26 ................................................  177  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus cereus m1293 ....................................................  177  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus cereus Rock3-42 .................................................  177  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus cereus
. . Burkholderia glumae BGR1 .................................................  177  2 hits [b-proteobacteria]       Branched-chain amino acid aminotransferase [Burkholderia gl
. . Bacillus anthracis str. Ames .............................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus anthracis str. 'Ames Ancestor' ..................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus anthracis str. Sterne ...........................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus thuringiensis serovar konkukian str. 97-27 ......................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus cereus E33L .....................................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus anthracis str. A2012 ............................................  176  1 hit  [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus thuringiensis str. Al Hakam .....................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus anthracis str. A0488 ............................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus anthracis str. A0193 ............................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus anthracis str. A0465 ............................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus anthracis str. A0389 ............................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus anthracis str. A0174 ............................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus anthracis Tsiankovskii-I ........................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus cereus W ........................................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus cereus NVH0597-99 ...............................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus cereus 03BB108 ..................................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus cereus AH820 ....................................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus cereus 03BB102 ..................................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus anthracis str. CDC 684 ..........................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus thuringiensis serovar andalousiensis BGSC 4AW1 ..................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus cereus BGSC 6E1 .................................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus anthracis str. A0248 ............................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus anthracis str. CNEVA-9066 .......................................  176  1 hit  [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus anthracis str. A1055 ............................................  176  1 hit  [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus anthracis str. Western North America USA6153 ....................  176  1 hit  [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus anthracis str. Vollum ...........................................  176  1 hit  [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus anthracis str. Australia 94 .....................................  176  1 hit  [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1 .................  176  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus thurin
. . Bacillus cereus AH1271 ...................................................  176  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus cereus
. . Candidatus Blochmannia pennsylvanicus str. BPEN ..........................  176  2 hits [enterobacteria]         branched-chain amino acid aminotransferase [Candidatus Bloc
. . Bacillus thuringiensis serovar pulsiensis BGSC 4CC1 ......................  176  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus thurin
. . Bacillus thuringiensis serovar huazhongensis BGSC 4BD1 ...................  176  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus thurin
. . Bacillus cereus AH621 ....................................................  176  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus anthracis str. A0442 ............................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Bacillus anthracis str. Kruger B .........................................  176  1 hit  [firmicutes]             branched-chain amino acid aminotransferase [Bacillus anthra
. . Pelotomaculum thermopropionicum SI .......................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Pelotomaculum t
. . Bacillus cereus 95/8201 ..................................................  176  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus thuringiensis serovar israelensis ATCC 35646 ....................  176  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus thurin
. . Bacillus cereus G9842 ....................................................  176  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus thurin
. . Bacillus thuringiensis serovar berliner ATCC 10792 .......................  176  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus thurin
. . Bacillus thuringiensis serovar thuringiensis str. T01001 .................  176  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus thurin
. . Bacillus thuringiensis Bt407 .............................................  176  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus thurin
. . Bacillus weihenstephanensis KBAB4 ........................................  176  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus weihen
. . Bacillus thuringiensis IBL 4222 ..........................................  176  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus thurin
. . Bacillus thuringiensis serovar sotto str. T04001 .........................  176  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus thurin
. . Bacillus mycoides DSM 2048 ...............................................  176  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus mycoid
. . Bacillus thuringiensis serovar monterrey BGSC 4AJ1 .......................  175  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus thurin
. . Bacillus cereus Rock4-18 .................................................  175  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus cereus Rock3-29 .................................................  175  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus cereus
. . Bacillus cereus Rock3-28 .................................................  175  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus cereus
. . Roseobacter denitrificans OCh 114 ........................................  174  2 hits [a-proteobacteria]       branched-chain amino acid aminotransferase [Roseobacter den
. . Thermoanaerobacter tengcongensis MB4 .....................................  174  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Thermoanaerobac
. . Bacillus thuringiensis IBL 200 ...........................................  174  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus thurin
. . Thermoanaerobacter mathranii subsp. mathranii str. A3 ....................  174  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Thermoanaerobac
. . Bacillus cereus Rock1-3 ..................................................  174  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus cereus
. . Heliobacterium modesticaldum Ice1 ........................................  173  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Heliobacterium 
. . Bacillus thuringiensis serovar pakistani str. T13001 .....................  173  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus thurin
. . Bacillus pseudomycoides DSM 12442 ........................................  173  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus pseudo
. . Bacillus mycoides Rock1-4 ................................................  173  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus mycoid
. . Sphaerobacter thermophilus DSM 20745 .....................................  172  2 hits [GNS bacteria]           branched-chain amino acid aminotransferase [Sphaerobacter t
. . Verrucomicrobium spinosum DSM 4136 .......................................  172  1 hit  [verrucomicrobia]        branched-chain amino acid aminotransferase [Verrucomicrobiu
. . Candidatus Pelagibacter sp. HTCC7211 .....................................  172  2 hits [a-proteobacteria]       branched-chain amino acid aminotransferase [Candidatus Pela
. . Bacillus mycoides Rock3-17 ...............................................  171  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus mycoid
. . Bacillus cytotoxicus NVH 391-98 ..........................................  171  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Bacillus cereus
. . Phaeobacter gallaeciensis BS107 ..........................................  171  2 hits [a-proteobacteria]       branched-chain amino acid aminotransferase [Phaeobacter gal
. . Phaeobacter gallaeciensis 2.10 ...........................................  171  2 hits [a-proteobacteria]       branched-chain amino acid aminotransferase [Phaeobacter gal
. . Hydrogenobaculum sp. SN ..................................................  171  2 hits [aquificales]            branched-chain amino acid aminotransferase [Hydrogenobaculu
. . Chitinophaga pinensis DSM 2588 ...........................................  171  2 hits [CFB group bacteria]     branched-chain amino acid aminotransferase [Chitinophaga pi
. . Flavobacteria bacterium BAL38 ............................................  171  2 hits [CFB group bacteria]     branched-chain amino acid aminotransferase [Flavobacteria b
. . Carboxydothermus hydrogenoformans Z-2901 .................................  171  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Carboxydothermu
. . Hydrogenobaculum sp. Y04AAS1 .............................................  170  2 hits [aquificales]            branched-chain amino acid aminotransferase [Hydrogenobaculu
. . uncultured Termite group 1 bacterium phylotype Rs-D17 ....................  170  2 hits [bacteria]               branched-chain-amino-acid aminotransferase [uncultured Term
. . Rhodobacterales bacterium Y4I ............................................  170  2 hits [a-proteobacteria]       branched-chain amino acid aminotransferase [Rhodobacterales
. . Rhodomicrobium vannielii ATCC 17100 ......................................  170  2 hits [a-proteobacteria]       branched-chain amino acid aminotransferase [Rhodomicrobium 
. . Akkermansia muciniphila ATCC BAA-835 .....................................  169  2 hits [verrucomicrobia]        branched-chain amino acid aminotransferase [Akkermansia muc
. . Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 ............  169  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Alicyclobacillu
. . Pedobacter heparinus DSM 2366 ............................................  169  2 hits [CFB group bacteria]     branched-chain amino acid aminotransferase [Pedobacter hepa
. . Bacillus cereus R309803 ..................................................  169  2 hits [firmicutes]             Branched-chain amino acid aminotransferase [Bacillus cereus
. . Dethiobacter alkaliphilus AHT 1 ..........................................  169  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Dethiobacter al
. . Oceanicola granulosus HTCC2516 ...........................................  169  2 hits [a-proteobacteria]       Branched chain acid aminotransferase [Oceanicola granulosus
. . Candidatus Desulforudis audaxviator MP104C ...............................  169  2 hits [firmicutes]             branched-chain amino acid aminotransferase [Candidatus Desu
. uncultured marine microorganism HF4000_APKG2M17 ----------------------------  223  1 hit  [unclassified]           putative aminotransferase class IV [uncultured marine micro

BLAST

PROTOCOL

a)BLASTp vs NR. default NCBI parameters * '1000 Max target sequence '


RESULTS ANALYSIS


The results of the BLASTp were significants,the E-values are low,who represent a good homology with compared the sequences.


The best E-value estimated were 1e-66 and corresponds to a brached-chain amino-acid aminotrasferase.


Our protein don´t differs much of taxonomic groups founded in the Lineage Report ,because the sequence is too conserved,so we don´t chose outgroup and we make a phylogenetic tree only based in ingroups.






RAW RESULTS

1)BLASTp      

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|NP_276546.1|  branched-chain amino-acid aminotransferase [...   257    1e-66
sp|O27481.2|ILVE_METTH  RecName: Full=Putative branched-chain-...   257    1e-66
ref|YP_003395340.1|  branched-chain amino acid aminotransferas...   256    1e-66
ref|YP_447078.1|  hypothetical protein Msp_0015 [Methanosphaer...   254    8e-66
ref|YP_001273775.1|  branched-chain-amino-acid aminotransferas...   246    2e-63
ref|ZP_03608009.1|  hypothetical protein METSMIALI_01133 [Meth...   246    2e-63
ref|ZP_06753654.1|  branched-chain-amino-acid transaminase [Si...   243    1e-62
ref|YP_003424849.1|  branched-chain-amino-acid aminotransferas...   241    5e-62
emb|CBH38165.1|  putative branched-chain-amino-acid aminotrans...   241    8e-62
ref|YP_157548.1|  branched-chain amino acid aminotransferase [...   240    1e-61
ref|YP_002248977.1|  branched-chain amino acid aminotransferas...   239    3e-61
ref|ZP_05081594.1|  branched-chain amino acid aminotransferase...   238    6e-61
ref|YP_001561347.1|  branched-chain amino acid aminotransferas...   238    6e-61
ref|YP_002801580.1|  Branched-chain amino acid aminotransferas...   238    7e-61
ref|YP_544737.1|  branched-chain amino acid aminotransferase [...   237    8e-61
ref|ZP_01871917.1|  branched-chain amino acid aminotransferase...   237    9e-61
ref|YP_658927.1|  branched-chain amino acid aminotransferase [...   237    1e-60
ref|YP_001276299.1|  branched-chain amino acid aminotransferas...   236    1e-60
ref|YP_003130920.1|  branched-chain amino acid aminotransferas...   236    2e-60
ref|YP_001505461.1|  branched-chain amino acid aminotransferas...   236    2e-60
ref|YP_001431661.1|  branched-chain amino acid aminotransferas...   236    2e-60
ref|ZP_01914940.1|  branched-chain amino acid aminotransferase...   235    4e-60
ref|ZP_06413470.1|  branched-chain amino acid aminotransferase...   235    5e-60
ref|YP_001174315.1|  branched-chain amino acid aminotransferas...   234    8e-60
ref|YP_003049309.1|  branched-chain amino acid aminotransferas...   234    8e-60
ref|YP_003276159.1|  branched-chain amino acid aminotransferas...   234    1e-59
ref|YP_715992.1|  branched-chain amino-acid aminotransferase [...   233    1e-59
ref|YP_001406988.1|  branched-chain amino acid aminotransferas...   233    1e-59
ref|ZP_06240992.1|  branched-chain amino acid aminotransferase...   233    1e-59
ref|ZP_03545752.1|  branched-chain amino acid aminotransferase...   233    2e-59
ref|ZP_05315599.1|  branched-chain amino acid aminotransferase...   232    3e-59
ref|YP_001634125.1|  branched-chain amino acid aminotransferas...   232    3e-59
ref|NP_253700.1|  branched-chain amino acid aminotransferase [...   232    3e-59
ref|YP_446418.1|  branched-chain amino acid aminotransferase [...   232    3e-59
ref|YP_001351067.1|  branched-chain amino acid aminotransferas...   231    5e-59
ref|YP_002464513.1|  branched-chain amino acid aminotransferas...   231    5e-59
ref|YP_003572416.1|  branched-chain amino acid aminotransferas...   231    5e-59
ref|YP_968645.1|  branched-chain amino acid aminotransferase [...   231    6e-59
ref|ZP_02001485.1|  Aminotransferase, class IV [Beggiatoa sp. ...   230    9e-59
ref|YP_001186080.1|  branched-chain amino acid aminotransferas...   230    1e-58
ref|YP_003168145.1|  branched-chain amino acid aminotransferas...   230    1e-58
ref|ZP_06475007.1|  branched-chain amino acid aminotransferase...   230    1e-58
ref|YP_001022740.1|  branched-chain amino acid aminotransferas...   230    1e-58
ref|YP_432352.1|  branched-chain amino acid aminotransferase [...   230    1e-58
ref|ZP_03698417.1|  branched-chain amino acid aminotransferase...   230    2e-58
ref|ZP_01551848.1|  branched-chain amino acid aminotransferase...   229    2e-58
ref|YP_002763250.1|  branched-chain amino-acid aminotransferas...   229    2e-58
ref|YP_003534406.1|  branched-chain amino acid aminotransferas...   229    2e-58
ref|YP_002607948.1|  branched-chain amino acid aminotransferas...   229    2e-58
ref|YP_547066.1|  branched-chain amino acid aminotransferase [...   229    2e-58
ref|YP_001357556.1|  branched-chain amino acid aminotransferas...   229    3e-58
ref|ZP_06210631.1|  branched-chain amino acid aminotransferase...   229    3e-58
ref|YP_003110133.1|  branched-chain amino acid aminotransferas...   229    3e-58
ref|YP_003404233.1|  branched-chain amino acid aminotransferas...   229    3e-58
ref|YP_137494.1|  branched-chain amino acid aminotransferase [...   228    4e-58
ref|YP_286494.1|  branched-chain amino acid aminotransferase [...   228    6e-58
ref|YP_001357006.1|  branched-chain amino acid aminotransferas...   228    6e-58
ref|YP_934278.1|  branched-chain amino acid aminotransferase [...   228    7e-58
ref|YP_003051913.1|  branched-chain amino acid aminotransferas...   228    8e-58
ref|NP_901764.1|  branched-chain amino acid aminotransferase [...   227    8e-58
ref|ZP_04763517.1|  branched-chain amino acid aminotransferase...   227    8e-58
ref|YP_001790335.1|  branched-chain amino acid aminotransferas...   227    8e-58
ref|YP_694021.1|  branched-chain amino acid aminotransferase [...   227    1e-57
ref|YP_482712.1|  branched chain amino acid aminotransferase /...   227    1e-57
ref|YP_002565027.1|  branched-chain amino acid aminotransferas...   227    1e-57
ref|YP_003479093.1|  branched-chain amino acid aminotransferas...   226    1e-57
ref|YP_002551686.1|  branched-chain amino acid aminotransferas...   226    2e-57
ref|YP_390804.1|  branched-chain amino acid aminotransferase [...   226    2e-57
ref|NP_885711.1|  branched-chain amino acid aminotransferase [...   226    2e-57
ref|ZP_05294110.1|  Branched-chain amino acid aminotransferase...   226    2e-57
ref|YP_984513.1|  branched-chain amino acid aminotransferase [...   226    2e-57
ref|ZP_05041163.1|  branched-chain amino acid aminotransferase...   226    3e-57
ref|YP_001629524.1|  branched-chain amino acid aminotransferas...   226    3e-57
ref|YP_001354538.1|  branched-chain amino acid aminotransferas...   226    3e-57
ref|YP_001798232.1|  branched-chain amino acid aminotransferas...   225    3e-57
ref|YP_748193.1|  branched-chain amino acid aminotransferase [...   225    4e-57
ref|NP_881926.1|  branched-chain amino acid aminotransferase [...   224    5e-57
ref|YP_001156595.1|  branched-chain amino acid aminotransferas...   224    7e-57
ref|YP_001581526.1|  branched-chain amino acid aminotransferas...   224    8e-57
ref|ZP_05625326.1|  branched-chain amino acid aminotransferase...   224    9e-57
ref|ZP_05061818.1|  branched-chain amino acid aminotransferase...   224    1e-56
ref|YP_003524713.1|  branched-chain amino acid aminotransferas...   224    1e-56
ref|YP_002512549.1|  branched-chain amino acid aminotransferas...   223    1e-56
ref|ZP_04831352.1|  branched-chain amino acid aminotransferase...   223    2e-56
gb|ABZ08279.1|  putative aminotransferase class IV [uncultured...   223    2e-56
ref|YP_002219161.1|  branched-chain amino acid aminotransferas...   222    3e-56
ref|YP_865777.1|  branched chain amino acid aminotransferase /...   222    3e-56
ref|YP_342199.1|  branched-chain amino acid aminotransferase [...   222    3e-56
ref|ZP_03998359.1|  branched chain amino acid aminotransferase...   222    3e-56
ref|ZP_01075706.1|  branched-chain amino acid aminotransferase...   222    4e-56
ref|ZP_05049464.1|  branched-chain amino acid aminotransferase...   222    4e-56
ref|NP_841915.1|  branched-chain amino acid aminotransferase [...   222    4e-56
ref|YP_003263999.1|  branched-chain amino acid aminotransferas...   221    5e-56
ref|YP_003291939.1|  branched-chain amino acid aminotransferas...   221    6e-56
ref|YP_702933.1|  branched-chain-amino-acid transaminase [Rhod...   221    6e-56
ref|YP_315892.1|  branched-chain amino acid aminotransferase [...   221    8e-56
emb|CBA26681.1|  Branched-chain-amino-acid aminotransferase [C...   221    8e-56
ref|ZP_01133272.1|  branched-chain amino acid aminotransferase...   221    8e-56
ref|YP_003176943.1|  branched-chain amino acid aminotransferas...   221    9e-56
ref|ZP_01072039.1|  branched-chain amino acid aminotransferase...   220    1e-55
ref|YP_003459552.1|  branched-chain amino acid aminotransferas...   220    1e-55
gb|AAV34463.1|  predicted branched-chain amino acid transferas...   220    1e-55
ref|YP_178338.1|  branched-chain amino acid aminotransferase [...   220    1e-55
ref|ZP_04570265.1|  2-keto-4-methylthiobutyrate aminotransfera...   220    2e-55
ref|NP_859982.1|  branched-chain amino acid aminotransferase [...   219    2e-55
ref|YP_003393022.1|  branched-chain amino acid aminotransferas...   219    2e-55
ref|YP_997238.1|  branched-chain amino acid aminotransferase [...   219    2e-55
ref|YP_394386.1|  branched-chain amino acid aminotransferase [...   219    2e-55
ref|YP_743529.1|  branched-chain amino acid aminotransferase [...   219    2e-55
ref|ZP_01067932.1|  branched-chain amino acid aminotransferase...   219    2e-55
ref|YP_891506.1|  branched-chain amino acid aminotransferase [...   219    2e-55
ref|YP_002894267.1|  branched-chain amino acid aminotransferas...   219    2e-55
ref|YP_411755.1|  branched-chain amino acid aminotransferase [...   219    3e-55
ref|ZP_04583164.1|  branched-chain amino acid aminotransferase...   219    3e-55
ref|YP_002942183.1|  branched-chain amino acid aminotransferas...   219    3e-55
emb|CAF28704.1|  putative branched chain amino acid aminotrans...   219    3e-55
ref|YP_003444056.1|  branched-chain amino acid aminotransferas...   219    3e-55
ref|YP_003517281.1|  branched-chain amino acid aminotransferas...   219    3e-55
ref|YP_980393.1|  branched-chain amino acid aminotransferase [...   219    4e-55
ref|YP_002354864.1|  branched-chain amino acid aminotransferas...   218    4e-55
ref|ZP_01810091.1|  branched-chain amino acid aminotransferase...   218    6e-55
ref|ZP_00953518.1|  branched-chain amino acid aminotransferase...   218    6e-55
ref|ZP_06372758.1|  branched-chain amino acid aminotransferase...   218    7e-55
ref|YP_003497175.1|  branched-chain amino acid aminotransferas...   218    7e-55
emb|CAZ89909.1|  Branched-chain-amino-acid aminotransferase (T...   218    7e-55
ref|ZP_05499145.1|  branched-chain amino acid aminotransferase...   218    7e-55
gb|ABZ07127.1|  putative aminotransferase class IV [uncultured...   217    9e-55
ref|YP_595290.1|  branched-chain amino acid aminotransferase [...   217    9e-55
ref|ZP_01900635.1|  branched-chain amino acid aminotransferase...   217    1e-54
ref|YP_001100854.1|  branched-chain amino acid aminotransferas...   217    1e-54
ref|ZP_06373183.1|  branched-chain amino acid aminotransferase...   217    1e-54
ref|ZP_05103344.1|  branched-chain amino acid aminotransferase...   216    2e-54
ref|ZP_03657016.1|  branched-chain amino acid aminotransferase...   216    2e-54
ref|YP_589791.1|  branched chain amino acid aminotransferase /...   216    2e-54
ref|YP_002796138.1|  IlvE [Laribacter hongkongensis HLHK9] >gb...   216    2e-54
ref|ZP_04808243.1|  branched-chain amino acid aminotransferase...   216    3e-54
ref|NP_280782.1|  branched-chain amino acid aminotransferase [...   216    3e-54
ref|ZP_06068147.1|  branched-chain amino acid aminotransferase...   216    3e-54
ref|YP_001467573.1|  branched-chain amino acid aminotransferas...   215    4e-54
ref|ZP_02155930.1|  branched-chain amino acid aminotransferase...   215    4e-54
ref|YP_521789.1|  branched-chain amino acid aminotransferase [...   215    4e-54
ref|YP_001398688.1|  branched-chain amino acid aminotransferas...   215    4e-54
ref|NP_906360.1|  branched-chain amino acid aminotransferase [...   215    5e-54
ref|ZP_00371476.1|  branched-chain amino acid aminotransferase...   214    6e-54
ref|YP_002575971.1|  branched-chain amino-acid aminotransferas...   214    6e-54
ref|YP_002755510.1|  branched-chain-amino-acid transaminase [A...   214    7e-54
ref|ZP_05620646.1|  branched-chain amino acid aminotransferase...   214    7e-54
ref|YP_003558615.1|  branched-chain amino acid aminotransferas...   214    7e-54
ref|YP_002309782.1|  Branched-chain amino acid amiotransferase...   214    8e-54
ref|YP_001999129.1|  branched-chain amino acid aminotransferas...   214    9e-54
ref|ZP_01451758.1|  branched-chain amino acid aminotransferase...   214    1e-53
ref|ZP_06064390.1|  branched-chain amino acid transferase [Aci...   214    1e-53
ref|ZP_00367523.1|  branched-chain amino acid aminotransferase...   213    1e-53
ref|YP_271484.1|  branched-chain amino acid aminotransferase [...   213    1e-53
ref|YP_001279881.1|  branched-chain amino acid aminotransferas...   213    2e-53
ref|NP_799439.1|  branched-chain amino acid aminotransferase [...   213    2e-53
ref|ZP_05943197.1|  branched-chain amino acid aminotransferase...   213    2e-53
ref|YP_002256421.1|  branched-chain amino acid aminotransferas...   213    2e-53
ref|ZP_06064944.1|  branched-chain amino acid aminotransferase...   213    2e-53
ref|YP_003525771.1|  branched-chain amino acid aminotransferas...   213    2e-53
gb|ABZ09091.1|  putative aminotransferase class IV [uncultured...   213    2e-53
ref|ZP_00943136.1|  Branched-chain amino acid aminotransferase...   213    2e-53
ref|YP_002992032.1|  branched-chain amino acid aminotransferas...   212    3e-53
ref|YP_002015252.1|  branched-chain amino acid aminotransferas...   212    3e-53
ref|ZP_05883897.1|  branched-chain amino acid aminotransferase...   212    3e-53
ref|ZP_01868736.1|  branched-chain amino acid aminotransferase...   212    3e-53
ref|ZP_06465195.1|  branched-chain amino acid aminotransferase...   212    3e-53
ref|ZP_01128868.1|  branched-chain amino acid aminotransferase...   212    3e-53
ref|YP_002953909.1|  branched-chain-amino-acid aminotransferas...   212    3e-53
ref|YP_001489072.1|  branched-chain amino acid aminotransferas...   212    3e-53
ref|ZP_05119463.1|  branched-chain amino acid aminotransferase...   212    4e-53
ref|YP_287274.1|  branched chain amino acid: 2-keto-4-methylth...   212    4e-53
ref|NP_518688.1|  branched-chain amino acid aminotransferase [...   212    4e-53
ref|ZP_05111490.1|  branched-chain amino acid aminotransferase...   212    4e-53
ref|YP_755517.1|  branched-chain amino acid aminotransferase [...   212    4e-53
ref|ZP_06026010.1|  branched-chain-amino-acid transaminase [Fu...   212    4e-53
ref|ZP_04582282.1|  branched-chain-amino-acid aminotransferase...   211    5e-53
ref|NP_662488.1|  branched-chain amino acid aminotransferase [...   211    5e-53
ref|ZP_06177006.1|  branched-chain amino acid aminotransferase...   211    5e-53
ref|YP_554936.1|  branched-chain amino acid aminotransferase [...   211    5e-53
ref|YP_114760.1|  branched-chain amino acid aminotransferase [...   211    5e-53
ref|ZP_06231540.1|  branched-chain amino acid aminotransferase...   211    7e-53
ref|YP_001003914.1|  branched-chain amino acid aminotransferas...   211    8e-53
ref|YP_001092422.1|  branched-chain amino acid aminotransferas...   211    8e-53
ref|YP_003341104.1|  branched-chain amino acid aminotransferas...   211    1e-52
ref|ZP_06293780.1|  branched-chain amino acid aminotransferase...   210    1e-52
ref|YP_001547203.1|  branched-chain amino acid aminotransferas...   210    1e-52
ref|YP_001407530.1|  branched-chain amino acid aminotransferas...   210    1e-52
ref|ZP_03497889.1|  branched-chain amino acid aminotransferase...   210    1e-52
gb|EES52206.1|  branched-chain amino acid aminotransferase [Le...   210    1e-52
ref|YP_001500210.1|  branched-chain amino acid aminotransferas...   210    1e-52
ref|YP_205941.1|  branched-chain amino acid aminotransferase [...   210    2e-52
ref|YP_001676141.1|  branched-chain amino acid aminotransferas...   210    2e-52
ref|YP_003303253.1|  branched-chain amino acid aminotransferas...   209    2e-52
ref|YP_331241.1|  branched-chain amino acid aminotransferase [...   209    2e-52
ref|ZP_03659424.1|  branched-chain amino acid aminotransferase...   209    2e-52
ref|YP_582648.1|  branched-chain amino acid aminotransferase [...   209    2e-52
ref|YP_903806.1|  branched chain amino acid: 2-keto-4-methylth...   209    2e-52
ref|YP_826805.1|  branched chain amino acid aminotransferase [...   209    2e-52
ref|YP_001140068.1|  branched-chain amino acid aminotransferas...   209    2e-52
ref|ZP_05070482.1|  branched-chain amino acid aminotransferase...   209    3e-52
ref|ZP_04768773.1|  branched-chain amino acid aminotransferase...   209    3e-52
ref|ZP_03312448.1|  hypothetical protein DESPIG_02375 [Desulfo...   209    3e-52
ref|YP_001995250.1|  branched-chain amino acid aminotransferas...   209    4e-52
ref|YP_001475895.1|  branched-chain amino acid aminotransferas...   208    5e-52
ref|ZP_04971637.1|  branched-chain-amino-acid transaminase [Fu...   208    5e-52
ref|YP_725078.1|  branched-chain amino acid aminotransferase [...   208    5e-52
ref|YP_002157345.1|  branched-chain amino acid aminotransferas...   208    5e-52
ref|ZP_01737744.1|  branched-chain amino acid transferase [Mar...   208    5e-52
ref|YP_001219381.1|  branched-chain amino acid aminotransferas...   208    5e-52
ref|ZP_01065463.1|  branched-chain amino acid aminotransferase...   208    5e-52
ref|YP_002418637.1|  branched-chain amino acid aminotransferas...   208    6e-52
ref|ZP_01986978.1|  branched-chain amino acid aminotransferase...   208    6e-52
ref|YP_264500.1|  branched-chain amino acid aminotransferase [...   208    6e-52
ref|YP_001130904.1|  branched-chain amino acid aminotransferas...   208    6e-52
ref|YP_580441.1|  branched-chain amino acid aminotransferase [...   207    7e-52
ref|ZP_00992180.1|  branched-chain amino acid aminotransferase...   207    7e-52
ref|YP_001795903.1|  branched-chain amino acid aminotransferas...   207    7e-52
ref|ZP_05879998.1|  branched-chain amino acid aminotransferase...   207    8e-52
ref|YP_003180758.1|  branched-chain amino acid aminotransferas...   207    9e-52
ref|YP_441216.1|  branched-chain amino acid aminotransferase [...   207    9e-52
ref|ZP_02884598.1|  branched-chain amino acid aminotransferase...   207    9e-52
ref|YP_965641.1|  branched-chain amino acid aminotransferase [...   207    9e-52
ref|ZP_01261087.1|  branched-chain amino acid aminotransferase...   207    1e-51
ref|YP_001856694.1|  branched-chain amino acid aminotransferas...   207    1e-51
ref|YP_143390.1|  branched-chain amino acid aminotransferase [...   207    1e-51
ref|ZP_00439950.1|  branched-chain-amino-acid transaminase [Bu...   207    1e-51
ref|ZP_04963760.1|  branched-chain amino acid aminotransferase...   207    1e-51
ref|ZP_02462476.1|  branched-chain amino acid aminotransferase...   207    1e-51
ref|YP_107418.1|  branched-chain amino acid aminotransferase [...   207    1e-51
ref|ZP_04793988.1|  branched-chain amino acid aminotransferase...   207    1e-51
ref|YP_012407.1|  branched-chain amino acid aminotransferase [...   207    1e-51
ref|ZP_06367972.1|  branched-chain amino acid aminotransferase...   206    1e-51
ref|ZP_01223448.1|  branched-chain amino acid aminotransferase...   206    1e-51
ref|ZP_01814858.1|  branched-chain amino acid aminotransferase...   206    2e-51
ref|ZP_02377960.1|  branched-chain amino acid aminotransferase...   206    2e-51
ref|YP_001896895.1|  branched-chain amino acid aminotransferas...   206    2e-51
ref|YP_005839.1|  branched-chain amino acid aminotransferase [...   206    2e-51
ref|ZP_04579200.1|  branched-chain amino acid aminotransferase...   206    2e-51
ref|YP_003131828.1|  branched-chain amino acid aminotransferas...   206    2e-51
ref|YP_858626.1|  branched-chain amino acid aminotransferase [...   206    3e-51
ref|YP_911068.1|  branched-chain amino acid aminotransferase [...   206    3e-51
ref|YP_560300.1|  branched-chain amino acid aminotransferase [...   206    3e-51
ref|ZP_05717989.1|  branched-chain amino acid aminotransferase...   205    5e-51
gb|EAY57905.1|  Branched-chain amino acid aminotransferase [Le...   204    6e-51
ref|ZP_06224732.1|  branched-chain amino acid aminotransferase...   204    6e-51
gb|EDZ39717.1|  Branched-chain amino acid aminotransferase [Le...   204    6e-51
ref|YP_001959047.1|  branched-chain amino acid aminotransferas...   204    6e-51
ref|YP_001981024.1|  branched-chain amino acid aminotransferas...   204    6e-51
ref|ZP_04917429.1|  branched-chain amino acid amiotransferase ...   204    7e-51
ref|YP_003508758.1|  branched-chain amino acid aminotransferas...   204    7e-51
ref|NP_229688.1|  branched-chain amino acid aminotransferase [...   204    8e-51
ref|YP_774568.1|  branched-chain amino acid aminotransferase [...   204    8e-51
ref|ZP_06078628.1|  branched-chain amino acid aminotransferase...   204    8e-51
ref|ZP_04414336.1|  branched-chain amino acid aminotransferase...   204    8e-51
ref|ZP_05240943.1|  branched-chain amino acid amiotransferase ...   204    8e-51
ref|YP_001758837.1|  branched-chain amino acid aminotransferas...   204    8e-51
ref|ZP_04576122.1|  branched-chain amino acid aminotransferase...   204    9e-51
ref|ZP_06716189.1|  branched-chain-amino-acid transaminase [Ed...   204    9e-51
ref|ZP_06040474.1|  branched-chain amino acid aminotransferase...   204    9e-51
ref|ZP_04035175.1|  branched chain amino acid aminotransferase...   204    1e-50
ref|ZP_05364288.1|  branched-chain amino acid aminotransferase...   204    1e-50
ref|YP_958061.1|  branched-chain amino acid aminotransferase [...   204    1e-50
ref|YP_003156736.1|  branched-chain amino acid aminotransferas...   204    1e-50
ref|YP_380073.1|  branched-chain amino acid aminotransferase [...   203    1e-50
ref|ZP_03267166.1|  branched-chain amino acid aminotransferase...   203    1e-50
ref|ZP_03738515.1|  branched-chain amino acid aminotransferase...   203    2e-50
ref|YP_386561.1|  branched-chain amino acid aminotransferase [...   202    2e-50
ref|YP_002931574.1|  branched-chain amino acid aminotransferas...   202    2e-50
ref|NP_936035.1|  branched-chain amino acid aminotransferase [...   202    3e-50
ref|YP_003197380.1|  branched-chain amino acid aminotransferas...   202    3e-50
ref|YP_002017628.1|  branched-chain amino acid aminotransferas...   202    4e-50
ref|ZP_02905019.1|  branched-chain amino acid aminotransferase...   202    4e-50
ref|YP_375498.1|  branched-chain amino acid aminotransferase [...   202    4e-50
ref|YP_001943884.1|  branched-chain amino acid aminotransferas...   202    4e-50
ref|YP_003294148.1|  branched-chain amino acid aminotransferas...   201    6e-50
ref|YP_370200.1|  branched-chain amino acid aminotransferase [...   201    6e-50
ref|ZP_04944841.1|  Branched-chain amino acid aminotransferase...   201    7e-50
ref|NP_759991.1|  branched-chain amino acid aminotransferase [...   201    7e-50
ref|YP_001378294.1|  branched-chain amino acid aminotransferas...   201    8e-50
ref|ZP_05883480.1|  branched-chain amino acid aminotransferase...   201    8e-50
ref|YP_525864.1|  branched-chain amino acid aminotransferase [...   201    1e-49
ref|YP_131652.1|  branched-chain amino acid aminotransferase [...   201    1e-49
ref|ZP_03611354.1|  branched-chain amino acid aminotransferase...   200    1e-49
ref|YP_001451719.1|  branched-chain amino acid aminotransferas...   200    1e-49
ref|ZP_03579687.1|  branched-chain amino acid aminotransferase...   200    1e-49
ref|YP_001578859.1|  branched-chain amino acid aminotransferas...   200    1e-49
ref|ZP_01161204.1|  branched-chain amino acid aminotransferase...   200    1e-49
ref|ZP_05970895.1|  branched-chain-amino-acid transaminase [En...   200    1e-49
ref|ZP_01221751.1|  branched-chain amino acid aminotransferase...   200    1e-49
ref|ZP_06127164.1|  branched-chain-amino-acid transaminase [Pr...   200    1e-49
ref|ZP_01236959.1|  branched-chain amino acid aminotransferase...   200    1e-49
ref|YP_876302.1|  branched-chain amino acid aminotransferase/4...   200    2e-49
ref|YP_621894.1|  branched-chain amino acid aminotransferase [...   200    2e-49
gb|ABF05753.1|  branched-chain amino-acid aminotransferase [Sh...   200    2e-49
ref|YP_931638.1|  branched-chain-amino-acid transaminase [Azoa...   199    2e-49
ref|ZP_03318336.1|  hypothetical protein PROVALCAL_01267 [Prov...   199    2e-49
ref|YP_464264.1|  branched chain amino acid: 2-keto-4-methylth...   199    2e-49
gb|ABD20280.1|  IlvE [Shigella flexneri]                            199    2e-49
gb|AAC33172.1|  unknown [Pseudomonas aeruginosa]                    199    2e-49
gb|ABD20281.1|  IlvE [Shigella flexneri]                            199    2e-49
ref|YP_001120572.1|  branched-chain amino acid aminotransferas...   199    2e-49
gb|ABD20250.1|  IlvE [Shigella boydii] >gb|ABD20276.1| IlvE [S...   199    2e-49
ref|NP_709575.1|  branched-chain amino acid aminotransferase [...   199    2e-49
ref|YP_543278.1|  branched-chain amino acid aminotransferase [...   199    2e-49
ref|YP_001765942.1|  branched-chain amino acid aminotransferas...   199    3e-49
ref|YP_003470063.1|  branched-chain amino-acid aminotransferas...   199    3e-49
ref|ZP_05128058.1|  branched-chain amino acid aminotransferase...   199    3e-49
ref|YP_002480717.1|  branched-chain amino acid aminotransferas...   199    3e-49
prf||1104250A  aminotransferase,branched chain AA                   199    3e-49
ref|ZP_01103042.1|  Branched-chain-amino-acid aminotransferase...   199    3e-49
ref|ZP_02904314.1|  branched-chain-amino-acid transaminase [Es...   199    3e-49
ref|YP_002133470.1|  branched-chain amino acid aminotransferas...   199    3e-49
ref|NP_290401.1|  branched-chain amino acid aminotransferase [...   199    3e-49
gb|ABD20263.1|  IlvE [Shigella boydii]                              199    3e-49
pdb|1A3G|A  Chain A, Branched-Chain Amino Acid Aminotransferas...   199    3e-49
gb|ABD20270.1|  IlvE [Shigella dysenteriae]                         199    3e-49
ref|ZP_05972921.1|  branched-chain-amino-acid transaminase [Pr...   199    3e-49
gb|ABD20283.1|  IlvE [Shigella flexneri]                            199    3e-49
gb|ABD20251.1|  IlvE [Shigella boydii]                              199    3e-49
gb|ABD20267.1|  IlvE [Shigella dysenteriae]                         199    4e-49
gb|ABD20247.1|  IlvE [Shigella boydii] >gb|ABD20249.1| IlvE [S...   199    4e-49
ref|ZP_03344552.1|  branched-chain amino acid aminotransferase...   199    4e-49
gb|ABD20277.1|  IlvE [Shigella flexneri]                            199    4e-49
ref|YP_312703.1|  branched-chain amino acid aminotransferase [...   199    4e-49
gb|ABD20248.1|  IlvE [Shigella boydii]                              199    4e-49
ref|YP_152837.1|  branched-chain amino acid aminotransferase [...   199    4e-49
ref|YP_003335452.1|  branched-chain amino acid aminotransferas...   198    4e-49
ref|NP_457845.1|  branched-chain amino acid aminotransferase [...   198    4e-49
ref|ZP_03027911.1|  branched-chain-amino-acid transaminase [Es...   198    4e-49
ref|ZP_02910663.1|  branched-chain amino acid aminotransferase...   198    4e-49
ref|YP_002989350.1|  branched-chain amino acid aminotransferas...   198    4e-49
gb|ABD20255.1|  IlvE [Shigella boydii]                              198    5e-49
ref|YP_002491590.1|  branched-chain amino acid aminotransferas...   198    5e-49
ref|ZP_04626070.1|  Branched-chain-amino-acid aminotransferase...   198    5e-49
gb|AAA67573.1|  branched-chain amino-acid aminotransferase [Es...   198    5e-49
ref|YP_002436679.1|  branched-chain amino acid aminotransferas...   198    6e-49
ref|ZP_04558376.1|  branched-chain amino acid aminotransferase...   198    6e-49
ref|ZP_05435352.1|  branched-chain amino acid aminotransferase...   197    7e-49
ref|ZP_06354283.1|  branched-chain-amino-acid transaminase [Ci...   197    7e-49
ref|YP_002228326.1|  branched-chain amino acid aminotransferas...   197    8e-49
ref|YP_003367414.1|  branched-chain amino-acid aminotransferas...   197    8e-49
ref|ZP_05732516.1|  branched-chain amino acid aminotransferase...   197    1e-48
ref|YP_002231946.1|  branched-chain amino acid aminotransferas...   197    1e-48
ref|ZP_02659280.1|  branched-chain amino acid aminotransferase...   197    1e-48
ref|YP_003208572.1|  Branched-chain-amino-acid aminotransferas...   197    1e-48
ref|YP_002241165.1|  branched-chain-amino-acid transaminase [K...   197    1e-48
ref|YP_218795.1|  branched-chain amino acid aminotransferase [...   197    1e-48
gb|EET89855.1|  branched-chain amino acid aminotransferase [Ca...   196    2e-48
ref|YP_003522122.1|  IlvE [Pantoea ananatis LMG 20103] >gb|ADD...   196    2e-48
ref|YP_001906140.1|  branched-chain amino acid aminotransferas...   196    2e-48
ref|ZP_06693403.1|  conserved hypothetical protein [Acinetobac...   196    2e-48
ref|ZP_01385328.1|  branched-chain amino acid aminotransferase...   196    2e-48
ref|ZP_02961743.1|  hypothetical protein PROSTU_03802 [Provide...   196    2e-48
ref|ZP_06192838.1|  branched-chain-amino-acid aminotransferase...   196    2e-48
ref|YP_001439814.1|  branched-chain amino acid aminotransferas...   196    2e-48
ref|YP_001480979.1|  branched-chain amino acid aminotransferas...   196    2e-48
ref|YP_045342.1|  branched-chain amino acid aminotransferase [...   196    2e-48
ref|YP_001712548.1|  branched-chain amino acid aminotransferas...   196    3e-48
ref|YP_001178719.1|  branched-chain amino acid aminotransferas...   196    3e-48
ref|ZP_04642624.1|  Branched-chain-amino-acid aminotransferase...   196    3e-48
ref|ZP_06637796.1|  branched-chain-amino-acid transaminase [Se...   196    3e-48
ref|YP_003002512.1|  branched-chain amino acid aminotransferas...   196    3e-48
ref|YP_001004542.1|  branched-chain amino acid aminotransferas...   196    3e-48
ref|YP_001847814.1|  branched-chain amino acid aminotransferas...   196    3e-48
ref|ZP_04620989.1|  Branched-chain-amino-acid aminotransferase...   195    4e-48
ref|YP_001706168.1|  branched-chain amino acid aminotransferas...   195    4e-48
ref|ZP_04637924.1|  Branched-chain-amino-acid aminotransferase...   195    4e-48
ref|ZP_04612138.1|  Branched-chain-amino-acid aminotransferase...   195    5e-48
ref|ZP_04633126.1|  Branched-chain-amino-acid aminotransferase...   195    6e-48
ref|ZP_06058854.1|  branched-chain amino acid transferase [Aci...   194    6e-48
emb|CBA71822.1|  branched-chain amino acid aminotransferase [A...   194    7e-48
ref|ZP_05823011.1|  branched-chain amino acid transferase [Aci...   194    1e-47
ref|YP_001572691.1|  branched-chain amino acid aminotransferas...   194    1e-47
ref|ZP_04630126.1|  Branched-chain-amino-acid aminotransferase...   194    1e-47
ref|YP_003261550.1|  branched-chain amino acid aminotransferas...   194    1e-47
ref|YP_003075250.1|  branched-chain-amino-acid transaminase [T...   193    1e-47
ref|YP_003042992.1|  branched-chain amino acid aminotransferas...   193    1e-47
ref|YP_003529518.1|  branched-chain amino-acid aminotransferas...   193    1e-47
ref|ZP_06156492.1|  branched-chain amino acid aminotransferase...   192    2e-47
ref|ZP_05057929.1|  branched-chain amino acid aminotransferase...   192    2e-47
ref|YP_002152986.1|  branched-chain amino acid aminotransferas...   192    2e-47
ref|ZP_06050915.1|  branched-chain amino acid aminotransferase...   192    2e-47
ref|YP_001337908.1|  branched-chain amino acid aminotransferas...   192    3e-47
ref|ZP_03824918.1|  branched-chain amino acid aminotransferase...   192    3e-47
ref|ZP_03828022.1|  branched-chain amino acid aminotransferase...   192    3e-47
gb|AAM83928.1|AE013634_1  branched-chain amino-acid aminotrans...   192    4e-47
ref|NP_994442.1|  branched-chain amino acid aminotransferase [...   192    5e-47
ref|ZP_05362288.1|  branched-chain amino acid aminotransferase...   191    6e-47
ref|YP_003019581.1|  branched-chain amino acid aminotransferas...   191    6e-47
ref|ZP_06073344.1|  branched-chain amino acid aminotransferase...   191    7e-47
ref|ZP_01625699.1|  branched-chain amino acid transferase [mar...   191    7e-47
ref|YP_052314.1|  branched-chain amino acid aminotransferase [...   191    8e-47
ref|ZP_01465847.1|  branched-chain amino acid aminotransferase...   191    9e-47
ref|ZP_03829868.1|  branched-chain amino acid aminotransferase...   191    9e-47
ref|ZP_06728784.1|  branched-chain-amino-acid transaminase [Ac...   190    1e-46
ref|YP_631196.1|  branched-chain amino acid aminotransferase [...   190    2e-46
gb|ABZ08611.1|  putative aminotransferase class IV [uncultured...   189    2e-46
ref|NP_931845.1|  branched-chain amino acid aminotransferase [...   189    2e-46
gb|ABZ09245.1|  putative aminotransferase class IV [uncultured...   189    3e-46
ref|YP_001812989.1|  branched-chain amino acid aminotransferas...   189    3e-46
gb|ABZ07409.1|  putative aminotransferase class IV [uncultured...   189    3e-46
ref|ZP_04617118.1|  Branched-chain-amino-acid aminotransferase...   186    2e-45
ref|NP_614910.1|  branched-chain amino acid aminotransferase [...   185    4e-45
ref|YP_002886632.1|  branched-chain amino acid aminotransferas...   185    4e-45
ref|ZP_01017791.1|  branched-chain amino acid aminotransferase...   185    4e-45
ref|ZP_04957483.1|  branched-chain amino acid aminotransferase...   184    7e-45
ref|YP_456075.1|  branched-chain amino acid aminotransferase [...   184    7e-45
ref|NP_878862.1|  branched-chain amino acid aminotransferase [...   184    1e-44
ref|YP_001153924.1|  branched-chain amino acid aminotransferas...   183    2e-44
ref|ZP_01466710.1|  branched-chain amino acid aminotransferase...   182    4e-44
ref|YP_001047644.1|  branched-chain amino acid aminotransferas...   182    4e-44
ref|YP_001056639.1|  branched-chain amino acid aminotransferas...   181    5e-44
ref|YP_002366568.1|  branched-chain amino acid aminotransferas...   181    5e-44
ref|YP_001581582.1|  branched-chain amino acid aminotransferas...   181    7e-44
ref|NP_560638.1|  branched-chain amino acid aminotransferase [...   181    9e-44
ref|ZP_06365309.1|  branched-chain amino acid aminotransferase...   181    1e-43
ref|ZP_04145149.1|  Branched-chain amino acid aminotransferase...   180    1e-43
ref|ZP_04283572.1|  Branched-chain amino acid aminotransferase...   180    1e-43
ref|ZP_04278313.1|  Branched-chain amino acid aminotransferase...   180    1e-43
ref|YP_002572561.1|  branched-chain amino acid aminotransferas...   180    2e-43
ref|YP_001179644.1|  branched-chain amino acid aminotransferas...   180    2e-43
ref|YP_566199.1|  branched-chain amino acid aminotransferase [...   179    4e-43
ref|NP_978249.1|  branched-chain amino acid aminotransferase [...   178    4e-43
ref|NP_831550.1|  branched-chain amino acid aminotransferase [...   178    4e-43
ref|ZP_03231872.1|  branched-chain amino acid aminotransferase...   178    4e-43
ref|ZP_02169903.1|  Branched-chain-amino-acid transaminase [Ba...   178    5e-43
ref|YP_002465767.1|  branched-chain amino acid aminotransferas...   178    5e-43
ref|ZP_04114356.1|  Branched-chain amino acid aminotransferase...   178    5e-43
ref|YP_001665400.1|  branched-chain amino acid aminotransferas...   178    5e-43
ref|ZP_04238938.1|  Branched-chain amino acid aminotransferase...   178    5e-43
ref|ZP_04202724.1|  Branched-chain amino acid aminotransferase...   178    6e-43
ref|ZP_04174087.1|  Branched-chain amino acid aminotransferase...   178    6e-43
ref|ZP_04300099.1|  Branched-chain amino acid aminotransferase...   178    7e-43
ref|ZP_04179858.1|  Branched-chain amino acid aminotransferase...   178    7e-43
ref|ZP_03453855.1|  branched-chain-amino-acid transaminase [Bu...   177    7e-43
ref|ZP_01447466.1|  branched-chain amino acid aminotransferase...   177    8e-43
ref|YP_336051.1|  branched-chain amino acid aminotransferase [...   177    9e-43
ref|ZP_05335417.1|  branched-chain amino acid aminotransferase...   177    9e-43
ref|YP_001663707.1|  branched-chain amino acid aminotransferas...   177    1e-42
ref|YP_111814.1|  branched-chain amino acid aminotransferase [...   177    1e-42
ref|YP_003476712.1|  branched-chain amino acid aminotransferas...   177    1e-42
ref|ZP_00236614.1|  branched-chain amino acid aminotransferase...   177    1e-42
ref|ZP_03235686.1|  branched-chain amino acid aminotransferase...   177    1e-42
ref|ZP_04222086.1|  Branched-chain amino acid aminotransferase...   177    1e-42
ref|YP_002907974.1|  Branched-chain amino acid aminotransferas...   177    2e-42
ref|NP_844267.1|  branched-chain amino acid aminotransferase [...   176    2e-42
ref|ZP_04089955.1|  Branched-chain amino acid aminotransferase...   176    2e-42
ref|ZP_04185666.1|  Branched-chain amino acid aminotransferase...   176    2e-42
ref|YP_278090.1|  branched-chain amino acid aminotransferase [...   176    2e-42
ref|ZP_04078087.1|  Branched-chain amino acid aminotransferase...   176    2e-42
ref|ZP_04083938.1|  Branched-chain amino acid aminotransferase...   176    2e-42
ref|ZP_04294507.1|  Branched-chain amino acid aminotransferase...   176    2e-42
ref|ZP_02467139.1|  branched-chain amino acid aminotransferase...   176    2e-42
ref|ZP_02391506.1|  branched-chain amino acid aminotransferase...   176    2e-42
ref|YP_001211075.1|  branched-chain amino acid aminotransferas...   176    2e-42
ref|ZP_04250665.1|  Branched-chain amino acid aminotransferase...   176    2e-42
ref|ZP_00740943.1|  Branched-chain amino acid aminotransferase...   176    3e-42
ref|ZP_04101599.1|  Branched-chain amino acid aminotransferase...   176    3e-42
ref|YP_001644573.1|  branched-chain amino acid aminotransferas...   176    3e-42
ref|ZP_04064693.1|  Branched-chain amino acid aminotransferase...   176    3e-42
ref|ZP_04168379.1|  Branched-chain amino acid aminotransferase...   176    3e-42
ref|NP_633069.1|  branched-chain amino acid aminotransferase [...   176    3e-42
ref|YP_003400017.1|  branched-chain amino acid aminotransferas...   176    3e-42
ref|YP_438767.1|  branched-chain amino acid aminotransferase [...   175    4e-42
ref|ZP_04107847.1|  Branched-chain amino acid aminotransferase...   175    4e-42
ref|YP_304136.1|  branched-chain amino acid aminotransferase [...   175    6e-42
ref|ZP_04207832.1|  Branched-chain amino acid aminotransferase...   175    6e-42
ref|YP_843724.1|  branched-chain amino acid aminotransferase [...   174    6e-42
ref|YP_003542980.1|  branched chain amino acid aminotransferas...   174    7e-42
ref|YP_680944.1|  branched-chain amino acid aminotransferase [...   174    7e-42
ref|NP_622585.1|  branched-chain amino acid aminotransferase [...   174    7e-42
ref|ZP_04071437.1|  Branched-chain amino acid aminotransferase...   174    9e-42
ref|NP_069766.1|  branched-chain amino acid aminotransferase [...   174    9e-42
ref|ZP_05378490.1|  branched-chain amino acid aminotransferase...   174    1e-41
ref|ZP_04244731.1|  Branched-chain amino acid aminotransferase...   174    1e-41
ref|YP_001098057.1|  branched-chain amino acid aminotransferas...   174    1e-41
ref|YP_001680093.1|  branched-chain amino acid aminotransferas...   173    1e-41
ref|ZP_02383922.1|  branched-chain amino acid aminotransferase...   173    1e-41
ref|ZP_04119900.1|  Branched-chain amino acid aminotransferase...   173    1e-41
ref|ZP_02359475.1|  branched-chain amino acid aminotransferase...   173    1e-41
ref|ZP_04150825.1|  Branched-chain amino acid aminotransferase...   173    2e-41
ref|ZP_04165435.1|  Branched-chain amino acid aminotransferase...   173    2e-41
ref|YP_003318647.1|  branched-chain amino acid aminotransferas...   172    3e-41
ref|ZP_02926065.1|  branched-chain amino acid aminotransferase...   172    3e-41
ref|ZP_05069990.1|  branched-chain amino acid aminotransferase...   172    4e-41
ref|ZP_04156590.1|  Branched-chain amino acid aminotransferase...   171    6e-41
ref|YP_001374758.1|  branched-chain amino acid aminotransferas...   171    6e-41
ref|NP_987252.1|  branched-chain amino acid aminotransferase [...   171    6e-41
ref|ZP_02145308.1|  branched-chain amino acid aminotransferase...   171    7e-41
ref|ZP_06463437.1|  branched-chain amino acid aminotransferase...   171    7e-41
ref|YP_003121616.1|  branched-chain amino acid aminotransferas...   171    7e-41
ref|NP_619212.1|  branched-chain amino acid aminotransferase [...   171    7e-41
ref|ZP_01734669.1|  branched-chain amino acid aminotransferase...   171    8e-41
ref|YP_359373.1|  branched-chain amino acid aminotransferase [...   171    1e-40
ref|YP_001330348.1|  branched-chain amino acid aminotransferas...   170    1e-40
ref|YP_002122029.1|  branched-chain amino acid aminotransferas...   170    1e-40
ref|ZP_02193516.1|  branched-chain amino acid aminotransferase...   170    1e-40
ref|YP_001956590.1|  branched-chain-amino-acid aminotransferas...   170    1e-40
ref|ZP_05079119.1|  branched-chain amino acid aminotransferase...   170    1e-40
ref|ZP_06348450.1|  branched-chain amino acid aminotransferase...   170    2e-40
ref|YP_001635052.1|  branched-chain amino acid aminotransferas...   170    2e-40
ref|YP_001877341.1|  branched-chain amino acid aminotransferas...   169    2e-40
ref|YP_003185630.1|  branched-chain amino acid aminotransferas...   169    2e-40
ref|YP_003093673.1|  branched-chain amino acid aminotransferas...   169    2e-40
ref|ZP_04288442.1|  Branched-chain amino acid aminotransferase...   169    3e-40
ref|YP_502147.1|  branched-chain amino acid aminotransferase [...   169    3e-40
ref|ZP_03734583.1|  branched-chain amino acid aminotransferase...   169    3e-40
ref|ZP_01157263.1|  Branched chain acid aminotransferase [Ocea...   169    3e-40
ref|YP_001716541.1|  branched-chain amino acid aminotransferas...   169    4e-40
ref|YP_003425567.1|  branched-chain amino acid aminotransferas...   169    4e-40
ref|YP_001548869.1|  branched-chain amino acid aminotransferas...   169    4e-40
ref|ZP_03494383.1|  branched-chain amino acid aminotransferase...   168    5e-40
ref|ZP_01743090.1|  branched-chain amino acid aminotransferase...   168    6e-40
ref|ZP_04173681.1|  Branched-chain amino acid aminotransferase...   168    7e-40
ref|ZP_05089179.1|  branched-chain amino acid aminotransferase...   168    7e-40
ref|YP_754810.1|  branched-chain amino acid aminotransferase [...   167    8e-40
ref|YP_002463002.1|  branched-chain amino acid aminotransferas...   167    8e-40
ref|ZP_02141873.1|  branched-chain amino acid aminotransferase...   167    9e-40
ref|ZP_01257147.1|  branched-chain amino acid aminotransferase...   167    1e-39
ref|YP_003329518.1|  branched-chain amino acid aminotransferas...   167    1e-39
ref|ZP_04156245.1|  Branched-chain amino acid aminotransferase...   167    1e-39
ref|YP_003357739.1|  branched-chain-amino-acid aminotransferas...   167    1e-39
ref|ZP_04095650.1|  Branched-chain amino acid aminotransferase...   167    1e-39
ref|ZP_01890125.1|  branched-chain amino acid aminotransferase...   167    1e-39
ref|YP_035614.1|  branched-chain amino acid aminotransferase [...   167    2e-39
ref|YP_001644193.1|  branched-chain amino acid aminotransferas...   167    2e-39
ref|NP_843873.1|  branched-chain amino acid aminotransferase [...   166    2e-39
ref|ZP_02693157.1|  branched-chain amino acid aminotransferase...   166    2e-39
ref|NP_963482.1|  hypothetical protein NEQ190 [Nanoarchaeum eq...   166    2e-39
ref|ZP_05785830.1|  branched-chain amino acid aminotransferase...   166    2e-39
ref|ZP_04216767.1|  Branched-chain amino acid aminotransferase...   166    2e-39
ref|YP_003241645.1|  branched-chain amino acid aminotransferas...   166    2e-39
ref|ZP_03632275.1|  branched-chain amino acid aminotransferase...   166    2e-39
ref|ZP_06008526.1|  branched-chain amino acid aminotransferase...   166    2e-39
ref|YP_431090.1|  branched-chain amino acid aminotransferase [...   166    2e-39
ref|ZP_03967657.1|  possible amino-acid transaminase [Sphingob...   166    2e-39
ref|ZP_04150471.1|  Branched-chain amino acid aminotransferase...   166    2e-39
ref|ZP_02152649.1|  branched-chain amino acid aminotransferase...   166    2e-39
ref|ZP_05069609.1|  branched-chain amino acid aminotransferase...   166    3e-39
ref|ZP_04805250.1|  branched-chain amino acid aminotransferase...   166    3e-39
ref|NP_977837.1|  branched-chain amino acid aminotransferase [...   166    3e-39
ref|YP_001487696.1|  branched-chain amino acid aminotransferas...   166    3e-39
ref|YP_001323649.1|  branched-chain amino acid aminotransferas...   166    3e-39
ref|ZP_05370937.1|  branched-chain amino acid aminotransferase...   166    3e-39
ref|ZP_04167997.1|  Branched-chain amino acid aminotransferase...   166    3e-39
ref|ZP_04083554.1|  Branched-chain amino acid aminotransferase...   166    3e-39
ref|ZP_01690813.1|  branched-chain amino acid aminotransferase...   166    3e-39
ref|YP_080106.1|  branched-chain amino acid aminotransferase [...   166    3e-39
ref|YP_001931393.1|  branched-chain amino acid aminotransferas...   166    3e-39
ref|ZP_04777508.1|  branched-chain-amino-acid transaminase [Sp...   166    4e-39
ref|ZP_04283176.1|  Branched-chain amino acid aminotransferase...   166    4e-39
ref|YP_003548257.1|  branched-chain amino acid aminotransferas...   165    4e-39
ref|NP_831177.1|  branched-chain amino acid aminotransferase [...   165    4e-39
ref|YP_002444838.1|  branched-chain amino acid aminotransferas...   165    4e-39
ref|YP_003431902.1|  branched-chain amino acid aminotransferas...   165    4e-39
ref|YP_165517.1|  branched-chain amino acid aminotransferase [...   165    4e-39
ref|YP_002950558.1|  branched-chain amino acid aminotransferas...   165    4e-39
ref|ZP_04232810.1|  Branched-chain amino acid aminotransferase...   165    4e-39
ref|YP_265513.1|  branched-chain amino acid aminotransferase [...   165    5e-39
ref|YP_674697.1|  branched-chain amino acid aminotransferase [...   165    6e-39
ref|NP_930274.1|  hypothetical protein plu3042 [Photorhabdus l...   165    6e-39
ref|NP_214301.1|  branched-chain amino acid aminotransferase [...   165    6e-39
ref|YP_180764.1|  branched-chain amino acid aminotransferase [...   164    6e-39
ref|ZP_02161518.1|  branched-chain amino acid aminotransferase...   164    7e-39
ref|YP_916385.1|  branched-chain amino acid aminotransferase [...   164    7e-39
ref|YP_002314956.1|  branched-chain amino acid aminotransferas...   164    7e-39
ref|ZP_04113972.1|  Branched-chain amino acid aminotransferase...   164    7e-39
ref|YP_001126681.1|  branched-chain amino acid aminotransferas...   164    7e-39
ref|ZP_02329846.1|  branched-chain amino acid aminotransferase...   164    8e-39
ref|ZP_00237313.1|  branched-chain amino acid aminotransferase...   164    8e-39
ref|ZP_02737910.1|  branched-chain amino acid aminotransferase...   164    8e-39
ref|ZP_04853048.1|  branched-chain amino acid aminotransferase...   164    8e-39
ref|ZP_02178591.1|  branched-chain amino acid aminotransferase...   164    8e-39
ref|ZP_04211234.1|  Branched-chain amino acid aminotransferase...   164    9e-39
ref|ZP_00998861.1|  branched-chain amino acid aminotransferase...   164    9e-39
ref|ZP_06119208.1|  branched-chain amino acid aminotransferase...   164    1e-38
ref|YP_001122646.1|  branched-chain amino acid aminotransferas...   164    1e-38
ref|ZP_04207706.1|  Branched-chain amino acid aminotransferase...   164    1e-38
ref|ZP_03228943.1|  branched-chain amino acid aminotransferase...   164    1e-38
ref|NP_924171.1|  branched-chain amino acid aminotransferase [...   164    1e-38
ref|YP_002728748.1|  branched-chain amino acid aminotransferas...   164    1e-38
ref|ZP_04226962.1|  Branched-chain amino acid aminotransferase...   164    1e-38
ref|ZP_03055758.1|  branched-chain amino acid aminotransferase...   164    1e-38
ref|ZP_03725016.1|  Branched-chain-amino-acid transaminase [Op...   163    2e-38
ref|YP_307204.1|  branched-chain amino acid aminotransferase [...   163    2e-38
ref|ZP_04987539.1|  branched-chain amino acid aminotransferase...   163    2e-38
ref|YP_685294.1|  branched-chain amino acid aminotransferase [...   163    2e-38
ref|YP_003461837.1|  branched-chain amino acid aminotransferas...   163    2e-38
ref|ZP_01444903.1|  branched-chain amino acid aminotransferase...   162    2e-38
ref|YP_508036.1|  branched-chain amino acid aminotransferase [...   162    3e-38
ref|ZP_04391000.1|  branched-chain amino acid aminotransferase...   162    3e-38
ref|NP_421723.1|  branched-chain amino acid aminotransferase [...   162    3e-38
ref|ZP_01055447.1|  branched-chain amino acid aminotransferase...   162    3e-38
ref|ZP_01751918.1|  branched-chain amino acid aminotransferase...   162    3e-38
ref|YP_169303.1|  branched-chain amino acid aminotransferase p...   162    3e-38
ref|ZP_04990673.1|  branched-chain-amino-acid transaminase [Fr...   162    4e-38
ref|YP_148515.1|  branched-chain amino acid aminotransferase [...   162    4e-38
ref|ZP_02181895.1|  branched-chain amino acid aminotransferase...   162    4e-38
ref|YP_002731002.1|  branched-chain amino acid aminotransferas...   162    4e-38
ref|ZP_01901573.1|  hypothetical protein RAZWK3B_03585 [Roseob...   162    4e-38
ref|YP_001432577.1|  branched-chain amino acid aminotransferas...   162    5e-38
gb|AAX77885.1|  unknown protein [synthetic construct]               162    5e-38
ref|ZP_01171798.1|  branched-chain amino acid aminotransferase...   161    6e-38
ref|YP_002298100.1|  branched-chain amino acid aminotransferas...   161    6e-38
ref|YP_614920.1|  branched-chain amino acid aminotransferase [...   161    6e-38
ref|ZP_01884733.1|  branched-chain amino acid aminotransferase...   161    7e-38
ref|ZP_03130277.1|  branched-chain amino acid aminotransferase...   161    7e-38
ref|YP_001233988.1|  branched-chain amino acid aminotransferas...   161    7e-38
ref|YP_001677490.1|  branched-chain amino acid aminotransferas...   161    8e-38
ref|ZP_01014012.1|  Branched chain acid aminotransferase [Rhod...   161    9e-38
ref|YP_001276870.1|  branched-chain amino acid aminotransferas...   160    9e-38
ref|ZP_05741962.1|  branched-chain amino acid aminotransferase...   160    1e-37
ref|YP_003434529.1|  branched-chain amino acid aminotransferas...   160    1e-37
emb|CAM76551.1|  Aminotransferase, class IV [Magnetospirillum ...   160    1e-37
gb|AAN64007.1|AF434658_4  putative branched-chain amino acid a...   160    1e-37
ref|YP_003459030.1|  branched-chain amino acid aminotransferas...   160    1e-37
ref|YP_796574.1|  branched-chain amino acid aminotransferase [...   160    1e-37
ref|NP_714540.2|  putative branched-chain amino acid aminotran...   160    1e-37
ref|YP_003393.1|  branched-chain amino acid aminotransferase [...   160    1e-37
ref|ZP_05791199.1|  branched-chain-amino-acid transaminase [Bu...   160    1e-37
ref|YP_076515.1|  branched-chain amino acid aminotransferase [...   160    2e-37
ref|YP_003128228.1|  branched-chain amino acid aminotransferas...   160    2e-37
ref|YP_001546126.1|  branched-chain amino acid aminotransferas...   160    2e-37
ref|YP_427310.1|  branched-chain amino acid aminotransferase [...   160    2e-37
ref|ZP_05124735.1|  branched-chain amino acid aminotransferase...   159    2e-37
ref|ZP_00959744.1|  branched-chain amino acid aminotransferase...   159    2e-37
ref|YP_878687.1|  branched-chain amino acid aminotransferase [...   159    3e-37
ref|YP_002522829.1|  branched-chain amino acid aminotransferas...   159    3e-37
ref|ZP_02168651.1|  branched-chain amino acid aminotransferase...   159    3e-37
ref|NP_103952.1|  branched-chain amino acid aminotransferase [...   159    3e-37
ref|YP_003238241.1|  branched-chain amino acid aminotransferas...   159    3e-37
ref|YP_354225.1|  branched-chain amino acid aminotransferase [...   159    3e-37
ref|YP_001840813.1|  branched-chain-amino-acid aminotransferas...   159    3e-37
ref|YP_512929.1|  branched-chain amino acid aminotransferase p...   159    3e-37
ref|YP_002526897.1|  Branched chain amino acid aminotransferas...   159    4e-37
ref|YP_001404582.1|  branched-chain amino acid aminotransferas...   159    4e-37
ref|YP_001295379.1|  branched-chain-amino-acid transaminase [F...   159    4e-37
ref|YP_761767.1|  branched-chain amino acid aminotransferase [...   159    4e-37
ref|NP_248002.1|  branched-chain amino acid aminotransferase [...   158    5e-37
ref|ZP_05374611.1|  branched-chain amino acid aminotransferase...   158    6e-37
ref|YP_001325384.1|  branched-chain amino acid aminotransferas...   158    6e-37
ref|YP_001413542.1|  branched-chain amino acid aminotransferas...   158    6e-37
ref|YP_003058715.1|  branched-chain amino acid aminotransferas...   158    6e-37
ref|YP_001534635.1|  branched-chain amino acid aminotransferas...   158    7e-37
ref|ZP_01226181.1|  branched-chain amino acid aminotransferase...   158    8e-37
ref|ZP_05813297.1|  branched-chain amino acid aminotransferase...   157    8e-37
ref|ZP_01913206.1|  branched-chain amino acid aminotransferase...   157    1e-36
ref|YP_002911949.1|  Branched-chain amino acid aminotransferas...   157    1e-36
emb|CAJ75101.1|  similar to branched-chain amino acid transfer...   157    1e-36
gb|AAO91867.1|  branched-chain amino acid aminotransferase 2 [...   157    1e-36
ref|YP_003473233.1|  branched-chain amino acid aminotransferas...   157    1e-36
ref|YP_001168978.1|  branched-chain amino acid aminotransferas...   157    1e-36
ref|ZP_05779546.1|  branched-chain amino acid aminotransferase...   157    1e-36
ref|YP_003246946.1|  branched-chain amino acid aminotransferas...   157    1e-36
ref|YP_003190131.1|  branched-chain amino acid aminotransferas...   157    2e-36
ref|YP_002508830.1|  branched-chain amino acid aminotransferas...   157    2e-36
ref|ZP_01877717.1|  branched-chain amino acid aminotransferase...   157    2e-36
ref|ZP_05083935.1|  branched-chain amino acid aminotransferase...   156    2e-36
ref|YP_001819556.1|  branched-chain amino acid aminotransferas...   156    2e-36
ref|YP_001417455.1|  branched-chain amino acid aminotransferas...   156    2e-36
ref|ZP_05845283.1|  branched-chain amino acid aminotransferase...   156    3e-36
ref|ZP_03356676.1|  branched-chain amino acid aminotransferase...   155    3e-36
ref|ZP_02621086.1|  branched-chain amino acid aminotransferase...   155    3e-36
ref|ZP_01756706.1|  branched-chain amino acid aminotransferase...   155    4e-36
ref|ZP_05342568.1|  branched-chain amino acid aminotransferase...   155    4e-36
ref|YP_001029917.1|  branched-chain amino acid aminotransferas...   155    4e-36
ref|ZP_05512801.1|  branched-chain amino acid aminotransferase...   155    4e-36
ref|ZP_00989936.1|  branched-chain amino acid aminotransferase...   155    5e-36
ref|YP_419914.1|  branched-chain amino acid aminotransferase [...   155    5e-36
ref|ZP_06054645.1|  branched-chain amino acid aminotransferase...   155    5e-36
ref|YP_003578901.1|  branched-chain-amino-acid transaminase-1 ...   155    6e-36
ref|ZP_04584906.1|  branched-chain amino acid aminotransferase...   154    7e-36
ref|ZP_05058180.1|  branched-chain amino acid aminotransferase...   154    7e-36
ref|ZP_01549290.1|  branched-chain amino acid aminotransferase...   154    8e-36
ref|ZP_01746189.1|  branched-chain amino acid aminotransferase...   154    9e-36
ref|YP_876633.1|  branched-chain amino acid aminotransferase/4...   154    1e-35
ref|ZP_01035239.1|  branched-chain amino acid aminotransferase...   154    1e-35
ref|ZP_00056336.2|  COG0115: Branched-chain amino acid aminotr...   154    1e-35
ref|ZP_05113076.1|  branched-chain amino acid aminotransferase...   154    1e-35
ref|ZP_01002065.1|  branched-chain amino acid aminotransferase...   153    2e-35
ref|ZP_05075410.1|  branched-chain amino acid aminotransferase...   153    2e-35
ref|ZP_05100095.1|  branched-chain amino acid aminotransferase...   152    4e-35
ref|ZP_01091695.1|  branched-chain amino acid aminotransferase...   152    4e-35
ref|ZP_06441020.1|  branched-chain-amino-acid transaminase [An...   152    5e-35
ref|ZP_04790176.1|  branched-chain amino acid aminotransferase...   152    5e-35
ref|ZP_05051010.1|  branched-chain amino acid aminotransferase...   151    6e-35
ref|YP_003318118.1|  branched-chain amino acid aminotransferas...   151    6e-35
ref|YP_001264560.1|  branched-chain amino acid aminotransferas...   151    6e-35
ref|YP_528526.1|  branched chain amino acid aminotransferase [...   151    7e-35
ref|YP_517597.1|  branched-chain amino acid aminotransferase [...   151    8e-35
ref|ZP_01438738.1|  branched-chain amino acid aminotransferase...   151    8e-35
ref|ZP_05033919.1|  branched-chain amino acid aminotransferase...   151    9e-35
ref|ZP_04426649.1|  branched chain amino acid aminotransferase...   151    9e-35
ref|YP_878103.1|  branched-chain amino acid aminotransferase [...   150    1e-34
ref|YP_003322521.1|  branched-chain amino acid aminotransferas...   150    1e-34
ref|ZP_00954592.1|  branched-chain amino acid aminotransferase...   150    2e-34
ref|ZP_05067741.1|  branched-chain amino acid aminotransferase...   149    2e-34
emb|CBE69858.1|  putative branched-chain-amino-acid aminotrans...   149    3e-34
ref|ZP_02188512.1|  Branched-chain amino acid aminotransferase...   149    4e-34
ref|ZP_04701853.1|  hypothetical protein SalbJ_07830 [Streptom...   149    4e-34
gb|AAO91865.1|  branched-chain amino acid aminotransferase 1 [...   149    4e-34
ref|ZP_04680729.1|  branched-chain amino acid aminotransferase...   148    6e-34
ref|YP_001370191.1|  branched-chain amino acid aminotransferas...   148    7e-34
ref|ZP_06172032.1|  branched-chain amino acid aminotransferase...   148    8e-34
ref|ZP_01855039.1|  branched-chain amino acid aminotransferase...   147    9e-34
ref|ZP_02620903.1|  branched-chain amino acid aminotransferase...   146    2e-33
ref|ZP_01235114.1|  branched-chain amino acid aminotransferase...   145    3e-33
ref|YP_001526888.1|  branched-chain amino acid aminotransferas...   145    4e-33
ref|ZP_02066678.1|  hypothetical protein BACOVA_03679 [Bactero...   145    5e-33
ref|YP_001492363.1|  branched-chain amino acid aminotransferas...   144    7e-33
ref|YP_001640051.1|  branched-chain amino acid aminotransferas...   144    8e-33
ref|YP_002421577.1|  branched-chain amino acid aminotransferas...   144    1e-32
ref|YP_002963749.1|  putative branched-chain amino acid transf...   144    1e-32
ref|YP_001496337.1|  branched-chain amino acid aminotransferas...   144    1e-32
ref|YP_537911.1|  branched-chain amino acid aminotransferase [...   144    1e-32
ref|ZP_00050341.1|  COG0115: Branched-chain amino acid aminotr...   143    1e-32
ref|ZP_03849796.1|  branched-chain-amino-acid transaminase [Ch...   143    2e-32
ref|YP_003552533.1|  branched-chain amino acid aminotransferas...   143    2e-32
ref|YP_437882.1|  branched-chain amino acid aminotransferase [...   142    3e-32
ref|YP_003068825.1|  putative branched-chain amino acid transf...   142    3e-32
ref|NP_868203.1|  branched-chain amino acid aminotransferase [...   142    3e-32
ref|NP_822017.1|  branched-chain amino acid aminotransferase [...   142    4e-32
ref|YP_003369189.1|  branched-chain amino acid aminotransferas...   142    4e-32
ref|YP_003270519.1|  branched-chain amino acid aminotransferas...   142    4e-32
ref|YP_001925307.1|  branched-chain amino acid aminotransferas...   142    4e-32
ref|YP_001517952.1|  branched-chain amino acid aminotransferas...   140    1e-31
ref|YP_002362796.1|  branched-chain amino acid aminotransferas...   140    2e-31
ref|YP_002380025.1|  branched-chain amino acid aminotransferas...   140    2e-31
ref|ZP_01731042.1|  branched-chain amino acid aminotransferase...   140    2e-31
ref|YP_246675.1|  branched-chain amino acid aminotransferase [...   139    2e-31
ref|YP_003321935.1|  branched-chain amino acid aminotransferas...   139    4e-31
ref|YP_001772728.1|  branched-chain amino acid aminotransferas...   139    4e-31
ref|YP_002251078.1|  branched-chain amino acid aminotransferas...   139    4e-31
ref|ZP_04699038.1|  branched-chain amino acid aminotransferase...   138    6e-31
ref|YP_002353252.1|  branched-chain amino acid aminotransferas...   138    6e-31
ref|NP_928736.1|  hypothetical protein plu1438 [Photorhabdus l...   138    7e-31
ref|YP_001493433.1|  branched-chain amino acid aminotransferas...   137    9e-31
ref|NP_220809.1|  branched-chain amino acid aminotransferase [...   137    9e-31
ref|YP_001834591.1|  branched-chain amino acid aminotransferas...   137    9e-31
emb|CAC33593.1|  IlvE protein [Rickettsia montanensis]              136    2e-30
ref|YP_001938861.1|  Branched-chain amino acid aminotransferas...   136    2e-30
ref|YP_067373.1|  branched-chain amino acid aminotransferase [...   136    2e-30
ref|ZP_00514261.1|  Branched-chain amino acid aminotransferase...   136    2e-30
ref|YP_002916738.1|  branched-chain amino acid aminotransferas...   136    2e-30
ref|ZP_02188991.1|  branched-chain amino acid aminotransferase...   136    2e-30
ref|YP_001803030.1|  branched-chain amino acid aminotransferas...   136    3e-30
ref|YP_001499335.1|  branched-chain amino acid aminotransferas...   136    3e-30
emb|CAE48340.1|  unnamed protein product [Methylocystis sp. SC2]    135    3e-30
ref|YP_001494707.1|  branched-chain amino acid aminotransferas...   135    4e-30
ref|YP_002845207.1|  Branched-chain amino acid aminotransferas...   135    4e-30
ref|NP_360231.1|  branched-chain amino acid aminotransferase [...   135    4e-30
ref|YP_001658925.1|  branched-chain amino acid aminotransferas...   135    4e-30
ref|ZP_00141971.1|  branched-chain amino acid aminotransferase...   135    5e-30
ref|YP_171227.1|  branched-chain amino acid aminotransferase [...   135    6e-30
ref|YP_001157891.1|  branched-chain amino acid aminotransferas...   134    7e-30
ref|ZP_06498967.1|  Similar to branched-chain amino acid amino...   134    7e-30
ref|ZP_01448442.1|  branched-chain amino acid aminotransferase...   134    8e-30
ref|YP_003323448.1|  branched-chain amino acid aminotransferas...   133    3e-29
ref|YP_002048809.1|  branched-chain amino acid aminotransferas...   132    4e-29
ref|YP_001550771.1|  branched-chain amino acid aminotransferas...   132    4e-29
ref|YP_001322928.1|  branched-chain amino acid aminotransferas...   132    4e-29
ref|YP_002502312.1|  branched-chain amino acid aminotransferas...   132    4e-29
ref|ZP_01056119.1|  branched-chain amino acid transferase [Ros...   132    6e-29
ref|ZP_05030687.1|  branched-chain amino acid aminotransferase...   131    6e-29
ref|ZP_05504517.1|  branched-chain amino acid aminotransferase...   131    6e-29
ref|YP_003318569.1|  branched-chain amino acid aminotransferas...   131    8e-29
ref|YP_476735.1|  branched-chain amino acid aminotransferase [...   130    1e-28
ref|ZP_01626000.1|  branched-chain amino acid aminotransferase...   130    2e-28
ref|NP_682252.1|  branched-chain amino acid aminotransferase [...   130    2e-28
ref|YP_003531562.1|  branched-chain amino acid aminotransferas...   130    2e-28
ref|YP_003267432.1|  branched-chain amino acid aminotransferas...   129    2e-28
emb|CAO86637.1|  ilvE [Microcystis aeruginosa PCC 7806]             129    2e-28
ref|YP_474467.1|  branched-chain amino acid aminotransferase [...   129    3e-28
ref|ZP_05812514.1|  aminotransferase class IV [Mesorhizobium o...   129    3e-28
ref|NP_442721.1|  branched-chain amino acid aminotransferase [...   129    3e-28
ref|YP_001227464.1|  branched-chain amino acid aminotransferas...   129    3e-28
ref|NP_875350.1|  branched-chain amino acid aminotransferase [...   129    3e-28
ref|YP_001248318.1|  branched-chain amino acid aminotransferas...   129    4e-28
ref|YP_001936774.1|  branched-chain amino acid aminotransferas...   129    4e-28
gb|EDQ48662.1|  predicted protein [Physcomitrella patens subsp...   129    4e-28
ref|YP_001091205.1|  branched-chain amino acid aminotransferas...   129    4e-28
ref|ZP_05138108.1|  branched-chain amino acid aminotransferase...   129    5e-28
ref|NP_897332.1|  branched-chain amino acid aminotransferase [...   128    5e-28
ref|YP_291527.1|  branched-chain amino acid aminotransferase [...   128    7e-28
ref|YP_397418.1|  branched-chain amino acid aminotransferase [...   127    1e-27
ref|ZP_03802259.1|  hypothetical protein PROPEN_00599 [Proteus...   127    1e-27
ref|YP_381665.1|  branched-chain amino acid aminotransferase [...   127    1e-27
ref|YP_001009374.1|  branched-chain amino acid aminotransferas...   127    1e-27
ref|ZP_01467832.1|  branched-chain amino acid aminotransferase...   127    1e-27
ref|YP_001484215.1|  branched-chain amino acid aminotransferas...   127    2e-27
ref|YP_001735107.1|  branched-chain amino acid aminotransferas...   127    2e-27
ref|YP_002372958.1|  branched-chain amino acid aminotransferas...   127    2e-27
ref|YP_002482757.1|  branched-chain amino acid aminotransferas...   126    2e-27
ref|NP_892996.1|  branched-chain amino acid aminotransferase [...   126    2e-27
ref|ZP_03157805.1|  branched-chain amino acid aminotransferase...   126    2e-27
ref|ZP_05789921.1|  branched-chain amino acid aminotransferase...   126    2e-27
ref|YP_001014828.1|  branched-chain amino acid aminotransferas...   126    3e-27
ref|ZP_01086663.1|  branched-chain amino acid aminotransferase...   125    3e-27
ref|YP_002648450.1|  Similar to branched-chain amino acid amin...   125    3e-27
ref|YP_915260.1|  aminotransferase, class IV [Paracoccus denit...   125    3e-27
ref|NP_103146.1|  branched-chain amino acid transferase [Mesor...   124    8e-27
ref|YP_377130.1|  branched-chain amino acid aminotransferase [...   124    1e-26
ref|YP_003323273.1|  aminotransferase class IV [Thermobaculum ...   124    2e-26
ref|ZP_05044849.1|  branched-chain amino acid aminotransferase...   123    2e-26
ref|YP_001519607.1|  branched-chain amino acid aminotransferas...   123    3e-26
ref|YP_116528.1|  putative branched-chain amino acid aminotran...   123    3e-26
ref|ZP_01472122.1|  branched-chain amino acid aminotransferase...   122    4e-26
ref|ZP_01080324.1|  putative Branched-chain amino acid aminotr...   122    5e-26
ref|YP_001224999.1|  branched-chain amino acid aminotransferas...   122    6e-26
ref|NP_085750.1|  branched-chain amino acid aminotransferase [...   121    6e-26
ref|YP_002522812.1|  branched-chain amino acid aminotransferas...   121    7e-26
ref|YP_730561.1|  branched-chain amino acid aminotransferase [...   121    8e-26
ref|ZP_01124051.1|  branched-chain amino acid aminotransferase...   121    9e-26
ref|ZP_01085489.1|  branched-chain amino acid aminotransferase...   120    1e-25
ref|ZP_04956509.1|  branched-chain amino acid aminotransferase...   120    1e-25
ref|ZP_05902539.1|  putative branched-chain-amino-acid aminotr...   120    2e-25
ref|YP_001011274.1|  branched-chain amino acid aminotransferas...   120    2e-25
ref|YP_645847.1|  branched chain amino acid aminotransferase [...   120    2e-25
ref|YP_003534768.1|  aminodeoxychorismate lyase [Haloferax vol...   119    3e-25
ref|XP_001818566.1|  hypothetical protein [Aspergillus oryzae ...   119    4e-25
ref|ZP_03728486.1|  aminotransferase class IV [Dethiobacter al...   119    4e-25
ref|YP_003163278.1|  Branched-chain-amino-acid transaminase [L...   118    6e-25
ref|YP_001610813.1|  branched-chain-amino-acid transaminase [S...   118    6e-25
ref|YP_001017501.1|  branched-chain amino acid aminotransferas...   118    7e-25
emb|CAD31279.1|  PUTATIVE BRANCHED-CHAIN AMINO ACID AMINOTRANS...   118    7e-25
ref|ZP_01078529.1|  branched-chain amino acid transferase [Mar...   118    7e-25
ref|YP_530026.1|  aminotransferase, class IV [Rhodopseudomonas...   117    2e-24
ref|ZP_06010889.1|  putative branched-chain-amino-acid aminotr...   116    2e-24
ref|YP_003307543.1|  Branched-chain-amino-acid transaminase [S...   116    3e-24
ref|NP_894560.1|  branched-chain amino acid aminotransferase [...   115    4e-24
pdb|3LQS|A  Chain A, Complex Structure Of D-Amino Acid Aminotr...   115    4e-24
sp|P19938.2|DAAA_BACYM  RecName: Full=D-alanine aminotransfera...   115    5e-24
pdb|3DAA|A  Chain A, Crystallographic Structure Of D-Amino Aci...   115    5e-24
pdb|1DAA|A  Chain A, Crystallographic Structure Of D-Amino Aci...   115    5e-24
ref|YP_003102581.1|  aminotransferase class IV [Actinosynnema ...   115    6e-24
ref|YP_001985405.1|  probable branched-chain amino acid aminot...   115    6e-24
ref|XP_001261640.1|  aminotransferase, class IV, putative [Neo...   115    7e-24
ref|ZP_03512482.1|  probable branched-chain amino acid aminotr...   115    7e-24
ref|XP_002512341.1|  branched-chain amino acid aminotransferas...   114    7e-24
ref|XP_002564064.1|  Pc22g00160 [Penicillium chrysogenum Wisco...   114    8e-24
ref|ZP_04432530.1|  D-amino acid aminotransferase [Bacillus co...   114    1e-23
pdb|5DAA|A  Chain A, E177k Mutant Of D-Amino Acid Aminotransfe...   114    1e-23
gb|AAY98539.1|  D-amino acid aminotransferase [Geobacillus toe...   114    2e-23
ref|YP_002948819.1|  D-amino acid aminotransferase [Geobacillu...   113    2e-23
emb|CAJ72545.1|  similar to branched-chain amino-acid aminotra...   113    2e-23
ref|YP_001518114.1|  branched-chain amino acid aminotransferas...   113    2e-23
pdb|1A0G|A  Chain A, L201a Mutant Of D-Amino Acid Aminotransfe...   113    2e-23
pdb|1G2W|A  Chain A, E177s Mutant Of The Pyridoxal-5'-Phosphat...   113    2e-23
ref|YP_391902.1|  aminotransferase, class IV [Thiomicrospira c...   113    3e-23
gb|AAY98538.1|  D-amino acid aminotransferase [Geobacillus sp....   112    3e-23
ref|YP_001374959.1|  D-amino acid aminotransferase [Bacillus c...   112    4e-23
ref|YP_001699810.1|  D-alanine aminotransferase [Lysinibacillu...   112    4e-23
ref|ZP_04444147.1|  D-alanine aminotransferase [Listeria grayi...   112    5e-23
ref|ZP_02189817.1|  branched-chain amino acid aminotransferase...   112    6e-23
ref|YP_002781551.1|  putative aminotransferase [Rhodococcus op...   112    6e-23
ref|YP_002135098.1|  aminotransferase class IV [Anaeromyxobact...   112    6e-23
ref|ZP_01723511.1|  D-Amino Acid Aminotransferase [Bacillus sp...   111    6e-23
ref|XP_748821.1|  branched-chain amino acid aminotransferase [...   111    7e-23
ref|ZP_02869683.1|  branched-chain amino acid aminotransferase...   111    7e-23
emb|CBI36739.1|  unnamed protein product [Vitis vinifera]           111    8e-23
ref|XP_002328541.1|  predicted protein [Populus trichocarpa] >...   111    8e-23
ref|YP_001778575.1|  aminotransferase class IV [Burkholderia c...   111    8e-23
ref|YP_838940.1|  aminotransferase, class IV [Burkholderia cen...   111    8e-23
ref|YP_622922.1|  aminotransferase, class IV [Burkholderia cen...   111    8e-23
ref|YP_003267762.1|  Branched-chain-amino-acid transaminase [H...   110    1e-22
ref|ZP_03146852.1|  D-amino acid aminotransferase [Geobacillus...   110    1e-22
ref|YP_001124706.1|  D-alanine aminotransferase [Geobacillus t...   110    2e-22
ref|ZP_04365549.1|  branched-chain amino acid aminotransferase...   110    2e-22
gb|ABC49779.1|  branched-chain amino acid aminotransferase [un...   110    2e-22
ref|ZP_05371459.1|  D-amino acid aminotransferase [Geobacillus...   109    2e-22
ref|ZP_04825604.1|  D-alanine aminotransferase [Staphylococcus...   109    3e-22
ref|NP_764978.1|  D-alanine aminotransferase [Staphylococcus e...   109    3e-22
gb|ADF40854.1|  D-amino acid aminotransferase [Bacillus megate...   109    3e-22
ref|YP_002493242.1|  aminotransferase class IV [Anaeromyxobact...   108    4e-22
ref|XP_002284915.1|  PREDICTED: hypothetical protein [Vitis vi...   108    5e-22
ref|NP_682833.1|  branched-chain amino acid aminotransferase [...   108    5e-22
ref|YP_761201.1|  aminotransferase, class IV [Hyphomonas neptu...   108    5e-22
ref|YP_081683.1|  4-amino-4-deoxychorismate lyase [Bacillus ce...   108    5e-22
ref|XP_381942.1|  hypothetical protein FG01766.1 [Gibberella z...   108    6e-22
ref|YP_003425290.1|  D-alanine aminotransferase [Bacillus pseu...   108    7e-22
ref|YP_704386.1|  branched-chain-amino-acid transaminase [Rhod...   108    7e-22
ref|YP_003564484.1|  D-amino acid aminotransferase [Bacillus m...   107    9e-22
ref|ZP_04217450.1|  D-alanine aminotransferase [Bacillus cereu...   107    1e-21
ref|YP_894836.1|  D-amino acid aminotransferase [Bacillus thur...   107    1e-21
ref|ZP_03107166.1|  D-amino-acid transaminase [Bacillus cereus...   107    1e-21
ref|ZP_04797454.1|  D-alanine aminotransferase [Staphylococcus...   107    2e-21
ref|NP_568496.1|  aminotransferase class IV family protein [Ar...   107    2e-21
ref|ZP_04172473.1|  4-amino-4-deoxychorismate lyase [Bacillus ...   107    2e-21
ref|ZP_03233513.1|  4-amino-4-deoxychorismate lyase PabC [Baci...   107    2e-21
sp|P54693.1|DAAA_BACSH  RecName: Full=D-alanine aminotransfera...   106    2e-21
ref|YP_521744.1|  aminotransferase, class IV [Rhodoferax ferri...   106    3e-21
ref|ZP_00742142.1|  4-amino-4-deoxychorismate lyase [Bacillus ...   106    3e-21
ref|ZP_04151204.1|  D-alanine aminotransferase [Bacillus pseud...   106    3e-21
ref|YP_002338319.1|  D-amino acid aminotransferase [Bacillus c...   106    3e-21
ref|ZP_04078464.1|  D-alanine aminotransferase [Bacillus thuri...   106    3e-21
ref|YP_001738141.1|  aminotransferase class IV [Thermotoga sp....   106    3e-21
ref|YP_014238.1|  D-amino acid aminotransferase [Listeria mono...   105    3e-21
ref|ZP_04096412.1|  D-alanine aminotransferase [Bacillus thuri...   105    4e-21
emb|CAD70620.1|  branched-chain amino acid aminotransferase-li...   105    4e-21
ref|ZP_04082402.1|  4-amino-4-deoxychorismate lyase [Bacillus ...   105    4e-21
ref|NP_228640.1|  branched-chain amino acid aminotransferase, ...   105    4e-21
ref|ZP_04392739.1|  D-amino acid aminotransferase [Geobacillus...   105    4e-21
ref|XP_001402221.1|  hypothetical protein An04g08630 [Aspergil...   105    5e-21
ref|ZP_04060651.1|  D-amino-acid transaminase [Staphylococcus ...   105    5e-21
ref|XP_001209325.1|  conserved hypothetical protein [Aspergill...   105    5e-21
ref|XP_001774716.1|  predicted protein [Physcomitrella patens ...   105    5e-21
ref|YP_036368.1|  D-amino acid aminotransferase [Bacillus thur...   105    5e-21
gb|EEU44019.1|  hypothetical protein NECHADRAFT_29730 [Nectria...   105    6e-21
ref|NP_001150217.1|  aminotransferase, class IV family protein...   105    6e-21
ref|ZP_03238817.1|  4-amino-4-deoxychorismate lyase PabC [Baci...   105    6e-21
ref|YP_083629.1|  D-amino acid aminotransferase [Bacillus cere...   105    6e-21
ref|NP_976397.1|  4-amino-4-deoxychorismate lyase [Bacillus ce...   105    7e-21
ref|ZP_04207180.1|  4-amino-4-deoxychorismate lyase [Bacillus ...   105    7e-21
ref|YP_465861.1|  branched chain amino acid: 2-keto-4-methylth...   105    7e-21
ref|ZP_04283943.1|  D-alanine aminotransferase [Bacillus cereu...   105    7e-21
ref|YP_002451231.1|  D-amino acid aminotransferase [Bacillus c...   105    7e-21
ref|NP_829973.1|  4-amino-4-deoxychorismate lyase [Bacillus ce...   105    7e-21
ref|ZP_04231676.1|  4-amino-4-deoxychorismate lyase [Bacillus ...   105    8e-21
ref|ZP_02878225.1|  D-amino acid aminotransferase [Bacillus an...   104    8e-21
ref|ZP_05635775.1|  branched-chain-amino-acid transaminase [Ps...   104    9e-21
ref|YP_001379824.1|  aminotransferase class IV [Anaeromyxobact...   104    9e-21
ref|ZP_03224789.1|  4-amino-4-deoxychorismate lyase [Bacillus ...   104    9e-21
ref|YP_002445635.1|  D-amino acid aminotransferase [Bacillus c...   104    9e-21
ref|ZP_04065062.1|  D-alanine aminotransferase [Bacillus thuri...   104    1e-20
ref|ZP_04063108.1|  4-amino-4-deoxychorismate lyase [Bacillus ...   104    1e-20
ref|ZP_04124342.1|  4-amino-4-deoxychorismate lyase [Bacillus ...   104    1e-20
emb|CBE69195.1|  Branched chain amino acid: 2-keto-4-methylthi...   104    1e-20
ref|NP_470996.1|  D-amino acid aminotransferase [Listeria inno...   104    1e-20
ref|ZP_04112755.1|  4-amino-4-deoxychorismate lyase [Bacillus ...   104    1e-20
ref|ZP_04101979.1|  D-alanine aminotransferase [Bacillus thuri...   104    1e-20
ref|ZP_04201154.1|  4-amino-4-deoxychorismate lyase [Bacillus ...   104    1e-20
ref|ZP_04323225.1|  D-alanine aminotransferase [Bacillus cereu...   104    1e-20
ref|ZP_04289219.1|  D-alanine aminotransferase [Bacillus cereu...   103    2e-20
ref|YP_301103.1|  D-alanine aminotransferase [Staphylococcus s...   103    2e-20
ref|ZP_00236652.1|  D-amino acid aminotransferase [Bacillus ce...   103    2e-20
ref|ZP_04100021.1|  4-amino-4-deoxychorismate lyase [Bacillus ...   103    2e-20
ref|YP_002535287.1|  branched-chain-amino-acid aminotransferas...   103    2e-20
ref|ZP_04294837.1|  D-alanine aminotransferase [Bacillus cereu...   103    2e-20
ref|NP_187170.2|  aminotransferase class IV family protein [Ar...   103    2e-20
ref|ZP_04304077.1|  4-amino-4-deoxychorismate lyase [Bacillus ...   103    2e-20
ref|YP_002314437.1|  4-amino-4-deoxychorismate lyase [Anoxybac...   103    2e-20
ref|YP_003480910.1|  D-amino-acid transaminase [Natrialba maga...   103    2e-20
pdb|3CSW|A  Chain A, Crystal Structure Of A Putative Branched-...   103    2e-20
ref|ZP_04233548.1|  D-alanine aminotransferase [Bacillus cereu...   103    2e-20
ref|ZP_04819614.1|  D-alanine aminotransferase [Staphylococcus...   103    2e-20
ref|XP_001766014.1|  predicted protein [Physcomitrella patens ...   103    2e-20
ref|YP_002908252.1|  Putative Branched-chain amino acid aminot...   103    2e-20
ref|ZP_04156966.1|  D-alanine aminotransferase [Bacillus mycoi...   103    2e-20
ref|ZP_03613604.1|  D-amino acid aminotransferase [Staphylococ...   103    2e-20
ref|NP_844646.1|  D-amino acid aminotransferase [Bacillus anth...   103    2e-20
ref|ZP_05097387.1|  probable branched-chain-amino-acid aminotr...   103    2e-20
ref|ZP_04245136.1|  D-alanine aminotransferase [Bacillus cereu...   103    2e-20
ref|YP_001243701.1|  aminotransferase, class IV [Thermotoga pe...   103    2e-20
ref|YP_253087.1|  D-amino acid aminotransferase [Staphylococcu...   103    2e-20
ref|NP_372274.1|  D-alanine aminotransferase [Staphylococcus a...   103    2e-20
ref|ZP_04225799.1|  4-amino-4-deoxychorismate lyase [Bacillus ...   103    2e-20
gb|ACG70818.1|  branched-chain amino acid aminotransferase-lik...   103    3e-20
ref|YP_001642963.1|  4-amino-4-deoxychorismate lyase [Bacillus...   103    3e-20
ref|ZP_04300503.1|  D-alanine aminotransferase [Bacillus cereu...   103    3e-20
ref|NP_978596.1|  D-amino acid aminotransferase [Bacillus cere...   103    3e-20
ref|ZP_04145506.1|  D-alanine aminotransferase [Bacillus thuri...   103    3e-20
ref|ZP_03234427.1|  D-amino acid aminotransferase [Bacillus ce...   102    3e-20
ref|ZP_04265546.1|  4-amino-4-deoxychorismate lyase [Bacillus ...   102    3e-20
ref|ZP_04315406.1|  4-amino-4-deoxychorismate lyase [Bacillus ...   102    3e-20
ref|ZP_04298525.1|  4-amino-4-deoxychorismate lyase [Bacillus ...   102    3e-20
ref|ZP_04186040.1|  D-alanine aminotransferase [Bacillus cereu...   102    3e-20
ref|ZP_00240849.1|  D-alanine aminotransferase, putative [Baci...   102    4e-20
ref|YP_186633.1|  D-alanine aminotransferase [Staphylococcus a...   102    4e-20
ref|ZP_04278696.1|  D-alanine aminotransferase [Bacillus cereu...   102    4e-20
ref|ZP_04118310.1|  4-amino-4-deoxychorismate lyase [Bacillus ...   102    4e-20
ref|ZP_04197301.1|  D-alanine aminotransferase [Bacillus cereu...   102    4e-20
ref|ZP_04184073.1|  4-amino-4-deoxychorismate lyase [Bacillus ...   102    4e-20
ref|YP_003258811.1|  aminotransferase class IV [Pectobacterium...   102    5e-20
gb|EEU48681.1|  hypothetical protein NECHADRAFT_75055 [Nectria...   102    5e-20
ref|YP_955297.1|  aminotransferase, class IV [Mycobacterium va...   102    5e-20
gb|EEC75297.1|  hypothetical protein OsI_11647 [Oryza sativa I...   102    5e-20
ref|ZP_01172509.1|  D-amino acid aminotransferase [Bacillus sp...   102    5e-20
gb|EEE59086.1|  hypothetical protein OsJ_10916 [Oryza sativa J...   102    5e-20
ref|ZP_03232347.1|  D-amino acid aminotransferase [Bacillus ce...   102    5e-20
ref|YP_002543780.1|  branched-chain-amino-acid aminotransferas...   102    5e-20
ref|NP_692004.1|  D-alanine aminotransferase [Oceanobacillus i...   102    5e-20
ref|ZP_04168716.1|  D-alanine aminotransferase [Bacillus mycoi...   102    5e-20
ref|ZP_00739806.1|  Branched-chain amino acid aminotransferase...   102    5e-20
gb|ABF96063.1|  branched-chain amino acid aminotransferase, pu...   102    6e-20
ref|YP_002366955.1|  D-amino acid aminotransferase [Bacillus c...   102    6e-20
ref|YP_001372097.1|  aminotransferase class IV [Ochrobactrum a...   102    6e-20
ref|ZP_04239283.1|  D-alanine aminotransferase [Bacillus cereu...   102    6e-20
ref|ZP_04120244.1|  D-alanine aminotransferase [Bacillus thuri...   102    6e-20
ref|ZP_04317341.1|  D-alanine aminotransferase [Bacillus cereu...   102    6e-20
gb|ABZ07939.1|  putative aminotransferase class IV [uncultured...   102    6e-20
ref|YP_146525.1|  D-alanine aminotransferase [Geobacillus kaus...   102    6e-20
ref|ZP_04114673.1|  D-alanine aminotransferase [Bacillus thuri...   102    6e-20
ref|YP_043796.1|  D-alanine aminotransferase [Staphylococcus a...   102    6e-20
ref|NP_353893.2|  aminotransferase [Agrobacterium tumefaciens ...   102    6e-20
ref|ZP_04227723.1|  D-alanine aminotransferase [Bacillus cereu...   101    7e-20
ref|ZP_04171520.1|  D-amino acid aminotransferase 1 [Bacillus ...   101    7e-20
ref|NP_646510.1|  D-alanine aminotransferase [Staphylococcus a...   101    7e-20
ref|ZP_00743700.1|  D-alanine aminotransferase [Bacillus thuri...   101    8e-20
gb|AAF27025.1|AC009177_15  putative branched-chain amino acid ...   101    8e-20

ALIGNMENTS
>ref|NP_276546.1| branched-chain amino-acid aminotransferase [Methanothermobacter 
thermautotrophicus str. Delta H]
 gb|AAB85907.1| branched-chain amino-acid aminotransferase [Methanothermobacter 
thermautotrophicus str. Delta H]
Length=330

 Score =  257 bits (656),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/268 (46%), Positives = 179/268 (66%), Gaps = 0/268 (0%)

Query  1    GIRARNTEKGVSIFRLNDHVDRLFASADSYNLKIPYTKEVIFEAIKDVVSKNKLQSAYIR  60
            GIR     KG +IFRL +HV RLF SA  Y + IPYT+E I +AI + V +N L+  YIR
Sbjct  63   GIRCYRNSKGSAIFRLREHVKRLFDSAKIYRMDIPYTQEQICDAIVETVRENGLEECYIR  122

Query  61   PLVFFGEGEMGLLPKDVPVRVSIAAWYWGAYLGDEAVNQGVNVCISRWRRISPTSFIPLA  120
            P+VF G GEMG+ P + PV V++AAW WGAYLG EA+  GV+  +S WRR++P +   +A
Sbjct  123  PVVFRGYGEMGVHPVNCPVDVAVAAWEWGAYLGAEALEVGVDAGVSTWRRMAPNTMPNMA  182

Query  121  KGVGGYMNSTLAKIDAVENGYDDAIMLGDDGTVAEGSGQNIFIVKDNNIFTPPNSTGALN  180
            K  G Y+NS LAK++AV +GYD+AIML   G ++EGSG+NIF+V +  I+TPP S+  L 
Sbjct  183  KAGGNYLNSQLAKMEAVRHGYDEAIMLDYHGYISEGSGENIFLVSEGEIYTPPVSSSLLR  242

Query  181  GITRRTVIEIAEQKNIPIEEKNLTVEDLKTADEVFFTGTATGVIGVVSIDKDDISDGQVG  240
            GITR +VI+IA  + + + E+ +T E L  ADE FFTGTA  +  + S+D  +I  G+ G
Sbjct  243  GITRDSVIKIARTEGVTVHEEPITREMLYIADEAFFTGTAAEITPIRSVDGIEIGAGRRG  302

Query  241  KITSDIIDSYEDVVNAKDDNFKSYITLI  268
             +T  + D +  ++ A+ ++   ++T I
Sbjct  303  PVTKLLQDEFFRIIRAETEDSFGWLTYI  330


>sp|O27481.2|ILVE_METTH RecName: Full=Putative branched-chain-amino-acid aminotransferase; 
Short=BCAT; AltName: Full=Transaminase B
Length=306

 Score =  257 bits (656),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/268 (46%), Positives = 179/268 (66%), Gaps = 0/268 (0%)

Query  1    GIRARNTEKGVSIFRLNDHVDRLFASADSYNLKIPYTKEVIFEAIKDVVSKNKLQSAYIR  60
            GIR     KG +IFRL +HV RLF SA  Y + IPYT+E I +AI + V +N L+  YIR
Sbjct  39   GIRCYRNSKGSAIFRLREHVKRLFDSAKIYRMDIPYTQEQICDAIVETVRENGLEECYIR  98

Query  61   PLVFFGEGEMGLLPKDVPVRVSIAAWYWGAYLGDEAVNQGVNVCISRWRRISPTSFIPLA  120
            P+VF G GEMG+ P + PV V++AAW WGAYLG EA+  GV+  +S WRR++P +   +A
Sbjct  99   PVVFRGYGEMGVHPVNCPVDVAVAAWEWGAYLGAEALEVGVDAGVSTWRRMAPNTMPNMA  158

Query  121  KGVGGYMNSTLAKIDAVENGYDDAIMLGDDGTVAEGSGQNIFIVKDNNIFTPPNSTGALN  180
            K  G Y+NS LAK++AV +GYD+AIML   G ++EGSG+NIF+V +  I+TPP S+  L 
Sbjct  159  KAGGNYLNSQLAKMEAVRHGYDEAIMLDYHGYISEGSGENIFLVSEGEIYTPPVSSSLLR  218

Query  181  GITRRTVIEIAEQKNIPIEEKNLTVEDLKTADEVFFTGTATGVIGVVSIDKDDISDGQVG  240
            GITR +VI+IA  + + + E+ +T E L  ADE FFTGTA  +  + S+D  +I  G+ G
Sbjct  219  GITRDSVIKIARTEGVTVHEEPITREMLYIADEAFFTGTAAEITPIRSVDGIEIGAGRRG  278

Query  241  KITSDIIDSYEDVVNAKDDNFKSYITLI  268
             +T  + D +  ++ A+ ++   ++T I
Sbjct  279  PVTKLLQDEFFRIIRAETEDSFGWLTYI  306


>ref|YP_003395340.1| branched-chain amino acid aminotransferase [Conexibacter woesei 
DSM 14684]
 gb|ADB51965.1| branched-chain amino acid aminotransferase [Conexibacter woesei 
DSM 14684]
Length=311

 Score =  256 bits (655),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/264 (45%), Positives = 175/264 (66%), Gaps = 0/264 (0%)

Query  1    GIRARNTEKGVSIFRLNDHVDRLFASADSYNLKIPYTKEVIFEAIKDVVSKNKLQSAYIR  60
            GIRA  TE+G ++FR ++HVDRLF SA  Y + +PYT+E I  AI +++ +N L + YIR
Sbjct  37   GIRAYETERGTAVFRNDEHVDRLFRSAALYYMPVPYTREQIKAAIHELIGRNGLPACYIR  96

Query  61   PLVFFGEGEMGLLPKDVPVRVSIAAWYWGAYLGDEAVNQGVNVCISRWRRISPTSFIPLA  120
            P+V+ G G MGL P D PV VSIAAW WGAYLGDE   +GV   +S WRRIS  S IP A
Sbjct  97   PIVYRGAGVMGLNPLDAPVEVSIAAWSWGAYLGDEGKTKGVRAKVSSWRRISGDSLIPHA  156

Query  121  KGVGGYMNSTLAKIDAVENGYDDAIMLGDDGTVAEGSGQNIFIVKDNNIFTPPNSTGALN  180
            K  G Y+NS LAKI++ + GY++ I+L   G V EG+G+N+F+V+D  I TP  + G LN
Sbjct  157  KASGQYLNSVLAKIESHKAGYEEGILLDQHGYVCEGTGENLFLVQDGKIVTPSQTNGILN  216

Query  181  GITRRTVIEIAEQKNIPIEEKNLTVEDLKTADEVFFTGTATGVIGVVSIDKDDISDGQVG  240
            GI R++VIEIA+ + + + E+++   +L   DE+F TGTA  +  +  ID   +  G+ G
Sbjct  217  GINRQSVIEIAKDEGVELVERDIARAELYLCDEIFMTGTAAELTPIREIDDRPVGSGEPG  276

Query  241  KITSDIIDSYEDVVNAKDDNFKSY  264
             +T  +   ++D ++A+D+ +  +
Sbjct  277  PVTKRLQKVFDDALHARDERYLKW  300


>ref|YP_447078.1| hypothetical protein Msp_0015 [Methanosphaera stadtmanae DSM 
3091]
 gb|ABC56435.1| IlvE [Methanosphaera stadtmanae DSM 3091]
Length=306

 Score =  254 bits (648),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 175/268 (65%), Gaps = 0/268 (0%)

Query  1    GIRARNTEKGVSIFRLNDHVDRLFASADSYNLKIPYTKEVIFEAIKDVVSKNKLQSAYIR  60
            GIR  +TE G ++FRL DH+ RL  SA  Y + IPYT+  + EA+KD ++ N ++S YIR
Sbjct  39   GIRCYDTENGPAVFRLKDHMKRLEDSAKVYRMDIPYTRNELCEAVKDTININNIRSCYIR  98

Query  61   PLVFFGEGEMGLLPKDVPVRVSIAAWYWGAYLGDEAVNQGVNVCISRWRRISPTSFIPLA  120
            P+VF G  E+G+ P + P+   IA W WG YLG++A+ QG++VC S WR+++P +   LA
Sbjct  99   PVVFRGYKELGVYPMNCPIETVIAVWAWGQYLGEDALEQGIDVCTSSWRKMAPDTMPNLA  158

Query  121  KGVGGYMNSTLAKIDAVENGYDDAIMLGDDGTVAEGSGQNIFIVKDNNIFTPPNSTGALN  180
            K    YMNS LAKI+A  NGY ++IML  +GTV EG+G+NIF V+D  ++TP   +  L 
Sbjct  159  KAGSNYMNSQLAKIEATTNGYKESIMLNYEGTVGEGTGENIFFVEDGELYTPDIGSSVLK  218

Query  181  GITRRTVIEIAEQKNIPIEEKNLTVEDLKTADEVFFTGTATGVIGVVSIDKDDISDGQVG  240
            GITR T+I IAE     + E+ +  E L TADEVFF+GTA  +  + SIDK  I  G+ G
Sbjct  219  GITRNTIITIAEDLGYKVREETIPRERLYTADEVFFSGTAAELSPIRSIDKIQIGKGKRG  278

Query  241  KITSDIIDSYEDVVNAKDDNFKSYITLI  268
             +T +I DS  D+VN K ++   ++  I
Sbjct  279  PVTKEIQDSLFDIVNNKVEDKYGWLDFI  306


>ref|YP_001273775.1| branched-chain-amino-acid aminotransferase, IlvE [Methanobrevibacter 
smithii ATCC 35061]
 gb|ABQ87407.1| branched-chain-amino-acid aminotransferase, IlvE [Methanobrevibacter 
smithii ATCC 35061]
Length=307

 Score =  246 bits (628),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/262 (46%), Positives = 176/262 (67%), Gaps = 1/262 (0%)

Query  1    GIRARNTEKGVSIFRLNDHVDRLFASADSYNLKIPYTKEVIFEAIKDVVSKNKLQSAYIR  60
            GIRA + +KG  IFRLN+HV RLF SA  Y + IPYT+E I +AI+D V  N+L S YIR
Sbjct  40   GIRAYDNKKGTCIFRLNEHVKRLFNSAKVYKIDIPYTQEEIAQAIRDTVKINELASCYIR  99

Query  61   PLVFFGEGEMGLLPKDVPVRVSIAAWYWGAYLGDEAVNQGVNVCISRWRRISPTSFIPLA  120
            P+VF G G++G+ P   PV   IAAW WG+YLG+E +  GV+V +S WR+ +P +F  LA
Sbjct  100  PIVFRGYGQLGVNPLSCPVNTVIAAWEWGSYLGEEGMANGVDVGVSSWRKPAPDTFPTLA  159

Query  121  KGVGGYMNSTLAKIDAVENGYDDAIMLGDDGTVAEGSGQNIFIVKDNNIFTPPNSTGALN  180
            K    YMNS LAK++A+++GY++AIML  +G V+EGSG+NIFI++D  ++TP   +  L 
Sbjct  160  KCGANYMNSQLAKLEAIDHGYEEAIMLDYEGHVSEGSGENIFIIEDGVLYTPSMDSSNLK  219

Query  181  GITRRTVIEIAEQKNIPIEEKNLTVEDLKTADEVFFTGTATGVIGVVSIDKDDISDGQVG  240
            GITR ++ ++A      + E+ ++ E L  ADEVFF+GTA  V  + SID   I  G+ G
Sbjct  220  GITRESIKQLANDLGYEVVEERISRERLYFADEVFFSGTAAEVTPIRSIDHKIIGAGKRG  279

Query  241  KITSDIIDSYEDVVNA-KDDNF  261
             I+ ++  ++ D+V   K+D F
Sbjct  280  PISEELQKTFFDIVEGKKEDKF  301


>ref|ZP_03608009.1| hypothetical protein METSMIALI_01133 [Methanobrevibacter smithii 
DSM 2375]
 ref|ZP_05975362.1| branched-chain-amino-acid transaminase [Methanobrevibacter smithii 
DSM 2374]
 gb|EEE42224.1| hypothetical protein METSMIALI_01133 [Methanobrevibacter smithii 
DSM 2375]
 gb|EFC93027.1| branched-chain-amino-acid transaminase [Methanobrevibacter smithii 
DSM 2374]
Length=307

 Score =  246 bits (628),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/262 (46%), Positives = 176/262 (67%), Gaps = 1/262 (0%)

Query  1    GIRARNTEKGVSIFRLNDHVDRLFASADSYNLKIPYTKEVIFEAIKDVVSKNKLQSAYIR  60
            GIRA + +KG  IFRLN+HV RLF SA  Y + IPYT+E I +AI+D V  N+L S YIR
Sbjct  40   GIRAYDNKKGTCIFRLNEHVKRLFNSAKVYKIDIPYTQEEIAQAIRDTVKINELASCYIR  99

Query  61   PLVFFGEGEMGLLPKDVPVRVSIAAWYWGAYLGDEAVNQGVNVCISRWRRISPTSFIPLA  120
            P+VF G G++G+ P   PV   IAAW WG+YLG+E +  GV+V +S WR+ +P +F  LA
Sbjct  100  PVVFRGYGQLGVNPLSCPVNTVIAAWEWGSYLGEEGMANGVDVGVSSWRKPAPDTFPTLA  159

Query  121  KGVGGYMNSTLAKIDAVENGYDDAIMLGDDGTVAEGSGQNIFIVKDNNIFTPPNSTGALN  180
            K    YMNS LAK++A+++GY++AIML  +G V+EGSG+NIFI++D  ++TP   +  L 
Sbjct  160  KCGANYMNSQLAKLEAIDHGYEEAIMLDYEGHVSEGSGENIFIIEDGVLYTPSMDSSNLK  219

Query  181  GITRRTVIEIAEQKNIPIEEKNLTVEDLKTADEVFFTGTATGVIGVVSIDKDDISDGQVG  240
            GITR ++ ++A      + E+ ++ E L  ADEVFF+GTA  V  + SID   I  G+ G
Sbjct  220  GITRESIKQLANDLGYEVVEERISRERLYFADEVFFSGTAAEVTPIRSIDHKIIGAGKRG  279

Query  241  KITSDIIDSYEDVVNA-KDDNF  261
             I+ ++  ++ D+V   K+D F
Sbjct  280  PISEELQKTFFDIVEGKKEDKF  301


>ref|ZP_06753654.1| branched-chain-amino-acid transaminase [Simonsiella muelleri 
ATCC 29453]
 gb|EFG31526.1| branched-chain-amino-acid transaminase [Simonsiella muelleri 
ATCC 29453]
Length=309

 Score =  243 bits (621),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 120/268 (44%), Positives = 176/268 (65%), Gaps = 1/268 (0%)

Query  1    GIRARNTEKGVSIFRLNDHVDRLFASADSYNLKIPYTKEVIFEAIKDVVSKNKLQSAYIR  60
            G+RA  T KG ++FRL DH +RLF SA  + + IP++K+ I +A  DVV  N+L+S Y R
Sbjct  42   GVRAYETPKGTAVFRLQDHTNRLFDSAKIFGMNIPFSKDEINQAHIDVVKANELKSCYFR  101

Query  61   PLVFFGEGEMGLLPKDVPVRVSIAAWYWGAYLGDEAVNQGVNVCISRWRRISPTSFIPLA  120
            P+ F+G  ++G+ P+   V+V +AAW WGAYLG+EA+ QG+   IS + R  P   +  A
Sbjct  102  PIAFYGSNKLGIAPQSDDVQVIVAAWAWGAYLGEEALKQGIRCKISSFSRHHPNITMIKA  161

Query  121  KGVGGYMNSTLAKIDAVENGYDDAIMLGDDGTVAEGSGQNIFIVKDNNIFTPPNSTGALN  180
            K  G YMNS LA  +A  +GYD+AI+L   G VAEGSG+NIF+V    +FTP     AL+
Sbjct  162  KASGNYMNSILANTEAHHDGYDEAILLDSTGYVAEGSGENIFVVSRGKLFTPALDV-ALD  220

Query  181  GITRRTVIEIAEQKNIPIEEKNLTVEDLKTADEVFFTGTATGVIGVVSIDKDDISDGQVG  240
            GITRRT+IEIA++  + + EK +T ++L  ADEVFFTGTA  V  +  ID   I  G  G
Sbjct  221  GITRRTIIEIAKKLGVEVVEKRITRDELYVADEVFFTGTAAEVTPIREIDNRQIGIGARG  280

Query  241  KITSDIIDSYEDVVNAKDDNFKSYITLI  268
            ++T+++   + D+V  ++ +++ Y+T +
Sbjct  281  ELTTELQQRFFDIVQGRNPDYEHYLTYV  308


>ref|YP_003424849.1| branched-chain-amino-acid aminotransferase IlvE [Methanobrevibacter 
ruminantium M1]
 gb|ADC47957.1| branched-chain-amino-acid aminotransferase IlvE [Methanobrevibacter 
ruminantium M1]
Length=307

 Score =  241 bits (616),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 118/268 (44%), Positives = 170/268 (63%), Gaps = 0/268 (0%)

Query  1    GIRARNTEKGVSIFRLNDHVDRLFASADSYNLKIPYTKEVIFEAIKDVVSKNKLQSAYIR  60
            GIR   TE G ++FRL DHV RLF SA  Y + IP+T+E I +AI + +  N L+S YIR
Sbjct  39   GIRCYETENGPAVFRLQDHVHRLFDSAKIYKMDIPFTEEEICDAIIETIKVNNLKSCYIR  98

Query  61   PLVFFGEGEMGLLPKDVPVRVSIAAWYWGAYLGDEAVNQGVNVCISRWRRISPTSFIPLA  120
            P+ + G GE+G+ P + PV  +IA W WGAY+G+E + QG N+ IS WR+ +P +   LA
Sbjct  99   PITYRGFGELGVNPLNCPVETTIAVWEWGAYIGEEEMEQGANIGISTWRKPAPGTLPVLA  158

Query  121  KGVGGYMNSTLAKIDAVENGYDDAIMLGDDGTVAEGSGQNIFIVKDNNIFTPPNSTGALN  180
            K    YMNS LA ++A E+GYD+AI L   G VAEGSG+NIFIV+   I TP   +  L 
Sbjct  159  KAAANYMNSQLANLEAGEHGYDEAIQLDYHGHVAEGSGENIFIVEKGKIVTPDLGSSILQ  218

Query  181  GITRRTVIEIAEQKNIPIEEKNLTVEDLKTADEVFFTGTATGVIGVVSIDKDDISDGQVG  240
            GITR +++ IA+     + ++ ++ E L  ADEVFFTG+A  V  + +ID   I  G  G
Sbjct  219  GITRDSIMTIAKDLGYEVSQETISRERLYLADEVFFTGSAAEVTPIRAIDNRQIGIGSRG  278

Query  241  KITSDIIDSYEDVVNAKDDNFKSYITLI  268
             +T ++ + Y D VN + ++  +++T +
Sbjct  279  PVTKELQEKYFDAVNGRSEDIHNWLTYV  306


>emb|CBH38165.1| putative branched-chain-amino-acid aminotransferase [uncultured 
archaeon]
Length=310

 Score =  241 bits (614),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 167/265 (63%), Gaps = 0/265 (0%)

Query  1    GIRARNTEKGVSIFRLNDHVDRLFASADSYNLKIPYTKEVIFEAIKDVVSKNKLQSAYIR  60
            GIR   TE+G  IFRL +HVDRL+ SA  Y ++IPYTKEVI +AIK+ V  N  ++ YIR
Sbjct  41   GIRCYATERGSFIFRLKEHVDRLYRSAALYKMEIPYTKEVITDAIKETVRINGFEACYIR  100

Query  61   PLVFFGEGEMGLLPKDVPVRVSIAAWYWGAYLGDEAVNQGVNVCISRWRRISPTSFIPLA  120
            P+ F+G   +G+ P   PV  +IA W WG YLG++A+  G+    S W RI P +    A
Sbjct  101  PIAFYGYHHLGVNPAGSPVDCAIATWRWGTYLGEDALKNGIRCIFSSWCRIDPRTLPVTA  160

Query  121  KGVGGYMNSTLAKIDAVENGYDDAIMLGDDGTVAEGSGQNIFIVKDNNIFTPPNSTGALN  180
            K  G Y+NS LA  +A E G D+AIML  +G VAEG G+NIF VK+  ++TP   +  L 
Sbjct  161  KATGHYLNSQLAVFEATERGVDEAIMLDINGYVAEGPGENIFAVKNAILYTPEAESSILP  220

Query  181  GITRRTVIEIAEQKNIPIEEKNLTVEDLKTADEVFFTGTATGVIGVVSIDKDDISDGQVG  240
            GITR +VI IA      + EK +T E+L +ADE FFTGTA  V  +  ID   I +G+ G
Sbjct  221  GITRDSVITIARDIGYEVVEKPITKEELLSADEAFFTGTAAEVSPIREIDDVRIGEGKRG  280

Query  241  KITSDIIDSYEDVVNAKDDNFKSYI  265
            ++T  I   + DVVNAK++ + S++
Sbjct  281  EVTGVIQKKFFDVVNAKEEKYMSWL  305


>ref|YP_157548.1| branched-chain amino acid aminotransferase [Aromatoleum aromaticum 
EbN1]
 emb|CAI06647.1| Branched-chain amino acid aminotransferase [Aromatoleum aromaticum 
EbN1]
Length=306

 Score =  240 bits (612),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/268 (42%), Positives = 173/268 (64%), Gaps = 1/268 (0%)

Query  1    GIRARNTEKGVSIFRLNDHVDRLFASADSYNLKIPYTKEVIFEAIKDVVSKNKLQSAYIR  60
            G+RA NT KG +IFRL +H  RL  S   Y ++IP++KE + EA K+VV  NKL+S Y+R
Sbjct  40   GVRAYNTAKGTAIFRLAEHTQRLINSGKIYRMEIPFSKEELMEAQKEVVRANKLESCYLR  99

Query  61   PLVFFGEGEMGLLPKDVPVRVSIAAWYWGAYLGDEAVNQGVNVCISRWRRISPTSFIPLA  120
            PL F+G  +MG+  +   V V+IAAW WGAYLG+E + +G+ +  S + R      +P A
Sbjct  100  PLAFYGSEKMGISTRGATVHVAIAAWPWGAYLGEEGLEKGIRIKTSSYSRHHVNVTMPRA  159

Query  121  KGVGGYMNSTLAKIDAVENGYDDAIMLGDDGTVAEGSGQNIFIVKDNNIFTPPNSTGALN  180
            K  G Y NS LA ++A E+GYD+A++L   G VAEGSG+N+F++KD  I+ P  ++ AL 
Sbjct  160  KMSGSYANSILANLEATEDGYDEALLLDTQGFVAEGSGENLFVIKDGKIYEPEIAS-ALT  218

Query  181  GITRRTVIEIAEQKNIPIEEKNLTVEDLKTADEVFFTGTATGVIGVVSIDKDDISDGQVG  240
            GITR +VI++A +    +E + +T +D+  ADE FFTGTA  V  +  +D   I +G+ G
Sbjct  219  GITRDSVIQVAHEFGYTVESRRMTRDDIYIADEAFFTGTAAEVTPIRELDNRTIGEGRRG  278

Query  241  KITSDIIDSYEDVVNAKDDNFKSYITLI  268
             IT+ I   + D+VN +   ++ ++T +
Sbjct  279  PITAKIQARFFDIVNGRAPEYERWLTHV  306


>ref|YP_002248977.1| branched-chain amino acid aminotransferase [Thermodesulfovibrio 
yellowstonii DSM 11347]
 gb|ACI20960.1| branched-chain amino acid aminotransferase [Thermodesulfovibrio 
yellowstonii DSM 11347]
Length=304

 Score =  239 bits (609),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 120/268 (44%), Positives = 175/268 (65%), Gaps = 1/268 (0%)

Query  1    GIRARNTEKGVSIFRLNDHVDRLFASADSYNLKIPYTKEVIFEAIKDVVSKNKLQSAYIR  60
            GIR  NTE+G ++FRL DH++RLF SA  + LKIP+T+E IFEA+K+ +  NK+ S YIR
Sbjct  38   GIRCYNTEQGPAVFRLKDHIERLFKSAHIFTLKIPFTEEEIFEAVKETIRVNKINSCYIR  97

Query  61   PLVFFGEGEMGLLPKDVPVRVSIAAWYWGAYLGDEAVNQGVNVCISRWRRISPTSFIPLA  120
            P+VF G G MG+ PK+ P++V+IA W WGAYLG+E + +G+ V  S + R    S +   
Sbjct  98   PIVFVGYGNMGVYPKNNPIQVAIAVWSWGAYLGEEGLQKGIRVKTSSFIRNHVNSNLSRG  157

Query  121  KGVGGYMNSTLAKIDAVENGYDDAIMLGDDGTVAEGSGQNIFIVKDNNIFTPPNSTGALN  180
            K  G Y+NS LAKI+A+  GYD+A++L  +G V+EGSG+NIFIV+   + T P  T  L 
Sbjct  158  KVAGYYVNSQLAKIEAISCGYDEAVLLDTEGYVSEGSGENIFIVRKGILKTTP-LTSILE  216

Query  181  GITRRTVIEIAEQKNIPIEEKNLTVEDLKTADEVFFTGTATGVIGVVSIDKDDISDGQVG  240
            GITR TV+ IA+  +I  +E+  T ++L  +DE FFTGTA  +  +  +D   I  G  G
Sbjct  217  GITRDTVLTIAKDLSIETKEERFTRDELYISDEAFFTGTAAEITPIREVDDRTIGIGSRG  276

Query  241  KITSDIIDSYEDVVNAKDDNFKSYITLI  268
             IT  I + + D+V  K+  ++ ++  +
Sbjct  277  PITEKIQNLFFDIVKGKNSKYQRWLDFV  304


>ref|ZP_05081594.1| branched-chain amino acid aminotransferase [beta proteobacterium 
KB13]
 gb|EDZ64281.1| branched-chain amino acid aminotransferase [beta proteobacterium 
KB13]
Length=310

 Score =  238 bits (607),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 120/268 (44%), Positives = 179/268 (66%), Gaps = 1/268 (0%)

Query  1    GIRARNTEKGVSIFRLNDHVDRLFASADSYNLKIPYTKEVIFEAIKDVVSKNKLQSAYIR  60
            G+RA   EKG +IFRL +H +RLF SA   ++ +P++K+ I +A  D V +NKL+SAYIR
Sbjct  44   GVRAYEAEKGTAIFRLKEHTNRLFNSAHIVSMAMPFSKDEINQAQIDSVKENKLKSAYIR  103

Query  61   PLVFFGEGEMGLLPKDVPVRVSIAAWYWGAYLGDEAVNQGVNVCISRWRRISPTSFIPLA  120
            P+VF+G   MG+  K +   V +AAW WGAY+G EA+ +G+ V  S + R      +  A
Sbjct  104  PMVFYGSEGMGISAKTLSTHVIVAAWSWGAYMGQEALEKGIAVKTSSFSRHHVNVTMCKA  163

Query  121  KGVGGYMNSTLAKIDAVENGYDDAIMLGDDGTVAEGSGQNIFIVKDNNIFTPPNSTGALN  180
            K  G YMNS LA  +A+ +GY++A++L   G V+EGSG+NIF+VK+ ++ TP  S+ AL 
Sbjct  164  KANGNYMNSILAHQEAINDGYNEALLLDTQGFVSEGSGENIFLVKNGHLITPSLSS-ALE  222

Query  181  GITRRTVIEIAEQKNIPIEEKNLTVEDLKTADEVFFTGTATGVIGVVSIDKDDISDGQVG  240
            GITR T+IEIA+  NI + EKN+T +++ TADE FFTGTA  V  + ++D+ +I  G  G
Sbjct  223  GITRDTIIEIAKANNIQVIEKNITRDEVYTADEAFFTGTAAEVTPIRALDRRNIGKGARG  282

Query  241  KITSDIIDSYEDVVNAKDDNFKSYITLI  268
            +IT  +  +Y DVV+ K+  +  ++T +
Sbjct  283  EITEFLQKTYFDVVSGKNTKYGDWLTYV  310
                                                             The