GOS 1437010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1092343626960
Annotathon code: GOS_1437010
Sample :
  • GPS :15°16'40s; 148°13'28w
  • Polynesia Archipelagos: Tikehau Lagoon - Fr. Polynesia
  • Coral Atoll (-1.2m, 27.8°C, 0.1-0.8 microns)
Authors
Team : Algarve
Username : gruta1
Annotated on : 2010-07-11 15:27:45
  • a36797 FernandoAlbertoLemosRodrigues
  • a36804 MargaridaIsabelAlvesGuerreiro
  • a37964 LurdesCristinaSardinhaGranadeiro

Synopsis

  • Taxonomy: Candidatus Pelagibacter ubique (NCBI info)
    Rank: species - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 198252
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order: Rickettsiales
    Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; SAR11 cluster; Candidatus Pelagibacter;

Genomic Sequence

>JCVI_READ_1092343626960 GOS_1437010 Genomic DNA
ATAATGGTTTTAGAAAATGTTGATGAAAAAGATAAAAATACAATATTATCAGCGTTACCGCCTAAAGATCGTTTTGCATTATTGGAGGGGCTAAGTTATC
CAGAGGATAGTGCTGCAAGGATAATGCAGCGTGAGTTTACTGCAATACCAAGCAATTGGTCTGTTGGTCAAACTATAGATTATTTAAGAGAAAACAAAGA
TCTTCCAGAAGAATTTTTAGAAATCTTTATTGTAAATGAAAACTTTAAACCAATAGGTTCGGTACCTTCGTCAAAAGTTTTGAGAACTCCTAGAGAGACA
AAAATGTCATCTATAATGGTTGATACTCTTTTTCTAGTTCCTGTTGATATGGATAGAGAGGAAGTTGGTAATTTGTTTGAAAATTACAACCTTAGTTCTG
CTTGTGTGGTTGATAAAAGTGAAAAATTAGTTGGTATGATAACTTATGACGATATTTTAACTGTATTAAAAGAAGAAGCAGAGGAAGATGCTCTTAGATT
AGCAGGTGTAGGCGATGAAGAGATAACAGATGGAGTTATAACTAAAACAAAAAGAAGATTTAACTGGCTTTTATTAAACTTGTTTACAGCATTCCTTGCC
ACTTGGTGTATTAGTTTATTTGGAGCAACTATAGAACAAATGGTAGTTTTGGCTTTTTTAATGCCAATAGTAGCATCAATGGGCGGTAATGCTGGTATGC
AAACATTAGCTGTCACTGTTAGATCTTTAGCCACTAATGATTTAACAAAAAATAATTTTACTCAAAATATTTTAAAAGAATTTAATATTGGAGTTTTAAA
TGGAATAATTTTTGCTGTTATCAGTTCGATTATTGTACAATTATGGTTTCAAGATAATCAATTATCTTTAATCATTTCAATCTCAATGATTTTAACTATG
ATAATTGCACGTCTTTTCGGAATTTTAATT

Translation

[1 - 930/930]   direct strand
>GOS_1437010 Translation [1-930   direct strand]
IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTIDYLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRET
KMSSIMVDTLFLVPVDMDREEVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVITKTKRRFNWLLLNLFTAFLA
TWCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTVRSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQLSLIISISMILTM
IIARLFGILI

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

In conclusion of our analysis, we have determined the following facts about the GOS_143701 metagenomic sample.


The ORF has been determined to be the frame 1, due to it being the longest sequence, and due to the fact that this ORF has 930 bases it is highly likely that it is coding.


This facts can be supported by the analysis of the Multiple alignment, which has found homolog coding sequences similar to the sample with a low E value, further suporting the hipothesis that the sample is coding, and that by comparing blastp and blastx reports, that our ORF is the best to work with due to it having generally higher scores and lower E-values than any other sugested by blastx


Although the sequence is incomplete by compraing homolog sequences in the multiple alignment, the protein domains have been preserved, which are supported by the protein domain and blastp and blastx data.


The possible biological role of this protein is ion transporting where ATP consumption is involved. These hipothesis is suported by the most significant protein domains with low E values. This domains codes a transmembrane ion transporter (MgtE magnesium transporter, integral membrane region [E value 6.1e-5]) coupled with adenosine binds that regulate the attached protein (CBS domain [E value 2.1e-8), this adenosine binds can interact with adenisone derivates, such as ATP.


In addition, we can safely assume that taxonomic group of this protein is likely to be of an alphaproteobacteria, more specifically of a Candidatus Pelagibacter ubique.Such facts are supported by both taxonomic trees, showing how the sample is integrated on the ingroup (alphaproteobacteria) with high bootstrap values, The lowest E values and highest score on blastx, blastp, lineage report all point towards the Candidatus Pelagibacter group.


Sources: CBS domain http://en.wikipedia.org/wiki/CBS_domain

ORF finding

PROTOCOL


a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code


RESULTS ANALYSIS


Only one ORF was found on the direct strand in reading frame 1, extending from base 1 to 930. Two ORFs were found in the reverse strand, both in reading frame 2, extending from base 170 to 487 and from 548 to 751.


The forward strand extending from base 1 to base 930 on ORF number 1 in reading frame 1 proves to be the longest one (310aa).


There exists additional ORFs with biological meaning by analysis of the BLASTx, wich search for biological function for the smaller ORF's.*discussed in BLAST*


This ORF is highly likely to be coding because of how long it is (930 bases), when is >150aa the probability of beig coding is high.


Since our ORF does not have a start and end codon (the amino and carboxylic exteme is incomplete), we could not calculate the molecular weight.

RAW RESULTS

a) Forward Strand

>ORF number 1 in reading frame 1 on the direct strand extends from base 1 to base 930.
ATAATGGTTTTAGAAAATGTTGATGAAAAAGATAAAAATACAATATTATCAGCGTTACCG
CCTAAAGATCGTTTTGCATTATTGGAGGGGCTAAGTTATCCAGAGGATAGTGCTGCAAGG
ATAATGCAGCGTGAGTTTACTGCAATACCAAGCAATTGGTCTGTTGGTCAAACTATAGAT
TATTTAAGAGAAAACAAAGATCTTCCAGAAGAATTTTTAGAAATCTTTATTGTAAATGAA
AACTTTAAACCAATAGGTTCGGTACCTTCGTCAAAAGTTTTGAGAACTCCTAGAGAGACA
AAAATGTCATCTATAATGGTTGATACTCTTTTTCTAGTTCCTGTTGATATGGATAGAGAG
GAAGTTGGTAATTTGTTTGAAAATTACAACCTTAGTTCTGCTTGTGTGGTTGATAAAAGT
GAAAAATTAGTTGGTATGATAACTTATGACGATATTTTAACTGTATTAAAAGAAGAAGCA
GAGGAAGATGCTCTTAGATTAGCAGGTGTAGGCGATGAAGAGATAACAGATGGAGTTATA
ACTAAAACAAAAAGAAGATTTAACTGGCTTTTATTAAACTTGTTTACAGCATTCCTTGCC
ACTTGGTGTATTAGTTTATTTGGAGCAACTATAGAACAAATGGTAGTTTTGGCTTTTTTA
ATGCCAATAGTAGCATCAATGGGCGGTAATGCTGGTATGCAAACATTAGCTGTCACTGTT
AGATCTTTAGCCACTAATGATTTAACAAAAAATAATTTTACTCAAAATATTTTAAAAGAA
TTTAATATTGGAGTTTTAAATGGAATAATTTTTGCTGTTATCAGTTCGATTATTGTACAA
TTATGGTTTCAAGATAATCAATTATCTTTAATCATTTCAATCTCAATGATTTTAACTATG
ATAATTGCACGTCTTTTCGGAATTTTAATT

>Translation of ORF number 1 in reading frame 1 on the direct strand.
IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID
YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE
EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI
TKTKRRFNWLLLNLFTAFLATWCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV
RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQLSLIISISMILTM
IIARLFGILI

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

---------------------------------------------------------------------------------------------------------------------------

b) Reverse Strand

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 170 to base 487.
GTAAAATTATTTTTTGTTAAATCATTAGTGGCTAAAGATCTAACAGTGACAGCTAATGTT
TGCATACCAGCATTACCGCCCATTGATGCTACTATTGGCATTAAAAAAGCCAAAACTACC
ATTTGTTCTATAGTTGCTCCAAATAAACTAATACACCAAGTGGCAAGGAATGCTGTAAAC
AAGTTTAATAAAAGCCAGTTAAATCTTCTTTTTGTTTTAGTTATAACTCCATCTGTTATC
TCTTCATCGCCTACACCTGCTAATCTAAGAGCATCTTCCTCTGCTTCTTCTTTTAATACA
GTTAAAATATCGTCATAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
VKLFFVKSLVAKDLTVTANVCIPALPPIDATIGIKKAKTTICSIVAPNKLIHQVARNAVN
KFNKSQLNLLFVLVITPSVISSSPTPANLRASSSASSFNTVKISS*

>ORF number 2 in reading frame 2 on the reverse strand extends from base 548 to base 751.
TTTTCAAACAAATTACCAACTTCCTCTCTATCCATATCAACAGGAACTAGAAAAAGAGTA
TCAACCATTATAGATGACATTTTTGTCTCTCTAGGAGTTCTCAAAACTTTTGACGAAGGT
ACCGAACCTATTGGTTTAAAGTTTTCATTTACAATAAAGATTTCTAAAAATTCTTCTGGA
AGATCTTTGTTTTCTCTTAAATAA

>Translation of ORF number 2 in reading frame 2 on the reverse strand.
FSNKLPTSSLSISTGTRKRVSTIIDDIFVSLGVLKTFDEGTEPIGLKFSFTIKISKNSSG
RSLFSLK*

No ORFs were found in reading frame 3.


Multiple Alignement

PROTOCOL


Gblocks 0.91b


RESULTS ANALYSIS


Comparing the ORF with the outgroups and ingroups, we can determine the ORF sequence is incomplete in the carboxilic end and in the amine group end, so the start and end codons are missing, however, mostly of the aminoacids in the sequence are generally conserved.


Since they are missing, the true possible lenght of the strand is in fact bigger by comparison with homolog sequences alignments, around 460 aminoacids.

RAW RESULTS

Processed file: input.fasta
Number of sequences: 21
Alignment assumed to be: Protein
New number of positions: 271 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
SUP05.cluster_O  --------------------------------MSEVENTSF-----EDCLQRLMVSLEAS
Candidatus_Out   --------------------------------MLEVENTSF-----KDCLQKLIKFLEHL
Thiomicro_Out    ------------------------------------MSQIHHTIDKLQLTEQLHKAVSDQ
Marine.gamma_Ou  ------------------------------------MPTSADFIQTQDHLDQLNQALDSG
Alteromonas_Out  ------------------------------------MAEALVSKYVQTQLRALNAALTNG
A.protobacteriu  -------------------------------MSNEETIEKKTFEVTKELIDNLVSLINEK
GOS_1437010_Tra  ------------------------------------------------------------
C.Pelagibacter2  -----------------------------MSLVKKIKDKKVNFEFNKEYIKVVTSKIANN
CPelagibacter1   -----------------------------MSLIKKIKDKKVNFEFNKEYIKVVTSKIANN
N.risticii_In    -------------------------------------------------MNDTIPLILKK
N.sennetsu_In    -------------------------------------------------MNDTIPLILKK
W.E.Brugia_In    ---------------------------------MSVETKFHY-DLDKKAIDSLVESLNNQ
W.E.Culex_In     ---------------------------------MNIKTSSHY-GLDKKAIDDLIESLDNQ
W.E.Drosophila2  ---------------------------------MNIEISSHY-GLDKKAIDDLIESLDNE
W.E.Drosophila1  ---------------------------------MNIEISSHY-GLYKKAIDDLIESLDNE
W.E.Muscidifura  ------------------------------------------------------------
E.Ruminatum_In   ------------------------------MSMSEIDHTLHY-ILDEKISNSLTQALETQ
E.canis.Jake_In  ------------------------------MYTQESDNALHY-ILDEKISNSLTEALEKQ
E.chaffensis_In  ------------------------------MYTQESGHALHY-ILDEKTSNSLTEALETQ
Anaplasma_In     ---------------------------------------MSYHLLDKKTSDFLIDAIEEE
A.marginale_In   MALIMKQIAKQFQDIQDGKNMLGVCCVVCCQSIEVVARVMSYHLLDKQTSDFLISAVEEG
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
SUP05.cluster_O  LYEEATSQLAGLHSGEIARLLEAVPPKERSKLWQGIDSSTQGDVLKELSEDVQEQLLKKM
Candidatus_Out   KYEEAISYLVELHPIEIARLLESIPPKDRIQIWLNIDIGIKGDIIKNLNENVQSQLLSKM
Thiomicro_Out    NTDYIQQLLQGLVAEEIAEILEATPPKERSQLWGLLPSETQGEILGHTNDEVRANLLSHL
Marine.gamma_Ou  ALVQVRRLLDSLPAADVAHVLESSPPKARAVLWRLIEIDREREVLPFLSDEIRSQFLRQM
Alteromonas_Out  QFVSVRKLLLELPPSDVAHILESSPSRTRDELWELIDGDFHGDILEELSDDVRNGIITKM
A.protobacteriu  RVVEINNSLHALHPSDAAEVLSNLPEKARFNLLLLEALDLRPDTVKELNNTLQKDILNQL
GOS_1437010_Tra  ------------------------------------------------------------
C.Pelagibacter2  DATFITNSFKEMHPADAADIIEHLNQSDRESLIKLNNFKIDPEVFVELNESIQTEIITYL
CPelagibacter1   DAQFITNSFNEMHPADAADIIEHLGQNDRESLIKLNNFNIDPEVFIELNESVQSEIIAYL
N.risticii_In    LTEEIPEQDRIQNQKELVDAFINAKSEVQEHFMHKHLIH-HTYILAEIPTELLRRIVETV
N.sennetsu_In    LTGEIPEQDRIQNQKELVDAFINAKSEVQEHFMHKHLIH-HTYILAEIPTELLRRIVETV
W.E.Brugia_In    KLENIHNIIKTIDSVQLAYFLSTSISDHREQLVSVLDQYSLSNALVHVVPDLQVEIIETL
W.E.Culex_In     ELENVRNIVKTIDSVQLAYFLSTSINDHREKLVNILDQHLLSDALVHVVPDLQVEIIEIL
W.E.Drosophila2  ELENVRNIVKTIDSVQLAYFLSTSISDHREKLVNILDQHLLSDALVHVVPDLQIEIIETL
W.E.Drosophila1  ELENVRNIVKTIDSVQLAYFLSTSISDHREKLVNILDQHLLSDALVHVVPDLQIEIIETL
W.E.Muscidifura  ------------------------------------------------------------
E.Ruminatum_In   NYEVIQEIINESDNVQLAYFLLTSTYQHRKELLNNINDNLIKDILIHLVPDLRQEIIKIL
E.canis.Jake_In  NYNVIEEIINKSDSVQLAYFLLTSTYQHRKEFLNNINDNLVKDILIHLVPDLRQEIIKIL
E.chaffensis_In  NYLVVEEIINKSDNVQLAYFLLTSTYQHRKEFFNSINDNLIKDILIHLVPDLRQEIIKIL
Anaplasma_In     RAGDIREILDNVDGVQLASFLLTSTINQRKGLLKYVGDELVSDTLVHLVPGLRQEAVSTL
A.marginale_In   RSSDIKEVIDRVDGVQLAYFLLTLTPNHRRELLGYVRDGLIPEILLHLVPGLRKEVIKAL
                                                                             


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
SUP05.cluster_O  DVSSIVKATEGLDTDDLADIVPNLPESALHNLLLTLDHKHRDHLKKIL-SYPEDSAGGLM
Candidatus_Out   DVVDIVKTIEVLDMDD-------LPESKIHNLLLILDYKHKDHLKQIL-SYPEDSAAGLM
Thiomicro_Out    DQHEIIQLTEALETDDIADIIQSLPDEEKSSLLAKLPEQSRRAVQTAL-SYPEDTAGGLM
Marine.gamma_Ou  DTEEVASITEGLEADDIADILQQLPDRVIREVLELMDLQDRQRVEHVL-SYPEDTAGGLM
Alteromonas_Out  LPANVVDALEEMDTDDLAETLSSLPEPVLADILDSMDAQDRVRAEQAL-SYGEETAGFIM
A.protobacteriu  PSDNVAEIVNQLESDDALQIVSNLDEEKKIDVYEKIPLQDKKLLEEVLKAYPEDSAARIM
GOS_1437010_Tra  -----------------IMVLENVDEKDKNTILSALPPKDRFALLEGL-SYPEDSAARIM
C.Pelagibacter2  SSDSIVSILTNLESDDAISILENVPEDDKNNILSSLPPKDRFALLESL-SYPEDTAARIM
CPelagibacter1   SPDTIVRLLKNLESDDAITILENVDEKDKNTILSSLPPKDRFALLESL-SYPEDTAARIM
N.risticii_In    GVRGFAQIITSLPVDEIVDVLEEIEQDFVKEIVKFFPSKLGKVIKEIL-AYPEESAGRLI
N.sennetsu_In    GVRGFAQIITSLPVDEIVDVLEEIEQDFVKEIVKFFPSKLAKVIKEIL-AYPEESAGRLI
W.E.Brugia_In    GIENAAKLLTLLDVEDIVAIVKDLDRKSIENILKYLPNETQKSVEELL-SYPEESAGRLI
W.E.Culex_In     GIENTAKLLMLLDIEDIVAIVKDLDRKSIENILNYLPNATQKLVEELL-SYPEESAGRLI
W.E.Drosophila2  GIENTAKLLMLLDVEDIVTIVKDLDRKSVENILYYLPSKTQKSVEELL-SYPEESAGRLI
W.E.Drosophila1  GIENTAKLLMLLDVEDIVTIVKDLDRKSVENILYYLPSKTQKSVEELL-SYPEESAGRLI
W.E.Muscidifura  -----------------------------------------------L-SYPEESAGRLI
E.Ruminatum_In   GIEKVASLISQLNTEDIVVIIEDLDKESQLSIINVLSKRNKIFVNELL-SYPEESAGRLM
E.canis.Jake_In  GIKKVASLISQLNTEDIVAVIEDLDKESQVNILNILPKSNKIHVHELL-SYPEESAGRLM
E.chaffensis_In  GIKKVASLISQLSTEDIVVIIEDLDKESQINILNILPKSNKIHVNELL-SYPEESAGRLM
Anaplasma_In     GVSKVAALIATLDSEDIVVVVEDLSKEYQEDILRLLPEEKRLLISELL-SYPEKSAGRLM
A.marginale_In   GTEKTAFLVSGLDSGDIVEIIEDLDEEYQNAIIDLLPEAQGTLIRELL-SYPEKSAGRLI
                                                                  ###########


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
SUP05.cluster_O  NIDIITVRSDVNVRTVIRYLRLLKKMPIDTDQVFVVDRAYKYLGAIHVSTLLTNEAEQNI
Candidatus_Out   NIDIITVRGNVTVGTVIRYLRLLKEMPIDTDQVFVVNKSYQYLGSIYISTLLTNEAEQNI
Thiomicro_Out    STDFIAVRSDVTLEVVIRLLRKIGSLPKDMVDLIVRDRDGKYQGTLKLNDLLVHDEETLV
Marine.gamma_Ou  NTDAITVRPKTLIEVVLRYLRRHDELPEMMDNLIVVNRRDEYIGLLPLRRVLVSDPGTTV
Alteromonas_Out  NTDTITLRPDVTIDVVLRYIRLKGELPENTDTFYVVNRTDNLVGIVPVTRLLTADTDDKV
A.protobacteriu  QTEYCSVSPEWTVGETIDYLRETDDLPKEFLQIFIVDDKKRPLGSVPSSRVLRNPRSTKM
GOS_1437010_Tra  QREFTAIPSNWSVGQTIDYLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKM
C.Pelagibacter2  QREFTAIPSNWSVGQTIDYLRENKDLPEEFLEIFIINEEFKPIGTVPSSRVLTTSRDTKM
CPelagibacter1   QREFTAVPSNWSVGQTIDYLRENKDLPEEFLEIFIIDEDFKPIGTVPSSKVLTTSRETKM
N.risticii_In    HKDFIVIPKDWSIEQVLQFIRVQKQLPKYISEIFVVDEENRPIGSVSLNDILCAKSRSLV
N.sennetsu_In    HKDFIVIPKDWSIEQVLQFIRVQKQLPKYISEIFVVDEENRPIGSVSLNDILCAKSRSLV
W.E.Brugia_In    HKDMVIAPYYWTINQLTEFLRSYKKIPEKFHQIFIIDSKLEPIGSVNLNKVISHSGETII
W.E.Culex_In     HKNMVIAPYYWTINQLMEFLRNYKKIPETFYQIFIINSKLEPIGIFNLNKVISHSGETII
W.E.Drosophila2  HKDMVIAPYYWTINQLTEFVCNYKKIPEKFHQIFIINSKLEPIGSVNLNKVISHSGDTII
W.E.Drosophila1  HKDMVIAPYYWTINQLTEFVCNYKKIPEKFHQIFIINSKLEPIGSVNLNKVISHSGDTII
W.E.Muscidifura  HKDMVIAPYYWTINQLTEFVCNYKKIPEKFHQIFIINSKLEPIGSVNLNKVISHSGDTII
E.Ruminatum_In   HKDVIIAPEYWTINQLLYFLTQNNKINKEFYEIFIVDPKLNPIGYLRLDNIICANKSQVI
E.canis.Jake_In  HKDIIIAPEYWTISQLLTFLKQNNKLSKEFYEIFIVDPKLNPIGYLRLDNIICSNSTQII
E.chaffensis_In  HKDIIIAPEYWTINQLLNFLKQNNKLNKEFYEIFIVDPKLNPIGYLRLDNIICSNSTQII
Anaplasma_In     HKDITVVPAHWSIQQLTTYLCDNAKQNRKLHEIFVVNPKLQPIGILSLDDVITSNKSCLV
A.marginale_In   YKDITVVPEYWNVEQLVDFLCNHARPNKKFHEIFVINPQLQPVGILALDDIIRASRNSMV
                 ############################################################


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
SUP05.cluster_O  DPLINKTLRPISADMPERKVAHLFEQRNLISAPVIDENNQLIGRITIDDVVDVIRDEAEH
Candidatus_Out   DLLINKKSKPILATTIDNEVASLFEQRNLISAPVVDESNQLIGRITIDDVVDIIRDEAEH
Thiomicro_Out    ADLVDPKRFAIKALVPDKEVATIFEKNDLISIAVVDENNFVLGRITIDDVVDIIREEAER
Marine.gamma_Ou  REIMNTDIDAIPANMDDREVANLFERNDWVSAPVVDSDGKMIGRITIDDVVDVIREDADH
Alteromonas_Out  SDVMDEESEAIPVNMPDDEVASLFERYNWLSAPVVDENHRLVGRITIDDVVDIIREDAEH
A.protobacteriu  RDIMDETQMLIYGDWDKEQVGYLFEQYNLISAGVVDKNNKLIGMITADDILTVLKEEAEE
GOS_1437010_Tra  SSIMVDTLFLVPVDMDREEVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEE
C.Pelagibacter2  LSIMSESQLLIPVDMDKEEVANLFENYNLNSAAVIDKNNKLVGMIMSDDVLTVLQEEAEE
CPelagibacter1   LSIMSESQLLIPVDMDKEEVGNVFENYSLNSAAVVDKSNKLVGMIMYDDVLTVLKEEAEE
N.risticii_In    RTLMQTNITTVETGQDQEEVARLFRDYSLRSIAVVDRSKSIVGVISIDDVVDVISEEAEE
N.sennetsu_In    KILMQTNIKTVETGQDQEEVARLFRDYSLHSIAVVDKNQRIVGVISIDDVVDVISEEAEE
W.E.Brugia_In    KEIMSQDIKIIKTGVDQEEVARVFKDYSLLSAPVVNKRGKIIGVILIEDVIKVVQQETEE
W.E.Culex_In     KEIMSQDIKIIKTGMDQEEVARIFKDYSLLSAPVVNKNGKIIGVILIEDVIKIVQQEAEE
W.E.Drosophila2  KEIMDHDIKIIKTGIDQEEVARIFKDYSLLSAPVVNKNGKIIGVILIEDVIKVVQQETEE
W.E.Drosophila1  KEIMDHDIKIIKTGIDQEEVARIFKDYSLLSAPVVNKNGKIIGVILIEDVIKVVQQETEE
W.E.Muscidifura  KEIMDHDIKIIKTGIDQEEVARIFKDYSLLSAPVVNKNGKIIGVILIEDVIKVVQQETEE
E.Ruminatum_In   KDLMKTDIKIITSHTTQEEVAEIFRKYSLLSAPVINKEGRIIGSIIVHDILNVIHQEAEK
E.canis.Jake_In  KNLMKTDIKIIKSHTTQEEVAEIFRKYSLLSAPVINKDGRIIGSIVVHDILNVMHQEAEK
E.chaffensis_In  KNLMKTDIKIIKSHTTQEEVAEIFRKYSLLSAPVINRDGRIIGSIIVHDILNVMHQEAEK
Anaplasma_In     QQLMDEDIKVIRPSAKQEEVSEMFRQYSLLSAPVVDKEGRIMGSILVYDIINVVHEEAEE
A.marginale_In   RQLMNTDIKIIRPGAKQEEVSEIFRQYSLLSAPVVNKDGRIIGSILVYDIINVVHQEAEE
                 ############################################################


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
SUP05.cluster_O  SVMSMAGLDEEEDVFAPVVQSTKRRSIWLGVNLVTVFIAVFFIGLFEATLQEKIALAILM
Candidatus_Out   SVMSMAGLNEEEDVFSPVIQSAKRRSIWLGINLITVFIAVFFIGLFEATLQGKITLAILM
Thiomicro_Out    AQMASAGLDDEEDLFAPPLRSAKRRSFWLGINLLTAIFASIVIGFFEATIEQVVALAVLM
Marine.gamma_Ou  SLMSLAGLGEDEDTFGSVLKTAPRRAVWLGINLLTAFMASAVINVFEATLDKVVALAILM
Alteromonas_Out  SMMSMAGLDDDEDTFAPVMQSTKRRSVWLAVNLVTALMAAMVSDLFEATLSQLAVLAILN
A.protobacteriu  DALKLAGV-QDEAITDNAVKITKKRFVWLLINLFTAVIASYVIGLFDGNIQKVVALAVLM
GOS_1437010_Tra  DALRLAGV-GDEEITDGVITKTKRRFNWLLLNLFTAFLATWCISLFGATIEQMVVLAFLM
C.Pelagibacter2  DALRLAGV-GDEEITDGVITKTKRRFNWLLLNLFTAFLATWCISLFGATIEQMVVLAFLM
CPelagibacter1   DALRLAGV-GDEEITDGVFKKTRRRFNWLLLNLFTAFLATWVISLFGATIEQMVVLAFLM
N.risticii_In    DILHA-GKVSESDINSDVANTVMRRIKWLIVTFLSINFSSYIIGFFQLTLQQHVELAILM
N.sennetsu_In    DILHA-GKVSESDINSDVANTVMRRIKWLIVTFLSINFSSYIIGFFQLTLQQHVELAILM
W.E.Brugia_In    DVLKISGVSSKADINAPIHKTIIQRLPWLLFNLLAATICSVVVGFFDDIIKSFVVLPIVM
W.E.Culex_In     DVLKISGVSSKSDINAPIHKTIIKRLPWLLFNLLAATICSIVVGFFDNVIQSFIVLPIIM
W.E.Drosophila2  DVLKISGVSSKADINAPIHKTIIKRLPWLLFNLLAATMCSIVVGFFDDVIKSFIVLPIIM
W.E.Drosophila1  DVLKISGVSSKADINAPIHKTIIKRLPWLLFNLLAATMCSIVVGFFDDVIKSFIVLPIIM
W.E.Muscidifura  DVLKISGVSSKADINAPIHKTIIKRLPWLLFNLLAATMCSIVVGFFDDVIKSFIVLPIIM
E.Ruminatum_In   DVLHL-GMVSNNDISSSLLKTVIKRLPWLIVNLLTATVSSMIIGIFSNTLQHFIALSIIM
E.canis.Jake_In  DVLHL-GMVSNNDISSSLIKTVIKRLPWLFINLLTATVSSMIIGIFSNTIQHFIALSVIM
E.chaffensis_In  DVLHL-GMVSNNDMSSSLSKTVIKRLPWLIINLLTSTISSMIIGIFSNTLQHFIALSVIM
Anaplasma_In     DALHL-GMVSDSDISAPLMKTVFRRMPWLLVNLLTSTASSLVIGWFSDTIKSFVALSVIM
A.marginale_In   DVLRM-GMVSDGDVTSSTISTVVKRLPWLLVNLLTSSASSIVIGWFSETIRSFIALSIIM
                 ###      ###################################################


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
SUP05.cluster_O  PVVASMGGIAGTQTLILVTRGIATGRVTTSNLKVLMNKEVAIGFLNGIVWSLVIALATYV
Candidatus_Out   PVVASMGGIAGTQTLILVTRGIATGRVTEANLKVLMNKEVVIGVLNGIFWSLIISVVTYI
Thiomicro_Out    PIIASMGGIAGTQTATIVIRAIATGKLGAKNSHKLILKETAVGSFNGLLWAILTSVVTWF
Marine.gamma_Ou  PIVASMGGVAGTQTLTVVIRGIALGQVGSNNSTWLINKELLVGVINGLCWSLVVAVAAAL
Alteromonas_Out  TIVPSMGGVAGNQTLTLVIRGMALGHVNASNSRWLISKEISIGFLNGAIWAVLIASVIAL
A.protobacteriu  PIVASMGGNAATQTLTVTVRLIATKELTAENLFKIIGKEFSVGFLNGILFSLISGLFVYF
GOS_1437010_Tra  PIVASMGGNAGMQTLAVTVRSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQL
C.Pelagibacter2  PIVASMGGNAGMQTLAVTVRTIATNDLTENNFSSNVLKEFTIGILNGIIFAAISAFIVQI
CPelagibacter1   PIVASMGGNAGMQTLAVTVRTLATNDLTKNNFTQNILKEFNIGILNGIIFAIISALVVQV
N.risticii_In    PIIAAMGGNAGIQASTVAVRALITKRFCQGNALRLFVKELIVGLCNGLVMSALMVVIIAL
N.sennetsu_In    PIIAAMGGNAGIQASTVAVRALITKRFCQGNALRLFVKELIVGLCNGLVMSALMIVIIAL
W.E.Brugia_In    PIITSMSGNAGSQTVTLTIRAIATKYLTEQNANRILIKEFFIGLINGIILSTISLMVLAI
W.E.Culex_In     PIIASMSGNAGSQTVTLTIRAIATKYLTEQNAKRILMKEFLIGLINGVILSTISLVVLAI
W.E.Drosophila2  PIIASMSGNAGSQTVTLTIRAIATKYLTEQNAKRILMKEFLIGLINGVILSTISLVVLAI
W.E.Drosophila1  PIIASMSGNAGSQTVTLTIRAIATKYLTEQNAKRILMKEFLIGLINGVILSTISLVVLAI
W.E.Muscidifura  PIIASMSGNAGSQTVTLTIRAIATKYLTEQNAKRILMKEFLIGLINGVILSTISLVVLAI
E.Ruminatum_In   PTIASMSGNAGLQSLAVTIRALSTKQLTHRNAYRLLFKELCVGSINGLILAIIASIVLIL
E.canis.Jake_In  PIIASMSGNAGLQALTVTIRALSTKQLTNRNANRLLFKELSVGFINGLILAIISSIALML
E.chaffensis_In  PIIASMSGNAGLQALTVTIRALSTKQLTNRNAHRLLFKELFVGFINGLILAIVSSIALML
Anaplasma_In     PMIASMSGNSGLQALAVTVRALATKQLTYRNSKRLLLKELCVGLVNGIIIAAIASVAVVI
A.marginale_In   PMIASMSGNSGLQALTVTIRALATKQLTYRNSRRLLFKELCVGFVNGAILAAIASIAIII
                 ############################################################


                        430       440       450       460       470       480
                 =========+=========+=========+=========+=========+=========+
SUP05.cluster_O  WFEDIMLSAVIALAIVVNLIFAAFSGAFLPSLLIKFKIDPALAGGVILTTITDVIGFVAF
Candidatus_Out   WFTDLMLSLVIALAIIVNLIFAAFSGAFLPLLLIKFKIDPALAGGVILTTITDVIGFLAF
Thiomicro_Out    WFQDGALGIIFGAAMLINLVAAAFAGALIPLFLNKIKVDPALASGLMLTTVTDSLGFFVF
Marine.gamma_Ou  WFDDLLIGAIIAGATVINLITAALAGATIPILLDKLNIDPALAGGVALTTITDIVGFMSF
Alteromonas_Out  WKQDYMLGVIIAFAMMVNMIAAALAGATLPMIMKRLKIDPALAGSVILTTITDVVGIFAF
A.protobacteriu  WFYEIKLSILIAVSMVINMACAGLSGIAIPVILDKSKIDPAIASTVFVTTVTDVVGFVSF
GOS_1437010_Tra  WFQDNQLSLIISISMILTMIIARLFGILI-------------------------------
C.Pelagibacter2  WFQDNTLSIIISISMILTMIIAGLFGILIPVTLKKMNIDPAIASSVFVTTITDVIGFVSF
CPelagibacter1   WFQDSLLSLIISMSMIVTMIVAGLFGILVPITLKKMDIDPAIASSVFVTTITDVIGFVSF
N.risticii_In    RFHNLALESTFLISITLVFALATSFGAAIPFIIEKFGGDPALSSSIITSSFTDILAFVVL
N.sennetsu_In    RFHNLALESTFLISITLVFALATSFGAAIPFIIEKFGGDPALSSSIITSSFTDILAFVVL
W.E.Brugia_In    RFHSFKVEIIFVASMVMMSIIATFIGTFIPIMLHRLKSDPAVSSSILTSATTDILSAFIF
W.E.Culex_In     RFHSLKVEIIFVVSMIAMSIIATFIGTFIPIMLHRLRSDPAVSSSILTSATTDILSALIF
W.E.Drosophila2  RFHNFKVEMIFVVSMIMMSIIATFIGTFIPIMLHRLKSDPAVSSSILTSATTDILSAFIF
W.E.Drosophila1  RFHNFKVEMIFVVSMIMMSIIATFIGTFIPIMLHRLKSDPAVSSSILTSATTDILSAFIF
W.E.Muscidifura  RFHNFKVEMIFVVSMIMMSIIATFIGTFIPIMLHRLKSDPAVSSAILTSATTDILSAFIF
E.Ruminatum_In   RGQDTEIQILAGTSMIITFSIATFLGTAIPMLLNFFKVDPAISSSIIICATSDTLSFLIF
E.canis.Jake_In  RGQHVDIQILSGMSMIITFSIATFLGTAIPMILNLFKVDPAISSSIIICATSDTLSFLIF
E.chaffensis_In  RGQHVDIQVLAGTSMIITFSIATFLGAAIPMILNLFKIDPAISSSIIICATSDTLSFLIF
Anaplasma_In     RFRDVSIEVLFAISMIITFSIATLSGAAVPMLLNFFRADPAISSSIIVCAASDIMSFLFF
A.marginale_In   RFHNTSIEVLFVASMIITFSIATFSGAAVPMLLHFFGADPAVSSSIIVCAASDIIAFLIF
                 ##########################                                  


                        490
                 =========+==
SUP05.cluster_O  LGLASL-VI---
Candidatus_Out   LSLATL-IV---
Thiomicro_Out    LGLATIVFTI--
Marine.gamma_Ou  LGLATW-FYI--
Alteromonas_Out  LGTATL-FLI--
A.protobacteriu  LGLAGI-ILGI-
GOS_1437010_Tra  ------------
C.Pelagibacter2  LGVGAY-FL---
CPelagibacter1   LGVSAY-FL---
N.risticii_In    LSIASI-ILV--
N.sennetsu_In    LSTASI-ILV--
W.E.Brugia_In    LGLATL-FLLNS
W.E.Culex_In     FGLATI-FLLNS
W.E.Drosophila2  LGLATI-FLLNS
W.E.Drosophila1  LGLATI-FLLNS
W.E.Muscidifura  LGLATI-FLLNS
E.Ruminatum_In   LGMATI-FLL--
E.canis.Jake_In  LGMATI-FLL--
E.chaffensis_In  LGMATI-FLL--
Anaplasma_In     LGLATL-FLM--
A.marginale_In   LGLATF-S----
                             






Parameters used
Minimum Number Of Sequences For A Conserved Position: 11
Minimum Number Of Sequences For A Flanking Position: 18
Maximum Number Of Contiguous Nonconserved Positions: 8
Minimum Length Of A Block: 10
Allowed Gap Positions: None
Use Similarity Matrices: Yes


Flank positions of the 2 selected block(s)
Flanks: [170  303]  [310  446]  

New number of positions in input.fasta-gb:  271  (55% of the original 492 positions)



                                                                 

Protein Domains

PROTOCOL


a) InterProScan default options at EBI


RESULTS ANALYSIS


The first domains which is important for our analisys, bacause may be the same domains that our protein has (coded by our ORF) ) is the Cystathionine beta-synthase (CBS Family),which has two zones, one has an E-value 6.7e-5 and extends from bases 38 to 95, the second one has an E-Value of 2.1e-7, extending from bases 104 to 157. This modules are relatively significant (lower than 1.0e-2) and they do not do not overlap each other, are found in proteins of bacteria archaea and eukaryontes. Binds the adenosine domains, regulates the activity of some attached domains, act in sensors of cellular energy and is implicated in intracellular targeting and trafficking. CBS can bind adenosines wich means that may have a function related with sensors of intracellular metabolites. In humans CBS domains causes a variety of heriditary diseases, like: homocystinuria, Wolff-Parkinson-White syndrome, retinitis pigmentosa, congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome.(1)


(1) Interpro - IPR000644


The other significant domain (in interproscan is only presented as a region) has got an E value of 2.1e-8, suggesting that it is the most likely domain coded by our ORF, is the MgtE magnesium transporter , integral membrane region (MgtE family) and is a cation transport and have a cation transmembrane transporter activity. This is a region of eubacterial MgtE family of magnesium transporters and are also found in archaebacterial and eukaryotic proteins and probably transport Mg2+ and may be involved in cation binding.(2)


(2) - IPR006667

RAW RESULTS

a) InterProScan

Sequence_1	99F1373A8789A273	310	superfamily	SSF54631	CBS-domain	96	166	5.8e-12	T	21-Apr-2010	NULL	NULL	
Sequence_1	99F1373A8789A273	310	superfamily	SSF54631	CBS-domain	32	95	0.0033	T	21-Apr-2010	NULL	NULL	
Sequence_1	99F1373A8789A273	310	ProfileScan	PS51371	CBS	106	162	11.557	T	21-Apr-2010	IPR000644	Cystathionine beta-synthase, core	
Sequence_1	99F1373A8789A273	310	ProfileScan	PS51371	CBS	42	104	7.118	T	21-Apr-2010	IPR000644	Cystathionine beta-synthase, core	
Sequence_1	99F1373A8789A273	310	HMMSmart	SM00116	CBS	109	157	6.1e-05	T	21-Apr-2010	IPR000644	Cystathionine beta-synthase, core	
Sequence_1	99F1373A8789A273	310	TMHMM	tmhmm	transmembrane_r	189	209	NA	?	21-Apr-2010	NULL	NULL
Sequence_1	99F1373A8789A273	310	TMHMM	tmhmm	transmembrane_r 215	233	NA	?	21-Apr-2010	NULL	NULL
Sequence_1	99F1373A8789A273	310	TMHMM	tmhmm	transmembrane_r	263	283	NA	?	21-Apr-2010	NULL	NULL
Sequence_1	99F1373A8789A273	310	TMHMM	tmhmm	transmembrane_r	289	309	NA	?	21-Apr-2010	NULL	NULL
Sequence_1	99F1373A8789A273	310	HMMPfam	PF00571	CBS	38	95	6.7e-05	T	21-Apr-2010	IPR000644	Cystathionine beta-synthase, core	
Sequence_1	99F1373A8789A273	310	HMMPfam	PF00571	CBS	104	157	2.1e-07	T	21-Apr-2010	IPR000644	Cystathionine beta-synthase, core	
Sequence_1	99F1373A8789A273	310	HMMPfam	PF01769	MgtE	221	309	2.1e-08	T	21-Apr-2010	IPR006667	MgtE magnesium transporter, integral membrane region	Biological Process: cation transport (GO:0006812), Molecular Function: cation transmembrane transporter activity (GO:0008324)



Phylogeny

PROTOCOL


a) Phylogeny.fr / A la Cart method / default step by step /PhyML method / bootstrap 100

b) Phylogeny.fr / A la Cart method / default step by step / BioNJ method / bootstrap 100


RESULTS ANALYSIS


Both trees are coherent and similar, the outgroups are seperated from the branches of the ingroups where the ORF is contained.

Our tree has significant bootstrap values, sugesting that the likelyhood of organisms splitting in the nods are high, particular attention where they split the outgroup and ingroups from each other.

However, the bootstrap value directly behind our sample has a bootstrap value of 0,46, lower than one where we could safely assume the class taxon.

RAW RESULTS

a) PhyML
Every omitted nodes have bootstrap values superior than 0.8
                                                                                                            -----0.1---
 
                                                                               +--------SUP05.cluster                        [g-proteobacteria]
                                                 +-----------------------------+
                                                 |                             +------------Candidatus                       [g-proteobacteria]
             +-----------------------------------+
             |                                   |        +------------------------------------------------Thiomicro         [g-proteobacteria]
             |                                   |  0.58  |
             |                                   +--------+          +---------------------------------Marine.gamma          [g-proteobacteria]
             |                                            |          |
 +-----------+                                            +----------+
 |           |                                                       +----------------------------------Alteromonas          [g-proteobacteria]
 |           |
 |           |                        +----------------------------A.protobacterium                                          [a-proteobacteria]
 |           |                        |
 |           +------------------------+                         +------GOS_1437010                                           [a-proteobacteria]
 |                                    |                         |
 |                                    +-------------------------+0,46+------C.Pelagibacter2                                  [a-proteobacteria]
 |                                                              +----+
 |                                                                   +------CPelagibacter1                                   [a-proteobacteria]
 |
 |                                                                                   +----N.risticii                         [a-proteobacteria]
 |                          +--------------------------------------------------------+
 |                          |                                                        +N.sennetsu                             [a-proteobacteria]
 |                          |
 |                          |
 |                          |                                                      +--------E.Ruminatum                      [a-proteobacteria]
 |                          |                                   +------------------+
 +--------------------------+                                   |                  |0,67+---E.canis.Jake                     [a-proteobacteria]
                            |                                   |                  +---+
                            |                +------------------+                      +---E.chaffensis                      [a-proteobacteria]
                            |                |                  |
                            |                |                  |               +--------------------Anaplasma               [a-proteobacteria]
                            |                |                  +---------------+
                            +----------------+                                  +------------A.marginale                     [a-proteobacteria]
                                             |
                                             |                            +--W.E.Culex                                       [a-proteobacteria]
                                             |                            |
                                             +----------------------------+
                                                                          | +-------W.E.Brugia                               [a-proteobacteria]
                                                                          +-+
                                                                            |  +W.E.Muscidifurax                             [a-proteobacteria]
                                                                            +--+0.39
                                                                               |W.E.Drosophila2                              [a-proteobacteria]
                                                                               |
                                                                               +W.E.Drosophila1                              [a-proteobacteria]

b) BioNJ

                                                                                                     ------0.1-----
 
                                            +-------------------------------------------------Thiomicro                     [g-proteobacteria]
                                            |
                                            |                                        +-------------SUP05.cluster            [g-proteobacteria]
      +-------------------------------------+    +-----------------------------------+
      |                                     |    |                                   +-------------Candidatus               [g-proteobacteria]
      |                                     +----+
      |                                          |       +----------------------------------Marine.gamma                    [g-proteobacteria]
      |                                          |       |
 +----+                                          +-------+
 |    |                                                  +-----------------------------------------------Alteromonas        [g-proteobacteria]
 |    |
 |    |                       +-----------------------------------------A.protobacterium                                    [a-proteobacteria]
 |    |                       |
 |    +-----------------------+                      +------------GOS_1437010                                               
 |                            |                      |
 |                            +----------------------+--------C.Pelagibacter2                                               [a-proteobacteria]
 |                                                   |
 |                                                   +--------CPelagibacter1                                                [a-proteobacteria]
 |
 |                                                                             +W.E.Muscidifurax                            [a-proteobacteria]
 |                                                                             |
 |                                                                         +---+W.E.Drosophila2                             [a-proteobacteria]
 |                                                                         |   |
 |                                                                        ++   |
 |                                                                        ||   +W.E.Drosophila1                             [a-proteobacteria]
 |                                                                        ||
 |                                    +-----------------------------------++---------W.E.Brugia                             [a-proteobacteria]
 |                                    |                                   |
 |                                    |                                   +-----W.E.Culex                                   [a-proteobacteria]
 |                                    |
 |                       +------------+                                  +----------E.Ruminatum                             [a-proteobacteria]
 |                       |            |                                  |
 |                       |            |             +--------------------+   +--E.canis.Jake                                [a-proteobacteria]
 |                       |            |             |                    +---+
 |                       |            |             |                        +-----E.chaffensis                             [a-proteobacteria]
 |                       |            +-------------+
 +-----------------------+                          |
                         |                          |           +---------------------Anaplasma                             [a-proteobacteria]
                         |                          +-----------+
                         |                                      +-----------------A.marginale                               [a-proteobacteria]
                         |
                         |                                                             +----N.risticii                      [a-proteobacteria]
                         +-------------------------------------------------------------+
                                                                                       +-N.sennetsu                         [a-proteobacteria]

Taxonomy report

PROTOCOL


Blastp / Lineage Reports.


RESULTS ANALYSIS


The first 3 highest hits that appear on the lineage report are the Candidatus Pelagibacter, which support that our ORF has the same function as of those of the Candidatus Pelagibacter, we can also conclude that the next set (Wolbachia and Ehrlichia) have similar functions to our ORF, although with a lower score.


The ingroup choices were based on the 20 highest scores on the lineage report whose class was a-proteobacteria, these ingroups are present on the blastx and blastp with low E values, proving to be relevant.


The outgroup choices were based on the 5 highest scores on the lineage report whose class was g-proteobacteria, these outgroups are present on the blastx and blastp with low E values, proving to be relevant.


Those scores and E values are significantly important so that we can compare to our sequence in terms of taxon relationship.



Ingroup: a-proteobacteria



ref|YP_266497.1| CPelagibacter1 Candidatus Pelagibacter ubique HTCC1062 2e-155(a-proteobacteria)

ref|ZP_05069612.1| C.Pelagibacter2 Candidatus Pelagibacter sp. HTCC7211 3e-147(a-proteobacteria)

ref|ZP_06054915.1| A.protobacterium alpha proteobacterium HIMB114 6e-96(a-proteobacteria)

ref|NP_966168.1| W.E.Drosophila2 Wolbachia endosymbiont of Drosophila simulans 1e-58(a-proteobacteria)

ref|YP_001976100.1| W.E.Culex Wolbachia endosymbiont of Culex quinquefasciatus Pel 1e-58(a-proteobacteria)

ref|YP_198125.1| W.E.Brugia Wolbachia endosymbiont strain TRS of Brugia malayi 1e-58(a-proteobacteria)

ref|YP_303093.1| E.canis.Jake Ehrlichia canis str. Jake 1e-57(a-proteobacteria)

ref|YP_180324.1| E.Ruminatum Ehrlichia ruminantium str. Welgevonden 2e-55(a-proteobacteria)

ref|YP_505094.1| Anaplasma Anaplasma phagocytophilum HZ 8e-55(a-proteobacteria)

ref|ZP_03787700.1| W.E.Muscidifurax Wolbachia endosymbiont of Muscidifurax uniraptor 1e-54(a-proteobacteria)

ref|YP_507383.1| E.chaffensis Ehrlichia chaffeensis str. Arkansas 2e-54(a-proteobacteria)

ref|YP_003081660.1| N.risticii Neorickettsia risticii str. Illinois 2e-53 (a-proteobacteria)

ref|YP_506350.1| N.sennetsu Neorickettsia sennetsu str. Miyayama 2e-53 (a-proteobacteria)

ref|YP_002563611.1| A.marginale Anaplasma marginale str. Florida 1e-50 (a-proteobacteria)



Outgroup: g-proteobacteria



gb|EEZ79613.1| SUP05.cluster uncultured SUP05 cluster bacterium 1e-51(g-proteobacteria)

ref|YP_001219265.1| Candidatus Candidatus Vesicomyosocius okutanii HA 3e-51(g-proteobacteria)

ref|ZP_01617564.1| Marine.gamma marine gamma proteobacterium HTCC2143 1e-50(g-proteobacteria)

ref|YP_391240.1| Thiomicro Thiomicrospira crunogena XCL-2 4e-50(g-proteobacteria)

ref|ZP_04715982.1| Alteromonas Alteromonas macleodii ATCC 27126 6e-50(g-proteobacteria)

RAW RESULTS

root
. cellular organisms
. . Bacteria                       [bacteria]
. . . Proteobacteria                 [proteobacteria]
. . . . Alphaproteobacteria            [a-proteobacteria]
. . . . . Rickettsiales                  [a-proteobacteria]
. . . . . . SAR11 cluster                  [a-proteobacteria]
. . . . . . . Candidatus Pelagibacter        [a-proteobacteria]
. . . . . . . . Candidatus Pelagibacter ubique [a-proteobacteria]
. . . . . . . . . Candidatus Pelagibacter ubique HTCC1062 ---------------------  552 2 hits [a-proteobacteria]    magnesium transport protein mgtE [Candidatus Pelagibacter u
. . . . . . . . . Candidatus Pelagibacter ubique HTCC1002 .....................  552 2 hits [a-proteobacteria]    magnesium transport protein mgtE [Candidatus Pelagibacter u
. . . . . . . . Candidatus Pelagibacter sp. HTCC7211 --------------------------  525 2 hits [a-proteobacteria]    magnesium transporter [Candidatus Pelagibacter sp. HTCC7211
. . . . . . . alpha proteobacterium HIMB114 -----------------------------------  354 2 hits [a-proteobacteria]    magnesium transporter [alpha proteobacterium HIMB114] >gi|2
. . . . . . Wolbachia endosymbiont of Drosophila melanogaster -----------------  230 2 hits [a-proteobacteria]    magnesium transporter [Wolbachia endosymbiont of Drosophila
. . . . . . Wolbachia endosymbiont of Drosophila simulans .....................  230 2 hits [a-proteobacteria]    magnesium transporter [Wolbachia endosymbiont of Drosophila
. . . . . . Wolbachia endosymbiont of Drosophila ananassae ....................  230 2 hits [a-proteobacteria]    magnesium transporter [Wolbachia endosymbiont of Drosophila
. . . . . . Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24 .  230 1 hit  [a-proteobacteria]    magnesium transporter [Wolbachia endosymbiont of Drosophila
. . . . . . Wolbachia sp. wRi .................................................  230 2 hits [a-proteobacteria]    magnesium transporter [Wolbachia endosymbiont of Drosophila
. . . . . . Wolbachia endosymbiont of Culex quinquefasciatus Pel ..............  229 2 hits [a-proteobacteria]    magnesium transporter [Wolbachia endosymbiont of Culex quin
. . . . . . Wolbachia endosymbiont of Culex quinquefasciatus JHB ..............  229 2 hits [a-proteobacteria]    magnesium transporter [Wolbachia endosymbiont of Culex quin
. . . . . . Wolbachia endosymbiont strain TRS of Brugia malayi ................  227 2 hits [a-proteobacteria]    Mg/Co/Ni transporter MgtE [Wolbachia endosymbiont strain TR
. . . . . . Ehrlichia canis str. Jake .........................................  227 2 hits [a-proteobacteria]    divalent cation transporter [Ehrlichia canis str. Jake] >gi
. . . . . . Ehrlichia ruminantium str. Welgevonden ............................  220 4 hits [a-proteobacteria]    magnesium transporter [Ehrlichia ruminantium str. Welgevond
. . . . . . Ehrlichia ruminantium str. Gardel .................................  220 2 hits [a-proteobacteria]    magnesium transporter [Ehrlichia ruminantium str. Welgevond
. . . . . . Anaplasma phagocytophilum HZ ......................................  218 2 hits [a-proteobacteria]    magnesium transporter [Anaplasma phagocytophilum HZ] >gi|88
. . . . . . Wolbachia endosymbiont of Muscidifurax uniraptor ..................  217 2 hits [a-proteobacteria]    magnesium transporter [Wolbachia endosymbiont of Muscidifur
. . . . . . Ehrlichia chaffeensis str. Arkansas ...............................  216 2 hits [a-proteobacteria]    magnesium transporter [Ehrlichia chaffeensis str. Arkansas]
. . . . . . Neorickettsia risticii str. Illinois ..............................  213 2 hits [a-proteobacteria]    magnesium transporter [Neorickettsia risticii str. Illinois
. . . . . . Neorickettsia sennetsu str. Miyayama ..............................  213 2 hits [a-proteobacteria]    magnesium transporter [Neorickettsia sennetsu str. Miyayama
. . . . . . Anaplasma marginale str. Florida ..................................  204 2 hits [a-proteobacteria]    magnesium transporter (mgtE) [Anaplasma marginale str. Flor
. . . . . . Anaplasma marginale str. St. Maries ...............................  204 2 hits [a-proteobacteria]    magnesium transporter [Anaplasma marginale str. St. Maries]
. . . . . . Anaplasma marginale str. Mississippi ..............................  204 1 hit  [a-proteobacteria]    magnesium transporter [Anaplasma marginale str. St. Maries]
. . . . . . Anaplasma marginale str. Puerto Rico ..............................  204 1 hit  [a-proteobacteria]    magnesium transporter [Anaplasma marginale str. St. Maries]
. . . . . . Anaplasma marginale str. Virginia .................................  204 1 hit  [a-proteobacteria]    magnesium transporter [Anaplasma marginale str. St. Maries]
. . . . . . Anaplasma centrale str. Israel ....................................  199 2 hits [a-proteobacteria]    magnesium transporter [Anaplasma centrale str. Israel] >gi|
. . . . . . Rickettsia canadensis str. McKiel .................................  190 2 hits [a-proteobacteria]    magnesium transporter [Rickettsia canadensis str. McKiel] >
. . . . . . Rickettsia prowazekii str. Madrid E ...............................  188 1 hit  [a-proteobacteria]    magnesium transporter (mgtE) [Rickettsia prowazekii str. Ma
. . . . . . Rickettsia prowazekii .............................................  188 1 hit  [a-proteobacteria]    magnesium transporter (mgtE) [Rickettsia prowazekii str. Ma
. . . . . . Rickettsia felis URRWXCal2 ........................................  187 2 hits [a-proteobacteria]    magnesium transporter [Rickettsia felis URRWXCal2] >gi|6700
. . . . . . Rickettsia typhi str. Wilmington ..................................  187 2 hits [a-proteobacteria]    magnesium transporter [Rickettsia typhi str. Wilmington] >g
. . . . . . Orientia tsutsugamushi str. Ikeda .................................  186 2 hits [a-proteobacteria]    magnesium transporter [Orientia tsutsugamushi str. Ikeda] >
. . . . . . Rickettsia rickettsii str. 'Sheila Smith' .........................  186 2 hits [a-proteobacteria]    magnesium transporter [Rickettsia rickettsii str. 'Sheila S
. . . . . . Rickettsia rickettsii str. Iowa ...................................  186 2 hits [a-proteobacteria]    magnesium transporter [Rickettsia rickettsii str. 'Sheila S
. . . . . . Rickettsia peacockii str. Rustic ..................................  186 2 hits [a-proteobacteria]    Mg2+ transporter [Rickettsia peacockii str. Rustic] >gi|238
. . . . . . Rickettsia massiliae MTU5 .........................................  185 2 hits [a-proteobacteria]    magnesium transporter [Rickettsia massiliae MTU5] >gi|15784
. . . . . . Rickettsia bellii RML369-C ........................................  185 2 hits [a-proteobacteria]    magnesium transporter [Rickettsia bellii RML369-C] >gi|1578
. . . . . . Rickettsia bellii OSU 85-389 ......................................  185 2 hits [a-proteobacteria]    magnesium transporter [Rickettsia bellii RML369-C] >gi|1578
. . . . . . Rickettsia conorii str. Malish 7 ..................................  184 2 hits [a-proteobacteria]    magnesium transporter [Rickettsia conorii str. Malish 7] >g
. . . . . . Rickettsia africae ESF-5 ..........................................  184 2 hits [a-proteobacteria]    magnesium transporter [Rickettsia conorii str. Malish 7] >g
. . . . . . Orientia tsutsugamushi str. Boryong ...............................  184 2 hits [a-proteobacteria]    magnesium transporter [Orientia tsutsugamushi str. Boryong]
. . . . . . Rickettsia sibirica 246 ...........................................  184 2 hits [a-proteobacteria]    magnesium transporter [Rickettsia sibirica 246] >gi|2826286
. . . . . . Rickettsia akari str. Hartford ....................................  183 2 hits [a-proteobacteria]    magnesium transporter [Rickettsia akari str. Hartford] >gi|
. . . . . Fulvimarina pelagi HTCC2506 -----------------------------------------  334 2 hits [a-proteobacteria]    probable magnesium transporter protein [Fulvimarina pelagi 
. . . . . Hoeflea phototrophica DFL-43 ........................................  329 2 hits [a-proteobacteria]    putative transmembrane cationic transporter [Hoeflea photot
. . . . . Aurantimonas manganoxydans SI85-9A1 .................................  323 2 hits [a-proteobacteria]    Mg/Co/Ni transporter [Aurantimonas manganoxydans SI85-9A1] 
. . . . . Chelativorans sp. BNC1 ..............................................  323 2 hits [a-proteobacteria]    magnesium transporter [Mesorhizobium sp. BNC1] >gi|11028442
. . . . . Mesorhizobium opportunistum WSM2075 .................................  323 2 hits [a-proteobacteria]    magnesium transporter [Mesorhizobium opportunistum WSM2075]
. . . . . Sinorhizobium medicae WSM419 ........................................  323 2 hits [a-proteobacteria]    magnesium transporter [Sinorhizobium medicae WSM419] >gi|15
. . . . . Mesorhizobium loti MAFF303099 .......................................  322 2 hits [a-proteobacteria]    magnesium transporter [Mesorhizobium loti MAFF303099] >gi|1
. . . . . Rhizobium sp. NGR234 ................................................  318 2 hits [a-proteobacteria]    putative transmembrane cationic transporter [Rhizobium sp. 
. . . . . Parvibaculum lavamentivorans DS-1 ...................................  315 2 hits [a-proteobacteria]    magnesium transporter [Parvibaculum lavamentivorans DS-1] >
. . . . . Rhizobium etli IE4771 ...............................................  315 1 hit  [a-proteobacteria]    magnesium transporter protein [Rhizobium etli IE4771]
. . . . . Rhizobium leguminosarum bv. viciae 3841 .............................  314 2 hits [a-proteobacteria]    putative transmembrane cationic transporter [Rhizobium legu
. . . . . Rhizobium etli CFN 42 ...............................................  313 2 hits [a-proteobacteria]    magnesium transporter protein [Rhizobium etli CFN 42] >gi|8
. . . . . Rhizobium leguminosarum bv. trifolii WSM2304 ........................  313 2 hits [a-proteobacteria]    magnesium transporter [Rhizobium leguminosarum bv. trifolii
. . . . . Rhizobium etli CIAT 652 .............................................  313 2 hits [a-proteobacteria]    probable magnesium transporter protein [Rhizobium etli CIAT
. . . . . Rhizobium leguminosarum bv. trifolii WSM1325 ........................  312 2 hits [a-proteobacteria]    magnesium transporter [Rhizobium leguminosarum bv. trifolii
. . . . . Agrobacterium radiobacter K84 .......................................  311 2 hits [a-proteobacteria]    magnesium transporter [Agrobacterium radiobacter K84] >gi|2
. . . . . Agrobacterium tumefaciens str. C58 ..................................  310 2 hits [a-proteobacteria]    magnesium transport protein [Agrobacterium tumefaciens str.
. . . . . Agrobacterium vitis S4 ..............................................  310 2 hits [a-proteobacteria]    magnesium transport protein [Agrobacterium vitis S4] >gi|22
. . . . . Labrenzia alexandrii DFL-11 .........................................  306 2 hits [a-proteobacteria]    magnesium transporter [Labrenzia alexandrii DFL-11] >gi|222
. . . . . Sinorhizobium meliloti 1021 .........................................  304 2 hits [a-proteobacteria]    putative transporter transmembrane protein [Sinorhizobium m
. . . . . Pseudovibrio sp. JE062 ..............................................  303 2 hits [a-proteobacteria]    magnesium transporter [Pseudovibrio sp. JE062] >gi|21196059
. . . . . Sphingomonas sp. SKA58 ..............................................  301 2 hits [a-proteobacteria]    magnesium transporter [Sphingomonas sp. SKA58] >gi|94421873
. . . . . Labrenzia aggregata IAM 12614 .......................................  300 2 hits [a-proteobacteria]    probable magnesium transporter protein [Stappia aggregata I
. . . . . Thalassiobium sp. R2A62 .............................................  297 2 hits [a-proteobacteria]    magnesium transporter [Thalassiobium sp. R2A62] >gi|2551061
. . . . . Rhodobacterales bacterium Y4I .......................................  296 2 hits [a-proteobacteria]    magnesium transporter [Rhodobacterales bacterium Y4I] >gi|2
. . . . . Roseobacter sp. MED193 ..............................................  296 2 hits [a-proteobacteria]    magnesium transporter [Roseobacter sp. MED193] >gi|85823287
. . . . . Ruegeria sp. R11 ....................................................  295 2 hits [a-proteobacteria]    magnesium transporter [Ruegeria sp. R11] >gi|214029902|gb|E
. . . . . Xanthobacter autotrophicus Py2 ......................................  295 4 hits [a-proteobacteria]    magnesium transporter [Xanthobacter autotrophicus Py2] >gi|
. . . . . Erythrobacter sp. SD-21 .............................................  295 2 hits [a-proteobacteria]    Mg/Co/Ni transporter [Erythrobacter sp. SD-21] >gi|14883007
. . . . . Silicibacter lacuscaerulensis ITI-1157 ..............................  294 2 hits [a-proteobacteria]    magnesium transporter [Silicibacter lacuscaerulensis ITI-11
. . . . . Roseobacter sp. SK209-2-6 ...........................................  293 2 hits [a-proteobacteria]    magnesium transporter [Roseobacter sp. SK209-2-6] >gi|12671
. . . . . Rhodobacterales bacterium HTCC2150 ..................................  293 2 hits [a-proteobacteria]    magnesium transporter [Rhodobacterales bacterium HTCC2150] 
. . . . . Sphingopyxis alaskensis RB2256 ......................................  292 2 hits [a-proteobacteria]    magnesium transporter [Sphingopyxis alaskensis RB2256] >gi|
. . . . . Phaeobacter gallaeciensis 2.10 ......................................  292 2 hits [a-proteobacteria]    magnesium transporter [Phaeobacter gallaeciensis 2.10] >gi|
. . . . . Phaeobacter gallaeciensis BS107 .....................................  292 2 hits [a-proteobacteria]    hypothetical protein RGBS107_18043 [Phaeobacter gallaeciens
. . . . . Oceanicaulis alexandrii HTCC2633 ....................................  290 2 hits [a-proteobacteria]    magnesium transporter [Oceanicaulis alexandrii HTCC2633] >g
. . . . . Citreicella sp. SE45 ................................................  289 2 hits [a-proteobacteria]    magnesium transporter [Citreicella sp. SE45] >gi|260420481|
. . . . . Ruegeria pomeroyi DSS-3 .............................................  287 2 hits [a-proteobacteria]    magnesium transporter [Ruegeria pomeroyi DSS-3] >gi|5667953
. . . . . Roseovarius sp. HTCC2601 ............................................  287 2 hits [a-proteobacteria]    magnesium transporter [Roseovarius sp. HTCC2601] >gi|114544
. . . . . Ruegeria sp. TM1040 .................................................  287 2 hits [a-proteobacteria]    magnesium transporter [Ruegeria sp. TM1040] >gi|99038025|gb
. . . . . Sphingomonas wittichii RW1 ..........................................  286 2 hits [a-proteobacteria]    magnesium transporter [Sphingomonas wittichii RW1] >gi|1485
. . . . . Octadecabacter antarcticus 307 ......................................  285 2 hits [a-proteobacteria]    magnesium transporter [Octadecabacter antarcticus 307] >gi|
. . . . . Parvularcula bermudensis HTCC2503 ...................................  285 2 hits [a-proteobacteria]    magnesium transporter [Parvularcula bermudensis HTCC2503] >
. . . . . Azorhizobium caulinodans ORS 571 ....................................  285 2 hits [a-proteobacteria]    divalent cation transporter [Azorhizobium caulinodans ORS 5
. . . . . Silicibacter sp. TrichCH4B ..........................................  285 2 hits [a-proteobacteria]    magnesium transporter [Silicibacter sp. TrichCH4B] >gi|2593
. . . . . Roseobacter sp. AzwK-3b .............................................  284 2 hits [a-proteobacteria]    hypothetical protein RAZWK3B_20441 [Roseobacter sp. AzwK-3b
. . . . . Octadecabacter antarcticus 238 ......................................  284 2 hits [a-proteobacteria]    magnesium transporter [Octadecabacter antarcticus 238] >gi|
. . . . . Rhodospirillum rubrum ATCC 11170 ....................................  283 2 hits [a-proteobacteria]    divalent cation transporter [Rhodospirillum rubrum ATCC 111
. . . . . Azospirillum sp. B510 ...............................................  283 2 hits [a-proteobacteria]    magnesium transporter [Azospirillum sp. B510] >gi|288909600
. . . . . Sulfitobacter sp. EE-36 .............................................  282 2 hits [a-proteobacteria]    magnesium transporter [Sulfitobacter sp. EE-36] >gi|8384463
. . . . . Sulfitobacter sp. NAS-14.1 ..........................................  281 2 hits [a-proteobacteria]    magnesium transporter [Sulfitobacter sp. NAS-14.1] >gi|8384
. . . . . Oceanibulbus indolifex HEL-45 .......................................  281 2 hits [a-proteobacteria]    putative magnesium transporter [Oceanibulbus indolifex HEL-
. . . . . Oceanicola granulosus HTCC2516 ......................................  281 2 hits [a-proteobacteria]    magnesium transporter [Oceanicola granulosus HTCC2516] >gi|
. . . . . Roseobacter litoralis Och 149 .......................................  281 2 hits [a-proteobacteria]    putative magnesium transporter [Roseobacter litoralis Och 1
. . . . . Rhodobacteraceae bacterium KLH11 ....................................  280 2 hits [a-proteobacteria]    magnesium transporter [Rhodobacteraceae bacterium KLH11] >g
. . . . . Jannaschia sp. CCS1 .................................................  280 2 hits [a-proteobacteria]    magnesium transporter [Jannaschia sp. CCS1] >gi|88864763|gb
. . . . . Sagittula stellata E-37 .............................................  280 2 hits [a-proteobacteria]    magnesium transporter [Sagittula stellata E-37] >gi|1267102
. . . . . Roseovarius nubinhibens ISM .........................................  280 2 hits [a-proteobacteria]    magnesium transporter [Roseovarius nubinhibens ISM] >gi|838
. . . . . Oceanicola batsensis HTCC2597 .......................................  279 2 hits [a-proteobacteria]    magnesium transporter [Oceanicola batsensis HTCC2597] >gi|8
. . . . . Rhodobacterales bacterium HTCC2654 ..................................  279 2 hits [a-proteobacteria]    magnesium transporter [Rhodobacterales bacterium HTCC2654] 
. . . . . Maricaulis maris MCS10 ..............................................  278 2 hits [a-proteobacteria]    magnesium transporter [Maricaulis maris MCS10] >gi|11434075
. . . . . Roseobacter sp. CCS2 ................................................  276 2 hits [a-proteobacteria]    magnesium transporter [Roseobacter sp. CCS2] >gi|126715662|
. . . . . Rhodospirillum centenum SW ..........................................  276 2 hits [a-proteobacteria]    magnesium transporter, putative [Rhodospirillum centenum SW
. . . . . alpha proteobacterium BAL199 ........................................  275 2 hits [a-proteobacteria]    Divalent cation transporter [alpha proteobacterium BAL199] 
. . . . . Erythrobacter sp. NAP1 ..............................................  275 2 hits [a-proteobacteria]    Mg/Co/Ni transporter [Erythrobacter sp. NAP1] >gi|85690666|
. . . . . Magnetospirillum gryphiswaldense MSR-1 ..............................  273 1 hit  [a-proteobacteria]    Divalent cation transporter [Magnetospirillum gryphiswalden
. . . . . Roseobacter sp. GAI101 ..............................................  273 2 hits [a-proteobacteria]    magnesium transporter [Roseobacter sp. GAI101] >gi|21404540
. . . . . Novosphingobium aromaticivorans DSM 12444 ...........................  273 2 hits [a-proteobacteria]    magnesium transporter [Novosphingobium aromaticivorans DSM 
. . . . . Rhodopseudomonas palustris BisA53 ...................................  273 2 hits [a-proteobacteria]    magnesium transporter [Rhodopseudomonas palustris BisA53] >
. . . . . Erythrobacter litoralis HTCC2594 ....................................  273 2 hits [a-proteobacteria]    Mg/Co/Ni transporter [Erythrobacter litoralis HTCC2594] >gi
. . . . . Roseovarius sp. 217 .................................................  271 2 hits [a-proteobacteria]    magnesium transporter [Roseovarius sp. 217] >gi|85668641|gb
. . . . . Rhodobacterales bacterium HTCC2083 ..................................  271 2 hits [a-proteobacteria]    magnesium transporter [Rhodobacterales bacterium HTCC2083] 
. . . . . Rhodopseudomonas palustris CGA009 ...................................  271 2 hits [a-proteobacteria]    magnesium transporter [Rhodopseudomonas palustris CGA009] >
. . . . . Rhodopseudomonas palustris TIE-1 ....................................  271 2 hits [a-proteobacteria]    magnesium transporter [Rhodopseudomonas palustris TIE-1] >g
. . . . . Zymomonas mobilis subsp. mobilis NCIMB 11163 ........................  271 2 hits [a-proteobacteria]    magnesium transporter [Zymomonas mobilis subsp. mobilis NCI
. . . . . Zymomonas mobilis subsp. mobilis ZM4 ................................  270 2 hits [a-proteobacteria]    magnesium transporter [Zymomonas mobilis subsp. mobilis ZM4
. . . . . Zymomonas mobilis subsp. mobilis ATCC 10988 .........................  270 2 hits [a-proteobacteria]    magnesium transporter [Zymomonas mobilis subsp. mobilis ZM4
. . . . . Bradyrhizobium sp. BTAi1 ............................................  270 2 hits [a-proteobacteria]    putative magnesium transporter MgtE-like (divalent cation t
. . . . . Rhodopseudomonas palustris DX-1 .....................................  270 2 hits [a-proteobacteria]    magnesium transporter [Rhodopseudomonas palustris DX-1] >gi
. . . . . Rhodobacterales bacterium HTCC2255 ..................................  270 3 hits [a-proteobacteria]    magnesium transporter [alpha proteobacterium HTCC2255] >gi|
. . . . . Bradyrhizobium sp. ORS278 ...........................................  270 2 hits [a-proteobacteria]    putative magnesium transporter MgtE-like (divalent cation t
. . . . . Brevundimonas sp. BAL3 ..............................................  270 2 hits [a-proteobacteria]    magnesium transporter [Brevundimonas sp. BAL3] >gi|19618650
. . . . . Rhodopseudomonas palustris BisB18 ...................................  269 2 hits [a-proteobacteria]    magnesium transporter [Rhodopseudomonas palustris BisB18] >
. . . . . Hyphomonas neptunium ATCC 15444 .....................................  269 2 hits [a-proteobacteria]    magnesium transporter [Hyphomonas neptunium ATCC 15444] >gi
. . . . . Rhodopseudomonas palustris BisB5 ....................................  269 2 hits [a-proteobacteria]    magnesium transporter [Rhodopseudomonas palustris BisB5] >g
. . . . . Roseovarius sp. TM1035 ..............................................  267 2 hits [a-proteobacteria]    magnesium transporter [Roseovarius sp. TM1035] >gi|14914282
. . . . . Caulobacter segnis ATCC 21756 .......................................  267 2 hits [a-proteobacteria]    magnesium transporter [Caulobacter segnis ATCC 21756] >gi|2
. . . . . Caulobacter crescentus CB15 .........................................  266 2 hits [a-proteobacteria]    magnesium transporter [Caulobacter crescentus CB15] >gi|221
. . . . . Caulobacter crescentus NA1000 .......................................  266 2 hits [a-proteobacteria]    magnesium transporter [Caulobacter crescentus CB15] >gi|221
. . . . . Rhodopseudomonas palustris HaA2 .....................................  265 2 hits [a-proteobacteria]    magnesium transporter [Rhodopseudomonas palustris HaA2] >gi
. . . . . Roseobacter denitrificans OCh 114 ...................................  264 2 hits [a-proteobacteria]    putative magnesium transporter [Roseobacter denitrificans O
. . . . . Rhodobacter sphaeroides 2.4.1 .......................................  263 2 hits [a-proteobacteria]    Mg/Co/Ni transporter, MgtE [Rhodobacter sphaeroides 2.4.1] 
. . . . . Rhodobacter sphaeroides ATCC 17029 ..................................  263 2 hits [a-proteobacteria]    magnesium transporter [Rhodobacter sphaeroides ATCC 17029] 
. . . . . Rhodobacter sphaeroides KD131 .......................................  263 2 hits [a-proteobacteria]    magnesium transporter [Rhodobacter sphaeroides ATCC 17029] 
. . . . . Dinoroseobacter shibae DFL 12 .......................................  263 2 hits [a-proteobacteria]    putative magnesium transporter [Dinoroseobacter shibae DFL 
. . . . . Loktanella vestfoldensis SKA53 ......................................  262 2 hits [a-proteobacteria]    magnesium transporter [Loktanella vestfoldensis SKA53] >gi|
. . . . . Brevundimonas subvibrioides ATCC 15264 ..............................  260 2 hits [a-proteobacteria]    magnesium transporter [Brevundimonas subvibrioides ATCC 152
. . . . . Rhodobacter sp. SW2 .................................................  260 2 hits [a-proteobacteria]    magnesium transporter [Rhodobacter sp. SW2] >gi|259023022|g
. . . . . Hirschia baltica ATCC 49814 .........................................  258 2 hits [a-proteobacteria]    magnesium transporter [Hirschia baltica ATCC 49814] >gi|254
. . . . . Asticcacaulis excentricus CB 48 .....................................  256 2 hits [a-proteobacteria]    magnesium transporter [Asticcacaulis excentricus CB 48] >gi
. . . . . Caulobacter sp. K31 .................................................  255 2 hits [a-proteobacteria]    magnesium transporter [Caulobacter sp. K31] >gi|167349551|g
. . . . . Methylocella silvestris BL2 .........................................  255 2 hits [a-proteobacteria]    magnesium transporter [Methylocella silvestris BL2] >gi|217
. . . . . Rhodobacter sphaeroides ATCC 17025 ..................................  246 2 hits [a-proteobacteria]    magnesium transporter [Rhodobacter sphaeroides ATCC 17025] 
. . . . . Beijerinckia indica subsp. indica ATCC 9039 .........................  242 2 hits [a-proteobacteria]    magnesium transporter [Beijerinckia indica subsp. indica AT
. . . . . Phenylobacterium zucineum HLK1 ......................................  241 2 hits [a-proteobacteria]    magnesium transporter [Phenylobacterium zucineum HLK1] >gi|
. . . . . Bradyrhizobium japonicum USDA 110 ...................................  239 2 hits [a-proteobacteria]    putative transporter transmembrane protein [Bradyrhizobium 
. . . . . Paracoccus denitrificans PD1222 .....................................  238 2 hits [a-proteobacteria]    magnesium transporter [Paracoccus denitrificans PD1222] >gi
. . . . . Ochrobactrum intermedium LMG 3301 ...................................  149 2 hits [a-proteobacteria]    magnesium transporter [Ochrobactrum intermedium LMG 3301] >
. . . . . Ochrobactrum anthropi ATCC 49188 ....................................  148 2 hits [a-proteobacteria]    magnesium transporter [Ochrobactrum anthropi ATCC 49188] >g
. . . . . Brucella suis bv. 4 str. 40 .........................................  145 2 hits [a-proteobacteria]    divalent cation transporter [Brucella suis bv. 4 str. 40] >
. . . . . Brucella suis 1330 ..................................................  145 2 hits [a-proteobacteria]    magnesium transporter [Brucella suis 1330] >gi|62317295|ref
. . . . . Brucella abortus bv. 1 str. 9-941 ...................................  145 2 hits [a-proteobacteria]    magnesium transporter [Brucella suis 1330] >gi|62317295|ref
. . . . . Brucella melitensis biovar Abortus 2308 .............................  145 2 hits [a-proteobacteria]    magnesium transporter [Brucella suis 1330] >gi|62317295|ref
. . . . . Brucella ovis ATCC 25840 ............................................  145 2 hits [a-proteobacteria]    magnesium transporter [Brucella suis 1330] >gi|62317295|ref
. . . . . Brucella canis ATCC 23365 ...........................................  145 2 hits [a-proteobacteria]    magnesium transporter [Brucella suis 1330] >gi|62317295|ref
. . . . . Brucella abortus S19 ................................................  145 2 hits [a-proteobacteria]    magnesium transporter [Brucella suis 1330] >gi|62317295|ref
. . . . . Brucella melitensis ATCC 23457 ......................................  145 2 hits [a-proteobacteria]    magnesium transporter [Brucella suis 1330] >gi|62317295|ref
. . . . . Brucella abortus str. 2308 A ........................................  145 2 hits [a-proteobacteria]    magnesium transporter [Brucella suis 1330] >gi|62317295|ref
. . . . . Brucella abortus bv. 6 str. 870 .....................................  145 3 hits [a-proteobacteria]    magnesium transporter [Brucella suis 1330] >gi|62317295|ref
. . . . . Brucella abortus bv. 3 str. Tulya ...................................  145 3 hits [a-proteobacteria]    magnesium transporter [Brucella suis 1330] >gi|62317295|ref
. . . . . Brucella abortus bv. 2 str. 86/8/59 .................................  145 3 hits [a-proteobacteria]    magnesium transporter [Brucella suis 1330] >gi|62317295|ref
. . . . . Brucella suis bv. 5 str. 513 ........................................  145 3 hits [a-proteobacteria]    magnesium transporter [Brucella suis 1330] >gi|62317295|ref
. . . . . Brucella suis bv. 3 str. 686 ........................................  145 3 hits [a-proteobacteria]    magnesium transporter [Brucella suis 1330] >gi|62317295|ref
. . . . . Brucella abortus bv. 4 str. 292 .....................................  145 3 hits [a-proteobacteria]    magnesium transporter [Brucella suis 1330] >gi|62317295|ref
. . . . . Brucella microti CCM 4915 ...........................................  145 2 hits [a-proteobacteria]    magnesium transporter [Brucella suis 1330] >gi|62317295|ref
. . . . . Brucella neotomae 5K33 ..............................................  145 3 hits [a-proteobacteria]    magnesium transporter [Brucella suis 1330] >gi|62317295|ref
. . . . . Brucella melitensis bv. 3 str. Ether ................................  145 3 hits [a-proteobacteria]    magnesium transporter [Brucella suis 1330] >gi|62317295|ref
. . . . . Brucella abortus bv. 9 str. C68 .....................................  145 3 hits [a-proteobacteria]    magnesium transporter [Brucella suis 1330] >gi|62317295|ref
. . . . . Brucella melitensis bv. 2 str. 63/9 .................................  145 2 hits [a-proteobacteria]    magnesium transporter [Brucella suis 1330] >gi|62317295|ref
. . . . . Brucella abortus NCTC 8038 ..........................................  145 2 hits [a-proteobacteria]    magnesium transporter [Brucella suis 1330] >gi|62317295|ref
. . . . . Brucella ceti str. Cudo .............................................  145 2 hits [a-proteobacteria]    magnesium transporter [Brucella ceti str. Cudo] >gi|2547056
. . . . . Brucella pinnipedialis M163/99/10 ...................................  145 3 hits [a-proteobacteria]    magnesium transporter [Brucella ceti str. Cudo] >gi|2547056
. . . . . Brucella pinnipedialis B2/94 ........................................  145 3 hits [a-proteobacteria]    magnesium transporter [Brucella ceti str. Cudo] >gi|2547056
. . . . . Brucella ceti M644/93/1 .............................................  145 3 hits [a-proteobacteria]    magnesium transporter [Brucella ceti str. Cudo] >gi|2547056
. . . . . Brucella ceti M13/05/1 ..............................................  145 3 hits [a-proteobacteria]    magnesium transporter [Brucella ceti str. Cudo] >gi|2547056
. . . . . Brucella pinnipedialis M292/94/1 ....................................  145 3 hits [a-proteobacteria]    magnesium transporter [Brucella ceti str. Cudo] >gi|2547056
. . . . . Brucella ceti M490/95/1 .............................................  145 3 hits [a-proteobacteria]    magnesium transporter [Brucella ceti str. Cudo] >gi|2547056
. . . . . Brucella ceti B1/94 .................................................  145 3 hits [a-proteobacteria]    magnesium transporter [Brucella ceti str. Cudo] >gi|2547056
. . . . . Brucella sp. F5/99 ..................................................  145 3 hits [a-proteobacteria]    magnesium transporter [Brucella ceti str. Cudo] >gi|2547056
. . . . uncultured SUP05 cluster bacterium ------------------------------------  207 1 hit  [g-proteobacteria]    Mg/Co/Ni transporter MgtE [uncultured SUP05 cluster bacteri
. . . . Candidatus Vesicomyosocius okutanii HA ................................  206 2 hits [g-proteobacteria]    magnesium transporter MgtE [Candidatus Vesicomyosocius okut
. . . . marine gamma proteobacterium HTCC2143 .................................  204 2 hits [g-proteobacteria]    magnesium transporter [marine gamma proteobacterium HTCC214
. . . . Thiomicrospira crunogena XCL-2 ........................................  202 4 hits [g-proteobacteria]    magnesium transporter [Thiomicrospira crunogena XCL-2] >gi|
. . . . Alteromonas macleodii ATCC 27126 ......................................  201 2 hits [g-proteobacteria]    Mg/Co/Ni transporter MgtE (contains CBS domain) [Alteromona
. . . . Bermanella marisrubri .................................................  200 2 hits [g-proteobacteria]    magnesium transporter [Oceanobacter sp. RED65] >gi|94426099
. . . . Psychromonas ingrahamii 37 ............................................  199 2 hits [g-proteobacteria]    magnesium transporter [Psychromonas ingrahamii 37] >gi|1198
. . . . Alteromonas macleodii 'Deep ecotype' ..................................  199 4 hits [g-proteobacteria]    Mg/Co/Ni transporter MgtE (contains CBS domain) [Alteromona
. . . . Neptuniibacter caesariensis ...........................................  198 4 hits [g-proteobacteria]    Divalent cation transporter [Oceanospirillum sp. MED92] >gi
. . . . Idiomarina baltica OS145 ..............................................  197 2 hits [g-proteobacteria]    Mg/Co/Ni transporter MgtE (contains CBS domain) [Idiomarina
. . . . Methylophaga thiooxidans DMS010 .......................................  197 2 hits [g-proteobacteria]    magnesium transporter [Methylophaga thiooxidans DMS010] >gi
. . . . Syntrophus aciditrophicus SB ..........................................  196 2 hits [d-proteobacteria]    Mg/Co/Ni transporter [Syntrophus aciditrophicus SB] >gi|857
. . . . Reinekea blandensis MED297 ............................................  196 2 hits [g-proteobacteria]    magnesium transporter [Reinekea sp. MED297] >gi|88778950|gb
. . . . Pseudoalteromonas atlantica T6c .......................................  196 2 hits [g-proteobacteria]    magnesium transporter [Pseudoalteromonas atlantica T6c] >gi
. . . . Hahella chejuensis KCTC 2396 ..........................................  195 2 hits [g-proteobacteria]    magnesium transporter [Hahella chejuensis KCTC 2396] >gi|83
. . . . Idiomarina loihiensis L2TR ............................................  195 2 hits [g-proteobacteria]    Mg2+/Co2+ transporter [Idiomarina loihiensis L2TR] >gi|5617
. . . . gamma proteobacterium HTCC2207 ........................................  194 2 hits [g-proteobacteria]    Mg/Co/Ni transporter MgtE [marine gamma proteobacterium HTC
. . . . Glaciecola sp. HTCC2999 ...............................................  194 1 hit  [g-proteobacteria]    magnesium transporter [alpha proteobacterium HTCC2255] >gi|
. . . . Photobacterium damselae subsp. damselae CIP 102761 ....................  194 2 hits [g-proteobacteria]    magnesium transporter [Photobacterium damselae subsp. damse
. . . . Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica) ...........  193 2 hits [g-proteobacteria]    magnesium transporter [Candidatus Ruthia magnifica str. Cm 
. . . . Magnetococcus sp. MC-1 ................................................  191 2 hits [proteobacteria]      magnesium transporter [Magnetococcus sp. MC-1] >gi|11761011
. . . . Marinomonas sp. MED121 ................................................  191 2 hits [g-proteobacteria]    Divalent cation transporter [Marinomonas sp. MED121] >gi|86
. . . . Alcanivorax sp. DG881 .................................................  191 2 hits [g-proteobacteria]    magnesium transporter [Alcanivorax sp. DG881] >gi|196193017
. . . . Vibrio fischeri MJ11 ..................................................  190 2 hits [g-proteobacteria]    magnesium transporter [Vibrio fischeri MJ11] >gi|197317023|
. . . . Vibrio fischeri ES114 .................................................  190 2 hits [g-proteobacteria]    magnesium transporter [Vibrio fischeri ES114] >gi|59479090|
. . . . Xanthomonas campestris pv. campestris str. ATCC 33913 .................  189 2 hits [g-proteobacteria]    Mg++ transporter [Xanthomonas campestris pv. campestris str
. . . . Xanthomonas campestris pv. campestris str. 8004 .......................  189 2 hits [g-proteobacteria]    Mg++ transporter [Xanthomonas campestris pv. campestris str
. . . . Xanthomonas campestris pv. campestris str. B100 .......................  189 1 hit  [g-proteobacteria]    Mg++ transporter [Xanthomonas campestris pv. campestris str
. . . . Xanthomonas campestris pv. campestris .................................  189 1 hit  [g-proteobacteria]    Mg++ transporter [Xanthomonas campestris pv. campestris str
. . . . Psychromonas sp. CNPT3 ................................................  189 2 hits [g-proteobacteria]    Mg/Co/Ni transporter MgtE (contains CBS domain) [Psychromon
. . . . Alcanivorax borkumensis SK2 ...........................................  189 2 hits [g-proteobacteria]    magnesium transporter [Alcanivorax borkumensis SK2] >gi|110
. . . . Moritella sp. PE36 ....................................................  189 2 hits [g-proteobacteria]    putative magnesium transporter [Moritella sp. PE36] >gi|149
. . . . Aliivibrio salmonicida LFI1238 ........................................  189 2 hits [g-proteobacteria]    magnesium transporter [Aliivibrio salmonicida LFI1238] >gi|
. . . . Marinobacter sp. ELB17 ................................................  189 2 hits [g-proteobacteria]    magnesium transporter [Marinobacter sp. ELB17] >gi|12662675
. . . . Marinobacter aquaeolei VT8 ............................................  185 2 hits [g-proteobacteria]    magnesium transporter [Marinobacter aquaeolei VT8] >gi|1203
. . . . Proteus mirabilis HI4320 ..............................................  184 2 hits [enterobacteria]      magnesium transporter [Proteus mirabilis HI4320] >gi|194682
. . . . Nitrosococcus oceani ATCC 19707 .......................................  184 4 hits [g-proteobacteria]    divalent cation transporter [Nitrosococcus oceani ATCC 1970
. . . . Nitrosococcus oceani AFC27 ............................................  184 4 hits [g-proteobacteria]    divalent cation transporter [Nitrosococcus oceani ATCC 1970
. . . . Shewanella pealeana ATCC 700345 .......................................  184 2 hits [g-proteobacteria]    magnesium transporter [Shewanella pealeana ATCC 700345] >gi
. . . . Vibrio metschnikovii CIP 69.14 ........................................  184 2 hits [g-proteobacteria]    mg/Co/Ni transporter MgtE (contains CBS domain) [Vibrio met
. . . . Allochromatium vinosum DSM 180 ........................................  184 2 hits [g-proteobacteria]    magnesium transporter [Allochromatium vinosum DSM 180] >gi|
. . . . Stenotrophomonas maltophilia R551-3 ...................................  184 2 hits [g-proteobacteria]    magnesium transporter [Stenotrophomonas maltophilia R551-3]
. . . . Photobacterium sp. SKA34 ..............................................  183 2 hits [g-proteobacteria]    putative magnesium transporter [Photobacterium sp. SKA34] >
. . . . Stenotrophomonas maltophilia K279a ....................................  183 2 hits [g-proteobacteria]    putative MgtE/divalent cation transmembrane transporter pro
. . . . Stenotrophomonas sp. SKA14 ............................................  183 2 hits [g-proteobacteria]    magnesium transporter [Stenotrophomonas sp. SKA14] >gi|2197
. . . . Proteus mirabilis ATCC 29906 ..........................................  183 2 hits [enterobacteria]      magnesium transporter [Proteus mirabilis ATCC 29906] >gi|22
. . . . Shewanella violacea ...................................................  183 1 hit  [g-proteobacteria]    unnamed protein product [Shewanella violacea]
. . . . Xanthomonas oryzae pv. oryzicola BLS256 ...............................  183 1 hit  [g-proteobacteria]    Mg++ transporter [Xanthomonas oryzae pv. oryzicola BLS256]
. . . . Shewanella sp. ANA-3 ..................................................  183 2 hits [g-proteobacteria]    magnesium transporter [Shewanella sp. ANA-3] >gi|117611451|
. . . . Proteus penneri ATCC 35198 ............................................  183 2 hits [enterobacteria]      hypothetical protein PROPEN_00324 [Proteus penneri ATCC 351
. . . . Shewanella sp. MR-4 ...................................................  183 2 hits [g-proteobacteria]    magnesium transporter [Shewanella sp. MR-4] >gi|113883696|g
. . . . Photobacterium angustum S14 ...........................................  183 2 hits [g-proteobacteria]    putative magnesium transporter [Vibrio angustum S14] >gi|90
. . . . Marinomonas sp. MWYL1 .................................................  182 4 hits [g-proteobacteria]    magnesium transporter [Marinomonas sp. MWYL1] >gi|150837367
. . . . Vibrio mimicus VM603 ..................................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio mimicus VM603] >gi|262166561|
. . . . Vibrio mimicus VM223 ..................................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio mimicus VM603] >gi|262166561|
. . . . Vibrio mimicus MB-451 .................................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio mimicus VM603] >gi|262166561|
. . . . gamma proteobacterium NOR5-3 ..........................................  182 2 hits [g-proteobacteria]    magnesium transporter [gamma proteobacterium NOR5-3] >gi|21
. . . . Vibrio cholerae RC385 .................................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae RC385] >gi|254291450
. . . . Vibrio cholerae AM-19226 ..............................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae RC385] >gi|254291450
. . . . Vibrio sp. RC586 ......................................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae RC385] >gi|254291450
. . . . Shewanella sp. MR-7 ...................................................  182 2 hits [g-proteobacteria]    magnesium transporter [Shewanella sp. MR-7] >gi|113890285|g
. . . . Shewanella baltica OS223 ..............................................  182 2 hits [g-proteobacteria]    magnesium transporter [Shewanella baltica OS223] >gi|217497
. . . . Marinobacter algicola DG893 ...........................................  182 2 hits [g-proteobacteria]    magnesium transporter [Marinobacter algicola DG893] >gi|149
. . . . Xanthomonas oryzae pv. oryzae KACC10331 ...............................  182 2 hits [g-proteobacteria]    Mg++ transporter [Xanthomonas oryzae pv. oryzae KACC10331] 
. . . . Xanthomonas oryzae pv. oryzae MAFF 311018 .............................  182 2 hits [g-proteobacteria]    Mg++ transporter [Xanthomonas oryzae pv. oryzae KACC10331] 
. . . . Vibrio harveyi HY01 ...................................................  182 4 hits [g-proteobacteria]    magnesium transporter [Vibrio harveyi HY01] >gi|269963392|r
. . . . Vibrio harveyi 1DA3 ...................................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio harveyi HY01] >gi|269963392|r
. . . . Shewanella oneidensis MR-1 ............................................  182 2 hits [g-proteobacteria]    magnesium transporter [Shewanella oneidensis MR-1] >gi|2435
. . . . Vibrio cholerae O1 biovar El Tor str. N16961 ..........................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae O1 biovar El Tor str
. . . . Vibrio cholerae V52 ...................................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae O1 biovar El Tor str
. . . . Vibrio cholerae O395 ..................................................  182 3 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae O1 biovar El Tor str
. . . . Vibrio cholerae 1587 ..................................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae O1 biovar El Tor str
. . . . Vibrio cholerae MAK 757 ...............................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae O1 biovar El Tor str
. . . . Vibrio cholerae MZO-3 .................................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae O1 biovar El Tor str
. . . . Vibrio cholerae NCTC 8457 .............................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae O1 biovar El Tor str
. . . . Vibrio cholerae MZO-2 .................................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae O1 biovar El Tor str
. . . . Vibrio cholerae 623-39 ................................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae O1 biovar El Tor str
. . . . Vibrio cholerae M66-2 .................................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae O1 biovar El Tor str
. . . . Vibrio cholerae BX 330286 .............................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae O1 biovar El Tor str
. . . . Vibrio cholerae B33 ...................................................  182 4 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae O1 biovar El Tor str
. . . . Vibrio cholerae TMA 21 ................................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae O1 biovar El Tor str
. . . . Vibrio cholerae RC9 ...................................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae O1 biovar El Tor str
. . . . Vibrio cholerae TM 11079-80 ...........................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae O1 biovar El Tor str
. . . . Vibrio cholerae MJ-1236 ...............................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae O1 biovar El Tor str
. . . . Vibrio cholerae V51 ...................................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae O1 biovar El Tor str
. . . . Vibrio cholerae MO10 ..................................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae O1 biovar El Tor str
. . . . Vibrio cholera CIRS 101 ...............................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae O1 biovar El Tor str
. . . . Vibrio sp. RC341 ......................................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae O1 biovar El Tor str
. . . . Vibrio cholerae INDRE 91/1 ............................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae O1 biovar El Tor str
. . . . Vibrio cholerae 2740-80 ...............................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae 2740-80] >gi|1215478
. . . . Shewanella piezotolerans WP3 ..........................................  182 2 hits [g-proteobacteria]    hypothetical protein swp_0672 [Shewanella piezotolerans WP3
. . . . Shewanella baltica OS195 ..............................................  182 2 hits [g-proteobacteria]    magnesium transporter [Shewanella baltica OS195] >gi|160859
. . . . Xanthomonas oryzae pv. oryzae PXO99A ..................................  182 2 hits [g-proteobacteria]    magnesium transporter [Xanthomonas oryzae pv. oryzae PXO99A
. . . . Xenorhabdus bovienii SS-2004 ..........................................  182 2 hits [enterobacteria]      putative divalent cation transport protein ( divalent catio
. . . . Vibrio mimicus VM573 ..................................................  182 2 hits [g-proteobacteria]    magnesium transporter [Vibrio mimicus VM573] >gi|258584962|
. . . . Shewanella baltica OS185 ..............................................  181 2 hits [g-proteobacteria]    magnesium transporter [Shewanella baltica OS185] >gi|151363
. . . . Vibrio harveyi ATCC BAA-1116 ..........................................  181 4 hits [g-proteobacteria]    hypothetical protein VIBHAR_03669 [Vibrio harveyi ATCC BAA-
. . . . Shewanella sp. W3-18-1 ................................................  181 2 hits [g-proteobacteria]    magnesium transporter [Shewanella sp. W3-18-1] >gi|14629181
. . . . Shewanella putrefaciens CN-32 .........................................  181 2 hits [g-proteobacteria]    magnesium transporter [Shewanella sp. W3-18-1] >gi|14629181
. . . . Shewanella putrefaciens 200 ...........................................  181 2 hits [g-proteobacteria]    magnesium transporter [Shewanella putrefaciens 200] >gi|124
. . . . marine gamma proteobacterium HTCC2148 .................................  181 2 hits [g-proteobacteria]    magnesium transporter [marine gamma proteobacterium HTCC214
. . . . Vibrio sp. Ex25 .......................................................  181 8 hits [g-proteobacteria]    magnesium transporter [Vibrio sp. Ex25] >gi|262393171|ref|Y
. . . . Photobacterium profundum SS9 ..........................................  181 2 hits [g-proteobacteria]    putative magnesium transporter [Photobacterium profundum SS
. . . . Arsenophonus nasoniae .................................................  181 1 hit  [enterobacteria]      magnesium transporter [Arsenophonus nasoniae]
. . . . Pseudoalteromonas tunicata D2 .........................................  181 4 hits [g-proteobacteria]    putative magnesium transporter [Pseudoalteromonas tunicata 
. . . . Shewanella baltica OS155 ..............................................  180 2 hits [g-proteobacteria]    magnesium transporter [Shewanella baltica OS155] >gi|125999
. . . . Vibrio cholerae bv. albensis VL426 ....................................  180 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae bv. albensis VL426] 
. . . . Vibrio cholerae CT 5369-93 ............................................  180 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae CT 5369-93] >gi|2620
. . . . Vibrio cholerae 12129(1) ..............................................  180 2 hits [g-proteobacteria]    magnesium transporter [Vibrio cholerae 12129(1)] >gi|229335
. . . . Alteromonadales bacterium TW-7 ........................................  180 2 hits [g-proteobacteria]    putative magnesium transporter [Alteromonadales bacterium T
. . . . Shewanella loihica PV-4 ...............................................  180 4 hits [g-proteobacteria]    magnesium transporter [Shewanella loihica PV-4] >gi|1266395
. . . . Vibrio coralliilyticus ATCC BAA-450 ...................................  180 2 hits [g-proteobacteria]    magnesium transporter [Vibrio coralliilyticus ATCC BAA-450]
. . . . Shewanella frigidimarina NCIMB 400 ....................................  179 2 hits [g-proteobacteria]    magnesium transporter [Shewanella frigidimarina NCIMB 400] 
. . . . Photobacterium profundum 3TCK .........................................  179 2 hits [g-proteobacteria]    putative magnesium transporter [Photobacterium profundum 3T
. . . . Shewanella halifaxensis HAW-EB4 .......................................  179 2 hits [g-proteobacteria]    magnesium transporter [Shewanella halifaxensis HAW-EB4] >gi
. . . . gamma proteobacterium NOR51-B .........................................  179 2 hits [g-proteobacteria]    magnesium transporter [gamma proteobacterium NOR51-B] >gi|2
. . . . Xanthomonas campestris pv. vasculorum NCPPB702 ........................  179 1 hit  [g-proteobacteria]    Mg++ transporter [Xanthomonas campestris pv. vasculorum NCP
. . . . Xanthomonas campestris pv. musacearum NCPPB4381 .......................  179 1 hit  [g-proteobacteria]    Mg++ transporter [Xanthomonas campestris pv. vasculorum NCP
. . . . Vibrio alginolyticus 12G01 ............................................  179 4 hits [g-proteobacteria]    magnesium transporter [Vibrio alginolyticus 12G01] >gi|2699
. . . . Vibrio alginolyticus 40B ..............................................  179 4 hits [g-proteobacteria]    magnesium transporter [Vibrio alginolyticus 12G01] >gi|2699
. . . . Pseudomonas putida W619 ...............................................  179 2 hits [g-proteobacteria]    magnesium transporter [Pseudomonas putida W619] >gi|1697609
. . . . Pseudomonas fluorescens SBW25 .........................................  179 2 hits [g-proteobacteria]    hypothetical protein PFLU4745 [Pseudomonas fluorescens SBW2
. . . . Vibrio parahaemolyticus 16 ............................................  179 2 hits [g-proteobacteria]    magnesium transporter [Vibrio parahaemolyticus 16] >gi|2195
. . . . Methylobacillus flagellatus KT ........................................  178 2 hits [b-proteobacteria]    magnesium transporter [Methylobacillus flagellatus KT] >gi|
. . . . Teredinibacter turnerae T7901 .........................................  178 2 hits [g-proteobacteria]    magnesium transporter [Teredinibacter turnerae T7901] >gi|2
. . . . Pseudomonas mendocina ymp .............................................  178 2 hits [g-proteobacteria]    magnesium transporter [Pseudomonas mendocina ymp] >gi|14557
. . . . Providencia stuartii ATCC 25827 .......................................  178 2 hits [enterobacteria]      hypothetical protein PROSTU_02886 [Providencia stuartii ATC
. . . . Pseudomonas entomophila L48 ...........................................  177 2 hits [g-proteobacteria]    magnesium transporter [Pseudomonas entomophila L48] >gi|951
. . . . Mariprofundus ferrooxydans PV-1 .......................................  177 2 hits [proteobacteria]      magnesium transporter [Mariprofundus ferrooxydans PV-1] >gi
. . . . Xanthomonas campestris pv. vesicatoria str. 85-10 .....................  177 2 hits [g-proteobacteria]    magnesium transporter [Xanthomonas campestris pv. vesicator
. . . . beta proteobacterium KB13 .............................................  177 2 hits [b-proteobacteria]    magnesium transporter [beta proteobacterium KB13] >gi|20708
. . . . Xanthomonas axonopodis pv. citri str. 306 .............................  177 2 hits [g-proteobacteria]    Mg++ transporter [Xanthomonas axonopodis pv. citri str. 306
. . . . Shewanella sediminis HAW-EB3 ..........................................  177 2 hits [g-proteobacteria]    magnesium transporter [Shewanella sediminis HAW-EB3] >gi|15
. . . . Yersinia frederiksenii ATCC 33641 .....................................  177 2 hits [enterobacteria]      Magnesium transporter [Yersinia frederiksenii ATCC 33641] >
. . . . Vibrio sp. AND4 .......................................................  177 2 hits [g-proteobacteria]    magnesium transporter [Vibrio sp. AND4] >gi|159173328|gb|ED
. . . . Bordetella petrii DSM 12804 ...........................................  177 1 hit  [b-proteobacteria]    putative cation transport protein [Bordetella petrii DSM 12
. . . . Bordetella petrii .....................................................  177 1 hit  [b-proteobacteria]    putative cation transport protein [Bordetella petrii DSM 12
. . . . Providencia alcalifaciens DSM 30120 ...................................  177 2 hits [enterobacteria]      hypothetical protein PROVALCAL_01969 [Providencia alcalifac
. . . . Kangiella koreensis DSM 16069 .........................................  177 2 hits [g-proteobacteria]    magnesium transporter [Kangiella koreensis DSM 16069] >gi|2
. . . . Providencia rustigianii DSM 4541 ......................................  176 2 hits [enterobacteria]      magnesium transporter [Providencia rustigianii DSM 4541] >g
. . . . Vibrio parahaemolyticus RIMD 2210633 ..................................  176 4 hits [g-proteobacteria]    magnesium transporter [Vibrio parahaemolyticus RIMD 2210633
. . . . Vibrio parahaemolyticus K5030 .........................................  176 2 hits [g-proteobacteria]    magnesium transporter [Vibrio parahaemolyticus RIMD 2210633
. . . . Vibrio parahaemolyticus AN-5034 .......................................  176 2 hits [g-proteobacteria]    magnesium transporter [Vibrio parahaemolyticus RIMD 2210633
. . . . Vibrio parahaemolyticus Peru-466 ......................................  176 2 hits [g-proteobacteria]    magnesium transporter [Vibrio parahaemolyticus RIMD 2210633
. . . . Vibrio parahaemolyticus AQ3810 ........................................  176 4 hits [g-proteobacteria]    magnesium transporter [Vibrio parahaemolyticus AQ3810] >gi|
. . . . Vibrio parahaemolyticus AQ4037 ........................................  176 2 hits [g-proteobacteria]    magnesium transporter [Vibrio parahaemolyticus AQ3810] >gi|
. . . . Vibrio furnissii CIP 102972 ...........................................  176 2 hits [g-proteobacteria]    mg/Co/Ni transporter MgtE (contains CBS domain) [Vibrio fur
. . . . Yersinia rohdei ATCC 43380 ............................................  176 2 hits [enterobacteria]      Magnesium transporter [Yersinia rohdei ATCC 43380] >gi|2387
. . . . Bordetella avium 197N .................................................  176 2 hits [b-proteobacteria]    magnesium transporter [Bordetella avium 197N] >gi|115423921
. . . . Pseudoalteromonas haloplanktis TAC125 .................................  176 4 hits [g-proteobacteria]    magnesium transporter [Pseudoalteromonas haloplanktis TAC12
. . . . Pantoea sp. At-9b .....................................................  176 2 hits [enterobacteria]      magnesium transporter [Pantoea sp. At-9b] >gi|258535583|gb|
. . . . Yersinia kristensenii ATCC 33638 ......................................  176 2 hits [enterobacteria]      Magnesium transporter [Yersinia kristensenii ATCC 33638] >g
. . . . Shewanella amazonensis SB2B ...........................................  176 2 hits [g-proteobacteria]    magnesium transporter [Shewanella amazonensis SB2B] >gi|119
. . . . Pelobacter carbinolicus DSM 2380 ......................................  176 2 hits [d-proteobacteria]    magnesium transporter [Pelobacter carbinolicus DSM 2380] >g
. . . . Pseudomonas syringae pv. tomato str. DC3000 ...........................  175 2 hits [g-proteobacteria]    magnesium transporter [Pseudomonas syringae pv. tomato str.
. . . . Pseudomonas syringae pv. tomato T1 ....................................  175 2 hits [g-proteobacteria]    magnesium transporter [Pseudomonas syringae pv. tomato str.
. . . . Desulfohalobium retbaense DSM 5692 ....................................  175 2 hits [d-proteobacteria]    magnesium transporter [Desulfohalobium retbaense DSM 5692] 
. . . . Pseudomonas fluorescens Pf-5 ..........................................  175 2 hits [g-proteobacteria]    magnesium transporter [Pseudomonas fluorescens Pf-5] >gi|68
. . . . Vibrio orientalis CIP 102891 ..........................................  175 2 hits [g-proteobacteria]    magnesium transporter [Vibrio orientalis CIP 102891] >gi|26
. . . . Vibrio sp. MED222 .....................................................  174 2 hits [g-proteobacteria]    magnesium transporter [Vibrio sp. MED222] >gi|85834624|gb|E
. . . . Citrobacter koseri ATCC BAA-895 .......................................  174 2 hits [enterobacteria]      hypothetical protein CKO_00564 [Citrobacter koseri ATCC BAA
. . . . Pseudomonas fluorescens Pf0-1 .........................................  174 2 hits [g-proteobacteria]    divalent cation transporter [Pseudomonas fluorescens Pf0-1]
. . . . gamma proteobacterium HTCC5015 ........................................  174 2 hits [g-proteobacteria]    magnesium transporter [gamma proteobacterium HTCC5015] >gi|
. . . . Vibrio splendidus LGP32 ...............................................  174 2 hits [g-proteobacteria]    magnesium transporter [Vibrio splendidus LGP32] >gi|2183237
. . . . Shewanella benthica KT99 ..............................................  174 2 hits [g-proteobacteria]    magnesium transporter [Shewanella benthica KT99] >gi|161330
. . . . Vibrionales bacterium SWAT-3 ..........................................  174 2 hits [g-proteobacteria]    magnesium transporter [Vibrionales bacterium SWAT-3] >gi|14
. . . . Neisseria flavescens SK114 ............................................  174 2 hits [b-proteobacteria]    magnesium transporter [Neisseria flavescens SK114] >gi|2413
. . . . Serratia odorifera 4Rx13 ..............................................  173 2 hits [enterobacteria]      transporter [Serratia odorifera 4Rx13] >gi|270041339|gb|EFA
. . . . Neisseria gonorrhoeae FA 1090 .........................................  173 2 hits [b-proteobacteria]    MgtE [Neisseria gonorrhoeae FA 1090] >gi|240014447|ref|ZP_0
. . . . Neisseria gonorrhoeae DGI18 ...........................................  173 1 hit  [b-proteobacteria]    MgtE [Neisseria gonorrhoeae FA 1090] >gi|240014447|ref|ZP_0
. . . . Neisseria gonorrhoeae FA6140 ..........................................  173 1 hit  [b-proteobacteria]    MgtE [Neisseria gonorrhoeae FA 1090] >gi|240014447|ref|ZP_0
. . . . Neisseria gonorrhoeae MS11 ............................................  173 3 hits [b-proteobacteria]    MgtE [Neisseria gonorrhoeae FA 1090] >gi|240014447|ref|ZP_0
. . . . Neisseria gonorrhoeae PID18 ...........................................  173 3 hits [b-proteobacteria]    MgtE [Neisseria gonorrhoeae FA 1090] >gi|240014447|ref|ZP_0
. . . . Neisseria gonorrhoeae PID1 ............................................  173 3 hits [b-proteobacteria]    MgtE [Neisseria gonorrhoeae FA 1090] >gi|240014447|ref|ZP_0
. . . . Neisseria gonorrhoeae PID24-1 .........................................  173 1 hit  [b-proteobacteria]    MgtE [Neisseria gonorrhoeae FA 1090] >gi|240014447|ref|ZP_0
. . . . Neisseria gonorrhoeae SK-92-679 .......................................  173 3 hits [b-proteobacteria]    MgtE [Neisseria gonorrhoeae FA 1090] >gi|240014447|ref|ZP_0
. . . . Neisseria gonorrhoeae SK-93-1035 ......................................  173 3 hits [b-proteobacteria]    MgtE [Neisseria gonorrhoeae FA 1090] >gi|240014447|ref|ZP_0
. . . . Neisseria gonorrhoeae DGI2 ............................................  173 3 hits [b-proteobacteria]    MgtE [Neisseria gonorrhoeae FA 1090] >gi|240014447|ref|ZP_0
. . . . Yersinia mollaretii ATCC 43969 ........................................  173 2 hits [enterobacteria]      Magnesium transporter [Yersinia mollaretii ATCC 43969] >gi|
. . . . Pseudomonas syringae pv. syringae B728a ...............................  173 2 hits [g-proteobacteria]    divalent cation transporter [Pseudomonas syringae pv. syrin
. . . . Providencia rettgeri DSM 1131 .........................................  173 1 hit  [enterobacteria]      magnesium transporter [Providencia rettgeri DSM 1131]
. . . . Neisseria gonorrhoeae NCCP11945 .......................................  173 2 hits [b-proteobacteria]    MgtE [Neisseria gonorrhoeae NCCP11945] >gi|239999719|ref|ZP
. . . . Neisseria gonorrhoeae 35/02 ...........................................  173 3 hits [b-proteobacteria]    MgtE [Neisseria gonorrhoeae NCCP11945] >gi|239999719|ref|ZP
. . . . Neisseria gonorrhoeae FA19 ............................................  173 3 hits [b-proteobacteria]    MgtE [Neisseria gonorrhoeae NCCP11945] >gi|239999719|ref|ZP
. . . . Neisseria gonorrhoeae PID332 ..........................................  173 3 hits [b-proteobacteria]    MgtE [Neisseria gonorrhoeae NCCP11945] >gi|239999719|ref|ZP
. . . . Neisseria gonorrhoeae 1291 ............................................  173 2 hits [b-proteobacteria]    MgtE [Neisseria gonorrhoeae NCCP11945] >gi|239999719|ref|ZP
. . . . Pseudomonas syringae pv. phaseolicola 1448A ...........................  173 2 hits [g-proteobacteria]    magnesium transporter [Pseudomonas syringae pv. phaseolicol
. . . . Pseudomonas syringae pv. tabaci ATCC 11528 ............................  173 1 hit  [g-proteobacteria]    magnesium transporter [Pseudomonas syringae pv. phaseolicol
. . . . Pseudomonas syringae pv. aesculi str. NCPPB3681 .......................  173 1 hit  [g-proteobacteria]    magnesium transporter [Pseudomonas syringae pv. phaseolicol
. . . . Pseudomonas syringae pv. aesculi str. 2250 ............................  173 1 hit  [g-proteobacteria]    magnesium transporter [Pseudomonas syringae pv. aesculi str
. . . . Pseudomonas stutzeri A1501 ............................................  173 2 hits [g-proteobacteria]    magnesium transporter [Pseudomonas stutzeri A1501] >gi|1455
. . . . Neisseria meningitidis alpha153 .......................................  173 1 hit  [b-proteobacteria]    magnesium transporter [Neisseria meningitidis alpha153]
. . . . Shewanella woodyi ATCC 51908 ..........................................  173 2 hits [g-proteobacteria]    magnesium transporter [Shewanella woodyi ATCC 51908] >gi|16
. . . . Neisseria flavescens NRL30031/H210 ....................................  172 2 hits [b-proteobacteria]    hypothetical protein NEIFLAOT_02514 [Neisseria flavescens N
. . . . Vibrio vulnificus CMCP6 ...............................................  172 4 hits [g-proteobacteria]    Mg/Co/Ni transporter MgtE [Vibrio vulnificus CMCP6] >gi|376
. . . . Vibrio vulnificus YJ016 ...............................................  172 4 hits [g-proteobacteria]    Mg/Co/Ni transporter MgtE [Vibrio vulnificus CMCP6] >gi|376
. . . . Neisseria meningitidis FAM18 ..........................................  172 2 hits [b-proteobacteria]    hypothetical protein NMC1976 [Neisseria meningitidis FAM18]
. . . . Neisseria meningitidis 8013 ...........................................  172 1 hit  [b-proteobacteria]    hypothetical protein NMC1976 [Neisseria meningitidis FAM18]
. . . . Yersinia intermedia ATCC 29909 ........................................  172 2 hits [enterobacteria]      Magnesium transporter [Yersinia intermedia ATCC 29909] >gi|
. . . . Neisseria meningitidis alpha275 .......................................  172 1 hit  [b-proteobacteria]    magnesium transporter [Neisseria meningitidis serogroup W13
. . . . Neisseria mucosa ATCC 25996 ...........................................  172 2 hits [b-proteobacteria]    magnesium transporter [Neisseria mucosa ATCC 25996] >gi|288
. . . . Neisseria meningitidis Z2491 ..........................................  172 2 hits [b-proteobacteria]    hypothetical inner membrane protein [Neisseria meningitidis
. . . . Vibrio splendidus 12B01 ...............................................  172 2 hits [g-proteobacteria]    magnesium transporter [Vibrio splendidus 12B01] >gi|8437731
. . . . Pseudomonas syringae pv. oryzae str. 1_6 ..............................  172 1 hit  [g-proteobacteria]    magnesium transporter [Pseudomonas syringae pv. oryzae str.
. . . . Neisseria meningitidis alpha14 ........................................  172 2 hits [b-proteobacteria]    magnesium transporter [Neisseria meningitidis alpha14] >gi|
. . . . Neisseria subflava NJ9703 .............................................  172 2 hits [b-proteobacteria]    magnesium transporter [Neisseria subflava NJ9703] >gi|28479
. . . . Neisseria cinerea ATCC 14685 ..........................................  172 2 hits [b-proteobacteria]    magnesium transporter [Neisseria cinerea ATCC 14685] >gi|26
. . . . Methylococcus capsulatus str. Bath ....................................  172 2 hits [g-proteobacteria]    magnesium transporter [Methylococcus capsulatus str. Bath] 
. . . . Yersinia aldovae ATCC 35236 ...........................................  171 2 hits [enterobacteria]      Magnesium transporter [Yersinia aldovae ATCC 35236] >gi|238
. . . . Neisseria sicca ATCC 29256 ............................................  171 2 hits [b-proteobacteria]    magnesium transporter [Neisseria sicca ATCC 29256] >gi|2550
. . . . Yersinia bercovieri ATCC 43970 ........................................  171 2 hits [enterobacteria]      Magnesium transporter [Yersinia bercovieri ATCC 43970] >gi|
. . . . Neisseria meningitidis 053442 .........................................  171 2 hits [b-proteobacteria]    magnesium transporter [Neisseria meningitidis 053442] >gi|1
. . . . Methylophilales bacterium HTCC2181 ....................................  171 2 hits [b-proteobacteria]    Divalent cation transporter [Methylophilales bacterium HTCC
. . . . Neisseria meningitidis MC58 ...........................................  171 2 hits [b-proteobacteria]    magnesium transporter [Neisseria meningitidis MC58] >gi|722
. . . . Pseudomonas syringae pv. syringae FF5 .................................  171 1 hit  [g-proteobacteria]    magnesium transporter [Pseudomonas syringae pv. syringae FF
. . . . Pseudomonas putida GB-1 ...............................................  171 2 hits [g-proteobacteria]    magnesium transporter [Pseudomonas putida GB-1] >gi|1668614
. . . . Pseudomonas putida KT2440 .............................................  171 2 hits [g-proteobacteria]    magnesium transporter [Pseudomonas putida KT2440] >gi|14854
. . . . Pseudomonas putida F1 .................................................  171 2 hits [g-proteobacteria]    magnesium transporter [Pseudomonas putida KT2440] >gi|14854
. . . . Grimontia hollisae CIP 101886 .........................................  171 2 hits [g-proteobacteria]    magnesium transporter [Grimontia hollisae CIP 101886] >gi|2
. . . . Campylobacter gracilis RM3268 .........................................  170 2 hits [e-proteobacteria]    magnesium transporter [Campylobacter gracilis RM3268] >gi|2
. . . . Neisseria lactamica ATCC 23970 ........................................  170 2 hits [b-proteobacteria]    magnesium transporter [Neisseria lactamica ATCC 23970] >gi|
. . . . Nitratiruptor sp. SB155-2 .............................................  170 2 hits [e-proteobacteria]    magnesium transporter [Nitratiruptor sp. SB155-2] >gi|15142
. . . . Yersinia enterocolitica subsp. enterocolitica 8081 ....................  169 2 hits [enterobacteria]      putative divalent cation transport protein [Yersinia entero
. . . . Bordetella pertussis Tohama I .........................................  169 2 hits [b-proteobacteria]    putative cation transport protein [Bordetella pertussis Toh
. . . . Bordetella parapertussis 12822 ........................................  169 1 hit  [b-proteobacteria]    putative cation transport protein [Bordetella pertussis Toh
. . . . Bordetella bronchiseptica RB50 ........................................  169 2 hits [b-proteobacteria]    putative cation transport protein [Bordetella pertussis Toh
. . . . Bordetella parapertussis ..............................................  169 1 hit  [b-proteobacteria]    putative cation transport protein [Bordetella pertussis Toh
. . . . Methylotenera mobilis JLW8 ............................................  169 2 hits [b-proteobacteria]    magnesium transporter [Methylotenera mobilis JLW8] >gi|2539
. . . . Eikenella corrodens ATCC 23834 ........................................  169 2 hits [b-proteobacteria]    hypothetical protein EIKCOROL_00995 [Eikenella corrodens AT
. . . . Citrobacter sp. 30_2 ..................................................  168 2 hits [enterobacteria]      magnesium transporter [Citrobacter sp. 30_2] >gi|226907800|
. . . . Campylobacterales bacterium GD 1 ......................................  168 6 hits [e-proteobacteria]    magnesium transporter [Campylobacterales bacterium GD 1] >g
. . . . Limnobacter sp. MED105 ................................................  168 2 hits [b-proteobacteria]    divalent cation transporter [Limnobacter sp. MED105] >gi|14
. . . . Laribacter hongkongensis HLHK9 ........................................  168 2 hits [b-proteobacteria]    probable magnesium transporter [Laribacter hongkongensis HL
. . . . Chromohalobacter salexigens DSM 3043 ..................................  167 2 hits [g-proteobacteria]    magnesium transporter [Chromohalobacter salexigens DSM 3043
. . . . Yersinia ruckeri ATCC 29473 ...........................................  167 2 hits [enterobacteria]      Magnesium transporter [Yersinia ruckeri ATCC 29473] >gi|238
. . . . Methylovorus sp. SIP3-4 ...............................................  167 2 hits [b-proteobacteria]    magnesium transporter [Methylovorus sp. SIP3-4] >gi|2539847
. . . . Thiobacillus denitrificans ATCC 25259 .................................  167 2 hits [b-proteobacteria]    divalent cation transporter [Thiobacillus denitrificans ATC
. . . . Yersinia pestis KIM 10 ................................................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pestis biovar Microtus str. 91001 ............................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pseudotuberculosis IP 32953 ..................................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pestis Antiqua ...............................................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pestis Nepal516 ..............................................  167 4 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pestis Pestoides F ...........................................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pestis CA88-4125 .............................................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pseudotuberculosis IP 31758 ..................................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pestis Angola ................................................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pestis biovar Orientalis str. F1991016 .......................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pestis biovar Orientalis str. IP275 ..........................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pestis biovar Antiqua str. E1979001 ..........................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pestis biovar Antiqua str. B42003004 .........................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pestis biovar Antiqua str. UG05-0454 .........................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pestis biovar Orientalis str. MG05-1020 ......................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pestis biovar Mediaevalis str. K1973002 ......................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pestis FV-1 ..................................................  167 1 hit  [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pseudotuberculosis YPIII .....................................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pseudotuberculosis PB1/+ .....................................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pestis CO92 ..................................................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pestis biovar Orientalis str. PEXU2 ..........................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pestis Pestoides A ...........................................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pestis biovar Orientalis str. India 195 ......................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pestis KIM D27 ...............................................  167 2 hits [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pestis D106004 ...............................................  167 1 hit  [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Yersinia pestis D182038 ...............................................  167 1 hit  [enterobacteria]      divalent cation transporter [Yersinia pestis KIM 10] >gi|45
. . . . Sulfurimonas denitrificans DSM 1251 ...................................  167 2 hits [e-proteobacteria]    divalent cation transporter [Sulfurimonas denitrificans DSM
. . . . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 .....................  166 2 hits [enterobacteria]      putative MgtE integral membrane region [Klebsiella pneumoni
. . . . Klebsiella pneumoniae NTUH-K2044 ......................................  166 2 hits [enterobacteria]      putative MgtE integral membrane region [Klebsiella pneumoni
. . . . Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 ..............  166 2 hits [enterobacteria]      putative MgtE integral membrane region [Klebsiella pneumoni
. . . . Klebsiella pneumoniae 342 .............................................  166 2 hits [enterobacteria]      magnesium transporter [Klebsiella pneumoniae 342] >gi|28893
. . . . Klebsiella variicola At-22 ............................................  166 2 hits [enterobacteria]      magnesium transporter [Klebsiella pneumoniae 342] >gi|28893
. . . . Klebsiella sp. 1_1_55 .................................................  166 2 hits [enterobacteria]      magnesium transporter [Klebsiella sp. 1_1_55] >gi|289777898
. . . . marine gamma proteobacterium HTCC2080 .................................  166 2 hits [g-proteobacteria]    magnesium transporter [marine gamma proteobacterium HTCC208
. . . . Citrobacter youngae ATCC 29220 ........................................  166 2 hits [enterobacteria]      magnesium transporter [Citrobacter youngae ATCC 29220] >gi|
. . . . Congregibacter litoralis KT71 .........................................  165 2 hits [g-proteobacteria]    magnesium transporter [Congregibacter litoralis KT71] >gi|8
. . . . Xanthomonas albilineans ...............................................  165 2 hits [g-proteobacteria]    putative magnesium transporter protein [Xanthomonas albilin
. . . . Pseudomonas aeruginosa PAO1 ...........................................  165 2 hits [g-proteobacteria]    putative Mg transporter MgtE [Pseudomonas aeruginosa PAO1] 
. . . . Pseudomonas aeruginosa PACS2 ..........................................  165 1 hit  [g-proteobacteria]    putative Mg transporter MgtE [Pseudomonas aeruginosa PAO1] 
. . . . Pseudomonas aeruginosa UCBPP-PA14 .....................................  165 2 hits [g-proteobacteria]    putative Mg transporter MgtE [Pseudomonas aeruginosa PAO1] 
. . . . Pseudomonas aeruginosa PA7 ............................................  165 2 hits [g-proteobacteria]    putative Mg transporter MgtE [Pseudomonas aeruginosa PAO1] 
. . . . Pseudomonas aeruginosa LESB58 .........................................  165 2 hits [g-proteobacteria]    putative Mg transporter MgtE [Pseudomonas aeruginosa PAO1] 
. . . . Pseudomonas aeruginosa C3719 ..........................................  165 2 hits [g-proteobacteria]    putative Mg transporter MgtE [Pseudomonas aeruginosa PAO1] 
. . . . Pseudomonas aeruginosa 2192 ...........................................  165 2 hits [g-proteobacteria]    putative Mg transporter MgtE [Pseudomonas aeruginosa PAO1] 
. . . . Dichelobacter nodosus VCS1703A ........................................  165 2 hits [g-proteobacteria]    magnesium transporter [Dichelobacter nodosus VCS1703A] >gi|
. . . . Campylobacter showae RM3277 ...........................................  164 2 hits [e-proteobacteria]    magnesium transporter [Campylobacter showae RM3277] >gi|255
. . . . Enterobacter cancerogenus ATCC 35316 ..................................  164 2 hits [enterobacteria]      magnesium transporter [Enterobacter cancerogenus ATCC 35316
. . . . Colwellia psychrerythraea 34H .........................................  164 2 hits [g-proteobacteria]    magnesium transporter [Colwellia psychrerythraea 34H] >gi|7
. . . . Citrobacter rodentium ICC168 ..........................................  164 2 hits [enterobacteria]      magnesium transporter [Citrobacter rodentium ICC168] >gi|28
. . . . Campylobacter concisus 13826 ..........................................  164 2 hits [e-proteobacteria]    magnesium transporter [Campylobacter concisus 13826] >gi|11
. . . . Cardiobacterium hominis ATCC 15826 ....................................  164 2 hits [g-proteobacteria]    magnesium transporter [Cardiobacterium hominis ATCC 15826] 
. . . . Saccharophagus degradans 2-40 .........................................  162 4 hits [g-proteobacteria]    magnesium transporter [Saccharophagus degradans 2-40] >gi|8
. . . . Nitrosomonas sp. AL212 ................................................  162 2 hits [b-proteobacteria]    magnesium transporter [Nitrosomonas sp. AL212] >gi|25498078
. . . . Vibrio shilonii AK1 ...................................................  162 2 hits [g-proteobacteria]    magnesium transporter [Vibrio shilonii AK1] >gi|148835580|g
. . . . Kingella oralis ATCC 51147 ............................................  162 2 hits [b-proteobacteria]    hypothetical protein GCWU000324_02124 [Kingella oralis ATCC
. . . . Enterobacter sp. 638 ..................................................  161 2 hits [enterobacteria]      magnesium transporter [Enterobacter sp. 638] >gi|145319308|
. . . . Campylobacter rectus RM3267 ...........................................  161 2 hits [e-proteobacteria]    magnesium transporter [Campylobacter rectus RM3267] >gi|222
. . . . Serratia proteamaculans 568 ...........................................  161 2 hits [enterobacteria]      magnesium transporter [Serratia proteamaculans 568] >gi|157
. . . . Halothiobacillus neapolitanus c2 ......................................  160 2 hits [g-proteobacteria]    magnesium transporter [Halothiobacillus neapolitanus c2] >g
. . . . Azotobacter vinelandii DJ .............................................  160 2 hits [g-proteobacteria]    magnesium transporter; MgtE [Azotobacter vinelandii DJ] >gi
. . . . Desulfomicrobium baculatum DSM 4028 ...................................  159 2 hits [d-proteobacteria]    magnesium transporter [Desulfomicrobium baculatum DSM 4028]
. . . . Aeromonas hydrophila subsp. hydrophila ATCC 7966 ......................  159 2 hits [g-proteobacteria]    magnesium transporter [Aeromonas hydrophila subsp. hydrophi
. . . . Desulfovibrio salexigens DSM 2638 .....................................  156 2 hits [d-proteobacteria]    magnesium transporter [Desulfovibrio salexigens DSM 2638] >
. . . . Campylobacter hominis ATCC BAA-381 ....................................  155 2 hits [e-proteobacteria]    magnesium transporter [Campylobacter hominis ATCC BAA-381] 
. . . . Aeromonas salmonicida subsp. salmonicida A449 .........................  155 2 hits [g-proteobacteria]    magnesium transporter [Aeromonas salmonicida subsp. salmoni
. . . . Campylobacter fetus subsp. fetus 82-40 ................................  155 2 hits [e-proteobacteria]    magnesium transporter [Campylobacter fetus subsp. fetus 82-
. . . . Campylobacter curvus 525.92 ...........................................  155 2 hits [e-proteobacteria]    magnesium transporter [Campylobacter curvus 525.92] >gi|112
. . . . Erwinia pyrifoliae Ep1/96 .............................................  155 2 hits [enterobacteria]      Divalent cation transport protein [Erwinia pyrifoliae Ep1/9
. . . . Erwinia pyrifoliae DSM 12163 ..........................................  155 1 hit  [enterobacteria]      Divalent cation transport protein [Erwinia pyrifoliae Ep1/9
. . . . Desulfovibrio piger ATCC 29098 ........................................  155 2 hits [d-proteobacteria]    hypothetical protein DESPIG_00431 [Desulfovibrio piger ATCC
. . . . Erwinia tasmaniensis Et1/99 ...........................................  154 2 hits [enterobacteria]      Divalent cation transport protein [Erwinia tasmaniensis Et1
. . . . Thioalkalivibrio sp. HL-EbGR7 .........................................  154 2 hits [g-proteobacteria]    magnesium transporter [Thioalkalivibrio sp. HL-EbGR7] >gi|2
. . . . Thauera sp. MZ1T ......................................................  154 2 hits [b-proteobacteria]    magnesium transporter [Thauera sp. MZ1T] >gi|237625585|gb|A
. . . . Sideroxydans lithotrophicus ES-1 ......................................  154 2 hits [b-proteobacteria]    magnesium transporter [Sideroxydans lithotrophicus ES-1] >g
. . . . Pectobacterium carotovorum subsp. carotovorum PC1 .....................  154 2 hits [enterobacteria]      magnesium transporter [Pectobacterium carotovorum subsp. ca
. . . . Campylobacter lari RM2100 .............................................  153 2 hits [e-proteobacteria]    Mg/Co/Ni transporter, MgtE family [Campylobacter lari RM210
. . . . Plesiocystis pacifica SIR-1 ...........................................  153 2 hits [d-proteobacteria]    magnesium (Mg2+) transporter-like protein [Plesiocystis pac
. . . . Nitrosomonas eutropha C91 .............................................  152 2 hits [b-proteobacteria]    magnesium transporter [Nitrosomonas eutropha C91] >gi|11430
. . . . Nitrosomonas europaea ATCC 19718 ......................................  152 2 hits [b-proteobacteria]    divalent cation transporter [Nitrosomonas europaea ATCC 197
. . . . Sodalis glossinidius str. 'morsitans' .................................  152 2 hits [enterobacteria]      putative magnesium transport protein [Sodalis glossinidius 
. . . . Sulfurovum sp. NBC37-1 ................................................  152 4 hits [e-proteobacteria]    magnesium transporter [Sulfurovum sp. NBC37-1] >gi|15142416
. . . . Chromobacterium violaceum ATCC 12472 ..................................  150 2 hits [b-proteobacteria]    magnesium transporter [Chromobacterium violaceum ATCC 12472
. . . . Desulfovibrio aespoeensis Aspo-2 ......................................  150 2 hits [d-proteobacteria]    magnesium transporter [Desulfovibrio aespoeensis Aspo-2] >g
. . . . Desulfonatronospira thiodismutans ASO3-1 ..............................  150 2 hits [d-proteobacteria]    magnesium transporter [Desulfonatronospira thiodismutans AS
. . . . Thioalkalivibrio sp. K90mix ...........................................  150 2 hits [g-proteobacteria]    magnesium transporter [Thioalkalivibrio sp. K90mix] >gi|288
. . . . Lutiella nitroferrum 2002 .............................................  149 2 hits [b-proteobacteria]    magnesium transporter [Lutiella nitroferrum 2002] >gi|22460
. . . . Desulfatibacillum alkenivorans AK-01 ..................................  148 2 hits [d-proteobacteria]    magnesium transporter [Desulfatibacillum alkenivorans AK-01
. . . . Pectobacterium wasabiae WPP163 ........................................  147 2 hits [enterobacteria]      magnesium transporter [Pectobacterium wasabiae WPP163] >gi|
. . . . Nitrosospira multiformis ATCC 25196 ...................................  147 2 hits [b-proteobacteria]    magnesium transporter [Nitrosospira multiformis ATCC 25196]
. . . . Desulfuromonas acetoxidans DSM 684 ....................................  147 2 hits [d-proteobacteria]    magnesium transporter [Desulfuromonas acetoxidans DSM 684] 
. . . . Pectobacterium carotovorum subsp. brasiliensis PBR1692 ................  147 1 hit  [enterobacteria]      magnesium transporter [Pectobacterium carotovorum subsp. br
. . . . Halorhodospira halophila SL1 ..........................................  146 2 hits [g-proteobacteria]    magnesium transporter [Halorhodospira halophila SL1] >gi|12
. . . . Psychrobacter arcticus 273-4 ..........................................  145 2 hits [g-proteobacteria]    Mg/Co/Ni transporter MgtE [Psychrobacter arcticus 273-4] >g
. . . Clostridium perfringens SM101 -------------------------------------------  207 2 hits [firmicutes]          magnesium transporter [Clostridium perfringens SM101] >gi|1
. . . Clostridium perfringens CPE str. F4969 ..................................  205 2 hits [firmicutes]          magnesium transporter [Clostridium perfringens CPE str. F49
. . . Clostridium perfringens str. 13 .........................................  205 2 hits [firmicutes]          magnesium transporter [Clostridium perfringens str. 13] >gi
. . . Clostridium perfringens ATCC 13124 ......................................  205 2 hits [firmicutes]          magnesium transporter [Clostridium perfringens str. 13] >gi
. . . Clostridium perfringens E str. JGS1987 ..................................  205 2 hits [firmicutes]          magnesium transporter [Clostridium perfringens str. 13] >gi
. . . Clostridium perfringens B str. ATCC 3626 ................................  205 2 hits [firmicutes]          magnesium transporter [Clostridium perfringens str. 13] >gi
. . . Clostridium perfringens NCTC 8239 .......................................  205 2 hits [firmicutes]          magnesium transporter [Clostridium perfringens str. 13] >gi
. . . Clostridium perfringens C str. JGS1495 ..................................  205 2 hits [firmicutes]          magnesium transporter [Clostridium perfringens str. 13] >gi
. . . Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)' ...............  204 2 hits [spirochetes]         putative divalent cation transporter; putative MgtE transpo
. . . Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)' ................  204 2 hits [spirochetes]         putative divalent cation transporter; putative MgtE transpo
. . . Leptospira interrogans serovar Lai str. 56601 ...........................  198 2 hits [spirochetes]         magnesium transporter [Leptospira interrogans serovar Lai s
. . . Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130 ..........  197 2 hits [spirochetes]         magnesium transporter [Leptospira interrogans serovar Copen
. . . Holdemania filiformis DSM 12042 .........................................  195 2 hits [firmicutes]          hypothetical protein HOLDEFILI_02974 [Holdemania filiformis
. . . Verrucomicrobiae bacterium DG1235 .......................................  194 2 hits [verrucomicrobia]     magnesium transporter [Verrucomicrobiae bacterium DG1235] >
. . . Leptospira borgpetersenii serovar Hardjo-bovis L550 .....................  194 2 hits [spirochetes]         magnesium transporter [Leptospira borgpetersenii serovar Ha
. . . Leptospira borgpetersenii serovar Hardjo-bovis JB197 ....................  194 2 hits [spirochetes]         magnesium transporter [Leptospira borgpetersenii serovar Ha
. . . Acidaminococcus fermentans DSM 20731 ....................................  191 2 hits [firmicutes]          magnesium transporter [Acidaminococcus fermentans DSM 20731
. . . Acidaminococcus sp. D21 .................................................  187 2 hits [firmicutes]          magnesium transporter [Acidaminococcus sp. D21] >gi|2269054
. . . Pedobacter sp. BAL39 ....................................................  180 2 hits [CFB group bacteria]  Mg/Co/Ni transporter [Pedobacter sp. BAL39] >gi|149233013|g
. . . Bulleidia extructa W1219 ................................................  179 2 hits [firmicutes]          magnesium transporter [Bulleidia extructa W1219] >gi|283104
. . . Herpetosiphon aurantiacus ATCC 23779 ....................................  179 2 hits [GNS bacteria]        magnesium transporter [Herpetosiphon aurantiacus ATCC 23779
. . . Catonella morbi ATCC 51271 ..............................................  179 2 hits [firmicutes]          hypothetical protein GCWU000282_00507 [Catonella morbi ATCC
. . . Dethiobacter alkaliphilus AHT 1 .........................................  178 2 hits [firmicutes]          magnesium transporter [Dethiobacter alkaliphilus AHT 1] >gi
. . . Pedobacter heparinus DSM 2366 ...........................................  175 2 hits [CFB group bacteria]  magnesium transporter [Pedobacter heparinus DSM 2366] >gi|2
. . . Granulicatella elegans ATCC 700633 ......................................  174 4 hits [firmicutes]          magnesium transporter [Granulicatella elegans ATCC 700633] 
. . . Exiguobacterium sibiricum 255-15 ........................................  174 2 hits [firmicutes]          magnesium transporter [Exiguobacterium sibiricum 255-15] >g
. . . Deferribacter desulfuricans SSM1 ........................................  173 1 hit  [bacteria]            magnesium transporter [Deferribacter desulfuricans SSM1]
. . . Bacillus coahuilensis m4-4 ..............................................  170 1 hit  [firmicutes]          magnesium (Mg2+) transporter [Bacillus coahuilensis m4-4]
. . . Bacillus selenitireducens MLS10 .........................................  167 4 hits [firmicutes]          Mg/Co/Ni transporter MgtE (contains CBS domain)-like protei
. . . Geobacillus sp. Y412MC10 ................................................  166 2 hits [firmicutes]          magnesium transporter [Geobacillus sp. Y412MC10] >gi|261285
. . . Bacillus sp. SG-1 .......................................................  165 4 hits [firmicutes]          magnesium (Mg2+) transporter [Bacillus sp. SG-1] >gi|148849
. . . Peptoniphilus lacrimalis 315-B ..........................................  165 4 hits [firmicutes]          magnesium transporter [Peptoniphilus lacrimalis 315-B] >gi|
. . . Bacillus sp. NRRL B-14911 ...............................................  165 4 hits [firmicutes]          magnesium (Mg2+) transporter [Bacillus sp. NRRL B-14911] >g
. . . Streptococcus sanguinis SK36 ............................................  165 2 hits [firmicutes]          magnesium/cobalt transporter, putative [Streptococcus sangu
. . . Anoxybacillus flavithermus WK1 ..........................................  164 2 hits [firmicutes]          Mg/Co/Ni transporter MgtE (contains CBS domain) [Anoxybacil
. . . Streptobacillus moniliformis DSM 12112 ..................................  164 2 hits [fusobacteria]        magnesium transporter [Streptobacillus moniliformis DSM 121
. . . Bacillus sp. B14905 .....................................................  164 2 hits [firmicutes]          magnesium (Mg2+) transporter [Bacillus sp. B14905] >gi|1265
. . . Granulicatella adiacens ATCC 49175 ......................................  163 2 hits [firmicutes]          magnesium transporter [Granulicatella adiacens ATCC 49175] 
. . . Bacillus cellulosilyticus DSM 2522 ......................................  163 6 hits [firmicutes]          magnesium transporter [Bacillus cellulosilyticus DSM 2522] 
. . . Halothermothrix orenii H 168 ............................................  162 2 hits [firmicutes]          magnesium transporter [Halothermothrix orenii H 168] >gi|21
. . . Lysinibacillus sphaericus C3-41 .........................................  162 2 hits [firmicutes]          magnesium (Mg2+) transporter [Lysinibacillus sphaericus C3-
. . . Bacillus halodurans .....................................................  162 1 hit  [firmicutes]          Ykok [Bacillus halodurans]
. . . Bacillus halodurans C-125 ...............................................  162 2 hits [firmicutes]          magnesium (Mg2+) transporter [Bacillus halodurans C-125] >g
. . . Oceanobacillus iheyensis HTE831 .........................................  159 2 hits [firmicutes]          magnesium (Mg2+) transporter [Oceanobacillus iheyensis HTE8
. . . Candidatus Desulforudis audaxviator MP104C ..............................  158 2 hits [firmicutes]          magnesium transporter [Candidatus Desulforudis audaxviator 
. . . cyanobacterium UCYN-A ...................................................  158 2 hits [cyanobacteria]       Mg2+ transporter MgtE [cyanobacterium UCYN-A] >gi|284809967
. . . Algoriphagus sp. PR1 ....................................................  157 2 hits [CFB group bacteria]  magnesium transporter [Algoriphagus sp. PR1] >gi|126579086|
. . . Staphylococcus epidermidis ATCC 12228 ...................................  157 2 hits [firmicutes]          Mg2+ transporter [Staphylococcus epidermidis ATCC 12228] >g
. . . Staphylococcus epidermidis W23144 .......................................  157 2 hits [firmicutes]          Mg2+ transporter [Staphylococcus epidermidis ATCC 12228] >g
. . . Staphylococcus epidermidis BCM-HMP0060 ..................................  157 2 hits [firmicutes]          Mg2+ transporter [Staphylococcus epidermidis ATCC 12228] >g
. . . Staphylococcus epidermidis SK135 ........................................  157 2 hits [firmicutes]          Mg2+ transporter [Staphylococcus epidermidis ATCC 12228] >g
. . . Staphylococcus epidermidis RP62A ........................................  157 2 hits [firmicutes]          magnesium transporter [Staphylococcus epidermidis RP62A] >g
. . . Bacillus pseudofirmus OF4 ...............................................  156 2 hits [firmicutes]          magnesium (Mg2+) transporter [Bacillus pseudofirmus OF4] >g
. . . Bacillus subtilis subsp. subtilis str. 168 ..............................  156 4 hits [firmicutes]          magnesium transporter [Bacillus subtilis subsp. subtilis st
. . . Bacillus subtilis subsp. subtilis str. NCIB 3610 ........................  156 1 hit  [firmicutes]          magnesium transporter [Bacillus subtilis subsp. subtilis st
. . . Bacillus subtilis subsp. subtilis str. JH642 ............................  156 1 hit  [firmicutes]          magnesium transporter [Bacillus subtilis subsp. subtilis st
. . . Bacillus subtilis subsp. subtilis str. SMY ..............................  156 1 hit  [firmicutes]          magnesium transporter [Bacillus subtilis subsp. subtilis st
. . . Bacillus subtilis .......................................................  156 1 hit  [firmicutes]          magnesium transporter [Bacillus subtilis subsp. subtilis st
. . . Bacillus amyloliquefaciens FZB42 ........................................  155 2 hits [firmicutes]          Mg2+ transporter [Bacillus amyloliquefaciens FZB42] >gi|154
. . . bacterium S5 ............................................................  154 2 hits [bacteria]            magnesium transporter [bacterium S5] >gi|288327729|gb|EFC66
. . . Bacillus licheniformis ATCC 14580 .......................................  154 4 hits [firmicutes]          divalent cation transporter [Bacillus licheniformis ATCC 14
. . . Sebaldella termitidis ATCC 33386 ........................................  153 2 hits [fusobacteria]        magnesium transporter [Sebaldella termitidis ATCC 33386] >g
. . . Staphylococcus capitis SK14 .............................................  152 2 hits [firmicutes]          magnesium transporter [Staphylococcus capitis SK14] >gi|222
. . . Pediococcus acidilactici 7_4 ............................................  152 2 hits [firmicutes]          magnesium transporter [Pediococcus acidilactici 7_4] >gi|27
. . . Flavobacteriales bacterium ALC-1 ........................................  151 2 hits [CFB group bacteria]  putative transmembrane Mg2+ transporter [Flavobacteriales b
. . . Macrococcus caseolyticus JCSC5402 .......................................  150 2 hits [firmicutes]          Mg2+ transporter [Macrococcus caseolyticus JCSC5402] >gi|22
. . . Staphylococcus haemolyticus JCSC1435 ....................................  150 2 hits [firmicutes]          hypothetical protein SH1949 [Staphylococcus haemolyticus JC
. . . Clostridium difficile QCD-23m63 .........................................  150 1 hit  [firmicutes]          putative Mg2+ transporter [Clostridium difficile QCD-23m63]
. . . Staphylococcus warneri L37603 ...........................................  150 2 hits [firmicutes]          magnesium transporter [Staphylococcus warneri L37603] >gi|2
. . . Hydrogenivirga sp. 128-5-R1-1 ...........................................  149 2 hits [aquificales]         magnesium (Mg2+) transporter-like protein [Hydrogenivirga s
. . . Clostridium butyricum E4 str. BoNT E BL5262 .............................  149 2 hits [firmicutes]          magnesium transporter [Clostridium butyricum E4 str. BoNT E
. . . Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 ............  149 2 hits [firmicutes]          putative divalent cation transport protein [Staphylococcus 
. . . Staphylococcus epidermidis M23864:W1 ....................................  149 2 hits [firmicutes]          magnesium transporter [Staphylococcus epidermidis M23864:W1
. . . Salinibacter ruber DSM 13855 ............................................  149 2 hits [CFB group bacteria]  magnesium transporter [Salinibacter ruber DSM 13855] >gi|83
. . . Gloeobacter violaceus PCC 7421 ..........................................  148 2 hits [cyanobacteria]       Mg2+ transporter [Gloeobacter violaceus PCC 7421] >gi|35212
. . . Anaerofustis stercorihominis DSM 17244 ..................................  148 2 hits [firmicutes]          hypothetical protein ANASTE_00167 [Anaerofustis stercorihom
. . . Flavobacteria bacterium MS024-3C ........................................  148 2 hits [CFB group bacteria]  magnesium transporter [Flavobacteria bacterium MS024-3C] >g
. . . Staphylococcus aureus subsp. aureus Mu50 ................................  148 2 hits [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus subsp. aureus N315 ................................  148 2 hits [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus subsp. aureus MW2 .................................  148 2 hits [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus subsp. aureus MSSA476 .............................  148 2 hits [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus RF122 .............................................  148 2 hits [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus subsp. aureus JH9 .................................  148 2 hits [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus subsp. aureus JH1 .................................  148 2 hits [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus subsp. aureus Mu3 .................................  148 2 hits [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus subsp. aureus str. CF-Marseille ...................  148 1 hit  [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus subsp. aureus Mu50-omega ..........................  148 1 hit  [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus A9781 .............................................  148 2 hits [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus A9763 .............................................  148 2 hits [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus A9719 .............................................  148 2 hits [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus A8115 .............................................  148 2 hits [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus A6300 .............................................  148 2 hits [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus A6224 .............................................  148 2 hits [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus A5937 .............................................  148 2 hits [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus subsp. aureus ED98 ................................  148 2 hits [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus A8117 .............................................  148 2 hits [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus subsp. aureus D139 ................................  148 2 hits [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus A10102 ............................................  148 2 hits [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus subsp. aureus H19 .................................  148 2 hits [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus subsp. aureus ST398 ...............................  148 1 hit  [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Staphylococcus aureus 04-02981 ..........................................  148 1 hit  [firmicutes]          Mg2 transporter [Staphylococcus aureus subsp. aureus Mu50] 
. . . Mollicutes bacterium D7 .................................................  148 2 hits [mycoplasmas]         magnesium transporter [Mollicutes bacterium D7] >gi|2293817
. . . Staphylococcus aureus subsp. aureus C427 ................................  148 2 hits [firmicutes]          magnesium transporter [Staphylococcus aureus subsp. aureus 
. . . Staphylococcus aureus subsp. aureus TCH70 ...............................  147 2 hits [firmicutes]          MgtE family magnesium (Mg2+)/cobalt (Co2+) transporter-E [S
. . . Staphylococcus aureus subsp. aureus USA300_TCH959 .......................  147 2 hits [firmicutes]          MgtE family magnesium (Mg2+)/cobalt (Co2+) transporter-E [S
. . . Staphylococcus aureus subsp. aureus COL .................................  147 2 hits [firmicutes]          magnesium transporter [Staphylococcus aureus subsp. aureus 
. . . Staphylococcus aureus subsp. aureus USA300_FPR3757 ......................  147 2 hits [firmicutes]          magnesium transporter [Staphylococcus aureus subsp. aureus 
. . . Staphylococcus aureus subsp. aureus NCTC 8325 ...........................  147 2 hits [firmicutes]          magnesium transporter [Staphylococcus aureus subsp. aureus 
. . . Staphylococcus aureus subsp. aureus str. Newman .........................  147 2 hits [firmicutes]          magnesium transporter [Staphylococcus aureus subsp. aureus 
. . . Staphylococcus aureus subsp. aureus USA300_TCH1516 ......................  147 2 hits [firmicutes]          magnesium transporter [Staphylococcus aureus subsp. aureus 
. . . Staphylococcus aureus subsp. aureus str. JKD6008 ........................  147 1 hit  [firmicutes]          magnesium transporter [Staphylococcus aureus subsp. aureus 
. . . Staphylococcus aureus subsp. aureus str. JKD6009 ........................  147 1 hit  [firmicutes]          magnesium transporter [Staphylococcus aureus subsp. aureus 
. . . Staphylococcus aureus subsp. aureus TCH130 ..............................  147 2 hits [firmicutes]          magnesium transporter [Staphylococcus aureus subsp. aureus 
. . . Staphylococcus aureus A5948 .............................................  147 2 hits [firmicutes]          magnesium transporter [Staphylococcus aureus subsp. aureus 
. . . Staphylococcus aureus D30 ...............................................  147 2 hits [firmicutes]          magnesium transporter [Staphylococcus aureus subsp. aureus 
. . . Staphylococcus aureus 930918-3 ..........................................  147 2 hits [firmicutes]          magnesium transporter [Staphylococcus aureus subsp. aureus 
. . . Staphylococcus aureus A9765 .............................................  147 2 hits [firmicutes]          magnesium transporter [Staphylococcus aureus subsp. aureus 
. . . Staphylococcus aureus subsp. aureus 132 .................................  147 1 hit  [firmicutes]          magnesium transporter [Staphylococcus aureus subsp. aureus 
. . . Staphylococcus aureus subsp. aureus TW20 ................................  147 1 hit  [firmicutes]          magnesium transporter [Staphylococcus aureus subsp. aureus 
. . . Clostridium ramosum DSM 1402 ............................................  147 2 hits [firmicutes]          hypothetical protein CLORAM_00740 [Clostridium ramosum DSM 
. . . Ruminococcus gnavus ATCC 29149 ..........................................  147 2 hits [firmicutes]          hypothetical protein RUMGNA_03692 [Ruminococcus gnavus ATCC
. . . Staphylococcus aureus A9299 .............................................  147 2 hits [firmicutes]          magnesium transporter [Staphylococcus aureus A9299] >gi|257
. . . Sulfurihydrogenibium sp. YO3AOP1 ........................................  147 2 hits [aquificales]         magnesium transporter [Sulfurihydrogenibium sp. YO3AOP1] >g
. . . Staphylococcus carnosus subsp. carnosus TM300 ...........................  147 2 hits [firmicutes]          putative divalent cation transporter [Staphylococcus carnos
. . . Bacillus pumilus SAFR-032 ...............................................  146 2 hits [firmicutes]          Mg2+/Co2+ transporter [Bacillus pumilus SAFR-032] >gi|15768
. . . Eubacterium ventriosum ATCC 27560 .......................................  146 2 hits [firmicutes]          hypothetical protein EUBVEN_02416 [Eubacterium ventriosum A
. . . Staphylococcus aureus subsp. aureus MRSA252 .............................  146 2 hits [firmicutes]          putative divalent cation transport protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus MN8 .................................  146 2 hits [firmicutes]          putative divalent cation transport protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus 55/2053 .............................  146 2 hits [firmicutes]          putative divalent cation transport protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus 65-1322 .............................  146 2 hits [firmicutes]          putative divalent cation transport protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus 68-397 ..............................  146 2 hits [firmicutes]          putative divalent cation transport protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus E1410 ...............................  146 2 hits [firmicutes]          putative divalent cation transport protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus M876 ................................  146 2 hits [firmicutes]          putative divalent cation transport protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus C160 ................................  146 2 hits [firmicutes]          putative divalent cation transport protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus Btn1260 .............................  146 2 hits [firmicutes]          putative divalent cation transport protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus WW2703/97 ...........................  146 2 hits [firmicutes]          putative divalent cation transport protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus M899 ................................  146 2 hits [firmicutes]          putative divalent cation transport protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus C101 ................................  146 2 hits [firmicutes]          putative divalent cation transport protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus A017934/97 ..........................  146 2 hits [firmicutes]          putative divalent cation transport protein [Staphylococcus 
. . . Staphylococcus aureus subsp. aureus M1015 ...............................  146 1 hit  [firmicutes]          putative divalent cation transport protein [Staphylococcus 
. . . Staphylococcus aureus A9635 .............................................  146 2 hits [firmicutes]          magnesium transporter [Staphylococcus aureus A9635] >gi|257
. . . Pediococcus pentosaceus ATCC 25745 ......................................  146 2 hits [firmicutes]          transcriptional regulator [Pediococcus pentosaceus ATCC 257
. . . Microscilla marina ATCC 23134 ...........................................  146 2 hits [CFB group bacteria]  magnesium transporter [Microscilla marina ATCC 23134] >gi|1
. . . Clostridium difficile QCD-66c26 .........................................  146 1 hit  [firmicutes]          putative Mg2+ transporter [Clostridium difficile QCD-66c26]
. . . Clostridium difficile CIP 107932 ........................................  146 1 hit  [firmicutes]          putative Mg2+ transporter [Clostridium difficile QCD-66c26]
. . . Clostridium difficile QCD-63q42 .........................................  146 1 hit  [firmicutes]          putative Mg2+ transporter [Clostridium difficile QCD-66c26]
. . . Clostridium difficile ATCC 43255 ........................................  146 1 hit  [firmicutes]          putative Mg2+ transporter [Clostridium difficile QCD-66c26]
. . . Clostridium difficile QCD-76w55 .........................................  146 1 hit  [firmicutes]          putative Mg2+ transporter [Clostridium difficile QCD-66c26]
. . . Clostridium difficile QCD-97b34 .........................................  146 1 hit  [firmicutes]          putative Mg2+ transporter [Clostridium difficile QCD-66c26]
. . . Clostridium difficile QCD-37x79 .........................................  146 1 hit  [firmicutes]          putative Mg2+ transporter [Clostridium difficile QCD-66c26]
. . . Clostridium difficile CD196 .............................................  146 2 hits [firmicutes]          putative Mg2+ transporter [Clostridium difficile QCD-66c26]
. . . Clostridium difficile R20291 ............................................  146 2 hits [firmicutes]          putative Mg2+ transporter [Clostridium difficile QCD-66c26]
. . . Staphylococcus aureus subsp. aureus TCH60 ...............................  146 2 hits [firmicutes]          MgtE family magnesium (Mg2+)/cobalt (Co2+) transporter-E [S
. . . Staphylococcus aureus subsp. aureus WBG10049 ............................  146 2 hits [firmicutes]          MgtE family magnesium (Mg2+)/cobalt (Co2+) transporter-E [S
. . . Bacillus pumilus ATCC 7061 ..............................................  146 2 hits [firmicutes]          magnesium transporter [Bacillus pumilus ATCC 7061] >gi|1940
. . . Clostridium difficile 630 ...............................................  146 2 hits [firmicutes]          putative Mg2+ transporter [Clostridium difficile 630] >gi|1
. . . Clostridium difficile QCD-32g58 .........................................  146 1 hit  [firmicutes]          hypothetical protein CdifQ_04002831 [Clostridium difficile 
. . . Ruminococcus torques ATCC 27756 .........................................  146 2 hits [firmicutes]          hypothetical protein RUMTOR_00255 [Ruminococcus torques ATC
. . . Fusobacterium nucleatum subsp. polymorphum ATCC 10953 ...................  145 2 hits [fusobacteria]        MgtE family magnesium (Mg2+)/cobalt (Co2+) transporter-E [F
. . . Dyadobacter fermentans DSM 18053 ........................................  145 2 hits [CFB group bacteria]  magnesium transporter [Dyadobacter fermentans DSM 18053] >g
. . . Clostridium hylemonae DSM 15053 .........................................  145 2 hits [firmicutes]          hypothetical protein CLOHYLEM_04487 [Clostridium hylemonae 
. . . Synechococcus sp. PCC 7002 ..............................................  145 2 hits [cyanobacteria]       magnesium transporter [Synechococcus sp. PCC 7002] >gi|1698
. . . Fusobacterium sp. D11 ...................................................  144 3 hits [fusobacteria]        MG2+ transporter MGTE [Fusobacterium sp. D11] >gi|289765415
. . . Jonquetella anthropi E3_33 E1 ...........................................  144 2 hits [bacteria]            magnesium transporter [Jonquetella anthropi E3_33 E1] >gi|2
. . . Fusobacterium sp. 7_1 ...................................................  144 2 hits [fusobacteria]        MG2+ transporter MGTE [Fusobacterium sp. 7_1] >gi|260495164
. . . Fusobacterium sp. 3_1_33 ................................................  144 2 hits [fusobacteria]        MG2+ transporter MGTE [Fusobacterium sp. 7_1] >gi|260495164
. . . uncultured bacterium ....................................................  144 1 hit  [bacteria]            hypothetical protein [uncultured bacterium]
. . Haloterrigena turkmenica DSM 5511 -----------------------------------------  152 2 hits [euryarchaeotes]      MgtE integral membrane region [Haloterrigena turkmenica DSM
. uncultured organism ---------------------------------------------------------  317 1 hit  [unclassified]        divalent cation transporter [uncultured organism]

BLAST

PROTOCOL


a) BLASTp versus NR, NCBI default parameters apart from "Max target sequences_1000"


RESULTS ANALYSIS


The blastp and blastx search with the 12 best alignments, all homologous to our ORF point to the fact that the homolog proteins have very low E values (2e-155 to 4e-19), a high score number (552 to 99.8), the number of hits describing the same protein type "Magnesium transporter" is high, and that the percentage of identity of the comparing sequences are high in both Blastp and Blastx, suggesting that the protein is a Magnesium transporter.


Upon closer comparison of Blastp and Blastx results, we can see that the score on Blastp is generally higher than Blastx, and that the E values on Blastp are generally lower than Blastx, suggesting that our Orf produces the best results

RAW RESULTS

a) BLASTp

Sequences producing significant alignments:                       (Bits)  Value

ref|YP_266497.1|  magnesium transport protein mgtE [Candidatus...   552    2e-155
ref|ZP_05069612.1|  magnesium transporter [Candidatus Pelagiba...   525    3e-147
ref|ZP_06054915.1|  magnesium transporter [alpha proteobacteri...   354    6e-96 
ref|ZP_01437807.1|  probable magnesium transporter protein [Fu...   334    8e-90 
ref|ZP_02167932.1|  putative transmembrane cationic transporte...   329    2e-88 
ref|ZP_01227484.1|  Mg/Co/Ni transporter [Aurantimonas mangano...   323    1e-86 
ref|YP_673645.1|  magnesium transporter [Mesorhizobium sp. BNC...   323    1e-86 
ref|ZP_05807852.1|  magnesium transporter [Mesorhizobium oppor...   323    1e-86 
ref|YP_001326721.1|  magnesium transporter [Sinorhizobium medi...   323    2e-86 
ref|NP_102935.1|  magnesium transporter [Mesorhizobium loti MA...   322    2e-86 
ref|YP_002825773.1|  putative transmembrane cationic transport...   318    7e-85 
emb|CAK32552.1|  divalent cation transporter [uncultured organ...   317    1e-84 
ref|YP_001414043.1|  magnesium transporter [Parvibaculum lavam...   315    4e-84 
ref|ZP_03517069.1|  magnesium transporter protein [Rhizobium e...   315    6e-84 
ref|YP_768135.1|  putative transmembrane cationic transporter ...   314    1e-83 
ref|YP_469726.1|  magnesium transporter protein [Rhizobium etl...   313    1e-83 
ref|YP_002281377.1|  magnesium transporter [Rhizobium legumino...   313    2e-83 
ref|YP_001978460.1|  probable magnesium transporter protein [R...   313    2e-83 
ref|YP_002975886.1|  magnesium transporter [Rhizobium legumino...   312    3e-83 
ref|YP_002544605.1|  magnesium transporter [Agrobacterium radi...   311    8e-83 
ref|NP_354549.2|  magnesium transport protein [Agrobacterium t...   310    9e-83 
ref|YP_002549888.1|  magnesium transport protein [Agrobacteriu...   310    1e-82 
ref|ZP_05114291.1|  magnesium transporter [Labrenzia alexandri...   306    2e-81 
ref|NP_385509.1|  putative transporter transmembrane protein [...   304    1e-80 
ref|ZP_05083691.1|  magnesium transporter [Pseudovibrio sp. JE...   303    1e-80 
ref|ZP_01305195.1|  magnesium transporter [Sphingomonas sp. SK...   301    9e-80 
ref|ZP_01548512.1|  probable magnesium transporter protein [St...   300    1e-79 
ref|ZP_05343108.1|  magnesium transporter [Thalassiobium sp. R...   297    1e-78 
ref|ZP_05079063.1|  magnesium transporter [Rhodobacterales bac...   296    2e-78 
ref|ZP_01058601.1|  magnesium transporter [Roseobacter sp. MED...   296    2e-78 
ref|ZP_05089045.1|  magnesium transporter [Ruegeria sp. R11] >...   295    3e-78 
ref|YP_001418963.1|  magnesium transporter [Xanthobacter autot...   295    4e-78 
ref|ZP_01864358.1|  Mg/Co/Ni transporter [Erythrobacter sp. SD...   295    4e-78 
ref|ZP_05786938.1|  magnesium transporter [Silicibacter lacusc...   294    9e-78 
ref|ZP_01754930.1|  magnesium transporter [Roseobacter sp. SK2...   293    1e-77 
ref|ZP_01743801.1|  magnesium transporter [Rhodobacterales bac...   293    2e-77 
ref|YP_616196.1|  magnesium transporter [Sphingopyxis alaskens...   292    3e-77 
ref|ZP_02148251.1|  magnesium transporter [Phaeobacter gallaec...   292    3e-77 
ref|ZP_02144875.1|  hypothetical protein RGBS107_18043 [Phaeob...   292    4e-77 
ref|ZP_00957822.1|  magnesium transporter [Oceanicaulis alexan...   290    1e-76 
ref|ZP_05779968.1|  magnesium transporter [Citreicella sp. SE4...   289    3e-76 
ref|YP_168163.1|  magnesium transporter [Ruegeria pomeroyi DSS...   287    9e-76 
ref|ZP_01442429.1|  magnesium transporter [Roseovarius sp. HTC...   287    1e-75 
ref|YP_613899.1|  magnesium transporter [Ruegeria sp. TM1040] ...   287    1e-75 
ref|YP_001264017.1|  magnesium transporter [Sphingomonas witti...   286    1e-75 
ref|ZP_05054617.1|  magnesium transporter [Octadecabacter anta...   285    4e-75 
ref|ZP_01018209.1|  magnesium transporter [Parvularcula bermud...   285    4e-75 
ref|YP_001525751.1|  divalent cation transporter [Azorhizobium...   285    5e-75 
ref|ZP_05740654.1|  magnesium transporter [Silicibacter sp. Tr...   285    5e-75 
ref|ZP_01902938.1|  hypothetical protein RAZWK3B_20441 [Roseob...   284    8e-75 
ref|ZP_05067231.1|  magnesium transporter [Octadecabacter anta...   284    9e-75 
ref|YP_427082.1|  divalent cation transporter [Rhodospirillum ...   283    1e-74 
ref|YP_003447633.1|  magnesium transporter [Azospirillum sp. B...   283    2e-74 
ref|ZP_00956982.1|  magnesium transporter [Sulfitobacter sp. E...   282    4e-74 
ref|ZP_00964006.1|  magnesium transporter [Sulfitobacter sp. N...   281    5e-74 
ref|ZP_02153301.1|  putative magnesium transporter [Oceanibulb...   281    7e-74 
ref|ZP_01157032.1|  magnesium transporter [Oceanicola granulos...   281    9e-74 
ref|ZP_02140878.1|  putative magnesium transporter [Roseobacte...   281    1e-73 
ref|ZP_05122945.1|  magnesium transporter [Rhodobacteraceae ba...   280    1e-73 
ref|YP_510665.1|  magnesium transporter [Jannaschia sp. CCS1] ...   280    2e-73 
ref|ZP_01745024.1|  magnesium transporter [Sagittula stellata ...   280    2e-73 
ref|ZP_00958579.1|  magnesium transporter [Roseovarius nubinhi...   280    2e-73 
ref|ZP_00998533.1|  magnesium transporter [Oceanicola batsensi...   279    2e-73 
ref|ZP_01011299.1|  magnesium transporter [Rhodobacterales bac...   279    3e-73 
ref|YP_756972.1|  magnesium transporter [Maricaulis maris MCS1...   278    7e-73 
ref|ZP_01750853.1|  magnesium transporter [Roseobacter sp. CCS...   276    2e-72 
ref|YP_002296657.1|  magnesium transporter, putative [Rhodospi...   276    3e-72 
ref|ZP_02190832.1|  Divalent cation transporter [alpha proteob...   275    3e-72 
ref|ZP_01040198.1|  Mg/Co/Ni transporter [Erythrobacter sp. NA...   275    4e-72 
emb|CAM74419.1|  Divalent cation transporter [Magnetospirillum...   273    1e-71 
ref|ZP_05101744.1|  magnesium transporter [Roseobacter sp. GAI...   273    2e-71 
ref|YP_496244.1|  magnesium transporter [Novosphingobium aroma...   273    2e-71 
ref|YP_782334.1|  magnesium transporter [Rhodopseudomonas palu...   273    3e-71 
ref|YP_458596.1|  Mg/Co/Ni transporter [Erythrobacter litorali...   273    3e-71 
ref|ZP_01037939.1|  magnesium transporter [Roseovarius sp. 217...   271    5e-71 
ref|ZP_05075712.1|  magnesium transporter [Rhodobacterales bac...   271    5e-71 
ref|NP_948502.1|  magnesium transporter [Rhodopseudomonas palu...   271    8e-71 
ref|YP_001992548.1|  magnesium transporter [Rhodopseudomonas p...   271    1e-70 
ref|YP_003225642.1|  magnesium transporter [Zymomonas mobilis ...   271    1e-70 
ref|YP_162505.1|  magnesium transporter [Zymomonas mobilis sub...   270    1e-70 
ref|YP_001240721.1|  putative magnesium transporter MgtE-like ...   270    1e-70 
ref|ZP_06357955.1|  magnesium transporter [Rhodopseudomonas pa...   270    1e-70 
ref|ZP_01449081.1|  magnesium transporter [alpha proteobacteri...   270    1e-70 
ref|YP_001206519.1|  putative magnesium transporter MgtE-like ...   270    1e-70 
ref|ZP_05034050.1|  magnesium transporter [Brevundimonas sp. B...   270    2e-70 
ref|YP_533201.1|  magnesium transporter [Rhodopseudomonas palu...   269    3e-70 
ref|YP_759988.1|  magnesium transporter [Hyphomonas neptunium ...   269    4e-70 
ref|YP_570202.1|  magnesium transporter [Rhodopseudomonas palu...   269    4e-70 
ref|ZP_01880676.1|  magnesium transporter [Roseovarius sp. TM1...   267    9e-70 
ref|ZP_06119624.1|  magnesium transporter [Caulobacter segnis ...   267    1e-69 
ref|NP_420977.1|  magnesium transporter [Caulobacter crescentu...   266    3e-69 
ref|YP_485995.1|  magnesium transporter [Rhodopseudomonas palu...   265    4e-69 
ref|YP_682299.1|  putative magnesium transporter [Roseobacter ...   264    1e-68 
ref|YP_351946.1|  Mg/Co/Ni transporter, MgtE [Rhodobacter spha...   263    1e-68 
ref|YP_001042434.1|  magnesium transporter [Rhodobacter sphaer...   263    2e-68 
ref|YP_001534104.1|  putative magnesium transporter [Dinoroseo...   263    2e-68 
ref|ZP_01002667.1|  magnesium transporter [Loktanella vestfold...   262    3e-68 
ref|ZP_06170823.1|  magnesium transporter [Brevundimonas subvi...   260    1e-67 
ref|ZP_05842608.1|  magnesium transporter [Rhodobacter sp. SW2...   260    1e-67 
ref|YP_003060398.1|  magnesium transporter [Hirschia baltica A...   258    4e-67 
ref|ZP_04771329.1|  magnesium transporter [Asticcacaulis excen...   256    2e-66 
ref|YP_001684784.1|  magnesium transporter [Caulobacter sp. K3...   255    5e-66 
ref|YP_002361029.1|  magnesium transporter [Methylocella silve...   255    6e-66 
ref|YP_001166509.1|  magnesium transporter [Rhodobacter sphaer...   246    3e-63 
ref|YP_001832739.1|  magnesium transporter [Beijerinckia indic...   242    3e-62 
ref|YP_002130125.1|  magnesium transporter [Phenylobacterium z...   241    8e-62 
ref|NP_771891.1|  putative transporter transmembrane protein [...   239    2e-61 
ref|YP_915183.1|  magnesium transporter [Paracoccus denitrific...   238    5e-61 
ref|NP_966168.1|  magnesium transporter [Wolbachia endosymbion...   230    1e-58 
ref|ZP_00372323.1|  magnesium transporter [Wolbachia endosymbi...   230    1e-58 
ref|YP_001976100.1|  magnesium transporter [Wolbachia endosymb...   229    3e-58 
ref|YP_198125.1|  Mg/Co/Ni transporter MgtE [Wolbachia endosym...   227    1e-57 
ref|YP_303093.1|  divalent cation transporter [Ehrlichia canis...   227    1e-57 
ref|YP_180324.1|  magnesium transporter [Ehrlichia ruminantium...   220    2e-55 
ref|YP_505094.1|  magnesium transporter [Anaplasma phagocytoph...   218    8e-55 
ref|ZP_03787700.1|  magnesium transporter [Wolbachia endosymbi...   217    1e-54 
ref|YP_507383.1|  magnesium transporter [Ehrlichia chaffeensis...   216    2e-54 
ref|YP_003081660.1|  magnesium transporter [Neorickettsia rist...   213    2e-53 
ref|YP_506350.1|  magnesium transporter [Neorickettsia sennets...   213    2e-53 
gb|EEZ79613.1|  Mg/Co/Ni transporter MgtE [uncultured SUP05 cl...   207    1e-51 
ref|YP_698577.1|  magnesium transporter [Clostridium perfringe...   207    1e-51 
ref|YP_001219265.1|  magnesium transporter MgtE [Candidatus Ve...   206    3e-51 
ref|ZP_02638685.1|  magnesium transporter [Clostridium perfrin...   205    6e-51 
ref|NP_562156.1|  magnesium transporter [Clostridium perfringe...   205    6e-51 
ref|YP_001839214.1|  putative divalent cation transporter; put...   204    8e-51 
ref|ZP_01617564.1|  magnesium transporter [marine gamma proteo...   204    1e-50 
ref|YP_002563611.1|  magnesium transporter (mgtE) [Anaplasma m...   204    1e-50 
ref|YP_153904.1|  magnesium transporter [Anaplasma marginale s...   204    1e-50 
ref|YP_391240.1|  magnesium transporter [Thiomicrospira crunog...   202    4e-50 
ref|ZP_04715982.1|  Mg/Co/Ni transporter MgtE (contains CBS do...   201    6e-50 
ref|ZP_01308304.1|  magnesium transporter [Oceanobacter sp. RE...   200    2e-49 
ref|YP_944199.1|  magnesium transporter [Psychromonas ingraham...   199    2e-49 
ref|YP_003328571.1|  magnesium transporter [Anaplasma centrale...   199    2e-49 
ref|YP_002127486.1|  Mg/Co/Ni transporter MgtE (contains CBS d...   199    2e-49 
ref|ZP_01166887.1|  Divalent cation transporter [Oceanospirill...   198    6e-49 
ref|NP_712398.1|  magnesium transporter [Leptospira interrogan...   198    6e-49 
ref|YP_001664.1|  magnesium transporter [Leptospira interrogan...   197    1e-48 
ref|ZP_01044078.1|  Mg/Co/Ni transporter MgtE (contains CBS do...   197    1e-48 
ref|ZP_05103369.1|  magnesium transporter [Methylophaga thioox...   197    2e-48 
ref|YP_462260.1|  Mg/Co/Ni transporter [Syntrophus aciditrophi...   196    2e-48 
ref|ZP_01113760.1|  magnesium transporter [Reinekea sp. MED297...   196    2e-48 
ref|YP_660228.1|  magnesium transporter [Pseudoalteromonas atl...   196    3e-48 
ref|YP_436423.1|  magnesium transporter [Hahella chejuensis KC...   195    5e-48 
ref|ZP_03635668.1|  hypothetical protein HOLDEFILI_02974 [Hold...   195    6e-48 
ref|YP_154783.1|  Mg2+/Co2+ transporter [Idiomarina loihiensis...   195    6e-48 
ref|ZP_01223678.1|  Mg/Co/Ni transporter MgtE [marine gamma pr...   194    8e-48 
ref|ZP_01449999.1|  magnesium transporter [alpha proteobacteri...   194    9e-48 
ref|ZP_05056027.1|  magnesium transporter [Verrucomicrobiae ba...   194    1e-47 
ref|ZP_06156783.1|  magnesium transporter [Photobacterium dams...   194    1e-47 
ref|YP_797983.1|  magnesium transporter [Leptospira borgpeters...   194    2e-47 
ref|YP_903684.1|  magnesium transporter [Candidatus Ruthia mag...   193    2e-47 
ref|YP_866971.1|  magnesium transporter [Magnetococcus sp. MC-...   191    7e-47 
ref|ZP_01076359.1|  Divalent cation transporter [Marinomonas s...   191    7e-47 
ref|ZP_05040555.1|  magnesium transporter [Alcanivorax sp. DG8...   191    9e-47 
ref|YP_003398947.1|  magnesium transporter [Acidaminococcus fe...   191    1e-46 
ref|YP_001492118.1|  magnesium transporter [Rickettsia canaden...   190    1e-46 
ref|YP_002155139.1|  magnesium transporter [Vibrio fischeri MJ...   190    2e-46 
ref|YP_203765.1|  magnesium transporter [Vibrio fischeri ES114...   190    2e-46 
ref|NP_638158.1|  Mg++ transporter [Xanthomonas campestris pv....   189    2e-46 
ref|ZP_01216385.1|  Mg/Co/Ni transporter MgtE (contains CBS do...   189    3e-46 
ref|YP_692261.1|  magnesium transporter [Alcanivorax borkumens...   189    3e-46 
ref|ZP_01899228.1|  putative magnesium transporter [Moritella ...   189    4e-46 
ref|YP_002262016.1|  magnesium transporter [Aliivibrio salmoni...   189    5e-46 
ref|ZP_01739718.1|  magnesium transporter [Marinobacter sp. EL...   189    5e-46 
ref|NP_220953.1|  magnesium transporter (mgtE) [Rickettsia pro...   188    8e-46 
ref|YP_246967.1|  magnesium transporter [Rickettsia felis URRW...   187    9e-46 
ref|YP_067520.1|  magnesium transporter [Rickettsia typhi str....   187    1e-45 
ref|ZP_03989763.1|  magnesium transporter [Acidaminococcus sp....   187    1e-45 
ref|YP_001936935.1|  magnesium transporter [Orientia tsutsugam...   186    2e-45 
ref|YP_001494986.1|  magnesium transporter [Rickettsia rickett...   186    3e-45 
ref|YP_002916496.1|  Mg2+ transporter [Rickettsia peacockii st...   186    3e-45 
ref|YP_959982.1|  magnesium transporter [Marinobacter aquaeole...   185    6e-45 
ref|YP_001499545.1|  magnesium transporter [Rickettsia massili...   185    6e-45 
ref|YP_538169.1|  magnesium transporter [Rickettsia bellii RML...   185    6e-45 
ref|NP_360523.1|  magnesium transporter [Rickettsia conorii st...   184    8e-45 
ref|YP_001248367.1|  magnesium transporter [Orientia tsutsugam...   184    8e-45 
ref|YP_002151311.1|  magnesium transporter [Proteus mirabilis ...   184    9e-45 
ref|ZP_00142961.1|  magnesium transporter [Rickettsia sibirica...   184    9e-45 
ref|YP_343838.1|  divalent cation transporter [Nitrosococcus o...   184    1e-44 
ref|YP_001503468.1|  magnesium transporter [Shewanella pealean...   184    1e-44 
ref|ZP_05881069.1|  mg/Co/Ni transporter MgtE (contains CBS do...   184    1e-44 
ref|YP_003444793.1|  magnesium transporter [Allochromatium vin...   184    1e-44 
ref|YP_002027334.1|  magnesium transporter [Stenotrophomonas m...   184    2e-44 
ref|ZP_01161698.1|  putative magnesium transporter [Photobacte...   183    2e-44 
ref|YP_001970975.1|  putative MgtE/divalent cation transmembra...   183    2e-44 
ref|ZP_05134674.1|  magnesium transporter [Stenotrophomonas sp...   183    2e-44 
ref|ZP_03840316.1|  magnesium transporter [Proteus mirabilis A...   183    2e-44 
dbj|BAA85890.1|  unnamed protein product [Shewanella violacea]      183    2e-44 
ref|ZP_02242410.1|  Mg++ transporter [Xanthomonas oryzae pv. o...   183    2e-44 
ref|YP_868311.1|  magnesium transporter [Shewanella sp. ANA-3]...   183    2e-44 
ref|ZP_03801994.1|  hypothetical protein PROPEN_00324 [Proteus...   183    2e-44 
ref|YP_732805.1|  magnesium transporter [Shewanella sp. MR-4] ...   183    2e-44 
ref|YP_001493682.1|  magnesium transporter [Rickettsia akari s...   183    2e-44 
ref|ZP_01235992.1|  putative magnesium transporter [Vibrio ang...   183    3e-44 
ref|YP_001341278.1|  magnesium transporter [Marinomonas sp. MW...   182    3e-44 
ref|ZP_05720679.1|  magnesium transporter [Vibrio mimicus VM60...   182    3e-44 
ref|ZP_05127343.1|  magnesium transporter [gamma proteobacteri...   182    3e-44 
ref|ZP_04917796.1|  magnesium transporter [Vibrio cholerae RC3...   182    3e-44 
ref|YP_739393.1|  magnesium transporter [Shewanella sp. MR-7] ...   182    4e-44 
ref|YP_002356644.1|  magnesium transporter [Shewanella baltica...   182    4e-44 
ref|ZP_01895759.1|  magnesium transporter [Marinobacter algico...   182    4e-44 
ref|YP_199915.1|  Mg++ transporter [Xanthomonas oryzae pv. ory...   182    4e-44 
ref|ZP_01987257.1|  magnesium transporter [Vibrio harveyi HY01...   182    4e-44 
ref|NP_719496.1|  magnesium transporter [Shewanella oneidensis...   182    4e-44 
ref|NP_232162.1|  magnesium transporter [Vibrio cholerae O1 bi...   182    4e-44 
ref|ZP_01677658.1|  magnesium transporter [Vibrio cholerae 274...   182    4e-44 
ref|YP_002310077.1|  hypothetical protein swp_0672 [Shewanella...   182    4e-44 
ref|YP_001553149.1|  magnesium transporter [Shewanella baltica...   182    4e-44 
ref|YP_001915053.1|  magnesium transporter [Xanthomonas oryzae...   182    5e-44 
ref|YP_003467966.1|  putative divalent cation transport protei...   182    5e-44 
ref|ZP_05717792.1|  magnesium transporter [Vibrio mimicus VM57...   182    6e-44 
ref|YP_001364901.1|  magnesium transporter [Shewanella baltica...   181    7e-44 
ref|YP_001446810.1|  hypothetical protein VIBHAR_03669 [Vibrio...   181    7e-44 
ref|YP_964829.1|  magnesium transporter [Shewanella sp. W3-18-...   181    7e-44 
ref|ZP_01706693.1|  magnesium transporter [Shewanella putrefac...   181    8e-44 
ref|ZP_05093191.1|  magnesium transporter [marine gamma proteo...   181    8e-44 
ref|ZP_04922696.1|  magnesium transporter [Vibrio sp. Ex25] >r...   181    9e-44 
ref|YP_131368.1|  putative magnesium transporter [Photobacteri...   181    9e-44 
emb|CBA74938.1|  magnesium transporter [Arsenophonus nasoniae]      181    1e-43 
ref|ZP_01135803.1|  putative magnesium transporter [Pseudoalte...   181    1e-43 
ref|ZP_01882637.1|  Mg/Co/Ni transporter [Pedobacter sp. BAL39...   180    1e-43 
ref|YP_001052017.1|  magnesium transporter [Shewanella baltica...   180    1e-43 
ref|ZP_04413922.1|  magnesium transporter [Vibrio cholerae bv....   180    2e-43 
ref|ZP_06049767.1|  magnesium transporter [Vibrio cholerae CT ...   180    2e-43 
ref|ZP_04416925.1|  magnesium transporter [Vibrio cholerae 121...   180    2e-43 
ref|ZP_01612144.1|  putative magnesium transporter [Alteromona...   180    2e-43 
ref|YP_001095441.1|  magnesium transporter [Shewanella loihica...   180    2e-43 
ref|ZP_05888338.1|  magnesium transporter [Vibrio coralliilyti...   180    2e-43 
ref|YP_752057.1|  magnesium transporter [Shewanella frigidimar...   179    3e-43 
ref|ZP_01220992.1|  putative magnesium transporter [Photobacte...   179    3e-43 
ref|YP_001675909.1|  magnesium transporter [Shewanella halifax...   179    3e-43 
ref|ZP_06341247.1|  magnesium transporter [Bulleidia extructa ...   179    3e-43 
ref|ZP_04959165.1|  magnesium transporter [gamma proteobacteri...   179    3e-43 
ref|ZP_06486092.1|  Mg++ transporter [Xanthomonas campestris p...   179    4e-43 
ref|YP_001546977.1|  magnesium transporter [Herpetosiphon aura...   179    4e-43 
ref|ZP_01260665.1|  magnesium transporter [Vibrio alginolyticu...   179    4e-43 
ref|YP_001750611.1|  magnesium transporter [Pseudomonas putida...   179    5e-43 
ref|ZP_04449278.1|  hypothetical protein GCWU000282_00507 [Cat...   179    5e-43 
ref|YP_002874263.1|  hypothetical protein PFLU4745 [Pseudomona...   179    5e-43 
ref|ZP_05121200.1|  magnesium transporter [Vibrio parahaemolyt...   179    5e-43 
ref|ZP_03729504.1|  magnesium transporter [Dethiobacter alkali...   178    7e-43 
ref|YP_544418.1|  magnesium transporter [Methylobacillus flage...   178    7e-43 
ref|YP_003075123.1|  magnesium transporter [Teredinibacter tur...   178    8e-43 
ref|YP_001188386.1|  magnesium transporter [Pseudomonas mendoc...   178    9e-43 
ref|ZP_02960904.1|  hypothetical protein PROSTU_02886 [Provide...   178    9e-43 
ref|YP_609368.1|  magnesium transporter [Pseudomonas entomophi...   177    1e-42 
ref|ZP_01452180.1|  magnesium transporter [Mariprofundus ferro...   177    1e-42 
ref|YP_364857.1|  magnesium transporter [Xanthomonas campestri...   177    1e-42 
ref|ZP_05081875.1|  magnesium transporter [beta proteobacteriu...   177    1e-42 
ref|NP_643289.1|  Mg++ transporter [Xanthomonas axonopodis pv....   177    1e-42 
ref|YP_001472460.1|  magnesium transporter [Shewanella sedimin...   177    1e-42 
ref|ZP_04631927.1|  Magnesium transporter [Yersinia frederikse...   177    1e-42 
ref|ZP_02196809.1|  magnesium transporter [Vibrio sp. AND4] >g...   177    1e-42 
ref|YP_001629314.1|  putative cation transport protein [Bordet...   177    2e-42 
ref|ZP_03319029.1|  hypothetical protein PROVALCAL_01969 [Prov...   177    2e-42 
ref|YP_003145832.1|  magnesium transporter [Kangiella koreensi...   177    2e-42 
ref|ZP_05973618.1|  magnesium transporter [Providencia rustigi...   176    2e-42 
ref|NP_799054.1|  magnesium transporter [Vibrio parahaemolytic...   176    2e-42 
ref|ZP_01992893.1|  magnesium transporter [Vibrio parahaemolyt...   176    2e-42 
ref|ZP_05879902.1|  mg/Co/Ni transporter MgtE (contains CBS do...   176    2e-42 
ref|ZP_04614496.1|  Magnesium transporter [Yersinia rohdei ATC...   176    3e-42 
ref|YP_787359.1|  magnesium transporter [Bordetella avium 197N...   176    3e-42 
ref|YP_001095136.1|  magnesium transporter [Shewanella loihica...   176    3e-42 
ref|YP_341046.1|  magnesium transporter [Pseudoalteromonas hal...   176    3e-42 
ref|ZP_05727739.1|  magnesium transporter [Pantoea sp. At-9b] ...   176    3e-42 
ref|ZP_04624549.1|  Magnesium transporter [Yersinia kristensen...   176    3e-42 
ref|YP_928965.1|  magnesium transporter [Shewanella amazonensi...   176    4e-42 
ref|YP_356025.1|  magnesium transporter [Pelobacter carbinolic...   176    4e-42 
ref|NP_791670.1|  magnesium transporter [Pseudomonas syringae ...   175    5e-42 
ref|YP_003092435.1|  magnesium transporter [Pedobacter heparin...   175    6e-42 
ref|YP_003197346.1|  magnesium transporter [Desulfohalobium re...   175    7e-42 
ref|YP_261586.1|  magnesium transporter [Pseudomonas fluoresce...   175    7e-42 
ref|ZP_05942706.1|  magnesium transporter [Vibrio orientalis C...   175    7e-42 
ref|ZP_01065895.1|  magnesium transporter [Vibrio sp. MED222] ...   174    8e-42 
ref|YP_001452155.1|  hypothetical protein CKO_00564 [Citrobact...   174    9e-42 
ref|YP_349999.1|  divalent cation transporter [Pseudomonas flu...   174    9e-42 
ref|ZP_05060540.1|  magnesium transporter [gamma proteobacteri...   174    1e-41 
ref|ZP_05851511.1|  magnesium transporter [Granulicatella eleg...   174    1e-41 
ref|YP_002418303.1|  magnesium transporter [Vibrio splendidus ...   174    1e-41 
ref|ZP_02156512.1|  magnesium transporter [Shewanella benthica...   174    1e-41 
ref|YP_001815212.1|  magnesium transporter [Exiguobacterium si...   174    1e-41 
ref|ZP_01814335.1|  magnesium transporter [Vibrionales bacteri...   174    2e-41 
ref|ZP_04757654.1|  magnesium transporter [Neisseria flavescen...   174    2e-41 
ref|ZP_06192921.1|  transporter [Serratia odorifera 4Rx13] >gb...   173    2e-41 
dbj|BAI80552.1|  magnesium transporter [Deferribacter desulfur...   173    2e-41 
ref|YP_208260.1|  MgtE [Neisseria gonorrhoeae FA 1090] >ref|ZP...   173    2e-41 
ref|ZP_04642752.1|  Magnesium transporter [Yersinia mollaretii...   173    2e-41 
ref|YP_236622.1|  divalent cation transporter [Pseudomonas syr...   173    2e-41 
ref|ZP_06123525.1|  magnesium transporter [Providencia rettger...   173    2e-41 
ref|YP_002002600.1|  MgtE [Neisseria gonorrhoeae NCCP11945] >r...   173    2e-41 
ref|YP_275656.1|  magnesium transporter [Pseudomonas syringae ...   173    2e-41 
ref|ZP_06481761.1|  magnesium transporter [Pseudomonas syringa...   173    3e-41 
ref|YP_001171910.1|  magnesium transporter [Pseudomonas stutze...   173    3e-41 
emb|CBA09465.1|  magnesium transporter [Neisseria meningitidis...   173    3e-41 
ref|YP_001762596.1|  magnesium transporter [Shewanella woodyi ...   173    3e-41 
ref|ZP_03720651.1|  hypothetical protein NEIFLAOT_02514 [Neiss...   172    3e-41 
ref|NP_759682.1|  Mg/Co/Ni transporter MgtE [Vibrio vulnificus...   172    4e-41 
ref|YP_975901.1|  hypothetical protein NMC1976 [Neisseria meni...   172    4e-41 
ref|ZP_04635746.1|  Magnesium transporter [Yersinia intermedia...   172    4e-41 
emb|CBA07512.1|  magnesium transporter [Neisseria meningitidis...   172    4e-41 
ref|ZP_05977052.1|  magnesium transporter [Neisseria mucosa AT...   172    4e-41 
ref|YP_002341939.1|  hypothetical inner membrane protein [Neis...   172    5e-41 
ref|ZP_00990817.1|  magnesium transporter [Vibrio splendidus 1...   172    5e-41 
ref|ZP_04587580.1|  magnesium transporter [Pseudomonas syringa...   172    5e-41 
ref|YP_003082409.1|  magnesium transporter [Neisseria meningit...   172    5e-41 
ref|ZP_05983991.1|  magnesium transporter [Neisseria subflava ...   172    5e-41 
ref|ZP_05983702.1|  magnesium transporter [Neisseria cinerea A...   172    6e-41 
ref|YP_112647.1|  magnesium transporter [Methylococcus capsula...   172    6e-41 
ref|ZP_04621619.1|  Magnesium transporter [Yersinia aldovae AT...   171    7e-41 
ref|ZP_05320343.1|  magnesium transporter [Neisseria sicca ATC...   171    7e-41 
ref|ZP_04627851.1|  Magnesium transporter [Yersinia bercovieri...   171    7e-41 
ref|YP_001598369.1|  magnesium transporter [Neisseria meningit...   171    7e-41 
ref|ZP_01552655.1|  Divalent cation transporter [Methylophilal...   171    7e-41 
ref|NP_274991.1|  magnesium transporter [Neisseria meningitidi...   171    8e-41 
ref|ZP_06498226.1|  magnesium transporter [Pseudomonas syringa...   171    9e-41 
ref|YP_001670202.1|  magnesium transporter [Pseudomonas putida...   171    9e-41 
ref|NP_746582.1|  magnesium transporter [Pseudomonas putida KT...   171    1e-40 
ref|ZP_06051670.1|  magnesium transporter [Grimontia hollisae ...   171    1e-40 
ref|ZP_03225102.1|  magnesium (Mg2+) transporter [Bacillus coa...   170    1e-40 
ref|ZP_05625648.1|  magnesium transporter [Campylobacter graci...   170    2e-40 
ref|ZP_05987612.1|  magnesium transporter [Neisseria lactamica...   170    2e-40 
ref|YP_001355815.1|  magnesium transporter [Nitratiruptor sp. ...   170    2e-40 
ref|ZP_01975073.1|  magnesium transporter [Vibrio cholerae B33...   169    2e-40 
ref|YP_001005446.1|  putative divalent cation transport protei...   169    3e-40 
ref|NP_881405.1|  putative cation transport protein [Bordetell...   169    3e-40 
ref|YP_003047811.1|  magnesium transporter [Methylotenera mobi...   169    4e-40 
gb|ADD78003.1|  Hypothetical Protein PANA_2836 [Pantoea ananat...   169    4e-40 
ref|ZP_03713319.1|  hypothetical protein EIKCOROL_00995 [Eiken...   169    4e-40 
ref|ZP_04562742.1|  magnesium transporter [Citrobacter sp. 30_...   168    7e-40 
ref|ZP_05071133.1|  magnesium transporter [Campylobacterales b...   168    7e-40 
ref|ZP_01916018.1|  divalent cation transporter [Limnobacter s...   168    7e-40 
ref|YP_002795887.1|  probable magnesium transporter [Laribacte...   168    8e-40 
ref|ZP_05071236.1|  magnesium transporter [Campylobacterales b...   168    9e-40 
ref|YP_574281.1|  magnesium transporter [Chromohalobacter sale...   167    9e-40 
ref|ZP_02168784.1|  Mg/Co/Ni transporter MgtE (contains CBS do...   167    1e-39 
ref|ZP_04615206.1|  Magnesium transporter [Yersinia ruckeri AT...   167    1e-39 
ref|YP_003050107.1|  magnesium transporter [Methylovorus sp. S...   167    2e-39 
ref|ZP_05070568.1|  magnesium transporter [Campylobacterales b...   167    2e-39 
ref|YP_316264.1|  divalent cation transporter [Thiobacillus de...   167    2e-39 
ref|NP_668716.1|  divalent cation transporter [Yersinia pestis...   167    2e-39 
ref|YP_394503.1|  divalent cation transporter [Sulfurimonas de...   167    2e-39 
ref|YP_001336278.1|  putative MgtE integral membrane region [K...   166    2e-39 
ref|YP_002237374.1|  magnesium transporter [Klebsiella pneumon...   166    2e-39 
ref|ZP_06547875.1|  magnesium transporter [Klebsiella sp. 1_1_...   166    2e-39 
ref|YP_003244781.1|  magnesium transporter [Geobacillus sp. Y4...   166    2e-39 
ref|ZP_01627237.1|  magnesium transporter [marine gamma proteo...   166    3e-39 
ref|ZP_06352085.1|  magnesium transporter [Citrobacter youngae...   166    4e-39 
ref|ZP_01861214.1|  magnesium (Mg2+) transporter [Bacillus sp....   165    5e-39 
ref|ZP_01101774.1|  magnesium transporter [Congregibacter lito...   165    5e-39 
ref|YP_003376622.1|  putative magnesium transporter protein [X...   165    6e-39 
ref|ZP_06291514.1|  magnesium transporter [Peptoniphilus lacri...   165    6e-39 
ref|NP_249604.1|  putative Mg transporter MgtE [Pseudomonas ae...   165    6e-39 
ref|YP_001209696.1|  magnesium transporter [Dichelobacter nodo...   165    7e-39 
ref|ZP_01171011.1|  magnesium (Mg2+) transporter [Bacillus sp....   165    7e-39 
ref|YP_001034864.1|  magnesium/cobalt transporter, putative [S...   165    8e-39 
ref|YP_002316452.1|  Mg/Co/Ni transporter MgtE (contains CBS d...   164    1e-38 
ref|ZP_05362701.1|  magnesium transporter [Campylobacter showa...   164    1e-38 
ref|ZP_05968483.1|  magnesium transporter [Enterobacter cancer...   164    1e-38 
ref|YP_271197.1|  magnesium transporter [Colwellia psychreryth...   164    1e-38 
ref|YP_003306075.1|  magnesium transporter [Streptobacillus mo...   164    1e-38 
ref|YP_003365888.1|  magnesium transporter [Citrobacter rodent...   164    1e-38 
ref|YP_001466773.1|  magnesium transporter [Campylobacter conc...   164    1e-38 
ref|ZP_05705855.1|  magnesium transporter [Cardiobacterium hom...   164    2e-38 
ref|ZP_01722168.1|  magnesium (Mg2+) transporter [Bacillus sp....   164    2e-38 
ref|ZP_05737162.1|  magnesium transporter [Granulicatella adia...   163    2e-38 
ref|ZP_06365072.1|  magnesium transporter [Bacillus cellulosil...   163    2e-38 
ref|ZP_01860754.1|  YkoK2 [Bacillus sp. SG-1] >gb|EDL64213.1| ...   163    3e-38 
ref|YP_528652.1|  magnesium transporter [Saccharophagus degrad...   162    4e-38 
ref|YP_002508995.1|  magnesium transporter [Halothermothrix or...   162    4e-38 
ref|ZP_05315368.1|  magnesium transporter [Nitrosomonas sp. AL...   162    4e-38 
ref|ZP_01868851.1|  magnesium transporter [Vibrio shilonii AK1...   162    4e-38 
ref|YP_001696968.1|  magnesium (Mg2+) transporter [Lysinibacil...   162    5e-38 
ref|ZP_04602643.1|  hypothetical protein GCWU000324_02124 [Kin...   162    6e-38 
dbj|BAA75383.1|  Ykok [Bacillus halodurans]                         162    6e-38 
ref|NP_241377.1|  magnesium (Mg2+) transporter [Bacillus halod...   162    6e-38 
ref|YP_001177506.1|  magnesium transporter [Enterobacter sp. 6...   161    9e-38 
ref|ZP_03610405.1|  magnesium transporter [Campylobacter rectu...   161    1e-37 
ref|YP_001479769.1|  magnesium transporter [Serratia proteamac...   161    1e-37 
ref|ZP_01170783.1|  YkoK2 [Bacillus sp. NRRL B-14911] >gb|EAR6...   160    2e-37 
ref|YP_003263444.1|  magnesium transporter [Halothiobacillus n...   160    2e-37 
ref|YP_002800566.1|  magnesium transporter; MgtE [Azotobacter ...   160    2e-37 
ref|YP_344778.1|  divalent cation transporter [Nitrosococcus o...   160    2e-37 
ref|ZP_06363765.1|  magnesium transporter [Bacillus cellulosil...   160    2e-37 
ref|YP_003157645.1|  magnesium transporter [Desulfomicrobium b...   159    4e-37 
ref|NP_692145.1|  magnesium (Mg2+) transporter [Oceanobacillus...   159    4e-37 
ref|ZP_02171518.1|  polar amino acid ABC transporter, inner me...   159    4e-37 
ref|YP_858546.1|  magnesium transporter [Aeromonas hydrophila ...   159    5e-37 
ref|YP_001716659.1|  magnesium transporter [Candidatus Desulfo...   158    6e-37 
ref|YP_003422045.1|  Mg2+ transporter MgtE [cyanobacterium UCY...   158    1e-36 
ref|ZP_01718219.1|  magnesium transporter [Algoriphagus sp. PR...   157    1e-36 
ref|NP_764253.1|  Mg2+ transporter [Staphylococcus epidermidis...   157    2e-36 
ref|YP_188180.1|  magnesium transporter [Staphylococcus epider...   157    2e-36 
ref|YP_003426771.1|  magnesium (Mg2+) transporter [Bacillus ps...   156    2e-36 
ref|YP_002991574.1|  magnesium transporter [Desulfovibrio sale...   156    3e-36 
ref|NP_389213.1|  magnesium transporter [Bacillus subtilis sub...   156    4e-36 
ref|YP_001407149.1|  magnesium transporter [Campylobacter homi...   155    4e-36 
ref|YP_001420906.1|  Mg2+ transporter [Bacillus amyloliquefaci...   155    4e-36 
ref|YP_001140133.1|  magnesium transporter [Aeromonas salmonic...   155    6e-36 
ref|YP_891872.1|  magnesium transporter [Campylobacter fetus s...   155    7e-36 
ref|YP_001408505.1|  magnesium transporter [Campylobacter curv...   155    8e-36 
ref|YP_002648105.1|  Divalent cation transport protein [Erwini...   155    8e-36 
ref|ZP_03310543.1|  hypothetical protein DESPIG_00431 [Desulfo...   155    8e-36 
ref|YP_001906990.1|  Divalent cation transport protein [Erwini...   154    8e-36 
ref|YP_002514068.1|  magnesium transporter [Thioalkalivibrio s...   154    1e-35 
ref|YP_002890652.1|  magnesium transporter [Thauera sp. MZ1T] ...   154    1e-35 
ref|ZP_06403188.1|  magnesium transporter [bacterium S5] >gb|E...   154    1e-35 
ref|YP_078614.1|  divalent cation transporter [Bacillus lichen...   154    2e-35 
ref|ZP_05339678.1|  magnesium transporter [Sideroxydans lithot...   154    2e-35 
ref|YP_003018510.1|  magnesium transporter [Pectobacterium car...   154    2e-35 
ref|YP_003308644.1|  magnesium transporter [Sebaldella termiti...   153    2e-35 
ref|NP_762723.1|  Mg/Co/Ni transporter MgtE [Vibrio vulnificus...   153    2e-35 
ref|YP_002575793.1|  Mg/Co/Ni transporter, MgtE family [Campyl...   153    2e-35 
ref|ZP_01906688.1|  magnesium (Mg2+) transporter-like protein ...   153    3e-35 
ref|ZP_01166332.1|  magnesium transporter [Oceanospirillum sp....   153    3e-35 
ref|YP_746725.1|  magnesium transporter [Nitrosomonas eutropha...   152    3e-35 
ref|ZP_03613078.1|  magnesium transporter [Staphylococcus capi...   152    3e-35 
ref|ZP_04716102.1|  putative Magnesium transporter [Alteromona...   152    4e-35 
ref|NP_841667.1|  divalent cation transporter [Nitrosomonas eu...   152    4e-35 
ref|YP_455418.1|  putative magnesium transport protein [Sodali...   152    4e-35 
ref|YP_003405270.1|  MgtE integral membrane region [Haloterrig...   152    5e-35 
ref|YP_001358027.1|  magnesium transporter [Sulfurovum sp. NBC...   152    5e-35 
ref|ZP_06197692.1|  magnesium transporter [Pediococcus acidila...   152    6e-35 
ref|ZP_01989846.1|  Mg2+ transporter MgtE [Vibrio parahaemolyt...   152    6e-35 
ref|ZP_02181119.1|  putative transmembrane Mg2+ transporter [F...   151    9e-35 
ref|NP_800750.1|  putative magnesium transporter MgtE [Vibrio ...   151    1e-34 
ref|NP_903255.1|  magnesium transporter [Chromobacterium viola...   150    1e-34 
ref|ZP_06231610.1|  magnesium transporter [Desulfovibrio aespo...   150    1e-34 
ref|YP_002560026.1|  Mg2+ transporter [Macrococcus caseolyticu...   150    1e-34 
ref|YP_392324.1|  magnesium transporter [Thiomicrospira crunog...   150    1e-34 
ref|YP_253864.1|  hypothetical protein SH1949 [Staphylococcus ...   150    2e-34 
ref|ZP_05401825.1|  putative Mg2+ transporter [Clostridium dif...   150    2e-34 
ref|ZP_03738232.1|  magnesium transporter [Desulfonatronospira...   150    2e-34 
ref|ZP_04677479.1|  magnesium transporter [Staphylococcus warn...   150    2e-34 
ref|YP_003460922.1|  magnesium transporter [Thioalkalivibrio s...   150    3e-34 
ref|ZP_02179280.1|  magnesium (Mg2+) transporter-like protein ...   149    3e-34 
ref|ZP_04681944.1|  magnesium transporter [Ochrobactrum interm...   149    3e-34 
ref|ZP_04525900.1|  magnesium transporter [Clostridium butyric...   149    3e-34 
ref|YP_301866.1|  putative divalent cation transport protein [...   149    3e-34 
ref|ZP_03697751.1|  magnesium transporter [Lutiella nitroferru...   149    3e-34 
ref|ZP_04818738.1|  magnesium transporter [Staphylococcus epid...   149    4e-34 
ref|ZP_04921251.1|  Mg/Co/Ni transporter MgtE [Vibrio sp. Ex25...   149    4e-34 
ref|YP_446298.1|  magnesium transporter [Salinibacter ruber DS...   149    5e-34 
ref|NP_924872.1|  Mg2+ transporter [Gloeobacter violaceus PCC ...   148    6e-34 
ref|YP_002429225.1|  magnesium transporter [Desulfatibacillum ...   148    7e-34 
ref|ZP_02860975.1|  hypothetical protein ANASTE_00167 [Anaerof...   148    8e-34 
ref|YP_529378.1|  serine/threonine protein kinase [Saccharopha...   148    8e-34 
ref|ZP_03701677.1|  magnesium transporter [Flavobacteria bacte...   148    8e-34 
ref|YP_001371838.1|  magnesium transporter [Ochrobactrum anthr...   148    9e-34 
ref|NP_371533.1|  Mg2 transporter [Staphylococcus aureus subsp...   148    9e-34 
ref|ZP_04565464.1|  magnesium transporter [Mollicutes bacteriu...   148    9e-34 
ref|ZP_06326442.1|  magnesium transporter [Staphylococcus aure...   148    1e-33 
ref|ZP_04828377.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   147    1e-33 
ref|YP_185881.1|  magnesium transporter [Staphylococcus aureus...   147    1e-33 
ref|YP_002124509.1|  putative Magnesium transporter [Alteromon...   147    1e-33 
ref|ZP_02427362.1|  hypothetical protein CLORAM_00740 [Clostri...   147    1e-33 
ref|ZP_02042888.1|  hypothetical protein RUMGNA_03692 [Ruminoc...   147    1e-33 
ref|YP_003258739.1|  magnesium transporter [Pectobacterium was...   147    1e-33 
ref|YP_411240.1|  magnesium transporter [Nitrosospira multifor...   147    1e-33 
ref|ZP_05689012.1|  magnesium transporter [Staphylococcus aure...   147    2e-33 
ref|ZP_01312480.1|  magnesium transporter [Desulfuromonas acet...   147    2e-33 
ref|ZP_01985560.1|  Mg2+ transporter MgtE [Vibrio harveyi HY01...   147    2e-33 
ref|YP_001931862.1|  magnesium transporter [Sulfurihydrogenibi...   147    2e-33 
ref|YP_002633709.1|  putative divalent cation transporter [Sta...   147    2e-33 
ref|ZP_03828713.1|  magnesium transporter [Pectobacterium caro...   147    2e-33 
ref|YP_001486469.1|  Mg2+/Co2+ transporter [Bacillus pumilus S...   146    2e-33 
ref|YP_001003288.1|  magnesium transporter [Halorhodospira hal...   146    2e-33 
ref|ZP_02027147.1|  hypothetical protein EUBVEN_02416 [Eubacte...   146    3e-33 
ref|YP_040395.1|  putative divalent cation transport protein [...   146    3e-33 
ref|ZP_05686404.1|  magnesium transporter [Staphylococcus aure...   146    3e-33 
ref|YP_804696.1|  transcriptional regulator [Pediococcus pento...   146    3e-33 
ref|YP_001339926.1|  MgtE intracellular region [Marinomonas sp...   146    3e-33 
ref|ZP_01695013.1|  magnesium transporter [Microscilla marina ...   146    3e-33 
ref|ZP_05272501.1|  putative Mg2+ transporter [Clostridium dif...   146    3e-33 
ref|ZP_04018383.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   146    3e-33 
ref|ZP_03053505.1|  magnesium transporter [Bacillus pumilus AT...   146    3e-33 
ref|YP_001088949.1|  putative Mg2+ transporter [Clostridium di...   146    3e-33 
ref|YP_001419026.1|  magnesium transporter [Xanthobacter autot...   146    3e-33 
ref|ZP_01801874.1|  hypothetical protein CdifQ_04002831 [Clost...   146    4e-33 
ref|ZP_01966715.1|  hypothetical protein RUMTOR_00255 [Ruminoc...   146    4e-33 
ref|ZP_05838337.1|  divalent cation transporter [Brucella suis...   145    4e-33 
ref|ZP_04971281.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   145    4e-33 
ref|ZP_06363767.1|  magnesium transporter [Bacillus cellulosil...   145    4e-33 
ref|YP_003090112.1|  magnesium transporter [Dyadobacter fermen...   145    5e-33 
ref|ZP_01259295.1|  putative magnesium transporter MgtE [Vibri...   145    5e-33 
ref|YP_001358693.1|  magnesium transporter [Sulfurovum sp. NBC...   145    5e-33 
ref|YP_263876.1|  Mg/Co/Ni transporter MgtE [Psychrobacter arc...   145    6e-33 
ref|YP_001447455.1|  hypothetical protein VIBHAR_05323 [Vibrio...   145    7e-33 
ref|ZP_03777435.1|  hypothetical protein CLOHYLEM_04487 [Clost...   145    7e-33 
ref|YP_001733539.1|  magnesium transporter [Synechococcus sp. ...   145    7e-33 
ref|YP_339238.1|  magnesium transporter [Pseudoalteromonas hal...   145    7e-33 
ref|NP_700044.1|  magnesium transporter [Brucella suis 1330] >...   145    7e-33 
ref|ZP_01135479.1|  putative Magnesium transporter [Pseudoalte...   145    8e-33 
ref|ZP_03787370.1|  magnesium transporter [Brucella ceti str. ...   145    8e-33 
ref|ZP_06180481.1|  hypothetical protein VMC_19110 [Vibrio alg...   145    8e-33 
ref|ZP_05441287.1|  MG2+ transporter MGTE [Fusobacterium sp. D...   144    9e-33 
ref|ZP_05861246.1|  magnesium transporter [Jonquetella anthrop...   144    9e-33 
ref|ZP_04574418.1|  MG2+ transporter MGTE [Fusobacterium sp. 7...   144    9e-33 
ref|ZP_06290945.1|  magnesium transporter [Peptoniphilus lacri...   144    1e-32 
gb|ABD75772.1|  hypothetical protein [uncultured bacterium]         144    1e-32 
ref|ZP_05851854.1|  magnesium transporter [Granulicatella eleg...   144    1e-32 
ref|YP_932209.1|  putative magnesium transport protein [Azoarc...   144    2e-32 
ref|YP_753763.1|  divalent cation transporter [Syntrophomonas ...   144    2e-32 
ref|ZP_05709298.1|  magnesium transporter [Desulfurivibrio alk...   144    2e-32 
ref|ZP_02194199.1|  putative magnesium transporter MgtE [Vibri...   143    2e-32 
ref|ZP_05116006.1|  magnesium transporter [Labrenzia alexandri...   143    2e-32 
ref|ZP_01201536.1|  magnesium ion transporter [Flavobacteria b...   143    2e-32 
ref|YP_066276.1|  magnesium transporter [Desulfotalea psychrop...   143    2e-32 
ref|ZP_04059125.1|  magnesium transporter [Staphylococcus homi...   143    2e-32 
ref|ZP_06425715.1|  magnesium transporter [Peptostreptococcus ...   143    3e-32 
ref|ZP_01611569.1|  putative Magnesium transporter [Alteromona...   143    3e-32 
ref|ZP_01866305.1|  putative magnesium transporter MgtE [Vibri...   143    3e-32 
ref|YP_388324.1|  magnesium transporter [Desulfovibrio desulfu...   143    3e-32 
ref|NP_541396.1|  Mg2+ transporter [Brucella melitensis 16M] >...   142    3e-32 
ref|YP_051258.1|  magnesium transporter [Pectobacterium atrose...   142    4e-32 
ref|YP_003472075.1|  Magnesium transporter [Staphylococcus lug...   142    4e-32 
ref|YP_001280715.1|  magnesium transporter [Psychrobacter sp. ...   142    4e-32 
ref|ZP_03225764.1|  magnesium (Mg2+) transporter [Bacillus coa...   142    5e-32 
ref|YP_579838.1|  magnesium transporter [Psychrobacter cryohal...   142    5e-32 
ref|NP_485722.1|  hypothetical protein all1682 [Nostoc sp. PCC...   142    5e-32 
ref|ZP_04047323.1|  Mg2+ transporter MgtE [Brachyspira murdoch...   142    5e-32 
ref|YP_001672448.1|  magnesium transporter [Shewanella halifax...   142    6e-32 
ref|YP_002479395.1|  magnesium transporter [Desulfovibrio desu...   142    6e-32 
ref|ZP_03683211.1|  hypothetical protein CATMIT_01856 [Catenib...   142    7e-32 
ref|ZP_04783288.1|  magnesium transporter [Weissella paramesen...   141    8e-32 
ref|ZP_04573069.1|  MG2+ transporter MGTE [Fusobacterium sp. 4...   141    8e-32 
ref|NP_604374.1|  MG2+ transporter MGTE [Fusobacterium nucleat...   141    8e-32 
ref|YP_002604070.1|  MgtE2 [Desulfobacterium autotrophicum HRM...   141    9e-32 
ref|YP_321691.1|  divalent cation transporter [Anabaena variab...   141    1e-31 
ref|ZP_05117804.1|  Mg/Co/Ni transporter MgtE [Vibrio parahaem...   141    1e-31 
ref|ZP_01288736.1|  Divalent cation transporter [delta proteob...   141    1e-31 
ref|ZP_05551441.1|  magnesium transporter [Fusobacterium sp. 3...   141    1e-31 
ref|ZP_01291167.1|  Divalent cation transporter [delta proteob...   141    1e-31 
ref|NP_242814.1|  magnesium (Mg2+) transporter [Bacillus halod...   141    1e-31 
ref|ZP_05182067.1|  magnesium transporter [Brucella sp. 83/13]...   140    1e-31 
ref|ZP_02160847.1|  magnesium transporter [Kordia algicida OT-...   140    2e-31 
ref|ZP_03294110.1|  hypothetical protein CLOHIR_02061 [Clostri...   140    2e-31 
ref|ZP_04569972.1|  MG2+ transporter MGTE [Fusobacterium sp. 2...   140    2e-31 
emb|CAJ72018.1|  similar to magnesium transporter MgtE [Candid...   140    2e-31 
ref|YP_001303926.1|  magnesium transporter [Parabacteroides di...   140    2e-31 
ref|YP_002885849.1|  magnesium transporter [Exiguobacterium sp...   140    3e-31 
ref|YP_001868455.1|  magnesium transporter [Nostoc punctiforme...   139    3e-31 
ref|ZP_05943409.1|  putative magnesium transporter MgtE [Vibri...   139    3e-31 
ref|YP_003323891.1|  magnesium transporter [Thermobaculum terr...   139    3e-31 
ref|YP_001622650.1|  magnesium transporter [Brucella suis ATCC...   139    3e-31 
ref|YP_207005.1|  magnesium transporter MgtE [Vibrio fischeri ...   139    4e-31 
ref|ZP_05807692.1|  magnesium transporter [Mesorhizobium oppor...   139    4e-31 
ref|YP_001503890.1|  magnesium transporter [Shewanella pealean...   139    4e-31 
ref|YP_001295007.1|  Mg2+ transporter MgtE [Flavobacterium psy...   139    4e-31 
ref|ZP_05649387.1|  magnesium transporter [Enterococcus gallin...   139    5e-31 
ref|ZP_02860974.1|  hypothetical protein ANASTE_00166 [Anaerof...   139    5e-31 
ref|YP_002722618.1|  Mg/Co/Ni transporter MgtE [Brachyspira hy...   139    5e-31 
ref|ZP_04046368.1|  Mg2+ transporter MgtE [Brachyspira murdoch...   139    5e-31 
ref|ZP_01105376.1|  magnesium transporter [Flavobacteriales ba...   139    5e-31 
ref|YP_002158713.1|  Mg2+ transporter MgtE [Vibrio fischeri MJ...   139    5e-31 
ref|ZP_01623485.1|  Mg2+ transport protein [Lyngbya sp. PCC 81...   139    6e-31 
ref|ZP_05656405.1|  magnesium transporter [Enterococcus cassel...   139    6e-31 
ref|ZP_02431495.1|  hypothetical protein CLOSCI_01715 [Clostri...   138    6e-31 
ref|ZP_05647511.1|  magnesium transporter [Enterococcus cassel...   138    6e-31 
ref|ZP_03930681.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   138    6e-31 
ref|ZP_02002347.1|  Divalent cation transporter [Beggiatoa sp....   138    7e-31 
ref|ZP_03010543.1|  hypothetical protein BACCOP_02424 [Bactero...   138    8e-31 
ref|ZP_01116540.1|  magnesium transporter, putative [Reinekea ...   138    8e-31 
ref|ZP_03474634.1|  hypothetical protein PRABACTJOHN_00288 [Pa...   138    9e-31 
ref|ZP_02033392.1|  hypothetical protein PARMER_03417 [Parabac...   138    9e-31 
ref|YP_001663891.1|  magnesium transporter [Thermoanaerobacter...   138    1e-30 
ref|ZP_05346310.3|  magnesium transporter [Bryantella formatex...   137    1e-30 
ref|YP_002720475.1|  magnesium transporter [Brachyspira hyodys...   137    1e-30 
ref|YP_003142085.1|  magnesium transporter [Capnocytophaga och...   137    1e-30 
ref|ZP_05659973.1|  magnesium transporter [Enterococcus faeciu...   137    1e-30 
ref|NP_102305.1|  Mg2+ transport protein [Mesorhizobium loti M...   137    1e-30 
ref|YP_001524672.1|  divalent cation transporter [Azorhizobium...   137    1e-30 
ref|YP_003425491.1|  magnesium transporter [Bacillus pseudofir...   137    1e-30 
ref|ZP_05679251.1|  magnesium transporter [Enterococcus faeciu...   137    2e-30 
ref|YP_001321043.1|  magnesium transporter [Alkaliphilus metal...   137    2e-30 
ref|YP_003166339.1|  magnesium transporter [Candidatus Accumul...   137    2e-30 
ref|ZP_06011202.1|  magnesium transporter [Leptotrichia goodfe...   137    2e-30 
ref|YP_001665619.1|  magnesium transporter [Thermoanaerobacter...   137    2e-30 
ref|ZP_05493285.1|  magnesium transporter [Thermoanaerobacter ...   137    2e-30 
ref|YP_011024.1|  magnesium transporter [Desulfovibrio vulgari...   137    2e-30 
ref|ZP_05136712.1|  magnesium transporter [Stenotrophomonas sp...   137    2e-30 
ref|ZP_03390359.1|  magnesium transporter [Capnocytophaga sput...   137    2e-30 
ref|YP_002567247.1|  MgtE integral membrane region [Halorubrum...   136    2e-30 
ref|ZP_03982652.1|  magnesium transporter [Enterococcus faeciu...   136    3e-30 
ref|ZP_03644082.1|  hypothetical protein BACCOPRO_02457 [Bacte...   136    3e-30 
ref|YP_003163496.1|  magnesium transporter [Leptotrichia bucca...   136    3e-30 
ref|ZP_01465379.1|  magnesium transporter [Stigmatella auranti...   136    3e-30 
ref|ZP_01548535.1|  magnesium transporter [Stappia aggregata I...   136    4e-30 
ref|YP_685660.1|  Mg(2+) transporter [uncultured methanogenic ...   136    4e-30 
ref|ZP_06305761.1|  Divalent cation transporter [Raphidiopsis ...   135    4e-30 
ref|ZP_06306713.1|  Divalent cation transporter [Cylindrosperm...   135    5e-30 
ref|YP_174237.1|  magnesium transporter [Bacillus clausii KSM-...   135    5e-30 
ref|YP_047388.1|  putative Mg transporter (MgtE) [Acinetobacte...   135    6e-30 
ref|ZP_02437085.1|  hypothetical protein BACSTE_03356 [Bactero...   135    7e-30 
ref|ZP_05900144.1|  magnesium transporter [Leptotrichia hofsta...   135    8e-30 
ref|NP_233204.1|  magnesium transporter MgtE, putative [Vibrio...   135    8e-30 
ref|ZP_01979952.1|  Mg2+ transporter MgtE [Vibrio cholerae MZO...   135    8e-30 
ref|YP_157965.1|  magnesium transporter [Aromatoleum aromaticu...   135    9e-30 
ref|ZP_01678453.1|  magnesium transporter MgtE, putative [Vibr...   135    9e-30 
ref|ZP_04020336.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   134    9e-30 
ref|ZP_03289359.1|  hypothetical protein CLONEX_01561 [Clostri...   134    9e-30 
ref|ZP_01682215.1|  magnesium transporter MgtE, putative [Vibr...   134    9e-30 
ref|ZP_03209520.1|  hypothetical protein BACPLE_03196 [Bactero...   134    9e-30 
ref|YP_002030285.1|  magnesium transporter [Stenotrophomonas m...   134    1e-29 
ref|ZP_00949701.1|  magnesium transporter [Croceibacter atlant...   134    1e-29 
ref|YP_001974182.1|  putative cation TRANSPORT TRANSMEMBRANE P...   134    1e-29 
ref|YP_003460921.1|  magnesium transporter [Thioalkalivibrio s...   134    1e-29 
ref|ZP_03488479.1|  hypothetical protein EUBIFOR_01061 [Eubact...   134    1e-29 
ref|YP_001691857.1|  Mg2 transporter [Finegoldia magna ATCC 29...   134    1e-29 
ref|ZP_03957367.1|  Mg2+ transporter [Lactobacillus ruminis AT...   134    2e-29 
ref|ZP_01982808.1|  putative magnesium transporter MgtE [Vibri...   134    2e-29 
ref|YP_863516.1|  MgtE family divalent cation transporter [Gra...   134    2e-29 
ref|YP_003292043.1|  magnesium transporter [Rhodothermus marin...   133    2e-29 
gb|ADD29022.1|  magnesium transporter [Meiothermus ruber DSM 1...   133    2e-29 
ref|YP_751442.1|  MgtE intracellular region [Shewanella frigid...   133    2e-29 
ref|ZP_02185008.1|  magnesium transporter [Carnobacterium sp. ...   133    2e-29 
ref|ZP_02171517.1|  Mg/Co/Ni transporter MgtE (contains CBS do...   133    2e-29 
gb|ADD68293.1|  magnesium transporter [Denitrovibrio acetiphil...   133    3e-29 
ref|ZP_04058572.1|  magnesium transporter [Capnocytophaga ging...   132    3e-29 
ref|ZP_05025005.1|  magnesium transporter [Microcoleus chthono...   132    3e-29 
ref|YP_001095792.1|  MgtE integral membrane region [Shewanella...   132    4e-29 
ref|ZP_03458045.1|  hypothetical protein BACEGG_00818 [Bactero...   132    4e-29 
ref|YP_033025.1|  Mg2+ transport protein [Bartonella henselae ...   132    4e-29 
ref|YP_003137409.1|  magnesium transporter [Cyanothece sp. PCC...   132    4e-29 
ref|YP_001513605.1|  magnesium transporter [Alkaliphilus oreml...   132    4e-29 
ref|YP_074368.1|  magnesium transporter [Symbiobacterium therm...   132    4e-29 
ref|ZP_01889420.1|  putative transmembrane Mg2+ transporter [u...   132    5e-29 
ref|ZP_03678650.1|  hypothetical protein BACCELL_03002 [Bacter...   132    5e-29 
ref|YP_003194010.1|  putative transmembrane Mg2+ transporter [...   132    5e-29 
ref|ZP_03155854.1|  magnesium transporter [Cyanothece sp. PCC ...   132    5e-29 
ref|NP_969349.1|  Mg2+ transporter MgtE [Bdellovibrio bacterio...   132    5e-29 
ref|ZP_03702665.1|  magnesium transporter [Flavobacteria bacte...   132    6e-29 
ref|ZP_03016902.1|  hypothetical protein BACINT_04511 [Bactero...   132    6e-29 
ref|ZP_03634906.1|  hypothetical protein HOLDEFILI_02203 [Hold...   132    6e-29 
ref|YP_001918966.1|  magnesium transporter [Natranaerobius the...   132    6e-29 
ref|YP_002371849.1|  magnesium transporter [Cyanothece sp. PCC...   132    6e-29 
ref|ZP_01253074.1|  magnesium transporter [Psychroflexus torqu...   132    7e-29 
ref|ZP_02072206.1|  hypothetical protein BACUNI_03650 [Bactero...   132    7e-29 
ref|ZP_05878342.1|  putative magnesium transporter MgtE [Vibri...   132    7e-29 
ref|YP_001299219.1|  putative Mg2+ transporter MgtE [Bacteroid...   131    8e-29 
ref|ZP_06079985.1|  putative magnesium transporter MgtE [Vibri...   131    8e-29 
ref|ZP_02428737.1|  hypothetical protein CLORAM_02147 [Clostri...   131    9e-29 
ref|ZP_04564380.1|  magnesium transporter [Mollicutes bacteriu...   131    9e-29 
ref|ZP_02420912.1|  hypothetical protein ANACAC_03559 [Anaeros...   131    1e-28 
ref|ZP_05655349.1|  magnesium transporter [Enterococcus cassel...   131    1e-28 
ref|ZP_05422514.1|  magnesium transporter [Enterococcus faecal...   131    1e-28 
ref|ZP_06299121.1|  hypothetical protein pah_c022o199 [Parachl...   131    1e-28 
ref|ZP_02094721.1|  hypothetical protein PEPMIC_01489 [Parvimo...   131    1e-28 
ref|ZP_06032115.1|  putative magnesium transporter MgtE [Vibri...   131    1e-28 
ref|ZP_05900145.1|  magnesium transporter [Leptotrichia hofsta...   131    1e-28 
ref|NP_812953.1|  putative Mg2+ transporter MgtE [Bacteroides ...   131    1e-28 
ref|ZP_05574198.1|  magnesium transporter [Enterococcus faecal...   131    1e-28 
ref|NP_816305.1|  magnesium transporter [Enterococcus faecalis...   131    1e-28 
ref|YP_741668.1|  magnesium transporter [Alkalilimnicola ehrli...   131    1e-28 
ref|YP_594736.1|  Mg2+/Co2+ transporter [Lawsonia intracellula...   131    1e-28 
ref|ZP_05567950.1|  magnesium transporter [Enterococcus faecal...   131    1e-28 
ref|ZP_05718219.1|  putative magnesium transporter MgtE [Vibri...   130    1e-28 
ref|ZP_03914324.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   130    1e-28 
ref|YP_001761887.1|  MgtE intracellular region [Shewanella woo...   130    1e-28 
ref|YP_002729486.1|  magnesium transporter [Sulfurihydrogenibi...   130    1e-28 
ref|ZP_01053403.1|  magnesium ion transporter [Polaribacter sp...   130    2e-28 
ref|ZP_03301751.1|  hypothetical protein BACDOR_03141 [Bactero...   130    2e-28 
ref|YP_003476500.1|  magnesium transporter [Thermoanaerobacter...   130    2e-28 
ref|ZP_01704356.1|  magnesium transporter [Shewanella putrefac...   130    2e-28 
ref|YP_964173.1|  magnesium transporter [Shewanella sp. W3-18-...   130    2e-28 
ref|ZP_06011206.1|  magnesium transporter [Leptotrichia goodfe...   130    2e-28 
emb|CAO89242.1|  unnamed protein product [Microcystis aerugino...   130    2e-28 
ref|ZP_05645715.1|  magnesium transporter [Enterococcus cassel...   130    2e-28 
ref|YP_434881.1|  Mg2+/Co2+ transporter [Hahella chejuensis KC...   130    2e-28 
ref|ZP_05047551.1|  magnesium transporter [Nitrosococcus ocean...   130    2e-28 
ref|YP_343786.1|  divalent cation transporter [Nitrosococcus o...   130    2e-28 
ref|ZP_06391544.1|  magnesium transporter [Dethiosulfovibrio p...   130    3e-28 
ref|ZP_05622102.1|  magnesium transporter [Treponema vincentii...   130    3e-28 
ref|ZP_01631735.1|  Mg2+ transport protein [Nodularia spumigen...   129    3e-28 
ref|YP_001817802.1|  magnesium transporter [Opitutus terrae PB...   129    3e-28 
ref|YP_003152039.1|  magnesium transporter [Anaerococcus prevo...   129    3e-28 
ref|ZP_05618095.1|  MG2+ transporter MGTE [Fusobacterium sp. 3...   129    3e-28 
ref|YP_003474924.1|  magnesium transporter [Clostridiales geno...   129    4e-28 
ref|ZP_05882279.1|  magnesium transporter [Vibrio metschnikovi...   129    4e-28 
ref|ZP_04862434.1|  magnesium transporter [Clostridium botulin...   129    4e-28 
ref|YP_818164.1|  transcriptional regulator [Leuconostoc mesen...   129    4e-28 
ref|ZP_01059489.1|  putative transmembrane Mg2+ transporter [L...   129    4e-28 
ref|ZP_06382533.1|  magnesium transporter [Arthrospira platens...   129    4e-28 
ref|ZP_03496334.1|  magnesium transporter [Thermus aquaticus Y...   129    4e-28 
ref|YP_003443329.1|  magnesium transporter [Allochromatium vin...   129    5e-28 
ref|YP_659848.1|  MgtE intracellular region [Pseudoalteromonas...   129    5e-28 
ref|ZP_05927114.1|  putative magnesium transporter MgtE [Vibri...   129    5e-28 
ref|YP_002514067.1|  magnesium transporter [Thioalkalivibrio s...   129    5e-28 
ref|ZP_04237139.1|  Mg2+ transporter mgtE [Bacillus cereus Roc...   129    6e-28 
ref|YP_003317973.1|  magnesium transporter [Thermanaerovibrio ...   129    6e-28 
ref|YP_031870.1|  Mg2+ transport protein [Bartonella quintana ...   129    6e-28 
ref|YP_734832.1|  MgtE intracellular region [Shewanella sp. MR...   129    6e-28 
ref|YP_001568705.1|  magnesium transporter [Petrotoga mobilis ...   128    7e-28 
ref|ZP_05035584.1|  magnesium transporter [Synechococcus sp. P...   128    7e-28 
ref|ZP_05087409.1|  magnesium transporter [Pseudovibrio sp. JE...   128    7e-28 
ref|YP_738814.1|  MgtE intracellular region [Shewanella sp. MR...   128    8e-28 
ref|ZP_05379589.1|  magnesium transporter [Thermoanaerobacter ...   128    8e-28 
ref|ZP_04227408.1|  Mg2+ transporter mgtE [Bacillus cereus Roc...   128    8e-28 
ref|YP_199109.1|  Mg++ transporter [Xanthomonas oryzae pv. ory...   128    9e-28 
ref|NP_440719.1|  Mg2+ transporter [Synechocystis sp. PCC 6803...   128    1e-27 
ref|ZP_03168734.1|  hypothetical protein RUMLAC_02426 [Ruminoc...   128    1e-27 
ref|ZP_03272139.1|  magnesium transporter [Arthrospira maxima ...   128    1e-27 
ref|ZP_06265358.1|  magnesium transporter [Pyramidobacter pisc...   128    1e-27 
ref|YP_003163497.1|  magnesium transporter [Leptotrichia bucca...   128    1e-27 
ref|YP_870507.1|  MgtE intracellular region [Shewanella sp. AN...   127    1e-27 
ref|ZP_03290998.1|  hypothetical protein CLONEX_03217 [Clostri...   127    1e-27 
ref|YP_944064.1|  MgtE integral membrane region [Psychromonas ...   127    1e-27 
ref|YP_001803426.1|  Mg2+ transporter [Cyanothece sp. ATCC 511...   127    1e-27 
ref|YP_563553.1|  magnesium transporter [Shewanella denitrific...   127    1e-27 
emb|CAI50965.1|  divalent cation (Mg2+) transporter [unculture...   127    1e-27 
ref|ZP_03757769.1|  hypothetical protein CLOSTASPAR_01779 [Clo...   127    1e-27 
ref|ZP_05882281.1|  magnesium transporter [Vibrio metschnikovi...   127    1e-27 
ref|ZP_05758239.1|  putative Mg2+ transporter MgtE [Bacteroide...   127    1e-27 
ref|ZP_04010117.1|  Mg2+ transporter [Lactobacillus salivarius...   127    1e-27 
ref|YP_001804111.1|  Mg2+ transporter [Cyanothece sp. ATCC 511...   127    2e-27 
ref|ZP_00515258.1|  Divalent cation transporter [Crocosphaera ...   127    2e-27 
ref|ZP_00515788.1|  Divalent cation transporter [Crocosphaera ...   127    2e-27 
ref|YP_007876.1|  putative Mg2+ transporter [Candidatus Protoc...   127    2e-27 
ref|YP_002499966.1|  magnesium transporter [Methylobacterium n...   127    2e-27 
ref|YP_001957641.1|  hypothetical protein Aasi_0507 [Candidatu...   127    2e-27 
ref|ZP_02093185.1|  hypothetical protein FAEPRAM212_03492 [Fae...   127    2e-27 
ref|ZP_04544964.1|  conserved hypothetical protein [Bacteroide...   127    2e-27 
ref|YP_002264540.1|  divalent cation transporter, putative mag...   127    2e-27 
ref|ZP_02067820.1|  hypothetical protein BACOVA_04831 [Bactero...   127    2e-27 
ref|ZP_05712501.1|  magnesium transporter [Enterococcus faeciu...   127    2e-27 
ref|YP_536192.1|  Mg2+ transporter [Lactobacillus salivarius U...   127    2e-27 
ref|ZP_01960093.1|  hypothetical protein BACCAC_01705 [Bactero...   127    2e-27 
ref|YP_319333.1|  divalent cation transporter [Nitrobacter win...   127    2e-27 
ref|ZP_05414835.1|  magnesium transporter [Bacteroides finegol...   126    3e-27 
ref|NP_662732.1|  Mg2+ transporter MgtE [Chlorobium tepidum TL...   126    3e-27 
ref|YP_001560112.1|  magnesium transporter [Clostridium phytof...   126    3e-27 
ref|YP_002434948.1|  magnesium transporter [Desulfovibrio vulg...   126    3e-27 
ref|YP_098062.1|  putative Mg2+ transporter MgtE [Bacteroides ...   126    3e-27 
ref|ZP_01117328.1|  magnesium transporter [Polaribacter irgens...   126    3e-27 
ref|ZP_01728248.1|  Mg2+ transport protein [Cyanothece sp. CCY...   126    3e-27 
ref|YP_008114.1|  putative Mg2+ transporter [Candidatus Protoc...   126    4e-27 
ref|ZP_06486310.1|  Mg++ transporter [Xanthomonas campestris p...   126    4e-27 
ref|ZP_03735800.1|  magnesium transporter [Desulfonatronospira...   126    4e-27 
ref|NP_868719.1|  magnesium transporter Ykok [Rhodopirellula b...   126    4e-27 
ref|ZP_01049517.1|  putative transmembrane Mg2+ transporter [D...   126    4e-27 
ref|ZP_05279728.1|  putative transmembrane Mg2+ transporter [B...   125    4e-27 
ref|ZP_05628740.1|  MG2+ transporter MGTE [Fusobacterium sp. D12]   125    4e-27 
ref|YP_001038350.1|  magnesium transporter [Clostridium thermo...   125    4e-27 
ref|YP_001002298.1|  magnesium transporter [Halorhodospira hal...   125    5e-27 
ref|YP_002377882.1|  magnesium transporter [Cyanothece sp. PCC...   125    5e-27 
ref|YP_400286.1|  magnesium transporter [Synechococcus elongat...   125    5e-27 
ref|YP_001319225.1|  magnesium transporter [Alkaliphilus metal...   125    5e-27 
ref|NP_644377.1|  Mg++ transporter [Xanthomonas axonopodis pv....   125    5e-27 
ref|ZP_06053049.1|  putative Magnesium transporter [Grimontia ...   125    5e-27 
ref|NP_904476.1|  magnesium transporter [Porphyromonas gingiva...   125    5e-27 
ref|ZP_06249983.1|  magnesium transporter [Clostridium thermoc...   125    6e-27 
ref|YP_877667.1|  magnesium transporter [Clostridium novyi NT]...   125    6e-27 
ref|YP_001883809.1|  Mg2+ transporter MgtE [Borrelia hermsii D...   125    6e-27 
ref|YP_001928363.1|  putative magnesium transporter [Porphyrom...   125    7e-27 
ref|YP_380095.1|  divalent cation transporter [Chlorobium chlo...   125    8e-27 
ref|ZP_03779742.1|  hypothetical protein CLOHYLEM_06820 [Clost...   124    1e-26 
ref|YP_001637291.1|  magnesium transporter [Chloroflexus auran...   124    1e-26 
ref|YP_170992.1|  Mg2+ transport protein [Synechococcus elonga...   124    1e-26 
ref|YP_988651.1|  magnesium transporter [Bartonella bacillifor...   124    1e-26 
ref|ZP_04200937.1|  Mg2+ transporter mgtE [Bacillus cereus AH6...   124    1e-26 
ref|NP_781975.1|  Mg2+ transporter mgtE [Clostridium tetani E8...   124    1e-26 
ref|YP_393855.1|  divalent cation transporter [Sulfurimonas de...   124    1e-26 
ref|YP_001193196.1|  magnesium transporter [Flavobacterium joh...   124    1e-26 
ref|YP_001747212.1|  MgtE integral membrane region [Pseudomona...   124    1e-26 
ref|ZP_03672557.1|  magnesium transporter [Borrelia valaisiana...   124    1e-26 
ref|YP_002280466.1|  magnesium transporter [Rhizobium legumino...   124    1e-26 
ref|ZP_01627973.1|  Mg2+ transport protein [Nodularia spumigen...   124    1e-26 
ref|YP_002290272.1|  magnesium transporter [Oligotropha carbox...   124    1e-26 
ref|NP_717178.1|  magnesium transporter, putative [Shewanella ...   124    1e-26 
ref|ZP_02430427.1|  hypothetical protein CLOSCI_00638 [Clostri...   124    2e-26 
ref|ZP_05427914.1|  magnesium transporter [Eubacterium saphenu...   124    2e-26 
ref|ZP_03305139.1|  hypothetical protein ANHYDRO_01576 [Anaero...   124    2e-26 
ref|ZP_03524456.1|  Mg2+ transporter protein [Rhizobium etli G...   124    2e-26 
ref|ZP_05980705.1|  magnesium transporter [Subdoligranulum var...   124    2e-26 
ref|YP_001771390.1|  magnesium transporter [Methylobacterium s...   124    2e-26 
ref|YP_001245170.1|  response regulator receiver protein [Ther...   124    2e-26 
ref|YP_002730434.1|  magnesium transporter [Persephonella mari...   123    2e-26 
ref|ZP_04094267.1|  Mg2+ transporter mgtE [Bacillus thuringien...   123    2e-26 
ref|ZP_04859586.1|  MgtE family magnesium /cobalt transporter-...   123    3e-26 
ref|NP_973316.1|  magnesium transporter [Treponema denticola A...   123    3e-26 
pir||I40201  mgtE protein - Bacillus firmus >gb|AAA64954.1| Mg...   123    3e-26 
ref|ZP_01852376.1|  Mg2+ transport protein [Planctomyces maris...   123    3e-26 
ref|YP_376156.1|  divalent cation transporter [Synechococcus s...   123    3e-26 
ref|ZP_06382230.1|  Mg2+ transporter [Arthrospira platensis st...   123    3e-26 
ref|ZP_04568663.1|  MG2+ transporter MGTE [Fusobacterium morti...   123    3e-26 
ref|ZP_02621379.1|  magnesium transporter [Clostridium botulin...   123    3e-26 
ref|ZP_01128364.1|  Divalent cation transporter [Nitrococcus m...   123    3e-26 
ref|YP_945380.1|  Mg2+ transporter MgtE [Borrelia turicatae 91...   122    3e-26 
ref|ZP_01976736.1|  magnesium transporter MgtE, putative [Vibr...   122    3e-26 
ref|ZP_06572105.1|  magnesium transporter [Clostridium sp. M62...   122    4e-26 
ref|YP_001608665.1|  Mg2+ transport protein [Bartonella triboc...   122    4e-26 
ref|YP_001432618.1|  magnesium transporter [Roseiflexus casten...   122    5e-26 
ref|YP_365895.1|  magnesium transporter [Xanthomonas campestri...   122    5e-26 
ref|ZP_05375116.1|  magnesium transporter [Hyphomicrobium deni...   122    5e-26 
ref|ZP_04034451.1|  Mg2+ transporter MgtE [Meiothermus silvanu...   122    5e-26 
ref|ZP_05634270.1|  MG2+ transporter MGTE [Fusobacterium ulcer...   122    5e-26 
ref|YP_002971226.1|  Mg2+ transport protein [Bartonella graham...   122    5e-26 
ref|YP_001977566.1|  Mg2+ transporter protein [Rhizobium etli ...   122    6e-26 
ref|YP_002433869.1|  magnesium transporter [Desulfatibacillum ...   122    6e-26 
ref|ZP_03519375.1|  magnesium transporter [Rhizobium etli IE4771]   122    6e-26 
ref|YP_578713.1|  magnesium transporter [Nitrobacter hamburgen...   122    6e-26 
ref|ZP_05472991.1|  magnesium transporter [Anaerococcus vagina...   122    6e-26 
ref|ZP_01885355.1|  putative Mg2+ transporter [Pedobacter sp. ...   122    7e-26 
ref|YP_722045.1|  magnesium transporter [Trichodesmium erythra...   122    7e-26 
ref|YP_468844.1|  magnesium (mg2+) transporter protein [Rhizob...   122    7e-26 
ref|YP_245138.1|  Mg++ transporter [Xanthomonas campestris pv....   122    7e-26 
ref|ZP_03276338.1|  magnesium transporter [Arthrospira maxima ...   121    8e-26 
ref|ZP_06403484.1|  magnesium transporter [bacterium S5] >gb|E...   121    8e-26 
ref|YP_926958.1|  magnesium transporter, putative [Shewanella ...   121    9e-26 
ref|ZP_03629451.1|  magnesium transporter [bacterium Ellin514]...   121    1e-25 
ref|ZP_03540241.1|  magnesium transporter [Borrelia garinii Fa...   121    1e-25 
ref|YP_072824.1|  Mg2+ transport protein [Borrelia garinii PBi...   121    1e-25 
ref|ZP_01468967.1|  Divalent cation transporter [Synechococcus...   121    1e-25 
ref|ZP_04126545.1|  Mg2+ transporter mgtE [Bacillus thuringien...   121    1e-25 
ref|ZP_03527476.1|  Mg2+ transporter protein [Rhizobium etli C...   121    1e-25 
ref|ZP_05360152.1|  magnesium transporter [Acinetobacter radio...   121    1e-25 
ref|ZP_03513369.1|  Mg2+ transporter protein [Rhizobium etli 8...   121    1e-25 
ref|YP_709821.1|  Mg2+ transport protein [Borrelia afzelii PKo...   121    1e-25 
ref|ZP_02037456.1|  hypothetical protein BACCAP_03070 [Bactero...   120    1e-25 
ref|ZP_03539697.1|  magnesium transporter [Borrelia garinii PB...   120    1e-25 
ref|ZP_03766065.1|  magnesium transporter ['Nostoc azollae' 07...   120    1e-25 
ref|ZP_03436071.1|  magnesium transporter [Borrelia afzelii AC...   120    1e-25 
ref|YP_003257260.1|  putative Mg2+ transporter [Blattabacteriu...   120    2e-25 
ref|YP_001728442.1|  magnesium transporter [Leuconostoc citreu...   120    2e-25 
ref|ZP_06439412.1|  magnesium transporter [Anaerobaculum hydro...   120    2e-25 
pdb|2YVX|A  Chain A, Crystal Structure Of Magnesium Transporte...   120    2e-25 
ref|ZP_06299937.1|  hypothetical protein pah_c171o006 [Parachl...   120    2e-25 
ref|ZP_01093363.1|  Mg2+ transport protein [Blastopirellula ma...   120    2e-25 
ref|YP_002222032.1|  Mg2 transport protein [Borrelia duttonii ...   120    2e-25 
ref|YP_003283764.1|  Mg2+ transporter [Blattabacterium sp. (Bl...   120    2e-25 
ref|NP_639329.1|  Mg++ transporter [Xanthomonas campestris pv....   120    2e-25 
ref|ZP_03795970.1|  magnesium transporter [Borrelia burgdorfer...   120    2e-25 
ref|ZP_03086652.1|  Mg2+ transport protein (mgtE) [Borrelia bu...   120    2e-25 
ref|YP_001758085.1|  magnesium transporter [Methylobacterium r...   120    2e-25 
ref|YP_002521810.1|  magnesium transporter [Thermomicrobium ro...   120    3e-25 
ref|YP_004670.1|  Mg(2+) transporter mgtE [Thermus thermophilu...   120    3e-25 
ref|YP_144326.1|  Mg2+ transporter MgtE [Thermus thermophilus ...   120    3e-25 
ref|ZP_03436288.1|  magnesium transporter [Borrelia burgdorfer...   119    3e-25 
ref|YP_001049772.1|  magnesium transporter [Shewanella baltica...   119    3e-25 
ref|YP_003121698.1|  magnesium transporter [Chitinophaga pinen...   119    4e-25 
ref|ZP_01045384.1|  divalent cation transporter [Nitrobacter s...   119    4e-25 
ref|YP_003091595.1|  magnesium transporter [Pedobacter heparin...   119    4e-25 
ref|ZP_03623531.1|  magnesium transporter [Borrelia burgdorfer...   119    4e-25 
ref|ZP_05736960.1|  magnesium transporter [Granulicatella adia...   119    4e-25 
ref|ZP_03773054.1|  magnesium transporter [Borrelia sp. SV1] >...   119    4e-25 
ref|ZP_02234594.1|  hypothetical protein DORFOR_01466 [Dorea f...   119    4e-25 
ref|NP_212514.1|  Mg2+ transport protein (mgtE) [Borrelia burg...   119    5e-25 
ref|ZP_04666566.1|  magnesium transporter [Clostridiales bacte...   119    5e-25 
ref|ZP_04298243.1|  Mg2+ transporter mgtE [Bacillus cereus AH6...   119    6e-25 
ref|YP_002543868.1|  magnesium transporter [Agrobacterium radi...   119    6e-25 
ref|YP_001997973.1|  magnesium transporter [Chlorobaculum parv...   119    6e-25 
ref|YP_475112.1|  magnesium transporter [Synechococcus sp. JA-...   119    6e-25 
gb|ADD45212.1|  magnesium transporter [Stackebrandtia nassauen...   118    7e-25 
ref|ZP_03821983.1|  Mg transporter (MgtE) [Acinetobacter sp. A...   118    8e-25 
ref|YP_374251.1|  divalent cation transporter [Chlorobium lute...   118    8e-25 
ref|ZP_01733910.1|  putative transmembrane Mg2+ transporter [F...   118    8e-25 
ref|NP_489224.1|  Mg2+ transport protein [Nostoc sp. PCC 7120]...   118    8e-25 
ref|ZP_01994674.1|  hypothetical protein DORLON_00659 [Dorea l...   118    9e-25 
ref|YP_002938957.1|  putative divalent cation transport protei...   118    1e-24 
ref|YP_322942.1|  divalent cation transporter [Anabaena variab...   117    1e-24 
ref|YP_001129910.1|  magnesium transporter [Prosthecochloris v...   117    1e-24 
ref|YP_002974929.1|  magnesium transporter [Rhizobium legumino...   117    1e-24 
ref|YP_287876.1|  putative MG2+ transport protein [Mycoplasma ...   117    2e-24 
gb|AAZ53853.2|  putative MG2+ transport protein [Mycoplasma hy...   117    2e-24 
ref|YP_001323960.1|  magnesium transporter [Methanococcus vann...   117    2e-24 
ref|YP_001012133.1|  Mg2+ transporter [Prochlorococcus marinus...   117    2e-24 
ref|YP_279281.1|  putative MG2+ transport protein [Mycoplasma ...   117    2e-24 
ref|YP_001015903.1|  Mg2+ transporter [Prochlorococcus marinus...   117    2e-24 
ref|YP_001960479.1|  magnesium transporter [Chlorobium phaeoba...   117    2e-24 
ref|YP_767065.1|  putative magnesium transporter protein [Rhiz...   117    2e-24 
gb|AAZ44570.2|  putative MG2+ transport protein [Mycoplasma hy...   117    2e-24 
ref|YP_678239.1|  magnesium transporter, MgtE [Cytophaga hutch...   116    3e-24 
ref|ZP_06062793.1|  magnesium transporter [Acinetobacter johns...   116    3e-24 
ref|YP_115995.1|  Mg2+ transporter [Mycoplasma hyopneumoniae 2...   116    3e-24 
ref|YP_002308861.1|  magnesium transporter [Candidatus Azobact...   116    3e-24 
ref|ZP_03970662.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   116    4e-24 
ref|NP_633684.1|  MG2+ transporter MGTE [Methanosarcina mazei ...   116    4e-24 
ref|ZP_06347454.1|  magnesium transporter [Clostridium sp. M62...   115    5e-24 
ref|YP_635548.1|  magnesium transporter [Myxococcus xanthus DK...   115    5e-24 
ref|ZP_01968838.1|  hypothetical protein RUMTOR_02418 [Ruminoc...   115    5e-24 
ref|ZP_03675013.1|  magnesium transporter [Borrelia spielmanii...   115    5e-24 
ref|ZP_00741176.1|  Mg2+ transporter mgtE [Bacillus thuringien...   115    5e-24 
ref|ZP_01462006.1|  magnesium transporter [Stigmatella auranti...   115    6e-24 
ref|ZP_05785653.1|  magnesium transporter [Silicibacter lacusc...   115    7e-24 
ref|YP_053458.1|  Mg/Co/Ni transporter [Mesoplasma florum L1] ...   115    7e-24 
ref|ZP_04779963.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   115    7e-24 
ref|NP_224491.1|  Mg2+ transporter [Chlamydophila pneumoniae C...   115    8e-24 
ref|YP_002549003.1|  magnesium transport protein [Agrobacteriu...   115    8e-24 
ref|YP_292401.1|  Mg2+ transporter [Prochlorococcus marinus st...   115    9e-24 
ref|ZP_03849733.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   114    1e-23 
ref|ZP_04114922.1|  Mg2+ transporter mgtE [Bacillus thuringien...   114    1e-23 
ref|ZP_04922625.1|  Mg/Co/Ni transporter MgtE [Vibrio sp. Ex25...   114    1e-23 
ref|YP_003388109.1|  magnesium transporter [Spirosoma linguale...   114    1e-23 
ref|YP_001800450.1|  putative transporter [Corynebacterium ure...   114    1e-23 
ref|ZP_02082937.1|  hypothetical protein CLOBOL_00452 [Clostri...   114    1e-23 
ref|ZP_03915416.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   114    1e-23 
ref|NP_228967.1|  Mg2+ transporter MgtE, putative [Thermotoga ...   114    1e-23 
ref|ZP_04427413.1|  Mg2+ transporter MgtE [Planctomyces limnop...   114    2e-23 
ref|ZP_03128588.1|  magnesium transporter [Chthoniobacter flav...   114    2e-23 
ref|ZP_04584876.1|  magnesium transporter [Sulfurihydrogenibiu...   114    2e-23 
ref|ZP_05613471.1|  magnesium transporter [Faecalibacterium pr...   114    2e-23 
ref|ZP_01875889.1|  magnesium (Mg2+) transporter-like protein ...   114    2e-23 
ref|ZP_01988999.1|  putative divalent cation transporter [Vibr...   113    2e-23 
ref|ZP_01260580.1|  putative Mg transporter MgtE [Vibrio algin...   113    2e-23 
ref|ZP_05903911.1|  putataive Mg transporter MgtE [Vibrio para...   113    2e-23 
ref|YP_003152816.1|  magnesium transporter [Anaerococcus prevo...   113    2e-23 
ref|NP_800288.1|  putataive Mg transporter MgtE [Vibrio paraha...   113    2e-23 
ref|NP_354023.1|  magnesium transport protein [Agrobacterium t...   113    3e-23 
ref|YP_002367207.1|  magnesium transporter [Bacillus cereus B4...   113    3e-23 
ref|YP_290255.1|  divalent cation transporter [Thermobifida fu...   112    4e-23 
ref|YP_001471005.1|  magnesium transporter [Thermotoga letting...   112    4e-23 
ref|ZP_02927276.1|  Mg/Co/Ni transporter MgtE (contains CBS do...   112    4e-23 
ref|ZP_04212231.1|  Mg2+ transporter mgtE [Bacillus cereus Roc...   112    4e-23 
ref|YP_003320314.1|  magnesium transporter [Sphaerobacter ther...   112    4e-23 
ref|ZP_02732111.1|  Mg2+ transport protein [Gemmata obscuriglo...   112    4e-23 
ref|NP_829362.1|  magnesium transporter [Chlamydophila caviae ...   112    5e-23 
ref|YP_219896.1|  putative magnesium transporter [Chlamydophil...   112    5e-23 
ref|ZP_06182213.1|  putative Mg transporter MgtE [Vibrio algin...   112    5e-23 
ref|YP_002462246.1|  magnesium transporter [Chloroflexus aggre...   112    5e-23 
ref|YP_002534956.1|  Response regulator receiver protein [Ther...   112    6e-23 
ref|ZP_06069841.1|  magnesium transporter [Acinetobacter lwoff...   112    6e-23 
ref|ZP_05789013.1|  magnesium transporter [Synechococcus sp. W...   112    6e-23 
ref|ZP_00373414.1|  magnesium transporter [Wolbachia endosymbi...   112    7e-23 
ref|ZP_05710583.1|  magnesium transporter [Desulfurivibrio alk...   112    7e-23 
ref|NP_893747.1|  Mg2+ transporter [Prochlorococcus marinus su...   111    9e-23 
ref|ZP_02210307.1|  hypothetical protein CLOBAR_02715 [Clostri...   111    9e-23 
ref|ZP_05912305.1|  Mg2+ transporter MgtE [Brevibacterium line...   111    1e-22 
ref|YP_474150.1|  magnesium transporter [Synechococcus sp. JA-...   111    1e-22 
ref|ZP_04105892.1|  Mg2+ transporter mgtE [Bacillus thuringien...   111    1e-22 
ref|YP_398220.1|  Mg2+ transporter [Prochlorococcus marinus st...   111    1e-22 
ref|YP_515428.1|  Mg++ transporter [Chlamydophila felis Fe/C-5...   111    1e-22 
ref|YP_002956546.1|  Mg2+ transporter MgtE [Micrococcus luteus...   111    1e-22 
ref|YP_001619263.1|  Mg2+ transporter [Sorangium cellulosum 'S...   111    1e-22 
ref|YP_001996937.1|  magnesium transporter [Chloroherpeton tha...   111    1e-22 
ref|ZP_04075953.1|  Mg2+ transporter mgtE [Bacillus thuringien...   111    1e-22 
ref|ZP_05876370.1|  magnesium transporter [Vibrio furnissii CI...   110    1e-22 
ref|ZP_05137427.1|  magnesium transporter [Prochlorococcus mar...   110    1e-22 
ref|YP_001485103.1|  Mg2+ transporter [Prochlorococcus marinus...   110    1e-22 
ref|YP_001944066.1|  magnesium transporter [Chlorobium limicol...   110    1e-22 
ref|YP_380426.1|  magnesium transporter [Synechococcus sp. CC9...   110    2e-22 
ref|YP_001886060.1|  magnesium transporter [Clostridium botuli...   110    2e-22 
ref|YP_002019245.1|  magnesium transporter [Pelodictyon phaeoc...   110    2e-22 
ref|ZP_02996732.1|  hypothetical protein CLOSPO_03855 [Clostri...   110    2e-22 
ref|YP_001092046.1|  Mg2+ transporter [Prochlorococcus marinus...   110    2e-22 
ref|ZP_06065247.1|  magnesium transporter [Acinetobacter junii...   110    2e-22 
ref|ZP_04088182.1|  Mg2+ transporter mgtE [Bacillus thuringien...   110    2e-22 
ref|ZP_01857891.1|  magnesium transporter Ykok [Planctomyces m...   110    2e-22 
ref|ZP_04168958.1|  Mg2+ transporter mgtE [Bacillus mycoides D...   110    2e-22 
ref|ZP_03232607.1|  magnesium transporter [Bacillus cereus AH1...   110    3e-22 
ref|YP_001010230.1|  Mg2+ transporter [Prochlorococcus marinus...   110    3e-22 
ref|ZP_01993046.1|  magnesium transporter [Vibrio parahaemolyt...   110    3e-22 
ref|YP_003371566.1|  magnesium transporter [Pirellula staleyi ...   109    3e-22 
ref|ZP_01385250.1|  magnesium transporter [Chlorobium ferrooxi...   109    3e-22 
ref|ZP_02091475.1|  hypothetical protein FAEPRAM212_01755 [Fae...   109    3e-22 
ref|YP_002960809.1|  hypothetical protein MCJ_002950 [Mycoplas...   109    4e-22 
ref|ZP_05614606.1|  magnesium transporter [Faecalibacterium pr...   109    4e-22 
ref|YP_001390477.1|  magnesium transporter [Clostridium botuli...   109    4e-22 
ref|ZP_04027646.1|  Mg2+ transporter MgtE [Tsukamurella paurom...   109    5e-22 
ref|YP_001611128.1|  Mg2+ transporter [Sorangium cellulosum 'S...   109    5e-22 
ref|ZP_04197558.1|  Mg2+ transporter mgtE [Bacillus cereus AH6...   108    5e-22 
ref|YP_001528299.1|  magnesium transporter [Desulfococcus oleo...   108    5e-22 
ref|ZP_03929510.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   108    5e-22 
ref|ZP_03991670.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   108    5e-22 
ref|YP_001223875.1|  Mg/Co/Ni transporter MgtE [Synechococcus ...   108    8e-22 
ref|ZP_01125418.1|  MgtE family, putative magnesium transport ...   108    1e-21 
ref|YP_001253653.1|  magnesium transporter [Clostridium botuli...   107    1e-21 
ref|ZP_01705357.1|  magnesium transporter [Shewanella putrefac...   107    1e-21 
ref|YP_001184449.1|  magnesium transporter [Shewanella putrefa...   107    1e-21 
ref|YP_001780754.1|  magnesium transporter [Clostridium botuli...   107    2e-21 
ref|YP_001383492.1|  magnesium transporter [Clostridium botuli...   107    2e-21 
ref|ZP_02613210.1|  magnesium transporter [Clostridium botulin...   107    2e-21 
ref|ZP_02437670.1|  hypothetical protein CLOSS21_00100 [Clostr...   107    2e-21 
ref|ZP_02094720.1|  hypothetical protein PEPMIC_01488 [Parvimo...   107    2e-21 
ref|YP_002356994.1|  magnesium transporter [Shewanella baltica...   107    2e-21 
ref|YP_001555943.1|  magnesium transporter [Shewanella baltica...   107    2e-21 
ref|NP_296843.1|  magnesium transporter [Chlamydia muridarum N...   107    2e-21 
ref|ZP_06194646.1|  magnesium transporter [Chlamydia muridarum...   107    2e-21 
ref|YP_328002.1|  Mg2+ transporter [Chlamydia trachomatis A/HA...   107    2e-21 
ref|YP_001051649.1|  magnesium transporter [Shewanella baltica...   107    2e-21 
ref|YP_278617.1|  Mg2+ transport protein [Mycoplasma synoviae 53]   107    2e-21 
ref|NP_896196.1|  Mg2+ transporter [Synechococcus sp. WH 8102]...   107    2e-21 
ref|ZP_06383109.1|  magnesium transporter [Arthrospira platens...   107    3e-21 
ref|ZP_03753808.1|  hypothetical protein ROSEINA2194_02229 [Ro...   106    3e-21 
ref|YP_001654522.1|  magnesium transport protein [Chlamydia tr...   106    3e-21 
ref|NP_219698.1|  Mg2+ transporter [Chlamydia trachomatis D/UW...   106    3e-21 
ref|ZP_04452693.1|  hypothetical protein GCWU000182_02000 [Abi...   106    3e-21 
gb|AAZ43906.2|  Mg2+ transport protein [Mycoplasma synoviae 53]     106    3e-21 
ref|ZP_04130683.1|  Mg2+ transporter mgtE [Bacillus thuringien...   106    3e-21 
ref|YP_002016549.1|  magnesium transporter [Prosthecochloris a...   106    3e-21 
ref|YP_001367586.1|  magnesium transporter [Shewanella baltica...   106    3e-21 
ref|YP_001515844.1|  magnesium transporter MgtE [Acaryochloris...   106    4e-21 
ref|ZP_04956823.1|  magnesium transporter [gamma proteobacteri...   106    4e-21 
ref|ZP_02042094.1|  hypothetical protein RUMGNA_02871 [Ruminoc...   106    4e-21 
ref|NP_599477.1|  Mg/Co/Ni transporter MgtE [Corynebacterium g...   105    5e-21 
ref|ZP_05353564.1|  magnesium transport protein [Chlamydia tra...   105    5e-21 
ref|YP_003271086.1|  magnesium transporter [Haliangium ochrace...   105    6e-21 
dbj|BAB97617.1|  Mg/Co/Ni transporter MgtE (contains CBS domai...   105    6e-21 
ref|YP_120514.1|  putative divalent cation transporter [Nocard...   105    6e-21 
ref|YP_003153617.1|  Mg2+ transporter MgtE [Brachybacterium fa...   105    7e-21 
ref|ZP_03628534.1|  CBS domain containing protein [bacterium E...   105    7e-21 
ref|YP_962411.1|  magnesium transporter [Shewanella sp. W3-18-...   105    7e-21 


ALIGNMENTS
>ref|YP_266497.1| magnesium transport protein mgtE [Candidatus Pelagibacter ubique 
HTCC1062]
 ref|ZP_01265151.1| magnesium transport protein mgtE [Candidatus Pelagibacter ubique 
HTCC1002]
 gb|AAZ21893.1| magnesium transport protein mgtE [Candidatus Pelagibacter ubique 
HTCC1062]
 gb|EAS84251.1| magnesium transport protein mgtE [Candidatus Pelagibacter ubique 
HTCC1002]
Length=457


Score =  552 bits (1422),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 265/310 (85%), Positives = 294/310 (94%), Gaps = 0/310 (0%)

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  60
            I +LENVDEKDKNTILS+LPPKDRFALLE LSYPED+AARIMQREFTA+PSNWSVGQTID
Sbjct  109  ITILENVDEKDKNTILSSLPPKDRFALLESLSYPEDTAARIMQREFTAVPSNWSVGQTID  168

Query  61   YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  120
            YLRENKDLPEEFLEIFI++E+FKPIG+VPSSKVL T RETKM SIM ++  L+PVDMD+E
Sbjct  169  YLRENKDLPEEFLEIFIIDEDFKPIGTVPSSKVLTTSRETKMLSIMSESQLLIPVDMDKE  228

Query  121  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  180
            EVGN+FENY+L+SA VVDKS KLVGMI YDD+LTVLKEEAEEDALRLAGVGDEEITDGV 
Sbjct  229  EVGNVFENYSLNSAAVVDKSNKLVGMIMYDDVLTVLKEEAEEDALRLAGVGDEEITDGVF  288

Query  181  TKTKRRFNWLLLNLFTAFLATWCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  240
             KT+RRFNWLLLNLFTAFLATW ISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV
Sbjct  289  KKTRRRFNWLLLNLFTAFLATWVISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  348

Query  241  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQLSLIISISMILTM  300
            R+LATNDLTKNNFTQNILKEFNIG+LNGIIFA+IS+++VQ+WFQD+ LSLIIS+SMI+TM
Sbjct  349  RTLATNDLTKNNFTQNILKEFNIGILNGIIFAIISALVVQVWFQDSLLSLIISMSMIVTM  408

Query  301  IIARLFGILI  310
            I+A LFGIL+
Sbjct  409  IVAGLFGILV  418


>ref|ZP_05069612.1| magnesium transporter [Candidatus Pelagibacter sp. HTCC7211]
 gb|EDZ60611.1| magnesium transporter [Candidatus Pelagibacter sp. HTCC7211]
Length=457

 Score =  525 bits (1352),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 262/310 (84%), Positives = 287/310 (92%), Gaps = 0/310 (0%)

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  60
            I +LENV E DKN ILS+LPPKDRFALLE LSYPED+AARIMQREFTAIPSNWSVGQTID
Sbjct  109  ISILENVPEDDKNNILSSLPPKDRFALLESLSYPEDTAARIMQREFTAIPSNWSVGQTID  168

Query  61   YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  120
            YLRENKDLPEEFLEIFI+NE FKPIG+VPSS+VL T R+TKM SIM ++  L+PVDMD+E
Sbjct  169  YLRENKDLPEEFLEIFIINEEFKPIGTVPSSRVLTTSRDTKMLSIMSESQLLIPVDMDKE  228

Query  121  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  180
            EV NLFENYNL+SA V+DK+ KLVGMI  DD+LTVL+EEAEEDALRLAGVGDEEITDGVI
Sbjct  229  EVANLFENYNLNSAAVIDKNNKLVGMIMSDDVLTVLQEEAEEDALRLAGVGDEEITDGVI  288

Query  181  TKTKRRFNWLLLNLFTAFLATWCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  240
            TKTKRRFNWLLLNLFTAFLATWCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV
Sbjct  289  TKTKRRFNWLLLNLFTAFLATWCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  348

Query  241  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQLSLIISISMILTM  300
            R++ATNDLT+NNF+ N+LKEF IG+LNGIIFA IS+ IVQ+WFQDN LS+IISISMILTM
Sbjct  349  RTIATNDLTENNFSSNVLKEFTIGILNGIIFAAISAFIVQIWFQDNTLSIIISISMILTM  408

Query  301  IIARLFGILI  310
            IIA LFGILI
Sbjct  409  IIAGLFGILI  418


>ref|ZP_06054915.1| magnesium transporter [alpha proteobacterium HIMB114]
 gb|EEY74684.1| magnesium transporter [alpha proteobacterium HIMB114]
Length=458

 Score =  354 bits (909),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 178/311 (57%), Positives = 233/311 (74%), Gaps = 1/311 (0%)

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGL-SYPEDSAARIMQREFTAIPSNWSVGQTI  59
            + ++ N+DE+ K  +   +P +D+  L E L +YPEDSAARIMQ E+ ++   W+VG+TI
Sbjct  107  LQIVSNLDEEKKIDVYEKIPLQDKKLLEEVLKAYPEDSAARIMQTEYCSVSPEWTVGETI  166

Query  60   DYLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDR  119
            DYLRE  DLP+EFL+IFIV++  +P+GSVPSS+VLR PR TKM  IM +T  L+  D D+
Sbjct  167  DYLRETDDLPKEFLQIFIVDDKKRPLGSVPSSRVLRNPRSTKMRDIMDETQMLIYGDWDK  226

Query  120  EEVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGV  179
            E+VG LFE YNL SA VVDK+ KL+GMIT DDILTVLKEEAEEDAL+LAGV DE ITD  
Sbjct  227  EQVGYLFEQYNLISAGVVDKNNKLIGMITADDILTVLKEEAEEDALKLAGVQDEAITDNA  286

Query  180  ITKTKRRFNWLLLNLFTAFLATWCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVT  239
            +  TK+RF WLL+NLFTA +A++ I LF   I+++V LA LMPIVASMGGNA  QTL VT
Sbjct  287  VKITKKRFVWLLINLFTAVIASYVIGLFDGNIQKVVALAVLMPIVASMGGNAATQTLTVT  346

Query  240  VRSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQLSLIISISMILT  299
            VR +AT +LT  N  + I KEF++G LNGI+F++IS + V  WF + +LS++I++SM++ 
Sbjct  347  VRLIATKELTAENLFKIIGKEFSVGFLNGILFSLISGLFVYFWFYEIKLSILIAVSMVIN  406

Query  300  MIIARLFGILI  310
            M  A L GI I
Sbjct  407  MACAGLSGIAI  417


>ref|ZP_01437807.1| probable magnesium transporter protein [Fulvimarina pelagi HTCC2506]
 gb|EAU42804.1| probable magnesium transporter protein [Fulvimarina pelagi HTCC2506]
Length=470

 Score =  334 bits (856),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 160/310 (51%), Positives = 221/310 (71%), Gaps = 0/310 (0%)

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  60
            + +LE+++E+D+  IL+ALP ++R  L   L YPE+SA R MQ EF A+P  WSVGQTID
Sbjct  119  VYILEDIEEEDRKEILAALPFRERMRLRRSLEYPEESAGRRMQTEFVAVPPYWSVGQTID  178

Query  61   YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  120
            Y+RE++DLP  F +IF+V+   K IG+V   ++LR  R  K+  IM DT   +P +MD+E
Sbjct  179  YMREDEDLPTSFAQIFVVDPMLKLIGAVELDRILRAKRPEKIEDIMHDTRHAIPAEMDQE  238

Query  121  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  180
            E   + E Y+L SA VVD+ E+LVG++T DD++ +++ EAEED  RL GVGDEEI+D V+
Sbjct  239  EAAQIIEQYDLLSAAVVDQGERLVGVLTIDDVIDIVQAEAEEDIKRLGGVGDEEISDTVL  298

Query  181  TKTKRRFNWLLLNLFTAFLATWCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  240
            T  + RF WL++NL TA LA+  I LF ATI+QMV LA LMPIVASMGGNAG QT+ V V
Sbjct  299  TAVRSRFTWLMVNLATAILASLVIGLFDATIQQMVALAVLMPIVASMGGNAGTQTMTVAV  358

Query  241  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQLSLIISISMILTM  300
            R+LA+ D+   N  + I +E  IG+LNG++FA++  I+  +WFQ+  L  +I+I+MI+ M
Sbjct  359  RALASRDIDLRNAGRIIRRESLIGLLNGVLFAIVIGIVAAVWFQNPGLGQVIAIAMIVNM  418

Query  301  IIARLFGILI  310
            I A L GILI
Sbjct  419  IAAALAGILI  428


>ref|ZP_02167932.1| putative transmembrane cationic transporter [Hoeflea phototrophica 
DFL-43]
 gb|EDQ32189.1| putative transmembrane cationic transporter [Hoeflea phototrophica 
DFL-43]
Length=479

 Score =  329 bits (844),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 152/300 (50%), Positives = 217/300 (72%), Gaps = 0/300 (0%)

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  60
            + +LE++DE D+  IL+ALP  +R  L   L YPED+A R MQ EF A+P  W+VGQTID
Sbjct  128  VYILEDLDEADQREILAALPFTERVRLRRSLDYPEDTAGRRMQTEFVAVPPFWTVGQTID  187

Query  61   YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  120
            Y+RE +DLP+ F +IF+++  FK +G V   ++LRT R+ ++  +M +T + +  +MD+E
Sbjct  188  YMREEEDLPDHFSQIFVIDPTFKLVGGVDLDRILRTKRQARIEDVMEETRYRIDAEMDQE  247

Query  121  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  180
            E   LFE Y+L SA VVD++E+LVG++T DD++ V+  EA+ED  RL GVGDEE++D +I
Sbjct  248  EAAQLFEQYDLLSAAVVDENERLVGVLTIDDVVDVIHAEADEDIKRLGGVGDEELSDNII  307

Query  181  TKTKRRFNWLLLNLFTAFLATWCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  240
            +  + RF+WLL+NL TA LA+W ISLF ATIEQMV LA LMPIVASMGGNAG QT+ VTV
Sbjct  308  STVRSRFSWLLINLATAILASWVISLFDATIEQMVALAVLMPIVASMGGNAGTQTMTVTV  367

Query  241  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQLSLIISISMILTM  300
            R+LAT D+   N  + I +E  +G++NG++FA I  ++  LWF ++ L  II+ +M++ M
Sbjct  368  RALATRDIDIYNAGRVIRREAAVGLINGVLFAAIIGVVAGLWFANSSLGGIIAAAMVVNM  427


>ref|ZP_01227484.1| Mg/Co/Ni transporter [Aurantimonas manganoxydans SI85-9A1]
 gb|EAS50252.1| Mg/Co/Ni transporter [Aurantimonas manganoxydans SI85-9A1]
Length=470

 Score =  323 bits (829),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 153/310 (49%), Positives = 221/310 (71%), Gaps = 0/310 (0%)

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  60
            + +LE++DE+D+  IL  LP ++R  L   L YPE+SA R MQ EF A+P  W+VGQTID
Sbjct  119  VYILEDLDEEDRKEILDRLPFRERIRLRRSLEYPEESAGRRMQTEFVAVPPFWTVGQTID  178

Query  61   YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  120
            Y+R+ ++LPE F +IF+++ +FK  G+V   ++LR  R  K+  IM +T   +P +MD+E
Sbjct  179  YMRDEEELPESFAQIFVIDPSFKLQGAVDLDRILRAKRPEKIEDIMHETRHAIPAEMDQE  238

Query  121  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  180
            E   + E Y+L SA VVD++E+LVG++T DD++ +L++EA+ED  RL GVGDEEI+D V+
Sbjct  239  EAAQIIEQYDLLSAAVVDENERLVGILTIDDVIDILQQEADEDIKRLGGVGDEEISDTVL  298

Query  181  TKTKRRFNWLLLNLFTAFLATWCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  240
            T  + RF+WLL+NL TA LA+  I LF ATIEQMV LA LMPIVASMGGNAG QT+ V V
Sbjct  299  TAARSRFSWLLINLATAILASCVIGLFDATIEQMVALAILMPIVASMGGNAGTQTMTVAV  358

Query  241  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQLSLIISISMILTM  300
            R+LA  D+   N  + I +E  +G+LNG++FA+I  ++  +WF+   L  +I+++M++ M
Sbjct  359  RALAARDIDLYNAGRIIRREALVGLLNGVLFALIIGLVAAVWFESAGLGGVIAVAMVVNM  418

Query  301  IIARLFGILI  310
            + A L GILI
Sbjct  419  MAAALAGILI  428


>ref|YP_673645.1| magnesium transporter [Mesorhizobium sp. BNC1]
 gb|ABG62480.1| magnesium transporter [Chelativorans sp. BNC1]
Length=471

 Score =  323 bits (829),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 153/310 (49%), Positives = 220/310 (70%), Gaps = 0/310 (0%)

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  60
            + +LE++D +D++ IL+ LP  +R  L   LSYPE++A R MQ EF A+P  W+VGQTID
Sbjct  121  VYILEDLDPEDQDEILAQLPFTERVRLRRSLSYPEETAGRRMQTEFVAVPPFWTVGQTID  180

Query  61   YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  120
            Y+RE+++LP+ F +IF+++ +F+ +G+V   ++LRT R  K   IM +T   +P  MD+E
Sbjct  181  YMREDQNLPDSFSQIFVIDPSFRLVGAVDLDRILRTKRSVKTEEIMRETRHAIPATMDQE  240

Query  121  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  180
            E   +FE Y+L SA VVD++E+LVG++T DD++ V+ +EAEED LR+ GVGDEE++D V+
Sbjct  241  EAARIFEQYDLLSAAVVDENERLVGVLTIDDVVDVITQEAEEDLLRMGGVGDEELSDSVL  300

Query  181  TKTKRRFNWLLLNLFTAFLATWCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  240
               + R  WL++NL TAF+A   ISLF ATIEQ+V LA LMPIVA MGGNAG QT+ VTV
Sbjct  301  AAGRSRVPWLMVNLVTAFIAASVISLFDATIEQVVALAVLMPIVAGMGGNAGSQTMTVTV  360

Query  241  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQLSLIISISMILTM  300
            R+LAT DL   N  + I +E  +G+LNG+IFA +  ++   WFQ   +  II+ +M++ M
Sbjct  361  RALATGDLDIYNAGRIIRREVGVGLLNGVIFATLIGLVAGAWFQSPTIGGIIAAAMVINM  420

Query  301  IIARLFGILI  310
             +A L GILI
Sbjct  421  FVAALAGILI  430


>ref|ZP_05807852.1| magnesium transporter [Mesorhizobium opportunistum WSM2075]
 gb|EEW35657.1| magnesium transporter [Mesorhizobium opportunistum WSM2075]
Length=470

 Score =  323 bits (828),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 151/310 (48%), Positives = 221/310 (71%), Gaps = 0/310 (0%)

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  60
            + +LE+++++D++ ILS LP  +R  L   L YPE++A R MQ EF A+P  W++GQTID
Sbjct  119  VYILEDLEKEDQDEILSQLPFTERIRLRRSLDYPEETAGRRMQTEFVAVPPFWTIGQTID  178

Query  61   YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  120
            Y+RE+K+LP+ F +IF+++ +FK +G++   ++LRT R  K+  +M +T   +P  MD+E
Sbjct  179  YMREDKNLPDRFSQIFVIDPSFKLLGAIDLDQILRTKRTVKVEEVMHETRHAIPATMDQE  238

Query  121  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  180
            E    FE Y+L SA VVD++E+LVG++T DD++ V+++EAEED LR+ GVGDEE++D ++
Sbjct  239  EAAREFEQYDLLSAAVVDENERLVGVLTIDDVVDVIQQEAEEDLLRMGGVGDEELSDSIL  298

Query  181  TKTKRRFNWLLLNLFTAFLATWCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  240
            + ++ R  WLL+NL TAFLA   I LF  TIE++V LA LMPIVA MGGNAG QT+ VTV
Sbjct  299  STSRSRVPWLLVNLLTAFLAASVIGLFDHTIERIVALAVLMPIVAGMGGNAGSQTMTVTV  358

Query  241  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQLSLIISISMILTM  300
            R+LAT DL   N  + I +E  +G +NGI+FA++  I+   WF D  L  II+ +MI+ M
Sbjct  359  RALATRDLDIYNAGRIIRREMGVGFINGIVFAILIGIVAAAWFHDANLGGIIAAAMIINM  418

Query  301  IIARLFGILI  310
             +A L GILI
Sbjct  419  FVAALAGILI  428


>ref|YP_001326721.1| magnesium transporter [Sinorhizobium medicae WSM419]
 gb|ABR59886.1| magnesium transporter [Sinorhizobium medicae WSM419]
Length=473

 Score =  323 bits (827),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 156/310 (50%), Positives = 215/310 (69%), Gaps = 0/310 (0%)

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  60
            + +LE++D++D+  IL+ LP  +R  L   L YPE +A R MQ EF A+P  W+VGQTID
Sbjct  122  VYILEDLDQEDQEEILAKLPFTERVRLRRSLDYPESTAGRRMQTEFVAVPPFWTVGQTID  181

Query  61   YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  120
            Y+RE+ DLPE F +IF+++  FK +G+V   +VLR  R  K+ +IM DT   VP +MD+E
Sbjct  182  YMREDDDLPESFTQIFVIDPTFKLLGAVDLDRVLRAKRSVKIDAIMRDTSHSVPAEMDQE  241

Query  121  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  180
            E   LFE Y+L SA VVD++ +LVG++T DD++ V++EEAEED LRL+GVGDEE++D V 
Sbjct  242  EAAQLFEQYDLLSAAVVDENGRLVGVLTIDDVVDVIQEEAEEDFLRLSGVGDEELSDSVA  301

Query  181  TKTKRRFNWLLLNLFTAFLATWCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  240
               + R  WL +N  TAF++   I LF ATI+Q+V LA LMPIVA MGGNAG QT+ VTV
Sbjct  302  EAARSRIPWLFVNSITAFVSASVIGLFDATIQQIVALAILMPIVAGMGGNAGSQTMTVTV  361

Query  241  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQLSLIISISMILTM  300
            R+LAT  L  +N  + I +E  +G+LNG+IF     ++  LWFQD  L  II+ +M++ M
Sbjct  362  RALATRGLDIHNAPRIIRREAGVGLLNGVIFGAFIGLVAGLWFQDPDLGGIIATAMLINM  421

Query  301  IIARLFGILI  310
            + A L GILI
Sbjct  422  MAAALAGILI  431


>ref|NP_102935.1| magnesium transporter [Mesorhizobium loti MAFF303099]
 dbj|BAB48721.1| magnesium transporter [Mesorhizobium loti MAFF303099]
Length=470

 Score =  322 bits (826),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 153/310 (49%), Positives = 218/310 (70%), Gaps = 0/310 (0%)

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  60
            + +LE+++++D++ ILS LP  +R  L   L YPE++A R MQ EF A+P  W++GQTID
Sbjct  119  VYILEDLEKEDQDEILSQLPFTERIRLRRSLDYPEETAGRRMQTEFVAVPPFWTIGQTID  178

Query  61   YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  120
            Y+RE+K+LP+ F +IF+++  FK +G++   ++LRT R  K+  +M +T   +P  MD+E
Sbjct  179  YMREDKNLPDRFSQIFVIDPTFKLVGAIDLDQILRTKRAVKVEDVMHETRHAIPATMDQE  238

Query  121  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  180
            E    FE Y+L SA VVD++E+LVG++T DD++ V+++EAEED LR+ GVGDEE++D V 
Sbjct  239  EAAREFEQYDLLSAAVVDENERLVGVLTIDDVVDVIQQEAEEDLLRMGGVGDEELSDTVF  298

Query  181  TKTKRRFNWLLLNLFTAFLATWCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  240
              ++ R  WLL+NLFTAFLA   I LF  TIE++V LA LMPIVA MGGNAG QT+ VTV
Sbjct  299  ATSRSRVPWLLVNLFTAFLAASVIGLFDHTIERIVALAVLMPIVAGMGGNAGSQTMTVTV  358

Query  241  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQLSLIISISMILTM  300
            R+LAT D+   N  + I +E  +G +NGI+FAV+  I+   WF+D  L  II  +MI+ M
Sbjct  359  RALATKDIDIYNAARIIRREMGVGFINGIVFAVLIGIVAAAWFRDPNLGGIIGAAMIINM  418

Query  301  IIARLFGILI  310
              A L GILI
Sbjct  419  FAAALAGILI  428


>ref|YP_002825773.1| putative transmembrane cationic transporter [Rhizobium sp. NGR234]
 gb|ACP25020.1| putative transmembrane cationic transporter [Rhizobium sp. NGR234]
Length=473

 Score =  318 bits (814),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 216/310 (69%), Gaps = 0/310 (0%)

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  60
            + +LE++D++D+  IL+ LP  +R  L   L YPE +A R MQ EF A+P  W+VGQTID
Sbjct  122  VYILEDLDQEDQEEILAKLPFTERVRLRRSLDYPESTAGRRMQTEFVAVPPFWTVGQTID  181

Query  61   YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  120
            Y+RE+ DLP+ F +IF+++  FK +G+V   +VLR  R  K+ +IM DT   +P +MD+E
Sbjct  182  YMREDDDLPDSFTQIFVIDPTFKLLGTVDLDRVLRAKRSVKIDAIMRDTSHAIPAEMDQE  241

Query  121  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  180
            E   LFE Y+L SA VVD + +LVG++T DD++ V++EEAEED LRL+GVGDEE++D V 
Sbjct  242  EAAQLFEQYDLLSAAVVDDNGRLVGVLTIDDVVDVIQEEAEEDLLRLSGVGDEELSDSVA  301

Query  181  TKTKRRFNWLLLNLFTAFLATWCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  240
              ++ R  WL +N  TA ++   I LF ATI+Q+V LA LMPIVA MGGNAG QT+ VTV
Sbjct  302  EASRSRVPWLFVNSMTACISASVIGLFDATIQQIVALAILMPIVAGMGGNAGSQTMTVTV  361

Query  241  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQLSLIISISMILTM  300
            R+LAT  L  +N ++ I +E  +G+LNG+IF  +  ++  LWFQD  +  II+ +M++ M
Sbjct  362  RALATRGLDIHNASRIIRREAGVGLLNGMIFGSLIGLVAGLWFQDPDIGGIIATAMLINM  421

Query  301  IIARLFGILI  310
            + A L GILI
Sbjct  422  MAAALAGILI  431


>emb|CAK32552.1| divalent cation transporter [uncultured organism]
Length=466

 Score =  317 bits (811),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 153/310 (49%), Positives = 217/310 (70%), Gaps = 0/310 (0%)

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  60
            + V E++DE+ ++ IL+ALP   R  L E LSYPEDSA RIMQRE   IPS W++G+TID
Sbjct  117  VEVFEDLDEEFQHRILTALPQAYRHILEESLSYPEDSAGRIMQREMVVIPSAWTLGETID  176

Query  61   YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  120
            Y+R  +DLP++F +++IVN    PIG +P S+ LRT R  +++ IM   + ++P+ MD+E
Sbjct  177  YMRAAEDLPDDFYDLYIVNPKHHPIGFIPLSRALRTRRPVRLTEIMETDMKVIPLTMDQE  236

Query  121  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  180
            EV  LF  Y L SA VVD++ +LVG+IT DD++ V+ EEAEED ++LAGV + ++    +
Sbjct  237  EVAYLFHQYGLVSAPVVDEAGRLVGVITVDDVVHVIHEEAEEDIMKLAGVQEPDLYSAFL  296

Query  181  TKTKRRFNWLLLNLFTAFLATWCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  240
              T+ RF WL++NL TA +A+  I LF ATIE++V LA LMPIVASMGGNAG QTL V V
Sbjct  297  ATTRARFPWLVVNLMTAIVASIVIGLFEATIERIVALAVLMPIVASMGGNAGTQTLTVAV  356

Query  241  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQLSLIISISMILTM  300
            R+LA  DLT+ N  + + KE  IG  NG++FAV++ ++  LWF    + L+I+ +M++ M
Sbjct  357  RALAMKDLTEANTRRFVGKELLIGAANGLLFAVLAGLVTWLWFSSPAIGLVIAAAMVVNM  416

Query  301  IIARLFGILI  310
             +A L G LI
Sbjct  417  AVAGLAGTLI  426

b) Blastx


                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|YP_266497.1|  magnesium transport protein mgtE [Candidatus...   464    5e-129
ref|ZP_05069612.1|  magnesium transporter [Candidatus Pelagiba...   453    1e-125
ref|ZP_06054915.1|  magnesium transporter [alpha proteobacteri...   300    1e-79 
ref|ZP_02167932.1|  putative transmembrane cationic transporte...   283    3e-74 
ref|ZP_01437807.1|  probable magnesium transporter protein [Fu...   281    7e-74 
ref|ZP_03517069.1|  magnesium transporter protein [Rhizobium e...   280    2e-73 
ref|YP_768135.1|  putative transmembrane cationic transporter ...   278    5e-73 
ref|YP_001326721.1|  magnesium transporter [Sinorhizobium medi...   278    6e-73 
ref|YP_001978460.1|  probable magnesium transporter protein [R...   278    8e-73 
ref|YP_469726.1|  magnesium transporter protein [Rhizobium etl...   278    8e-73 
ref|YP_002975886.1|  magnesium transporter [Rhizobium legumino...   277    1e-72 
ref|YP_002281377.1|  magnesium transporter [Rhizobium legumino...   277    1e-72 
ref|NP_354549.2|  magnesium transport protein [Agrobacterium t...   277    1e-72 
ref|YP_002825773.1|  putative transmembrane cationic transport...   276    2e-72 
ref|YP_002549888.1|  magnesium transport protein [Agrobacteriu...   275    4e-72 
ref|NP_385509.1|  putative transporter transmembrane protein [...   275    4e-72 
ref|YP_673645.1|  magnesium transporter [Mesorhizobium sp. BNC...   275    4e-72 
ref|ZP_01227484.1|  Mg/Co/Ni transporter [Aurantimonas mangano...   275    5e-72 
ref|ZP_05807852.1|  magnesium transporter [Mesorhizobium oppor...   272    3e-71 
ref|YP_002544605.1|  magnesium transporter [Agrobacterium radi...   272    3e-71 
ref|NP_102935.1|  magnesium transporter [Mesorhizobium loti MA...   271    6e-71 
ref|YP_001414043.1|  magnesium transporter [Parvibaculum lavam...   271    1e-70 
emb|CAK32552.1|  divalent cation transporter [uncultured organ...   265    4e-69 
ref|ZP_05083691.1|  magnesium transporter [Pseudovibrio sp. JE...   265    7e-69 
ref|ZP_05114291.1|  magnesium transporter [Labrenzia alexandri...   264    1e-68 
ref|ZP_01548512.1|  probable magnesium transporter protein [St...   261    1e-67 
ref|ZP_01305195.1|  magnesium transporter [Sphingomonas sp. SK...   256    3e-66 
ref|ZP_05343108.1|  magnesium transporter [Thalassiobium sp. R...   253    3e-65 
ref|ZP_01864358.1|  Mg/Co/Ni transporter [Erythrobacter sp. SD...   252    4e-65 
ref|YP_003544100.1|  magnesium transporter [Sphingobium japoni...   252    5e-65 
ref|YP_001418963.1|  magnesium transporter [Xanthobacter autot...   251    6e-65 
ref|ZP_01058601.1|  magnesium transporter [Roseobacter sp. MED...   251    6e-65 
ref|ZP_01754930.1|  magnesium transporter [Roseobacter sp. SK2...   250    2e-64 
ref|ZP_05089045.1|  magnesium transporter [Ruegeria sp. R11] >...   249    2e-64 
ref|YP_616196.1|  magnesium transporter [Sphingopyxis alaskens...   248    7e-64 
ref|ZP_05079063.1|  magnesium transporter [Rhodobacterales bac...   248    9e-64 
ref|YP_001264017.1|  magnesium transporter [Sphingomonas witti...   248    9e-64 
ref|ZP_02148251.1|  magnesium transporter [Phaeobacter gallaec...   247    1e-63 
ref|ZP_02144875.1|  hypothetical protein RGBS107_18043 [Phaeob...   247    2e-63 
ref|YP_001525751.1|  divalent cation transporter [Azorhizobium...   247    2e-63 
ref|YP_168163.1|  magnesium transporter [Ruegeria pomeroyi DSS...   246    3e-63 
ref|ZP_01743801.1|  magnesium transporter [Rhodobacterales bac...   245    4e-63 
ref|ZP_01018209.1|  magnesium transporter [Parvularcula bermud...   245    4e-63 
ref|ZP_05786938.1|  magnesium transporter [Silicibacter lacusc...   244    1e-62 
ref|YP_613899.1|  magnesium transporter [Ruegeria sp. TM1040] ...   244    1e-62 
ref|ZP_01902938.1|  hypothetical protein RAZWK3B_20441 [Roseob...   243    2e-62 
ref|ZP_01442429.1|  magnesium transporter [Roseovarius sp. HTC...   243    3e-62 
ref|ZP_05740654.1|  magnesium transporter [Silicibacter sp. Tr...   242    4e-62 
ref|ZP_02190832.1|  Divalent cation transporter [alpha proteob...   242    5e-62 
ref|ZP_05122945.1|  magnesium transporter [Rhodobacteraceae ba...   241    6e-62 
ref|ZP_05779968.1|  magnesium transporter [Citreicella sp. SE4...   241    8e-62 
ref|YP_002296657.1|  magnesium transporter, putative [Rhodospi...   240    1e-61 
ref|ZP_00958579.1|  magnesium transporter [Roseovarius nubinhi...   239    3e-61 
ref|ZP_00957822.1|  magnesium transporter [Oceanicaulis alexan...   239    3e-61 
ref|ZP_05054617.1|  magnesium transporter [Octadecabacter anta...   238    7e-61 
ref|ZP_02153301.1|  putative magnesium transporter [Oceanibulb...   238    9e-61 
ref|YP_427082.1|  divalent cation transporter [Rhodospirillum ...   237    1e-60 
ref|ZP_05067231.1|  magnesium transporter [Octadecabacter anta...   237    2e-60 
ref|ZP_00956982.1|  magnesium transporter [Sulfitobacter sp. E...   236    2e-60 
ref|YP_003447633.1|  magnesium transporter [Azospirillum sp. B...   236    3e-60 
ref|ZP_01157032.1|  magnesium transporter [Oceanicola granulos...   236    3e-60 
ref|ZP_00998533.1|  magnesium transporter [Oceanicola batsensi...   236    3e-60 
ref|ZP_00964006.1|  magnesium transporter [Sulfitobacter sp. N...   236    3e-60 
ref|ZP_01040198.1|  Mg/Co/Ni transporter [Erythrobacter sp. NA...   235    5e-60 
ref|ZP_01750853.1|  magnesium transporter [Roseobacter sp. CCS...   235    6e-60 
ref|ZP_01011299.1|  magnesium transporter [Rhodobacterales bac...   235    6e-60 
ref|ZP_01745024.1|  magnesium transporter [Sagittula stellata ...   234    8e-60 
ref|YP_458596.1|  Mg/Co/Ni transporter [Erythrobacter litorali...   234    8e-60 
ref|ZP_02140878.1|  putative magnesium transporter [Roseobacte...   234    1e-59 
ref|ZP_01449081.1|  magnesium transporter [alpha proteobacteri...   234    1e-59 
ref|YP_510665.1|  magnesium transporter [Jannaschia sp. CCS1] ...   233    3e-59 
ref|ZP_05075712.1|  magnesium transporter [Rhodobacterales bac...   232    4e-59 
ref|YP_682299.1|  putative magnesium transporter [Roseobacter ...   231    9e-59 
ref|YP_003225642.1|  magnesium transporter [Zymomonas mobilis ...   231    1e-58 
ref|ZP_05101744.1|  magnesium transporter [Roseobacter sp. GAI...   231    1e-58 
emb|CAM74419.1|  Divalent cation transporter [Magnetospirillum...   231    1e-58 
ref|YP_162505.1|  magnesium transporter [Zymomonas mobilis sub...   231    1e-58 
ref|YP_003552802.1|  Divalent cation transporter [alpha proteo...   229    3e-58 
ref|ZP_05034050.1|  magnesium transporter [Brevundimonas sp. B...   229    3e-58 
ref|ZP_01037939.1|  magnesium transporter [Roseovarius sp. 217...   229    3e-58 
ref|ZP_06119624.1|  magnesium transporter [Caulobacter segnis ...   229    4e-58 
ref|YP_496244.1|  magnesium transporter [Novosphingobium aroma...   229    4e-58 
ref|YP_001534104.1|  putative magnesium transporter [Dinoroseo...   228    6e-58 
ref|YP_756972.1|  magnesium transporter [Maricaulis maris MCS1...   226    2e-57 
ref|ZP_01880676.1|  magnesium transporter [Roseovarius sp. TM1...   225    6e-57 
ref|NP_420977.1|  magnesium transporter [Caulobacter crescentu...   224    1e-56 
ref|YP_001206519.1|  putative magnesium transporter MgtE-like ...   221    9e-56 
ref|YP_001240721.1|  putative magnesium transporter MgtE-like ...   221    9e-56 
ref|YP_782334.1|  magnesium transporter [Rhodopseudomonas palu...   220    2e-55 
ref|YP_001684784.1|  magnesium transporter [Caulobacter sp. K3...   220    2e-55 
ref|ZP_01002667.1|  magnesium transporter [Loktanella vestfold...   220    2e-55 
ref|YP_001992548.1|  magnesium transporter [Rhodopseudomonas p...   219    3e-55 
ref|YP_759988.1|  magnesium transporter [Hyphomonas neptunium ...   219    3e-55 
ref|ZP_06357955.1|  magnesium transporter [Rhodopseudomonas pa...   219    3e-55 
ref|YP_351946.1|  Mg/Co/Ni transporter, MgtE [Rhodobacter spha...   219    3e-55 
ref|NP_948502.1|  magnesium transporter [Rhodopseudomonas palu...   219    3e-55 
ref|YP_001042434.1|  magnesium transporter [Rhodobacter sphaer...   219    3e-55 
ref|YP_570202.1|  magnesium transporter [Rhodopseudomonas palu...   219    5e-55 
ref|ZP_06170823.1|  magnesium transporter [Brevundimonas subvi...   218    6e-55 
ref|NP_771891.1|  putative transporter transmembrane protein [...   218    8e-55 
ref|YP_533201.1|  magnesium transporter [Rhodopseudomonas palu...   218    8e-55 
ref|YP_485995.1|  magnesium transporter [Rhodopseudomonas palu...   217    1e-54 
ref|YP_001166509.1|  magnesium transporter [Rhodobacter sphaer...   216    2e-54 
ref|ZP_05842608.1|  magnesium transporter [Rhodobacter sp. SW2...   215    7e-54 
ref|ZP_04771329.1|  magnesium transporter [Asticcacaulis excen...   214    1e-53 
ref|YP_003060398.1|  magnesium transporter [Hirschia baltica A...   213    3e-53 
ref|YP_002130125.1|  magnesium transporter [Phenylobacterium z...   212    6e-53 
ref|YP_002361029.1|  magnesium transporter [Methylocella silve...   208    6e-52 
ref|YP_001832739.1|  magnesium transporter [Beijerinckia indic...   202    6e-50 
ref|YP_003577049.1|  magnesium transporter [Rhodobacter capsul...   201    1e-49 
ref|YP_001976100.1|  magnesium transporter [Wolbachia endosymb...   199    4e-49 
ref|YP_915183.1|  magnesium transporter [Paracoccus denitrific...   198    8e-49 
ref|YP_505094.1|  magnesium transporter [Anaplasma phagocytoph...   197    2e-48 
ref|NP_966168.1|  magnesium transporter [Wolbachia endosymbion...   197    2e-48 
ref|ZP_00372323.1|  magnesium transporter [Wolbachia endosymbi...   197    2e-48 
ref|YP_198125.1|  Mg/Co/Ni transporter MgtE [Wolbachia endosym...   196    4e-48 
ref|YP_303093.1|  divalent cation transporter [Ehrlichia canis...   194    2e-47 
ref|YP_506350.1|  magnesium transporter [Neorickettsia sennets...   193    3e-47 
ref|YP_003081660.1|  magnesium transporter [Neorickettsia rist...   192    3e-47 
ref|YP_002563611.1|  magnesium transporter (mgtE) [Anaplasma m...   189    5e-46 
ref|YP_153904.1|  magnesium transporter [Anaplasma marginale s...   189    5e-46 
ref|YP_180324.1|  magnesium transporter [Ehrlichia ruminantium...   187    2e-45 
ref|YP_507383.1|  magnesium transporter [Ehrlichia chaffeensis...   186    3e-45 
ref|ZP_03787700.1|  magnesium transporter [Wolbachia endosymbi...   184    2e-44 
ref|YP_003328571.1|  magnesium transporter [Anaplasma centrale...   182    4e-44 
gb|EEZ79613.1|  Mg/Co/Ni transporter MgtE [uncultured SUP05 cl...   180    2e-43 
ref|YP_002262016.1|  magnesium transporter [Aliivibrio salmoni...   179    3e-43 
ref|ZP_01617564.1|  magnesium transporter [marine gamma proteo...   179    3e-43 
ref|ZP_01223678.1|  Mg/Co/Ni transporter MgtE [marine gamma pr...   179    3e-43 
ref|YP_001219265.1|  magnesium transporter MgtE [Candidatus Ve...   177    1e-42 
ref|YP_002155139.1|  magnesium transporter [Vibrio fischeri MJ...   175    6e-42 
ref|YP_203765.1|  magnesium transporter [Vibrio fischeri ES114...   175    7e-42 
ref|YP_001839214.1|  putative divalent cation transporter; put...   174    2e-41 
ref|YP_391240.1|  magnesium transporter [Thiomicrospira crunog...   174    2e-41 
ref|ZP_06156783.1|  magnesium transporter [Photobacterium dams...   172    6e-41 
ref|YP_698577.1|  magnesium transporter [Clostridium perfringe...   171    8e-41 
ref|ZP_04715982.1|  Mg/Co/Ni transporter MgtE (contains CBS do...   171    1e-40 
ref|YP_462260.1|  Mg/Co/Ni transporter [Syntrophus aciditrophi...   171    1e-40 
ref|YP_001664.1|  magnesium transporter [Leptospira interrogan...   171    1e-40 
ref|ZP_02638685.1|  magnesium transporter [Clostridium perfrin...   171    1e-40 
ref|ZP_01987257.1|  magnesium transporter [Vibrio harveyi HY01...   171    1e-40 
ref|NP_562156.1|  magnesium transporter [Clostridium perfringe...   171    1e-40 
ref|ZP_04922696.1|  magnesium transporter [Vibrio sp. Ex25] >r...   171    1e-40 
ref|YP_001446810.1|  hypothetical protein VIBHAR_03669 [Vibrio...   170    2e-40 
ref|YP_944199.1|  magnesium transporter [Psychromonas ingraham...   170    2e-40 
ref|ZP_01899228.1|  putative magnesium transporter [Moritella ...   170    2e-40 
ref|ZP_05093191.1|  magnesium transporter [marine gamma proteo...   169    3e-40 
ref|ZP_05717792.1|  magnesium transporter [Vibrio mimicus VM57...   169    4e-40 
ref|ZP_05720679.1|  magnesium transporter [Vibrio mimicus VM60...   169    4e-40 
ref|ZP_01975073.1|  magnesium transporter [Vibrio cholerae B33...   169    4e-40 
ref|ZP_01677658.1|  magnesium transporter [Vibrio cholerae 274...   169    4e-40 
ref|ZP_01220992.1|  putative magnesium transporter [Photobacte...   169    4e-40 
ref|ZP_04917796.1|  magnesium transporter [Vibrio cholerae RC3...   169    4e-40 
ref|NP_232162.1|  magnesium transporter [Vibrio cholerae O1 bi...   169    4e-40 
ref|ZP_06573649.1|  magnesium transporter [Filifactor alocis A...   169    5e-40 
ref|ZP_01260665.1|  magnesium transporter [Vibrio alginolyticu...   169    5e-40 
ref|YP_002127486.1|  Mg/Co/Ni transporter MgtE (contains CBS d...   169    5e-40 
ref|YP_131368.1|  putative magnesium transporter [Photobacteri...   168    7e-40 
ref|ZP_05888338.1|  magnesium transporter [Vibrio coralliilyti...   168    9e-40 
ref|ZP_05121200.1|  magnesium transporter [Vibrio parahaemolyt...   168    9e-40 
ref|ZP_01044078.1|  Mg/Co/Ni transporter MgtE (contains CBS do...   168    9e-40 
ref|ZP_04416925.1|  magnesium transporter [Vibrio cholerae 121...   167    1e-39 
ref|ZP_01166887.1|  Divalent cation transporter [Oceanospirill...   167    1e-39 
ref|ZP_06049767.1|  magnesium transporter [Vibrio cholerae CT ...   167    2e-39 
ref|ZP_04413922.1|  magnesium transporter [Vibrio cholerae bv....   167    2e-39 
ref|ZP_02196809.1|  magnesium transporter [Vibrio sp. AND4] >g...   167    2e-39 
ref|YP_660228.1|  magnesium transporter [Pseudoalteromonas atl...   167    2e-39 
ref|ZP_01992893.1|  magnesium transporter [Vibrio parahaemolyt...   167    2e-39 
ref|YP_797983.1|  magnesium transporter [Leptospira borgpeters...   167    2e-39 
ref|NP_799054.1|  magnesium transporter [Vibrio parahaemolytic...   167    2e-39 
ref|ZP_05879902.1|  mg/Co/Ni transporter MgtE (contains CBS do...   166    3e-39 
ref|ZP_01308304.1|  magnesium transporter [Oceanobacter sp. RE...   166    3e-39 
ref|ZP_06051670.1|  magnesium transporter [Grimontia hollisae ...   166    3e-39 
ref|YP_154783.1|  Mg2+/Co2+ transporter [Idiomarina loihiensis...   166    3e-39 
ref|YP_001341278.1|  magnesium transporter [Marinomonas sp. MW...   165    6e-39 
ref|YP_436423.1|  magnesium transporter [Hahella chejuensis KC...   165    6e-39 
ref|ZP_01895759.1|  magnesium transporter [Marinobacter algico...   165    8e-39 
ref|ZP_01113760.1|  magnesium transporter [Reinekea sp. MED297...   165    8e-39 
ref|ZP_01065895.1|  magnesium transporter [Vibrio sp. MED222] ...   164    1e-38 
ref|ZP_05942706.1|  magnesium transporter [Vibrio orientalis C...   164    1e-38 
ref|YP_002418303.1|  magnesium transporter [Vibrio splendidus ...   164    1e-38 
ref|YP_959982.1|  magnesium transporter [Marinobacter aquaeole...   164    1e-38 
ref|ZP_05040555.1|  magnesium transporter [Alcanivorax sp. DG8...   164    2e-38 
ref|ZP_00990817.1|  magnesium transporter [Vibrio splendidus 1...   164    2e-38 
ref|ZP_01814335.1|  magnesium transporter [Vibrionales bacteri...   163    2e-38 
ref|YP_903684.1|  magnesium transporter [Candidatus Ruthia mag...   163    2e-38 
ref|ZP_05881069.1|  mg/Co/Ni transporter MgtE (contains CBS do...   163    3e-38 
ref|ZP_01449999.1|  magnesium transporter [alpha proteobacteri...   163    3e-38 
ref|YP_001492118.1|  magnesium transporter [Rickettsia canaden...   163    3e-38 
ref|NP_759682.1|  Mg/Co/Ni transporter MgtE [Vibrio vulnificus...   162    4e-38 
ref|YP_003075123.1|  magnesium transporter [Teredinibacter tur...   162    7e-38 
ref|YP_692261.1|  magnesium transporter [Alcanivorax borkumens...   162    7e-38 
ref|ZP_01868851.1|  magnesium transporter [Vibrio shilonii AK1...   161    9e-38 
ref|ZP_01161698.1|  putative magnesium transporter [Photobacte...   161    9e-38 
ref|ZP_01235992.1|  putative magnesium transporter [Vibrio ang...   161    1e-37 
ref|ZP_01216385.1|  Mg/Co/Ni transporter MgtE (contains CBS do...   161    1e-37 
ref|ZP_01718219.1|  magnesium transporter [Algoriphagus sp. PR...   160    2e-37 
ref|YP_067520.1|  magnesium transporter [Rickettsia typhi str....   160    2e-37 
ref|YP_246967.1|  magnesium transporter [Rickettsia felis URRW...   160    2e-37 
ref|NP_220953.1|  magnesium transporter (mgtE) [Rickettsia pro...   160    2e-37 
ref|YP_003145832.1|  magnesium transporter [Kangiella koreensi...   160    2e-37 
ref|ZP_05060540.1|  magnesium transporter [gamma proteobacteri...   160    2e-37 
ref|ZP_01739718.1|  magnesium transporter [Marinobacter sp. EL...   160    2e-37 
ref|ZP_01076359.1|  Divalent cation transporter [Marinomonas s...   159    3e-37 
ref|YP_002916496.1|  Mg2+ transporter [Rickettsia peacockii st...   159    4e-37 
ref|YP_001494986.1|  magnesium transporter [Rickettsia rickett...   159    4e-37 
ref|ZP_03635668.1|  hypothetical protein HOLDEFILI_02974 [Hold...   159    6e-37 
ref|YP_528652.1|  magnesium transporter [Saccharophagus degrad...   159    6e-37 
ref|ZP_05103369.1|  magnesium transporter [Methylophaga thioox...   158    9e-37 
ref|YP_001499545.1|  magnesium transporter [Rickettsia massili...   158    9e-37 
ref|NP_360523.1|  magnesium transporter [Rickettsia conorii st...   158    9e-37 
ref|ZP_00142961.1|  magnesium transporter [Rickettsia sibirica...   158    9e-37 
ref|YP_001493682.1|  magnesium transporter [Rickettsia akari s...   157    1e-36 
ref|YP_001936935.1|  magnesium transporter [Orientia tsutsugam...   157    2e-36 
ref|ZP_01612144.1|  putative magnesium transporter [Alteromona...   157    2e-36 
ref|YP_003555158.1|  magnesium transporter [Shewanella violace...   157    2e-36 
ref|YP_003525909.1|  magnesium transporter [Nitrosococcus halo...   156    4e-36 
ref|YP_538169.1|  magnesium transporter [Rickettsia bellii RML...   156    4e-36 
ref|YP_003496308.1|  magnesium transporter [Deferribacter desu...   155    5e-36 
ref|YP_002310077.1|  hypothetical protein swp_0672 [Shewanella...   155    5e-36 
ref|YP_001503468.1|  magnesium transporter [Shewanella pealean...   155    5e-36 
ref|NP_719496.1|  magnesium transporter [Shewanella oneidensis...   155    6e-36 
ref|YP_002356644.1|  magnesium transporter [Shewanella baltica...   155    8e-36 
ref|YP_732805.1|  magnesium transporter [Shewanella sp. MR-4] ...   154    1e-35 
ref|YP_868311.1|  magnesium transporter [Shewanella sp. ANA-3]...   154    1e-35 
ref|YP_001248367.1|  magnesium transporter [Orientia tsutsugam...   154    1e-35 
ref|YP_001052017.1|  magnesium transporter [Shewanella baltica...   154    1e-35 
ref|YP_001553149.1|  magnesium transporter [Shewanella baltica...   154    1e-35 
ref|ZP_01135803.1|  putative magnesium transporter [Pseudoalte...   154    1e-35 
ref|YP_739393.1|  magnesium transporter [Shewanella sp. MR-7] ...   154    1e-35 
ref|YP_003398947.1|  magnesium transporter [Acidaminococcus fe...   154    2e-35 
ref|YP_001364901.1|  magnesium transporter [Shewanella baltica...   154    2e-35 
ref|ZP_05127343.1|  magnesium transporter [gamma proteobacteri...   153    2e-35 
ref|ZP_01706693.1|  magnesium transporter [Shewanella putrefac...   153    3e-35 
ref|YP_964829.1|  magnesium transporter [Shewanella sp. W3-18-...   153    3e-35 
ref|YP_752057.1|  magnesium transporter [Shewanella frigidimar...   153    3e-35 
ref|YP_001675909.1|  magnesium transporter [Shewanella halifax...   152    4e-35 
ref|ZP_01882637.1|  Mg/Co/Ni transporter [Pedobacter sp. BAL39...   152    4e-35 
ref|YP_003444793.1|  magnesium transporter [Allochromatium vin...   152    5e-35 
ref|ZP_05056027.1|  magnesium transporter [Verrucomicrobiae ba...   152    5e-35 
ref|YP_001095441.1|  magnesium transporter [Shewanella loihica...   152    5e-35 
ref|ZP_01627237.1|  magnesium transporter [marine gamma proteo...   152    7e-35 
ref|YP_001472460.1|  magnesium transporter [Shewanella sedimin...   151    9e-35 
ref|NP_638158.1|  Mg++ transporter [Xanthomonas campestris pv....   151    9e-35 
ref|ZP_03989763.1|  magnesium transporter [Acidaminococcus sp....   151    1e-34 
ref|YP_341046.1|  magnesium transporter [Pseudoalteromonas hal...   151    1e-34 
ref|YP_866971.1|  magnesium transporter [Magnetococcus sp. MC-...   151    1e-34 
ref|ZP_06365072.1|  magnesium transporter [Bacillus cellulosil...   150    2e-34 
ref|ZP_04959165.1|  magnesium transporter [gamma proteobacteri...   150    2e-34 
ref|ZP_01452180.1|  magnesium transporter [Mariprofundus ferro...   150    2e-34 
ref|ZP_06685887.1|  MgtE family magnesium transporter [Achromo...   150    2e-34 
ref|YP_003092435.1|  magnesium transporter [Pedobacter heparin...   150    2e-34 
ref|YP_343838.1|  divalent cation transporter [Nitrosococcus o...   150    2e-34 
ref|ZP_06486092.1|  Mg++ transporter [Xanthomonas campestris p...   150    3e-34 
ref|ZP_03729504.1|  magnesium transporter [Dethiobacter alkali...   150    3e-34 
ref|YP_271197.1|  magnesium transporter [Colwellia psychreryth...   150    3e-34 
ref|ZP_01101774.1|  magnesium transporter [Congregibacter lito...   149    3e-34 
ref|ZP_02156512.1|  magnesium transporter [Shewanella benthica...   149    4e-34 
ref|YP_003244781.1|  magnesium transporter [Geobacillus sp. Y4...   149    6e-34 
ref|YP_001629314.1|  putative cation transport protein [Bordet...   148    7e-34 
ref|NP_643289.1|  Mg++ transporter [Xanthomonas axonopodis pv....   148    7e-34 
ref|YP_364857.1|  magnesium transporter [Xanthomonas campestri...   148    7e-34 
ref|YP_001815212.1|  magnesium transporter [Exiguobacterium si...   148    7e-34 
ref|ZP_06363765.1|  magnesium transporter [Bacillus cellulosil...   148    1e-33 
ref|YP_003467966.1|  putative divalent cation transport protei...   147    2e-33 
ref|ZP_03801994.1|  hypothetical protein PROPEN_00324 [Proteus...   147    2e-33 
ref|YP_002151311.1|  magnesium transporter [Proteus mirabilis ...   147    2e-33 
ref|YP_002027334.1|  magnesium transporter [Stenotrophomonas m...   147    2e-33 
ref|YP_787359.1|  magnesium transporter [Bordetella avium 197N...   147    2e-33 
ref|YP_344778.1|  divalent cation transporter [Nitrosococcus o...   147    2e-33 
ref|YP_928965.1|  magnesium transporter [Shewanella amazonensi...   147    2e-33 
ref|ZP_03840316.1|  magnesium transporter [Proteus mirabilis A...   146    3e-33 
ref|ZP_02242410.1|  Mg++ transporter [Xanthomonas oryzae pv. o...   146    3e-33 
ref|YP_316264.1|  divalent cation transporter [Thiobacillus de...   146    3e-33 
dbj|BAA75383.1|  Ykok [Bacillus halodurans]                         146    3e-33 
ref|NP_241377.1|  magnesium (Mg2+) transporter [Bacillus halod...   146    3e-33 
ref|ZP_05134674.1|  magnesium transporter [Stenotrophomonas sp...   146    4e-33 
ref|YP_001970975.1|  putative MgtE/divalent cation transmembra...   146    4e-33 
ref|ZP_02168784.1|  Mg/Co/Ni transporter MgtE (contains CBS do...   146    4e-33 
ref|YP_001355815.1|  magnesium transporter [Nitratiruptor sp. ...   146    4e-33 
ref|YP_001546977.1|  magnesium transporter [Herpetosiphon aura...   146    4e-33 
ref|YP_356025.1|  magnesium transporter [Pelobacter carbinolic...   146    4e-33 
emb|CBA74938.1|  magnesium transporter [Arsenophonus nasoniae]      145    5e-33 
ref|YP_001915053.1|  magnesium transporter [Xanthomonas oryzae...   145    5e-33 
ref|YP_112647.1|  magnesium transporter [Methylococcus capsula...   145    5e-33 
ref|YP_199915.1|  Mg++ transporter [Xanthomonas oryzae pv. ory...   145    5e-33 
ref|ZP_05081875.1|  magnesium transporter [beta proteobacteriu...   145    6e-33 
ref|ZP_01861214.1|  magnesium (Mg2+) transporter [Bacillus sp....   145    6e-33 
ref|ZP_01722168.1|  magnesium (Mg2+) transporter [Bacillus sp....   145    6e-33 
ref|YP_001095136.1|  magnesium transporter [Shewanella loihica...   145    6e-33 
ref|YP_001762596.1|  magnesium transporter [Shewanella woodyi ...   144    1e-32 
ref|ZP_05727739.1|  magnesium transporter [Pantoea sp. At-9b] ...   144    1e-32 
ref|YP_001696968.1|  magnesium (Mg2+) transporter [Lysinibacil...   144    1e-32 
ref|YP_544418.1|  magnesium transporter [Methylobacillus flage...   144    1e-32 
ref|ZP_04631927.1|  Magnesium transporter [Yersinia frederikse...   144    2e-32 
ref|YP_002874263.1|  hypothetical protein PFLU4745 [Pseudomona...   144    2e-32 
ref|YP_002316452.1|  Mg/Co/Ni transporter MgtE (contains CBS d...   144    2e-32 
ref|YP_003197346.1|  magnesium transporter [Desulfohalobium re...   143    2e-32 
ref|ZP_04614496.1|  Magnesium transporter [Yersinia rohdei ATC...   143    2e-32 
ref|ZP_04624549.1|  Magnesium transporter [Yersinia kristensen...   143    2e-32 
ref|NP_924872.1|  Mg2+ transporter [Gloeobacter violaceus PCC ...   143    2e-32 
ref|ZP_06643788.1|  magnesium transporter [Neisseria gonorrhoe...   143    3e-32 
ref|YP_609368.1|  magnesium transporter [Pseudomonas entomophi...   143    3e-32 
ref|NP_881405.1|  putative cation transport protein [Bordetell...   143    3e-32 
ref|ZP_06341247.1|  magnesium transporter [Bulleidia extructa ...   142    4e-32 
ref|ZP_04757654.1|  magnesium transporter [Neisseria flavescen...   142    4e-32 
ref|ZP_02960904.1|  hypothetical protein PROSTU_02886 [Provide...   142    4e-32 
ref|ZP_01552655.1|  Divalent cation transporter [Methylophilal...   142    4e-32 
ref|YP_001188386.1|  magnesium transporter [Pseudomonas mendoc...   142    4e-32 
ref|YP_208260.1|  MgtE [Neisseria gonorrhoeae FA 1090] >ref|ZP...   142    4e-32 
ref|ZP_05315368.1|  magnesium transporter [Nitrosomonas sp. AL...   142    5e-32 
emb|CBA07512.1|  magnesium transporter [Neisseria meningitidis...   142    5e-32 
emb|CBA09465.1|  magnesium transporter [Neisseria meningitidis...   142    5e-32 
ref|YP_002508995.1|  magnesium transporter [Halothermothrix or...   142    5e-32 
ref|ZP_03319029.1|  hypothetical protein PROVALCAL_01969 [Prov...   142    5e-32 
ref|ZP_05071133.1|  magnesium transporter [Campylobacterales b...   142    5e-32 
ref|ZP_03225102.1|  magnesium (Mg2+) transporter [Bacillus coa...   142    5e-32 
ref|YP_002002600.1|  MgtE [Neisseria gonorrhoeae NCCP11945] >r...   142    5e-32 
ref|NP_791670.1|  magnesium transporter [Pseudomonas syringae ...   142    5e-32 
ref|YP_002341939.1|  hypothetical inner membrane protein [Neis...   142    5e-32 
ref|YP_975901.1|  hypothetical protein NMC1976 [Neisseria meni...   142    7e-32 
ref|YP_003426771.1|  magnesium (Mg2+) transporter [Bacillus ps...   141    9e-32 
ref|ZP_05977052.1|  magnesium transporter [Neisseria mucosa AT...   141    9e-32 
ref|ZP_03720651.1|  hypothetical protein NEIFLAOT_02514 [Neiss...   141    9e-32 
ref|YP_001420906.1|  Mg2+ transporter [Bacillus amyloliquefaci...   141    9e-32 
ref|YP_001750611.1|  magnesium transporter [Pseudomonas putida...   141    9e-32 
ref|YP_261586.1|  magnesium transporter [Pseudomonas fluoresce...   141    9e-32 
ref|YP_078614.1|  divalent cation transporter [Bacillus lichen...   141    9e-32 
ref|YP_003376622.1|  putative magnesium transporter protein [X...   141    1e-31 
ref|ZP_05973618.1|  magnesium transporter [Providencia rustigi...   141    1e-31 
ref|ZP_01906688.1|  magnesium (Mg2+) transporter-like protein ...   141    1e-31 
ref|NP_389213.1|  magnesium transporter [Bacillus subtilis sub...   141    1e-31 
ref|ZP_04642752.1|  Magnesium transporter [Yersinia mollaretii...   141    1e-31 
ref|ZP_02171518.1|  polar amino acid ABC transporter, inner me...   140    2e-31 
ref|YP_349999.1|  divalent cation transporter [Pseudomonas flu...   140    2e-31 
ref|NP_274991.1|  magnesium transporter [Neisseria meningitidi...   140    2e-31 
ref|YP_003082409.1|  magnesium transporter [Neisseria meningit...   140    2e-31 
ref|ZP_05983991.1|  magnesium transporter [Neisseria subflava ...   140    2e-31 
ref|ZP_05983702.1|  magnesium transporter [Neisseria cinerea A...   140    2e-31 
ref|YP_001598369.1|  magnesium transporter [Neisseria meningit...   140    2e-31 
ref|YP_001452155.1|  hypothetical protein CKO_00564 [Citrobact...   140    2e-31 
ref|ZP_06481761.1|  magnesium transporter [Pseudomonas syringa...   140    3e-31 
ref|ZP_04621619.1|  Magnesium transporter [Yersinia aldovae AT...   140    3e-31 
ref|ZP_04449278.1|  hypothetical protein GCWU000282_00507 [Cat...   140    3e-31 
ref|ZP_01916018.1|  divalent cation transporter [Limnobacter s...   140    3e-31 
ref|YP_574281.1|  magnesium transporter [Chromohalobacter sale...   140    3e-31 
ref|YP_275656.1|  magnesium transporter [Pseudomonas syringae ...   140    3e-31 
ref|YP_236622.1|  divalent cation transporter [Pseudomonas syr...   140    3e-31 
ref|YP_003521131.1|  hypothetical protein PANA_2836 [Pantoea a...   139    3e-31 
ref|ZP_05320343.1|  magnesium transporter [Neisseria sicca ATC...   139    3e-31 
ref|ZP_04677479.1|  magnesium transporter [Staphylococcus warn...   139    3e-31 
ref|YP_003460922.1|  magnesium transporter [Thioalkalivibrio s...   139    3e-31 
ref|YP_001670202.1|  magnesium transporter [Pseudomonas putida...   139    3e-31 
ref|ZP_04627851.1|  Magnesium transporter [Yersinia bercovieri...   139    3e-31 
ref|NP_746582.1|  magnesium transporter [Pseudomonas putida KT...   139    3e-31 
ref|ZP_06639242.1|  MgtE family magnesium transporter [Serrati...   139    5e-31 
ref|YP_003422045.1|  Mg2+ transporter MgtE [cyanobacterium UCY...   139    5e-31 
ref|ZP_06123525.1|  magnesium transporter [Providencia rettger...   139    5e-31 
ref|ZP_04635746.1|  Magnesium transporter [Yersinia intermedia...   139    5e-31 
ref|ZP_04587580.1|  magnesium transporter [Pseudomonas syringa...   139    6e-31 
ref|ZP_03310543.1|  hypothetical protein DESPIG_00431 [Desulfo...   139    6e-31 
ref|ZP_06498226.1|  magnesium transporter [Pseudomonas syringa...   138    8e-31 
ref|YP_003308644.1|  magnesium transporter [Sebaldella termiti...   138    8e-31 
ref|ZP_05987612.1|  magnesium transporter [Neisseria lactamica...   138    8e-31 
ref|YP_001371838.1|  magnesium transporter [Ochrobactrum anthr...   138    8e-31 
ref|YP_001171910.1|  magnesium transporter [Pseudomonas stutze...   138    8e-31 
ref|ZP_04681944.1|  magnesium transporter [Ochrobactrum interm...   138    1e-30 
ref|ZP_05071236.1|  magnesium transporter [Campylobacterales b...   138    1e-30 
ref|YP_001906990.1|  Divalent cation transport protein [Erwini...   138    1e-30 
ref|ZP_02160847.1|  magnesium transporter [Kordia algicida OT-...   138    1e-30 
ref|YP_411240.1|  magnesium transporter [Nitrosospira multifor...   138    1e-30 
ref|YP_003561200.1|  magnesium transporter [Bacillus megateriu...   137    1e-30 
ref|YP_002648105.1|  Divalent cation transport protein [Erwini...   137    1e-30 
ref|YP_001005446.1|  putative divalent cation transport protei...   137    1e-30 
ref|NP_764253.1|  Mg2+ transporter [Staphylococcus epidermidis...   137    1e-30 
ref|NP_692145.1|  magnesium (Mg2+) transporter [Oceanobacillus...   137    1e-30 
ref|ZP_01171011.1|  magnesium (Mg2+) transporter [Bacillus sp....   137    1e-30 
gb|ADF37596.1|  magnesium transporter [Bacillus megaterium DSM...   137    2e-30 
ref|YP_003531906.1|  putative MgtE family transporter [Erwinia...   137    2e-30 
ref|ZP_04565464.1|  magnesium transporter [Mollicutes bacteriu...   137    2e-30 
ref|YP_002795887.1|  probable magnesium transporter [Laribacte...   137    2e-30 
ref|ZP_02427362.1|  hypothetical protein CLORAM_00740 [Clostri...   137    2e-30 
ref|YP_001486469.1|  Mg2+/Co2+ transporter [Bacillus pumilus S...   137    2e-30 
ref|ZP_04562742.1|  magnesium transporter [Citrobacter sp. 30_...   137    2e-30 
ref|ZP_03053505.1|  magnesium transporter [Bacillus pumilus AT...   137    2e-30 
ref|YP_188180.1|  magnesium transporter [Staphylococcus epider...   137    2e-30 
ref|ZP_06192921.1|  transporter [Serratia odorifera 4Rx13] >gb...   136    3e-30 
ref|ZP_05851511.1|  magnesium transporter [Granulicatella eleg...   136    3e-30 
ref|YP_003047811.1|  magnesium transporter [Methylotenera mobi...   136    3e-30 
ref|YP_003157645.1|  magnesium transporter [Desulfomicrobium b...   136    3e-30 
ref|YP_002514068.1|  magnesium transporter [Thioalkalivibrio s...   136    3e-30 
ref|YP_002800566.1|  magnesium transporter; MgtE [Azotobacter ...   136    3e-30 
ref|ZP_05649387.1|  magnesium transporter [Enterococcus gallin...   136    4e-30 
ref|ZP_05838337.1|  divalent cation transporter [Brucella suis...   135    5e-30 
ref|YP_001716659.1|  magnesium transporter [Candidatus Desulfo...   135    5e-30 
ref|ZP_01860754.1|  YkoK2 [Bacillus sp. SG-1] >gb|EDL64213.1| ...   135    5e-30 
ref|YP_388324.1|  magnesium transporter [Desulfovibrio desulfu...   135    5e-30 
ref|ZP_06547875.1|  magnesium transporter [Klebsiella sp. 1_1_...   135    7e-30 
ref|ZP_06231610.1|  magnesium transporter [Desulfovibrio aespo...   135    7e-30 
ref|ZP_03713319.1|  hypothetical protein EIKCOROL_00995 [Eiken...   135    7e-30 
ref|YP_002237374.1|  magnesium transporter [Klebsiella pneumon...   135    7e-30 
ref|YP_001336278.1|  putative MgtE integral membrane region [K...   135    7e-30 
ref|ZP_06754502.1|  magnesium transporter [Simonsiella mueller...   135    9e-30 
ref|ZP_05656405.1|  magnesium transporter [Enterococcus cassel...   135    9e-30 
ref|ZP_05647511.1|  magnesium transporter [Enterococcus cassel...   135    9e-30 
ref|ZP_03225764.1|  magnesium (Mg2+) transporter [Bacillus coa...   135    9e-30 
ref|NP_485722.1|  hypothetical protein all1682 [Nostoc sp. PCC...   135    9e-30 
ref|NP_668716.1|  divalent cation transporter [Yersinia pestis...   135    9e-30 
ref|ZP_05659973.1|  magnesium transporter [Enterococcus faeciu...   134    1e-29 
ref|ZP_03787370.1|  magnesium transporter [Brucella ceti str. ...   134    1e-29 
ref|YP_001479769.1|  magnesium transporter [Serratia proteamac...   134    1e-29 
ref|NP_700044.1|  magnesium transporter [Brucella suis 1330] >...   134    1e-29 
ref|ZP_05679251.1|  magnesium transporter [Enterococcus faeciu...   134    1e-29 
ref|YP_003050107.1|  magnesium transporter [Methylovorus sp. S...   134    1e-29 
ref|YP_446298.1|  magnesium transporter [Salinibacter ruber DS...   134    1e-29 
ref|ZP_06734831.1|  hypothetical protein NEIELOOT_01665 [Neiss...   134    2e-29 
ref|YP_003018510.1|  magnesium transporter [Pectobacterium car...   134    2e-29 
ref|ZP_05070568.1|  magnesium transporter [Campylobacterales b...   134    2e-29 
ref|ZP_04602643.1|  hypothetical protein GCWU000324_02124 [Kin...   133    2e-29 
ref|ZP_03982652.1|  magnesium transporter [Enterococcus faeciu...   133    2e-29 
ref|ZP_03613078.1|  magnesium transporter [Staphylococcus capi...   133    2e-29 
ref|YP_002991574.1|  magnesium transporter [Desulfovibrio sale...   133    2e-29 
ref|ZP_02179280.1|  magnesium (Mg2+) transporter-like protein ...   133    2e-29 
ref|ZP_01695013.1|  magnesium transporter [Microscilla marina ...   133    2e-29 
ref|YP_002575793.1|  Mg/Co/Ni transporter, MgtE family [Campyl...   133    2e-29 
ref|YP_003526796.1|  magnesium transporter [Nitrosococcus halo...   133    3e-29 
ref|ZP_06352085.1|  magnesium transporter [Citrobacter youngae...   133    3e-29 
ref|ZP_06197692.1|  magnesium transporter [Pediococcus acidila...   133    3e-29 
ref|ZP_04615206.1|  Magnesium transporter [Yersinia ruckeri AT...   133    3e-29 
ref|YP_001568705.1|  magnesium transporter [Petrotoga mobilis ...   133    3e-29 
ref|NP_249604.1|  putative Mg transporter MgtE [Pseudomonas ae...   133    3e-29 
ref|ZP_06326442.1|  magnesium transporter [Staphylococcus aure...   132    4e-29 
ref|ZP_04828377.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   132    4e-29 
ref|YP_003263444.1|  magnesium transporter [Halothiobacillus n...   132    4e-29 
ref|ZP_03683211.1|  hypothetical protein CATMIT_01856 [Catenib...   132    4e-29 
ref|YP_185881.1|  magnesium transporter [Staphylococcus aureus...   132    4e-29 
ref|NP_371533.1|  Mg2 transporter [Staphylococcus aureus subsp...   132    4e-29 
ref|ZP_06291514.1|  magnesium transporter [Peptoniphilus lacri...   132    6e-29 
ref|ZP_05689012.1|  magnesium transporter [Staphylococcus aure...   132    6e-29 
ref|ZP_05625648.1|  magnesium transporter [Campylobacter graci...   132    6e-29 
ref|ZP_02185008.1|  magnesium transporter [Carnobacterium sp. ...   132    6e-29 
ref|YP_321691.1|  divalent cation transporter [Anabaena variab...   132    6e-29 
ref|NP_541396.1|  Mg2+ transporter [Brucella melitensis 16M] >...   132    6e-29 
ref|YP_253864.1|  hypothetical protein SH1949 [Staphylococcus ...   132    6e-29 
ref|ZP_01170783.1|  YkoK2 [Bacillus sp. NRRL B-14911] >gb|EAR6...   132    6e-29 
ref|ZP_04783288.1|  magnesium transporter [Weissella paramesen...   132    7e-29 
ref|ZP_05968483.1|  magnesium transporter [Enterobacter cancer...   132    7e-29 
ref|YP_001663891.1|  magnesium transporter [Thermoanaerobacter...   132    7e-29 
ref|YP_001466773.1|  magnesium transporter [Campylobacter conc...   132    7e-29 
ref|YP_001419026.1|  magnesium transporter [Xanthobacter autot...   132    7e-29 
ref|ZP_05705855.1|  magnesium transporter [Cardiobacterium hom...   131    9e-29 
ref|ZP_05686404.1|  magnesium transporter [Staphylococcus aure...   131    9e-29 
ref|ZP_05182067.1|  magnesium transporter [Brucella sp. 83/13]...   131    9e-29 
ref|ZP_04047323.1|  Mg2+ transporter MgtE [Brachyspira murdoch...   131    9e-29 
ref|ZP_04018383.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   131    9e-29 
ref|YP_001034864.1|  magnesium/cobalt transporter, putative [S...   131    9e-29 
ref|YP_301866.1|  putative divalent cation transport protein [...   131    9e-29 
ref|YP_040395.1|  putative divalent cation transport protein [...   131    9e-29 
ref|ZP_05861246.1|  magnesium transporter [Jonquetella anthrop...   131    1e-28 
ref|ZP_05493285.1|  magnesium transporter [Thermoanaerobacter ...   131    1e-28 
ref|YP_001003288.1|  magnesium transporter [Halorhodospira hal...   131    1e-28 
ref|YP_001665619.1|  magnesium transporter [Thermoanaerobacter...   131    1e-28 
ref|YP_003365888.1|  magnesium transporter [Citrobacter rodent...   130    2e-28 
ref|ZP_02181119.1|  putative transmembrane Mg2+ transporter [F...   130    2e-28 
emb|CAJ72018.1|  similar to magnesium transporter MgtE [Candid...   130    2e-28 
ref|YP_001868455.1|  magnesium transporter [Nostoc punctiforme...   130    2e-28 
ref|ZP_04818738.1|  magnesium transporter [Staphylococcus epid...   130    2e-28 
ref|ZP_03701677.1|  magnesium transporter [Flavobacteria bacte...   130    2e-28 
ref|YP_394503.1|  divalent cation transporter [Sulfurimonas de...   130    2e-28 
ref|ZP_05574198.1|  magnesium transporter [Enterococcus faecal...   130    3e-28 
ref|ZP_05567950.1|  magnesium transporter [Enterococcus faecal...   130    3e-28 
ref|ZP_05422514.1|  magnesium transporter [Enterococcus faecal...   130    3e-28 
ref|YP_001407149.1|  magnesium transporter [Campylobacter homi...   130    3e-28 
ref|YP_001280715.1|  magnesium transporter [Psychrobacter sp. ...   130    3e-28 
ref|NP_816305.1|  magnesium transporter [Enterococcus faecalis...   130    3e-28 
ref|ZP_05362701.1|  magnesium transporter [Campylobacter showa...   129    4e-28 
ref|ZP_04525900.1|  magnesium transporter [Clostridium butyric...   129    4e-28 
ref|ZP_05272501.1|  putative Mg2+ transporter [Clostridium dif...   129    4e-28 
ref|ZP_03697751.1|  magnesium transporter [Lutiella nitroferru...   129    4e-28 
ref|YP_002633709.1|  putative divalent cation transporter [Sta...   129    4e-28 
ref|YP_002560026.1|  Mg2+ transporter [Macrococcus caseolyticu...   129    4e-28 
ref|ZP_01733910.1|  putative transmembrane Mg2+ transporter [F...   129    4e-28 
ref|YP_001088949.1|  putative Mg2+ transporter [Clostridium di...   129    4e-28 
ref|ZP_01801874.1|  hypothetical protein CdifQ_04002831 [Clost...   129    4e-28 
ref|ZP_06299121.1|  hypothetical protein pah_c022o199 [Parachl...   129    5e-28 
ref|ZP_05737162.1|  magnesium transporter [Granulicatella adia...   129    5e-28 
ref|YP_003306075.1|  magnesium transporter [Streptobacillus mo...   129    5e-28 
ref|ZP_05116006.1|  magnesium transporter [Labrenzia alexandri...   129    5e-28 
ref|YP_001622650.1|  magnesium transporter [Brucella suis ATCC...   129    5e-28 
ref|YP_001209696.1|  magnesium transporter [Dichelobacter nodo...   129    5e-28 
ref|YP_746725.1|  magnesium transporter [Nitrosomonas eutropha...   129    5e-28 
ref|ZP_05401825.1|  putative Mg2+ transporter [Clostridium dif...   129    6e-28 
ref|YP_001733539.1|  magnesium transporter [Synechococcus sp. ...   129    6e-28 
ref|YP_263876.1|  Mg/Co/Ni transporter MgtE [Psychrobacter arc...   129    6e-28 
ref|ZP_05807692.1|  magnesium transporter [Mesorhizobium oppor...   128    8e-28 
ref|ZP_04059125.1|  magnesium transporter [Staphylococcus homi...   128    8e-28 
ref|ZP_03828713.1|  magnesium transporter [Pectobacterium caro...   128    8e-28 
ref|ZP_01105376.1|  magnesium transporter [Flavobacteriales ba...   128    8e-28 
ref|YP_753763.1|  divalent cation transporter [Syntrophomonas ...   128    8e-28 
ref|ZP_03610405.1|  magnesium transporter [Campylobacter rectu...   128    1e-27 
ref|YP_001177506.1|  magnesium transporter [Enterobacter sp. 6...   128    1e-27 
ref|YP_001432618.1|  magnesium transporter [Roseiflexus casten...   128    1e-27 
ref|NP_841667.1|  divalent cation transporter [Nitrosomonas eu...   128    1e-27 
ref|NP_242814.1|  magnesium (Mg2+) transporter [Bacillus halod...   128    1e-27 
ref|ZP_06403188.1|  magnesium transporter [bacterium S5] >gb|E...   127    1e-27 
ref|ZP_05851854.1|  magnesium transporter [Granulicatella eleg...   127    1e-27 
ref|ZP_05709298.1|  magnesium transporter [Desulfurivibrio alk...   127    1e-27 
ref|ZP_03496334.1|  magnesium transporter [Thermus aquaticus Y...   127    1e-27 
ref|YP_001817802.1|  magnesium transporter [Opitutus terrae PB...   127    1e-27 
ref|YP_002429225.1|  magnesium transporter [Desulfatibacillum ...   127    1e-27 
ref|YP_001524672.1|  divalent cation transporter [Azorhizobium...   127    1e-27 
ref|YP_455418.1|  putative magnesium transport protein [Sodali...   127    1e-27 
ref|NP_102305.1|  Mg2+ transport protein [Mesorhizobium loti M...   127    1e-27 
ref|ZP_06391544.1|  magnesium transporter [Dethiosulfovibrio p...   127    2e-27 
ref|YP_003292043.1|  magnesium transporter [Rhodothermus marin...   127    2e-27 
ref|YP_001358027.1|  magnesium transporter [Sulfurovum sp. NBC...   127    2e-27 
gb|ABD75772.1|  hypothetical protein [uncultured bacterium]         127    2e-27 
ref|ZP_01166332.1|  magnesium transporter [Oceanospirillum sp....   127    2e-27 
ref|YP_003508042.1|  magnesium transporter [Meiothermus ruber ...   127    2e-27 
ref|ZP_03766065.1|  magnesium transporter ['Nostoc azollae' 07...   127    2e-27 
ref|YP_579838.1|  magnesium transporter [Psychrobacter cryohal...   127    2e-27 
ref|YP_003090112.1|  magnesium transporter [Dyadobacter fermen...   126    3e-27 
ref|ZP_03738232.1|  magnesium transporter [Desulfonatronospira...   126    3e-27 
ref|ZP_04046368.1|  Mg2+ transporter MgtE [Brachyspira murdoch...   126    4e-27 
ref|ZP_01889420.1|  putative transmembrane Mg2+ transporter [u...   126    4e-27 
ref|YP_804696.1|  transcriptional regulator [Pediococcus pento...   126    4e-27 
ref|YP_003137409.1|  magnesium transporter [Cyanothece sp. PCC...   125    5e-27 
ref|YP_003476500.1|  magnesium transporter [Thermoanaerobacter...   125    5e-27 
ref|YP_003258739.1|  magnesium transporter [Pectobacterium was...   125    5e-27 
ref|ZP_05136712.1|  magnesium transporter [Stenotrophomonas sp...   125    5e-27 
ref|YP_002479395.1|  magnesium transporter [Desulfovibrio desu...   125    5e-27 
ref|YP_002371849.1|  magnesium transporter [Cyanothece sp. PCC...   125    5e-27 
ref|ZP_01465379.1|  magnesium transporter [Stigmatella auranti...   125    5e-27 
ref|YP_891872.1|  magnesium transporter [Campylobacter fetus s...   125    5e-27 
ref|ZP_01201536.1|  magnesium ion transporter [Flavobacteria b...   125    5e-27 
ref|ZP_06305761.1|  Divalent cation transporter [Raphidiopsis ...   125    7e-27 
ref|ZP_06306713.1|  Divalent cation transporter [Cylindrosperm...   125    7e-27 
ref|ZP_03957367.1|  Mg2+ transporter [Lactobacillus ruminis AT...   125    7e-27 
ref|YP_002720475.1|  magnesium transporter [Brachyspira hyodys...   125    7e-27 
ref|YP_002885849.1|  magnesium transporter [Exiguobacterium sp...   125    7e-27 
ref|YP_594736.1|  Mg2+/Co2+ transporter [Lawsonia intracellula...   125    7e-27 
ref|NP_969349.1|  Mg2+ transporter MgtE [Bdellovibrio bacterio...   125    7e-27 
ref|YP_002434948.1|  magnesium transporter [Desulfovibrio vulg...   125    9e-27 
ref|ZP_03474634.1|  hypothetical protein PRABACTJOHN_00288 [Pa...   125    9e-27 
ref|YP_001803426.1|  Mg2+ transporter [Cyanothece sp. ATCC 511...   125    9e-27 
ref|YP_001303926.1|  magnesium transporter [Parabacteroides di...   125    9e-27 
ref|ZP_00515788.1|  Divalent cation transporter [Crocosphaera ...   125    9e-27 
ref|YP_002890652.1|  magnesium transporter [Thauera sp. MZ1T] ...   124    1e-26 
ref|YP_001974182.1|  putative cation TRANSPORT TRANSMEMBRANE P...   124    1e-26 
ref|YP_001931862.1|  magnesium transporter [Sulfurihydrogenibi...   124    1e-26 
ref|ZP_02033392.1|  hypothetical protein PARMER_03417 [Parabac...   124    1e-26 
ref|YP_001408505.1|  magnesium transporter [Campylobacter curv...   124    1e-26 
ref|ZP_06363767.1|  magnesium transporter [Bacillus cellulosil...   124    2e-26 
ref|YP_002971226.1|  Mg2+ transport protein [Bartonella graham...   124    2e-26 
ref|YP_002030285.1|  magnesium transporter [Stenotrophomonas m...   124    2e-26 
ref|ZP_03010543.1|  hypothetical protein BACCOP_02424 [Bactero...   124    2e-26 
ref|ZP_01966715.1|  hypothetical protein RUMTOR_00255 [Ruminoc...   124    2e-26 
ref|YP_066276.1|  magnesium transporter [Desulfotalea psychrop...   124    2e-26 
ref|YP_033025.1|  Mg2+ transport protein [Bartonella henselae ...   124    2e-26 
ref|NP_762723.1|  Mg/Co/Ni transporter MgtE [Vibrio vulnificus...   124    2e-26 
ref|YP_003472075.1|  Magnesium transporter [Staphylococcus lug...   124    2e-26 
ref|ZP_05900144.1|  magnesium transporter [Leptotrichia hofsta...   124    2e-26 
ref|ZP_05379589.1|  magnesium transporter [Thermoanaerobacter ...   124    2e-26 
ref|YP_074368.1|  magnesium transporter [Symbiobacterium therm...   124    2e-26 
ref|ZP_06290945.1|  magnesium transporter [Peptoniphilus lacri...   123    3e-26 
ref|YP_001608665.1|  Mg2+ transport protein [Bartonella triboc...   123    3e-26 
ref|ZP_01623485.1|  Mg2+ transport protein [Lyngbya sp. PCC 81...   123    3e-26 
ref|YP_863516.1|  MgtE family divalent cation transporter [Gra...   123    3e-26 
ref|YP_988651.1|  magnesium transporter [Bartonella bacillifor...   123    3e-26 
ref|ZP_03930681.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   123    3e-26 
ref|YP_157965.1|  magnesium transporter [Aromatoleum aromaticu...   123    3e-26 
ref|ZP_06621803.1|  magnesium transporter [Turicibacter sp. PC...   122    4e-26 
ref|ZP_05712501.1|  magnesium transporter [Enterococcus faeciu...   122    4e-26 
ref|YP_002729486.1|  magnesium transporter [Sulfurihydrogenibi...   122    4e-26 
ref|ZP_03644082.1|  hypothetical protein BACCOPRO_02457 [Bacte...   122    4e-26 
ref|ZP_01728248.1|  Mg2+ transport protein [Cyanothece sp. CCY...   122    4e-26 
ref|YP_932209.1|  putative magnesium transport protein [Azoarc...   122    4e-26 
ref|YP_011024.1|  magnesium transporter [Desulfovibrio vulgari...   122    4e-26 
ref|YP_051258.1|  magnesium transporter [Pectobacterium atrose...   122    4e-26 
ref|ZP_06265358.1|  magnesium transporter [Pyramidobacter pisc...   122    6e-26 
ref|ZP_04010117.1|  Mg2+ transporter [Lactobacillus salivarius...   122    6e-26 
ref|YP_002604070.1|  MgtE2 [Desulfobacterium autotrophicum HRM...   122    6e-26 
ref|YP_001619263.1|  Mg2+ transporter [Sorangium cellulosum 'S...   122    6e-26 
ref|YP_536192.1|  Mg2+ transporter [Lactobacillus salivarius U...   122    6e-26 
ref|YP_003121698.1|  magnesium transporter [Chitinophaga pinen...   122    8e-26 
ref|YP_031870.1|  Mg2+ transport protein [Bartonella quintana ...   122    8e-26 
ref|YP_003152039.1|  magnesium transporter [Anaerococcus prevo...   121    1e-25 
ref|ZP_03294110.1|  hypothetical protein CLOHIR_02061 [Clostri...   121    1e-25 
ref|ZP_03209520.1|  hypothetical protein BACPLE_03196 [Bactero...   121    1e-25 
ref|ZP_02437085.1|  hypothetical protein BACSTE_03356 [Bactero...   121    1e-25 
emb|CAO89242.1|  unnamed protein product [Microcystis aerugino...   121    1e-25 
ref|ZP_02002347.1|  Divalent cation transporter [Beggiatoa sp....   121    1e-25 
ref|YP_858546.1|  magnesium transporter [Aeromonas hydrophila ...   121    1e-25 
ref|ZP_01253074.1|  magnesium transporter [Psychroflexus torqu...   121    1e-25 
ref|ZP_06011202.1|  magnesium transporter [Leptotrichia goodfe...   121    1e-25 
ref|ZP_03016902.1|  hypothetical protein BACINT_04511 [Bactero...   121    1e-25 
ref|YP_001140133.1|  magnesium transporter [Aeromonas salmonic...   121    1e-25 
ref|YP_003523107.1|  magnesium transporter [Sideroxydans litho...   120    2e-25 
ref|YP_003317973.1|  magnesium transporter [Thermanaerovibrio ...   120    2e-25 
ref|ZP_04034451.1|  Mg2+ transporter MgtE [Meiothermus silvanu...   120    2e-25 
ref|ZP_03678650.1|  hypothetical protein BACCELL_03002 [Bacter...   120    2e-25 
ref|ZP_05035584.1|  magnesium transporter [Synechococcus sp. P...   120    2e-25 
ref|YP_001299219.1|  putative Mg2+ transporter MgtE [Bacteroid...   120    2e-25 
ref|ZP_04971281.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   120    2e-25 
ref|YP_003166339.1|  magnesium transporter [Candidatus Accumul...   120    2e-25 
ref|ZP_05441287.1|  MG2+ transporter MGTE [Fusobacterium sp. D...   120    2e-25 
ref|ZP_04716102.1|  putative Magnesium transporter [Alteromona...   120    2e-25 
ref|YP_002290272.1|  magnesium transporter [Oligotropha carbox...   120    2e-25 
ref|ZP_02860975.1|  hypothetical protein ANASTE_00167 [Anaerof...   120    2e-25 
ref|ZP_01989846.1|  Mg2+ transporter MgtE [Vibrio parahaemolyt...   120    2e-25 
ref|NP_812953.1|  putative Mg2+ transporter MgtE [Bacteroides ...   120    2e-25 
ref|YP_008114.1|  putative Mg2+ transporter [Candidatus Protoc...   120    2e-25 
ref|ZP_01059489.1|  putative transmembrane Mg2+ transporter [L...   120    2e-25 
ref|ZP_06425715.1|  magnesium transporter [Peptostreptococcus ...   120    3e-25 
ref|YP_003443329.1|  magnesium transporter [Allochromatium vin...   120    3e-25 
ref|ZP_04574418.1|  MG2+ transporter MGTE [Fusobacterium sp. 7...   120    3e-25 
ref|ZP_02027147.1|  hypothetical protein EUBVEN_02416 [Eubacte...   120    3e-25 
ref|ZP_00949701.1|  magnesium transporter [Croceibacter atlant...   120    3e-25 
ref|YP_003163496.1|  magnesium transporter [Leptotrichia bucca...   119    4e-25 
ref|YP_003142085.1|  magnesium transporter [Capnocytophaga och...   119    4e-25 
ref|ZP_03301751.1|  hypothetical protein BACDOR_03141 [Bactero...   119    4e-25 
ref|YP_002377882.1|  magnesium transporter [Cyanothece sp. PCC...   119    4e-25 
ref|ZP_02860974.1|  hypothetical protein ANASTE_00166 [Anaerof...   119    4e-25 
ref|ZP_01852376.1|  Mg2+ transport protein [Planctomyces maris...   119    4e-25 
ref|YP_001513605.1|  magnesium transporter [Alkaliphilus oreml...   119    4e-25 
emb|CAI50965.1|  divalent cation (Mg2+) transporter [unculture...   119    4e-25 
ref|YP_007876.1|  putative Mg2+ transporter [Candidatus Protoc...   119    4e-25 
ref|NP_800750.1|  putative magnesium transporter MgtE [Vibrio ...   119    4e-25 
ref|ZP_01049517.1|  putative transmembrane Mg2+ transporter [D...   119    4e-25 
ref|YP_001321043.1|  magnesium transporter [Alkaliphilus metal...   119    4e-25 
ref|ZP_06748771.1|  magnesium transporter [Fusobacterium sp. 1...   119    5e-25 
ref|ZP_04020336.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   119    5e-25 
ref|ZP_03458045.1|  hypothetical protein BACEGG_00818 [Bactero...   119    5e-25 
ref|ZP_03390359.1|  magnesium transporter [Capnocytophaga sput...   119    5e-25 
ref|ZP_01548535.1|  magnesium transporter [Stappia aggregata I...   119    5e-25 
ref|NP_903255.1|  magnesium transporter [Chromobacterium viola...   119    5e-25 
ref|YP_174237.1|  magnesium transporter [Bacillus clausii KSM-...   119    5e-25 
ref|ZP_01312480.1|  magnesium transporter [Desulfuromonas acet...   119    5e-25 
ref|ZP_05900145.1|  magnesium transporter [Leptotrichia hofsta...   119    6e-25 
ref|YP_001691857.1|  Mg2 transporter [Finegoldia magna ATCC 29...   119    6e-25 
ref|ZP_02072206.1|  hypothetical protein BACUNI_03650 [Bactero...   119    6e-25 
ref|ZP_02042888.1|  hypothetical protein RUMGNA_03692 [Ruminoc...   119    6e-25 
ref|YP_380095.1|  divalent cation transporter [Chlorobium chlo...   119    6e-25 
ref|NP_662732.1|  Mg2+ transporter MgtE [Chlorobium tepidum TL...   119    6e-25 
ref|NP_440719.1|  Mg2+ transporter [Synechocystis sp. PCC 6803...   119    6e-25 
ref|YP_003194010.1|  putative transmembrane Mg2+ transporter [...   119    6e-25 
ref|YP_003504249.1|  magnesium transporter [Denitrovibrio acet...   118    8e-25 
ref|ZP_04237139.1|  Mg2+ transporter mgtE [Bacillus cereus Roc...   118    8e-25 
ref|YP_003323891.1|  magnesium transporter [Thermobaculum terr...   118    8e-25 
ref|YP_002722618.1|  Mg/Co/Ni transporter MgtE [Brachyspira hy...   118    8e-25 
ref|ZP_03305139.1|  hypothetical protein ANHYDRO_01576 [Anaero...   118    8e-25 
ref|YP_001997973.1|  magnesium transporter [Chlorobaculum parv...   118    8e-25 
ref|ZP_02171517.1|  Mg/Co/Ni transporter MgtE (contains CBS do...   118    8e-25 
ref|YP_047388.1|  putative Mg transporter (MgtE) [Acinetobacte...   118    8e-25 
ref|ZP_04921251.1|  Mg/Co/Ni transporter MgtE [Vibrio sp. Ex25...   118    8e-25 
ref|ZP_00741176.1|  Mg2+ transporter mgtE [Bacillus thuringien...   118    8e-25 
ref|ZP_06011206.1|  magnesium transporter [Leptotrichia goodfe...   118    1e-24 
ref|ZP_04058572.1|  magnesium transporter [Capnocytophaga ging...   118    1e-24 
ref|ZP_05087409.1|  magnesium transporter [Pseudovibrio sp. JE...   118    1e-24 
ref|ZP_03155854.1|  magnesium transporter [Cyanothece sp. PCC ...   118    1e-24 
ref|YP_001358693.1|  magnesium transporter [Sulfurovum sp. NBC...   118    1e-24 
ref|NP_781975.1|  Mg2+ transporter mgtE [Clostridium tetani E8...   118    1e-24 
ref|ZP_05758239.1|  putative Mg2+ transporter MgtE [Bacteroide...   117    1e-24 
ref|ZP_05472991.1|  magnesium transporter [Anaerococcus vagina...   117    1e-24 
ref|ZP_04227408.1|  Mg2+ transporter mgtE [Bacillus cereus Roc...   117    1e-24 
ref|ZP_00515258.1|  Divalent cation transporter [Crocosphaera ...   117    1e-24 
ref|ZP_04544964.1|  conserved hypothetical protein [Bacteroide...   117    2e-24 
ref|ZP_03272139.1|  magnesium transporter [Arthrospira maxima ...   117    2e-24 
ref|ZP_02067820.1|  hypothetical protein BACOVA_04831 [Bactero...   117    2e-24 
ref|ZP_01960093.1|  hypothetical protein BACCAC_01705 [Bactero...   117    2e-24 
ref|YP_376156.1|  divalent cation transporter [Synechococcus s...   117    2e-24 
dbj|BAI92776.1|  Mg2+ transporter [Arthrospira platensis NIES-39]   117    2e-24 
emb|CBE68559.1|  Magnesium transporter [NC10 bacterium 'Dutch ...   117    2e-24 
ref|ZP_06382533.1|  magnesium transporter [Arthrospira platens...   117    2e-24 
ref|ZP_05655349.1|  magnesium transporter [Enterococcus cassel...   117    2e-24 
ref|ZP_05025005.1|  magnesium transporter [Microcoleus chthono...   117    2e-24 
ref|ZP_03629451.1|  magnesium transporter [bacterium Ellin514]...   117    2e-24 
ref|YP_001295007.1|  Mg2+ transporter MgtE [Flavobacterium psy...   117    2e-24 
ref|YP_199109.1|  Mg++ transporter [Xanthomonas oryzae pv. ory...   117    2e-24 
ref|YP_098062.1|  putative Mg2+ transporter MgtE [Bacteroides ...   117    2e-24 
ref|YP_002124509.1|  putative Magnesium transporter [Alteromon...   117    2e-24 
ref|ZP_06382230.1|  Mg2+ transporter [Arthrospira platensis st...   116    3e-24 
ref|ZP_05279728.1|  putative transmembrane Mg2+ transporter [B...   116    3e-24 
ref|ZP_04569972.1|  MG2+ transporter MGTE [Fusobacterium sp. 2...   116    3e-24 
ref|ZP_04114922.1|  Mg2+ transporter mgtE [Bacillus thuringien...   116    3e-24 
ref|ZP_05414835.1|  magnesium transporter [Bacteroides finegol...   116    3e-24 
ref|YP_003460921.1|  magnesium transporter [Thioalkalivibrio s...   116    3e-24 
ref|ZP_03289359.1|  hypothetical protein CLONEX_01561 [Clostri...   116    3e-24 
ref|ZP_03276338.1|  magnesium transporter [Arthrospira maxima ...   116    3e-24 
ref|ZP_03672557.1|  magnesium transporter [Borrelia valaisiana...   116    3e-24 
ref|YP_002499966.1|  magnesium transporter [Methylobacterium n...   116    3e-24 
ref|ZP_01885355.1|  putative Mg2+ transporter [Pedobacter sp. ...   116    3e-24 
ref|ZP_01985560.1|  Mg2+ transporter MgtE [Vibrio harveyi HY01...   116    3e-24 
ref|ZP_01631735.1|  Mg2+ transport protein [Nodularia spumigen...   116    3e-24 
ref|YP_685660.1|  Mg(2+) transporter [uncultured methanogenic ...   116    3e-24 
ref|YP_392324.1|  magnesium transporter [Thiomicrospira crunog...   116    3e-24 
ref|ZP_01053403.1|  magnesium ion transporter [Polaribacter sp...   116    3e-24 
emb|CBL26894.1|  Mg2+ transporter (mgtE) [Ruminococcus torques...   116    4e-24 
emb|CBL15072.1|  Mg2+ transporter (mgtE) [Ruminococcus bromii ...   116    4e-24 
ref|ZP_05645715.1|  magnesium transporter [Enterococcus cassel...   116    4e-24 
ref|ZP_05622102.1|  magnesium transporter [Treponema vincentii...   116    4e-24 
ref|ZP_01462006.1|  magnesium transporter [Stigmatella auranti...   116    4e-24 
ref|YP_529378.1|  serine/threonine protein kinase [Saccharopha...   116    4e-24 
ref|NP_604374.1|  MG2+ transporter MGTE [Fusobacterium nucleat...   116    4e-24 
ref|YP_003425491.1|  magnesium transporter [Bacillus pseudofir...   115    5e-24 
ref|YP_003163497.1|  magnesium transporter [Leptotrichia bucca...   115    5e-24 
ref|YP_003144932.1|  Mg2+ transporter MgtE [Slackia heliotrini...   115    5e-24 
ref|ZP_04573069.1|  MG2+ transporter MGTE [Fusobacterium sp. 4...   115    5e-24 
ref|ZP_04200937.1|  Mg2+ transporter mgtE [Bacillus cereus AH6...   115    5e-24 
ref|ZP_05346310.3|  magnesium transporter [Bryantella formatex...   115    5e-24 
ref|YP_001883809.1|  Mg2+ transporter MgtE [Borrelia hermsii D...   115    5e-24 
ref|ZP_01468967.1|  Divalent cation transporter [Synechococcus...   115    5e-24 
ref|ZP_01288736.1|  Divalent cation transporter [delta proteob...   115    5e-24 
ref|ZP_01291167.1|  Divalent cation transporter [delta proteob...   115    5e-24 
ref|ZP_01259295.1|  putative magnesium transporter MgtE [Vibri...   115    5e-24 
ref|YP_319333.1|  divalent cation transporter [Nitrobacter win...   115    5e-24 
ref|YP_001637291.1|  magnesium transporter [Chloroflexus auran...   115    5e-24 
ref|ZP_05551441.1|  magnesium transporter [Fusobacterium sp. 3...   115    7e-24 
ref|ZP_04862434.1|  magnesium transporter [Clostridium botulin...   115    7e-24 
ref|ZP_03821983.1|  Mg transporter (MgtE) [Acinetobacter sp. A...   115    7e-24 
ref|YP_002514067.1|  magnesium transporter [Thioalkalivibrio s...   115    7e-24 
ref|YP_002367207.1|  magnesium transporter [Bacillus cereus B4...   115    7e-24 
ref|YP_400286.1|  magnesium transporter [Synechococcus elongat...   115    7e-24 
ref|YP_003553169.1|  magnesium transporter [Aminobacterium col...   115    9e-24 
ref|ZP_06704301.1|  Mg++ transporter [Xanthomonas fuscans subs...   115    9e-24 
ref|ZP_06486310.1|  Mg++ transporter [Xanthomonas campestris p...   115    9e-24 
ref|ZP_06180481.1|  hypothetical protein VMC_19110 [Vibrio alg...   115    9e-24 
ref|ZP_04105892.1|  Mg2+ transporter mgtE [Bacillus thuringien...   115    9e-24 
ref|ZP_03702665.1|  magnesium transporter [Flavobacteria bacte...   115    9e-24 
ref|YP_001771390.1|  magnesium transporter [Methylobacterium s...   115    9e-24 
ref|YP_001503890.1|  magnesium transporter [Shewanella pealean...   115    9e-24 
ref|NP_644377.1|  Mg++ transporter [Xanthomonas axonopodis pv....   115    9e-24 
ref|ZP_01117328.1|  magnesium transporter [Polaribacter irgens...   115    9e-24 
ref|ZP_05618095.1|  MG2+ transporter MGTE [Fusobacterium sp. 3...   114    1e-23 
ref|ZP_04075953.1|  Mg2+ transporter mgtE [Bacillus thuringien...   114    1e-23 
ref|ZP_04094267.1|  Mg2+ transporter mgtE [Bacillus thuringien...   114    1e-23 
ref|ZP_04212231.1|  Mg2+ transporter mgtE [Bacillus cereus Roc...   114    1e-23 
ref|ZP_03757769.1|  hypothetical protein CLOSTASPAR_01779 [Clo...   114    1e-23 
ref|ZP_03634906.1|  hypothetical protein HOLDEFILI_02203 [Hold...   114    1e-23 
pdb|2YVX|A  Chain A, Crystal Structure Of Magnesium Transporte...   114    1e-23 
ref|YP_001447455.1|  hypothetical protein VIBHAR_05323 [Vibrio...   114    1e-23 
ref|YP_144326.1|  Mg2+ transporter MgtE [Thermus thermophilus ...   114    1e-23 
ref|ZP_01093363.1|  Mg2+ transport protein [Blastopirellula ma...   114    1e-23 
ref|ZP_02617642.1|  magnesium transporter [Clostridium botulin...   114    2e-23 
ref|ZP_02431495.1|  hypothetical protein CLOSCI_01715 [Clostri...   114    2e-23 
ref|ZP_01627973.1|  Mg2+ transport protein [Nodularia spumigen...   114    2e-23 
ref|YP_004670.1|  Mg(2+) transporter mgtE [Thermus thermophilu...   114    2e-23 
ref|ZP_00373414.1|  magnesium transporter [Wolbachia endosymbi...   114    2e-23 
ref|ZP_06439412.1|  magnesium transporter [Anaerobaculum hydro...   114    2e-23 
ref|ZP_04126545.1|  Mg2+ transporter mgtE [Bacillus thuringien...   114    2e-23 
ref|ZP_04666566.1|  magnesium transporter [Clostridiales bacte...   114    2e-23 
ref|ZP_03540241.1|  magnesium transporter [Borrelia garinii Fa...   114    2e-23 
ref|ZP_02996732.1|  hypothetical protein CLOSPO_03855 [Clostri...   114    2e-23 
ref|ZP_03232607.1|  magnesium transporter [Bacillus cereus AH1...   114    2e-23 
ref|YP_374251.1|  divalent cation transporter [Chlorobium lute...   114    2e-23 
ref|YP_003283764.1|  Mg2+ transporter [Blattabacterium sp. (Bl...   113    3e-23 
ref|ZP_05375116.1|  magnesium transporter [Hyphomicrobium deni...   113    3e-23 
ref|ZP_03539697.1|  magnesium transporter [Borrelia garinii PB...   113    3e-23 
ref|YP_001957641.1|  hypothetical protein Aasi_0507 [Candidatu...   113    3e-23 
ref|YP_741668.1|  magnesium transporter [Alkalilimnicola ehrli...   113    3e-23 
ref|YP_001038350.1|  magnesium transporter [Clostridium thermo...   113    3e-23 
ref|YP_003548918.1|  magnesium transporter [Coraliomargarita a...   113    3e-23 
ref|ZP_02094721.1|  hypothetical protein PEPMIC_01489 [Parvimo...   113    3e-23 
ref|ZP_01866305.1|  putative magnesium transporter MgtE [Vibri...   113    3e-23 
ref|YP_002462246.1|  magnesium transporter [Chloroflexus aggre...   113    3e-23 
ref|YP_072824.1|  Mg2+ transport protein [Borrelia garinii PBi...   113    3e-23 
ref|NP_904476.1|  magnesium transporter [Porphyromonas gingiva...   113    3e-23 
ref|NP_868719.1|  magnesium transporter Ykok [Rhodopirellula b...   113    3e-23 
emb|CBK74233.1|  Mg2+ transporter (mgtE) [Butyrivibrio fibriso...   112    5e-23 
ref|YP_003257260.1|  putative Mg2+ transporter [Blattabacteriu...   112    5e-23 
ref|ZP_04564380.1|  magnesium transporter [Mollicutes bacteriu...   112    5e-23 
ref|ZP_04088182.1|  Mg2+ transporter mgtE [Bacillus thuringien...   112    5e-23 
ref|ZP_03777435.1|  hypothetical protein CLOHYLEM_04487 [Clost...   112    5e-23 
ref|YP_001928363.1|  putative magnesium transporter [Porphyrom...   112    5e-23 
ref|YP_001786513.1|  magnesium transporter [Clostridium botuli...   112    5e-23 
ref|ZP_02428737.1|  hypothetical protein CLORAM_02147 [Clostri...   112    5e-23 
ref|YP_001390477.1|  magnesium transporter [Clostridium botuli...   112    5e-23 
ref|YP_001015903.1|  Mg2+ transporter [Prochlorococcus marinus...   112    5e-23 
ref|YP_170992.1|  Mg2+ transport protein [Synechococcus elonga...   112    5e-23 
ref|YP_001319225.1|  magnesium transporter [Alkaliphilus metal...   112    5e-23 
ref|ZP_05045637.1|  magnesium transporter [Cyanobium sp. PCC 7...   112    6e-23 
ref|YP_945380.1|  Mg2+ transporter MgtE [Borrelia turicatae 91...   112    6e-23 
ref|YP_365895.1|  magnesium transporter [Xanthomonas campestri...   112    6e-23 
ref|YP_001960479.1|  magnesium transporter [Chlorobium phaeoba...   112    6e-23 
ref|ZP_06299937.1|  hypothetical protein pah_c171o006 [Parachl...   112    8e-23 
ref|YP_003388109.1|  magnesium transporter [Spirosoma linguale...   112    8e-23 
ref|ZP_05117804.1|  Mg/Co/Ni transporter MgtE [Vibrio parahaem...   112    8e-23 
ref|YP_001918966.1|  magnesium transporter [Natranaerobius the...   112    8e-23 
ref|ZP_03436071.1|  magnesium transporter [Borrelia afzelii AC...   112    8e-23 
ref|YP_001672448.1|  magnesium transporter [Shewanella halifax...   112    8e-23 
ref|ZP_02194199.1|  putative magnesium transporter MgtE [Vibri...   112    8e-23 
ref|YP_001339926.1|  MgtE intracellular region [Marinomonas sp...   112    8e-23 
ref|YP_001411023.1|  magnesium transporter [Fervidobacterium n...   112    8e-23 
ref|YP_709821.1|  Mg2+ transport protein [Borrelia afzelii PKo...   112    8e-23 
ref|YP_578713.1|  magnesium transporter [Nitrobacter hamburgen...   112    8e-23 
ref|ZP_06730120.1|  Mg++ transporter [Xanthomonas fuscans subs...   111    1e-22 
ref|ZP_06383109.1|  magnesium transporter [Arthrospira platens...   111    1e-22 
ref|ZP_05785653.1|  magnesium transporter [Silicibacter lacusc...   111    1e-22 
ref|ZP_03914324.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   111    1e-22 
ref|ZP_03970662.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   111    1e-22 
ref|YP_002730434.1|  magnesium transporter [Persephonella mari...   111    1e-22 
ref|ZP_03795970.1|  magnesium transporter [Borrelia burgdorfer...   111    1e-22 
ref|ZP_03086652.1|  Mg2+ transport protein (mgtE) [Borrelia bu...   111    1e-22 
ref|YP_001886060.1|  magnesium transporter [Clostridium botuli...   111    1e-22 
ref|ZP_02082937.1|  hypothetical protein CLOBOL_00452 [Clostri...   111    1e-22 
ref|ZP_06598736.1|  magnesium transporter [Oribacterium sp. or...   111    1e-22 
ref|ZP_06249983.1|  magnesium transporter [Clostridium thermoc...   111    1e-22 
ref|ZP_05628740.1|  MG2+ transporter MGTE [Fusobacterium sp. D12]   111    1e-22 
ref|YP_002308861.1|  magnesium transporter [Candidatus Azobact...   111    1e-22 
ref|YP_002280466.1|  magnesium transporter [Rhizobium legumino...   111    1e-22 
ref|ZP_02093185.1|  hypothetical protein FAEPRAM212_03492 [Fae...   111    1e-22 
ref|YP_001383492.1|  magnesium transporter [Clostridium botuli...   111    1e-22 
ref|YP_001253653.1|  magnesium transporter [Clostridium botuli...   111    1e-22 
gb|AAZ53853.2|  putative MG2+ transport protein [Mycoplasma hy...   111    1e-22 
ref|ZP_03436288.1|  magnesium transporter [Borrelia burgdorfer...   111    1e-22 
ref|YP_287876.1|  putative MG2+ transport protein [Mycoplasma ...   111    1e-22 
ref|YP_245138.1|  Mg++ transporter [Xanthomonas campestris pv....   111    1e-22 
ref|NP_973316.1|  magnesium transporter [Treponema denticola A...   111    1e-22 
ref|YP_722045.1|  magnesium transporter [Trichodesmium erythra...   111    1e-22 
ref|ZP_05789013.1|  magnesium transporter [Synechococcus sp. W...   110    2e-22 
ref|ZP_05736960.1|  magnesium transporter [Granulicatella adia...   110    2e-22 
ref|ZP_04779963.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   110    2e-22 
ref|ZP_04298243.1|  Mg2+ transporter mgtE [Bacillus cereus AH6...   110    2e-22 
ref|YP_002222032.1|  Mg2 transport protein [Borrelia duttonii ...   110    2e-22 
ref|ZP_03623531.1|  magnesium transporter [Borrelia burgdorfer...   110    2e-22 
ref|ZP_03773054.1|  magnesium transporter [Borrelia sp. SV1] >...   110    2e-22 
ref|YP_001780754.1|  magnesium transporter [Clostridium botuli...   110    2e-22 
ref|ZP_02613210.1|  magnesium transporter [Clostridium botulin...   110    2e-22 
ref|YP_001129910.1|  magnesium transporter [Prosthecochloris v...   110    2e-22 
ref|YP_001528299.1|  magnesium transporter [Desulfococcus oleo...   110    2e-22 
ref|ZP_01385250.1|  magnesium transporter [Chlorobium ferrooxi...   110    2e-22 
ref|YP_292401.1|  Mg2+ transporter [Prochlorococcus marinus st...   110    2e-22 
ref|NP_212514.1|  Mg2+ transport protein (mgtE) [Borrelia burg...   110    2e-22 
ref|YP_001944066.1|  magnesium transporter [Chlorobium limicol...   110    2e-22 
ref|ZP_03527476.1|  Mg2+ transporter protein [Rhizobium etli C...   110    2e-22 
ref|ZP_03168734.1|  hypothetical protein RUMLAC_02426 [Ruminoc...   110    2e-22 
ref|YP_002433869.1|  magnesium transporter [Desulfatibacillum ...   110    2e-22 
gb|AAZ44570.2|  putative MG2+ transport protein [Mycoplasma hy...   110    2e-22 
ref|YP_628652.1|  magnesium transporter [Myxococcus xanthus DK...   110    2e-22 
ref|YP_279281.1|  putative MG2+ transport protein [Mycoplasma ...   110    2e-22 
ref|YP_003405270.1|  MgtE integral membrane region [Haloterrig...   110    3e-22 
ref|YP_003091595.1|  magnesium transporter [Pedobacter heparin...   110    3e-22 
ref|ZP_03524456.1|  Mg2+ transporter protein [Rhizobium etli G...   110    3e-22 
ref|YP_115995.1|  Mg2+ transporter [Mycoplasma hyopneumoniae 2...   110    3e-22 
ref|NP_639329.1|  Mg++ transporter [Xanthomonas campestris pv....   110    3e-22 
ref|YP_659848.1|  MgtE intracellular region [Pseudoalteromonas...   110    3e-22 
ref|YP_678239.1|  magnesium transporter, MgtE [Cytophaga hutch...   110    3e-22 
ref|YP_818164.1|  transcriptional regulator [Leuconostoc mesen...   110    3e-22 
ref|ZP_05943409.1|  putative magnesium transporter MgtE [Vibri...   109    4e-22 
ref|YP_002158713.1|  Mg2+ transporter MgtE [Vibrio fischeri MJ...   109    4e-22 
ref|YP_001758085.1|  magnesium transporter [Methylobacterium r...   109    4e-22 
ref|YP_001223875.1|  Mg/Co/Ni transporter MgtE [Synechococcus ...   109    4e-22 
ref|YP_001012133.1|  Mg2+ transporter [Prochlorococcus marinus...   109    4e-22 
ref|YP_468844.1|  magnesium (mg2+) transporter protein [Rhizob...   109    4e-22 
ref|YP_207005.1|  magnesium transporter MgtE [Vibrio fischeri ...   109    4e-22 
ref|YP_380426.1|  magnesium transporter [Synechococcus sp. CC9...   109    4e-22 
ref|NP_489224.1|  Mg2+ transport protein [Nostoc sp. PCC 7120]...   109    4e-22 
ref|ZP_01045384.1|  divalent cation transporter [Nitrobacter s...   109    4e-22 
ref|ZP_06065247.1|  magnesium transporter [Acinetobacter junii...   109    5e-22 
ref|ZP_05882279.1|  magnesium transporter [Vibrio metschnikovi...   109    5e-22 
ref|ZP_05427914.1|  magnesium transporter [Eubacterium saphenu...   109    5e-22 
ref|ZP_04859586.1|  MgtE family magnesium /cobalt transporter-...   109    5e-22 
ref|ZP_03488479.1|  hypothetical protein EUBIFOR_01061 [Eubact...   109    5e-22 
ref|YP_001977566.1|  Mg2+ transporter protein [Rhizobium etli ...   109    5e-22 
ref|ZP_02037456.1|  hypothetical protein BACCAP_03070 [Bactero...   109    5e-22 
ref|YP_001002298.1|  magnesium transporter [Halorhodospira hal...   109    5e-22 
ref|YP_003320314.1|  magnesium transporter [Sphaerobacter ther...   108    7e-22 
ref|YP_393855.1|  divalent cation transporter [Sulfurimonas de...   108    7e-22 
ref|ZP_01125418.1|  MgtE family, putative magnesium transport ...   108    7e-22 
ref|ZP_05882281.1|  magnesium transporter [Vibrio metschnikovi...   108    9e-22 
ref|ZP_05634270.1|  MG2+ transporter MGTE [Fusobacterium ulcer...   108    9e-22 
ref|ZP_03519375.1|  magnesium transporter [Rhizobium etli IE4771]   108    9e-22 
ref|ZP_02430427.1|  hypothetical protein CLOSCI_00638 [Clostri...   108    9e-22 
ref|ZP_02420912.1|  hypothetical protein ANACAC_03559 [Anaeros...   108    9e-22 
ref|ZP_01875889.1|  magnesium (Mg2+) transporter-like protein ...   108    9e-22 
ref|YP_877667.1|  magnesium transporter [Clostridium novyi NT]...   108    9e-22 
ref|YP_322942.1|  divalent cation transporter [Anabaena variab...   108    9e-22 
ref|NP_896196.1|  Mg2+ transporter [Synechococcus sp. WH 8102]...   108    9e-22 
ref|YP_002543868.1|  magnesium transporter [Agrobacterium radi...   108    1e-21 
ref|YP_001804111.1|  Mg2+ transporter [Cyanothece sp. ATCC 511...   108    1e-21 
ref|YP_001226353.1|  Mg/Co/Ni transporter MgtE [Synechococcus ...   108    1e-21 
ref|YP_001323960.1|  magnesium transporter [Methanococcus vann...   108    1e-21 
ref|ZP_04568663.1|  MG2+ transporter MGTE [Fusobacterium morti...   107    1e-21 
ref|ZP_03779742.1|  hypothetical protein CLOHYLEM_06820 [Clost...   107    1e-21 
ref|ZP_03128588.1|  magnesium transporter [Chthoniobacter flav...   107    1e-21 
ref|ZP_01079094.1|  MgtE family, putative magnesium transport ...   107    1e-21 
ref|ZP_03513369.1|  Mg2+ transporter protein [Rhizobium etli 8...   107    2e-21 
ref|YP_002264540.1|  divalent cation transporter, putative mag...   107    2e-21 
ref|ZP_05047551.1|  magnesium transporter [Nitrosococcus ocean...   107    2e-21 
ref|ZP_03675013.1|  magnesium transporter [Borrelia spielmanii...   107    2e-21 
ref|YP_001996937.1|  magnesium transporter [Chloroherpeton tha...   107    2e-21 
ref|YP_001515844.1|  magnesium transporter MgtE [Acaryochloris...   107    2e-21 
ref|ZP_01471644.1|  MgtE family, putative magnesium transport ...   107    2e-21 
ref|YP_001560112.1|  magnesium transporter [Clostridium phytof...   107    2e-21 
ref|YP_343786.1|  divalent cation transporter [Nitrosococcus o...   107    2e-21 
ref|YP_339238.1|  magnesium transporter [Pseudoalteromonas hal...   107    2e-21 
ref|ZP_05980705.1|  magnesium transporter [Subdoligranulum var...   107    2e-21 
ref|ZP_03735800.1|  magnesium transporter [Desulfonatronospira...   107    2e-21 
ref|ZP_03290998.1|  hypothetical protein CLONEX_03217 [Clostri...   107    2e-21 
ref|ZP_01611569.1|  putative Magnesium transporter [Alteromona...   107    2e-21 
ref|NP_893747.1|  Mg2+ transporter [Prochlorococcus marinus su...   107    2e-21 
ref|ZP_01979952.1|  Mg2+ transporter MgtE [Vibrio cholerae MZO...   107    2e-21 
ref|YP_002016549.1|  magnesium transporter [Prosthecochloris a...   107    2e-21 
ref|YP_003554040.1|  magnesium transporter [Aminobacterium col...   106    3e-21 
ref|ZP_04130683.1|  Mg2+ transporter mgtE [Bacillus thuringien...   106    3e-21 
ref|ZP_03991670.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   106    3e-21 
ref|ZP_02621379.1|  magnesium transporter [Clostridium botulin...   106    3e-21 
ref|ZP_01982808.1|  putative magnesium transporter MgtE [Vibri...   106    3e-21 
ref|YP_001377284.1|  magnesium transporter [Anaeromyxobacter s...   106    3e-21 
ref|NP_233204.1|  magnesium transporter MgtE, putative [Vibrio...   106    3e-21 
ref|ZP_01678453.1|  magnesium transporter MgtE, putative [Vibr...   106    3e-21 
ref|ZP_01682215.1|  magnesium transporter MgtE, putative [Vibr...   106    3e-21 
ref|ZP_06718063.1|  magnesium transporter [Ruminococcus albus ...   106    4e-21 
ref|ZP_04584876.1|  magnesium transporter [Sulfurihydrogenibiu...   106    4e-21 
ref|ZP_05137427.1|  magnesium transporter [Prochlorococcus mar...   106    4e-21 
ref|YP_001485103.1|  Mg2+ transporter [Prochlorococcus marinus...   106    4e-21 
ref|YP_001092046.1|  Mg2+ transporter [Prochlorococcus marinus...   106    4e-21 
ref|YP_398220.1|  Mg2+ transporter [Prochlorococcus marinus st...   106    4e-21 
ref|ZP_06572105.1|  magnesium transporter [Clostridium sp. M62...   105    6e-21 
ref|NP_876183.1|  Mg2+/Co2+ transporter [Prochlorococcus marin...   105    6e-21 
ref|YP_290255.1|  divalent cation transporter [Thermobifida fu...   105    6e-21 
ref|ZP_01135479.1|  putative Magnesium transporter [Pseudoalte...   105    6e-21 
ref|ZP_06719159.1|  magnesium transporter [Ruminococcus albus ...   105    7e-21 
ref|ZP_03849733.1|  MgtE family magnesium (Mg2+)/cobalt (Co2+)...   105    7e-21 
ref|YP_001728442.1|  magnesium transporter [Leuconostoc citreu...   105    7e-21 
ref|YP_002974929.1|  magnesium transporter [Rhizobium legumino...   105    7e-21 
ref|YP_001471005.1|  magnesium transporter [Thermotoga letting...   105    7e-21 
ref|YP_001010230.1|  Mg2+ transporter [Prochlorococcus marinus...   105    7e-21 
ref|YP_767065.1|  putative magnesium transporter protein [Rhiz...   105    7e-21 
ref|ZP_01128364.1|  Divalent cation transporter [Nitrococcus m...   105    7e-21 
ref|YP_001551642.1|  Mg2+ transporter [Prochlorococcus marinus...   105    7e-21 
ref|YP_002019245.1|  magnesium transporter [Pelodictyon phaeoc...   105    7e-21 
ref|YP_003474924.1|  magnesium transporter [Clostridiales geno...   105    9e-21 
ref|ZP_04334374.1|  Mg2+ transporter MgtE [Nocardiopsis dasson...   105    9e-21 
ref|NP_224491.1|  Mg2+ transporter [Chlamydophila pneumoniae C...   105    9e-21 
ref|ZP_05718219.1|  putative magnesium transporter MgtE [Vibri...   104    1e-20 
ref|YP_002549003.1|  magnesium transport protein [Agrobacteriu...   104    1e-20 
ref|YP_219896.1|  putative magnesium transporter [Chlamydophil...   104    1e-20 
ref|ZP_06079985.1|  putative magnesium transporter MgtE [Vibri...   104    2e-20 
ref|ZP_06032115.1|  putative magnesium transporter MgtE [Vibri...   104    2e-20 
ref|YP_002521810.1|  magnesium transporter [Thermomicrobium ro...   104    2e-20 
ref|ZP_02234594.1|  hypothetical protein DORFOR_01466 [Dorea f...   104    2e-20 
ref|YP_001747212.1|  MgtE integral membrane region [Pseudomona...   104    2e-20 
ref|YP_474150.1|  magnesium transporter [Synechococcus sp. JA-...   104    2e-20 
ref|NP_829362.1|  magnesium transporter [Chlamydophila caviae ...   104    2e-20 
ref|YP_515428.1|  Mg++ transporter [Chlamydophila felis Fe/C-5...   104    2e-20 
ref|NP_244090.1|  magnesium (Mg2+) transporter [Bacillus halod...   104    2e-20 
ref|YP_001016183.1|  Mg2+ transporter [Prochlorococcus marinus...   103    2e-20 
ref|ZP_01116540.1|  magnesium transporter, putative [Reinekea ...   103    2e-20 
ref|ZP_05360152.1|  magnesium transporter [Acinetobacter radio...   103    3e-20 
ref|YP_002567247.1|  MgtE integral membrane region [Halorubrum...   103    3e-20 
ref|YP_001193196.1|  magnesium transporter [Flavobacterium joh...   103    3e-20 
ref|YP_912535.1|  magnesium transporter [Chlorobium phaeobacte...   103    3e-20 
ref|ZP_04297889.1|  Mg2+ transporter mgtE [Bacillus cereus AH6...   103    4e-20 
ref|ZP_01968838.1|  hypothetical protein RUMTOR_02418 [Ruminoc...   103    4e-20 
ref|YP_001137164.1|  hypothetical protein cgR_0298 [Corynebact...   103    4e-20 
ref|NP_893959.1|  Mg2+ transporter [Prochlorococcus marinus st...   103    4e-20 
ref|ZP_06403484.1|  magnesium transporter [bacterium S5] >gb|E...   102    5e-20 
ref|YP_003060401.1|  magnesium transporter [Hirschia baltica A...   102    5e-20 
ref|ZP_04168958.1|  Mg2+ transporter mgtE [Bacillus mycoides D...   102    5e-20 
ref|YP_003271086.1|  magnesium transporter [Haliangium ochrace...   102    5e-20 
ref|ZP_03168110.1|  hypothetical protein RUMLAC_01789 [Ruminoc...   102    5e-20 
ref|YP_635548.1|  magnesium transporter [Myxococcus xanthus DK...   102    5e-20 
ref|NP_354023.1|  magnesium transport protein [Agrobacterium t...   102    5e-20 
ref|ZP_02042094.1|  hypothetical protein RUMGNA_02871 [Ruminoc...   102    6e-20 
ref|ZP_01976736.1|  magnesium transporter MgtE, putative [Vibr...   102    6e-20 
ref|YP_001095792.1|  MgtE integral membrane region [Shewanella...   102    6e-20 
ref|YP_003514305.1|  magnesium transporter [Stackebrandtia nas...   102    8e-20 
ref|YP_002762216.1|  magnesium transporter [Gemmatimonas auran...   102    8e-20 
ref|YP_002956546.1|  Mg2+ transporter MgtE [Micrococcus luteus...   102    8e-20 
ref|ZP_01994674.1|  hypothetical protein DORLON_00659 [Dorea l...   102    8e-20 
ref|NP_633684.1|  MG2+ transporter MGTE [Methanosarcina mazei ...   102    8e-20 
ref|ZP_05878342.1|  putative magnesium transporter MgtE [Vibri...   101    1e-19 
ref|ZP_04197558.1|  Mg2+ transporter mgtE [Bacillus cereus AH6...   101    1e-19 
ref|YP_002049099.1|  MgtE family, putative magnesium transport...   101    1e-19 
ref|YP_475112.1|  magnesium transporter [Synechococcus sp. JA-...   101    1e-19 
ref|YP_120514.1|  putative divalent cation transporter [Nocard...   101    1e-19 
ref|YP_003094995.1|  Divalent cation transporter [Flavobacteri...   101    1e-19 
ref|ZP_04427413.1|  Mg2+ transporter MgtE [Planctomyces limnop...   101    1e-19 
ref|ZP_01993046.1|  magnesium transporter [Vibrio parahaemolyt...   101    1e-19 
emb|CBK93294.1|  Mg2+ transporter (mgtE) [Eubacterium rectale ...   100    2e-19 
ref|ZP_05710583.1|  magnesium transporter [Desulfurivibrio alk...   100    2e-19 
ref|YP_002284422.1|  magnesium transporter [Ureaplasma urealyt...   100    2e-19 
ref|YP_001800450.1|  putative transporter [Corynebacterium ure...   100    2e-19 
ref|YP_001611128.1|  Mg2+ transporter [Sorangium cellulosum 'S...   100    2e-19 
ref|YP_729334.1|  magnesium transporter [Synechococcus sp. CC9...   100    2e-19 
ref|ZP_01084516.1|  MgtE family, putative magnesium transport ...   100    2e-19 
emb|CBK89857.1|  Mg2+ transporter (mgtE) [Eubacterium rectale ...   100    2e-19 
ref|ZP_05927114.1|  putative magnesium transporter MgtE [Vibri...   100    2e-19 
dbj|BAB97617.1|  Mg/Co/Ni transporter MgtE (contains CBS domai...   100    2e-19 
ref|YP_478323.1|  magnesium transporter [Synechococcus sp. JA-...   100    2e-19 
ref|NP_599477.1|  Mg/Co/Ni transporter MgtE [Corynebacterium g...   100    2e-19 
ref|YP_751442.1|  MgtE intracellular region [Shewanella frigid...   100    2e-19 
ref|ZP_05912305.1|  Mg2+ transporter MgtE [Brevibacterium line...   100    3e-19 
ref|ZP_04075175.1|  Mg2+ transporter mgtE [Bacillus thuringien...   100    3e-19 
ref|ZP_04114831.1|  Mg2+ transporter mgtE [Bacillus thuringien...   100    3e-19 
ref|ZP_04206198.1|  Mg2+ transporter mgtE [Bacillus cereus F65...   100    3e-19 
ref|YP_002136388.1|  magnesium transporter [Anaeromyxobacter s...   100    3e-19 
ref|YP_001280593.1|  magnesium transporter [Psychrobacter sp. ...   100    3e-19 
pir||I40201  mgtE protein - Bacillus firmus >gb|AAA64954.1| Mg...  99.8    4e-19 

ALIGNMENTS
>ref|YP_266497.1| magnesium transport protein mgtE [Candidatus Pelagibacter ubique 
HTCC1062]
 ref|ZP_01265151.1| magnesium transport protein mgtE [Candidatus Pelagibacter ubique 
HTCC1002]
 gb|AAZ21893.1| magnesium transport protein mgtE [Candidatus Pelagibacter ubique 
HTCC1062]
 gb|EAS84251.1| magnesium transport protein mgtE [Candidatus Pelagibacter ubique 
HTCC1002]
Length=457

 Score =  464 bits (1195),  Expect = 5e-129
 Identities = 265/310 (85%), Positives = 294/310 (94%), Gaps = 0/310 (0%)
 Frame = +1

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  180
            I +LENVDEKDKNTILS+LPPKDRFALLE LSYPED+AARIMQREFTA+PSNWSVGQTID
Sbjct  109  ITILENVDEKDKNTILSSLPPKDRFALLESLSYPEDTAARIMQREFTAVPSNWSVGQTID  168

Query  181  YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  360
            YLRENKDLPEEFLEIFI++E+FKPIG+VPSSKVL T RETKM SIM ++  L+PVDMD+E
Sbjct  169  YLRENKDLPEEFLEIFIIDEDFKPIGTVPSSKVLTTSRETKMLSIMSESQLLIPVDMDKE  228

Query  361  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  540
            EVGN+FENY+L+SA VVDKS KLVGMI YDD+LTVLKEEAEEDALRLAGVGDEEITDGV 
Sbjct  229  EVGNVFENYSLNSAAVVDKSNKLVGMIMYDDVLTVLKEEAEEDALRLAGVGDEEITDGVF  288

Query  541  TKTKRRFnwlllnlftaflatwCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  720
             KT+RRFNWLLLNLFTAFLATW ISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV
Sbjct  289  KKTRRRFNWLLLNLFTAFLATWVISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  348

Query  721  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQlsliisismiltm  900
            R+LATNDLTKNNFTQNILKEFNIG+LNGIIFA+IS+++VQ+WFQD+ LSLIIS+SMI+TM
Sbjct  349  RTLATNDLTKNNFTQNILKEFNIGILNGIIFAIISALVVQVWFQDSLLSLIISMSMIVTM  408

Query  901  iiARLFGILI  930
            I+A LFGIL+
Sbjct  409  IVAGLFGILV  418


>ref|ZP_05069612.1| magnesium transporter [Candidatus Pelagibacter sp. HTCC7211]
 gb|EDZ60611.1| magnesium transporter [Candidatus Pelagibacter sp. HTCC7211]
Length=457

 Score =  453 bits (1166),  Expect = 1e-125
 Identities = 262/310 (84%), Positives = 287/310 (92%), Gaps = 0/310 (0%)
 Frame = +1

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  180
            I +LENV E DKN ILS+LPPKDRFALLE LSYPED+AARIMQREFTAIPSNWSVGQTID
Sbjct  109  ISILENVPEDDKNNILSSLPPKDRFALLESLSYPEDTAARIMQREFTAIPSNWSVGQTID  168

Query  181  YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  360
            YLRENKDLPEEFLEIFI+NE FKPIG+VPSS+VL T R+TKM SIM ++  L+PVDMD+E
Sbjct  169  YLRENKDLPEEFLEIFIINEEFKPIGTVPSSRVLTTSRDTKMLSIMSESQLLIPVDMDKE  228

Query  361  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  540
            EV NLFENYNL+SA V+DK+ KLVGMI  DD+LTVL+EEAEEDALRLAGVGDEEITDGVI
Sbjct  229  EVANLFENYNLNSAAVIDKNNKLVGMIMSDDVLTVLQEEAEEDALRLAGVGDEEITDGVI  288

Query  541  TKTKRRFnwlllnlftaflatwCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  720
            TKTKRRFNWLLLNLFTAFLATWCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV
Sbjct  289  TKTKRRFNWLLLNLFTAFLATWCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  348

Query  721  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQlsliisismiltm  900
            R++ATNDLT+NNF+ N+LKEF IG+LNGIIFA IS+ IVQ+WFQDN LS+IISISMILTM
Sbjct  349  RTIATNDLTENNFSSNVLKEFTIGILNGIIFAAISAFIVQIWFQDNTLSIIISISMILTM  408

Query  901  iiARLFGILI  930
            IIA LFGILI
Sbjct  409  IIAGLFGILI  418


>ref|ZP_06054915.1| magnesium transporter [alpha proteobacterium HIMB114]
 gb|EEY74684.1| magnesium transporter [alpha proteobacterium HIMB114]
Length=458

 Score =  300 bits (769),  Expect = 1e-79
 Identities = 167/286 (58%), Positives = 215/286 (75%), Gaps = 1/286 (0%)
 Frame = +1

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGL-SYPEDSAARIMQREFTAIPSNWSVGQTI  177
            + ++ N+DE+ K  +   +P +D+  L E L +YPEDSAARIMQ E+ ++   W+VG+TI
Sbjct  107  LQIVSNLDEEKKIDVYEKIPLQDKKLLEEVLKAYPEDSAARIMQTEYCSVSPEWTVGETI  166

Query  178  DYLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDR  357
            DYLRE  DLP+EFL+IFIV++  +P+GSVPSS+VLR PR TKM  IM +T  L+  D D+
Sbjct  167  DYLRETDDLPKEFLQIFIVDDKKRPLGSVPSSRVLRNPRSTKMRDIMDETQMLIYGDWDK  226

Query  358  EEVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGV  537
            E+VG LFE YNL SA VVDK+ KL+GMIT DDILTVLKEEAEEDAL+LAGV DE ITD  
Sbjct  227  EQVGYLFEQYNLISAGVVDKNNKLIGMITADDILTVLKEEAEEDALKLAGVQDEAITDNA  286

Query  538  ITKTKRRFnwlllnlftaflatwCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVT  717
            +  TK+RF WLL+NLFTA +A++ I LF   I+++V LA LMPIVASMGGNA  QTL VT
Sbjct  287  VKITKKRFVWLLINLFTAVIASYVIGLFDGNIQKVVALAVLMPIVASMGGNAATQTLTVT  346

Query  718  VRSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQD  855
            VR +AT +LT  N  + I KEF++G LNGI+F++IS + V  WF +
Sbjct  347  VRLIATKELTAENLFKIIGKEFSVGFLNGILFSLISGLFVYFWFYE  392


>ref|ZP_02167932.1| putative transmembrane cationic transporter [Hoeflea phototrophica 
DFL-43]
 gb|EDQ32189.1| putative transmembrane cationic transporter [Hoeflea phototrophica 
DFL-43]
Length=479

 Score =  283 bits (723),  Expect = 3e-74
 Identities = 157/310 (50%), Positives = 224/310 (72%), Gaps = 0/310 (0%)
 Frame = +1

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  180
            + +LE++DE D+  IL+ALP  +R  L   L YPED+A R MQ EF A+P  W+VGQTID
Sbjct  128  VYILEDLDEADQREILAALPFTERVRLRRSLDYPEDTAGRRMQTEFVAVPPFWTVGQTID  187

Query  181  YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  360
            Y+RE +DLP+ F +IF+++  FK +G V   ++LRT R+ ++  +M +T + +  +MD+E
Sbjct  188  YMREEEDLPDHFSQIFVIDPTFKLVGGVDLDRILRTKRQARIEDVMEETRYRIDAEMDQE  247

Query  361  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  540
            E   LFE Y+L SA VVD++E+LVG++T DD++ V+  EA+ED  RL GVGDEE++D +I
Sbjct  248  EAAQLFEQYDLLSAAVVDENERLVGVLTIDDVVDVIHAEADEDIKRLGGVGDEELSDNII  307

Query  541  TKTKRRFnwlllnlftaflatwCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  720
            +  + RF+WLL+NL TA LA+W ISLF ATIEQMV LA LMPIVASMGGNAG QT+ VTV
Sbjct  308  STVRSRFSWLLINLATAILASWVISLFDATIEQMVALAVLMPIVASMGGNAGTQTMTVTV  367

Query  721  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQlsliisismiltm  900
            R+LAT D+   N  + I +E  +G++NG++FA I  ++  LWF ++ L  II+ +M++ M
Sbjct  368  RALATRDIDIYNAGRVIRREAAVGLINGVLFAAIIGVVAGLWFANSSLGGIIAAAMVVNM  427

Query  901  iiARLFGILI  930
            + A L GIL+
Sbjct  428  LAAALAGILL  437


>ref|ZP_01437807.1| probable magnesium transporter protein [Fulvimarina pelagi HTCC2506]
 gb|EAU42804.1| probable magnesium transporter protein [Fulvimarina pelagi HTCC2506]
Length=470

 Score =  281 bits (719),  Expect = 7e-74
 Identities = 160/310 (51%), Positives = 221/310 (71%), Gaps = 0/310 (0%)
 Frame = +1

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  180
            + +LE+++E+D+  IL+ALP ++R  L   L YPE+SA R MQ EF A+P  WSVGQTID
Sbjct  119  VYILEDIEEEDRKEILAALPFRERMRLRRSLEYPEESAGRRMQTEFVAVPPYWSVGQTID  178

Query  181  YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  360
            Y+RE++DLP  F +IF+V+   K IG+V   ++LR  R  K+  IM DT   +P +MD+E
Sbjct  179  YMREDEDLPTSFAQIFVVDPMLKLIGAVELDRILRAKRPEKIEDIMHDTRHAIPAEMDQE  238

Query  361  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  540
            E   + E Y+L SA VVD+ E+LVG++T DD++ +++ EAEED  RL GVGDEEI+D V+
Sbjct  239  EAAQIIEQYDLLSAAVVDQGERLVGVLTIDDVIDIVQAEAEEDIKRLGGVGDEEISDTVL  298

Query  541  TKTKRRFnwlllnlftaflatwCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  720
            T  + RF WL++NL TA LA+  I LF ATI+QMV LA LMPIVASMGGNAG QT+ V V
Sbjct  299  TAVRSRFTWLMVNLATAILASLVIGLFDATIQQMVALAVLMPIVASMGGNAGTQTMTVAV  358

Query  721  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQlsliisismiltm  900
            R+LA+ D+   N  + I +E  IG+LNG++FA++  I+  +WFQ+  L  +I+I+MI+ M
Sbjct  359  RALASRDIDLRNAGRIIRRESLIGLLNGVLFAIVIGIVAAVWFQNPGLGQVIAIAMIVNM  418

Query  901  iiARLFGILI  930
            I A L GILI
Sbjct  419  IAAALAGILI  428


>ref|ZP_03517069.1| magnesium transporter protein [Rhizobium etli IE4771]
Length=386

 Score =  280 bits (716),  Expect = 2e-73
 Identities = 156/310 (50%), Positives = 219/310 (70%), Gaps = 0/310 (0%)
 Frame = +1

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  180
            + +LE++D++D+  IL+ LP  +R  L   L YPE SA R MQ EF A+P  W+VGQTID
Sbjct  36   VYILEDLDKEDREEILAQLPFTERVRLRRALDYPESSAGRRMQTEFVAVPPFWTVGQTID  95

Query  181  YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  360
            Y+R+ +DLP  F +IF+++  FK +G+V   ++LRT R+TK+  IM +T   VP +MD+E
Sbjct  96   YMRDEEDLPYSFSQIFVIDPTFKLLGAVDLDQILRTKRQTKIEQIMRETNHPVPAEMDQE  155

Query  361  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  540
            E   LFE Y+L SA VVD++ +LVG++T DD++ V+ EEA+ED  RL GVGDEE++D V+
Sbjct  156  EAAQLFEQYDLLSAAVVDENGRLVGVLTIDDVVDVIHEEADEDIKRLGGVGDEELSDNVL  215

Query  541  TKTKRRFnwlllnlftaflatwCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  720
            +  + RF WLL+NL TA L+   I LF A+IE+M+ LA LMPIVASMGGNAG QT+ VTV
Sbjct  216  STARSRFLWLLINLGTAMLSASVIGLFDASIEKMIALAVLMPIVASMGGNAGTQTMTVTV  275

Query  721  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQlsliisismiltm  900
            R+LAT DL   N  + I +E  +G+LNG +FA I  +I   WFQD QL  +I+ +M++ +
Sbjct  276  RALATRDLDIYNAGRIIRREAGVGILNGAVFATIMGLIAGTWFQDYQLGGVIAAAMVINL  335

Query  901  iiARLFGILI  930
            + A L GIL+
Sbjct  336  MAAALAGILL  345


>ref|YP_768135.1| putative transmembrane cationic transporter [Rhizobium leguminosarum 
bv. viciae 3841]
 emb|CAK08039.1| putative transmembrane cationic transporter [Rhizobium leguminosarum 
bv. viciae 3841]
Length=471

 Score =  278 bits (712),  Expect = 5e-73
 Identities = 156/310 (50%), Positives = 218/310 (70%), Gaps = 0/310 (0%)
 Frame = +1

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  180
            + +LE++D++D+  IL+ LP  +R  L   L YPE SA R MQ EF A+P  W+VGQTID
Sbjct  121  VYILEDLDKEDREEILAQLPFTERVRLRRALDYPESSAGRRMQTEFVAVPPFWTVGQTID  180

Query  181  YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  360
            Y+R+ +DLP  F +IF+++  FK +G+V   ++LRT R+TK+  IM +T   VP +MD+E
Sbjct  181  YMRDEEDLPYSFSQIFVIDPTFKLLGAVDLDQILRTKRQTKIEQIMRETNHPVPAEMDQE  240

Query  361  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  540
            E   LFE Y+L SA VVD++ +LVG++T DD++ V+ EEA+ED  RL GVGDEE++D V+
Sbjct  241  EAAQLFEQYDLLSAAVVDENGRLVGVLTIDDVVDVIHEEADEDIKRLGGVGDEELSDNVL  300

Query  541  TKTKRRFnwlllnlftaflatwCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  720
            +  + RF WLL+NL TA L+   I LF  +IE+M+ LA LMPIVASMGGNAG QT+ VTV
Sbjct  301  STVRSRFLWLLINLGTAMLSASVIGLFDGSIEKMIALAVLMPIVASMGGNAGTQTMTVTV  360

Query  721  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQlsliisismiltm  900
            R+LAT DL   N  + I +E  +GVLNGI+FA I  +I   WF D QL  +I+ +M++ +
Sbjct  361  RALATRDLDIYNAGRIIRREAGVGVLNGIVFASIMGVIAGTWFHDYQLGGVIAAAMVINL  420

Query  901  iiARLFGILI  930
            + A L GIL+
Sbjct  421  MAAALAGILL  430


>ref|YP_001326721.1| magnesium transporter [Sinorhizobium medicae WSM419]
 gb|ABR59886.1| magnesium transporter [Sinorhizobium medicae WSM419]
Length=473

 Score =  278 bits (711),  Expect = 6e-73
 Identities = 156/310 (50%), Positives = 215/310 (69%), Gaps = 0/310 (0%)
 Frame = +1

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  180
            + +LE++D++D+  IL+ LP  +R  L   L YPE +A R MQ EF A+P  W+VGQTID
Sbjct  122  VYILEDLDQEDQEEILAKLPFTERVRLRRSLDYPESTAGRRMQTEFVAVPPFWTVGQTID  181

Query  181  YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  360
            Y+RE+ DLPE F +IF+++  FK +G+V   +VLR  R  K+ +IM DT   VP +MD+E
Sbjct  182  YMREDDDLPESFTQIFVIDPTFKLLGAVDLDRVLRAKRSVKIDAIMRDTSHSVPAEMDQE  241

Query  361  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  540
            E   LFE Y+L SA VVD++ +LVG++T DD++ V++EEAEED LRL+GVGDEE++D V 
Sbjct  242  EAAQLFEQYDLLSAAVVDENGRLVGVLTIDDVVDVIQEEAEEDFLRLSGVGDEELSDSVA  301

Query  541  TKTKRRFnwlllnlftaflatwCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  720
               + R  WL +N  TAF++   I LF ATI+Q+V LA LMPIVA MGGNAG QT+ VTV
Sbjct  302  EAARSRIPWLFVNSITAFVSASVIGLFDATIQQIVALAILMPIVAGMGGNAGSQTMTVTV  361

Query  721  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQlsliisismiltm  900
            R+LAT  L  +N  + I +E  +G+LNG+IF     ++  LWFQD  L  II+ +M++ M
Sbjct  362  RALATRGLDIHNAPRIIRREAGVGLLNGVIFGAFIGLVAGLWFQDPDLGGIIATAMLINM  421

Query  901  iiARLFGILI  930
            + A L GILI
Sbjct  422  MAAALAGILI  431


>ref|YP_001978460.1| probable magnesium transporter protein [Rhizobium etli CIAT 652]
 gb|ACE91282.1| probable magnesium transporter protein [Rhizobium etli CIAT 652]
Length=470

 Score =  278 bits (710),  Expect = 8e-73
 Identities = 155/310 (50%), Positives = 219/310 (70%), Gaps = 0/310 (0%)
 Frame = +1

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  180
            + +LE++D++D+  IL+ LP  +R  L   L YPE SA R MQ EF A+P  W+VGQTID
Sbjct  120  VYILEDLDKEDREEILAQLPFTERVRLRRALDYPESSAGRRMQTEFVAVPPFWTVGQTID  179

Query  181  YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  360
            Y+R+ ++LP  F +IF+++  FK +G+V   ++LRT R+TK+  IM +T   VP +MD+E
Sbjct  180  YMRDEENLPYSFSQIFVIDPTFKLLGAVDLDQILRTKRQTKIEQIMRETNHPVPAEMDQE  239

Query  361  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  540
            E   LFE Y+L SA VVD++++LVG++T DD++ V+ EEA+ED  RL GVGDEE++D V+
Sbjct  240  EAAQLFEQYDLLSAAVVDENDRLVGVLTIDDVVDVIHEEADEDIKRLGGVGDEELSDNVL  299

Query  541  TKTKRRFnwlllnlftaflatwCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  720
            +  + RF WLL+NL TA L+   I LF A+IE+M+ LA LMPIVASMGGNAG QT+ VTV
Sbjct  300  STARSRFLWLLINLATAMLSASVIGLFDASIEKMIALAVLMPIVASMGGNAGTQTMTVTV  359

Query  721  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQlsliisismiltm  900
            R+LAT DL   N  + I +E  +G+LNG +FA I   I  +WF D QL  +I+ +MI+ +
Sbjct  360  RALATRDLDIYNAGRIIRREAGVGILNGAVFATIMGAIAAVWFNDYQLGGVIAAAMIINL  419

Query  901  iiARLFGILI  930
            + A L GIL+
Sbjct  420  MAAALAGILL  429


>ref|YP_469726.1| magnesium transporter protein [Rhizobium etli CFN 42]
 gb|ABC90999.1| probable magnesium transporter protein [Rhizobium etli CFN 42]
Length=468

 Score =  278 bits (710),  Expect = 8e-73
 Identities = 156/310 (50%), Positives = 218/310 (70%), Gaps = 0/310 (0%)
 Frame = +1

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  180
            + +LE++D++D+  IL+ LP  +R  L   L YPE SA R MQ EF A+P  W+VGQTID
Sbjct  118  VYILEDLDKEDREEILAQLPFTERVRLRRALDYPESSAGRRMQTEFVAVPPFWTVGQTID  177

Query  181  YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  360
            Y+R+ +DLP  F +IF+++  FK +G+V   ++LRT R+TK+  IM +T   VP +MD+E
Sbjct  178  YMRDEEDLPYSFSQIFVIDPTFKLLGAVDLDQILRTKRQTKIEQIMRETNHPVPAEMDQE  237

Query  361  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  540
            E   LFE Y+L SA VVD++ +LVG++T DD++ V+ EEA+ED  RL GVGDEE++D +I
Sbjct  238  EAAQLFEQYDLLSAAVVDENGRLVGVLTIDDVVDVIHEEADEDIKRLGGVGDEELSDNLI  297

Query  541  TKTKRRFnwlllnlftaflatwCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  720
            +  + RF WLL+NL TA L+   I LF A+IE+M+ LA LMPIVASMGGNAG QT+ VTV
Sbjct  298  STARSRFLWLLINLGTAMLSASVIGLFDASIEKMIALAVLMPIVASMGGNAGTQTMTVTV  357

Query  721  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQlsliisismiltm  900
            R+LAT DL   N  + I +E  +G+LNG +FA I   I  +WF D QL  +I+ +MI+ +
Sbjct  358  RALATRDLDIYNAGRIIRREAGVGILNGAVFATIMGAIAGIWFHDYQLGGVIAAAMIINL  417

Query  901  iiARLFGILI  930
            + A L GIL+
Sbjct  418  MAAALAGILL  427


>ref|YP_002975886.1| magnesium transporter [Rhizobium leguminosarum bv. trifolii WSM1325]
 gb|ACS56347.1| magnesium transporter [Rhizobium leguminosarum bv. trifolii WSM1325]
Length=471

 Score =  277 bits (709),  Expect = 1e-72
 Identities = 155/310 (50%), Positives = 217/310 (70%), Gaps = 0/310 (0%)
 Frame = +1

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  180
            + +LE++D++D+  IL+ LP  +R  L   L YPE SA R MQ EF A+P  W+VGQTID
Sbjct  121  VYILEDLDKEDREEILAQLPFTERVRLRRALDYPESSAGRRMQTEFVAVPPFWTVGQTID  180

Query  181  YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  360
            Y+R+ +DLP  F +IF+++  FK +G+V   ++LRT R+TK+  IM +T   VP +MD+E
Sbjct  181  YMRDEEDLPYSFSQIFVIDPTFKLLGAVDLDQILRTKRQTKIEQIMRETNHPVPAEMDQE  240

Query  361  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  540
            E   LFE Y+L SA VVD++ +LVG++T DD++ V+ EEA+ED  RL GVGDEE++D V+
Sbjct  241  EAAQLFEQYDLLSAAVVDENGRLVGVLTIDDVVDVIHEEADEDIKRLGGVGDEELSDNVL  300

Query  541  TKTKRRFnwlllnlftaflatwCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  720
            +  + RF WLL+NL TA L+   I LF  +IE+M+ LA LMPIVASMGGNAG QT+ VTV
Sbjct  301  STVRSRFLWLLINLGTAMLSASVIGLFDGSIEKMIALAVLMPIVASMGGNAGTQTMTVTV  360

Query  721  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQlsliisismiltm  900
            R+LAT DL   N  + I +E  +G+LNGI+FA I   I   WF D QL  +I+ +M++ +
Sbjct  361  RALATRDLDIYNAGRIIRREAGVGILNGIVFATIMGAIAGTWFHDYQLGGVIAAAMVINL  420

Query  901  iiARLFGILI  930
            + A L GIL+
Sbjct  421  MAAALAGILL  430


>ref|YP_002281377.1| magnesium transporter [Rhizobium leguminosarum bv. trifolii WSM2304]
 gb|ACI55151.1| magnesium transporter [Rhizobium leguminosarum bv. trifolii WSM2304]
Length=471

 Score =  277 bits (708),  Expect = 1e-72
 Identities = 157/310 (50%), Positives = 217/310 (70%), Gaps = 0/310 (0%)
 Frame = +1

Query  1    IMVLENVDEKDKNTILSALPPKDRFALLEGLSYPEDSAARIMQREFTAIPSNWSVGQTID  180
            + +LE++D++D+  IL+ LP  +R  L   L YPE SA R MQ EF A+P  W+VGQTID
Sbjct  121  VYILEDLDKEDREEILAQLPFTERVRLRRALDYPESSAGRRMQTEFVAVPPFWTVGQTID  180

Query  181  YLRENKDLPEEFLEIFIVNENFKPIGSVPSSKVLRTPRETKMSSIMVDTLFLVPVDMDRE  360
            Y+R+ +DLP  F +IF+++  FK +G+V   ++LRT R+TK+  IM +T   VP +MD+E
Sbjct  181  YMRDEEDLPYSFSQIFVIDPTFKLLGAVDLDQILRTKRQTKIEQIMRETNHPVPAEMDQE  240

Query  361  EVGNLFENYNLSSACVVDKSEKLVGMITYDDILTVLKEEAEEDALRLAGVGDEEITDGVI  540
            E   LFE Y+L SA VVD++ +LVG++T DD++ V+ EEA+ED  RL GVGDEE++D V+
Sbjct  241  EAAQLFEQYDLLSAAVVDENGRLVGVLTIDDVVDVIHEEADEDIKRLGGVGDEELSDNVL  300

Query  541  TKTKRRFnwlllnlftaflatwCISLFGATIEQMVVLAFLMPIVASMGGNAGMQTLAVTV  720
            +  + RF WLL+NL TA L+   I LF A+IE+M+ LA LMPIVASMGGNAG QT+ VTV
Sbjct  301  STARSRFLWLLINLGTAMLSASVIGLFDASIEKMIALAVLMPIVASMGGNAGTQTMTVTV  360

Query  721  RSLATNDLTKNNFTQNILKEFNIGVLNGIIFAVISSIIVQLWFQDNQlsliisismiltm  900
            R+LAT DL   N  + I +E  +G+LNGIIFA I   I   WF   QL  +I+ +MI+ +
Sbjct  361  RALATRDLDIYNAGRIIRREAGVGILNGIIFATIMGAIAGAWFHSYQLGGVIAAAMIINL  420

Query  901  iiARLFGILI  930
            + A L GIL+
Sbjct  421  MAAALAGILL  430