GOS 1420010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1092963660387
Annotathon code: GOS_1420010
Sample :
  • GPS :17°28'33s; 149°48'44w
  • Polynesia Archipelagos: Moorea, Cooks Bay - Fr. Polynesia
  • Coral Reef (-1.4m, 28.9°C, 0.1-0.8 microns)
Authors
Team : Algarve
Username : 768990bio1
Annotated on : 2010-07-30 14:30:16
  • a37076 AnaSofiaCarraçoCosta
  • a37089 LilianaSofiaGriloSantos
  • a37090 ManuelAlexanderGuerreiroVieira

Synopsis

  • Taxonomy: Candidatus Pelagibacter (NCBI info)
    Rank: genus - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 198251
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Alphaproteobacteria - Order: Rickettsiales
    Bacteria; Proteobacteria; Alphaproteobacteria; Rickettsiales; SAR11 cluster; Candidatus Pelagibacter;

Genomic Sequence

>JCVI_READ_1092963660387 GOS_1420010 Genomic DNA
GCTTGATATATGTTTTGTTTTCAATTAATTTTTCTGTACCTCTATGCAGTAATCCAATATGTGGATCTGCTTTTTCAACTATTTCCCCATCTAATTCTAA
TATAAGTCTTAAAACGCCATGCGCAGCGGGATGTTGAGGTCCAAAATTTAAATTTAGTTTTTTAATTTCTTTTGACATTATTATTTTTATTTTTTTGAAA
TTTCTTTAATATATTTTGTTCCTTCCCATGGGCTTTCATAATCAAAATTTCTATAATTTTGTTCTAGCTTAACAGGCTCATAAATTACTTTTTTATCATC
CTCGCTATATCTAACTTCGTTGTGTCCTGTTAATGGAAAGTCTTTTCTTAAAGGATGTCCATCAAATCCGTAGTCTGTTAAAATTCTTCTTAAGTCTGGA
TGATTTTTAAAATTAATTCCATACATATCAAAAACTTCTCTTTCCATCCAATTTGCCGATGGAAAAATTGAAGTTATTGATGTTACAGGATTATTTTCTT
TAATAAAAAAATCAACTTTAATTCTTTTATTATTTTCATGGCTTAAAAATAAATAAACTAATTTAAATCTCATTTCTTTTTCTGGATAGTCAACCGCAGT
AATATCTATTAATTGCTTAAATTTTGTTTCACTATTTGTTTTTAAAAAAATAATTACATCTAATAAATCTTCCTCATCTATATTTAGATAAATATGATTA
TGATTGATACTAGAACTATTAATTTTAGTTGTAAGTTCAGAATTAATTTTTTTTTCCAGAATTTCTAAATTTTTCATTAACCTTTATCTCTCCAAAGATC
CTTTTTTTCTTATCTTCTTTTGTAATTGCATTATTCCGTATAAAAGAGCTTCAGCAGAGGGTGGGCAACCTGGAACATATATATCAA

Translation

[111 - 698/887]   indirect strand
>GOS_1420010 Translation [111-698   indirect strand]
MKNLEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDITAVDYPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTS
ITSIFPSANWMEREVFDMYGINFKNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDYESPWEGTKYIKEISKK

Annotator commentaries

The sequence analysed has codon START and STOP, and is a coding sequence with known biological significance.

Analysing the Protein Domain that shows a NADH:ubiquinone oxidoreductase and related regions, and the BLAST results with great homologous of NADH dehydrogenase subunit C with three E-values under e-79 and more than 50 values under e-49 , we concluded that the function is in the electron transport chain in cellular respiration, a metabolic process. And can see that the molecular function is catalytic activity, or more specific a NADH dehydrogenase activity (GO:0003954).

Through the tree and multiple alignement analysis the GOS_1420010 sequence is from the SAR11 cluster group, between the alpha proteobacterium HIMB114 and the two known species of Candidatus Pelagibacter. Looking to the existent taxonomy information this organism must be a Candidatus Pelagibacter or a closest unclassified organism.






ORF finding

PROTOCOL


a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code



RESULTS ANALYSIS


The sequence have one forward strand and two reverse strand.

The ORF that we choose have codon START and STOP and it is the ORF number 1 in reading frame 3 on the reverse strand. This ORF is the biggest and is overlapped with the other ORF reverse chain. The sequence is coding.

The ORF chosen has biological significance, because as we could see trough the Blast the e_values are good.

The ORF number 1 in reading frame 2 on the direct strand doesn´t has biological significance.



RAW RESULTS

a)forward strand

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the direct strand extends from base 704 to base 886.
TTGATACTAGAACTATTAATTTTAGTTGTAAGTTCAGAATTAATTTTTTTTTCCAGAATT
TCTAAATTTTTCATTAACCTTTATCTCTCCAAAGATCCTTTTTTTCTTATCTTCTTTTGT
AATTGCATTATTCCGTATAAAAGAGCTTCAGCAGAGGGTGGGCAACCTGGAACATATATA
TCA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
LILELLILVVSSELIFFSRISKFFINLYLSKDPFFLIFFCNCIIPYKRASAEGGQPGTYI
S

No ORFs were found in reading frame 3.

b) reverse strand

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 683 to base 886.
AGAAATTTCAAAAAAATAAAAATAATAATGTCAAAAGAAATTAAAAAACTAAATTTAAAT
TTTGGACCTCAACATCCCGCTGCGCATGGCGTTTTAAGACTTATATTAGAATTAGATGGG
GAAATAGTTGAAAAAGCAGATCCACATATTGGATTACTGCATAGAGGTACAGAAAAATTA
ATTGAAAACAAAACATATATCAAG

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
RNFKKIKIIMSKEIKKLNLNFGPQHPAAHGVLRLILELDGEIVEKADPHIGLLHRGTEKL
IENKTYIK

>ORF number 1 in reading frame 3 on the reverse strand extends from base 111 to base 701.
ATGAAAAATTTAGAAATTCTGGAAAAAAAAATTAATTCTGAACTTACAACTAAAATTAAT
AGTTCTAGTATCAATCATAATCATATTTATCTAAATATAGATGAGGAAGATTTATTAGAT
GTAATTATTTTTTTAAAAACAAATAGTGAAACAAAATTTAAGCAATTAATAGATATTACT
GCGGTTGACTATCCAGAAAAAGAAATGAGATTTAAATTAGTTTATTTATTTTTAAGCCAT
GAAAATAATAAAAGAATTAAAGTTGATTTTTTTATTAAAGAAAATAATCCTGTAACATCA
ATAACTTCAATTTTTCCATCGGCAAATTGGATGGAAAGAGAAGTTTTTGATATGTATGGA
ATTAATTTTAAAAATCATCCAGACTTAAGAAGAATTTTAACAGACTACGGATTTGATGGA
CATCCTTTAAGAAAAGACTTTCCATTAACAGGACACAACGAAGTTAGATATAGCGAGGAT
GATAAAAAAGTAATTTATGAGCCTGTTAAGCTAGAACAAAATTATAGAAATTTTGATTAT
GAAAGCCCATGGGAAGGAACAAAATATATTAAAGAAATTTCAAAAAAATAA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
MKNLEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDIT
AVDYPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYG
INFKNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDY
ESPWEGTKYIKEISKK*

Multiple Alignement

PROTOCOL

a)ClustalIW2 sequence alignment / default parameters;


RESULTS ANALYSIS


Analysing the results of multiple alignement, we see that the sequence has codon START and STOP codon. The GOS sequence begins with a methionine.

The sequences aligned have good similarity (mainly between the sequences of in-group). The region corresponding the domain found is where are more identity.


RAW RESULTS

a)

CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


b.pr.out        ----MSDLNKL-ISNLKSTFPQAVVNKQ---FDEATLSIYGNEIIKTLKKLKTGSQFKFL
M.mo.out        ---MSAKLDQL-LASLQTVLGEKITKQTVA-LDEVTIECRAEDYLAVCELLRDDTALKFE
S.l.out         ---MATDLNIL-SANLNEAFSVKVVSLEER-LGELTLVIKAHDMLAVFTRLRDDADLRFE
T.i.out         ---MTSKLEQL-DTALRAALGERIVALQAS-VGELTLDVAPAHYRDVCLALRDDAELHFE
D.ar.out        ---MSAKLETL-SQNLQEHFGDKLKSLKLA-LGEITIEVAAADYFCVMTALRDEAAFGFE
N.s.in          ---MTIDTTEV-DALINA-------------PGRCVVNSSLESLVELISHL---SSCGFE
A.ph.in         ---MSLDIEPVASSHIQELLQTDIVLRQ---DGVLQCYLEAQSIRDNLITLRDDPKTKLR
A.ma.in         ---MQQSVEHV-TKHVGKILKREVAVRS---DGVLECRLEAGDLLKCITTLRDDEKSKFK
A.ce.in         ---MQQSVKHV-TERVGKILKREVAVRD---DGVLECRLEAGDLLKCITTLRDDEKSKFR
W.e.in          -------MDKT-AKYIQKKTKCEFIQQG---DGTIVIYSTLDNIEDHLLFLRDDEKCRFE
W.e2.in         -------MDKT-AKYIQKKTKCECIQKD---DGIIVIYSTLDEIEKYLFFLRDDKKCRFE
W.e3.in         -------MDKT-AKYIQKKTKCECIQKD---DGIIVIYSTLDEIEKHLFFLRDDEKCRFE
E.r.in          MSDIDNTLEEI-MTHINTCLNVKCIAQD---STTLEFYSTPQDIHNHILFLCNDRICKFQ
E.ch.in         MSDSNNAIDNI-STYINTSINVECVIKD---NITLELHSDVQNIYNHISFLRTDTKCKFH
E.cai.in        MSDNNNAIDNI-IAHINTSINVKCTIKD---SINLELNSNVNDIYSHILFLRNDTKCKFH
O.t.in          --MKLHHLKEL-KELVESQFAISSISAKFNITNHVEAIINKEQLIEVLKLLKNDKELKFT
O.t2.in         --MKLHHLKEL-KELVESQFAISSISAKFNITNHVEAIIHKEQLIEVLKLLKNDKELKFT
R.b.in          -----MTLEKI-IEKLAAKSSILISPITV--KENLAYKVEPNFLLPFLKALKESEELRFT
R.ak.in         -----MTLDKF-IEKLADKSSILITPVMV--KDYLAYKVELNFLLPFLKALKESAELRFT
R.caa.in        -----MTLDKL-IEELAAKYSILITHITV--QGYLAYNVEPHFLLLFLKALKKSEELRFT
R.e.in          -----MTLDKL-IEKLVAKSSILITPVTV--KNYLAYKIAPNFLLPFLKALKESEELRFT
R.f.in          -----MTLDKL-IEKLAAKSSILITPIIV--KDYLAYQVEPNFLLPFLKALKESEELRFT
a.pr.in         ----MKSLDEM-KTIIEGSPNFRFAKIEFQ-NDNLVCHCNADQLIDNVVQLKRHSDLKFR
GOS_142001      ----MKNLEIL-EKKINSELTTKINSSSIN-HNHIYLNIDEEDLLDVIIFLKTNSETKFK
C.P.sp._in      ----MINLEDL-EKKINSELTTKINSTEIK-HNQLYIETDKDDLIDVTLFIKTNQDTKFR
C.P.ubique      ----MQNLIDL-EKKINSELTTKIKKTEIR-HEQLYINIDNEDLIDVTLFIKSNENTKFR
                               :                                  :       : 

b.pr.out        QLIDIAAVDYSQYPQKLFDNN-----------RYAVVYHLLSIKNNQRLRVRAFVE-DNN
M.mo.out        QLIDLCGVDYQEYGEGSYDGL-----------RYAVVCHFLSVSLNQRLRLRVFAK-DED
S.l.out         ELVDVCGIDYSTYGSELCEDGKYLPDEPRAGPRFAAVYHLLSITHNIRLRVRVFAD-DDD
T.i.out         QLIDLCGVDYAQYGNAVRDEAG----------RFMVVLHLLSLKHNRRLRVRVRCA-DDD
D.ar.out        EMIDLCGVDYSTYGDGTWQGA-----------RFAVVVHLLSVANNWRLRVRVFAE-DEG
N.s.in          QLTDIFGIDYLEREK-----------------RIEVVYLLLDLKRNRRCCVKVSVDPASE
A.ph.in         VLTDIFAVDYHNKKS-----------------RFEVVYMLLSLVYNIRVCCKVALT-EGS
A.ma.in         ILTDIFAVDYQAREA-----------------RFDVVYMLLSVAFNARICCKVPLV-EGH
A.ce.in         ILTDIFAVDYQAREA-----------------RFDVVYMLLSVAFNARICCKVPLV-EGH
W.e.in          LLVDIFGVDYPDREK-----------------RFELIYNLLSIVHNIRVHIKLQLY-EDD
W.e2.in         LLVDIFGVDYPNREK-----------------RFELIYNLLSIVHNIRVHIKLQLC-ESD
W.e3.in         LLVDIFGVDYPNREK-----------------RFELIYNLLSIVHNIRVHIKLQLC-ESD
E.r.in          ILIDIFIVDYPHREA-----------------RFEIIYSLLSIANNIRIFCKVSLH-ENE
E.ch.in         ILVDIFAIDYPTRLA-----------------RFEVIYSLLSIINNIRVSCKVPLQ-ENE
E.cai.in        ILIDIFAIDYPSRPA-----------------RFEVVYSLLSIINNIRIFCKVPLQ-ENE
O.t.in          ILTDVFAADFPDRNK-----------------RFEIVYNLLSIIKNIRLIVKINLN-DNE
O.t2.in         ILTDIFAADFPDRNK-----------------RFEIVYNLLSIIKNIRLIVKINLN-DNE
R.b.in          VLTDLFGSDFPEKAK-----------------RFEVVYNLLSLKLNKRLIIKTYVS-EHE
R.ak.in         VLTDLFGADFPKRDK-----------------RFEVVYNLLSLKLNKRLIIKVYIS-EEE
R.caa.in        VLTDLFGADFPERDK-----------------RFEVVYNLLSLKLNKRLIIKVQIS-EKE
R.e.in          VLTDLFGSDFPERDK-----------------RFEVVYNLLSLKLNKRLIIKVDIS-EKE
R.f.in          VLTDLFGTDFPERDK-----------------RFEVIYNLLSLKLNKRLIIKVYIS-EKE
a.pr.in         QLVDILAVDYPNREK-----------------RFEIIYLFLSHENNLRISIKIDLE-DQQ
GOS_142001      QLIDITAVDYPEKEM-----------------RFKLVYLFLSHENNKRIKVDFFIK-ENN
C.P.sp._in      QLIDITVVDYPENTQ-----------------RFKMVYLFLSHEYNQRIILSYSIN-ENE
C.P.ubique      QLIDITVVDYPENAQ-----------------RFKVVYLFLSHEFNQRIILSYLIS-ENE
                 : *:   *:                      *   :  :*.   * *            

b.pr.out        FPVIETATTVYANADWYEREAFDLFGVMFLNHPDLRRILTDYGFIGHPFRKDFPMIGNVE
M.mo.out        FPILSTLVGLWPVANWFEREAFDLYGILFENHPDLRRLLTDYGFVGHPFRKDFPMIGNVE
S.l.out         MPVLNSVTGIWPSANWYEREAFDLYGIIFVGHPDLRRILTDYGFVGNPFRKDFPLSGTVE
T.i.out         LPLVASINDIWNSANWFEREAFDLYGIIFEGHPDLRRILTDYGFIGHPFRKDFPLSGTVE
D.ar.out        FPSVASITTVWASANWFEREAFDLYGIAFVGHDDLRRILTDYGFIGHPFRKDFPISGHVE
N.s.in          --KVPTCCGVFSVANWFEREVYDMYGVVFEGHPDLRRILTDYEFEGFPMLKDFPLTGYKE
A.ph.in         --IIPSVTSVFGSAGWFEREVYDMYGIEFSDHPDLRRILTDYGFRGHPMLKDFPLTGYEE
A.ma.in         --NVPSVTSVFGSAGWFEREVFDMYGIVFDGHPDLRRILTDYGFTGHPMLKDFPLTGYDE
A.ce.in         --NVPSVTSVFGAAGWFEREVFDMYGIVFDGHPDLRRILTDYGFTGHPMLKDFPLTGYDE
W.e.in          --MPPSVVRIFNTASWFEREVFDMYGIEFSNHPDLRRILTDYGFKGHPMLKDFPLTGYEE
W.e2.in         --MPPSVAKIFSTALWFEREVFDMYGIEFSDHPDLRRILTDYGFKGHPMLKDFPLTGYEE
W.e3.in         --MPPSVAKIFSTALWFEREVFDMYGIEFSDHPDLRRILTDYGFKGHPMLKDFPLTGYEE
E.r.in          --NITSITNIFNAAGWFEREAFDMYGILFTNNPDLRRILTDYGFSGHPMLKDFPLSGYKE
E.ch.in         --SIPSITNIFSAAGWFEREVFDMYGIIFANNPDLRRILTDYGFSGHPMLKDFPLTGYKE
E.cai.in        --SIPSITNLFSAAGWFEREVFDMYGIIFANNPDLRRILTDYGFSGHPMLKDFPLTGYKE
O.t.in          --LIQSATPVFSNANWYEREIYDLFGIKFANHPHLKRILTDYGFVGHPLRKDFALSGYSQ
O.t2.in         --LIQSATPVFSNANWYEREIYDLFGIKFANHPHLKRILTDYGFVGHPLRKDFALSGYSQ
R.b.in          --SIPSAMSIFNAACWYEREVYDMFGINFDGNDDKRRILTDYEFEGHPLRKDFPLTGYTQ
R.ak.in         --TIPSAMNIFSTACWYEREVYDMYGVNFDGNDDKRRILTDYEFDGHPLRKDFPLTGYTQ
R.caa.in        --SIPSAMNIFNAACWYEREVYDMFGVNFEGNDDKRRILTDYEFEGHPLRKDFPLTGYTQ
R.e.in          --TIPSAMNIFSAACWYEREVYDMYGINFDGNDDKRRILTDYEFEGHPLRKDFPLTGYTQ
R.f.in          --TIPSAMNIFNASCWYEREVYDMYGVNFDGNDDKRRILTDYEFEGHPLRKDFPLTGYTQ
a.pr.in         --KIQTLTNVFPSANWLEREVFDMNGIEFSDHPDLRRILTDYNFEGFPLRKDFPLTGYKE
GOS_142001      --PVTSITSIFPSANWMEREVFDMYGINFKNHPDLRRILTDYGFDGHPLRKDFPLTGHNE
C.P.sp._in      --IIPSLTSIFPASNWMEREVFDMYGVSFKDHPDLRRILTDYGFEGHPLRKDFPLTGHTE
C.P.ubique      --VIPSLTPIYPAANWMEREVFDMYGVKFKDHPDMRRILTDYGFEGHPLRKDFPLTGHTE
                     :   ::  : * *** :*: *: * .:   .*:**** * * *: ***.: *  :

b.pr.out        MRYDPEQKRVIYQPVTIE----------SRNNVPRVIDEEGFRNG----------
M.mo.out        MRYDPEQQRVIYQPVSIE----------LRNNVPRVIRNEGAHNG----------
S.l.out         MRYDAAQQRVIYEPVTVE----------PRQITPRTMREENYGRE----------
T.i.out         MRYDPDSKRVIYQPVTIE----------PREITPRVIRETGYGGLGGVSRAGLGR
D.ar.out        MRYDPDQARVIYQPVTIE----------PRENTPRIVREDTFGDTAHG-------
N.s.in          VRYDLESKEVVYEKVDLSQDYRSFDSLTPWKGVGRPSDPFDGRKE----------
A.ph.in         IRYDFRKGKVAYQPVDLQQNFRLFNSMSPWKGYK---------------------
A.ma.in         VRYDLQKKQVVYQPVNLQQDFRNFDAISPWKGER---------------------
A.ce.in         VRYDLQKKQVVYQPVNLQQDFRNFDAISPWKGER---------------------
W.e.in          VRYDIEAKKVVYNPIDLPQDFRMFDSLSPWEGETAKANTKE--------------
W.e2.in         VRYDIETKKVVYNPIDLPQDFRMFDSLSPWEGKTIKVNTKE--------------
W.e3.in         VRYDIETKKVVYNPIDLPQDFRMFDSLSPWEGKTIKVNTKE--------------
E.r.in          VRYDIAKKEVIYEPVNLQQDFRSFDFLSPWKEHKP--------------------
E.ch.in         VRYDISKKEVAYENVNLQQDFRSFDFLSPWKELKNE-------------------
E.cai.in        VRYDILKKEVTYEAVNLQQDFRSFDFLSPWKEVSNE-------------------
O.t.in          VKYDDKLEKVVYEPVKLDQEYRNFNFSSPWQGPKSTTN-----------------
O.t2.in         VKYDDKLEKVVYEPVKLDQEYRNFNFSSPWQGPKSTIQD----------------
R.b.in          VKYDEQTKKVAYEPVNLDIEYREFDFSSPWHSPTYTLPGDEKAK-----------
R.ak.in         VKYDEQLKQVAYEPVNCDIEYREFDFSSHWHSQTYVLPGDEKAAYVIPKKTEAQK
R.caa.in        VKYDKKLKKVAYEPVDLDIEYRKFDFSSQWHSPTYILPGDEKAK-----------
R.e.in          VKYDEKLKKVAYEPVDLDIEYREFDFSSHWHSPTYILPGDEKAGK----------
R.f.in          VKYDEKLKKVAYEPVDLDIEYREFDFSSHWHSPSYVLPGDEKATDVIPAKAGIQK
a.pr.in         VRYDPETKKVVYGPVKLQQAYRDFDFKSPWQGPDYIKKQQEKSGE----------
GOS_142001      VRYSEDDKKVIYEPVKLEQNYRNFDYESPWEGTKYIKEISKK-------------
C.P.sp._in      VRYSEDQKKVINEPVKLEQNYRNFDYESPWEGTKYIKEELDSNDKKN--------
C.P.ubique      VRYSEDQKKVISEPVKLEQNYRNFDYESPWEGTKYIKDQTDLENDKKN-------
                :.*.     *    :              .                    

Protein Domains

PROTOCOL


a) InterProScan; default parameters at EBI



RESULTS ANALYSIS


Through this program we obtain seven results. The NADH (or F420H2) dehydrogenase, subunit C (IPR010218) is the father of NADH:ubiquinone oxidoreductase, 30kDa subunit (IPR001268). The father has an e_value 5e-57 [29-151] and its biological process is oxidation reduction. The children has the same biological process that father and its molecular function is NADH dehydrogenase (ubiquinone) activity.

The domain IPR001268 has two results for the e_value: Q4FM89_PELUB_Q4FM89 (1e-17 [83-138]) and Complex1_30kDa (2.9e-36 [44-145]).

RAW RESULTS

a)InterProScan
GOS_1420010     C960B2BA0FB12409	198	BlastProDom	PD001581	Q4FM89_PELUB_Q4FM89;	85	140	1e-17	T	16-Mar-2010	IPR001268	NADH:ubiquinone oxidoreductase, 30kDa subunit	Molecular Function: NADH dehydrogenase (ubiquinone) activity (GO:0008137), Biological Process: oxidation reduction (GO:0055114)
GOS_1420010	C960B2BA0FB12409	198	PatternScan	PS00542	COMPLEX1_30K	114	135	NA	T	16-Mar-2010	IPR020396	NADH:ubiquinone oxidoreductase, 30kDa subunit, conserved site	
GOS_1420010	C960B2BA0FB12409	198	HMMPfam	PF00329	Complex1_30kDa	46	147	3e-36	T	16-Mar-2010	IPR001268	NADH:ubiquinone oxidoreductase, 30kDa subunit	Molecular Function: NADH dehydrogenase (ubiquinone) activity (GO:0008137), Biological Process: oxidation reduction (GO:0055114)
GOS_1420010	C960B2BA0FB12409	198	HMMPanther	PTHR10884:SF5	NADH-UBIQUINONE OXIDOREDUCTASE MITOCHONDRIAL PRECURSOR	6	187	9.4e-81	T	16-Mar-2010	NULL	NULL	
GOS_1420010	C960B2BA0FB12409	198	HMMPanther	PTHR10884	NADH-UBIQUINONE OXIDOREDUCTASE-RELATED	6	187	9.4e-81	T	16-Mar-2010	NULL	NULL	
GOS_1420010	C960B2BA0FB12409	198	HAMAP	MF_01357	NDHJ_MF_01357	17	161	29.296	T	16-Mar-2010	NULL	NULL	
GOS_1420010	C960B2BA0FB12409	198	HMMTigr	TIGR01961	NuoC_fam: NADH (or F420H2) dehydrogenase, s	31	153	5e-57	T	16-Mar-2010	IPR010218	NADH (or F420H2) dehydrogenase, subunit C	Molecular Function: oxidoreductase activity, acting on NADH or NADPH (GO:0016651), Biological Process: oxidation reduction (GO:0055114)

Phylogeny

PROTOCOL

a) Phylogeny.fr / BioNJ method /1000 bootstrap / out group: Methylotenera mobilis (b-proteobacteria), Thiomonas intermedia (b-proteobacteria), Dechloromonas aromatica (b-proteobacteria), Sideroxydans lithotrophicus (b-proteobacteria), beta proteobacterium


b) Phylogeny.fr / PhyML method /100 bootstrap / default substitution model / out group: Methylotenera mobilis (b-proteobacteria), Thiomonas intermedia (b-proteobacteria), Dechloromonas aromatica (b-proteobacteria), Sideroxydans lithotrophicus (b-proteobacteria), beta proteobacterium



RESULTS ANALYSIS

In both trees, ingroups are separated from the outgroups. The trees obtained are in agreement.

The GOS_142001 is integrated in SAR11 cluster group (the group of alpha_proteobacterium_in and the Candidatus_Pelagibacter).


In the tree a) we have reported values below 0.7:


node 1 - 0.56

node 2 - 0.41

node 3 - 0.45

node 4 - 0.53

node 5 - 0.53

node 6 - 0.39

node 7 - 0.44

node 8 - 0.24

node 9 - 0.5


In the tree b) we have reported values below 0.7:


node 1 - 0.14

node 2 - 0.56

node 3 - 0.65

node 4 - 0.54

node 5 - 0.61

node 6 - 0.69

RAW RESULTS

a)BioNJ
                                                                                                                  ----0.05---
 
                    +------------------------------------alpha_proteobacterium_in                                         (a-proteobacteria)
                    |
      +-------------+                           +-------------------GOS_1420010                                           (a-proteobacteria)
      |             |                           |
      |             +---------------------------+                     +--------Candidatus_Pelagibacter_sp._in             (a-proteobacteria)
      |                                         +---------------------+
      |                                                               +---------Candidatus_Pelagibacter_ubique_in         (a-proteobacteria)
      |
      |                                                                               +--Orientia_tsutsugamushi_in        (a-proteobacteria)
      |                                                                               |
      |                               +-----------------------------------------------+
 +----+                               |                                               +Orientia_tsutsugamushi2_in         (a-proteobacteria)
 |    |      +------------------------+
 |    |      |                        |                                          +--------Rickettsia_akari_in             (a-proteobacteria)
 |    |      |                        |                                          |
 |    |      |                        +------------------------------------------+ +----7----Rickettsia_bellii_in         (a-proteobacteria)
 |    |      |                                                                   | |
 |    |      |                                                                   +-++---Rickettsia_endosymbiont_in        (a-proteobacteria)
 |    |      |                                                                     ||
 |    |      |                                                                    8++  +-----Rickettsia_canadensis_in     (a-proteobacteria)
 |    +--1---+                                                                     9+--+
 |           |                                                                         +-------Rickettsia_felis_in        (a-proteobacteria)
 |           |
 |           |  +-------------------------------------------------------------------Neorickettsia_sennetsu_in             (a-proteobacteria)
 |           |  |
 |           |  |                                             +------Wolbachia_endosymbiont_in                            (a-proteobacteria)
 |           |  |                                             |
 |           |  |    +----------------------------------------+
 |          2+--+    |                                        |      +Wolbachia_endosymbiont2_in                          (a-proteobacteria)
 |              |    |                                        +------+
 |              |    |                                               +Wolbachia_endosymbiont3_in                          (a-proteobacteria)
 |              |    |
 |              +-3--+               +----------------------------Anaplasma_phagocytophilum_in                            (a-proteobacteria)
 |                   |   +-----------+
 |                   |   |           |                    +--Anaplasma_marginale_in                                       (a-proteobacteria)
 |                   |   |           +--------------------+
 |                   |   |                                +-Anaplasma_centrale_in                                         (a-proteobacteria)
 |                   +-4-+
 |                       |                     +---------------------Ehrlichia_ruminantium_in                             (a-proteobacteria)
 |                       |                     |
 |                       +---------------------+       +--------Ehrlichia_chaffeensis_in                                  (a-proteobacteria)
 |                                             +-------+
 |                                                     +--------Ehrlichia_canis_in                                        (a-proteobacteria)
 |
 |
 |                                               +-----------------------------beta_proteobacterium_out                   (b-proteobacteria)
 |                                    +----5-----+
 |                                    |          +---------------------------------------------Methylotenera_mobilis_out  (b-proteobacteria)
 +------------------------------------+
                                      |     +-------------------------------Sideroxydans_lithotrophicus_out               (b-proteobacteria)
                                      +--6--+
                                            |         +---------------------Thiomonas_intermedia_out                      (b-proteobacteria)
                                            +---------+
                                                      +-----------------------------Dechloromonas_aromatica_out           (b-proteobacteria)

-------------------------------------------------------------------------------------------------------------------

b) PhyML

                                                                                                   -------0.1------
 
                                                       +--------------------------------beta_proteobacterium_out          (b-proteobacteria)
                                           +-----------+
                                           |           +-----------------------------Methylotenera_mobilis_out            (b-proteobacteria)
 +-----------------------------------------+
 |                                         |   +-------------------------------Sideroxydans_lithotrophicus_out            (b-proteobacteria)
 |                                         |   |
 |                                         +-1-+        +---------------Thiomonas_intermedia_out                          (b-proteobacteria)
 |                                             +---2----+
 |                                                      +---------------------------Dechloromonas_aromatica_out           (b-proteobacteria)
 |
 |
 |                                                                                        +-Orientia_tsutsugamushi_in     (a-proteobacteria)
 |                                                +---------------------------------------+
 |                                                |                                       +Orientia_tsutsugamushi2_in     (a-proteobacteria)
 |                                                |
 |             +----------------------------------+                                  +Rickettsia_endosymbiont_in          (a-proteobacteria)
 |             |                                  |                                 ++
 |             |                                  |                                 |+---------Rickettsia_bellii_in       (a-proteobacteria)
 |             |                                  |                                 |
 |             |                                  +---------------------------------+  +----Rickettsia_canadensis_in      (a-proteobacteria)
 |             |                                                                    |+-+
 |             |                                                                    || +----Rickettsia_felis_in           (a-proteobacteria)
 |       +--3--+                                                                    ++
 |       |     |                                                                     +------Rickettsia_akari_in           (a-proteobacteria)
 |       |     |
 |       |     |        +-------------------------------------------------------------Neorickettsia_sennetsu_in           (a-proteobacteria)
 |       |     |        |
 |       |     |        |
 |       |     |        |                                         +----Wolbachia_endosymbiont_in                          (a-proteobacteria)
 |       |     |        |     +-----------------------------------+
 |       |     +---4----+     |                                   |   +Wolbachia_endosymbiont2_in                         (a-proteobacteria)
 |       |              |     |                                   +---+
 |       |              |     |                                       +Wolbachia_endosymbiont3_in                         (a-proteobacteria)
 |       |              |     |
 |       |              +--5--+                             +-----------------------Anaplasma_phagocytophilum_in          (a-proteobacteria)
 +-------+                    |                             |
         |                    |           +-----------------+                 +--Anaplasma_marginale_in                   (a-proteobacteria)
         |                    |           |                 +-----------------+
         |                    |           |                                   +--Anaplasma_centrale_in                    (a-proteobacteria)
         |                    +-----6-----+
         |                                |                  +----------------Ehrlichia_ruminantium_in                    (a-proteobacteria)
         |                                |                  |
         |                                +------------------+      +--------Ehrlichia_chaffeensis_in                     (a-proteobacteria)
         |                                                   +------+
         |                                                          |
         |                                                          +-----Ehrlichia_canis_in                              (a-proteobacteria)
         |
         |                     +----------------------------alpha_proteobacterium_in                                      (a-proteobacteria)
         +---------------------+
                               |                         +---------------GOS_1420010                                      (a-proteobacteria)
                               +-------------------------+
                                                         |                   +--Candidatus_Pelagibacter_sp._in            (a-proteobacteria)
                                                         +-------------------+
                                                                             +---------Candidatus_Pelagibacter_ubique_in  (a-proteobacteria)

Taxonomy report

PROTOCOL


a) Blastp vs NR, NCBI defaut parameters * "1000 Max target sequences"

b) Blastp vs SWISSPROT, NCBI defaut parameters * "1000 Max target sequences"



RESULTS ANALYSIS

The hits to each taxon was very low (1 or 2 hits).

The choice of in and outgroups was through the results of the lineage report and considering the E-values on BLASTp results. For in groups we chosen the a-proteobcteria class. The out groups has b-proteobacteria class, being the closest of in groups.


In group: proteobacteria

ZP_05068709 Candidatus Pelagibacter sp. in 2e-82 Candidatus Pelagibacter sp. HTCC7211 (a-proteobacteria)

YP_266303 Candidatus Pelagibacter ubique in 4e-80 Candidatus Pelagibacter ubique HTCC1062 (a-proteobacteria)

ZP_06055092 alpha proteobacterium in 5e-55 alpha proteobacterium HIMB114 (a-proteobacteria)

YP_153752 Anaplasma marginale in 5e-46 Anaplasma marginale str. St. Maries (a-proteobacteria)

YP_003328692 Anaplasma centrale in 1e-45 Anaplasma centrale str. Israel (a-proteobacteria)

ZP_00544994 Ehrlichia chaffeensis in 2e-44 Ehrlichia chaffeensis str. Sapulpa (a-proteobacteria)

ZP_00544994 Ehrlichia ruminantium in 2e-44 Ehrlichia ruminantium str. Welgevonden (a-proteobacteria)

YP_001248971 Orientia tsutsugamushi in 2e-43 Orientia tsutsugamushi str. Boryong (a-proteobacteria)

YP_001937605 Orientia tsutsugamushi2 in 2e-43 Orientia tsutsugamushi str. Ikeda (a-proteobacteria)

YP_302932 Ehrlichia canis in 2e-43 Ehrlichia canis str. Jake (a-proteobacteria)

YP_198074 Wolbachia endosymbiont in 4e-43 Wolbachia endosymbiont strain TRS of Brugia malayi (a-proteobacteria)

ZP_01314776 Wolbachia endosymbiont2 in 6e-42 Wolbachia endosymbiont of Drosophila willistoni(a-proteobacteria)

ZP_00373214 Wolbachia endosymbiont3 in 1e-41 Wolbachia endosymbiont of Drosophila ananassae (a-proteobacteria)

YP_505116 Anaplasma phagocytophilum in 1e-41 Anaplasma phagocytophilum HZ (a-proteobacteria)

YP_001496515 Rickettsia bellii in 3e-39 Rickettsia bellii OSU 85-389 (a-proteobacteria)

YP_001493336 Rickettsia akari in 4e-37 Rickettsia akari str. Hartford (a-proteobacteria)

YP_506318 Neorickettsia sennetsu in 6e-37 Neorickettsia sennetsu str. Miyayama (a-proteobacteria)

ZP_04699245 Rickettsia endosymbiont in 8e-37 Rickettsia endosymbiont of Ixodes scapularis (a-proteobacteria)

YP_246581 Rickettsia felis in 1e-36 Rickettsia felis URRWXCal2 (a-proteobacteria)

YP_001492452 Rickettsia canadensis in 7e-35 Rickettsia canadensis str. McKiel (a-proteobacteria)



Outgroup: proteobacteria

YP_003049035 Methylotenera mobilis out 9e-36 Methylotenera mobilis JLW8 (b-proteobacteria)

ZP_05498443 Thiomonas intermedia out 3e-35 Thiomonas intermedia K12 (b-proteobacteria)

YP_284177 Dechloromonas aromatica out 7e-35 Dechloromonas aromatica RCB (b-proteobacteria)

YP_003523697 Sideroxydans lithotrophicus out 2e-34 Sideroxydans lithotrophicus ES-1 (b-proteobacteria)

ZP_05081650 beta proteobacterium out 1e-34 beta proteobacterium KB13 (b-proteobacteria)


RAW RESULTS

a) Blastp vs NR
Lineage Report

root
. cellular organisms
. . Bacteria                [bacteria]
. . . Proteobacteria          [proteobacteria]
. . . . Alphaproteobacteria     [a-proteobacteria]
. . . . . Rickettsiales           [a-proteobacteria]
. . . . . . SAR11 cluster           [a-proteobacteria]
. . . . . . . Candidatus Pelagibacter [a-proteobacteria]
. . . . . . . . Candidatus Pelagibacter sp. HTCC7211 --------------------------  308  2 hits [a-proteobacteria]      NADH dehydrogenase i chain c [Candidatus Pelagibacter sp. H
. . . . . . . . Candidatus Pelagibacter ubique HTCC1062 .......................  300  2 hits [a-proteobacteria]      NADH dehydrogenase I chain C [Candidatus Pelagibacter ubiqu
. . . . . . . . Candidatus Pelagibacter ubique HTCC1002 .......................  300  2 hits [a-proteobacteria]      NADH dehydrogenase I chain C [Candidatus Pelagibacter ubiqu
. . . . . . . alpha proteobacterium HIMB114 -----------------------------------  217  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase subunit c (nadhdehydrogenase i 
. . . . . . Anaplasma marginale str. St. Maries -------------------------------  187  2 hits [a-proteobacteria]      NADH-ubiquinone oxidoreductase subunit [Anaplasma marginale
. . . . . . Anaplasma marginale str. Florida ..................................  187  2 hits [a-proteobacteria]      NADH-ubiquinone oxidoreductase subunit [Anaplasma marginale
. . . . . . Anaplasma marginale str. Mississippi ..............................  187  1 hit  [a-proteobacteria]      NADH-ubiquinone oxidoreductase subunit [Anaplasma marginale
. . . . . . Anaplasma marginale str. Puerto Rico ..............................  187  1 hit  [a-proteobacteria]      NADH-ubiquinone oxidoreductase subunit [Anaplasma marginale
. . . . . . Anaplasma marginale str. Virginia .................................  187  1 hit  [a-proteobacteria]      NADH-ubiquinone oxidoreductase subunit [Anaplasma marginale
. . . . . . Anaplasma centrale str. Israel ....................................  186  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Anaplasma centrale str. Israe
. . . . . . Ehrlichia chaffeensis str. Sapulpa ................................  182  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Ehrlichia chaffe
. . . . . . Ehrlichia chaffeensis str. Arkansas ...............................  182  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Ehrlichia chaffe
. . . . . . Ehrlichia ruminantium str. Welgevonden ............................  181  4 hits [a-proteobacteria]      NADH-quinone oxidoreductase chain C [Ehrlichia ruminantium 
. . . . . . Ehrlichia ruminantium str. Gardel .................................  181  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase chain C [Ehrlichia ruminantium 
. . . . . . Orientia tsutsugamushi str. Boryong ...............................  179  2 hits [a-proteobacteria]      NADH dehydrogenase I chain C [Orientia tsutsugamushi str. B
. . . . . . Orientia tsutsugamushi str. Ikeda .................................  178  2 hits [a-proteobacteria]      NADH dehydrogenase I chain C [Orientia tsutsugamushi str. I
. . . . . . Ehrlichia canis str. Jake .........................................  178  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Ehrlichia canis 
. . . . . . Wolbachia endosymbiont strain TRS of Brugia malayi ................  177  3 hits [a-proteobacteria]      NADH:ubiquinone oxidoreductase chain C [Wolbachia endosymbi
. . . . . . Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24 .  174  1 hit  [a-proteobacteria]      hypothetical protein Wendoof_01000399 [Wolbachia endosymbio
. . . . . . Wolbachia endosymbiont of Drosophila melanogaster .................  174  2 hits [a-proteobacteria]      NADH dehydrogenase I, C subunit [Wolbachia endosymbiont of 
. . . . . . Wolbachia endosymbiont of Muscidifurax uniraptor ..................  174  2 hits [a-proteobacteria]      NADH dehydrogenase I, C subunit [Wolbachia endosymbiont of 
. . . . . . Wolbachia endosymbiont of Drosophila ananassae ....................  173  2 hits [a-proteobacteria]      NADH dehydrogenase I, C subunit [Wolbachia endosymbiont of 
. . . . . . Wolbachia sp. wRi .................................................  173  2 hits [a-proteobacteria]      NADH dehydrogenase I, C subunit [Wolbachia endosymbiont of 
. . . . . . Wolbachia endosymbiont of Culex quinquefasciatus Pel ..............  172  2 hits [a-proteobacteria]      NADH dehydrogenase I, C subunit [Wolbachia endosymbiont of 
. . . . . . Wolbachia endosymbiont of Culex quinquefasciatus JHB ..............  172  2 hits [a-proteobacteria]      NADH dehydrogenase I, C subunit [Wolbachia endosymbiont of 
. . . . . . Anaplasma phagocytophilum HZ ......................................  172  2 hits [a-proteobacteria]      NADH dehydrogenase I, C subunit [Anaplasma phagocytophilum 
. . . . . . Rickettsia bellii OSU 85-389 ......................................  164  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rickettsia bellii OSU 85-389]
. . . . . . Neorickettsia risticii str. Illinois ..............................  164  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase chain c 1 [Neorickettsia ristic
. . . . . . Rickettsia bellii RML369-C ........................................  162  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rickettsia bellii RML369-C] >
. . . . . . Rickettsia akari str. Hartford ....................................  158  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rickettsia akari str. Hartfor
. . . . . . Neorickettsia sennetsu str. Miyayama ..............................  157  3 hits [a-proteobacteria]      NADH dehydrogenase I, C subunit [Neorickettsia sennetsu str
. . . . . . Rickettsia endosymbiont of Ixodes scapularis ......................  157  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase subunit C [Rickettsia endosymbi
. . . . . . Rickettsia felis URRWXCal2 ........................................  155  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rickettsia felis URRWXCal2] >
. . . . . . Rickettsia felis ..................................................  155  1 hit  [a-proteobacteria]      NADH dehydrogenase subunit C [Rickettsia felis URRWXCal2] >
. . . . . . Rickettsia canadensis str. McKiel .................................  150  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rickettsia canadensis str. Mc
. . . . . . Rickettsia rickettsii str. 'Sheila Smith' .........................  143  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rickettsia rickettsii str. 'S
. . . . . . Rickettsia rickettsii str. Iowa ...................................  143  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rickettsia rickettsii str. Io
. . . . . . Rickettsia prowazekii str. Madrid E ...............................  142  1 hit  [a-proteobacteria]      NADH dehydrogenase subunit C [Rickettsia prowazekii str. Ma
. . . . . . Rickettsia prowazekii .............................................  142  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rickettsia prowazekii str. Ma
. . . . . . Rickettsia typhi str. Wilmington ..................................  142  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rickettsia typhi str. Wilming
. . . . . . Rickettsia typhi ..................................................  142  1 hit  [a-proteobacteria]      NADH dehydrogenase subunit C [Rickettsia typhi str. Wilming
. . . . . . Rickettsia africae ESF-5 ..........................................  142  2 hits [a-proteobacteria]      NADH dehydrogenase I chain C [Rickettsia africae ESF-5] >gi
. . . . . . Rickettsia sibirica 246 ...........................................  142  2 hits [a-proteobacteria]      NADH dehydrogenase I chain C [Rickettsia sibirica 246] >gi|
. . . . . . Rickettsia conorii str. Malish 7 ..................................  141  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rickettsia conorii str. Malis
. . . . . . Rickettsia conorii ................................................  141  1 hit  [a-proteobacteria]      NADH dehydrogenase subunit C [Rickettsia conorii str. Malis
. . . . . . Rickettsia peacockii str. Rustic ..................................  141  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rickettsia peacockii str. Rus
. . . . . Labrenzia aggregata IAM 12614 ---------------------------------------  219  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Stappia aggregata IAM 12614] 
. . . . . Rhodobacterales bacterium HTCC2255 ..................................  218  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [alpha proteobacterium HTCC225
. . . . . Ruegeria sp. TM1040 .................................................  213  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Ruegeria sp. TM1040] >gi|1223
. . . . . Labrenzia alexandrii DFL-11 .........................................  212  2 hits [a-proteobacteria]      putative NADH dehydrogenase, subunit C subfamily [Labrenzia
. . . . . Dinoroseobacter shibae DFL 12 .......................................  212  3 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Dinoroseobacter 
. . . . . Xanthobacter autotrophicus Py2 ......................................  212  3 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Xanthobacter aut
. . . . . Hirschia baltica ATCC 49814 .........................................  212  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Hirschia baltica
. . . . . Roseobacter sp. MED193 ..............................................  211  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Roseobacter sp. MED193] >gi|8
. . . . . Roseobacter sp. SK209-2-6 ...........................................  211  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Roseobacter sp. SK209-2-6] >g
. . . . . Silicibacter lacuscaerulensis ITI-1157 ..............................  211  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase subunit c [Silicibacter lacusca
. . . . . Rhodobacter sphaeroides ATCC 17025 ..................................  210  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rhodobacter sphaeroides ATCC 
. . . . . Loktanella vestfoldensis SKA53 ......................................  210  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Loktanella vestfoldensis SKA5
. . . . . Silicibacter sp. TrichCH4B ..........................................  210  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase subunit c [Silicibacter sp. Tri
. . . . . Ruegeria pomeroyi DSS-3 .............................................  210  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Ruegeria pomeroyi DSS-3] >gi|
. . . . . Ruegeria pomeroyi ...................................................  210  1 hit  [a-proteobacteria]      NADH dehydrogenase subunit C [Ruegeria pomeroyi DSS-3] >gi|
. . . . . Methylobacterium populi BJ001 .......................................  209  3 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Methylobacterium
. . . . . Rhodobacterales bacterium HTCC2654 ..................................  209  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rhodobacterales bacterium HTC
. . . . . alpha proteobacterium BAL199 ........................................  209  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [alpha proteobacterium BAL199]
. . . . . Roseobacter sp. CCS2 ................................................  208  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Roseobacter sp. CCS2] >gi|126
. . . . . Sinorhizobium medicae WSM419 ........................................  208  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Sinorhizobium medicae WSM419]
. . . . . Oceanicola granulosus HTCC2516 ......................................  207  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Oceanicola granulosus HTCC251
. . . . . Roseobacter sp. GAI101 ..............................................  207  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase chain c [Roseobacter sp. GAI101
. . . . . Rhodobacteraceae bacterium KLH11 ....................................  207  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase, c subunit [Rhodobacteraceae ba
. . . . . Oceanicaulis alexandrii HTCC2633 ....................................  207  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Oceanicaulis alexandrii HTCC2
. . . . . Rhodobacter sphaeroides KD131 .......................................  206  3 hits [a-proteobacteria]      NADH-quinone oxidoreductase [Rhodobacter sphaeroides KD131]
. . . . . Chelativorans sp. BNC1 ..............................................  206  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Mesorhizobium sp. BNC1] >gi|1
. . . . . Rhodobacter sphaeroides 2.4.1 .......................................  206  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rhodobacter sphaeroides 2.4.1
. . . . . Rhodobacter sphaeroides ATCC 17029 ..................................  206  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rhodobacter sphaeroides 2.4.1
. . . . . Rhodobacterales bacterium Y4I .......................................  206  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase chain c [Rhodobacterales bacter
. . . . . Sinorhizobium meliloti ..............................................  206  3 hits [a-proteobacteria]      NADH-ubiquinone oxidoreductase subunit NuoC [Sinorhizobium 
. . . . . Roseobacter sp. AzwK-3b .............................................  206  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Roseobacter sp. AzwK-3b] >gi|
. . . . . Rhodospirillum centenum SW ..........................................  206  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rhodospirillum centenum SW] >
. . . . . Methylobacterium extorquens AM1 .....................................  206  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase chain C (NADH dehydrogenase I, 
. . . . . Methylobacterium extorquens DM4 .....................................  206  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase chain C (NADH dehydrogenase I, 
. . . . . Rhizobium etli IE4771 ...............................................  206  1 hit  [a-proteobacteria]      NADH dehydrogenase subunit C [Rhizobium etli IE4771]
. . . . . Methylobacterium chloromethanicum CM4 ...............................  206  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Methylobacterium
. . . . . Rhizobium etli CFN 42 ...............................................  206  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rhizobium etli CFN 42] >gi|12
. . . . . Methylobacterium extorquens PA1 .....................................  206  3 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Methylobacterium
. . . . . Sagittula stellata E-37 .............................................  205  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Sagittula stellata E-37] >gi|
. . . . . Octadecabacter antarcticus 238 ......................................  205  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase, c subunit [Octadecabacter anta
. . . . . Sinorhizobium meliloti 1021 .........................................  205  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Sinorhizobium meliloti 1021] 
. . . . . Methylobacterium radiotolerans JCM 2831 .............................  205  3 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Methylobacterium
. . . . . Methylobacterium nodulans ORS 2060 ..................................  205  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Methylobacterium
. . . . . Methylobacterium sp. 4-46 ...........................................  205  3 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Methylobacterium
. . . . . Roseovarius sp. 217 .................................................  205  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase, C subunit [Roseovarius sp. 217
. . . . . Rhizobium etli CIAT 652 .............................................  205  3 hits [a-proteobacteria]      NADH-ubiquinone oxidoreductase protein, chain C [Rhizobium 
. . . . . Azospirillum sp. B510 ...............................................  205  2 hits [a-proteobacteria]      NADH dehydrogenase I chain C [Azospirillum sp. B510] >gi|28
. . . . . Mesorhizobium loti MAFF303099 .......................................  205  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Mesorhizobium loti MAFF303099
. . . . . Mesorhizobium loti ..................................................  205  1 hit  [a-proteobacteria]      NADH dehydrogenase subunit C [Mesorhizobium loti MAFF303099
. . . . . Rhizobium leguminosarum bv. viciae 3841 .............................  204  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rhizobium leguminosarum bv. v
. . . . . Rhizobium leguminosarum bv. trifolii WSM1325 ........................  204  4 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rhizobium leguminosarum bv. v
. . . . . Rhodopseudomonas palustris BisB5 ....................................  204  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rhodopseudomonas palustris Bi
. . . . . Mesorhizobium opportunistum WSM2075 .................................  204  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Mesorhizobium op
. . . . . Rhizobium leguminosarum bv. trifolii WSM2304 ........................  204  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rhizobium leguminosarum bv. t
. . . . . Phaeobacter gallaeciensis BS107 .....................................  204  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Phaeobacter gallaeciensis BS1
. . . . . Thalassiobium sp. R2A62 .............................................  204  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase subunit c [Thalassiobium sp. R2
. . . . . Maricaulis maris MCS10 ..............................................  204  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Maricaulis maris MCS10] >gi|1
. . . . . Ruegeria sp. R11 ....................................................  203  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase, c subunit [Ruegeria sp. R11] >
. . . . . Rhodospirillum rubrum ATCC 11170 ....................................  203  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rhodospirillum rubrum ATCC 11
. . . . . Agrobacterium vitis S4 ..............................................  203  3 hits [a-proteobacteria]      NADH ubiquinone oxidoreductase chain C [Agrobacterium vitis
. . . . . Roseovarius nubinhibens ISM .........................................  202  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Roseovarius nubinhibens ISM] 
. . . . . Rhodobacterales bacterium HTCC2083 ..................................  202  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase, c subunit [Rhodobacterales bac
. . . . . Citreicella sp. SE45 ................................................  202  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase subunit c [Citreicella sp. SE45
. . . . . Rhodopseudomonas palustris HaA2 .....................................  202  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rhodopseudomonas palustris Ha
. . . . . Rhodobacter capsulatus ..............................................  202  2 hits [a-proteobacteria]      RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Rhodobacter sp. SW2 .................................................  202  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Rhodobacter sp. 
. . . . . Roseobacter litoralis Och 149 .......................................  202  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Roseobacter litoralis Och 149
. . . . . Magnetospirillum magneticum AMB-1 ...................................  202  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Magnetospirillum magneticum A
. . . . . Rhodopseudomonas palustris BisB18 ...................................  202  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rhodopseudomonas palustris Bi
. . . . . Methylocella silvestris BL2 .........................................  202  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Methylocella sil
. . . . . Sulfitobacter sp. NAS-14.1 ..........................................  202  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase, C subunit [Sulfitobacter sp. N
. . . . . Phaeobacter gallaeciensis 2.10 ......................................  202  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Phaeobacter gallaeciensis 2.1
. . . . . Octadecabacter antarcticus 307 ......................................  202  2 hits [a-proteobacteria]      NADH dehydrogenase, subunit C subfamily, putative [Octadeca
. . . . . Hyphomonas neptunium ATCC 15444 .....................................  201  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Hyphomonas neptunium ATCC 154
. . . . . Parvibaculum lavamentivorans DS-1 ...................................  201  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Parvibaculum lavamentivorans 
. . . . . Roseovarius sp. HTCC2601 ............................................  201  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Roseovarius sp. HTCC2601] >gi
. . . . . Oceanibulbus indolifex HEL-45 .......................................  201  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Oceanibulbus indolifex HEL-45
. . . . . Hoeflea phototrophica DFL-43 ........................................  201  2 hits [a-proteobacteria]      NADH-ubiquinone oxidoreductase chain C protein [Hoeflea pho
. . . . . Magnetospirillum magnetotacticum MS-1 ...............................  201  1 hit  [a-proteobacteria]      COG0852: NADH:ubiquinone oxidoreductase 27 kD subunit [Magn
. . . . . Rhizobium etli 8C-3 .................................................  201  1 hit  [a-proteobacteria]      NADH dehydrogenase subunit C [Rhizobium etli 8C-3]
. . . . . Sulfitobacter sp. EE-36 .............................................  201  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase, C subunit [Sulfitobacter sp. E
. . . . . Rhizobium sp. NGR234 ................................................  201  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase chain C 1 [Rhizobium sp. NGR234
. . . . . Nitrobacter sp. Nb-311A .............................................  201  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Nitrobacter sp. Nb-311A] >gi|
. . . . . Azorhizobium caulinodans ORS 571 ....................................  201  3 hits [a-proteobacteria]      NADH-ubiquinone dehydrogenase chain C 1 [Azorhizobium cauli
. . . . . Caulobacter crescentus CB15 .........................................  200  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Caulobacter crescentus CB15] 
. . . . . Caulobacter crescentus NA1000 .......................................  200  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Caulobacter crescentus CB15] 
. . . . . Caulobacter vibrioides ..............................................  200  1 hit  [a-proteobacteria]      NADH dehydrogenase subunit C [Caulobacter crescentus CB15] 
. . . . . Roseobacter denitrificans OCh 114 ...................................  200  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Roseobacter denitrificans OCh
. . . . . Pseudovibrio sp. JE062 ..............................................  200  2 hits [a-proteobacteria]      NADH-ubiquinone oxidoreductase chain c protein [Pseudovibri
. . . . . Oligotropha carboxidovorans OM5 .....................................  200  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase subunit c [Oligotropha carboxid
. . . . . Roseovarius sp. TM1035 ..............................................  200  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Roseovarius sp. TM1035] >gi|1
. . . . . Rhodomicrobium vannielii ATCC 17100 .................................  199  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Rhodomicrobium v
. . . . . Jannaschia sp. CCS1 .................................................  199  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Jannaschia sp. CCS1] >gi|1224
. . . . . Beijerinckia indica subsp. indica ATCC 9039 .........................  199  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Beijerinckia ind
. . . . . Hyphomicrobium denitrificans ATCC 51888 .............................  199  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Hyphomicrobium d
. . . . . Nitrobacter winogradskyi Nb-255 .....................................  199  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Nitrobacter winogradskyi Nb-2
. . . . . Oceanicola batsensis HTCC2597 .......................................  199  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Oceanicola batsensis HTCC2597
. . . . . Brucella melitensis bv. 1 str. 16M ..................................  199  4 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella suis 1330 ..................................................  199  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella ovis ATCC 25840 ............................................  199  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella canis ATCC 23365 ...........................................  199  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella suis ATCC 23445 ............................................  199  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella melitensis ATCC 23457 ......................................  199  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella abortus bv. 3 str. Tulya ...................................  199  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella suis bv. 5 str. 513 ........................................  199  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella suis bv. 3 str. 686 ........................................  199  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella pinnipedialis M163/99/10 ...................................  199  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella pinnipedialis B2/94 ........................................  199  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella ceti M644/93/1 .............................................  199  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella ceti M13/05/1 ..............................................  199  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella sp. 83/13 ..................................................  199  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella pinnipedialis M292/94/1 ....................................  199  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella melitensis bv. 1 str. Rev.1 ................................  199  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella neotomae 5K33 ..............................................  199  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella melitensis bv. 3 str. Ether ................................  199  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella melitensis bv. 2 str. 63/9 .................................  199  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella microti CCM 4915 ...........................................  199  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella suis bv. 4 str. 40 .........................................  199  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella suis .......................................................  199  1 hit  [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Brucella melitensis .................................................  199  1 hit  [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella melitensis 16M] >gi|
. . . . . Rhodobacterales bacterium HTCC2150 ..................................  198  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rhodobacterales bacterium HTC
. . . . . Brucella ceti str. Cudo .............................................  198  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella ceti str. Cudo] >gi|
. . . . . Brucella ceti M490/95/1 .............................................  198  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella ceti str. Cudo] >gi|
. . . . . Brucella ceti B1/94 .................................................  198  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella ceti str. Cudo] >gi|
. . . . . Brucella sp. F5/99 ..................................................  198  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella ceti str. Cudo] >gi|
. . . . . Brevundimonas sp. BAL3 ..............................................  198  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C subfamily, putati
. . . . . Rhodopseudomonas palustris CGA009 ...................................  197  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rhodopseudomonas palustris CG
. . . . . Rhodopseudomonas palustris TIE-1 ....................................  197  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rhodopseudomonas palustris CG
. . . . . Rhodopseudomonas palustris ..........................................  197  1 hit  [a-proteobacteria]      NADH dehydrogenase subunit C [Rhodopseudomonas palustris CG
. . . . . Agrobacterium radiobacter K84 .......................................  197  3 hits [a-proteobacteria]      NADH-ubiquinone oxidoreductase chain C protein [Agrobacteri
. . . . . Bartonella henselae str. Houston-1 ..................................  197  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Bartonella henselae str. Hous
. . . . . Bartonella henselae .................................................  197  1 hit  [a-proteobacteria]      NADH dehydrogenase subunit C [Bartonella henselae str. Hous
. . . . . Ochrobactrum anthropi ATCC 49188 ....................................  197  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Ochrobactrum anthropi ATCC 49
. . . . . Brucella abortus bv. 1 str. 9-941 ...................................  197  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella abortus bv. 1 str. 9
. . . . . Brucella melitensis biovar Abortus 2308 .............................  197  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella abortus bv. 1 str. 9
. . . . . Brucella abortus S19 ................................................  197  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella abortus bv. 1 str. 9
. . . . . Brucella abortus str. 2308 A ........................................  197  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella abortus bv. 1 str. 9
. . . . . Brucella abortus bv. 6 str. 870 .....................................  197  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella abortus bv. 1 str. 9
. . . . . Brucella abortus bv. 2 str. 86/8/59 .................................  197  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella abortus bv. 1 str. 9
. . . . . Brucella abortus bv. 4 str. 292 .....................................  197  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella abortus bv. 1 str. 9
. . . . . Brucella abortus bv. 9 str. C68 .....................................  197  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella abortus bv. 1 str. 9
. . . . . Brucella abortus NCTC 8038 ..........................................  197  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella abortus bv. 1 str. 9
. . . . . Brucella abortus ....................................................  197  1 hit  [a-proteobacteria]      NADH dehydrogenase subunit C [Brucella abortus bv. 1 str. 9
. . . . . Bradyrhizobium sp. ORS278 ...........................................  196  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Bradyrhizobium sp. ORS278] >g
. . . . . Brevundimonas subvibrioides ATCC 15264 ..............................  196  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Brevundimonas su
. . . . . Bartonella bacilliformis KC583 ......................................  196  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Bartonella bacilliformis KC58
. . . . . Magnetospirillum gryphiswaldense MSR-1 ..............................  196  1 hit  [a-proteobacteria]      NADH dehydrogenase I, C subunit [Magnetospirillum gryphiswa
. . . . . Parvularcula bermudensis HTCC2503 ...................................  195  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Parvularcula bermudensis HTCC
. . . . . Fulvimarina pelagi HTCC2506 .........................................  195  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Fulvimarina pelagi HTCC2506] 
. . . . . Rhodopseudomonas palustris BisA53 ...................................  195  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Rhodopseudomonas palustris Bi
. . . . . Aurantimonas manganoxydans SI85-9A1 .................................  195  2 hits [a-proteobacteria]      NADH dehydrogenase I, C subunit [Aurantimonas manganoxydans
. . . . . Bradyrhizobium sp. BTAi1 ............................................  195  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Bradyrhizobium sp. BTAi1] >gi
. . . . . Erythrobacter sp. SD-21 .............................................  195  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Erythrobacter sp
. . . . . Sphingopyxis alaskensis RB2256 ......................................  195  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Sphingopyxis ala
. . . . . Nitrobacter hamburgensis X14 ........................................  194  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Nitrobacter hamburgensis X14]
. . . . . Erythrobacter sp. NAP1 ..............................................  194  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Erythrobacter sp. NAP1] >gi|8
. . . . . Ochrobactrum intermedium LMG 3301 ...................................  194  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Ochrobactrum int
. . . . . Caulobacter sp. K31 .................................................  194  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Caulobacter sp. K31] >gi|2185
. . . . . Novosphingobium aromaticivorans DSM 12444 ...........................  194  3 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Novosphingobium 
. . . . . Paracoccus denitrificans PD1222 .....................................  193  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Paracoccus denitrificans PD12
. . . . . Paracoccus denitrificans ............................................  193  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Paracoccus denitrificans PD12
. . . . . Sphingomonas wittichii RW1 ..........................................  193  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Sphingomonas wit
. . . . . Bradyrhizobium japonicum USDA 110 ...................................  193  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Bradyrhizobium japonicum USDA
. . . . . Rhodopseudomonas palustris DX-1 .....................................  192  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Rhodopseudomonas
. . . . . Bartonella grahamii as4aup ..........................................  191  2 hits [a-proteobacteria]      NADH dehydrogenase I subunit C [Bartonella grahamii as4aup]
. . . . . Asticcacaulis excentricus CB 48 .....................................  191  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Asticcacaulis ex
. . . . . Gluconacetobacter diazotrophicus PAl 5 ..............................  191  4 hits [a-proteobacteria]      NADH-quinone oxidoreductase chain C [Gluconacetobacter diaz
. . . . . Caulobacter segnis ATCC 21756 .......................................  191  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Caulobacter segn
. . . . . Bartonella quintana str. Toulouse ...................................  190  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Bartonella quintana str. Toul
. . . . . Bartonella quintana .................................................  190  1 hit  [a-proteobacteria]      NADH dehydrogenase subunit C [Bartonella quintana str. Toul
. . . . . Agrobacterium tumefaciens str. C58 ..................................  190  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Agrobacterium tumefaciens str
. . . . . Sphingomonas sp. SKA58 ..............................................  189  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Sphingomonas sp.
. . . . . Bartonella tribocorum CIP 105476 ....................................  188  3 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Bartonella tribocorum CIP 105
. . . . . Erythrobacter litoralis HTCC2594 ....................................  183  3 hits [a-proteobacteria]      NADH dehydrogenase I, C subunit [Erythrobacter litoralis HT
. . . . . Candidatus Liberibacter asiaticus str. psy62 ........................  182  2 hits [a-proteobacteria]      NADH dehydrogenase subunit C [Candidatus Liberibacter asiat
. . . . . Phenylobacterium zucineum HLK1 ......................................  181  3 hits [a-proteobacteria]      NADH dehydrogenase I, C subunit [Phenylobacterium zucineum 
. . . . . Granulibacter bethesdensis CGDNIH1 ..................................  173  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase chain C [Granulibacter bethesde
. . . . . Acetobacter pasteurianus IFO 3283-01 ................................  172  2 hits [a-proteobacteria]      NADH-quinone oxidoreductase chain C [Acetobacter pasteurian
. . . . . Acetobacter pasteurianus IFO 3283-03 ................................  172  1 hit  [a-proteobacteria]      NADH-quinone oxidoreductase chain C [Acetobacter pasteurian
. . . . . Acetobacter pasteurianus IFO 3283-07 ................................  172  1 hit  [a-proteobacteria]      NADH-quinone oxidoreductase chain C [Acetobacter pasteurian
. . . . . Acetobacter pasteurianus IFO 3283-22 ................................  172  1 hit  [a-proteobacteria]      NADH-quinone oxidoreductase chain C [Acetobacter pasteurian
. . . . . Acetobacter pasteurianus IFO 3283-26 ................................  172  1 hit  [a-proteobacteria]      NADH-quinone oxidoreductase chain C [Acetobacter pasteurian
. . . . . Acetobacter pasteurianus IFO 3283-32 ................................  172  1 hit  [a-proteobacteria]      NADH-quinone oxidoreductase chain C [Acetobacter pasteurian
. . . . . Acetobacter pasteurianus IFO 3283-01-42C ............................  172  1 hit  [a-proteobacteria]      NADH-quinone oxidoreductase chain C [Acetobacter pasteurian
. . . . . Acetobacter pasteurianus IFO 3283-12 ................................  172  1 hit  [a-proteobacteria]      NADH-quinone oxidoreductase chain C [Acetobacter pasteurian
. . . . . Rhizobium etli Kim 5 ................................................  169  1 hit  [a-proteobacteria]      NADH dehydrogenase subunit C [Rhizobium etli Kim 5]
. . . . . Acidiphilium cryptum JF-5 ...........................................  169  2 hits [a-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Acidiphilium cry
. . . . . Rhizobium etli GR56 .................................................  157  1 hit  [a-proteobacteria]      NADH dehydrogenase subunit C [Rhizobium etli GR56]
. . . . . Rhizobium etli CIAT 894 .............................................  153  1 hit  [a-proteobacteria]      NADH dehydrogenase subunit C [Rhizobium etli CIAT 894]
. . . . Acidithiobacillus caldus ATCC 51756 -----------------------------------  154  2 hits [g-proteobacteria]      NADH-ubiquinone oxidoreductase chain C [Acidithiobacillus c
. . . . Methylotenera mobilis JLW8 ............................................  153  2 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Methylotenera mo
. . . . Thiomonas intermedia K12 ..............................................  152  2 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Thiomonas interm
. . . . Dechloromonas aromatica RCB ...........................................  150  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Dechloromonas aromatica RCB] 
. . . . Sideroxydans lithotrophicus ES-1 ......................................  150  2 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Sideroxydans lit
. . . . beta proteobacterium KB13 .............................................  149  2 hits [b-proteobacteria]      NADH dehydrogenase i chain c [beta proteobacterium KB13] >g
. . . . Acidithiobacillus ferrooxidans ATCC 53993 .............................  149  3 hits [g-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Acidithiobacillu
. . . . Acidithiobacillus ferrooxidans ATCC 23270 .............................  149  3 hits [g-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Acidithiobacillu
. . . . Oxalobacter formigenes OXCC13 .........................................  149  2 hits [b-proteobacteria]      NADH-quinone oxidoreductase subunit C/D [Oxalobacter formig
. . . . Nitrosomonas sp. AL212 ................................................  148  2 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Nitrosomonas sp.
. . . . Methylovorus sp. SIP3-4 ...............................................  148  2 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Methylovorus sp.
. . . . Chromobacterium violaceum ATCC 12472 ..................................  147  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Chromobacterium violaceum ATC
. . . . Chromobacterium violaceum .............................................  147  1 hit  [b-proteobacteria]      NADH dehydrogenase subunit C [Chromobacterium violaceum ATC
. . . . Nitrosospira multiformis ATCC 25196 ...................................  147  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Nitrosospira multiformis ATCC
. . . . Acidovorax sp. JS42 ...................................................  147  3 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Acidovorax sp. J
. . . . Acidovorax ebreus TPSY ................................................  147  2 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Acidovorax ebreu
. . . . Lutiella nitroferrum 2002 .............................................  147  2 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Lutiella nitrofe
. . . . Burkholderia ambifaria MEX-5 ..........................................  146  2 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Burkholderia amb
. . . . Methylibium petroleiphilum PM1 ........................................  146  3 hits [b-proteobacteria]      NADH dehydrogenase (quinone) [Methylibium petroleiphilum PM
. . . . Burkholderia ambifaria IOP40-10 .......................................  146  2 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Burkholderia amb
. . . . Burkholderia ambifaria MC40-6 .........................................  146  3 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Burkholderia amb
. . . . Nitrosomonas europaea ATCC 19718 ......................................  145  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Nitrosomonas europaea ATCC 19
. . . . Nitrosomonas europaea .................................................  145  1 hit  [b-proteobacteria]      NADH dehydrogenase subunit C [Nitrosomonas europaea ATCC 19
. . . . Neisseria meningitidis alpha275 .......................................  145  1 hit  [b-proteobacteria]      respiratory-chain NADH dehydrogenase, 30 kDa subunit [Neiss
. . . . Neisseria meningitidis alpha153 .......................................  145  1 hit  [b-proteobacteria]      respiratory-chain NADH dehydrogenase, 30 kDa subunit [Neiss
. . . . Burkholderia multivorans ATCC 17616 ...................................  145  5 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia multivorans ATCC
. . . . Burkholderia multivorans CGD2M ........................................  145  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia multivorans ATCC
. . . . Burkholderia multivorans CGD2 .........................................  145  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia multivorans ATCC
. . . . Burkholderia multivorans CGD1 .........................................  145  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia multivorans ATCC
. . . . Delftia acidovorans SPH-1 .............................................  145  3 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Delftia acidovor
. . . . Burkholderia glumae BGR1 ..............................................  145  2 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Burkholderia glu
. . . . Burkholderia ubonensis Bu .............................................  145  1 hit  [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Burkholderia ubo
. . . . Acidovorax avenae subsp. avenae ATCC 19860 ............................  145  2 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Acidovorax avena
. . . . Magnetococcus sp. MC-1 ................................................  145  2 hits [proteobacteria]        NADH (or F420H2) dehydrogenase, subunit C [Magnetococcus sp
. . . . Nitrococcus mobilis Nb-231 ............................................  145  2 hits [g-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Nitrococcus mobi
. . . . Legionella longbeachae D-4968 .........................................  145  2 hits [g-proteobacteria]      NADH-quinone oxidoreductase C subunit [Legionella longbeach
. . . . Legionella longbeachae NSW150 .........................................  145  2 hits [g-proteobacteria]      NADH-quinone oxidoreductase C subunit [Legionella longbeach
. . . . Burkholderia ambifaria AMMD ...........................................  145  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia ambifaria AMMD] 
. . . . Rickettsiella grylli ..................................................  145  2 hits [g-proteobacteria]      NADH-quinone oxidoreductase, c subunit [Rickettsiella gryll
. . . . Ralstonia pickettii 12J ...............................................  145  3 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Ralstonia picket
. . . . Burkholderia dolosa AUO158 ............................................  145  2 hits [b-proteobacteria]      NADH dehydrogenase I,D subunit [Burkholderia dolosa AUO158]
. . . . Azoarcus sp. BH72 .....................................................  144  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Azoarcus sp. BH72] >gi|218534
. . . . Herminiimonas arsenicoxydans ..........................................  144  3 hits [b-proteobacteria]      putative NADH-quinone oxidoreductase chain C (NADH dehydrog
. . . . Burkholderia cenocepacia AU 1054 ......................................  144  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia cenocepacia AU 1
. . . . Burkholderia cenocepacia HI2424 .......................................  144  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia cenocepacia AU 1
. . . . Burkholderia cenocepacia MC0-3 ........................................  144  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia cenocepacia AU 1
. . . . Burkholderia cenocepacia J2315 ........................................  144  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia cenocepacia AU 1
. . . . Burkholderia cenocepacia PC184 ........................................  144  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia cenocepacia AU 1
. . . . Neisseria lactamica ATCC 23970 ........................................  144  2 hits [b-proteobacteria]      NADH-quinone oxidoreductase chain 5 [Neisseria lactamica AT
. . . . Neisseria meningitidis MC58 ...........................................  144  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Neisseria meningitidis MC58] 
. . . . Neisseria meningitidis serogroup B ....................................  144  1 hit  [b-proteobacteria]      NADH dehydrogenase subunit C [Neisseria meningitidis MC58] 
. . . . Burkholderia sp. 383 ..................................................  144  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia sp. 383] >gi|123
. . . . Burkholderia phymatum STM815 ..........................................  144  3 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Burkholderia phy
. . . . Laribacter hongkongensis HLHK9 ........................................  144  3 hits [b-proteobacteria]      NADH-quinone oxidoreductase [Laribacter hongkongensis HLHK9
. . . . Ralstonia pickettii 12D ...............................................  144  2 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Ralstonia picket
. . . . Kingella oralis ATCC 51147 ............................................  144  2 hits [b-proteobacteria]      hypothetical protein GCWU000324_03087 [Kingella oralis ATCC
. . . . Neisseria meningitidis 8013 ...........................................  143  1 hit  [b-proteobacteria]      NADH-quinone oxidoreductase chain C (NADH dehydrogenase I, 
. . . . Neisseria meningitidis alpha14 ........................................  143  2 hits [b-proteobacteria]      NADH dehydrogenase I chain C [Neisseria meningitidis alpha1
. . . . Acidovorax citrulli AAC00-1 ...........................................  143  3 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Acidovorax avena
. . . . Thiobacillus denitrificans ATCC 25259 .................................  143  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Thiobacillus denitrificans AT
. . . . Neisseria meningitidis Z2491 ..........................................  143  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Neisseria meningitidis Z2491]
. . . . Neisseria flavescens SK114 ............................................  143  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Neisseria meningitidis Z2491]
. . . . Neisseria subflava NJ9703 .............................................  143  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Neisseria meningitidis Z2491]
. . . . Neisseria meningitidis serogroup A ....................................  143  1 hit  [b-proteobacteria]      NADH dehydrogenase subunit C [Neisseria meningitidis Z2491]
. . . . Polaromonas sp. JS666 .................................................  143  3 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Polaromonas sp. 
. . . . Kangiella koreensis DSM 16069 .........................................  143  2 hits [g-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Kangiella koreen
. . . . Neisseria flavescens NRL30031/H210 ....................................  143  2 hits [b-proteobacteria]      hypothetical protein NEIFLAOT_02070 [Neisseria flavescens N
. . . . Comamonas testosteroni KF-1 ...........................................  143  2 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Comamonas testos
. . . . Nitrosomonas eutropha C91 .............................................  143  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Nitrosomonas eutropha C91] >g
. . . . Neisseria meningitidis FAM18 ..........................................  142  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Neisseria meningitidis FAM18]
. . . . Eikenella corrodens ATCC 23834 ........................................  142  2 hits [b-proteobacteria]      hypothetical protein EIKCOROL_00991 [Eikenella corrodens AT
. . . . Leptothrix cholodnii SP-6 .............................................  142  3 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Leptothrix cholo
. . . . Comamonas testosteroni CNB-2 ..........................................  142  2 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Comamonas testos
. . . . Acidovorax delafieldii 2AN ............................................  142  2 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Acidovorax delaf
. . . . Burkholderia thailandensis MSMB43 .....................................  142  1 hit  [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia thailandensis MS
. . . . Gallionella capsiferriformans ES-2 ....................................  142  2 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Gallionella ferr
. . . . Limnobacter sp. MED105 ................................................  142  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Limnobacter sp. MED105] >gi|1
. . . . Burkholderia oklahomensis EO147 .......................................  142  1 hit  [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia oklahomensis EO1
. . . . Burkholderia oklahomensis C6786 .......................................  142  1 hit  [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia oklahomensis EO1
. . . . Cupriavidus taiwanensis ...............................................  141  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Cupriavidus taiwanensis] >gi|
. . . . Burkholderia pseudomallei K96243 ......................................  141  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia mallei ATCC 23344 ........................................  141  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia mallei GB8 horse 4 .......................................  141  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei 1710b .......................................  141  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia mallei SAVP1 .............................................  141  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia mallei NCTC 10229 ........................................  141  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei 668 .........................................  141  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia mallei NCTC 10247 ........................................  141  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei 1106a .......................................  141  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei 305 .........................................  141  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia mallei PRL-20 ............................................  141  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei DM98 ........................................  141  1 hit  [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei 14 ..........................................  141  1 hit  [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei 91 ..........................................  141  1 hit  [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei 9 ...........................................  141  1 hit  [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei B7210 .......................................  141  1 hit  [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei 7894 ........................................  141  1 hit  [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei NCTC 13177 ..................................  141  1 hit  [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei 112 .........................................  141  1 hit  [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei BCC215 ......................................  141  1 hit  [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei 576 .........................................  141  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei Pakistan 9 ..................................  141  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei MSHR346 .....................................  141  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei 1106b .......................................  141  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia mallei ATCC 10399 ........................................  141  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei 1655 ........................................  141  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei Pasteur 52237 ...............................  141  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei S13 .........................................  141  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia mallei FMH ...............................................  141  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia mallei JHU ...............................................  141  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei 1710a .......................................  141  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei 406e ........................................  141  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia mallei 2002721280 ........................................  141  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia pseudomallei .............................................  141  1 hit  [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Burkholderia mallei ...................................................  141  1 hit  [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia pseudomallei K96
. . . . Ralstonia eutropha H16 ................................................  141  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Ralstonia eutropha H16] >gi|1
. . . . Candidatus Accumulibacter phosphatis clade IIA str. UW-1 ..............  141  2 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Candidatus Accum
. . . . Rhodoferax ferrireducens T118 .........................................  141  3 hits [b-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Rhodoferax ferri
. . . . Cupriavidus metallidurans CH34 ........................................  141  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Ralstonia metallidurans CH34]
. . . . Neisseria meningitidis 053442 .........................................  141  3 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Neisseria meningitidis 053442
. . . . Burkholderia thailandensis E264 .......................................  141  4 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia thailandensis E2
. . . . Burkholderia thailandensis Bt4 ........................................  141  1 hit  [b-proteobacteria]      NADH dehydrogenase subunit C [Burkholderia thailandensis E2
. . . . Neisseria sicca ATCC 29256 ............................................  141  2 hits [b-proteobacteria]      NADH-quinone oxidoreductase chain 5 [Neisseria sicca ATCC 2
. . . . Ralstonia solanacearum UW551 ..........................................  140  2 hits [b-proteobacteria]      NADH-quinone oxidoreductase chain C [Ralstonia solanacearum
. . . . Ralstonia solanacearum MolK2 ..........................................  140  2 hits [b-proteobacteria]      NADH-quinone oxidoreductase chain C [Ralstonia solanacearum
. . . . Ralstonia solanacearum IPO1609 ........................................  140  2 hits [b-proteobacteria]      NADH-quinone oxidoreductase chain C [Ralstonia solanacearum
. . . . Halorhodospira halophila SL1 ..........................................  140  3 hits [g-proteobacteria]      NADH (or F420H2) dehydrogenase, subunit C [Halorhodospira h
. . . . Neisseria mucosa ATCC 25996 ...........................................  140  2 hits [b-proteobacteria]      NADH-quinone oxidoreductase chain 5 [Neisseria mucosa ATCC 
. . . . Francisella philomiragia subsp. philomiragia ATCC 25015 ...............  140  2 hits [g-proteobacteria]      NADH dehydrogenase I [Francisella philomiragia subsp. philo
. . . . Ralstonia solanacearum GMI1000 ........................................  140  2 hits [b-proteobacteria]      NADH dehydrogenase subunit C [Ralstonia solanacearum GMI100
. . . . Ralstonia solanacearum ................................................  140  1 hit  [b-proteobacteria]      NADH dehydrogenase subunit C [Ralstonia solanacearum GMI100
. . . Psychroflexus torquis ATCC 700755 ---------------------------------------  302  1 hit  [CFB group bacteria]    NADH Dehydrogenase I Chain C [Psychroflexus torquis ATCC 70
. . Nephroselmis olivacea -----------------------------------------------------  197  2 hits [green algae]           NADH dehydrogenase subunit 9 [Nephroselmis olivacea] >gi|60
. . Yarrowia lipolytica CLIB122 ...............................................  194  1 hit  [ascomycetes]           YALI0F02123p [Yarrowia lipolytica] >gi|6689654|emb|CAB65522
. . Yarrowia lipolytica .......................................................  194  2 hits [ascomycetes]           YALI0F02123p [Yarrowia lipolytica] >gi|6689654|emb|CAB65522
. . Cryptococcus neoformans var. neoformans JEC21 .............................  193  2 hits [basidiomycetes]        NADH-ubiquinone oxidoreductase 30.4 kDa subunit [Cryptococc
. . Cryptococcus neoformans var. neoformans B-3501A ...........................  193  2 hits [basidiomycetes]        NADH-ubiquinone oxidoreductase 30.4 kDa subunit [Cryptococc
. . Chara vulgaris ............................................................  192  2 hits [green plants]          NADH dehydrogenase subunit 9 [Chara vulgaris] >gi|32966601|
. . Ostreococcus tauri ........................................................  192  2 hits [green algae]           nad9 [Ostreococcus tauri] >gi|112806898|emb|CAL36404.1| unn
. . Micromonas sp. RCC299 .....................................................  192  2 hits [green algae]           NADH dehydrogenase subunit 9 [Micromonas sp. RCC299] >gi|22
. . Isoetes engelmannii .......................................................  192  3 hits [club-mosses]           NADH dehydrogenase subunit 9 [Isoetes engelmannii] >gi|2173
. . Coprinopsis cinerea okayama7#130 ..........................................  192  2 hits [basidiomycetes]        hypothetical protein CC1G_04419 [Coprinopsis cinerea okayam
. . Trichoplax adhaerens ......................................................  192  2 hits [placozoans]            hypothetical protein TRIADDRAFT_52564 [Trichoplax adhaerens
. . Ustilago maydis 521 .......................................................  191  2 hits [basidiomycetes]        hypothetical protein UM01681.1 [Ustilago maydis 521] >gi|46
. . Physcomitrella patens .....................................................  191  2 hits [mosses]                NADH dehydrogenase subunit 9 [Physcomitrella patens] >gi|90
. . Marchantia polymorpha .....................................................  190  3 hits [liverworts]            NADH dehydrogenase subunit 9 [Marchantia polymorpha] >gi|78
. . Chaetosphaeridium globosum ................................................  190  2 hits [green plants]          NADH dehydrogenase subunit 9 [Chaetosphaeridium globosum] >
. . Laccaria bicolor S238N-H82 ................................................  189  2 hits [basidiomycetes]        predicted protein [Laccaria bicolor S238N-H82] >gi|16465119
. . Malassezia globosa CBS 7966 ...............................................  188  2 hits [basidiomycetes]        hypothetical protein MGL_3162 [Malassezia globosa CBS 7966]
. . Penicillium marneffei ATCC 18224 ..........................................  187  4 hits [ascomycetes]           NADH-ubiquinone oxidoreductase 304 kDa subunit precursor [P
. . Talaromyces stipitatus ATCC 10500 .........................................  187  2 hits [ascomycetes]           NADH-ubiquinone oxidoreductase 304 kDa subunit precursor [T
. . Chlamydomonas reinhardtii .................................................  186  3 hits [green algae]           NADH:ubiquinone oxidoreductase ND9 subunit [Chlamydomonas r
. . Dictyota dichotoma ........................................................  186  2 hits [brown algae]           NADH dehydrogenase subunit 9 [Dictyota dichotoma] >gi|45925
. . Hydra magnipapillata ......................................................  185  1 hit  [hydrozoans]            PREDICTED: similar to NADH dehydrogenase (ubiquinone) Fe-S 
. . Uncinocarpus reesii 1704 ..................................................  184  2 hits [ascomycetes]           NADH-ubiquinone oxidoreductase 30.4 kDa subunit [Uncinocarp
. . Macaca mulatta (rhesus macaque) ...........................................  184  1 hit  [primates]              PREDICTED: similar to NADH dehydrogenase (ubiquinone) Fe-S 
. . Oryza sativa Japonica Group (Japanese rice) ...............................  184  7 hits [monocots]              NADH dehydrogenase subunit 9 [Oryza sativa Japonica Group] 
. . Zea mays (maize) ..........................................................  184  2 hits [monocots]              NADH dehydrogenase, subunit 9 [Zea mays]
. . Strongylocentrotus purpuratus (purple urchin) .............................  184  3 hits [sea urchins]           PREDICTED: similar to NADH dehydrogenase (ubiquinone) Fe-S 
. . Micromonas pusilla CCMP1545 ...............................................  184  1 hit  [green algae]           NADH dehydrogenase subunit 9 [Micromonas pusilla CCMP1545]
. . Pleurozia purpurea ........................................................  183  2 hits [liverworts]            NADH dehydrogenase subunit 9 [Pleurozia purpurea] >gi|23778
. . Candida albicans WO-1 .....................................................  183  1 hit  [ascomycetes]           NADH-ubiquinone oxidoreductase subunit 9 [Candida albicans 
. . Candida albicans SC5314 ...................................................  183  4 hits [ascomycetes]           potential mitochondrial Complex I, NUGM_30kd subunit [Candi
. . Gallus gallus (bantam) ....................................................  183  1 hit  [birds]                 NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mito
. . Candida dubliniensis CD36 .................................................  183  2 hits [ascomycetes]           NADH-ubiquinone oxidoreductase subunit, mitochondrial precu
. . Beta trigyna ..............................................................  183  2 hits [eudicots]              RecName: Full=NADH-ubiquinone oxidoreductase 27 kDa subunit
. . Homo sapiens (man) ........................................................  182 10 hits [primates]              NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mito
. . Reclinomonas americana ....................................................  182  3 hits [eukaryotes]            NADH dehydrogenase subunit 9 [Reclinomonas americana] >gi|6
. . Pan troglodytes ...........................................................  182  3 hits [primates]              NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mito
. . Gorilla gorilla gorilla (lowland gorilla) .................................  182  1 hit  [primates]              RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur p
. . Gorilla gorilla (Gorilla) .................................................  182  1 hit  [primates]              RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur p
. . Pongo pygmaeus (orang utan) ...............................................  182  2 hits [primates]              RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur p
. . Coccidioides immitis RS ...................................................  182  1 hit  [ascomycetes]           hypothetical protein CIMG_01359 [Coccidioides immitis RS] >
. . Coccidioides posadasii ....................................................  182  1 hit  [ascomycetes]           hypothetical protein CIMG_01359 [Coccidioides immitis RS] >
. . Coccidioides posadasii C735 delta SOWgp ...................................  182  1 hit  [ascomycetes]           hypothetical protein CIMG_01359 [Coccidioides immitis RS] >
. . Pylaiella littoralis ......................................................  182  2 hits [brown algae]           NADH dehydrogenase subunit 9 [Pylaiella littoralis] >gi|151
. . Oltmannsiellopsis viridis .................................................  182  2 hits [green algae]           NADH dehydrogenase subunit 9 [Oltmannsiellopsis viridis] >g
. . Phytophthora megasperma (potato pink rot fungus) ..........................  182  1 hit  [oomycetes]             NADH dehydrogenase [Phytophthora megasperma]
. . Xenopus laevis (common platanna) ..........................................  182  4 hits [frogs & toads]         NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH
. . Brassica napus (rapeseeds) ................................................  182  2 hits [eudicots]              NADH dehydrogenase subunit 9 [Brassica napus] >gi|37591060|
. . Brassica oleracea var. botrytis (cauliflower) .............................  182  2 hits [eudicots]              NADH dehydrogenase subunit 9 [Brassica napus] >gi|37591060|
. . Ciona intestinalis ........................................................  182  1 hit  [tunicates]             PREDICTED: similar to NADH dehydrogenase (ubiquinone) Fe-S 
. . Nectria haematococca mpVI 77-13-4 .........................................  182  1 hit  [ascomycetes]           predicted protein [Nectria haematococca mpVI 77-13-4]
. . Lupinus luteus ............................................................  182  2 hits [eudicots]              NADH dehydrogenase subunit 9 [Lupinus luteus] >gi|9280614|g
. . Lupinus angustifolius .....................................................  182  3 hits [eudicots]              NADH dehydrogenase subunit 9 [Lupinus luteus] >gi|9280614|g
. . Gibberella zeae PH-1 ......................................................  181  1 hit  [ascomycetes]           hypothetical protein FG09234.1 [Gibberella zeae PH-1]
. . Microsporum canis CBS 113480 ..............................................  181  1 hit  [ascomycetes]           NADH-ubiquinone oxidoreductase kDa subunit [Microsporum can
. . Phytophthora infestans (potato late blight fungus) ........................  181  6 hits [oomycetes]             NADH dehydrogenase subunit 9 [Phytophthora infestans] >gi|6
. . Beta vulgaris subsp. vulgaris (Swiss chard) ...............................  181  4 hits [eudicots]              NADH dehydrogenase subunit 9 [Beta vulgaris subsp. vulgaris
. . Beta vulgaris (beet) ......................................................  181  2 hits [eudicots]              NADH dehydrogenase subunit 9 [Beta vulgaris subsp. vulgaris
. . Magnaporthe grisea ........................................................  181  1 hit  [ascomycetes]           NADH-ubiquinone oxidoreductase-like protein [Magnaporthe gr
. . Ailuropoda melanoleuca ....................................................  181  1 hit  [carnivores]            hypothetical protein PANDA_010603 [Ailuropoda melanoleuca]
. . Arabidopsis thaliana (thale-cress) ........................................  181  6 hits [eudicots]              RecName: Full=NADH-ubiquinone oxidoreductase 27 kDa subunit
. . Magnaporthe oryzae 70-15 ..................................................  181  2 hits [ascomycetes]           hypothetical protein MGG_01333 [Magnaporthe grisea 70-15] >
. . Beta webbiana .............................................................  181  2 hits [eudicots]              RecName: Full=NADH-ubiquinone oxidoreductase 27 kDa subunit
. . Sclerotinia sclerotiorum 1980 UF-70 .......................................  181  2 hits [ascomycetes]           NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondr
. . Aspergillus clavatus NRRL 1 ...............................................  181  2 hits [ascomycetes]           NADH-ubiquinone oxidoreductase 304 kDa subunit precursor [A
. . Taeniopygia guttata (zebra finch) .........................................  181  2 hits [birds]                 PREDICTED: NADH dehydrogenase (ubiquinone) Fe-S protein 3, 
. . Xenopus (Silurana) tropicalis .............................................  181  4 hits [frogs & toads]         NADH dehydrogenase (ubiquinone) Fe-S protein 3 [Xenopus (Si
. . Canis lupus familiaris (dogs) .............................................  180  1 hit  [carnivores]            PREDICTED: similar to NADH dehydrogenase (ubiquinone) Fe-S 
. . Plasmopara viticola .......................................................  180 12 hits [oomycetes]             NADH dehydrogenase subunit 9 [Plasmopara viticola] >gi|9449
. . Monodelphis domestica .....................................................  180  1 hit  [marsupials]            PREDICTED: similar to NADH dehydrogenase (ubiquinone) Fe-S 
. . Podospora anserina DSM 980 ................................................  180  1 hit  [ascomycetes]           unnamed protein product [Podospora anserina] >gi|170941134|
. . Podospora anserina ........................................................  180  1 hit  [ascomycetes]           unnamed protein product [Podospora anserina] >gi|170941134|
. . Monosiga brevicollis MX1 ..................................................  180  2 hits [choanoflagellates]     NADH dehydrogenase Fe S [Monosiga brevicollis MX1] >gi|1637
. . Acyrthosiphon pisum .......................................................  180  1 hit  [aphids]                PREDICTED: similar to AGAP006456-PA [Acyrthosiphon pisum]
. . Neurospora crassa OR74A ...................................................  180  2 hits [ascomycetes]           NADH:ubiquinone oxidoreductase 30.4kD subunit [Neurospora c
. . Neurospora crassa .........................................................  180  1 hit  [ascomycetes]           NADH:ubiquinone oxidoreductase 30.4kD subunit [Neurospora c
. . Danio rerio (zebra fish) ..................................................  179  3 hits [bony fishes]           NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mito
. . Equus caballus (equine) ...................................................  179  1 hit  [odd-toed ungulates]    PREDICTED: similar to NADH dehydrogenase [ubiquinone] iron-
. . Penicillium chrysogenum Wisconsin 54-1255 .................................  179  2 hits [ascomycetes]           Pc12g08820 [Penicillium chrysogenum Wisconsin 54-1255] >gi|
. . Neosartorya fischeri NRRL 181 .............................................  179  2 hits [ascomycetes]           NADH-ubiquinone oxidoreductase 304 kDa subunit precursor [N
. . Salmo salar ...............................................................  179  2 hits [bony fishes]           NADH dehydrogenase iron-sulfur protein 3, mitochondrial pre
. . Chattonella marina ........................................................  179  2 hits [eukaryotes]            NADH dehydrogenase subunit 9 [Chattonella marina] >gi|28887
. . Paracoccidioides brasiliensis Pb03 ........................................  179  1 hit  [ascomycetes]           NADH-ubiquinone oxidoreductase 27 kDa subunit [Paracoccidio
. . Paracoccidioides brasiliensis Pb18 ........................................  179  1 hit  [ascomycetes]           NADH dehydrogenase iron-sulfur protein [Paracoccidioides br
. . Aspergillus niger CBS 513.88 ..............................................  179  1 hit  [ascomycetes]           hypothetical protein An11g06200 [Aspergillus niger] >gi|134
. . Aspergillus niger .........................................................  179  1 hit  [ascomycetes]           hypothetical protein An11g06200 [Aspergillus niger] >gi|134
. . Bos taurus (cow) ..........................................................  179  3 hits [even-toed ungulates]   NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mito
. . Paracoccidioides brasiliensis Pb01 ........................................  179  1 hit  [ascomycetes]           NADH dehydrogenase iron-sulfur protein [Paracoccidioides br
. . Fucus vesiculosus .........................................................  178  2 hits [brown algae]           NADH dehydrogenase subunit 9 [Fucus vesiculosus] >gi|396532
. . Aspergillus flavus NRRL3357 ...............................................  178  2 hits [ascomycetes]           NADH-ubiquinone oxidoreductase 304 kDa subunit precursor [A
. . Aspergillus oryzae RIB40 ..................................................  178  1 hit  [ascomycetes]           hypothetical protein [Aspergillus oryzae RIB40] >gi|8376692
. . Aspergillus oryzae ........................................................  178  1 hit  [ascomycetes]           hypothetical protein [Aspergillus oryzae RIB40] >gi|8376692
. . Mus musculus (mouse) ......................................................  178 13 hits [rodents]               unnamed protein product [Mus musculus]
. . Candida tropicalis MYA-3404 ...............................................  178  2 hits [ascomycetes]           NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondr
. . Hemiselmis andersenii .....................................................  178  2 hits [cryptomonads]          NADH dehydrogenase subunit 9 [Hemiselmis andersenii] >gi|18
. . Clavispora lusitaniae ATCC 42720 ..........................................  178  2 hits [ascomycetes]           hypothetical protein CLUG_04416 [Clavispora lusitaniae ATCC
. . Rana catesbeiana (bullfrogs) ..............................................  178  1 hit  [frogs & toads]         NADH dehydrogenase iron-sulfur protein 3, mitochondrial pre
. . Ajellomyces dermatitidis SLH14081 .........................................  178  2 hits [ascomycetes]           NADH-ubiquinone oxidoreductase 30.4 kDa subunit [Ajellomyce
. . Ajellomyces dermatitidis ER-3 .............................................  178  1 hit  [ascomycetes]           NADH-ubiquinone oxidoreductase 30.4 kDa subunit [Ajellomyce
. . Saccharina japonica .......................................................  178  2 hits [brown algae]           NADH dehydrogenase subunit 9 [Saccharina japonica] >gi|2680
. . Saccharina religiosa ......................................................  178  2 hits [brown algae]           NADH dehydrogenase subunit 9 [Saccharina japonica] >gi|2680
. . Saccharina ochotensis .....................................................  178  2 hits [brown algae]           NADH dehydrogenase subunit 9 [Saccharina japonica] >gi|2680
. . Saccharina diabolica ......................................................  178  2 hits [brown algae]           NADH dehydrogenase subunit 9 [Saccharina japonica] >gi|2680
. . Saccharina longipedalis ...................................................  178  2 hits [brown algae]           NADH dehydrogenase subunit 9 [Saccharina japonica] >gi|2680
. . Saccharina angustata ......................................................  178  2 hits [brown algae]           NADH dehydrogenase subunit 9 [Saccharina japonica] >gi|2680
. . Laminaria digitata ........................................................  177  2 hits [brown algae]           NADH dehydrogenase subunit 9 [Laminaria digitata] >gi|21425
. . Phytophthora sojae ........................................................  177  2 hits [oomycetes]             NADH dehydrogenase subunit 9 [Phytophthora sojae] >gi|11016
. . Esox lucius ...............................................................  177  1 hit  [bony fishes]           NADH dehydrogenase iron-sulfur protein 3, mitochondrial pre
. . Ornithorhynchus anatinus (duck-billed platypus) ...........................  177  1 hit  [monotremes]            PREDICTED: similar to NADH dehydrogenase [ubiquinone] iron-
. . Saccharina coriacea .......................................................  177  2 hits [brown algae]           NADH dehydrogenase subunit 9 [Saccharina coriacea] >gi|2623
. . Phytophthora ramorum ......................................................  177  3 hits [oomycetes]             NADH dehydrogenase subunit 9 [Phytophthora ramorum] >gi|110
. . Candida maltosa ...........................................................  177  3 hits [ascomycetes]           RecName: Full=Probable NADH-ubiquinone oxidoreductase 30.4 
. . Oncorhynchus masou formosanus (Taiwan salmon) .............................  177  1 hit  [bony fishes]           NADH dehydrogenase ubiquinone Fe-S protein 3 [Oncorhynchus 
. . Branchiostoma floridae ....................................................  177  2 hits [lancelets]             hypothetical protein BRAFLDRAFT_167919 [Branchiostoma flori
. . Verticillium albo-atrum VaMs.102 ..........................................  177  1 hit  [ascomycetes]           NADH dehydrogenase iron-sulfur protein [Verticillium albo-a
. . Brugia malayi (agent of lymphatic fil...) .................................  177  2 hits [nematodes]             NADH-ubiquinone oxidoreductase 30 kDa subunit, mitochondria
. . Moniliophthora perniciosa FA553 ...........................................  177  2 hits [basidiomycetes]        hypothetical protein MPER_11103 [Moniliophthora perniciosa 
. . Lysiphlebus testaceipes ...................................................  177  1 hit  [wasps &c.]             NADH dehydrogenase [Lysiphlebus testaceipes]
. . Aspergillus fumigatus Af293 ...............................................  176  2 hits [ascomycetes]           NADH-ubiquinone oxidoreductase 304 kDa subunit precursor [A
. . Aspergillus fumigatus A1163 ...............................................  176  1 hit  [ascomycetes]           NADH-ubiquinone oxidoreductase 304 kDa subunit precursor [A
. . Aspergillus terreus NIH2624 ...............................................  176  2 hits [ascomycetes]           NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondr
. . Rattus norvegicus (brown rat) .............................................  176  4 hits [rodents]               NADH dehydrogenase (ubiquinone) Fe-S protein 3 [Rattus norv
. . Solanum tuberosum (potatoes) ..............................................  176  2 hits [eudicots]              RecName: Full=NADH-ubiquinone oxidoreductase 27 kDa subunit
. . Heterosigma akashiwo ......................................................  176  3 hits [eukaryotes]            NADH dehydrogenase subunit 9 [Heterosigma akashiwo] >gi|239
. . Culex quinquefasciatus ....................................................  176  4 hits [flies]                 NADH dehydrogenase iron-sulfur protein 3, mitochondrial [Cu
. . Desmarestia viridis .......................................................  176  2 hits [brown algae]           NADH dehydrogenase subunit 9 [Desmarestia viridis] >gi|4592
. . Phaeosphaeria nodorum SN15 ................................................  176  2 hits [ascomycetes]           hypothetical protein SNOG_06383 [Phaeosphaeria nodorum SN15
. . Ajellomyces capsulatus G186AR .............................................  176  1 hit  [ascomycetes]           NADH-ubiquinone oxidoreductase [Ajellomyces capsulatus G186
. . Ajellomyces capsulatus NAm1 ...............................................  176  2 hits [ascomycetes]           NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondr
. . Ajellomyces capsulatus H143 ...............................................  176  1 hit  [ascomycetes]           NADH-ubiquinone oxidoreductase subunit [Ajellomyces capsula
. . Lodderomyces elongisporus NRRL YB-4239 ....................................  175  2 hits [ascomycetes]           NADH-ubiquinone oxidoreductase subunit 9 [Lodderomyces elon
. . Debaryomyces hansenii CBS767 ..............................................  175  1 hit  [ascomycetes]           hypothetical protein DEHA0A12265g [Debaryomyces hansenii CB
. . Debaryomyces hansenii .....................................................  175  1 hit  [ascomycetes]           hypothetical protein DEHA0A12265g [Debaryomyces hansenii CB
. . Aspergillus nidulans FGSC A4 ..............................................  174  3 hits [ascomycetes]           TPA: NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitoc
. . Botryotinia fuckeliana B05.10 .............................................  174  2 hits [ascomycetes]           hypothetical protein BC1G_04333 [Botryotinia fuckeliana B05
. . Pyrenophora tritici-repentis Pt-1C-BFP ....................................  174  2 hits [ascomycetes]           NADH dehydrogenase iron-sulfur protein 3, mitochondrial pre
. . Pichia guilliermondii ATCC 6260 ...........................................  174  2 hits [ascomycetes]           hypothetical protein PGUG_01928 [Pichia guilliermondii ATCC
. . Nasonia vitripennis .......................................................  174  1 hit  [wasps &c.]             NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mito
. . Pichia stipitis CBS 6054 ..................................................  174  2 hits [ascomycetes]           NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondr
. . Pichia pastoris GS115 .....................................................  174  2 hits [ascomycetes]           hypothetical protein [Pichia pastoris GS115] >gi|238033325|
. . Caligus rogercresseyi .....................................................  174  2 hits [crustaceans]           NADH dehydrogenase iron-sulfur protein 3, mitochondrial pre
. . Prototheca wickerhamii ....................................................  173  3 hits [green algae]           NADH dehydrogenase (ubiquinone), subunit 9 [Prototheca wick
. . Anopheles gambiae str. PEST ...............................................  172  2 hits [flies]                 AGAP006456-PA [Anopheles gambiae str. PEST] >gi|55239226|gb
. . Drosophila mojavensis .....................................................  172  2 hits [flies]                 GI12345 [Drosophila mojavensis] >gi|193919131|gb|EDW17998.1
. . Caligus clemensi ..........................................................  172  1 hit  [crustaceans]           NADH dehydrogenase iron-sulfur protein 3, mitochondrial pre
. . Drosophila simulans .......................................................  171  2 hits [flies]                 GD13354 [Drosophila simulans] >gi|194195445|gb|EDX09021.1| 
. . Drosophila sechellia ......................................................  171  2 hits [flies]                 GM14080 [Drosophila sechellia] >gi|194128236|gb|EDW50279.1|
. . Drosophila virilis ........................................................  171  2 hits [flies]                 GJ12236 [Drosophila virilis] >gi|194154057|gb|EDW69241.1| G
. . Tribolium castaneum (rust-red flour beetle) ...............................  171  2 hits [beetles]               PREDICTED: similar to AGAP006456-PA [Tribolium castaneum] >
. . Schistosoma mansoni .......................................................  171  2 hits [flatworms]             NADH-ubiquinone oxidoreductase [Schistosoma mansoni] >gi|23
. . Beta vulgaris subsp. maritima (palanki) ...................................  171  1 hit  [eudicots]              NADH dehydrogenase subunit 9 [Beta vulgaris subsp. maritima]
. . Drosophila grimshawi ......................................................  171  2 hits [flies]                 GH16082 [Drosophila grimshawi] >gi|193897255|gb|EDV96121.1|
. . Drosophila ananassae ......................................................  171  2 hits [flies]                 GF10219 [Drosophila ananassae] >gi|190624310|gb|EDV39834.1|
. . Drosophila erecta .........................................................  171  2 hits [flies]                 GG14478 [Drosophila erecta] >gi|190653134|gb|EDV50377.1| GG
. . Schistosoma japonicum .....................................................  171  4 hits [flatworms]             SJCHGC06115 protein [Schistosoma japonicum] >gi|226478696|e
. . Saprolegnia ferax .........................................................  171  2 hits [oomycetes]             NADH dehydrogenase subunit 9 [Saprolegnia ferax] >gi|482376
. . Drosophila melanogaster ...................................................  171  4 hits [flies]                 CG12079 [Drosophila melanogaster] >gi|7292316|gb|AAF47723.1
. . Drosophila pseudoobscura pseudoobscura ....................................  171  2 hits [flies]                 GA11380 [Drosophila pseudoobscura pseudoobscura] >gi|546414
. . Lepeophtheirus salmonis ...................................................  171  2 hits [crustaceans]           NADH dehydrogenase iron-sulfur protein 3, mitochondrial pre
. . Drosophila persimilis .....................................................  170  2 hits [flies]                 GL20750 [Drosophila persimilis] >gi|194109088|gb|EDW31131.1
. . Caenorhabditis briggsae ...................................................  170  2 hits [nematodes]             C. briggsae CBR-NUO-2 protein [Caenorhabditis briggsae] >gi
. . Ixodes scapularis (shoulder tick) .........................................  170  2 hits [mites & ticks]         NADH-ubiquinone oxidoreductase, NDUFS3/30 kDa subunit, puta
. . Drosophila yakuba .........................................................  170  2 hits [flies]                 GE21665 [Drosophila yakuba] >gi|194180240|gb|EDW93851.1| GE
. . Populus trichocarpa (black cottonwood) ....................................  170  2 hits [eudicots]              predicted protein [Populus trichocarpa] >gi|222837161|gb|EE
. . Sordaria macrospora .......................................................  170  1 hit  [ascomycetes]           unnamed protein product [Sordaria macrospora]
. . Drosophila willistoni .....................................................  169  2 hits [flies]                 GK18031 [Drosophila willistoni] >gi|194165011|gb|EDW79912.1
. . Glossina morsitans morsitans ..............................................  169  1 hit  [flies]                 NADH-ubiquinone oxidoreductase NDUFS3/30kDa subunit [Glossi
. . Chlorokybus atmophyticus ..................................................  169  2 hits [green plants]          NADH dehydrogenase subunit 9 [Chlorokybus atmophyticus] >gi
. . Acanthamoeba castellanii ..................................................  169  3 hits [eukaryotes]            NADH dehydrogenase, subunit 9 [Acanthamoeba castellanii] >g
. . Caenorhabditis elegans (nematode) .........................................  169  4 hits [nematodes]             NADH Ubiquinone Oxidoreductase family member (nuo-2) [Caeno
. . Apis mellifera (bee) ......................................................  168  1 hit  [bees]                  PREDICTED: similar to CG12079-PA [Apis mellifera]
. . Ricinus communis ..........................................................  168  2 hits [eudicots]              NADH-ubiquinone oxidoreductase mitochondrial precursor, put
. . Chaetomium globosum CBS 148.51 ............................................  168  2 hits [ascomycetes]           hypothetical protein CHGG_09244 [Chaetomium globosum CBS 14
. . Thraustochytrium aureum ...................................................  166  1 hit  [slime nets]            NADH dehydrogenase subunit 9 [Thraustochytrium aureum]
. . Lupinus albus .............................................................  166  1 hit  [eudicots]              NADH dehydrogenase subunit 9 [Lupinus albus]
. . Carica papaya (mamon) .....................................................  165  2 hits [eudicots]              NADH dehydrogenase subunit 9 [Carica papaya] >gi|170522395|
. . Lupinus mutabilis .........................................................  164  1 hit  [eudicots]              NADH dehydrogenase subunit 9 [Lupinus mutabilis]
. . Nicotiana tabacum (tobacco) ...............................................  164  2 hits [eudicots]              NADH dehydrogenase subunit 9 [Nicotiana tabacum] >gi|568066
. . Helicosporidium sp. ex Simulium jonesi ....................................  163  1 hit  [green algae]           NADH dehydrogenase subunit 9 [Helicosporidium sp. ex Simuli
. . Ochromonas danica .........................................................  162  2 hits [golden algae]          NADH dehydrogenase subunit 9 [Ochromonas danica] >gi|105052
. . Armillariella tabescens ...................................................  162  1 hit  [basidiomycetes]        NADH-ubiquinone oxidoreductase 30.4 kDa subunit [Armillarie
. . Nematostella vectensis ....................................................  161  2 hits [sea anemones]          predicted protein [Nematostella vectensis] >gi|156216100|gb
. . Malawimonas jakobiformis ..................................................  161  2 hits [eukaryotes]            NADH dehydrogenase subunit 9 [Malawimonas jakobiformis] >gi
. . Piper betle ...............................................................  160  1 hit  [flowering plants]      NADH dehydrogenase subunit 9 [Piper betle]
. . Rhodomonas salina .........................................................  160  2 hits [cryptomonads]          NADH dehydrogenase subunit 9 [Rhodomonas salina] >gi|104441
. . Triticum aestivum (common wheat) ..........................................  160  4 hits [monocots]              nad9 [Triticum aestivum] >gi|416536|emb|CAA49376.1| 30 kDa 
. . Polysphondylium pallidum ..................................................  160  3 hits [cellular slime molds]  NADH dehydrogenase subunit 9 [Polysphondylium pallidum]
. . Allium cepa ...............................................................  159  1 hit  [monocots]              NADH hydrogenase subunit 9 [Allium cepa]
. . Zea mays subsp. mays (Indian corn) ........................................  158  5 hits [monocots]              NADH dehydrogenase subunit 9 [Zea mays subsp. mays] >gi|114
. . Zea perennis (teosinte) ...................................................  158  2 hits [monocots]              NADH dehydrogenase subunit 9 [Zea mays subsp. mays] >gi|114
. . Zea luxurians (Florida teosinte) ..........................................  158  2 hits [monocots]              NADH dehydrogenase subunit 9 [Zea mays subsp. mays] >gi|114
. . Zea mays subsp. parviglumis (teosinte) ....................................  158  2 hits [monocots]              NADH dehydrogenase subunit 9 [Zea mays subsp. mays] >gi|114
. . Sorghum bicolor (milo) ....................................................  158  2 hits [monocots]              NADH dehydrogenase subunit 9 [Zea mays subsp. mays] >gi|114
. . Tripsacum dactyloides .....................................................  158  2 hits [monocots]              NADH dehydrogenase subunit 9 [Zea mays subsp. mays] >gi|114
. . Megaceros aenigmaticus ....................................................  158  2 hits [hornworts]             NADH dehydrogenase subunit 9 [Megaceros aenigmaticus] >gi|1
. . Oryza sativa Indica Group (Indian rice) ...................................  158  4 hits [monocots]              NADH dehydrogenase subunit 9 [Oryza sativa Indica Group] >g
. . Oryza rufipogon (red rice) ................................................  158  2 hits [monocots]              NADH dehydrogenase subunit 9 [Oryza sativa Indica Group] >g
. . Bambusa oldhamii ..........................................................  158  1 hit  [monocots]              NADH dehydrogenase subunit 9 [Oryza sativa Indica Group] >g
. . Mesostigma viride .........................................................  158  2 hits [green plants]          NADH dehydrogenase subunit 9 [Mesostigma viride] >gi|172225
. . Vitis vinifera (wine grape) ...............................................  157  6 hits [eudicots]              NADH dehydrogenase subunit 9 [Vitis vinifera] >gi|209954163
. . Helianthus annuus .........................................................  156  1 hit  [eudicots]              NADH dehydrogenase subunit 9 [Helianthus annuus]
. . Hartmannella vermiformis ..................................................  155  1 hit  [eukaryotes]            NADH dehydrogenase subunit 9 [Hartmannella vermiformis]
. . Berberis bealei ...........................................................  155  1 hit  [eudicots]              NADH dehydrogenase subunit 9 [Berberis bealei]
. . Dictyostelium discoideum ..................................................  154  4 hits [cellular slime molds]  NADH dehydrogenase subunit 9 [Dictyostelium discoideum] >gi
. . Dictyostelium citrinum ....................................................  153  3 hits [cellular slime molds]  NADH dehydrogenase subunit 9 [Dictyostelium citrinum] >gi|1
. . Cycas taitungensis ........................................................  153  2 hits [cycads]                NADH dehydrogenase subunit 9 [Cycas taitungensis] >gi|16670
. . Thalassiosira pseudonana ..................................................  153  2 hits [diatoms]               NADH dehydrogenase subunit 9 [Thalassiosira pseudonana] >gi
. . Chrysodidymus synuroideus .................................................  153  2 hits [eukaryotes]            NADH dehydrogenase subunit 9 [Chrysodidymus synuroideus] >g
. . Phaeoceros laevis .........................................................  152  2 hits [hornworts]             NADH dehydrogenase subunit 9 [Phaeoceros laevis] >gi|254596
. . Asarum sp. Qiu 96018 ......................................................  152  1 hit  [flowering plants]      NADH dehydrogenase subunit 9 [Asarum sp. Qiu 96018]
. . Eichhornia crassipes ......................................................  152  1 hit  [monocots]              NADH dehydrogenase subunit 9 [Eichhornia crassipes]
. . Calycanthus floridus (eastern sweetshrub) .................................  151  1 hit  [flowering plants]      NADH dehydrogenase subunit 9 [Calycanthus floridus]
. . Lonicera sp. Bergthorsson 0301 ............................................  151  1 hit  [eudicots]              NADH dehydrogenase subunit 9 [Lonicera sp. Bergthorsson 030
. . Silene conica .............................................................  150  1 hit  [eudicots]              NADH dehydrogenase subunit 9 [Silene conica]
. . Liriodendron tulipifera ...................................................  150  1 hit  [flowering plants]      NADH dehydrogenase subunit 9 [Liriodendron tulipifera]
. . Silene macrodonta .........................................................  150  1 hit  [eudicots]              NADH dehydrogenase subunit 9 [Silene macrodonta]
. . Pediculus humanus corporis (human body lice) ..............................  150  2 hits [lice]                  NADH-ubiquinone oxidoreductase 30 kDa subunit, putative [Pe
. . Platanus occidentalis (eastern plane-tree) ................................  149  1 hit  [eudicots]              NADH dehydrogenase subunit 9 [Platanus occidentalis]
. . Silene ammophila ..........................................................  149  1 hit  [eudicots]              NADH dehydrogenase subunit 9 [Silene ammophila]
. . Silene noctiflora (sticky cockle) .........................................  149  1 hit  [eudicots]              NADH dehydrogenase subunit 9 [Silene noctiflora] >gi|255709
. . Silene turkestanica .......................................................  149  1 hit  [eudicots]              NADH dehydrogenase subunit 9 [Silene noctiflora] >gi|255709
. . Dictyostelium fasciculatum ................................................  149  2 hits [cellular slime molds]  NADH dehydrogenase subunit 9 [Dictyostelium fasciculatum] >
. . Agave attenuata ...........................................................  148  1 hit  [monocots]              NADH dehydrogenase subunit 9 [Agave attenuata]
. . Silene conoidea (large sand catchfly) .....................................  148  1 hit  [eudicots]              NADH dehydrogenase subunit 9 [Silene conoidea]
. . Eschscholzia californica ..................................................  148  1 hit  [eudicots]              NADH dehydrogenase subunit 9 [Eschscholzia californica]
. . Phytophthora cinnamomi ....................................................  145  1 hit  [oomycetes]             NADH dehydrogenase subunit 9 [Phytophthora cinnamomi]
. . Phytophthora palmivora ....................................................  143  1 hit  [oomycetes]             NADH dehydrogenase subunit 9 [Phytophthora palmivora] >gi|2
. . Phytophthora gonapodyides .................................................  143  1 hit  [oomycetes]             NADH dehydrogenase subunit 9 [Phytophthora palmivora] >gi|2
. . Silene latifolia ..........................................................  143  2 hits [eudicots]              NADH dehydrogenase subunit 9 [Silene latifolia]
. . Heliosperma pusillum ......................................................  143  1 hit  [eudicots]              NADH dehydrogenase subunit 9 [Heliosperma pusillum]
. . Tetraodon nigroviridis ....................................................  143  1 hit  [bony fishes]           unnamed protein product [Tetraodon nigroviridis]
. . Phytophthora inundata .....................................................  142  1 hit  [oomycetes]             NADH dehydrogenase subunit 9 [Phytophthora inundata]
. . Phytophthora humicola .....................................................  142  1 hit  [oomycetes]             NADH dehydrogenase subunit 9 [Phytophthora humicola]
. . Silene khasiana ...........................................................  141  1 hit  [eudicots]              NADH dehydrogenase subunit 9 [Silene khasiana]
. . Silene antirrhina .........................................................  141  1 hit  [eudicots]              NADH dehydrogenase subunit 9 [Silene antirrhina]
. . Agrostemma githago (purple cockle) ........................................  141  1 hit  [eudicots]              NADH dehydrogenase subunit 9 [Agrostemma githago]
. . Amborella trichopoda ......................................................  140  1 hit  [flowering plants]      NADH dehydrogenase subunit 9 [Amborella trichopoda]
. . Phytophthora nicotianae var. parasitica ...................................  140  1 hit  [oomycetes]             NADH dehydrogenase subunit 9 [Phytophthora nicotianae var. 
. . Silene auriculata .........................................................  140  1 hit  [eudicots]              NADH dehydrogenase subunit 9 [Silene auriculata]
. synthetic construct ---------------------------------------------------------  182  4 hits [other sequences]       NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitoYP_003049035.1	


----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

b) Blastp vs SWISSPROT

Lineage Report

root
. cellular organisms
. . Bacteria            [bacteria]
. . . Proteobacteria      [proteobacteria]
. . . . Alphaproteobacteria [a-proteobacteria]
. . . . . Rhodobacterales     [a-proteobacteria]
. . . . . . Rhodobacteraceae    [a-proteobacteria]
. . . . . . . Ruegeria            [a-proteobacteria]
. . . . . . . . Ruegeria sp. TM1040 ----------------------------------------------  213 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . . . . Ruegeria pomeroyi ................................................  209 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . . . Dinoroseobacter shibae DFL 12 --------------------------------------  211 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . . . Rhodobacter sphaeroides ATCC 17025 .................................  209 2 hits [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . . . Rhodobacter sphaeroides KD131 ......................................  206 2 hits [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . . . Rhodobacter sphaeroides 2.4.1 ......................................  206 2 hits [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . . . Rhodobacter sphaeroides ATCC 17029 .................................  206 2 hits [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . . . Rhodobacter capsulatus .............................................  202 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . . . Roseobacter denitrificans OCh 114 ..................................  200 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . . . Jannaschia sp. CCS1 ................................................  199 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . . . Paracoccus denitrificans ...........................................  191 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase chain 5; AltName:
. . . . . . Maricaulis maris MCS10 -----------------------------------------------  203 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . . Hyphomonas neptunium ATCC 15444 ......................................  202 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Xanthobacter autotrophicus Py2 -----------------------------------------  212 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Methylobacterium populi BJ001 ..........................................  209 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Sinorhizobium medicae WSM419 ...........................................  208 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Chelativorans sp. BNC1 .................................................  206 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Rhizobium etli CFN 42 ..................................................  206 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Methylobacterium sp. 4-46 ..............................................  206 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Methylobacterium extorquens PA1 ........................................  206 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Sinorhizobium meliloti .................................................  205 2 hits [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C 1; AltN
. . . . . Methylobacterium radiotolerans JCM 2831 ................................  205 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Rhizobium etli CIAT 652 ................................................  205 2 hits [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C 1; AltN
. . . . . Rhizobium leguminosarum bv. viciae 3841 ................................  204 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Mesorhizobium loti .....................................................  204 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Rhizobium leguminosarum bv. trifolii WSM2304 ...........................  204 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Rhodospirillum rubrum ATCC 11170 .......................................  203 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Agrobacterium vitis S4 .................................................  202 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Rhodopseudomonas palustris BisB18 ......................................  202 2 hits [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Magnetospirillum magneticum AMB-1 ......................................  202 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Parvibaculum lavamentivorans DS-1 ......................................  201 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Azorhizobium caulinodans ORS 571 .......................................  201 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Caulobacter vibrioides .................................................  200 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Brucella suis ..........................................................  199 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Brucella melitensis ....................................................  199 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Brucella canis ATCC 23365 ..............................................  199 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Brucella ovis ATCC 25840 ...............................................  199 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Brucella suis ATCC 23445 ...............................................  199 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Brucella melitensis ATCC 23457 .........................................  199 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Rhodopseudomonas palustris .............................................  197 2 hits [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Rhodopseudomonas palustris TIE-1 .......................................  197 2 hits [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Ochrobactrum anthropi ATCC 49188 .......................................  197 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Agrobacterium radiobacter K84 ..........................................  197 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Bartonella henselae ....................................................  197 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Brucella abortus .......................................................  197 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Brucella melitensis biovar Abortus 2308 ................................  197 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Brucella abortus S19 ...................................................  197 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Bartonella bacilliformis KC583 .........................................  196 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Caulobacter sp. K31 ....................................................  194 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Novosphingobium aromaticivorans DSM 12444 ..............................  194 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Bartonella quintana ....................................................  191 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Agrobacterium tumefaciens str. C58 .....................................  190 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Bartonella tribocorum CIP 105476 .......................................  189 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Erythrobacter litoralis HTCC2594 .......................................  183 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Phenylobacterium zucineum HLK1 .........................................  181 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Wolbachia endosymbiont strain TRS of Brugia malayi .....................  177 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Rickettsia bellii RML369-C .............................................  162 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Neorickettsia sennetsu str. Miyayama ...................................  157 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Rickettsia felis .......................................................  156 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Rickettsia prowazekii ..................................................  142 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Rickettsia typhi .......................................................  142 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Rickettsia conorii .....................................................  141 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . . Acidiphilium cryptum JF-5 ..............................................   92 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . . Rhodopseudomonas palustris BisB5 .......................................   79 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . . Rhodopseudomonas palustris HaA2 ........................................   76 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . . Gluconacetobacter diazotrophicus PAl 5 .................................   76 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . . Rhodopseudomonas palustris BisA53 ......................................   70 1 hit  [a-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Dechloromonas aromatica RCB ----------------------------------------------  150 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Acidithiobacillus ferrooxidans ATCC 53993 ................................  148 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Acidithiobacillus ferrooxidans ATCC 23270 ................................  148 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Chromobacterium violaceum ................................................  147 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Nitrosospira multiformis ATCC 25196 ......................................  147 2 hits [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Acidovorax sp. JS42 ......................................................  147 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Methylibium petroleiphilum PM1 ...........................................  146 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Nitrosomonas europaea ....................................................  146 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Delftia acidovorans SPH-1 ................................................  146 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Burkholderia ambifaria MC40-6 ............................................  145 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Burkholderia multivorans ATCC 17616 ......................................  145 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Ralstonia pickettii 12J ..................................................  144 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Azoarcus sp. BH72 ........................................................  144 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Herminiimonas arsenicoxydans .............................................  144 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Neisseria meningitidis serogroup B .......................................  144 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Burkholderia ambifaria AMMD ..............................................  144 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Thiobacillus denitrificans ATCC 25259 ....................................  144 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Acidovorax citrulli AAC00-1 ..............................................  144 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Neisseria meningitidis serogroup A .......................................  143 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Burkholderia cenocepacia AU 1054 .........................................  143 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Burkholderia cenocepacia MC0-3 ...........................................  143 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Burkholderia cenocepacia J2315 ...........................................  143 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Burkholderia cenocepacia HI2424 ..........................................  143 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Burkholderia sp. 383 .....................................................  143 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Polaromonas sp. JS666 ....................................................  143 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Burkholderia phymatum STM815 .............................................  143 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Nitrosomonas eutropha C91 ................................................  143 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Laribacter hongkongensis HLHK9 ...........................................  143 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Neisseria meningitidis FAM18 .............................................  142 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Leptothrix cholodnii SP-6 ................................................  142 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Ralstonia eutropha H16 ...................................................  141 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Rhodoferax ferrireducens T118 ............................................  141 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Cupriavidus taiwanensis ..................................................  141 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Neisseria meningitidis 053442 ............................................  141 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Cupriavidus metallidurans CH34 ...........................................  141 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Burkholderia pseudomallei ................................................  141 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Burkholderia mallei ......................................................  141 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Burkholderia pseudomallei 1710b ..........................................  141 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Burkholderia mallei NCTC 10247 ...........................................  141 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Burkholderia pseudomallei 1106a ..........................................  141 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Burkholderia mallei SAVP1 ................................................  141 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Burkholderia mallei NCTC 10229 ...........................................  141 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Burkholderia pseudomallei 668 ............................................  141 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Halorhodospira halophila SL1 .............................................  140 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Ralstonia solanacearum ...................................................  140 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Francisella philomiragia subsp. philomiragia ATCC 25017 ..................  140 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Burkholderia thailandensis E264 ..........................................  140 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Neisseria gonorrhoeae FA 1090 ............................................  139 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Neisseria gonorrhoeae NCCP11945 ..........................................  139 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Verminephrobacter eiseniae EF01-2 ........................................  139 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Methylobacillus flagellatus KT ...........................................  139 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Francisella tularensis subsp. holarctica FTNF002-00 ......................  139 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Ralstonia eutropha JMP134 ................................................  139 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Francisella tularensis subsp. holarctica LVS .............................  139 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Francisella tularensis subsp. holarctica OSU18 ...........................  139 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Francisella tularensis subsp. tularensis .................................  139 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Francisella tularensis subsp. tularensis FSC198 ..........................  139 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Bordetella avium 197N ....................................................  139 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Francisella tularensis subsp. mediasiatica FSC147 ........................  139 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Francisella tularensis subsp. tularensis WY96-3418 .......................  138 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Burkholderia vietnamiensis G4 ............................................  138 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1 ............  137 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Legionella pneumophila str. Corby ........................................  137 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Burkholderia xenovorans LB400 ............................................  136 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Legionella pneumophila subsp. pneumophila str. Philadelphia 1 ............  136 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Francisella novicida U112 ................................................  135 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Janthinobacterium sp. Marseille ..........................................  135 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Polynucleobacter necessarius subsp. necessarius STIR1 ....................  135 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Thiomicrospira crunogena XCL-2 ...........................................  134 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Bordetella bronchiseptica ................................................  134 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Aromatoleum aromaticum EbN1 ..............................................  134 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Legionella pneumophila str. Paris ........................................  134 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Bordetella pertussis .....................................................  134 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Bordetella parapertussis .................................................  134 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Legionella pneumophila str. Lens .........................................  133 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Burkholderia phytofirmans PsJN ...........................................  133 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica) ..............  132 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Alkalilimnicola ehrlichii MLHE-1 .........................................  132 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Coxiella burnetii ........................................................  132 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Coxiella burnetii Dugway 5J108-111 .......................................  132 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Polaromonas naphthalenivorans CJ2 ........................................  131 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Candidatus Vesicomyosocius okutanii HA ...................................  131 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Coxiella burnetii RSA 331 ................................................  131 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Nitrosococcus oceani ATCC 19707 ..........................................  130 2 hits [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Bordetella petrii DSM 12804 ..............................................  129 1 hit  [b-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Xanthomonas oryzae pv. oryzae ............................................  129 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Xanthomonas oryzae pv. oryzae MAFF 311018 ................................  129 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Xanthomonas oryzae pv. oryzae PXO99A .....................................  129 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Xanthomonas campestris pv. vesicatoria str. 85-10 ........................  128 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Xanthomonas axonopodis pv. citri .........................................  127 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Thioalkalivibrio sp. HL-EbGR7 ............................................  127 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Xanthomonas campestris pv. campestris str. 8004 ..........................  126 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Xanthomonas campestris pv. campestris ....................................  126 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Xanthomonas campestris pv. campestris str. B100 ..........................  126 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Xylella fastidiosa .......................................................  125 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Xylella fastidiosa Temecula1 .............................................  124 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Xylella fastidiosa M23 ...................................................  124 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Stenotrophomonas maltophilia R551-3 ......................................  121 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Stenotrophomonas maltophilia K279a .......................................  121 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Xylella fastidiosa M12 ...................................................  120 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Geobacter lovleyi SZ .....................................................  114 1 hit  [d-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Syntrophobacter fumaroxidans MPOB ........................................  108 1 hit  [d-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit B/C/D; Al
. . . . Geobacter uraniireducens Rf4 .............................................  104 2 hits [d-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Geobacter metallireducens GS-15 ..........................................  104 2 hits [d-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Geobacter bemidjiensis Bem ...............................................  103 2 hits [d-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Campylobacter fetus subsp. fetus 82-40 ...................................  101 1 hit  [e-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Geobacter sulfurreducens .................................................  100 2 hits [d-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . . Bdellovibrio bacteriovorus ...............................................  100 1 hit  [d-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Pelobacter carbinolicus DSM 2380 .........................................   98 1 hit  [d-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit B/C/D; Al
. . . . Methylococcus capsulatus .................................................   92 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Chromohalobacter salexigens DSM 3043 .....................................   91 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Pseudomonas fluorescens Pf0-1 ............................................   89 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Acinetobacter baumannii ACICU ............................................   89 2 hits [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Acinetobacter baumannii SDF ..............................................   89 2 hits [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Acinetobacter baumannii AYE ..............................................   89 2 hits [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Acinetobacter baumannii ATCC 17978 .......................................   89 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Acinetobacter baumannii AB307-0294 .......................................   89 2 hits [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Acinetobacter baumannii AB0057 ...........................................   89 2 hits [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Shewanella woodyi ATCC 51908 .............................................   89 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Pseudomonas syringae pv. phaseolicola 1448A ..............................   89 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Pseudomonas syringae pv. syringae B728a ..................................   89 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Pseudomonas syringae pv. tomato ..........................................   89 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Psychrobacter sp. PRwf-1 .................................................   88 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Pectobacterium carotovorum subsp. carotovorum PC1 ........................   87 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Pectobacterium atrosepticum ..............................................   87 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Buchnera aphidicola str. Cc (Cinara cedri) ...............................   86 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Azotobacter vinelandii DJ ................................................   86 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Arcobacter butzleri RM4018 ...............................................   86 1 hit  [e-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Pseudomonas fluorescens Pf-5 .............................................   85 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Yersinia enterocolitica subsp. enterocolitica 8081 .......................   85 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Psychrobacter arcticus 273-4 .............................................   85 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Psychrobacter cryohalolentis K5 ..........................................   85 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Yersinia pseudotuberculosis ..............................................   85 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Yersinia pestis Nepal516 .................................................   85 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Yersinia pestis Antiqua ..................................................   85 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Yersinia pestis ..........................................................   85 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Yersinia pseudotuberculosis IP 31758 .....................................   85 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Yersinia pseudotuberculosis PB1/+ ........................................   85 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Yersinia pestis Pestoides F ..............................................   85 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Yersinia pseudotuberculosis YPIII ........................................   85 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Acinetobacter sp. ADP1 ...................................................   84 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Escherichia coli K-12 ....................................................   83 3 hits [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Photorhabdus luminescens subsp. laumondii ................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Escherichia coli 536 .....................................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Shigella flexneri 5 str. 8401 ............................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Escherichia coli O157:H7 .................................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Escherichia coli O157:H7 str. EC4115 .....................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Erwinia tasmaniensis .....................................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Yersinia pestis Angola ...................................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Pseudomonas fluorescens SBW25 ............................................   83 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Escherichia coli str. K-12 substr. DH10B .................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Proteus mirabilis HI4320 .................................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Escherichia coli O6 ......................................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Escherichia coli UTI89 ...................................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Escherichia coli APEC O1 .................................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Escherichia coli S88 .....................................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Escherichia coli ED1a ....................................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Escherichia coli O127:H6 str. E2348/69 ...................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Shigella boydii CDC 3083-94 ..............................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Shigella flexneri ........................................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Shigella boydii Sb227 ....................................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Shigella dysenteriae Sd197 ...............................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Shigella sonnei Ss046 ....................................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Escherichia coli E24377A .................................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Escherichia coli HS ......................................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Escherichia coli ATCC 8739 ...............................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Escherichia coli SMS-3-5 .................................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Escherichia coli IAI39 ...................................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Escherichia coli IAI1 ....................................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Escherichia coli UMN026 ..................................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Escherichia coli SE11 ....................................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Escherichia fergusonii ATCC 35469 ........................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Escherichia coli 55989 ...................................................   83 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Pseudomonas putida W619 ..................................................   82 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Cronobacter sakazakii ATCC BAA-894 .......................................   82 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Edwardsiella ictaluri 93-146 .............................................   82 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Aeromonas hydrophila subsp. hydrophila ATCC 7966 .........................   82 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ........................   82 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Pseudomonas entomophila L48 ..............................................   81 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Serratia proteamaculans 568 ..............................................   81 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Pseudomonas putida GB-1 ..................................................   81 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Pseudomonas putida KT2440 ................................................   81 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Pseudomonas putida F1 ....................................................   81 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Aeromonas salmonicida subsp. salmonicida A449 ............................   80 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Klebsiella pneumoniae 342 ................................................   80 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Salmonella enterica ......................................................   80 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Salmonella enterica subsp. enterica serovar Typhi ........................   80 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Salmonella enterica subsp. enterica serovar Typhimurium ..................   80 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ......   80 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 .....   80 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .......   80 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ........   80 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .................   80 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...   80 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Salmonella enterica subsp. enterica serovar Paratyphi A ..................   80 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ........   80 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 ...   80 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .   80 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Salmonella enterica subsp. enterica serovar Agona str. SL483 .............   80 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Salmonella enterica subsp. enterica serovar Newport str. SL254 ...........   80 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Pseudomonas aeruginosa PA7 ...............................................   80 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Pseudomonas aeruginosa ...................................................   80 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Pseudomonas aeruginosa UCBPP-PA14 ........................................   80 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Pseudomonas mendocina ymp ................................................   79 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Citrobacter koseri ATCC BAA-895 ..........................................   79 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Shewanella oneidensis ....................................................   77 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Sodalis glossinidius str. 'morsitans' ....................................   77 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Enterobacter sp. 638 .....................................................   76 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Buchnera aphidicola (Baizongia pistaciae) ................................   75 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Baumannia cicadellinicola str. Hc (Homalodisca coagulata) ................   75 1 hit  [g-proteobacteria]       RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Buchnera aphidicola str. 5A (Acyrthosiphon pisum) ........................   72 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Buchnera aphidicola (Acyrthosiphon pisum) ................................   72 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum) ......................   72 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Buchnera aphidicola (Schizaphis graminum) ................................   70 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Candidatus Blochmannia pennsylvanicus str. BPEN ..........................   69 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . . Candidatus Blochmannia floridanus ........................................   69 1 hit  [enterobacteria]         RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . Roseiflexus sp. RS-1 -------------------------------------------------------  112 1 hit  [GNS bacteria]           RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Roseiflexus castenholzii DSM 13941 .........................................  111 1 hit  [GNS bacteria]           RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Saccharopolyspora erythraea NRRL 2338 ......................................  101 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Nocardioides sp. JS614 .....................................................   99 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Salinispora tropica CNB-440 ................................................   95 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Moorella thermoacetica ATCC 39073 ..........................................   94 1 hit  [firmicutes]             RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Mycobacterium abscessus ATCC 19977 .........................................   93 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Aquifex aeolicus ...........................................................   93 2 hits [aquificales]            RecName: Full=NADH-quinone oxidoreductase subunit C/D 2; Al
. . . Herpetosiphon aurantiacus ATCC 23779 .......................................   93 1 hit  [GNS bacteria]           RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Salinispora arenicola CNS-205 ..............................................   92 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Sulfurihydrogenibium sp. YO3AOP1 ...........................................   92 1 hit  [aquificales]            RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . Mycobacterium gilvum PYR-GCK ...............................................   89 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Mycobacterium ulcerans Agy99 ...............................................   87 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Mycobacterium avium 104 ....................................................   87 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Mycobacterium marinum M ....................................................   87 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Mycobacterium avium subsp. paratuberculosis ................................   87 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Mycobacterium vanbaalenii PYR-1 ............................................   86 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Mycobacterium smegmatis str. MC2 155 .......................................   86 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Chloroherpeton thalassium ATCC 35110 .......................................   85 1 hit  [green sulfur bacteria]  RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Deinococcus radiodurans ....................................................   83 1 hit  [bacteria]               RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Chlorobium phaeobacteroides DSM 266 ........................................   83 1 hit  [green sulfur bacteria]  RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Thermus thermophilus HB8 ...................................................   83 1 hit  [bacteria]               RecName: Full=NADH-quinone oxidoreductase subunit 5; AltNam
. . . Thermus thermophilus HB27 ..................................................   83 1 hit  [bacteria]               RecName: Full=NADH-quinone oxidoreductase subunit 5; AltNam
. . . Rhodococcus jostii RHA1 ....................................................   82 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Mycobacterium sp. MCS ......................................................   82 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Mycobacterium sp. KMS ......................................................   82 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Mycobacterium sp. JLS ......................................................   82 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Streptomyces coelicolor ....................................................   82 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Acidothermus cellulolyticus 11B ............................................   81 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Nocardia farcinica .........................................................   81 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Mycobacterium bovis ........................................................   81 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Mycobacterium tuberculosis .................................................   81 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Mycobacterium bovis BCG str. Pasteur 1173P2 ................................   81 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Mycobacterium tuberculosis H37Ra ...........................................   81 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Mycobacterium bovis BCG str. Tokyo 172 .....................................   81 1 hit  [high GC Gram+]          RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Deinococcus geothermalis DSM 11300 .........................................   80 1 hit  [bacteria]               RecName: Full=NADH-quinone oxidoreductase subunit C; AltNam
. . . Hydrogenobaculum sp. Y04AAS1 ...............................................   73 1 hit  [aquificales]            RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . Cyanothece sp. ATCC 51142 ..................................................   67 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Synechococcus elongatus PCC 7942 ...........................................   67 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Synechocystis sp. PCC 6803 .................................................   66 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Synechococcus sp. WH 8102 ..................................................   65 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Synechococcus sp. PCC 7002 .................................................   65 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Prochlorococcus marinus str. NATL1A ........................................   65 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Synechococcus elongatus PCC 6301 ...........................................   65 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Synechococcus sp. CC9605 ...................................................   65 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Prochlorococcus marinus str. MIT 9303 ......................................   64 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Synechococcus sp. JA-3-3Ab .................................................   64 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Prochlorococcus marinus str. NATL2A ........................................   64 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Gloeobacter violaceus ......................................................   64 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Synechococcus sp. WH 7803 ..................................................   64 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Synechococcus sp. CC9902 ...................................................   63 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Nostoc sp. PCC 7120 ........................................................   63 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Anabaena variabilis ATCC 29413 .............................................   63 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Prochlorococcus marinus str. MIT 9313 ......................................   63 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Prochlorococcus marinus str. AS9601 ........................................   63 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Nostoc punctiforme PCC 73102 ...............................................   63 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Prochlorococcus marinus str. MIT 9515 ......................................   62 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Synechococcus sp. CC9311 ...................................................   62 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Thermosynechococcus elongatus BP-1 .........................................   62 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Microcystis aeruginosa NIES-843 ............................................   62 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Synechococcus sp. JA-2-3B'a(2-13) ..........................................   62 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Acaryochloris marina MBIC11017 .............................................   62 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Bacteroides thetaiotaomicron ...............................................   60 1 hit  [CFB group bacteria]     RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . Prochlorococcus marinus subsp. pastoris str. CCMP1986 ......................   60 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Prochlorococcus marinus str. MIT 9215 ......................................   60 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Trichodesmium erythraeum IMS101 ............................................   59 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Bacteroides fragilis NCTC 9343 .............................................   59 1 hit  [CFB group bacteria]     RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . Bacteroides fragilis .......................................................   59 1 hit  [CFB group bacteria]     RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . Prochlorococcus marinus str. MIT 9211 ......................................   57 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Synechococcus sp. RCC307 ...................................................   57 1 hit  [cyanobacteria]          RecName: Full=NAD(P)H-quinone oxidoreductase subunit J; Alt
. . . Bacteroides vulgatus ATCC 8482 .............................................   54 1 hit  [CFB group bacteria]     RecName: Full=NADH-quinone oxidoreductase subunit C/D; AltN
. . . Rhodococcus opacus B4 ......................................................   31 1 hit  [high GC Gram+]          RecName: Full=D-alanine--D-alanine ligase; AltName: Full=D-
. . . Staphylococcus haemolyticus JCSC1435 .......................................   31 1 hit  [firmicutes]             RecName: Full=UPF0161 protein SH1134
. . Marchantia polymorpha --------------------------------------------------------  188 2 hits [liverworts]             RecName: Full=NADH-ubiquinone oxidoreductase 27 kDa subunit
. . Oryza sativa Japonica Group (Japanese rice) ..................................  184 2 hits [monocots]               RecName: Full=NADH-ubiquinone oxidoreductase 27 kDa subunit
. . Beta trigyna .................................................................  183 1 hit  [eudicots]               RecName: Full=NADH-ubiquinone oxidoreductase 27 kDa subunit
. . Reclinomonas americana .......................................................  182 1 hit  [eukaryotes]             RecName: Full=NADH-ubiquinone oxidoreductase subunit 9
. . Homo sapiens (man) ...........................................................  182 1 hit  [primates]               RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur p
. . Pongo pygmaeus (orang utan) ..................................................  182 1 hit  [primates]               RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur p
. . Gorilla gorilla gorilla (lowland gorilla) ....................................  182 1 hit  [primates]               RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur p
. . Pan troglodytes ..............................................................  182 1 hit  [primates]               RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur p
. . Beta vulgaris (beet) .........................................................  181 1 hit  [eudicots]               RecName: Full=NADH-ubiquinone oxidoreductase 27 kDa subunit
. . Beta webbiana ................................................................  181 1 hit  [eudicots]               RecName: Full=NADH-ubiquinone oxidoreductase 27 kDa subunit
. . Arabidopsis thaliana (thale-cress) ...........................................  181 3 hits [eudicots]               RecName: Full=NADH-ubiquinone oxidoreductase 27 kDa subunit
. . Neurospora crassa ............................................................  180 1 hit  [ascomycetes]            RecName: Full=NADH-ubiquinone oxidoreductase 30.4 kDa subun
. . Bos taurus (cow) .............................................................  179 1 hit  [even-toed ungulates]    RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur p
. . Mus musculus (mouse) .........................................................  178 2 hits [rodents]                RecName: Full=NADH dehydrogenase [ubiquinone] iron-sulfur p
. . Candida maltosa ..............................................................  177 1 hit  [ascomycetes]            RecName: Full=Probable NADH-ubiquinone oxidoreductase 30.4 
. . Solanum tuberosum (potatoes) .................................................  176 2 hits [eudicots]               RecName: Full=NADH-ubiquinone oxidoreductase 27 kDa subunit
. . Prototheca wickerhamii .......................................................  173 1 hit  [green algae]            RecName: Full=NADH-ubiquinone oxidoreductase subunit 9
. . Acanthamoeba castellanii .....................................................  169 1 hit  [eukaryotes]             RecName: Full=NADH-ubiquinone oxidoreductase subunit 9
. . Dictyostelium discoideum .....................................................  154 1 hit  [cellular slime molds]   RecName: Full=NADH-ubiquinone oxidoreductase subunit 9
. . Dictyostelium citrinum .......................................................  153 1 hit  [cellular slime molds]   RecName: Full=NADH-ubiquinone oxidoreductase subunit 9
. . Paramecium primaurelia .......................................................   70 1 hit  [ciliates]               RecName: Full=NADH-ubiquinone oxidoreductase subunit 9; Alt
. . Zygnema circumcarinatum ......................................................   63 1 hit  [green plants]           RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Paulinella chromatophora .....................................................   62 1 hit  [cercozoans]             RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, org
. . Paramecium tetraurelia .......................................................   61 1 hit  [ciliates]               RecName: Full=NADH-ubiquinone oxidoreductase subunit 9; Alt
. . Agrostis stolonifera (creeping bent grass) ...................................   60 1 hit  [monocots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Physcomitrella patens ........................................................   60 1 hit  [mosses]                 RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Dioscorea elephantipes (elephant's-foot) .....................................   60 1 hit  [monocots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Lotus japonicus ..............................................................   60 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Brachypodium distachyon ......................................................   59 1 hit  [monocots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Triticum aestivum (common wheat) .............................................   59 1 hit  [monocots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Hordeum vulgare (barley) .....................................................   59 1 hit  [monocots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Lolium perenne (perennial ryegrass) ..........................................   59 1 hit  [monocots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Oryza nivara .................................................................   59 1 hit  [monocots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Oryza sativa (red rice) ......................................................   59 1 hit  [monocots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Oryza sativa Indica Group (Indian rice) ......................................   59 1 hit  [monocots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Lemna minor ..................................................................   58 1 hit  [monocots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Illicium oligandrum ..........................................................   58 1 hit  [flowering plants]       RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Zea mays (maize) .............................................................   58 1 hit  [monocots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Saccharum officinarum (sugarcane) ............................................   58 1 hit  [monocots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Saccharum sp. ................................................................   58 1 hit  [monocots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Sorghum bicolor (milo) .......................................................   58 1 hit  [monocots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Glycine max (soybeans) .......................................................   58 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Ceratophyllum demersum (hornwort) ............................................   58 1 hit  [flowering plants]       RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Pelargonium x hortorum (geranium) ............................................   58 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Oenothera elata subsp. hookeri (Hooker's evening primrose) ...................   58 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Oenothera argillicola ........................................................   58 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Oenothera biennis ............................................................   58 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Oenothera glazioviana ........................................................   58 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Oenothera parviflora .........................................................   58 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Adiantum capillus-veneris (maidenhair fern) ..................................   58 1 hit  [vascular plants]        RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Nuphar advena ................................................................   58 1 hit  [flowering plants]       RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Nymphaea alba (white water-lily) .............................................   57 1 hit  [flowering plants]       RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Chaetosphaeridium globosum ...................................................   57 1 hit  [green plants]           RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Liriodendron tulipifera ......................................................   57 1 hit  [flowering plants]       RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Drimys granadensis ...........................................................   57 1 hit  [flowering plants]       RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Spinacia oleracea ............................................................   57 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Piper cenocladum .............................................................   57 1 hit  [flowering plants]       RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Calycanthus floridus var. glaucus ............................................   57 1 hit  [flowering plants]       RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Platanus occidentalis (eastern plane-tree) ...................................   56 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Acorus calamus (flagroot) ....................................................   56 1 hit  [monocots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Acorus americanus (sweetflag) ................................................   56 1 hit  [monocots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Buxus microphylla ............................................................   56 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Ipomoea purpurea .............................................................   56 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Citrus sinensis (Valencia orange) ............................................   56 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Chloranthus spicatus (cha-ran) ...............................................   56 1 hit  [flowering plants]       RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Cicer arietinum (garbanzo) ...................................................   56 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Chlorokybus atmophyticus .....................................................   56 1 hit  [green plants]           RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Ranunculus macranthus ........................................................   56 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Nandina domestica ............................................................   56 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Morus indica .................................................................   56 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Carica papaya (mamon) ........................................................   56 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Vitis vinifera (wine grape) ..................................................   56 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Coffea arabica (arabica coffee) ..............................................   55 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Phaseolus vulgaris (string bean) .............................................   55 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Populus alba (abele) .........................................................   55 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Populus trichocarpa (black cottonwood) .......................................   55 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Gossypium hirsutum (cotton) ..................................................   55 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Gossypium barbadense (Egyptian cotton) .......................................   55 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Anthoceros formosae ..........................................................   55 1 hit  [hornworts]              RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Amborella trichopoda .........................................................   55 1 hit  [flowering plants]       RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Cryptomeria japonica .........................................................   55 1 hit  [conifers]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Cycas taitungensis ...........................................................   54 1 hit  [cycads]                 RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Fagopyrum esculentum subsp. ancestrale .......................................   54 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Staurastrum punctulatum ......................................................   54 1 hit  [green plants]           RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Jasminum nudiflorum (winter jasmine) .........................................   54 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Nicotiana tabacum (tobacco) ..................................................   54 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Atropa belladonna (deadly nightshade) ........................................   54 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Nicotiana tomentosiformis ....................................................   54 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Nicotiana sylvestris .........................................................   54 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Manihot esculenta (yuca) .....................................................   53 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Mesostigma viride ............................................................   53 1 hit  [green plants]           RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Angiopteris evecta ...........................................................   53 1 hit  [vascular plants]        RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Psilotum nudum ...............................................................   53 1 hit  [vascular plants]        RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Solanum bulbocastanum (ornamental nightshade) ................................   53 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Solanum lycopersicum (tomato) ................................................   53 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Aethionema cordifolium .......................................................   53 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Draba nemorosa ...............................................................   53 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Arabis hirsuta (hairy rockcress) .............................................   53 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Eucalyptus globulus subsp. globulus ..........................................   53 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Cucumis sativus (cucumbers) ..................................................   53 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Lupinus luteus ...............................................................   53 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Daucus carota (Queen Anne's lace) ............................................   53 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Trachelium caeruleum .........................................................   52 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Crucihimalaya wallichii ......................................................   52 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Lepidium virginicum ..........................................................   52 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Lobularia maritima (sweet-alyssum) ...........................................   52 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Olimarabidopsis pumila .......................................................   52 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Barbarea verna ...............................................................   52 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Nasturtium officinale (watercress) ...........................................   52 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Capsella bursa-pastoris ......................................................   52 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Helianthus annuus ............................................................   52 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Guizotia abyssinica (werinnua) ...............................................   52 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Lactuca sativa (cultivated lettuce) ..........................................   51 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Aethionema grandiflorum ......................................................   51 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Panax ginseng (insam) ........................................................   51 1 hit  [eudicots]               RecName: Full=NAD(P)H-quinone oxidoreductase subunit J, chl
. . Methanosarcina mazei .........................................................   33 1 hit  [euryarchaeotes]         RecName: Full=Chemotaxis response regulator protein-glutama
. Tobacco ringspot virus strain Bud Blight ---------------------------------------   32 1 hit  [viruses]                RecName: Full=RNA1 polyprotein; AltName: Full=P1; Contains:

BLAST

PROTOCOL


a) BLASTp vs NR, default NCBI parameters * "1000 Max target sequences"

b) BLASTp vs SWISSPROT, default NCBI parameters * "1000 Max target sequences"


RESULTS ANALYSIS

There are a large number of proteins with small E_values (E_value<< e-13), which means that there is goods homologous.

The local alignements of optimum score was using all query sequence.

Through analysis of homologs, we can see that the possible function can be NADH desydrogenase.

The values and sequences that will be used are from the BLASTp vs NR results, because the Results with BLAST vs NR are more complete, the SWISSPROT don't shows the species with the more homology in NR.



RAW RESULTS

a) BLASTp vs NR

                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_05068709.1|  NADH dehydrogenase i chain c [Candidatus P...   308    2e-82
ref|ZP_01256390.1|  NADH Dehydrogenase I Chain C [Psychroflexu...   302    1e-80
ref|YP_266303.1|  NADH dehydrogenase I chain C [Candidatus Pel...   300    4e-80
ref|ZP_01547441.1|  NADH dehydrogenase subunit C [Stappia aggr...   219    1e-55
ref|ZP_01449211.1|  NADH dehydrogenase subunit C [alpha proteo...   218    2e-55
ref|ZP_06055092.1|  NADH-quinone oxidoreductase subunit c (nad...   217    6e-55
ref|YP_612738.1|  NADH dehydrogenase subunit C [Ruegeria sp. T...   213    8e-54
ref|ZP_05116862.1|  putative NADH dehydrogenase, subunit C sub...   212    1e-53
ref|YP_001532652.1|  NADH (or F420H2) dehydrogenase, subunit C...   212    2e-53
ref|YP_001419508.1|  NADH (or F420H2) dehydrogenase, subunit C...   212    2e-53
ref|YP_003060125.1|  NADH (or F420H2) dehydrogenase, subunit C...   212    2e-53
ref|ZP_01056176.1|  NADH dehydrogenase subunit C [Roseobacter ...   211    3e-53
ref|ZP_01756066.1|  NADH dehydrogenase subunit C [Roseobacter ...   211    5e-53
ref|ZP_05788151.1|  NADH-quinone oxidoreductase subunit c [Sil...   211    5e-53
ref|YP_001168201.1|  NADH dehydrogenase subunit C [Rhodobacter...   210    7e-53
ref|ZP_01004099.1|  NADH dehydrogenase subunit C [Loktanella v...   210    7e-53
ref|ZP_05742753.1|  NADH-quinone oxidoreductase subunit c [Sil...   210    8e-53
ref|YP_167991.1|  NADH dehydrogenase subunit C [Ruegeria pomer...   210    8e-53
ref|YP_001923728.1|  NADH (or F420H2) dehydrogenase, subunit C...   209    1e-52
ref|ZP_01014323.1|  NADH dehydrogenase subunit C [Rhodobactera...   209    2e-52
ref|ZP_02187165.1|  NADH dehydrogenase subunit C [alpha proteo...   209    2e-52
ref|ZP_01751815.1|  NADH dehydrogenase subunit C [Roseobacter ...   208    2e-52
ref|YP_001326580.1|  NADH dehydrogenase subunit C [Sinorhizobi...   208    2e-52
ref|ZP_01155238.1|  NADH dehydrogenase subunit C [Oceanicola g...   207    4e-52
ref|ZP_05099136.1|  NADH-quinone oxidoreductase chain c [Roseo...   207    4e-52
ref|ZP_05123921.1|  NADH-quinone oxidoreductase, c subunit [Rh...   207    5e-52
ref|ZP_00951935.1|  NADH dehydrogenase subunit C [Oceanicaulis...   207    5e-52
ref|YP_002525190.1|  NADH-quinone oxidoreductase [Rhodobacter ...   206    1e-51
ref|YP_673586.1|  NADH dehydrogenase subunit C [Mesorhizobium ...   206    1e-51
ref|YP_352576.1|  NADH dehydrogenase subunit C [Rhodobacter sp...   206    1e-51
ref|ZP_05079534.1|  NADH-quinone oxidoreductase chain c [Rhodo...   206    1e-51
gb|AAC12756.1|  NADH-ubiquinone oxidoreductase subunit NuoC [S...   206    1e-51
ref|ZP_01903109.1|  NADH dehydrogenase subunit C [Roseobacter ...   206    1e-51
ref|YP_002297463.1|  NADH dehydrogenase subunit C [Rhodospiril...   206    1e-51
ref|YP_002962051.1|  NADH-quinone oxidoreductase chain C (NADH...   206    1e-51
ref|YP_003067146.1|  NADH-quinone oxidoreductase chain C (NADH...   206    1e-51
ref|ZP_03516456.1|  NADH dehydrogenase subunit C [Rhizobium et...   206    1e-51
ref|YP_002420028.1|  NADH (or F420H2) dehydrogenase, subunit C...   206    2e-51
ref|YP_469130.1|  NADH dehydrogenase subunit C [Rhizobium etli...   206    2e-51
ref|YP_001638558.1|  NADH (or F420H2) dehydrogenase, subunit C...   206    2e-51
ref|ZP_01745364.1|  NADH dehydrogenase subunit C [Sagittula st...   205    2e-51
ref|ZP_05067362.1|  NADH-quinone oxidoreductase, c subunit [Oc...   205    2e-51
ref|NP_385372.1|  NADH dehydrogenase subunit C [Sinorhizobium ...   205    2e-51
ref|YP_001754736.1|  NADH (or F420H2) dehydrogenase, subunit C...   205    2e-51
ref|YP_002499309.1|  NADH (or F420H2) dehydrogenase, subunit C...   205    2e-51
ref|YP_001771168.1|  NADH (or F420H2) dehydrogenase, subunit C...   205    2e-51
ref|ZP_01034315.1|  NADH-quinone oxidoreductase, C subunit [Ro...   205    2e-51
ref|YP_001977829.1|  NADH-ubiquinone oxidoreductase protein, c...   205    2e-51
ref|YP_003449328.1|  NADH dehydrogenase I chain C [Azospirillu...   205    2e-51
ref|NP_102971.1|  NADH dehydrogenase subunit C [Mesorhizobium ...   205    2e-51
emb|CAB51622.1|  nuoC1 [Sinorhizobium meliloti]                     204    3e-51
ref|YP_767306.1|  NADH dehydrogenase subunit C [Rhizobium legu...   204    3e-51
ref|YP_570014.1|  NADH dehydrogenase subunit C [Rhodopseudomon...   204    4e-51
ref|ZP_05810476.1|  NADH (or F420H2) dehydrogenase, subunit C ...   204    5e-51
ref|YP_002280781.1|  NADH dehydrogenase subunit C [Rhizobium l...   204    5e-51
ref|ZP_02146213.1|  NADH dehydrogenase subunit C [Phaeobacter ...   204    5e-51
ref|ZP_05342503.1|  NADH-quinone oxidoreductase subunit c [Tha...   204    6e-51
ref|YP_756587.1|  NADH dehydrogenase subunit C [Maricaulis mar...   204    6e-51
ref|ZP_05089287.1|  NADH-quinone oxidoreductase, c subunit [Ru...   203    7e-51
ref|YP_426644.1|  NADH dehydrogenase subunit C [Rhodospirillum...   203    9e-51
ref|YP_002549233.1|  NADH ubiquinone oxidoreductase chain C [A...   203    1e-50
ref|ZP_00960472.1|  NADH dehydrogenase subunit C [Roseovarius ...   202    1e-50
ref|ZP_05075365.1|  NADH-quinone oxidoreductase, c subunit [Rh...   202    1e-50
ref|ZP_05781505.1|  NADH-quinone oxidoreductase subunit c [Cit...   202    1e-50
ref|YP_486188.1|  NADH dehydrogenase subunit C [Rhodopseudomon...   202    1e-50
sp|O84971.1|NUOC_RHOCA  RecName: Full=NADH-quinone oxidoreduct...   202    1e-50
ref|ZP_05842763.1|  NADH (or F420H2) dehydrogenase, subunit C ...   202    1e-50
ref|ZP_02139511.1|  NADH dehydrogenase subunit C [Roseobacter ...   202    1e-50
ref|YP_422148.1|  NADH dehydrogenase subunit C [Magnetospirill...   202    2e-50
ref|YP_532273.1|  NADH dehydrogenase subunit C [Rhodopseudomon...   202    2e-50
ref|YP_002363198.1|  NADH (or F420H2) dehydrogenase, subunit C...   202    2e-50
ref|ZP_00962633.1|  NADH-quinone oxidoreductase, C subunit [Su...   202    2e-50
ref|ZP_02148881.1|  NADH dehydrogenase subunit C [Phaeobacter ...   202    2e-50
ref|ZP_05050919.1|  NADH dehydrogenase, subunit C subfamily, p...   202    2e-50
ref|YP_760448.1|  NADH dehydrogenase subunit C [Hyphomonas nep...   201    2e-50
ref|YP_001414487.1|  NADH dehydrogenase subunit C [Parvibaculu...   201    3e-50
ref|ZP_01443905.1|  NADH dehydrogenase subunit C [Roseovarius ...   201    3e-50
ref|ZP_02153557.1|  NADH dehydrogenase subunit C [Oceanibulbus...   201    3e-50
ref|ZP_02166626.1|  NADH-ubiquinone oxidoreductase chain C pro...   201    3e-50
ref|ZP_00053336.1|  COG0852: NADH:ubiquinone oxidoreductase 27...   201    3e-50
ref|ZP_03513130.1|  NADH dehydrogenase subunit C [Rhizobium et...   201    4e-50
ref|ZP_00955134.1|  NADH-quinone oxidoreductase, C subunit [Su...   201    4e-50
ref|YP_002825589.1|  NADH-quinone oxidoreductase chain C 1 [Rh...   201    4e-50
ref|ZP_01047990.1|  NADH dehydrogenase subunit C [Nitrobacter ...   201    5e-50
ref|YP_001524585.1|  NADH-ubiquinone dehydrogenase chain C 1 [...   201    5e-50
ref|NP_420761.1|  NADH dehydrogenase subunit C [Caulobacter cr...   200    7e-50
ref|YP_683477.1|  NADH dehydrogenase subunit C [Roseobacter de...   200    8e-50
ref|ZP_05082934.1|  NADH-ubiquinone oxidoreductase chain c pro...   200    8e-50
ref|YP_002288910.1|  NADH-quinone oxidoreductase subunit c [Ol...   200    8e-50
ref|ZP_01879644.1|  NADH dehydrogenase subunit C [Roseovarius ...   200    9e-50
ref|ZP_06350019.1|  NADH (or F420H2) dehydrogenase, subunit C ...   199    1e-49
ref|YP_509113.1|  NADH dehydrogenase subunit C [Jannaschia sp....   199    1e-49
ref|YP_001833497.1|  NADH (or F420H2) dehydrogenase, subunit C...   199    1e-49
ref|ZP_05376758.1|  NADH (or F420H2) dehydrogenase, subunit C ...   199    1e-49
ref|YP_318498.1|  NADH dehydrogenase subunit C [Nitrobacter wi...   199    1e-49
ref|ZP_01000725.1|  NADH dehydrogenase subunit C [Oceanicola b...   199    1e-49
ref|NP_540073.1|  NADH dehydrogenase subunit C [Brucella melit...   199    2e-49
ref|ZP_01742980.1|  NADH dehydrogenase subunit C [Rhodobactera...   198    2e-49
ref|ZP_03785338.1|  NADH dehydrogenase subunit C [Brucella cet...   198    2e-49
ref|ZP_05032687.1|  NADH (or F420H2) dehydrogenase, subunit C ...   198    3e-49
ref|NP_948291.1|  NADH dehydrogenase subunit C [Rhodopseudomon...   197    3e-49
ref|YP_665665.1|  NADH dehydrogenase subunit 9 [Nephroselmis o...   197    4e-49
ref|YP_002544107.1|  NADH-ubiquinone oxidoreductase chain C pr...   197    4e-49
ref|YP_033697.1|  NADH dehydrogenase subunit C [Bartonella hen...   197    5e-49
ref|YP_001370965.1|  NADH dehydrogenase subunit C [Ochrobactru...   197    5e-49
ref|YP_221546.1|  NADH dehydrogenase subunit C [Brucella abort...   197    6e-49
ref|YP_001206161.1|  NADH dehydrogenase subunit C [Bradyrhizob...   196    9e-49
ref|ZP_06171463.1|  NADH (or F420H2) dehydrogenase, subunit C ...   196    1e-48
ref|YP_989072.1|  NADH dehydrogenase subunit C [Bartonella bac...   196    1e-48
emb|CAM76331.1|  NADH dehydrogenase I, C subunit [Magnetospiri...   196    2e-48
ref|ZP_01018524.1|  NADH dehydrogenase subunit C [Parvularcula...   195    2e-48
ref|ZP_01440266.1|  NADH dehydrogenase subunit C [Fulvimarina ...   195    2e-48
ref|YP_781439.1|  NADH dehydrogenase subunit C [Rhodopseudomon...   195    2e-48
ref|ZP_01225754.1|  NADH dehydrogenase I, C subunit [Aurantimo...   195    3e-48
ref|YP_001240498.1|  NADH dehydrogenase subunit C [Bradyrhizob...   195    3e-48
ref|ZP_01862955.1|  NADH (or F420H2) dehydrogenase, subunit C ...   195    3e-48
ref|YP_616356.1|  NADH (or F420H2) dehydrogenase, subunit C [S...   195    3e-48
ref|YP_577471.1|  NADH dehydrogenase subunit C [Nitrobacter ha...   194    3e-48
ref|XP_504891.1|  YALI0F02123p [Yarrowia lipolytica] >emb|CAB6...   194    3e-48
ref|ZP_01039818.1|  NADH dehydrogenase subunit C [Erythrobacte...   194    4e-48
ref|ZP_04680017.1|  NADH (or F420H2) dehydrogenase, subunit C ...   194    5e-48
ref|YP_001684459.1|  NADH dehydrogenase subunit C [Caulobacter...   194    5e-48
ref|YP_497572.1|  NADH (or F420H2) dehydrogenase, subunit C [N...   194    5e-48
ref|YP_916036.1|  NADH dehydrogenase subunit C [Paracoccus den...   193    6e-48
ref|XP_571409.1|  NADH-ubiquinone oxidoreductase 30.4 kDa subu...   193    6e-48
ref|YP_001263473.1|  NADH (or F420H2) dehydrogenase, subunit C...   193    9e-48
ref|NP_771557.1|  NADH dehydrogenase subunit C [Bradyrhizobium...   193    1e-47
ref|NP_943683.1|  NADH dehydrogenase subunit 9 [Chara vulgaris...   192    1e-47
ref|YP_717282.1|  nad9 [Ostreococcus tauri] >emb|CAL36404.1| u...   192    1e-47
ref|YP_002860157.1|  NADH dehydrogenase subunit 9 [Micromonas ...   192    2e-47
gb|ACI95883.1|  NADH dehydrogenase subunit 9 [Isoetes engelman...   192    2e-47
ref|XP_001828448.1|  hypothetical protein CC1G_04419 [Coprinop...   192    2e-47
ref|XP_002109001.1|  hypothetical protein TRIADDRAFT_52564 [Tr...   192    2e-47
ref|ZP_06359847.1|  NADH (or F420H2) dehydrogenase, subunit C ...   192    2e-47
ref|YP_002979135.1|  NADH (or F420H2) dehydrogenase, subunit C...   191    3e-47
ref|YP_002971985.1|  NADH dehydrogenase I subunit C [Bartonell...   191    3e-47
ref|XP_757828.1|  hypothetical protein UM01681.1 [Ustilago may...   191    3e-47
ref|ZP_04770976.1|  NADH (or F420H2) dehydrogenase, subunit C ...   191    3e-47
ref|YP_001603270.1|  NADH-quinone oxidoreductase chain C [Gluc...   191    3e-47
sp|P29917.3|NQO5_PARDE  RecName: Full=NADH-quinone oxidoreduct...   191    4e-47
ref|ZP_06121647.1|  NADH (or F420H2) dehydrogenase, subunit C ...   191    4e-47
ref|YP_539028.1|  NADH dehydrogenase subunit 9 [Physcomitrella...   191    5e-47
ref|YP_032221.1|  NADH dehydrogenase subunit C [Bartonella qui...   190    6e-47
ref|NP_054446.1|  NADH dehydrogenase subunit 9 [Marchantia pol...   190    7e-47
ref|NP_354280.1|  NADH dehydrogenase subunit C [Agrobacterium ...   190    7e-47
ref|NP_689378.1|  NADH dehydrogenase subunit 9 [Chaetosphaerid...   190    7e-47
ref|ZP_01303057.1|  NADH (or F420H2) dehydrogenase, subunit C ...   189    1e-46
ref|XP_001873647.1|  predicted protein [Laccaria bicolor S238N...   189    2e-46
sp|P34944.2|NDUS3_MARPO  RecName: Full=NADH-ubiquinone oxidore...   189    2e-46
ref|YP_001609580.1|  NADH dehydrogenase subunit C [Bartonella ...   188    2e-46
ref|XP_001729618.1|  hypothetical protein MGL_3162 [Malassezia...   188    2e-46
ref|YP_153752.1|  NADH-ubiquinone oxidoreductase subunit [Anap...   187    4e-46
ref|XP_002145892.1|  NADH-ubiquinone oxidoreductase 304 kDa su...   187    4e-46
ref|XP_002145893.1|  NADH-ubiquinone oxidoreductase 304 kDa su...   187    5e-46
ref|XP_002478155.1|  NADH-ubiquinone oxidoreductase 304 kDa su...   187    6e-46
ref|XP_001690652.1|  NADH:ubiquinone oxidoreductase ND9 subuni...   186    9e-46
ref|YP_448702.1|  NADH dehydrogenase subunit 9 [Dictyota dicho...   186    1e-45
ref|YP_003328692.1|  NADH dehydrogenase subunit C [Anaplasma c...   186    2e-45
ref|XP_002163056.1|  PREDICTED: similar to NADH dehydrogenase ...   185    2e-45
gb|AAQ55457.1|  putative NADH dehydrogenase subunit 9 precurso...   184    3e-45
ref|XP_002541766.1|  NADH-ubiquinone oxidoreductase 30.4 kDa s...   184    3e-45
ref|XP_001105264.1|  PREDICTED: similar to NADH dehydrogenase ...   184    4e-45
ref|YP_002000595.1|  NADH dehydrogenase subunit 9 [Oryza sativ...   184    4e-45
sp|Q35322.2|NDUS3_ORYSJ  RecName: Full=NADH-ubiquinone oxidore...   184    4e-45
emb|CAI23792.1|  NADH dehydrogenase, subunit 9 [Zea mays]           184    4e-45
ref|XP_001178712.1|  PREDICTED: similar to NADH dehydrogenase ...   184    6e-45
gb|ACO50724.1|  NADH dehydrogenase subunit 9 [Micromonas pusil...   184    6e-45
ref|YP_003276005.1|  NADH dehydrogenase subunit 9 [Pleurozia p...   183    7e-45
gb|EEQ44210.1|  NADH-ubiquinone oxidoreductase subunit 9 [Cand...   183    7e-45
ref|XP_721781.1|  potential mitochondrial Complex I, NUGM_30kd...   183    7e-45
ref|YP_458226.1|  NADH dehydrogenase I, C subunit [Erythrobact...   183    8e-45
ref|NP_001139804.1|  NADH dehydrogenase [ubiquinone] iron-sulf...   183    9e-45
ref|XP_002419079.1|  NADH-ubiquinone oxidoreductase subunit, m...   183    9e-45
sp|Q33994.1|NDUS3_BETTR  RecName: Full=NADH-ubiquinone oxidore...   183    1e-44
ref|XP_796382.2|  PREDICTED: similar to NADH dehydrogenase (ub...   182    1e-44
ref|NP_004542.1|  NADH dehydrogenase [ubiquinone] iron-sulfur ...   182    1e-44
ref|NP_044783.1|  NADH dehydrogenase subunit 9 [Reclinomonas a...   182    1e-44
ref|NP_001073382.1|  NADH dehydrogenase [ubiquinone] iron-sulf...   182    1e-44
sp|Q0MQG7.1|NDUS3_GORGO  RecName: Full=NADH dehydrogenase [ubi...   182    1e-44
sp|Q0MQG6.1|NDUS3_PONPY  RecName: Full=NADH dehydrogenase [ubi...   182    1e-44
ref|XP_001247588.1|  hypothetical protein CIMG_01359 [Coccidio...   182    1e-44
ref|YP_003065267.1|  NADH dehydrogenase subunit C [Candidatus ...   182    1e-44
ref|NP_150409.1|  NADH dehydrogenase subunit 9 [Pylaiella litt...   182    2e-44
gb|AAD40386.1|  NADH-Ubiquinone reductase [Homo sapiens]            182    2e-44
ref|YP_684387.1|  NADH dehydrogenase subunit 9 [Oltmannsiellop...   182    2e-44
gb|AAA32025.2|  NADH dehydrogenase [Phytophthora megasperma]        182    2e-44
ref|ZP_00544994.1|  NADH (or F420H2) dehydrogenase, subunit C ...   182    2e-44
ref|NP_001088888.1|  NADH dehydrogenase (ubiquinone) Fe-S prot...   182    2e-44
ref|YP_717114.1|  NADH dehydrogenase subunit 9 [Brassica napus...   182    2e-44
ref|XP_002131761.1|  PREDICTED: similar to NADH dehydrogenase ...   182    2e-44
gb|EEU41113.1|  predicted protein [Nectria haematococca mpVI 7...   182    2e-44
gb|AAF86494.1|AF279447_1  NADH dehydrogenase subunit 9 [Lupinu...   182    2e-44
ref|XP_389410.1|  hypothetical protein FG09234.1 [Gibberella z...   181    3e-44
gb|EEQ27665.1|  NADH-ubiquinone oxidoreductase kDa subunit [Mi...   181    3e-44
ref|NP_037602.1|  NADH dehydrogenase subunit 9 [Phytophthora i...   181    3e-44
ref|YP_002130643.1|  NADH dehydrogenase I, C subunit [Phenylob...   181    3e-44
ref|NP_001088497.1|  hypothetical protein LOC495365 [Xenopus l...   181    3e-44
ref|NP_063974.2|  NADH dehydrogenase subunit 9 [Beta vulgaris ...   181    4e-44
dbj|BAD96975.1|  NADH dehydrogenase (ubiquinone) Fe-S protein ...   181    4e-44
gb|AAW69332.1|  NADH-ubiquinone oxidoreductase-like protein [M...   181    4e-44
gb|EFB16080.1|  hypothetical protein PANDA_010603 [Ailuropoda ...   181    4e-44
emb|CAB63881.1|  hypothetical protein [Homo sapiens]                181    4e-44
sp|Q95748.2|NDUS3_ARATH  RecName: Full=NADH-ubiquinone oxidore...   181    4e-44
ref|XP_363407.1|  hypothetical protein MGG_01333 [Magnaporthe ...   181    4e-44
sp|Q34011.2|NDUS3_BETWE  RecName: Full=NADH-ubiquinone oxidore...   181    4e-44
ref|YP_180171.1|  NADH-quinone oxidoreductase chain C [Ehrlich...   181    4e-44
ref|XP_001596014.1|  NADH-ubiquinone oxidoreductase 30.4 kDa s...   181    4e-44
ref|XP_001268091.1|  NADH-ubiquinone oxidoreductase 304 kDa su...   181    4e-44
ref|XP_002198697.1|  PREDICTED: NADH dehydrogenase (ubiquinone...   181    5e-44
ref|NP_001003921.1|  NADH dehydrogenase (ubiquinone) Fe-S prot...   181    6e-44
ref|XP_533185.2|  PREDICTED: similar to NADH dehydrogenase (ub...   180    6e-44
emb|CAJ82146.1|  NADH dehydrogenase (ubiquinone) Fe-S protein ...   180    7e-44
gb|AAW21977.1|  NADH dehydrogenase subunit 9 [Plasmopara vitic...   180    7e-44
ref|XP_001370635.1|  PREDICTED: similar to NADH dehydrogenase ...   180    7e-44
ref|XP_001906118.1|  unnamed protein product [Podospora anseri...   180    7e-44
ref|XP_001742494.1|  NADH dehydrogenase Fe S [Monosiga brevico...   180    8e-44
ref|XP_002199900.1|  PREDICTED: NADH dehydrogenase (ubiquinone...   180    8e-44
ref|XP_001952447.1|  PREDICTED: similar to AGAP006456-PA [Acyr...   180    9e-44
ref|XP_957689.1|  NADH:ubiquinone oxidoreductase 30.4kD subuni...   180    9e-44
ref|NP_001017755.1|  NADH dehydrogenase [ubiquinone] iron-sulf...   179    1e-43
gb|AAF86496.1|AF279449_1  NADH dehydrogenase subunit 9 [Lupinu...   179    1e-43
ref|XP_001491322.2|  PREDICTED: similar to NADH dehydrogenase ...   179    1e-43
ref|XP_002557711.1|  Pc12g08820 [Penicillium chrysogenum Wisco...   179    1e-43
ref|XP_001257997.1|  NADH-ubiquinone oxidoreductase 304 kDa su...   179    1e-43
gb|ACI69869.1|  NADH dehydrogenase iron-sulfur protein 3, mito...   179    1e-43
ref|YP_003434217.1|  NADH dehydrogenase subunit 9 [Chattonella...   179    1e-43
ref|YP_001248971.1|  NADH dehydrogenase I chain C [Orientia ts...   179    2e-43
gb|EEH19559.1|  NADH-ubiquinone oxidoreductase 27 kDa subunit ...   179    2e-43
gb|EEH47432.1|  NADH dehydrogenase iron-sulfur protein [Paraco...   179    2e-43
ref|XP_001394604.1|  hypothetical protein An11g06200 [Aspergil...   179    2e-43
ref|NP_777244.1|  NADH dehydrogenase [ubiquinone] iron-sulfur ...   179    2e-43
gb|EEH38386.1|  NADH dehydrogenase iron-sulfur protein [Paraco...   179    2e-43
ref|YP_001937605.1|  NADH dehydrogenase I chain C [Orientia ts...   178    2e-43
ref|YP_302932.1|  NADH (or F420H2) dehydrogenase, subunit C [E...   178    2e-43
ref|YP_448624.1|  NADH dehydrogenase subunit 9 [Fucus vesiculo...   178    2e-43
sp|P23709.1|NDUS3_BOVIN  RecName: Full=NADH dehydrogenase [ubi...   178    2e-43
ref|XP_002382051.1|  NADH-ubiquinone oxidoreductase 304 kDa su...   178    2e-43
ref|XP_001819064.1|  hypothetical protein [Aspergillus oryzae ...   178    3e-43
dbj|BAB22149.1|  unnamed protein product [Mus musculus]             178    3e-43
ref|NP_080964.1|  NADH dehydrogenase [ubiquinone] iron-sulfur ...   178    3e-43
ref|XP_002547875.1|  NADH-ubiquinone oxidoreductase 30.4 kDa s...   178    3e-43
ref|YP_001874777.1|  NADH dehydrogenase subunit 9 [Hemiselmis ...   178    3e-43
ref|XP_002615534.1|  hypothetical protein CLUG_04416 [Clavispo...   178    3e-43
gb|ACO51781.1|  NADH dehydrogenase iron-sulfur protein 3, mito...   178    3e-43
ref|XP_002627405.1|  NADH-ubiquinone oxidoreductase 30.4 kDa s...   178    3e-43
gb|AAH27270.1|  NADH dehydrogenase (ubiquinone) Fe-S protein 3...   178    3e-43
ref|YP_003288913.1|  NADH dehydrogenase subunit 9 [Saccharina ...   178    3e-43
ref|NP_659275.1|  NADH dehydrogenase subunit 9 [Laminaria digi...   177    4e-43
ref|YP_001165386.1|  NADH dehydrogenase subunit 9 [Phytophthor...   177    4e-43
gb|ACO13552.1|  NADH dehydrogenase iron-sulfur protein 3, mito...   177    4e-43
ref|XP_001513308.1|  PREDICTED: similar to NADH dehydrogenase ...   177    4e-43
ref|YP_003288875.1|  NADH dehydrogenase subunit 9 [Saccharina ...   177    4e-43
ref|YP_001165343.1|  NADH dehydrogenase subunit 9 [Phytophthor...   177    4e-43
ref|YP_198074.1|  NADH:ubiquinone oxidoreductase chain C [Wolb...   177    5e-43
sp|Q00673.1|NDUS3_CANMA  RecName: Full=Probable NADH-ubiquinon...   177    5e-43
gb|ABY55256.1|  NADH dehydrogenase ubiquinone Fe-S protein 3 [...   177    5e-43
ref|XP_002604665.1|  hypothetical protein BRAFLDRAFT_167919 [B...   177    5e-43
gb|EEY21793.1|  NADH dehydrogenase iron-sulfur protein [Vertic...   177    6e-43
ref|XP_001892941.1|  NADH-ubiquinone oxidoreductase 30 kDa sub...   177    6e-43
ref|XP_002389728.1|  hypothetical protein MPER_11103 [Moniliop...   177    6e-43
gb|AAY63976.1|  NADH dehydrogenase [Lysiphlebus testaceipes]        177    6e-43
gb|ACI67788.1|  NADH dehydrogenase iron-sulfur protein 3, mito...   177    7e-43
ref|XP_750770.1|  NADH-ubiquinone oxidoreductase 304 kDa subun...   176    8e-43
ref|XP_001215808.1|  NADH-ubiquinone oxidoreductase 30.4 kDa s...   176    9e-43
ref|NP_001099959.1|  NADH dehydrogenase (ubiquinone) Fe-S prot...   176    1e-42
ref|XP_894449.1|  PREDICTED: similar to NADH dehydrogenase (ub...   176    1e-42
sp|P80261.3|NDUS3_SOLTU  RecName: Full=NADH-ubiquinone oxidore...   176    1e-42
gb|ACS27113.1|  NADH dehydrogenase subunit 9 [Heterosigma akas...   176    1e-42
ref|XP_001863738.1|  NADH dehydrogenase iron-sulfur protein 3,...   176    1e-42
gb|EDL79488.1|  NADH dehydrogenase (ubiquinone) Fe-S protein 3...   176    1e-42
ref|YP_448663.1|  NADH dehydrogenase subunit 9 [Desmarestia vi...   176    1e-42
ref|XP_001796755.1|  hypothetical protein SNOG_06383 [Phaeosph...   176    2e-42
gb|EEH05636.1|  NADH-ubiquinone oxidoreductase [Ajellomyces ca...   176    2e-42
ref|XP_001538159.1|  NADH-ubiquinone oxidoreductase 30.4 kDa s...   176    2e-42
gb|EER41498.1|  NADH-ubiquinone oxidoreductase subunit [Ajello...   176    2e-42
ref|XP_001527248.1|  NADH-ubiquinone oxidoreductase subunit 9 ...   175    2e-42
ref|XP_456843.1|  hypothetical protein DEHA0A12265g [Debaryomy...   175    2e-42
ref|XP_001472715.1|  PREDICTED: hypothetical protein [Mus musc...   175    2e-42
gb|EDL07739.1|  mCG50233, isoform CRA_a [Mus musculus]              175    3e-42
tpe|CBF85447.1|  TPA: NADH-ubiquinone oxidoreductase 30.4 kDa ...   174    3e-42
ref|XP_001557083.1|  hypothetical protein BC1G_04333 [Botryoti...   174    4e-42
ref|XP_001931808.1|  NADH dehydrogenase iron-sulfur protein 3,...   174    4e-42
ref|XP_001486257.1|  hypothetical protein PGUG_01928 [Pichia g...   174    5e-42
ref|NP_001165786.1|  NADH dehydrogenase [ubiquinone] iron-sulf...   174    5e-42
ref|XP_001386464.2|  NADH-ubiquinone oxidoreductase 30.4 kDa s...   174    5e-42
ref|ZP_01314776.1|  hypothetical protein Wendoof_01000399 [Wol...   174    6e-42
ref|NP_966841.1|  NADH dehydrogenase I, C subunit [Wolbachia e...   174    6e-42
ref|XP_002493526.1|  hypothetical protein [Pichia pastoris GS1...   174    7e-42
gb|ACO10677.1|  NADH dehydrogenase iron-sulfur protein 3, mito...   174    7e-42
ref|YP_745121.1|  NADH-quinone oxidoreductase chain C [Granuli...   173    8e-42
ref|NP_042261.1|  NADH dehydrogenase (ubiquinone), subunit 9 [...   173    9e-42
ref|ZP_00373214.1|  NADH dehydrogenase I, C subunit [Wolbachia...   173    1e-41
ref|YP_001975611.1|  NADH dehydrogenase I, C subunit [Wolbachi...   172    1e-41
ref|YP_003188153.1|  NADH-quinone oxidoreductase chain C [Acet...   172    1e-41
ref|YP_505116.1|  NADH dehydrogenase I, C subunit [Anaplasma p...   172    2e-41
ref|XP_316497.2|  AGAP006456-PA [Anopheles gambiae str. PEST] ...   172    2e-41
ref|XP_659332.1|  hypothetical protein AN1728.2 [Aspergillus n...   172    2e-41
dbj|BAD66816.1|  NADH dehydrogenase subunit 9 [Beta vulgaris s...   172    2e-41
ref|XP_002007522.1|  GI12345 [Drosophila mojavensis] >gb|EDW17...   172    2e-41
gb|ACO15274.1|  NADH dehydrogenase iron-sulfur protein 3, mito...   172    2e-41
ref|XP_002083436.1|  GD13354 [Drosophila simulans] >gb|EDX0902...   171    3e-41
ref|XP_002035143.1|  GM14080 [Drosophila sechellia] >gb|EDW502...   171    3e-41
ref|XP_002046899.1|  GJ12236 [Drosophila virilis] >gb|EDW69241...   171    4e-41
prf||2009372A  NADH dehydrogenase:SUBUNIT=9                         171    4e-41
ref|XP_966588.1|  PREDICTED: similar to AGAP006456-PA [Triboli...   171    4e-41
ref|XP_002580233.1|  NADH-ubiquinone oxidoreductase [Schistoso...   171    4e-41
gb|AAK82657.1|AF276428_1  NADH dehydrogenase subunit 9 [Beta v...   171    4e-41
ref|XP_001983773.1|  GH16082 [Drosophila grimshawi] >gb|EDV961...   171    4e-41
ref|XP_001957028.1|  GF10219 [Drosophila ananassae] >gb|EDV398...   171    5e-41
ref|XP_001971351.1|  GG14478 [Drosophila erecta] >gb|EDV50377....   171    5e-41
gb|AAP06227.1|  SJCHGC06115 protein [Schistosoma japonicum] >e...   171    5e-41
ref|YP_052922.1|  NADH dehydrogenase subunit 9 [Saprolegnia fe...   171    5e-41
ref|NP_647775.1|  CG12079 [Drosophila melanogaster] >gb|AAF477...   171    5e-41
ref|XP_001352740.1|  GA11380 [Drosophila pseudoobscura pseudoo...   171    5e-41
gb|ACO12881.1|  NADH dehydrogenase iron-sulfur protein 3, mito...   171    6e-41
ref|XP_002025595.1|  GL20750 [Drosophila persimilis] >gb|EDW31...   170    6e-41
ref|XP_002640168.1|  C. briggsae CBR-NUO-2 protein [Caenorhabd...   170    6e-41
ref|XP_002413990.1|  NADH-ubiquinone oxidoreductase, NDUFS3/30...   170    7e-41
ref|XP_002094139.1|  GE21665 [Drosophila yakuba] >gb|EDW93851....   170    7e-41
dbj|BAA07214.1|  NADH dehydrogenase subunit 9 [Beta trigyna]        170    7e-41
ref|XP_002335983.1|  predicted protein [Populus trichocarpa] >...   170    8e-41
emb|CBI53615.1|  unnamed protein product [Sordaria macrospora]      170    9e-41
ref|XP_002068926.1|  GK18031 [Drosophila willistoni] >gb|EDW79...   169    1e-40
gb|ADD18604.1|  NADH-ubiquinone oxidoreductase NDUFS3/30kDa su...   169    1e-40
ref|ZP_03500442.1|  NADH dehydrogenase subunit C [Rhizobium et...   169    1e-40
ref|YP_001315138.1|  NADH dehydrogenase subunit 9 [Chlorokybus...   169    1e-40
ref|NP_042560.1|  NADH dehydrogenase, subunit 9 [Acanthamoeba ...   169    2e-40
ref|NP_871796.1|  NADH Ubiquinone Oxidoreductase family member...   169    2e-40
ref|YP_001234061.1|  NADH (or F420H2) dehydrogenase, subunit C...   169    2e-40
ref|NP_491881.2|  NADH Ubiquinone Oxidoreductase family member...   168    2e-40
dbj|BAA07215.1|  NADH dehydrogenase subunit 9 [Beta webbiana]       168    3e-40
ref|XP_394885.1|  PREDICTED: similar to CG12079-PA [Apis melli...   168    3e-40
ref|XP_002535359.1|  NADH-ubiquinone oxidoreductase mitochondr...   168    3e-40
ref|XP_001227171.1|  hypothetical protein CHGG_09244 [Chaetomi...   168    3e-40
gb|AAG23682.1|AF288091_27  NADH dehydrogenase subunit 9 [Thrau...   166    1e-39
gb|AAF86491.1|AF279444_1  NADH dehydrogenase subunit 9 [Lupinu...   166    2e-39
gb|ABB54699.1|  NADH dehydrogenase subunit 9 [Brassica olerace...   165    2e-39
ref|YP_002608216.1|  NADH dehydrogenase subunit 9 [Carica papa...   165    3e-39
ref|YP_001496515.1|  NADH dehydrogenase subunit C [Rickettsia ...   164    3e-39
ref|YP_003081629.1|  NADH-quinone oxidoreductase chain c 1 [Ne...   164    4e-39
gb|AAF86492.1|AF279445_1  NADH dehydrogenase subunit 9 [Lupinu...   164    4e-39
ref|NP_085479.1|  NADH dehydrogenase subunit 9 [Arabidopsis th...   164    5e-39
gb|AAF86490.1|AF279443_1  NADH dehydrogenase subunit 9 [Lupinu...   164    5e-39
ref|YP_173479.1|  NADH dehydrogenase subunit 9 [Nicotiana taba...   164    6e-39
gb|ABS50638.1|  NADH dehydrogenase subunit 9 [Arabidopsis thal...   164    7e-39
gb|ACT36216.1|  NADH dehydrogenase subunit 9 [Helicosporidium ...   163    8e-39
emb|CAA56168.1|  NADH dehydrogenase [Solanum tuberosum]             163    1e-38
ref|YP_537566.1|  NADH dehydrogenase subunit C [Rickettsia bel...   162    1e-38
ref|NP_066419.1|  NADH dehydrogenase subunit 9 [Ochromonas dan...   162    2e-38
gb|AAQ82457.1|  NADH-ubiquinone oxidoreductase 30.4 kDa subuni...   162    3e-38
ref|XP_001629107.1|  predicted protein [Nematostella vectensis...   161    4e-38
ref|NP_066312.1|  NADH dehydrogenase subunit 9 [Malawimonas ja...   161    4e-38
dbj|BAA11532.1|  subunit 9 of NADH dehydrogenase [Arabidopsis ...   161    4e-38
gb|AAW30337.1|  NADH dehydrogenase subunit 9 [Piper betle]          160    5e-38
ref|NP_066483.1|  NADH dehydrogenase subunit 9 [Rhodomonas sal...   160    6e-38
ref|YP_398414.1|  nad9 [Triticum aestivum] >emb|CAA49376.1| 30...   160    7e-38
gb|ABX45160.1|  NADH dehydrogenase subunit 9 [Polysphondylium ...   160    8e-38
gb|ADA85897.1|  NADH hydrogenase subunit 9 [Allium cepa]            159    2e-37
ref|YP_588298.1|  NADH dehydrogenase subunit 9 [Zea mays subsp...   158    3e-37
ref|YP_002860265.1|  NADH dehydrogenase subunit 9 [Megaceros a...   158    3e-37
ref|YP_514683.1|  NADH dehydrogenase subunit 9 [Oryza sativa I...   158    3e-37
ref|YP_665720.1|  NADH dehydrogenase subunit 9 [Mesostigma vir...   158    3e-37
ref|YP_001493336.1|  NADH dehydrogenase subunit C [Rickettsia ...   158    4e-37
ref|ZP_03523094.1|  NADH dehydrogenase subunit C [Rhizobium et...   157    4e-37
ref|YP_506318.1|  NADH dehydrogenase I, C subunit [Neoricketts...   157    6e-37
ref|YP_209576.1|  NADH dehydrogenase subunit 9 [Polysphondyliu...   157    6e-37
ref|YP_002608366.1|  NADH dehydrogenase subunit 9 [Vitis vinif...   157    7e-37
ref|ZP_04699245.1|  NADH-quinone oxidoreductase subunit C [Ric...   157    8e-37
emb|CAI83762.1|  NADH dehydrogenase subunit 9 [Helianthus annuus]   156    1e-36
ref|XP_002277597.1|  PREDICTED: similar to nad9 [Vitis vinifera]    156    1e-36
ref|YP_246581.1|  NADH dehydrogenase subunit C [Rickettsia fel...   155    2e-36
gb|ADD62217.1|  NADH dehydrogenase subunit 9 [Hartmannella ver...   155    2e-36
gb|AAW30335.1|  NADH dehydrogenase subunit 9 [Berberis bealei]      155    3e-36
ref|NP_050084.1|  NADH dehydrogenase subunit 9 [Dictyostelium ...   154    6e-36
ref|ZP_05291984.1|  NADH-ubiquinone oxidoreductase chain C [Ac...   154    7e-36
ref|YP_492628.1|  NADH dehydrogenase subunit 9 [Dictyostelium ...   153    8e-36
ref|YP_001661408.1|  NADH dehydrogenase subunit 9 [Cycas taitu...   153    8e-36
ref|YP_316618.1|  NADH dehydrogenase subunit 9 [Thalassiosira ...   153    9e-36
ref|NP_038176.1|  NADH dehydrogenase subunit 9 [Chrysodidymus ...   153    1e-35
ref|YP_003049035.1|  NADH (or F420H2) dehydrogenase, subunit C...   153    1e-35
ref|ZP_03527070.1|  NADH dehydrogenase subunit C [Rhizobium et...   153    1e-35
ref|YP_003412101.1|  NADH dehydrogenase subunit 9 [Phaeoceros ...   152    1e-35
gb|AAW30330.1|  NADH dehydrogenase subunit 9 [Asarum sp. Qiu 9...   152    2e-35
ref|ZP_05498443.1|  NADH (or F420H2) dehydrogenase, subunit C ...   152    2e-35
gb|AAW30332.1|  NADH dehydrogenase subunit 9 [Eichhornia crass...   152    2e-35
gb|AAW30331.1|  NADH dehydrogenase subunit 9 [Calycanthus flor...   151    4e-35
gb|AAW30341.1|  NADH dehydrogenase subunit 9 [Lonicera sp. Ber...   151    5e-35
ref|YP_284177.1|  NADH dehydrogenase subunit C [Dechloromonas ...   150    5e-35
gb|ACU30386.1|  NADH dehydrogenase subunit 9 [Silene conica]        150    5e-35
gb|AAW30334.1|  NADH dehydrogenase subunit 9 [Liriodendron tul...   150    6e-35
gb|ACU30406.1|  NADH dehydrogenase subunit 9 [Silene macrodonta]    150    7e-35
ref|YP_001492452.1|  NADH dehydrogenase subunit C [Rickettsia ...   150    8e-35
ref|XP_002432001.1|  NADH-ubiquinone oxidoreductase 30 kDa sub...   150    8e-35
ref|ZP_05338979.1|  NADH (or F420H2) dehydrogenase, subunit C ...   150    1e-34
ref|XP_002263031.1|  PREDICTED: hypothetical protein [Vitis vi...   149    1e-34
gb|AAW30338.1|  NADH dehydrogenase subunit 9 [Platanus occiden...   149    1e-34
gb|ACU30377.1|  NADH dehydrogenase subunit 9 [Silene ammophila]     149    1e-34
gb|ABV25446.1|  NADH dehydrogenase subunit 9 [Silene noctiflor...   149    1e-34
ref|ZP_05081650.1|  NADH dehydrogenase i chain c [beta proteob...   149    1e-34
ref|YP_001876533.1|  NADH dehydrogenase subunit 9 [Dictyosteli...   149    2e-34
emb|CAN77857.1|  hypothetical protein [Vitis vinifera]              149    2e-34
ref|YP_002220665.1|  NADH (or F420H2) dehydrogenase, subunit C...   149    2e-34
ref|ZP_04579369.1|  NADH-quinone oxidoreductase subunit C/D [O...   149    2e-34
gb|AAW30340.1|  NADH dehydrogenase subunit 9 [Agave attenuata]      148    2e-34
ref|ZP_05316109.1|  NADH (or F420H2) dehydrogenase, subunit C ...   148    3e-34
ref|YP_003050448.1|  NADH (or F420H2) dehydrogenase, subunit C...   148    3e-34
gb|ACU30387.1|  NADH dehydrogenase subunit 9 [Silene conoidea]      148    3e-34
gb|AAW30339.1|  NADH dehydrogenase subunit 9 [Eschscholzia cal...   148    4e-34
ref|NP_900613.1|  NADH dehydrogenase subunit C [Chromobacteriu...   147    4e-34
ref|YP_411788.1|  NADH dehydrogenase subunit C [Nitrosospira m...   147    5e-34
ref|YP_985275.1|  NADH (or F420H2) dehydrogenase, subunit C [A...   147    7e-34
ref|YP_002552352.1|  NADH (or F420H2) dehydrogenase, subunit C...   147    7e-34
ref|ZP_03697928.1|  NADH (or F420H2) dehydrogenase, subunit C ...   147    8e-34
ref|ZP_02905526.1|  NADH (or F420H2) dehydrogenase, subunit C ...   146    9e-34
ref|YP_001020602.1|  NADH dehydrogenase (quinone) [Methylibium...   146    1e-33
ref|ZP_02889191.1|  NADH (or F420H2) dehydrogenase, subunit C ...   146    1e-33
ref|NP_841805.1|  NADH dehydrogenase subunit C [Nitrosomonas e...   145    2e-33
emb|CBA09890.1|  respiratory-chain NADH dehydrogenase, 30 kDa ...   145    2e-33
emb|CBA07621.1|  respiratory-chain NADH dehydrogenase, 30 kDa ...   145    2e-33
ref|YP_001579218.1|  NADH dehydrogenase subunit C [Burkholderi...   145    2e-33
ref|YP_001566192.1|  NADH (or F420H2) dehydrogenase, subunit C...   145    2e-33
ref|YP_002912372.1|  NADH (or F420H2) dehydrogenase, subunit C...   145    2e-33
ref|ZP_02378361.1|  NADH (or F420H2) dehydrogenase, subunit C ...   145    2e-33
ref|ZP_06209848.1|  NADH (or F420H2) dehydrogenase, subunit C ...   145    2e-33
gb|ACY37786.1|  NADH dehydrogenase subunit 9 [Phytophthora cin...   145    2e-33
ref|YP_867524.1|  NADH (or F420H2) dehydrogenase, subunit C [M...   145    2e-33
ref|ZP_01128217.1|  NADH (or F420H2) dehydrogenase, subunit C ...   145    3e-33
ref|ZP_06186769.1|  NADH-quinone oxidoreductase C subunit [Leg...   145    3e-33
ref|YP_774175.1|  NADH dehydrogenase subunit C [Burkholderia a...   145    3e-33
ref|ZP_02062652.1|  NADH-quinone oxidoreductase, c subunit [Ri...   145    3e-33
ref|YP_001899778.1|  NADH (or F420H2) dehydrogenase, subunit C...   145    3e-33
ref|ZP_04945181.1|  NADH dehydrogenase I,D subunit [Burkholder...   145    3e-33
ref|XP_790261.2|  PREDICTED: similar to LOC496233 protein [Str...   145    3e-33
ref|YP_932902.1|  NADH dehydrogenase subunit C [Azoarcus sp. B...   144    4e-33
ref|YP_001100104.1|  putative NADH-quinone oxidoreductase chai...   144    5e-33
ref|YP_621513.1|  NADH dehydrogenase subunit C [Burkholderia c...   144    5e-33
ref|ZP_05986596.1|  NADH-quinone oxidoreductase chain 5 [Neiss...   144    5e-33
ref|NP_273299.1|  NADH dehydrogenase subunit C [Neisseria meni...   144    5e-33
ref|YP_369813.1|  NADH dehydrogenase subunit C [Burkholderia s...   144    5e-33
ref|YP_001858232.1|  NADH (or F420H2) dehydrogenase, subunit C...   144    5e-33
ref|YP_002794531.1|  NADH-quinone oxidoreductase [Laribacter h...   144    7e-33
ref|YP_002981842.1|  NADH (or F420H2) dehydrogenase, subunit C...   144    7e-33
ref|ZP_04603587.1|  hypothetical protein GCWU000324_03087 [Kin...   144    7e-33
emb|CAX49230.1|  NADH-quinone oxidoreductase chain C (NADH deh...   143    8e-33
ref|YP_003083936.1|  NADH dehydrogenase I chain C [Neisseria m...   143    8e-33
ref|YP_969630.1|  NADH (or F420H2) dehydrogenase, subunit C [A...   143    8e-33
ref|YP_001494599.1|  NADH dehydrogenase subunit C [Rickettsia ...   143    8e-33
ref|YP_314902.1|  NADH dehydrogenase subunit C [Thiobacillus d...   143    8e-33
gb|ACY37794.1|  NADH dehydrogenase subunit 9 [Phytophthora pal...   143    8e-33
gb|ABV25438.1|  NADH dehydrogenase subunit 9 [Silene latifolia]     143    9e-33
ref|YP_002341579.1|  NADH dehydrogenase subunit C [Neisseria m...   143    9e-33
ref|YP_550066.1|  NADH (or F420H2) dehydrogenase, subunit C [P...   143    9e-33
ref|YP_003145480.1|  NADH (or F420H2) dehydrogenase, subunit C...   143    9e-33
ref|ZP_03720217.1|  hypothetical protein NEIFLAOT_02070 [Neiss...   143    9e-33
gb|EDL27506.1|  mCG13496, isoform CRA_b [Mus musculus]              143    1e-32
gb|ACU30372.1|  NADH dehydrogenase subunit 9 [Heliosperma pusi...   143    1e-32
ref|ZP_03544715.1|  NADH (or F420H2) dehydrogenase, subunit C ...   143    1e-32
emb|CAG12476.1|  unnamed protein product [Tetraodon nigroviridis]   143    1e-32
ref|YP_747149.1|  NADH dehydrogenase subunit C [Nitrosomonas e...   143    1e-32
ref|YP_001649854.1|  NADH dehydrogenase subunit C [Rickettsia ...   143    1e-32
ref|NP_220739.1|  NADH dehydrogenase subunit C [Rickettsia pro...   142    1e-32
ref|YP_974360.1|  NADH dehydrogenase subunit C [Neisseria meni...   142    1e-32
gb|ACY37790.1|  NADH dehydrogenase subunit 9 [Phytophthora inu...   142    1e-32
ref|ZP_03713315.1|  hypothetical protein EIKCOROL_00991 [Eiken...   142    1e-32
ref|YP_001790536.1|  NADH (or F420H2) dehydrogenase, subunit C...   142    2e-32
gb|ACY37798.1|  NADH dehydrogenase subunit 9 [Phytophthora hum...   142    2e-32
ref|YP_003277106.1|  NADH (or F420H2) dehydrogenase, subunit C...   142    2e-32
ref|ZP_04761347.1|  NADH (or F420H2) dehydrogenase, subunit C ...   142    2e-32
ref|ZP_02462934.1|  NADH dehydrogenase subunit C [Burkholderia...   142    2e-32
ref|ZP_04829993.1|  NADH (or F420H2) dehydrogenase, subunit C ...   142    2e-32
ref|ZP_01915797.1|  NADH dehydrogenase subunit C [Limnobacter ...   142    2e-32
ref|YP_067306.1|  NADH dehydrogenase subunit C [Rickettsia typ...   142    2e-32
ref|ZP_02355095.1|  NADH dehydrogenase subunit C [Burkholderia...   142    2e-32
ref|YP_002845123.1|  NADH dehydrogenase I chain C [Rickettsia ...   142    3e-32
ref|ZP_00142072.1|  NADH dehydrogenase I chain C [Rickettsia s...   142    3e-32
ref|YP_002005068.1|  NADH dehydrogenase subunit C [Cupriavidus...   141    3e-32
gb|ACU30402.1|  NADH dehydrogenase subunit 9 [Silene khasiana]      141    3e-32
ref|YP_107835.1|  NADH dehydrogenase subunit C [Burkholderia p...   141    3e-32
ref|NP_360120.1|  NADH dehydrogenase subunit C [Rickettsia con...   141    3e-32
ref|YP_002916893.1|  NADH dehydrogenase subunit C [Rickettsia ...   141    3e-32
ref|YP_725561.1|  NADH dehydrogenase subunit C [Ralstonia eutr...   141    3e-32
ref|YP_003168958.1|  NADH (or F420H2) dehydrogenase, subunit C...   141    3e-32
ref|YP_522759.1|  NADH (or F420H2) dehydrogenase, subunit C [R...   141    4e-32
ref|YP_583084.1|  NADH dehydrogenase subunit C [Ralstonia meta...   141    4e-32
ref|YP_001599994.1|  NADH dehydrogenase subunit C [Neisseria m...   141    4e-32
gb|EDL79487.1|  NADH dehydrogenase (ubiquinone) Fe-S protein 3...   141    4e-32
gb|ACU30378.1|  NADH dehydrogenase subunit 9 [Silene antirrhina]    141    4e-32
gb|ACU30369.1|  NADH dehydrogenase subunit 9 [Agrostemma githago]   141    4e-32
gb|ABV25439.1|  NADH dehydrogenase subunit 9 [Silene latifolia]     141    4e-32
ref|YP_441616.1|  NADH dehydrogenase subunit C [Burkholderia t...   141    4e-32
gb|ACY37800.1|  NADH dehydrogenase subunit 9 [Phytophthora inf...   141    5e-32
ref|ZP_05319138.1|  NADH-quinone oxidoreductase chain 5 [Neiss...   141    5e-32
ref|ZP_00943352.1|  NADH-quinone oxidoreductase chain C [Ralst...   140    5e-32
gb|AAW30342.1|  NADH dehydrogenase subunit 9 [Amborella tricho...   140    6e-32
ref|YP_001003329.1|  NADH (or F420H2) dehydrogenase, subunit C...   140    6e-32
ref|ZP_05977232.1|  NADH-quinone oxidoreductase chain 5 [Neiss...   140    6e-32
ref|ZP_05248971.1|  NADH dehydrogenase I [Francisella philomir...   140    6e-32
ref|NP_520181.1|  NADH dehydrogenase subunit C [Ralstonia sola...   140    6e-32
gb|ACY37788.1|  NADH dehydrogenase subunit 9 [Phytophthora nic...   140    6e-32
gb|ACU30381.1|  NADH dehydrogenase subunit 9 [Silene auriculata]    140    6e-32
gb|AAX77754.1|  unknown protein [synthetic construct]               140    7e-32
ref|YP_001677655.1|  NADH dehydrogenase [Francisella philomira...   140    7e-32
ref|ZP_04577229.1|  NADH-quinone oxidoreductase subunit C/D [O...   140    7e-32
ref|ZP_04755295.1|  NADH dehydrogenase [Francisella philomirag...   140    7e-32
gb|ABO39168.1|  NADH dehydrogenase subunit 9 [Silene vulgaris]...   140    8e-32
gb|ACU30375.1|  NADH dehydrogenase subunit 9 [Silene acutifoli...   140    8e-32
gb|ACY37792.1|  NADH dehydrogenase subunit 9 [Phytophthora cit...   140    9e-32
gb|ACU30373.1|  NADH dehydrogenase subunit 9 [Petrocoptis pyre...   140    9e-32
ref|YP_001499259.1|  NADH dehydrogenase subunit C [Rickettsia ...   140    9e-32
gb|ABO39165.1|  NADH dehydrogenase subunit 9 [Silene vulgaris]...   140    9e-32
gb|ABO39195.1|  NADH dehydrogenase subunit 9 [Silene paradoxa]...   140    1e-31
gb|ACU30380.1|  NADH dehydrogenase subunit 9 [Silene armena] >...   140    1e-31
gb|ACB41372.1|  NADH dehydrogenase subunit C [Mimulus guttatus]     140    1e-31
ref|ZP_02373298.1|  NADH dehydrogenase subunit C [Burkholderia...   140    1e-31
gb|ACU30403.1|  NADH dehydrogenase subunit 9 [Silene lacera]        139    1e-31
gb|ACU30426.1|  NADH dehydrogenase subunit 9 [Silene seoulensis]    139    1e-31
gb|ABV25445.1|  NADH dehydrogenase subunit 9 [Silene acaulis] ...   139    1e-31
gb|ACU30422.1|  NADH dehydrogenase subunit 9 [Silene samia]         139    1e-31
ref|YP_208782.1|  NADH dehydrogenase subunit C [Neisseria gono...   139    1e-31
gb|ACU30382.1|  NADH dehydrogenase subunit 9 [Silene bellidifo...   139    1e-31
ref|YP_785567.1|  NADH dehydrogenase I chain C [Bordetella avi...   139    1e-31
ref|YP_546167.1|  NADH (or F420H2) dehydrogenase, subunit C [M...   139    1e-31
ref|YP_002945391.1|  NADH (or F420H2) dehydrogenase, subunit C...   139    1e-31
gb|ABV25448.1|  NADH dehydrogenase subunit 9 [Lychnis coronaria]    139    1e-31
gb|ACU30429.1|  NADH dehydrogenase subunit 9 [Silene succulenta]    139    1e-31
ref|YP_997567.1|  NADH (or F420H2) dehydrogenase, subunit C [V...   139    2e-31
gb|ABV25418.1|  NADH dehydrogenase subunit 9 [Silene latifolia]     139    2e-31
ref|YP_001429367.2|  NADH dehydrogenase I subunit C [Francisel...   139    2e-31
ref|ZP_06557612.1|  NADH-quinone oxidoreductase subunit C [Fra...   139    2e-31
gb|ACU30385.1|  NADH dehydrogenase subunit 9 [Silene ciliata]       139    2e-31
gb|ACU30424.1|  NADH dehydrogenase subunit 9 [Silene schafta]       139    2e-31
gb|ACU30412.1|  NADH dehydrogenase subunit 9 [Silene niceensis]     139    2e-31
ref|YP_001120166.1|  NADH dehydrogenase subunit C [Burkholderi...   139    2e-31
ref|YP_514450.1|  NADH dehydrogenase I [Francisella tularensis...   139    2e-31
ref|YP_764168.1|  NADH dehydrogenase (ubiquinone) [Francisella...   139    2e-31
ref|YP_001890974.1|  NADH dehydrogenase I, C subunit [Francise...   139    2e-31
ref|YP_295186.1|  NADH dehydrogenase subunit C [Ralstonia eutr...   138    2e-31
ref|YP_169109.1|  NADH dehydrogenase I [Francisella tularensis...   138    3e-31
gb|ACU30393.1|  NADH dehydrogenase subunit 9 [Silene flavescen...   138    3e-31
ref|ZP_05983111.1|  NADH-quinone oxidoreductase chain 5 [Neiss...   138    3e-31
ref|YP_001121216.1|  NADH dehydrogenase I subunit C [Francisel...   138    3e-31
ref|ZP_01452360.1|  NADH dehydrogenase I, C subunit [Mariprofu...   138    3e-31
gb|ACY37808.1|  NADH dehydrogenase subunit 9 [Bremia lactucae]...   137    4e-31
ref|ZP_02887526.1|  NADH (or F420H2) dehydrogenase, subunit C ...   137    4e-31
ref|YP_001155829.1|  NADH (or F420H2) dehydrogenase, subunit C...   137    5e-31
ref|YP_002221400.1|  NADH dehydrogenase subunit 9 [Blastocysti...   137    5e-31
gb|ACY37806.1|  NADH dehydrogenase subunit 9 [Plasmopara halst...   137    5e-31
ref|ZP_06297835.1|  NADH (or F420H2) dehydrogenase, subunit C ...   137    5e-31
gb|ACU30410.1|  NADH dehydrogenase subunit 9 [Silene muscipula]     137    5e-31
gb|ACY37778.1|  NADH dehydrogenase subunit 9 [Phytophthora aln...   137    5e-31
ref|YP_557820.1|  NADH dehydrogenase subunit C [Burkholderia x...   137    6e-31
ref|YP_001252307.1|  NADH dehydrogenase I, C subunit [Legionel...   137    7e-31
gb|ACY37802.1|  NADH dehydrogenase subunit 9 [Plasmopara halst...   136    1e-30
ref|YP_002355392.1|  NADH (or F420H2) dehydrogenase, subunit C...   136    1e-30
ref|YP_096784.1|  NADH dehydrogenase I, C subunit [Legionella ...   136    1e-30
gb|ACY37784.1|  NADH dehydrogenase subunit 9 [Phytophthora rubi]    136    1e-30
ref|ZP_06464641.1|  NADH dehydrogenase subunit C [Burkholderia...   135    2e-30
ref|ZP_03247608.1|  respiratory-chain NADH dehydrogenase, 30 k...   135    2e-30
ref|YP_899289.1|  NADH dehydrogenase I, C subunit [Francisella...   135    2e-30
ref|ZP_03267334.1|  NADH (or F420H2) dehydrogenase, subunit C ...   135    2e-30
ref|ZP_04990527.1|  NADH-quinone oxidoreductase chain C [Franc...   135    2e-30
sp|Q7W5A9.1|NUOC_BORPA  RecName: Full=NADH-quinone oxidoreduct...   135    2e-30
sp|Q7WCU1.1|NUOC_BORBR  RecName: Full=NADH-quinone oxidoreduct...   135    2e-30
ref|ZP_06229837.1|  NADH dehydrogenase subunit C [Burkholderia...   135    2e-30
ref|YP_001353154.1|  NADH dehydrogenase I chain C [Janthinobac...   135    2e-30
gb|AAW30333.1|  NADH dehydrogenase subunit 9 [Laurus nobilis]       135    3e-30
ref|NP_879653.1|  NADH dehydrogenase subunit C [Bordetella per...   135    3e-30
ref|YP_001797641.1|  NADH (or F420H2) dehydrogenase, subunit C...   135    3e-30
ref|NP_885552.2|  NADH dehydrogenase subunit C [Bordetella par...   135    3e-30
ref|YP_002221373.1|  NADH dehydrogenase subunit 9 [Blastocysti...   134    4e-30
ref|YP_391089.1|  NADH (or F420H2) dehydrogenase, subunit C [T...   134    4e-30
ref|YP_159767.1|  NADH dehydrogenase subunit C [Aromatoleum ar...   134    5e-30
ref|YP_125139.1|  NADH dehydrogenase I chain C [Legionella pne...   134    5e-30
ref|ZP_05109022.1|  NADH dehydrogenase I, C subunit [Legionell...   134    5e-30
gb|AAW30336.1|  NADH dehydrogenase subunit 9 [Philodendron hed...   134    6e-30
ref|ZP_05105020.1|  putative NADH dehydrogenase, subunit C sub...   134    7e-30
emb|CBA33406.1|  NADH-quinone oxidoreductase subunit C [Curvib...   134    7e-30
ref|YP_001894984.1|  NADH dehydrogenase subunit C [Burkholderi...   134    7e-30
ref|YP_003444372.1|  NADH (or F420H2) dehydrogenase, subunit C...   133    9e-30
ref|YP_128031.1|  NADH dehydrogenase I chain C [Legionella pne...   133    1e-29
ref|NP_066543.1|  NADH dehydrogenase subunit 9 [Naegleria grub...   132    2e-29
ref|YP_742800.1|  NADH (or F420H2) dehydrogenase, subunit C [A...   132    2e-29
ref|YP_903492.1|  NADH (or F420H2) dehydrogenase, subunit C [C...   132    2e-29
emb|CBI60959.1|  unnamed protein product [Sordaria macrospora]      132    2e-29
ref|NP_051146.1|  NADH dehydrogenase subunit 9 [Cafeteria roen...   132    2e-29
ref|YP_505106.1|  NADH dehydrogenase I, C subunit, truncation ...   132    3e-29
ref|YP_981661.1|  NADH (or F420H2) dehydrogenase, subunit C [P...   131    3e-29
ref|NP_820429.1|  NADH dehydrogenase (ubiquinone), C subunit [...   131    4e-29
ref|ZP_01946053.1|  NADH dehydrogenase (ubiquinone), C subunit...   131    4e-29
ref|YP_001597291.1|  NADH dehydrogenase (ubiquinone), C subuni...   131    4e-29
ref|YP_001219085.1|  NADH dehydrogenase I chain C [Candidatus ...   131    4e-29
gb|EEZ80712.1|  NADH dehydrogenase I chain C [uncultured SUP05...   130    5e-29
ref|YP_344546.1|  NADH (or F420H2) dehydrogenase, subunit C [N...   130    6e-29
ref|YP_002303120.1|  NADH-quinone oxidoreductase chain C [Coxi...   130    6e-29
emb|CAN72618.1|  hypothetical protein [Vitis vinifera]              129    1e-28
ref|YP_001630287.1|  NADH dehydrogenase subunit C [Bordetella ...   129    2e-28
ref|ZP_01257193.1|  NADH Dehydrogenase I Chain C [Psychroflexu...   129    2e-28
ref|YP_201873.1|  NADH dehydrogenase subunit C [Xanthomonas or...   128    3e-28
ref|ZP_02243819.1|  NADH dehydrogenase subunit C [Xanthomonas ...   128    3e-28
ref|YP_364582.1|  NADH dehydrogenase subunit C [Xanthomonas ca...   128    3e-28
ref|YP_003375505.1|  probable nadh-quinone oxidoreductase chai...   127    5e-28
ref|NP_643012.1|  NADH dehydrogenase subunit C [Xanthomonas ax...   127    6e-28
ref|YP_002513063.1|  NADH (or F420H2) dehydrogenase, subunit C...   126    1e-27
ref|ZP_06488453.1|  NADH dehydrogenase subunit C [Xanthomonas ...   126    1e-27
ref|NP_637875.1|  NADH dehydrogenase subunit C [Xanthomonas ca...   126    1e-27
ref|ZP_06486756.1|  NADH dehydrogenase subunit C [Xanthomonas ...   126    1e-27
ref|NP_297598.1|  NADH dehydrogenase subunit C [Xylella fastid...   125    4e-27
ref|NP_778487.1|  NADH dehydrogenase subunit C [Xylella fastid...   124    4e-27
ref|ZP_00679994.1|  NADH (or F420H2) dehydrogenase, subunit C ...   124    6e-27
ref|YP_001828967.1|  NADH (or F420H2) dehydrogenase, subunit C...   124    6e-27
ref|YP_003359480.1|  NADH dehydrogenase subunit 9 [Synedra acu...   124    8e-27
ref|YP_003459961.1|  NADH (or F420H2) dehydrogenase, subunit C...   121    3e-26
ref|YP_001973121.1|  putative respiratory-chain NADH dehydroge...   121    4e-26
sp|B0U1W7.2|NUOC_XYLFM  RecName: Full=NADH-quinone oxidoreduct...   120    7e-26
ref|ZP_00651973.1|  NADH dehydrogenase [Xylella fastidiosa Dix...   120    1e-25
ref|YP_001953362.1|  NADH (or F420H2) dehydrogenase, subunit C...   114    5e-24
ref|YP_001277981.1|  NADH (or F420H2) dehydrogenase, subunit C...   112    2e-23
ref|ZP_06404019.1|  NADH (or F420H2) dehydrogenase, subunit C ...   112    3e-23
ref|YP_001431436.1|  NADH (or F420H2) dehydrogenase, subunit C...   110    6e-23
ref|YP_826915.1|  NADH (or F420H2) dehydrogenase, subunit C [S...   110    8e-23
ref|ZP_03966018.1|  NADH dehydrogenase I chain C [Sphingobacte...   110    9e-23
gb|ABK80613.1|  putative proton-translocating NADH dehydrogena...   109    1e-22
ref|XP_853570.1|  PREDICTED: similar to NADH dehydrogenase (ub...   109    2e-22
ref|YP_002522981.1|  nadh-quinone oxidoreductase chain c [Ther...   108    2e-22
ref|ZP_06386291.1|  NADH-ubiquinone oxidoreductase, chain 49kD...   108    2e-22
ref|YP_846062.1|  trifunctional NADH dehydrogenase I subunit B...   108    2e-22
ref|ZP_04777746.1|  NADH dehydrogenase I subunit C [Sphingobac...   108    3e-22
gb|EES53718.1|  NADH dehydrogenase (quinone), chain C [Leptosp...   108    3e-22
ref|ZP_01886684.1|  NADH dehydrogenase I chain C [Pedobacter s...   107    6e-22
ref|YP_001838684.1|  NADH-quinone oxidoreductase, chain C [Lep...   107    6e-22
ref|YP_590364.1|  NADH (or F420H2) dehydrogenase, subunit C [C...   107    7e-22
ref|YP_001378484.1|  NADH (or F420H2) dehydrogenase, subunit C...   107    8e-22
ref|YP_590390.1|  NADH (or F420H2) dehydrogenase, subunit C [C...   107    1e-21
ref|YP_003263831.1|  NADH (or F420H2) dehydrogenase, subunit C...   106    1e-21
ref|YP_002826723.1|  NADH dehydrogenase subunit C1 [Rhizobium ...   105    2e-21
ref|YP_821410.1|  NADH (or F420H2) dehydrogenase, subunit C [S...   105    2e-21
ref|YP_002731181.1|  NADH-quinone oxidoreductase subunit c/d (...   105    2e-21
ref|NP_436078.1|  NuoC2 NADH I chain C [Sinorhizobium meliloti...   105    2e-21
ref|ZP_05310129.1|  NADH (or F420H2) dehydrogenase, subunit C ...   105    3e-21
ref|YP_003094333.1|  NADH (or F420H2) dehydrogenase, subunit C...   105    3e-21
ref|YP_002535934.1|  NADH (or F420H2) dehydrogenase, subunit C...   105    3e-21
ref|ZP_03510637.1|  NADH-ubiquinone oxidoreductase protein, ch...   105    4e-21
ref|YP_001232958.1|  NADH (or F420H2) dehydrogenase, subunit C...   104    5e-21
ref|XP_001625914.1|  predicted protein [Nematostella vectensis...   104    5e-21
emb|CAJ71569.1|  strongly similar to to proton-translocating N...   104    5e-21
gb|EAY57323.1|  NADH dehydrogenase (quinone), chain C [Leptosp...   104    6e-21
ref|YP_386290.1|  NADH (or F420H2) dehydrogenase, subunit C [G...   104    7e-21
ref|YP_001979757.1|  NADH-ubiquinone oxidoreductase protein, c...   103    8e-21
ref|YP_002140712.1|  NADH (or F420H2) dehydrogenase, subunit C...   103    8e-21
ref|YP_003023782.1|  NADH (or F420H2) dehydrogenase, subunit C...   103    8e-21
ref|ZP_01311189.1|  NADH (or F420H2) dehydrogenase, subunit C ...   103    9e-21
gb|EDZ38540.1|  NADH dehydrogenase (quinone), chain C [Leptosp...   103    9e-21
ref|ZP_03500196.1|  NADH-ubiquinone oxidoreductase chain C pro...   103    1e-20
ref|YP_001312368.1|  NADH (or F420H2) dehydrogenase, subunit C...   103    1e-20
gb|ACI25322.1|  NADH dehydrogenase subunit 9 [Physarum polycep...   103    1e-20
ref|YP_465775.1|  NADH (or F420H2) dehydrogenase, subunit C [A...   103    1e-20
ref|YP_471220.1|  NADH-ubiquinone oxidoreductase chain C prote...   103    1e-20
ref|YP_002753438.1|  NADH dehydrogenase I, C subunit [Acidobac...   102    2e-20
gb|AAY42997.1|  Nqo5 [Rhodothermus marinus]                         102    2e-20
ref|YP_003291421.1|  NADH (or F420H2) dehydrogenase, subunit C...   102    2e-20
ref|YP_394336.1|  NADH dehydrogenase subunit C [Sulfurimonas d...   102    2e-20
ref|ZP_06300328.1|  hypothetical protein pah_c198o041 [Parachl...   102    3e-20
ref|YP_003369287.1|  NADH (or F420H2) dehydrogenase, subunit C...   102    3e-20
ref|YP_002248749.1|  NADH-quinone oxidoreductase chain c [Ther...   102    3e-20
ref|YP_891364.1|  NADH-quinone oxidoreductase chain c/d [Campy...   101    4e-20
ref|YP_002133642.1|  NADH (or F420H2) dehydrogenase, subunit C...   101    4e-20
ref|ZP_06562426.1|  NADH dehydrogenase subunit C [Saccharopoly...   101    4e-20
ref|YP_001108989.1|  NADH dehydrogenase subunit C [Saccharopol...   101    4e-20
ref|YP_001817374.1|  NADH (or F420H2) dehydrogenase, subunit C...   101    4e-20
ref|ZP_01159845.1|  NADH dehydrogenase I, B/C/D subunits [Phot...   101    4e-20
ref|ZP_01235001.1|  NADH dehydrogenase I, B/C/D subunits [Vibr...   100    8e-20
ref|NP_951400.1|  NADH dehydrogenase I, C subunit [Geobacter s...   100    8e-20
ref|YP_002663.1|  NADH dehydrogenase I subunit C [Leptospira i...   100    9e-20
ref|ZP_06044718.1|  NADH dehydrogenase subunit C [Aeromicrobiu...   100    1e-19
ref|NP_969855.1|  NADH dehydrogenase I,D subunit [Bdellovibrio...   100    1e-19
ref|ZP_02159063.1|  NADH dehydrogenase I, C/D subunits [Shewan...   100    1e-19
ref|YP_900319.1|  NADH (or F420H2) dehydrogenase, subunit C [P...   100    1e-19
ref|YP_003323270.1|  NADH (or F420H2) dehydrogenase, subunit C...   100    1e-19
ref|YP_001996869.1|  NADH (or F420H2) dehydrogenase, subunit C...  99.8    2e-19
ref|YP_001355761.1|  NADH dehydrogenase subunit C [Nitratirupt...  99.4    2e-19
ref|YP_003334291.1|  NADH dehydrogenase I, D subunit [Dickeya ...  99.4    2e-19
ref|YP_001938869.1|  NADH dehydrogenase subunit C [Methylacidi...  99.4    2e-19
ref|ZP_01898454.1|  NuoC2 NADH  I CHAIN C [Moritella sp. PE36]...  99.4    2e-19
ref|NP_711074.1|  NADH dehydrogenase I, C subunit [Leptospira ...  99.4    2e-19
ref|YP_921751.1|  NADH dehydrogenase subunit C [Nocardioides s...  99.0    2e-19
ref|YP_355637.1|  trifunctional NADH dehydrogenase I subunit B...  98.6    3e-19
ref|YP_002761913.1|  NADH-quinone oxidoreductase chain C [Gemm...  98.2    4e-19
ref|YP_003318555.1|  NADH (or F420H2) dehydrogenase, subunit C...  98.2    4e-19
ref|YP_003473139.1|  NADH dehydrogenase I, D subunit [Thermocr...  98.2    4e-19
ref|YP_001931064.1|  NADH-ubiquinone oxidoreductase chain 49kD...  98.2    5e-19
gb|ADD40985.1|  NADH (or F420H2) dehydrogenase, subunit C [Sta...  98.2    5e-19
dbj|BAI81434.1|  NADH-quinone oxidoreductase, C subunit [Defer...  97.8    5e-19
ref|ZP_02732663.1|  NADH (or F420H2) dehydrogenase, subunit C ...  97.8    5e-19
ref|YP_290749.1|  NADH dehydrogenase subunit C [Thermobifida f...  97.8    6e-19
ref|ZP_04809711.1|  NADH dehydrogenase I [Helicobacter pulloru...  97.4    7e-19
ref|YP_001359527.1|  NADH dehydrogenase subunit C [Sulfurovum ...  97.4    7e-19
ref|YP_003003737.1|  NADH dehydrogenase I, D subunit [Dickeya ...  97.4    7e-19
ref|ZP_04585518.1|  NADH-quinone oxidoreductase, subunit c/d [...  97.4    8e-19
ref|NP_954484.1|  trifunctional NADH dehydrogenase I subunit B...  97.1    9e-19
ref|YP_799958.1|  NADH dehydrogenase (ubiquinone), C chain [Le...  97.1    1e-18
ref|ZP_04582061.1|  trifunctional NADH dehydrogenase I subunit...  97.1    1e-18
ref|YP_003303213.1|  NADH (or F420H2) dehydrogenase, subunit C...  96.7    1e-18
ref|YP_001193595.1|  NADH dehydrogenase (ubiquinone), 30 kDa s...  96.7    1e-18
ref|YP_798872.1|  NADH dehydrogenase (ubiquinone), C chain [Le...  96.3    1e-18
ref|ZP_05071095.1|  NADH dehydrogenase, C subunit [Campylobact...  96.3    1e-18
ref|ZP_03658329.1|  NADH dehydrogenase subunit C [Helicobacter...  96.3    2e-18
ref|YP_003250196.1|  NADH (or F420H2) dehydrogenase, subunit C...  96.3    2e-18
ref|YP_001229122.1|  trifunctional NADH dehydrogenase I subuni...  95.9    2e-18
emb|CAJ73411.1|  strongly similar to NADH dehydrogenase I chai...  95.9    2e-18
ref|ZP_04366084.1|  NADH dehydrogenase subunit C [Cellulomonas...  95.5    2e-18
ref|ZP_01465717.1|  NADH-quinone oxidoreductase chain 5 [Stigm...  95.5    3e-18
ref|YP_002728036.1|  NADH-quinone oxidoreductase subunit c/d (...  95.5    3e-18
ref|YP_001160871.1|  NADH dehydrogenase subunit C [Salinispora...  95.5    3e-18
ref|YP_002248946.1|  NADH-quinone oxidoreductase chain c 2 [Th...  95.1    3e-18
ref|ZP_04384667.1|  NADH-quinone oxidoreductase subunit c [Rho...  95.1    4e-18
ref|ZP_04606922.1|  NADH dehydrogenase subunit C [Micromonospo...  95.1    4e-18
ref|YP_003336353.1|  NADH:ubiquinone oxidoreductase 27 kD subu...  95.1    4e-18
ref|ZP_05057970.1|  Respiratory-chain NADH dehydrogenase, 30 K...  94.7    4e-18
ref|YP_003123486.1|  NADH dehydrogenase I, D subunit [Chitinop...  94.7    4e-18
ref|ZP_02926103.1|  NuoC2 NADH I CHAIN C [Verrucomicrobium spi...  94.7    4e-18
ref|YP_429837.1|  NADH (or F420H2) dehydrogenase, subunit C [M...  94.7    5e-18
ref|ZP_05476698.1|  NADH dehydrogenase subunit C [Streptomyces...  94.4    5e-18
ref|YP_001680765.1|  proton-translocating NADH-ubiquinone oxid...  94.4    6e-18
ref|ZP_03923546.1|  NADH dehydrogenase subunit C [Mobiluncus c...  94.4    6e-18
ref|ZP_06411554.1|  NADH (or F420H2) dehydrogenase, subunit C ...  94.4    6e-18
ref|ZP_06401519.1|  NADH (or F420H2) dehydrogenase, subunit C ...  94.0    8e-18
ref|YP_002536724.1|  NADH dehydrogenase I, D subunit [Geobacte...  94.0    8e-18
ref|YP_001702871.1|  NADH dehydrogenase subunit C [Mycobacteri...  94.0    8e-18
ref|YP_002137005.1|  NADH dehydrogenase I, D subunit [Geobacte...  94.0    8e-18
ref|YP_001297087.1|  NADH dehydrogenase I, C subunit [Flavobac...  93.6    1e-17
ref|ZP_05226137.1|  NADH dehydrogenase subunit C [Mycobacteriu...  93.6    1e-17
ref|YP_630947.1|  NADH dehydrogenase I, C subunit [Myxococcus ...  93.6    1e-17
ref|YP_001611161.1|  NADH dehydrogenase (ubiquinone) [Sorangiu...  93.2    1e-17
ref|YP_001545847.1|  NADH (or F420H2) dehydrogenase, subunit C...  93.2    1e-17
ref|NP_213899.1|  NADH dehydrogenase I chain D [Aquifex aeolic...  93.2    1e-17
ref|ZP_04582970.1|  trifunctional NADH dehydrogenase I subunit...  93.2    1e-17
ref|ZP_02178865.1|  NADH dehydrogenase I chain D [Hydrogenivir...  93.2    1e-17
ref|YP_003104323.1|  NADH (or F420H2) dehydrogenase, subunit C...  93.2    1e-17
ref|ZP_05359553.1|  NADH dehydrogenase, D subunit [Acinetobact...  93.2    1e-17
ref|NP_861132.1|  NADH dehydrogenase subunit C [Helicobacter h...  92.8    2e-17
ref|ZP_06219438.1|  NADH (or F420H2) dehydrogenase, subunit C ...  92.8    2e-17
ref|ZP_04584895.1|  NADH-quinone oxidoreductase, subunit c/d [...  92.8    2e-17
ref|ZP_05973799.2|  NADH-quinone oxidoreductase, C/D subunit [...  92.8    2e-17
ref|YP_001878746.1|  NADH dehydrogenase (ubiquinone) 30 kDa su...  92.8    2e-17
ref|YP_001234249.1|  bifunctional NADH:ubiquinone oxidoreducta...  92.8    2e-17
ref|YP_001619712.1|  NADH dehydrogenase (ubiquinone) [Sorangiu...  92.8    2e-17
ref|YP_001930819.1|  NADH-ubiquinone oxidoreductase chain 49kD...  92.4    2e-17
ref|YP_003268905.1|  NADH (or F420H2) dehydrogenase, subunit C...  92.4    2e-17
ref|YP_001539226.1|  NADH dehydrogenase subunit C [Salinispora...  92.4    2e-17
ref|ZP_06125358.1|  bifunctional NADH:ubiquinone oxidoreductas...  92.4    2e-17
ref|YP_003433065.1|  NADH dehydrogenase chain D [Hydrogenobact...  92.0    3e-17
ref|YP_003250412.1|  NADH-quinone oxidoreductase, B subunit [F...  92.0    3e-17
ref|YP_113818.1|  bifunctional NADH:ubiquinone oxidoreductase ...  92.0    3e-17
ref|ZP_03320406.1|  hypothetical protein PROVALCAL_03364 [Prov...  92.0    3e-17
ref|YP_002988147.1|  NADH dehydrogenase I, D subunit [Dickeya ...  91.7    4e-17
ref|YP_383125.1|  trifunctional NADH dehydrogenase I subunit B...  91.3    4e-17
ref|ZP_06062663.1|  NADH-quinone oxidoreductase subunit C/D [A...  91.3    5e-17
ref|YP_003132226.1|  NADH dehydrogenase subunit C [Saccharomon...  91.3    5e-17
ref|YP_002462397.1|  NADH (or F420H2) dehydrogenase, subunit C...  91.3    5e-17
ref|ZP_02961127.2|  hypothetical protein PROSTU_03121 [Provide...  91.3    6e-17
ref|ZP_03628986.1|  NADH (or F420H2) dehydrogenase, subunit C ...  90.9    6e-17
ref|YP_711295.1|  NADH dehydrogenase subunit C [Frankia alni A...  90.9    6e-17
gb|ADD66819.1|  NADH dehydrogenase (ubiquinone) 30 kDa subunit...  90.9    7e-17
ref|YP_677992.1|  NADH dehydrogenase I chain C [Cytophaga hutc...  90.9    7e-17
ref|ZP_06070003.1|  NADH dehydrogenase (quinone), D subunit [A...  90.5    8e-17
ref|ZP_06066652.1|  NADH dehydrogenase (quinone), D subunit [A...  90.5    9e-17
ref|ZP_05825236.1|  bifunctional NADH:ubiquinone oxidoreductas...  90.5    1e-16
ref|YP_003411477.1|  NADH (or F420H2) dehydrogenase, subunit C...  90.5    1e-16
ref|ZP_03928076.1|  NADH dehydrogenase chain C [Actinomyces ur...  90.1    1e-16
gb|ADD28632.1|  NADH (or F420H2) dehydrogenase, subunit C [Mei...  90.1    1e-16
ref|YP_002761172.1|  NADH-quinone oxidoreductase chain C [Gemm...  90.1    1e-16
ref|YP_007560.1|  putative NADH-ubiquinone oxidoreductase chai...  90.1    1e-16
emb|CBA76483.1|  NADH-quinone oxidoreductase chain C/D [Arseno...  90.1    1e-16
ref|NP_906714.1|  NADH dehydrogenase subunit C [Wolinella succ...  90.1    1e-16
ref|YP_575173.1|  bifunctional NADH:ubiquinone oxidoreductase ...  90.1    1e-16
ref|YP_001083796.2|  bifunctional NADH:ubiquinone oxidoreducta...  89.7    1e-16
ref|ZP_00994047.1|  NADH dehydrogenase subunit C [Janibacter s...  89.7    1e-16
ref|YP_003389874.1|  NADH (or F420H2) dehydrogenase, subunit C...  89.4    2e-16
ref|YP_001761232.1|  NADH dehydrogenase I, D subunit [Shewanel...  89.4    2e-16
ref|YP_349334.1|  bifunctional NADH:ubiquinone oxidoreductase ...  89.4    2e-16
ref|ZP_05094194.1|  putative NADH dehydrogenase, subunit C sub...  89.4    2e-16
ref|YP_001135740.1|  NADH dehydrogenase subunit C [Mycobacteri...  89.4    2e-16
ref|ZP_05639482.1|  bifunctional NADH:ubiquinone oxidoreductas...  89.4    2e-16
ref|ZP_03992749.1|  NADH dehydrogenase subunit C [Mobiluncus m...  89.0    2e-16
ref|ZP_06184581.1|  NADH dehydrogenase subunit c [Mobiluncus m...  89.0    3e-16
ref|ZP_03398165.1|  NADH dehydrogenase I, C/D subunit [Pseudom...  89.0    3e-16
ref|ZP_00371739.1|  NADH-ubiquinone oxidoreductase, NQO5 subun...  89.0    3e-16
ref|YP_275281.1|  bifunctional NADH:ubiquinone oxidoreductase ...  89.0    3e-16
ref|ZP_06427423.1|  NADH dehydrogenase, C subunit [Propionibac...  89.0    3e-16
ref|YP_056611.1|  NADH dehydrogenase subunit C [Propionibacter...  89.0    3e-16
ref|ZP_06264604.1|  NADH dehydrogenase, C subunit [Propionibac...  89.0    3e-16
ref|ZP_01666188.1|  NADH (or F420H2) dehydrogenase, subunit C ...  89.0    3e-16
ref|YP_001280587.1|  bifunctional NADH:ubiquinone oxidoreducta...  89.0    3e-16
gb|ABH04822.1|  NAD(P)H-quinone oxidoreductase 27 kDa subunit ...  89.0    3e-16
ref|YP_236269.1|  bifunctional NADH:ubiquinone oxidoreductase ...  88.6    3e-16
ref|ZP_06458382.1|  bifunctional NADH:ubiquinone oxidoreductas...  88.6    3e-16
ref|ZP_06473589.1|  NADH (or F420H2) dehydrogenase, subunit C ...  88.6    3e-16
ref|YP_003384098.1|  NADH (or F420H2) dehydrogenase, subunit C...  88.6    3e-16
ref|ZP_03726514.1|  NADH (or F420H2) dehydrogenase, subunit C ...  88.6    3e-16
ref|ZP_03824014.1|  bifunctional NADH:ubiquinone oxidoreductas...  88.6    3e-16
ref|NP_793150.1|  NADH dehydrogenase I, C/D subunit [Pseudomon...  88.6    3e-16
ref|YP_001378479.1|  NADH (or F420H2) dehydrogenase, subunit C...  88.6    3e-16
ref|YP_001510342.1|  NADH dehydrogenase subunit C [Frankia sp....  88.6    3e-16
ref|ZP_04589004.1|  bifunctional NADH:ubiquinone oxidoreductas...  88.6    4e-16
ref|ZP_05047229.1|  NADH dehydrogenase, subunit C subfamily, p...  88.6    4e-16
ref|YP_378952.1|  NADH (or F420H2) dehydrogenase, subunit C [C...  88.6    4e-16
ref|YP_343159.1|  bifunctional NADH:ubiquinone oxidoreductase ...  88.2    4e-16
ref|ZP_06236234.1|  NADH (or F420H2) dehydrogenase, subunit C ...  88.2    4e-16
ref|ZP_06057929.1|  NADH:ubiquinone oxidoreductase 49 kDa subu...  88.2    5e-16
ref|YP_003118354.1|  NADH (or F420H2) dehydrogenase, subunit C...  88.2    5e-16
ref|ZP_03924821.1|  NADH dehydrogenase (quinone) [Actinomyces ...  87.8    5e-16
ref|YP_664071.1|  NADH dehydrogenase subunit C [Helicobacter a...  87.8    5e-16
ref|ZP_02176784.1|  NADH dehydrogenase I chain D [Hydrogenivir...  87.8    5e-16
ref|YP_197189.1|  NADH-quinone oxidoreductase chain C [Ehrlich...  87.8    5e-16
ref|YP_906280.1|  NADH dehydrogenase subunit C [Mycobacterium ...  87.8    6e-16
ref|ZP_03853716.1|  NADH dehydrogenase I chain C [Chryseobacte...  87.8    6e-16
ref|YP_001849787.1|  NADH dehydrogenase I (chain C) NuoC (NADH...  87.8    6e-16
ref|YP_883187.1|  NADH dehydrogenase subunit C [Mycobacterium ...  87.4    6e-16
ref|ZP_01071159.1|  nadh dehydrogenase i chain c [Campylobacte...  87.4    6e-16
ref|YP_003020003.1|  NADH dehydrogenase I, D subunit [Geobacte...  87.4    7e-16
ref|NP_962137.1|  NADH dehydrogenase subunit C [Mycobacterium ...  87.4    7e-16
ref|YP_411710.1|  bifunctional NADH:ubiquinone oxidoreductase ...  87.4    8e-16
ref|YP_002491786.1|  NADH (or F420H2) dehydrogenase, subunit C...  87.4    8e-16
ref|YP_003018336.1|  NADH dehydrogenase I, D subunit [Pectobac...  87.0    9e-16
ref|YP_002729942.1|  NADH-quinone oxidoreductase subunit c/d (...  87.0    9e-16
ref|ZP_05217973.1|  NADH dehydrogenase subunit C [Mycobacteriu...  87.0    1e-15
ref|ZP_04702674.1|  NADH dehydrogenase subunit C [Streptomyces...  87.0    1e-15
ref|YP_051116.1|  bifunctional NADH:ubiquinone oxidoreductase ...  87.0    1e-15
ref|YP_002133637.1|  NADH (or F420H2) dehydrogenase, subunit C...  87.0    1e-15
ref|YP_003096168.1|  NADH-ubiquinone oxidoreductase chain C [F...  87.0    1e-15
ref|YP_075417.1|  NADH dehydrogenase I subunit C [Symbiobacter...  87.0    1e-15
ref|ZP_03830189.1|  bifunctional NADH:ubiquinone oxidoreductas...  87.0    1e-15
ref|ZP_03825981.1|  bifunctional NADH:ubiquinone oxidoreductas...  87.0    1e-15
ref|YP_001398859.1|  NADH dehydrogenase subunit C [Campylobact...  86.7    1e-15
ref|NP_223901.1|  NADH dehydrogenase subunit C [Helicobacter p...  86.7    1e-15
ref|YP_001998909.1|  NADH (or F420H2) dehydrogenase, subunit C...  86.7    1e-15
gb|EDL07740.1|  mCG50233, isoform CRA_b [Mus musculus]             86.7    1e-15
ref|YP_002799993.1|  NADH-ubiquinone oxidoreductase, chain cd ...  86.7    1e-15
ref|YP_444540.1|  NADH-quinone oxidoreductase chain c/d [Salin...  86.7    1e-15
ref|ZP_06374421.1|  NADH dehydrogenase I chain C [Campylobacte...  86.7    1e-15
ref|YP_002766172.1|  NADH-quinone oxidoreductase chain C [Rhod...  86.7    1e-15
ref|YP_179721.1|  NADH dehydrogenase subunit C [Campylobacter ...  86.7    1e-15
ref|YP_802669.1|  bifunctional NADH:ubiquinone oxidoreductase ...  86.3    1e-15
ref|ZP_01070463.1|  NADH-quinone oxidoreductase, C subunit [Ca...  86.3    1e-15
ref|YP_003301981.1|  NADH (or F420H2) dehydrogenase, subunit C...  86.3    2e-15
ref|YP_952710.1|  NADH dehydrogenase subunit C [Mycobacterium ...  86.3    2e-15
ref|ZP_04426291.1|  NADH dehydrogenase subunit C [Planctomyces...  86.3    2e-15
ref|NP_661663.1|  NADH dehydrogenase I, 30 kDa subunit [Chloro...  86.3    2e-15
ref|YP_001489257.1|  NADH-quinone oxidoreductase, C/D subunit ...  86.3    2e-15
ref|YP_001483049.1|  NADH dehydrogenase subunit C [Campylobact...  86.3    2e-15
ref|YP_886422.1|  NADH dehydrogenase subunit C [Mycobacterium ...  85.9    2e-15
ref|YP_003392957.1|  NADH (or F420H2) dehydrogenase, subunit C...  85.9    2e-15
ref|YP_002015537.1|  NADH (or F420H2) dehydrogenase, subunit C...  85.9    2e-15
ref|ZP_04748327.1|  NADH dehydrogenase subunit C [Mycobacteriu...  85.9    2e-15
ref|NP_208054.1|  NADH dehydrogenase subunit C [Helicobacter p...  85.9    2e-15
ref|ZP_01067622.1|  NADH-quinone oxidoreductase, C subunit [Ca...  85.9    2e-15
ref|YP_002344946.1|  NADH dehydrogenase subunit C [Campylobact...  85.9    2e-15
ref|YP_002883233.1|  NADH (or F420H2) dehydrogenase, subunit C...  85.9    2e-15
ref|YP_260999.1|  bifunctional NADH:ubiquinone oxidoreductase ...  85.9    2e-15
ref|YP_001005662.1|  bifunctional NADH:ubiquinone oxidoreducta...  85.9    2e-15
ref|YP_001636486.1|  NADH (or F420H2) dehydrogenase, subunit C...  85.9    2e-15
ref|YP_003258900.1|  NADH dehydrogenase I, D subunit [Pectobac...  85.9    2e-15
ref|YP_002923186.1|  NADH dehydrogenase I chain C, D [Candidat...  85.9    2e-15
ref|YP_263880.1|  bifunctional NADH:ubiquinone oxidoreductase ...  85.9    2e-15
ref|ZP_03130718.1|  NADH (or F420H2) dehydrogenase, subunit C ...  85.9    2e-15
ref|ZP_03919022.1|  NADH dehydrogenase subunit C [Corynebacter...  85.5    2e-15
ref|YP_003160508.1|  NADH (or F420H2) dehydrogenase, subunit C...  85.5    3e-15
ref|YP_579842.1|  bifunctional NADH:ubiquinone oxidoreductase ...  85.5    3e-15
ref|NP_668950.1|  bifunctional NADH:ubiquinone oxidoreductase ...  85.5    3e-15
ref|ZP_04624885.1|  NADH-quinone oxidoreductase subunit C/D [Y...  85.5    3e-15
ref|YP_001997459.1|  NADH (or F420H2) dehydrogenase, subunit C...  85.5    3e-15
ref|ZP_05006346.1|  NADH-quinone oxidoreductase subunit C/D [S...  85.5    3e-15
ref|YP_465780.1|  NADH (or F420H2) dehydrogenase, subunit C [A...  85.5    3e-15
ref|ZP_04638212.1|  NADH-quinone oxidoreductase subunit C/D [Y...  85.5    3e-15
ref|ZP_04615113.1|  NADH-quinone oxidoreductase subunit C/D [Y...  85.5    3e-15
ref|ZP_03439011.1|  hypothetical protein HP9810_899g19 [Helico...  85.5    3e-15
ref|ZP_04458254.1|  NADH:ubiquinone oxidoreductase, chain C,D ...  85.5    3e-15
ref|ZP_04632444.1|  NADH-quinone oxidoreductase subunit C/D [Y...  85.5    3e-15
ref|YP_002576010.1|  NADH-quinone oxidoreductase, C subunit [C...  85.5    3e-15
gb|ACX98351.1|  NADH-ubiquinone oxidoreductase chain C [Helico...  85.1    3e-15
ref|YP_001910738.1|  NADH dehydrogenase subunit C [Helicobacte...  85.1    3e-15
ref|ZP_04621117.1|  NADH-quinone oxidoreductase subunit C/D [Y...  85.1    3e-15
ref|ZP_03496558.1|  NADH (or F420H2) dehydrogenase, subunit C ...  85.1    3e-15
ref|XP_732968.1|  hypothetical protein [Plasmodium chabaudi ch...  85.1    3e-15
ref|ZP_03239400.1|  NADH dehydrogenase subunit C [Helicobacter...  85.1    4e-15
ref|YP_002460201.1|  NADH dehydrogenase (ubiquinone) 30 kDa su...  85.1    4e-15
ref|ZP_04612740.1|  NADH-quinone oxidoreductase subunit C/D [Y...  85.1    4e-15
emb|CBG35359.1|  NADH-quinone oxidoreductase subunit C/D [Esch...  84.7    4e-15
ref|YP_003040358.1|  nadh dehydrogenase i chain c/d (nadh-ubiq...  84.7    5e-15
ref|YP_001405791.1|  NADH dehydrogenase subunit C [Campylobact...  84.7    5e-15
ref|ZP_04659027.1|  possible NADH (or F420H2) dehydrogenase, s...  84.7    5e-15
ref|YP_001407460.1|  NADH dehydrogenase subunit C [Campylobact...  84.7    5e-15
ref|ZP_04429176.1|  NADH dehydrogenase subunit C [Planctomyces...  84.7    5e-15
ref|YP_003126619.1|  NADH (or F420H2) dehydrogenase, subunit C...  84.3    5e-15
ref|YP_002301860.1|  NADH-ubiquinone oxidoreductase chain C [H...  84.3    6e-15
ref|YP_002266822.1|  NADH-ubiquinone oxidoreductase chain C [H...  84.3    6e-15
ref|YP_002873374.1|  NADH dehydrogenase I chain C/D [Pseudomon...  84.3    6e-15
ref|YP_002648285.1|  NADH-quinone oxidoreductase subunit C/D [...  84.3    6e-15
ref|ZP_04028940.1|  NADH dehydrogenase subunit C [Tsukamurella...  84.3    6e-15
ref|YP_045461.1|  bifunctional NADH:ubiquinone oxidoreductase ...  84.3    6e-15
ref|ZP_06371341.1|  NADH-quinone oxidoreductase, C subunit [Ca...  84.3    7e-15
ref|ZP_04037156.1|  NADH dehydrogenase subunit C [Meiothermus ...  84.3    7e-15
ref|YP_003200374.1|  NADH (or F420H2) dehydrogenase, subunit C...  84.3    7e-15
ref|YP_003079015.1|  NADH:ubiquinone oxidoreductase, chain C,D...  84.3    7e-15
ref|YP_003271626.1|  NADH (or F420H2) dehydrogenase, subunit C...  84.0    7e-15
ref|YP_003390803.1|  NADH (or F420H2) dehydrogenase, subunit C...  84.0    7e-15
ref|ZP_04641887.1|  NADH-quinone oxidoreductase subunit C/D [Y...  84.0    7e-15
ref|NP_930319.1|  bifunctional NADH:ubiquinone oxidoreductase ...  84.0    7e-15
ref|XP_001118707.1|  PREDICTED: similar to NADH dehydrogenase ...  84.0    7e-15
ref|NP_416789.2|  NADH:ubiquinone oxidoreductase, fused CD sub...  84.0    8e-15
gb|ACX99745.1|  NADH (or F420H2) dehydrogenase, subunit C [Hel...  84.0    8e-15
ref|YP_001907146.1|  bifunctional NADH:ubiquinone oxidoreducta...  84.0    8e-15
ref|YP_001606302.1|  bifunctional NADH:ubiquinone oxidoreducta...  84.0    8e-15
gb|ACI80856.1|  NADH dehydrogenase I chain C/D [Escherichia coli]  84.0    8e-15
ref|YP_670220.1|  bifunctional NADH:ubiquinone oxidoreductase ...  84.0    8e-15
ref|NP_288860.1|  bifunctional NADH:ubiquinone oxidoreductase ...  84.0    8e-15
ref|NP_754713.1|  bifunctional NADH:ubiquinone oxidoreductase ...  84.0    8e-15
ref|AP_002884.1|  NADH:ubiquinone oxidoreductase, chain C,D [E...  84.0    8e-15
ref|YP_002893822.1|  NADH dehydrogenase I, D subunit [Tolumona...  84.0    8e-15
ref|ZP_02901977.1|  NADH-quinone oxidoreductase, C/D subunit [...  84.0    8e-15
ref|YP_002329930.1|  bifunctional NADH:ubiquinone oxidoreducta...  84.0    8e-15
ref|YP_002151490.1|  NADH-quinone oxidoreductase chain C/D [Pr...  84.0    8e-15
ref|YP_001881107.1|  NADH-quinone oxidoreductase, C/D subunit ...  84.0    8e-15
ref|NP_708168.1|  bifunctional NADH:ubiquinone oxidoreductase ...  84.0    8e-15
ref|YP_003190714.1|  NADH dehydrogenase (ubiquinone) 30 kDa su...  84.0    9e-15
ref|NP_295227.1|  NADH dehydrogenase I, C subunit [Deinococcus...  84.0    9e-15
ref|YP_911435.1|  NADH (or F420H2) dehydrogenase, subunit C [C...  84.0    9e-15
ref|ZP_05619245.1|  NADH-quinone oxidoreductase subunit c/d [E...  83.6    1e-14
ref|ZP_03972344.1|  NADH dehydrogenase subunit C [Corynebacter...  83.6    1e-14
ref|YP_003057911.1|  NADH-ubiquinone oxidoreductase, NQO5 subu...  83.6    1e-14
ref|ZP_05730570.1|  NADH dehydrogenase I, D subunit [Pantoea s...  83.6    1e-14
ref|YP_627947.1|  NADH dehydrogenase subunit C [Helicobacter p...  83.6    1e-14
ref|ZP_05016480.1|  NADH-quinone oxidoreductase subunit C/D [S...  83.6    1e-14
ref|YP_001748743.1|  bifunctional NADH:ubiquinone oxidoreducta...  83.6    1e-14
ref|ZP_03437819.1|  hypothetical protein HPB128_132g21 [Helico...  83.2    1e-14
ref|ZP_03222362.1|  NADH dehydrogenase I chain C [Campylobacte...  83.2    1e-14
ref|ZP_00367452.1|  NADH2 dehydrogenase (ubiquinone) I chain C...  83.2    1e-14
ref|ZP_04628996.1|  NADH-quinone oxidoreductase subunit C/D [Y...  83.2    1e-14
ref|YP_005887.1|  NADH-quinone oxidoreductase chain C [Thermus...  83.2    1e-14
ref|ZP_01688468.1|  NADH-quinone oxidoreductase chain c [Micro...  83.2    2e-14
gb|AAC38642.1|  NADH dehydrogenase chain C [Pectobacterium car...  82.8    2e-14
ref|ZP_04686565.1|  NADH dehydrogenase subunit C [Streptomyces...  82.8    2e-14
ref|YP_001960007.1|  NADH (or F420H2) dehydrogenase, subunit C...  82.8    2e-14
ref|YP_003325068.1|  NADH (or F420H2) dehydrogenase, subunit C...  82.8    2e-14
ref|YP_003211274.1|  NADH-quinone oxidoreductase subunit C/D [...  82.8    2e-14
ref|YP_705846.1|  NADH dehydrogenase subunit C [Rhodococcus jo...  82.8    2e-14
gb|ABE03927.1|  NuoC [Theonella swinhoei bacterial symbiont cl...  82.8    2e-14
ref|YP_609021.1|  bifunctional NADH:ubiquinone oxidoreductase ...  82.4    2e-14
ref|YP_001669920.1|  bifunctional NADH:ubiquinone oxidoreducta...  82.4    2e-14
ref|YP_479653.1|  NADH dehydrogenase subunit C [Frankia sp. Cc...  82.4    2e-14
ref|YP_001437040.1|  bifunctional NADH:ubiquinone oxidoreducta...  82.4    2e-14
ref|YP_001267084.1|  bifunctional NADH:ubiquinone oxidoreducta...  82.4    2e-14
ref|YP_002934080.1|  NADH-quinone oxidoreductase subunit c/d [...  82.4    2e-14
ref|YP_002783165.1|  NADH-quinone oxidoreductase chain C [Rhod...  82.4    2e-14
ref|ZP_04957195.1|  NADH dehydrogenase i, b/c/d subunit [gamma...  82.4    2e-14
ref|YP_856316.1|  bifunctional NADH:ubiquinone oxidoreductase ...  82.4    2e-14
ref|NP_746240.1|  bifunctional NADH:ubiquinone oxidoreductase ...  82.4    3e-14
ref|ZP_06529210.1|  trifunctional NADH dehydrogenase I subunit...  82.4    3e-14
ref|ZP_05524370.1|  NADH dehydrogenase subunit C [Streptomyces...  82.4    3e-14
ref|YP_638745.1|  NADH dehydrogenase subunit C [Mycobacterium ...  82.4    3e-14
ref|NP_628726.1|  NADH dehydrogenase subunit C [Streptomyces c...  82.0    3e-14
ref|ZP_05310030.1|  NADH dehydrogenase I, D subunit [Geobacter...  82.0    3e-14
ref|YP_001336323.1|  bifunctional NADH:ubiquinone oxidoreducta...  81.6    4e-14
gb|EFD92733.1|  NADH dehydrogenase (ubiquinone) 30 kDa subunit...  81.6    4e-14
ref|ZP_04934393.1|  NADH dehydrogenase I chain C,D [Pseudomona...  81.6    4e-14
ref|YP_003296429.1|  NADH:ubiquinone oxidoreductase 49 kD subu...  81.6    4e-14
ref|YP_001479532.1|  bifunctional NADH:ubiquinone oxidoreducta...  81.6    4e-14
ref|YP_118876.1|  NADH dehydrogenase subunit C [Nocardia farci...  81.6    4e-14
ref|YP_872029.1|  NADH dehydrogenase subunit C [Acidothermus c...  81.6    4e-14
ref|ZP_06511203.1|  NADH dehydrogenase subunit I C nuoC [Mycob...  81.6    4e-14
ref|ZP_02044281.1|  hypothetical protein ACTODO_01140 [Actinom...  81.6    4e-14
ref|YP_001130607.1|  NADH (or F420H2) dehydrogenase, subunit C...  81.3    5e-14
ref|NP_217663.1|  NADH dehydrogenase subunit C [Mycobacterium ...  81.3    5e-14
ref|YP_003432079.1|  NADH dehydrogenase chain D [Hydrogenobact...  81.3    5e-14
ref|ZP_05533504.1|  NADH dehydrogenase subunit C [Streptomyces...  81.3    5e-14
ref|ZP_06191083.1|  NADH-quinone oxidoreductase subunit C/D [S...  81.3    5e-14
ref|NP_337760.1|  NADH dehydrogenase subunit C [Mycobacterium ...  81.3    5e-14
ref|ZP_03426522.1|  NADH dehydrogenase subunit C [Mycobacteriu...  81.3    6e-14
ref|YP_001347932.1|  bifunctional NADH:ubiquinone oxidoreducta...  80.9    6e-14
ref|YP_001141562.1|  bifunctional NADH:ubiquinone oxidoreducta...  80.9    6e-14
ref|NP_251329.1|  bifunctional NADH:ubiquinone oxidoreductase ...  80.9    6e-14
ref|YP_360255.1|  NADH dehydrogenase subunit C [Carboxydotherm...  80.9    7e-14
ref|YP_003468810.1|  NADH dehydrogenase I chain C, D [Xenorhab...  80.9    7e-14
ref|YP_002774924.1|  NADH-quinone oxidoreductase chain C [Brev...  80.9    7e-14
ref|ZP_04331992.1|  NADH dehydrogenase subunit C [Nocardiopsis...  80.9    7e-14
ref|YP_002728265.1|  NADH-quinone oxidoreductase subunit c/d (...  80.9    7e-14
ref|ZP_04562798.1|  bifunctional NADH:ubiquinone oxidoreductas...  80.9    7e-14
ref|YP_002237326.1|  NADH-quinone oxidoreductase, C/D subunit ...  80.9    7e-14
gb|AAF97799.1|AF281148_3  NADH dehydrogenase I subunit C [Pseu...  80.9    7e-14
ref|ZP_05539505.1|  NADH dehydrogenase subunit C [Streptomyces...  80.5    8e-14
ref|NP_949598.1|  bifunctional NADH:ubiquinone oxidoreductase ...  80.5    8e-14
ref|YP_003088454.1|  NADH dehydrogenase (ubiquinone) 30 kDa su...  80.5    9e-14
sp|Q57M30.2|NUOCD_SALCH  RecName: Full=NADH-quinone oxidoreduc...  80.5    9e-14
sp|P0A1Y7.2|NUOCD_SALTI  RecName: Full=NADH-quinone oxidoreduc...  80.5    9e-14
ref|ZP_05968532.1|  NADH-quinone oxidoreductase, C/D subunit [...  80.5    9e-14
ref|YP_002041586.1|  NADH-quinone oxidoreductase, C/D subunit ...  80.5    9e-14
ref|YP_001569641.1|  bifunctional NADH:ubiquinone oxidoreducta...  80.5    9e-14
ref|YP_217313.1|  bifunctional NADH:ubiquinone oxidoreductase ...  80.5    9e-14
ref|NP_456868.1|  bifunctional NADH:ubiquinone oxidoreductase ...  80.5    9e-14
ref|ZP_06352025.1|  bifunctional NADH:ubiquinone oxidoreductas...  80.5    1e-13

ALIGNMENTS
>ref|ZP_05068709.1| NADH dehydrogenase i chain c [Candidatus Pelagibacter sp. HTCC7211]
 gb|EDZ59708.1| NADH dehydrogenase i chain c [Candidatus Pelagibacter sp. HTCC7211]
Length=201

 Score =  308 bits (790),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 168/192 (87%), Gaps = 0/192 (0%)

Query  3    MKNLEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDIT  62
            M NLE LEKKINSELTTKINS+ I HN +Y+  D++DL+DV +F+KTN +TKF+QLIDIT
Sbjct  1    MINLEDLEKKINSELTTKINSTEIKHNQLYIETDKDDLIDVTLFIKTNQDTKFRQLIDIT  60

Query  63   AVDYPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYG  122
             VDYPE   RFK+VYLFLSHE N+RI + + I EN  + S+TSIFP++NWMEREVFDMYG
Sbjct  61   VVDYPENTQRFKMVYLFLSHEYNQRIILSYSINENEIIPSLTSIFPASNWMEREVFDMYG  120

Query  123  INFKNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDY  182
            ++FK+HPDLRRILTDYGF+GHPLRKDFPLTGH EVRYSED KKVI EPVKLEQNYRNFDY
Sbjct  121  VSFKDHPDLRRILTDYGFEGHPLRKDFPLTGHTEVRYSEDQKKVINEPVKLEQNYRNFDY  180

Query  183  ESPWEGTKYIKE  194
            ESPWEGTKYIKE
Sbjct  181  ESPWEGTKYIKE  192


>ref|ZP_01256390.1| NADH Dehydrogenase I Chain C [Psychroflexus torquis ATCC 700755]
Length=201

 Score =  302 bits (773),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 168/192 (87%), Gaps = 0/192 (0%)

Query  3    MKNLEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDIT  62
            MKNL+ LEKKINSEL TKIN S I +N IYL  D++D +DV +FLKT+ +TKF+QLIDIT
Sbjct  1    MKNLQDLEKKINSELNTKINKSEIKYNQIYLETDKDDFIDVTLFLKTSKDTKFRQLIDIT  60

Query  63   AVDYPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYG  122
             +DYPE+  RF L+YLFLSHE N+RI + + I EN  + S+TSIFPSANWMEREVFDMYG
Sbjct  61   VIDYPERNQRFDLIYLFLSHEFNQRIILKYSISENEVIPSLTSIFPSANWMEREVFDMYG  120

Query  123  INFKNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDY  182
            ++FK+HPDLRRILTDYGF+GHPLRKDFPLTGH+EVRYSED+KKVI EPVKLEQN+RNFDY
Sbjct  121  VSFKDHPDLRRILTDYGFEGHPLRKDFPLTGHSEVRYSEDEKKVINEPVKLEQNFRNFDY  180

Query  183  ESPWEGTKYIKE  194
            ESPWEGTKYIK+
Sbjct  181  ESPWEGTKYIKD  192


>ref|YP_266303.1| NADH dehydrogenase I chain C [Candidatus Pelagibacter ubique 
HTCC1062]
 ref|ZP_01263960.1| NADH Dehydrogenase I Chain C [Candidatus Pelagibacter ubique 
HTCC1002]
 gb|AAZ21700.1| NADH Dehydrogenase I Chain C [Candidatus Pelagibacter ubique 
HTCC1062]
 gb|EAS84447.1| NADH Dehydrogenase I Chain C [Candidatus Pelagibacter ubique 
HTCC1002]
Length=202

 Score =  300 bits (769),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 163/192 (84%), Gaps = 0/192 (0%)

Query  3    MKNLEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDIT  62
            M+NL  LEKKINSELTTKI  + I H  +Y+NID EDL+DV +F+K+N  TKF+QLIDIT
Sbjct  1    MQNLIDLEKKINSELTTKIKKTEIRHEQLYINIDNEDLIDVTLFIKSNENTKFRQLIDIT  60

Query  63   AVDYPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYG  122
             VDYPE   RFK+VYLFLSHE N+RI + + I EN  + S+T I+P+ANWMEREVFDMYG
Sbjct  61   VVDYPENAQRFKVVYLFLSHEFNQRIILSYLISENEVIPSLTPIYPAANWMEREVFDMYG  120

Query  123  INFKNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDY  182
            + FK+HPD+RRILTDYGF+GHPLRKDFPLTGH EVRYSED KKVI EPVKLEQNYRNFDY
Sbjct  121  VKFKDHPDMRRILTDYGFEGHPLRKDFPLTGHTEVRYSEDQKKVISEPVKLEQNYRNFDY  180

Query  183  ESPWEGTKYIKE  194
            ESPWEGTKYIK+
Sbjct  181  ESPWEGTKYIKD  192


>ref|ZP_01547441.1| NADH dehydrogenase subunit C [Stappia aggregata IAM 12614]
 gb|EAV44171.1| NADH dehydrogenase subunit C [Stappia aggregata IAM 12614]
Length=201

 Score =  219 bits (558),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/189 (53%), Positives = 128/189 (67%), Gaps = 0/189 (0%)

Query  4    KNLEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDITA  63
            + L+ L + I   L   + S  + +  + L +D  D+LD I FL+ NS  KF  L DI  
Sbjct  3    ETLKELAEHIELGLGESLVSWKVEYGELTLTVDATDILDAIRFLRDNSSCKFVNLTDICG  62

Query  64   VDYPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYGI  123
            VDYP +E RF +VY FLS   N+RI+V     EN PV S+T +FP A W ERE +DMYGI
Sbjct  63   VDYPSREKRFDVVYHFLSPVQNQRIRVKVATDENTPVASLTPLFPGAEWFEREAYDMYGI  122

Query  124  NFKNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDYE  183
             F  HPDLRRILTDYGFDGHPLRKDFP+TG  EVRY ++ K+V+YEPV+L Q  R+FD+ 
Sbjct  123  LFSGHPDLRRILTDYGFDGHPLRKDFPVTGFVEVRYDDEKKRVVYEPVRLNQEMRSFDFL  182

Query  184  SPWEGTKYI  192
            SPWEGT Y+
Sbjct  183  SPWEGTDYV  191


>ref|ZP_01449211.1| NADH dehydrogenase subunit C [alpha proteobacterium HTCC2255]
 gb|EAU50525.1| NADH dehydrogenase subunit C [alpha proteobacterium HTCC2255]
Length=202

 Score =  218 bits (556),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 129/185 (69%), Gaps = 1/185 (0%)

Query  9    LEKKINSELTTKINSSSIN-HNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDITAVDYP  67
            L + I S+L   + +S +N    + LN+  E ++ V+ FLKTNS  +F  LIDITA+DYP
Sbjct  8    LGEVIASKLPNAVTASGVNDFGELVLNVKLEKIVTVVEFLKTNSAMRFSTLIDITAIDYP  67

Query  68   EKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYGINFKN  127
             ++ RF++VY FLS   N RI++   + E+  V SI  I P ANW EREVFDMYG+ F  
Sbjct  68   SRKNRFEMVYHFLSMYTNMRIRLKLQVSEDGMVPSICEIHPGANWFEREVFDMYGVLFSG  127

Query  128  HPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDYESPWE  187
            HPDLRRILTDYGF GHPLRKDFP TG+ E+RY E  K+V+YEPV L Q YR FD+ SPWE
Sbjct  128  HPDLRRILTDYGFRGHPLRKDFPTTGYTELRYDEVGKRVVYEPVTLTQEYRQFDFMSPWE  187

Query  188  GTKYI  192
            G +YI
Sbjct  188  GAQYI  192


>ref|ZP_06055092.1| NADH-quinone oxidoreductase subunit c (nadhdehydrogenase i subunit 
c) (ndh-1 subunit c) [alpha proteobacterium HIMB114]
 gb|EEY74861.1| NADH-quinone oxidoreductase subunit c (nadhdehydrogenase i subunit 
c) (ndh-1 subunit c) [alpha proteobacterium HIMB114]
Length=199

 Score =  217 bits (552),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 99/196 (50%), Positives = 144/196 (73%), Gaps = 0/196 (0%)

Query  3    MKNLEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDIT  62
            MK+L+ ++  I      +       ++++  + + + L+D ++ LK +S+ KF+QL+DI 
Sbjct  1    MKSLDEMKTIIEGSPNFRFAKIEFQNDNLVCHCNADQLIDNVVQLKRHSDLKFRQLVDIL  60

Query  63   AVDYPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYG  122
            AVDYP +E RF+++YLFLSHENN RI +   +++   + ++T++FPSANW+EREVFDM G
Sbjct  61   AVDYPNREKRFEIIYLFLSHENNLRISIKIDLEDQQKIQTLTNVFPSANWLEREVFDMNG  120

Query  123  INFKNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDY  182
            I F +HPDLRRILTDY F+G PLRKDFPLTG+ EVRY  + KKV+Y PVKL+Q YR+FD+
Sbjct  121  IEFSDHPDLRRILTDYNFEGFPLRKDFPLTGYKEVRYDPETKKVVYGPVKLQQAYRDFDF  180

Query  183  ESPWEGTKYIKEISKK  198
            +SPW+G  YIK+  +K
Sbjct  181  KSPWQGPDYIKKQQEK  196


>ref|YP_612738.1| NADH dehydrogenase subunit C [Ruegeria sp. TM1040]
 sp|Q1GIP0.1|NUOC_SILST RecName: Full=NADH-quinone oxidoreductase subunit C; AltName: 
Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1 subunit 
C
 gb|ABF63476.1| NADH (or F420H2) dehydrogenase subunit C [Ruegeria sp. TM1040]
Length=201

 Score =  213 bits (543),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 100/201 (49%), Positives = 137/201 (68%), Gaps = 5/201 (2%)

Query  2    LMKNLEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDI  61
            +++ L+ L  +I ++    + S  I H  + +++   ++  ++ FL+ +S  +F  L+DI
Sbjct  1    MIEALQDLGHQIEAKRPECVLSWDIAHGELNIDVKPANIAGLVEFLRVDSACRFSTLVDI  60

Query  62   TAVDYPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMY  121
            TAVDYPE+  RF +VY  LS   N+RI++   ++E + V SI  + PSANW EREVFDM+
Sbjct  61   TAVDYPERTKRFDVVYHLLSMYQNQRIRLRAAVREEDMVPSIVDVHPSANWFEREVFDMF  120

Query  122  GINFKNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFD  181
            GI F  HPDLRR+LTDYGF GHPLRKDFP TG+ EVRY E  K+V+YEPVKL Q YR FD
Sbjct  121  GILFTGHPDLRRLLTDYGFRGHPLRKDFPTTGYTEVRYDEAQKRVVYEPVKLVQEYRQFD  180

Query  182  YESPWEGTKYI-----KEISK  197
            + SPWEG +YI     KEI+K
Sbjct  181  FMSPWEGAEYILPGDEKEIAK  201


>ref|ZP_05116862.1| putative NADH dehydrogenase, subunit C subfamily [Labrenzia alexandrii 
DFL-11]
 gb|EEE47461.1| putative NADH dehydrogenase, subunit C subfamily [Labrenzia alexandrii 
DFL-11]
Length=201

 Score =  212 bits (540),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/189 (51%), Positives = 129/189 (68%), Gaps = 0/189 (0%)

Query  4    KNLEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDITA  63
            + L+ L + I   L+  + S  + +  + L ++  D+LDV+ +L+ N+  KF  L DI  
Sbjct  3    ETLKELAEHIELGLSESLVSWKVEYGELTLVVNASDILDVVRYLRDNASCKFVNLTDICG  62

Query  64   VDYPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYGI  123
            VDYP +E RF +VY FLS   N+RI+V     +  PV S+TS+FP A W ERE +DMYGI
Sbjct  63   VDYPAREKRFDVVYHFLSPFQNQRIRVKLETDDVTPVASLTSLFPGAEWFEREAYDMYGI  122

Query  124  NFKNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDYE  183
             F  HPDLRRILTDYGFDGHPLRKDFP+TG  EVRY ++ K+V+YEPV+L Q  R FD+ 
Sbjct  123  LFSGHPDLRRILTDYGFDGHPLRKDFPVTGFVEVRYDDEKKRVVYEPVRLNQEMRTFDFL  182

Query  184  SPWEGTKYI  192
            SPWEGT Y+
Sbjct  183  SPWEGTDYV  191


>ref|YP_001532652.1| NADH (or F420H2) dehydrogenase, subunit C [Dinoroseobacter shibae 
DFL 12]
 sp|A8LIT7.1|NUOC_DINSH RecName: Full=NADH-quinone oxidoreductase subunit C; AltName: 
Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1 subunit 
C
 gb|ABV93051.1| NADH (or F420H2) dehydrogenase, subunit C [Dinoroseobacter shibae 
DFL 12]
Length=215

 Score =  212 bits (540),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 130/191 (68%), Gaps = 0/191 (0%)

Query  2    LMKNLEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDI  61
            +   L+ L   I  +    + S+ I H+ + +      ++ ++ FLKT++  KF  LIDI
Sbjct  10   MTAALQELAAHIEMKRPDCVISTEIAHDELTVVATPNSIVGLVAFLKTDATCKFSTLIDI  69

Query  62   TAVDYPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMY  121
            TAVDYPE+  RF +VY FLS   N RI++   ++E++ V SI S  PSANW EREVFDM+
Sbjct  70   TAVDYPERAQRFDVVYHFLSMYQNHRIRIRVPVREDDIVPSIISEHPSANWFEREVFDMF  129

Query  122  GINFKNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFD  181
            GI F  HPDLRRILTDYGF G+PLRKDFP TG+ EVRY E+ K+V+YEPV L Q YR FD
Sbjct  130  GILFSGHPDLRRILTDYGFRGYPLRKDFPTTGYTEVRYDEEKKRVVYEPVNLVQEYRQFD  189

Query  182  YESPWEGTKYI  192
            + SPWEG +YI
Sbjct  190  FMSPWEGAEYI  200


>ref|YP_001419508.1| NADH (or F420H2) dehydrogenase, subunit C [Xanthobacter autotrophicus 
Py2]
 sp|A7IPA5.1|NUOC_XANP2 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName: 
Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1 subunit 
C
 gb|ABS69851.1| NADH (or F420H2) dehydrogenase, subunit C [Xanthobacter autotrophicus 
Py2]
Length=209

 Score =  212 bits (539),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/189 (48%), Positives = 126/189 (66%), Gaps = 0/189 (0%)

Query  4    KNLEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDITA  63
            + L  L   +++ L+  +  S + H  + L ID   ++ V  FL+ +    F  ++D+  
Sbjct  3    ETLNDLAAHVSAALSGAVLGSLVAHGELTLQIDPAQIVKVATFLRDDPACLFHCIVDVCG  62

Query  64   VDYPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYGI  123
            VDYP +E RF +VY  LS + N RI++     E+ PV SI S+FP ANW ERE +DMYGI
Sbjct  63   VDYPAREKRFDVVYHLLSLKQNVRIRLKVETDEDTPVPSICSVFPGANWFEREAYDMYGI  122

Query  124  NFKNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDYE  183
             F  HP+LRR+LTDYGFDGHPLRKDFP TG  EVRY ++ K+V+YEPV+L Q +RNFD+ 
Sbjct  123  LFTGHPELRRLLTDYGFDGHPLRKDFPTTGFVEVRYDDEQKRVVYEPVRLPQEFRNFDFL  182

Query  184  SPWEGTKYI  192
            SPWEG +Y+
Sbjct  183  SPWEGVEYV  191


>ref|YP_003060125.1| NADH (or F420H2) dehydrogenase, subunit C [Hirschia baltica ATCC 
49814]
 gb|ACT59428.1| NADH (or F420H2) dehydrogenase, subunit C [Hirschia baltica ATCC 
49814]
Length=209

 Score =  212 bits (539),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/189 (49%), Positives = 133/189 (70%), Gaps = 0/189 (0%)

Query  4    KNLEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDITA  63
            + L+ L   I +E    + S ++ ++ + +    + ++ ++ FL+++S+ +F+ L D+ A
Sbjct  9    ETLDELVSHIETEQPHSVKSCAVVNDELVVYAVRDQIMSLMRFLRSDSQCRFETLTDLCA  68

Query  64   VDYPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYGI  123
            VDYPE+  RF++VY  LS   N+RI+V     E +PV S+  +FP ANW ERE FDMYG+
Sbjct  69   VDYPERAERFEVVYHMLSMSLNQRIRVKVSTDEESPVPSLVELFPCANWNEREAFDMYGV  128

Query  124  NFKNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDYE  183
             F  HPDLRRILTDYGF+GHPLRKDFPLTGH EVRY E +K+V+Y+PVKL Q YRNFD+ 
Sbjct  129  LFSGHPDLRRILTDYGFEGHPLRKDFPLTGHVEVRYDEVEKRVVYQPVKLVQEYRNFDFM  188

Query  184  SPWEGTKYI  192
            SPWEG + +
Sbjct  189  SPWEGMQSV  197


>ref|ZP_01056176.1| NADH dehydrogenase subunit C [Roseobacter sp. MED193]
 gb|EAQ46132.1| NADH dehydrogenase subunit C [Roseobacter sp. MED193]
Length=197

 Score =  211 bits (537),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 133/191 (69%), Gaps = 0/191 (0%)

Query  2    LMKNLEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDI  61
            + + L+ L  +I ++    + S  + H  + +++   ++  ++ FLK++S  KF  L+DI
Sbjct  1    MTEALQELGTQIAAKRPDCVLSWDVAHGELNVDVAPANIAGLVEFLKSDSSCKFSSLVDI  60

Query  62   TAVDYPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMY  121
            TAVDYPE+  RF +VY  LS   N+RI++   ++E++ V SI  + PSANW EREVFDM+
Sbjct  61   TAVDYPERGKRFDVVYHLLSMYQNQRIRLRVSVREDDMVPSIVDVHPSANWFEREVFDMF  120

Query  122  GINFKNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFD  181
            GI F  HPDLRRILTDYGF G+PLRKDFP TG+ EVRY E +K+V+YEPV L Q YR FD
Sbjct  121  GILFSGHPDLRRILTDYGFRGYPLRKDFPTTGYTEVRYDEAEKRVVYEPVSLVQEYRQFD  180

Query  182  YESPWEGTKYI  192
            + SPWEG +YI
Sbjct  181  FMSPWEGAEYI  191


--------------------------------------------------------------------------------------------------------
b) BLASTp vs SWISSPROT

                                                                 Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q1GIP0.1|NUOC_SILST  RecName: Full=NADH-quinone oxidoreduct...   213    8e-55
sp|A7IPA5.1|NUOC_XANP2  RecName: Full=NADH-quinone oxidoreduct...   212    1e-54
sp|A8LIT7.1|NUOC_DINSH  RecName: Full=NADH-quinone oxidoreduct...   211    2e-54
sp|Q5LPR5.1|NUOC_SILPO  RecName: Full=NADH-quinone oxidoreduct...   209    6e-54
sp|A4WU32.1|NUOC_RHOS5  RecName: Full=NADH-quinone oxidoreduct...   209    7e-54
sp|B1ZA44.1|NUOC_METPB  RecName: Full=NADH-quinone oxidoreduct...   209    9e-54
sp|A6U7W5.1|NUOC_SINMW  RecName: Full=NADH-quinone oxidoreduct...   208    1e-53
sp|B9KQW2.1|NUOC_RHOSK  RecName: Full=NADH-quinone oxidoreduct...   206    5e-53
sp|Q3J3F9.1|NUOC_RHOS4  RecName: Full=NADH-quinone oxidoreduct...   206    6e-53
sp|Q11JK4.1|NUOC_MESSB  RecName: Full=NADH-quinone oxidoreduct...   206    6e-53
sp|Q2K9T3.1|NUOC_RHIEC  RecName: Full=NADH-quinone oxidoreduct...   206    9e-53
sp|B0ULK6.1|NUOC_METS4  RecName: Full=NADH-quinone oxidoreduct...   206    1e-52
sp|A9W1N1.1|NUOC_METEP  RecName: Full=NADH-quinone oxidoreduct...   206    1e-52
sp|O68854.2|NUOC1_RHIME  RecName: Full=NADH-quinone oxidoreduc...   205    1e-52
sp|B1LUN5.1|NUOC_METRJ  RecName: Full=NADH-quinone oxidoreduct...   205    1e-52
sp|B3PVZ9.1|NUOC1_RHIE6  RecName: Full=NADH-quinone oxidoreduc...   205    1e-52
sp|Q1MIL3.1|NUOC_RHIL3  RecName: Full=NADH-quinone oxidoreduct...   204    2e-52
sp|Q98KQ7.1|NUOC_RHILO  RecName: Full=NADH-quinone oxidoreduct...   204    3e-52
sp|B5ZYL4.1|NUOC_RHILW  RecName: Full=NADH-quinone oxidoreduct...   204    3e-52
sp|Q0APY8.1|NUOC_MARMM  RecName: Full=NADH-quinone oxidoreduct...   203    4e-52
sp|Q2RU38.1|NUOC_RHORT  RecName: Full=NADH-quinone oxidoreduct...   203    5e-52
sp|B9JVE7.1|NUOC_AGRVS  RecName: Full=NADH-quinone oxidoreduct...   202    7e-52
sp|O84971.1|NUOC_RHOCA  RecName: Full=NADH-quinone oxidoreduct...   202    1e-51
sp|Q215I2.1|NUOC_RHOPB  RecName: Full=NADH-quinone oxidoreduct...   202    1e-51
sp|Q0C1E5.1|NUOC_HYPNA  RecName: Full=NADH-quinone oxidoreduct...   202    1e-51
sp|Q2W3I6.1|NUOC_MAGMM  RecName: Full=NADH-quinone oxidoreduct...   202    1e-51
sp|A7HY47.1|NUOC_PARL1  RecName: Full=NADH-quinone oxidoreduct...   201    2e-51
sp|A8I3Y9.1|NUOC_AZOC5  RecName: Full=NADH-quinone oxidoreduct...   201    3e-51
sp|Q163Q2.1|NUOC_ROSDO  RecName: Full=NADH-quinone oxidoreduct...   200    5e-51
sp|Q9A6X2.1|NUOC_CAUCR  RecName: Full=NADH-quinone oxidoreduct...   200    5e-51
sp|Q28T74.1|NUOC_JANSC  RecName: Full=NADH-quinone oxidoreduct...   199    7e-51
sp|Q8G1B5.1|NUOC_BRUSU  RecName: Full=NADH-quinone oxidoreduct...   199    9e-51
sp|Q6N5M4.1|NUOC_RHOPA  RecName: Full=NADH-quinone oxidoreduct...   197    2e-50
sp|A6X1N2.1|NUOC_OCHA4  RecName: Full=NADH-quinone oxidoreduct...   197    3e-50
sp|B9JD44.1|NUOC_AGRRK  RecName: Full=NADH-quinone oxidoreduct...   197    3e-50
sp|Q6G390.1|NUOC_BARHE  RecName: Full=NADH-quinone oxidoreduct...   197    3e-50
sp|Q57DU9.1|NUOC_BRUAB  RecName: Full=NADH-quinone oxidoreduct...   197    4e-50
sp|A1USW9.1|NUOC_BARBK  RecName: Full=NADH-quinone oxidoreduct...   196    8e-50
sp|B0SZ50.1|NUOC_CAUSK  RecName: Full=NADH-quinone oxidoreduct...   194    3e-49
sp|Q2G5Y5.1|NUOC_NOVAD  RecName: Full=NADH-quinone oxidoreduct...   194    3e-49
sp|P29917.3|NQO5_PARDE  RecName: Full=NADH-quinone oxidoreduct...   191    2e-48
sp|Q6FZY9.1|NUOC_BARQU  RecName: Full=NADH-quinone oxidoreduct...   191    3e-48
sp|A9CJB1.1|NUOC_AGRT5  RecName: Full=NADH-quinone oxidoreduct...   190    4e-48
sp|A9IUQ0.1|NUOC_BART1  RecName: Full=NADH-quinone oxidoreduct...   189    1e-47
sp|P34944.2|NDUS3_MARPO  RecName: Full=NADH-ubiquinone oxidore...   188    1e-47
sp|Q35322.2|NDUS3_ORYSJ  RecName: Full=NADH-ubiquinone oxidore...   184    3e-46
sp|Q2NA62.1|NUOC_ERYLH  RecName: Full=NADH-quinone oxidoreduct...   183    4e-46
sp|Q33994.1|NDUS3_BETTR  RecName: Full=NADH-ubiquinone oxidore...   183    6e-46
sp|O21271.1|NDUS3_RECAM  RecName: Full=NADH-ubiquinone oxidore...   182    7e-46
sp|O75489.1|NDUS3_HUMAN  RecName: Full=NADH dehydrogenase [ubi...   182    7e-46
sp|Q0MQG6.1|NDUS3_PONPY  RecName: Full=NADH dehydrogenase [ubi...   182    7e-46
sp|Q0MQG7.1|NDUS3_GORGO  RecName: Full=NADH dehydrogenase [ubi...   182    8e-46
sp|Q0MQG8.1|NDUS3_PANTR  RecName: Full=NADH dehydrogenase [ubi...   182    8e-46
sp|B4RCM7.1|NUOC_PHEZH  RecName: Full=NADH-quinone oxidoreduct...   181    2e-45
sp|Q37787.3|NDUS3_BETVU  RecName: Full=NADH-ubiquinone oxidore...   181    2e-45
sp|Q34011.2|NDUS3_BETWE  RecName: Full=NADH-ubiquinone oxidore...   181    2e-45
sp|Q95748.2|NDUS3_ARATH  RecName: Full=NADH-ubiquinone oxidore...   181    2e-45
sp|P23710.2|NDUS3_NEUCR  RecName: Full=NADH-ubiquinone oxidore...   180    6e-45
sp|P23709.1|NDUS3_BOVIN  RecName: Full=NADH dehydrogenase [ubi...   179    1e-44
sp|Q9DCT2.2|NDUS3_MOUSE  RecName: Full=NADH dehydrogenase [ubi...   178    2e-44
sp|Q5GT42.1|NUOC_WOLTR  RecName: Full=NADH-quinone oxidoreduct...   177    3e-44
sp|Q00673.1|NDUS3_CANMA  RecName: Full=Probable NADH-ubiquinon...   177    3e-44
sp|P80261.3|NDUS3_SOLTU  RecName: Full=NADH-ubiquinone oxidore...   176    7e-44
sp|Q37622.1|NDUS3_PROWI  RecName: Full=NADH-ubiquinone oxidore...   173    6e-43
sp|Q37383.1|NDUS3_ACACA  RecName: Full=NADH-ubiquinone oxidore...   169    1e-41
sp|Q1RJI7.1|NUOC_RICBR  RecName: Full=NADH-quinone oxidoreduct...   162    8e-40
sp|Q2GDX8.1|NUOC_NEOSM  RecName: Full=NADH-quinone oxidoreduct...   157    4e-38
sp|Q4UM07.1|NUOC_RICFE  RecName: Full=NADH-quinone oxidoreduct...   156    9e-38
sp|P22237.1|NDUS3_DICDI  RecName: Full=NADH-ubiquinone oxidore...   154    4e-37
sp|Q2LCR4.1|NDUS3_DICCI  RecName: Full=NADH-ubiquinone oxidore...   153    5e-37
sp|Q47HH4.1|NUOC_DECAR  RecName: Full=NADH-quinone oxidoreduct...   150    4e-36
sp|B5EN69.1|NUOC_ACIF5  RecName: Full=NADH-quinone oxidoreduct...   148    2e-35
sp|Q7NZH9.1|NUOC_CHRVO  RecName: Full=NADH-quinone oxidoreduct...   147    3e-35
sp|Q2YA25.1|NUOC_NITMU  RecName: Full=NADH-quinone oxidoreduct...   147    3e-35
sp|A1W4M4.1|NUOC_ACISJ  RecName: Full=NADH-quinone oxidoreduct...   147    4e-35
sp|A2SFM8.1|NUOC_METPP  RecName: Full=NADH-quinone oxidoreduct...   146    6e-35
sp|Q82TU5.1|NUOC_NITEU  RecName: Full=NADH-quinone oxidoreduct...   146    9e-35
sp|A9BNB2.1|NUOC_DELAS  RecName: Full=NADH-quinone oxidoreduct...   146    1e-34
sp|B1YTQ5.1|NUOC_BURA4  RecName: Full=NADH-quinone oxidoreduct...   145    1e-34
sp|A9AFY9.1|NUOC_BURM1  RecName: Full=NADH-quinone oxidoreduct...   145    2e-34
sp|B2U7Q9.1|NUOC_RALPJ  RecName: Full=NADH-quinone oxidoreduct...   144    2e-34
sp|A1K5B0.1|NUOC_AZOSB  RecName: Full=NADH-quinone oxidoreduct...   144    3e-34
sp|A4G642.1|NUOC_HERAR  RecName: Full=NADH-quinone oxidoreduct...   144    3e-34
sp|Q9K1C1.1|NUOC_NEIMB  RecName: Full=NADH-quinone oxidoreduct...   144    3e-34
sp|Q0BDD2.1|NUOC_BURCM  RecName: Full=NADH-quinone oxidoreduct...   144    3e-34
sp|Q3SEX6.1|NUOC_THIDA  RecName: Full=NADH-quinone oxidoreduct...   144    4e-34
sp|A1TLL8.1|NUOC_ACIAC  RecName: Full=NADH-quinone oxidoreduct...   144    5e-34
sp|Q9JX80.1|NUOC_NEIMA  RecName: Full=NADH-quinone oxidoreduct...   143    5e-34
sp|Q1BV15.1|NUOC_BURCA  RecName: Full=NADH-quinone oxidoreduct...   143    5e-34
sp|Q39EE7.1|NUOC_BURS3  RecName: Full=NADH-quinone oxidoreduct...   143    5e-34
sp|Q127X4.1|NUOC_POLSJ  RecName: Full=NADH-quinone oxidoreduct...   143    5e-34
sp|B2JDM6.1|NUOC_BURP8  RecName: Full=NADH-quinone oxidoreduct...   143    6e-34
sp|Q0AHJ8.1|NUOC_NITEC  RecName: Full=NADH-quinone oxidoreduct...   143    7e-34
sp|C1DCA5.1|NUOC_LARHH  RecName: Full=NADH-quinone oxidoreduct...   143    7e-34
sp|Q9ZDH3.1|NUOC_RICPR  RecName: Full=NADH-quinone oxidoreduct...   142    8e-34
sp|A1KRS4.1|NUOC_NEIMF  RecName: Full=NADH-quinone oxidoreduct...   142    9e-34
sp|Q68X18.1|NUOC_RICTY  RecName: Full=NADH-quinone oxidoreduct...   142    1e-33
sp|B1Y829.1|NUOC_LEPCP  RecName: Full=NADH-quinone oxidoreduct...   142    2e-33
sp|Q0KCS8.1|NUOC_RALEH  RecName: Full=NADH-quinone oxidoreduct...   141    2e-33
sp|Q21YC5.1|NUOC_RHOFD  RecName: Full=NADH-quinone oxidoreduct...   141    2e-33
sp|Q92ID7.1|NUOC_RICCN  RecName: Full=NADH-quinone oxidoreduct...   141    2e-33
sp|B3R3W9.1|NUOC_CUPTR  RecName: Full=NADH-quinone oxidoreduct...   141    2e-33
sp|A9M3E0.1|NUOC_NEIM0  RecName: Full=NADH-quinone oxidoreduct...   141    2e-33
sp|Q1LPW1.1|NUOC_RALME  RecName: Full=NADH-quinone oxidoreduct...   141    3e-33
sp|Q63VN1.1|NUOC_BURPS  RecName: Full=NADH-quinone oxidoreduct...   141    3e-33
sp|A1WXW5.1|NUOC_HALHL  RecName: Full=NADH-quinone oxidoreduct...   140    4e-33
sp|Q8XXQ3.1|NUOC_RALSO  RecName: Full=NADH-quinone oxidoreduct...   140    4e-33
sp|B0TWP6.1|NUOC_FRAP2  RecName: Full=NADH-quinone oxidoreduct...   140    4e-33
sp|Q2SZN3.1|NUOC_BURTA  RecName: Full=NADH-quinone oxidoreduct...   140    5e-33
sp|Q5F617.1|NUOC_NEIG1  RecName: Full=NADH-quinone oxidoreduct...   139    8e-33
sp|A1WLP2.1|NUOC_VEREI  RecName: Full=NADH-quinone oxidoreduct...   139    9e-33
sp|Q1GZL1.1|NUOC_METFK  RecName: Full=NADH-quinone oxidoreduct...   139    9e-33
sp|A7NEK8.2|NUOC_FRATF  RecName: Full=NADH-quinone oxidoreduct...   139    1e-32
sp|Q473U1.1|NUOC_RALEJ  RecName: Full=NADH-quinone oxidoreduct...   139    1e-32
sp|Q2A1F2.1|NUOC_FRATH  RecName: Full=NADH-quinone oxidoreduct...   139    1e-32
sp|Q0BK53.1|NUOC_FRATO  RecName: Full=NADH-quinone oxidoreduct...   139    1e-32
sp|Q5NIN3.1|NUOC_FRATT  RecName: Full=NADH-quinone oxidoreduct...   139    1e-32
sp|Q2KV11.1|NUOC_BORA1  RecName: Full=NADH-quinone oxidoreduct...   139    2e-32
sp|B2SEV1.1|NUOC_FRATM  RecName: Full=NADH-quinone oxidoreduct...   139    2e-32
sp|A4IVZ4.1|NUOC_FRATW  RecName: Full=NADH-quinone oxidoreduct...   138    2e-32
sp|A4JGC8.1|NUOC_BURVG  RecName: Full=NADH-quinone oxidoreduct...   138    2e-32
sp|A4SXQ1.1|NUOC_POLSQ  RecName: Full=NADH-quinone oxidoreduct...   137    3e-32
sp|A5IHW1.1|NUOC_LEGPC  RecName: Full=NADH-quinone oxidoreduct...   137    4e-32
sp|Q142H1.1|NUOC_BURXL  RecName: Full=NADH-quinone oxidoreduct...   136    6e-32
sp|Q5ZRU0.1|NUOC_LEGPH  RecName: Full=NADH-quinone oxidoreduct...   136    8e-32
sp|A0Q8H0.1|NUOC_FRATN  RecName: Full=NADH-quinone oxidoreduct...   135    1e-31
sp|A6SY07.1|NUOC_JANMA  RecName: Full=NADH-quinone oxidoreduct...   135    1e-31
sp|B1XUK0.1|NUOC_POLNS  RecName: Full=NADH-quinone oxidoreduct...   135    2e-31
sp|Q31HF8.1|NUOC_THICR  RecName: Full=NADH-quinone oxidoreduct...   134    2e-31
sp|Q7WCU1.1|NUOC_BORBR  RecName: Full=NADH-quinone oxidoreduct...   134    2e-31
sp|Q5P1E8.1|NUOC_AZOSE  RecName: Full=NADH-quinone oxidoreduct...   134    3e-31
sp|Q5X1A9.1|NUOC_LEGPA  RecName: Full=NADH-quinone oxidoreduct...   134    3e-31
sp|Q7VZQ3.1|NUOC_BORPE  RecName: Full=NADH-quinone oxidoreduct...   134    3e-31
sp|Q7W5A9.1|NUOC_BORPA  RecName: Full=NADH-quinone oxidoreduct...   134    3e-31
sp|Q5WT22.1|NUOC_LEGPL  RecName: Full=NADH-quinone oxidoreduct...   133    6e-31
sp|B2T2E9.1|NUOC_BURPP  RecName: Full=NADH-quinone oxidoreduct...   133    7e-31
sp|A1AVR4.1|NUOC_RUTMC  RecName: Full=NADH-quinone oxidoreduct...   132    1e-30
sp|Q0A777.1|NUOC_ALHEH  RecName: Full=NADH-quinone oxidoreduct...   132    2e-30
sp|Q83BQ7.1|NUOC_COXBU  RecName: Full=NADH-quinone oxidoreduct...   132    2e-30
sp|A1VM62.1|NUOC_POLNA  RecName: Full=NADH-quinone oxidoreduct...   131    2e-30
sp|A5CXF9.1|NUOC_VESOH  RecName: Full=NADH-quinone oxidoreduct...   131    3e-30
sp|A9N8X1.1|NUOC_COXBR  RecName: Full=NADH-quinone oxidoreduct...   131    3e-30
sp|Q3J830.1|NUOC_NITOC  RecName: Full=NADH-quinone oxidoreduct...   130    4e-30
sp|A9II05.1|NUOC_BORPD  RecName: Full=NADH-quinone oxidoreduct...   129    1e-29
sp|Q5GXT3.1|NUOC_XANOR  RecName: Full=NADH-quinone oxidoreduct...   129    2e-29
sp|Q3BRN1.1|NUOC_XANC5  RecName: Full=NADH-quinone oxidoreduct...   128    2e-29
sp|Q8PJ42.1|NUOC_XANAC  RecName: Full=NADH-quinone oxidoreduct...   127    4e-29
sp|B8GNY7.1|NUOC_THISH  RecName: Full=NADH-quinone oxidoreduct...   127    6e-29
sp|Q4UWB6.1|NUOC_XANC8  RecName: Full=NADH-quinone oxidoreduct...   126    7e-29
sp|Q9PGJ3.1|NUOC_XYLFA  RecName: Full=NADH-quinone oxidoreduct...   125    2e-28
sp|Q87EQ3.1|NUOC_XYLFT  RecName: Full=NADH-quinone oxidoreduct...   124    3e-28
sp|B4SQT4.1|NUOC_STRM5  RecName: Full=NADH-quinone oxidoreduct...   121    2e-27
sp|B0U1W7.2|NUOC_XYLFM  RecName: Full=NADH-quinone oxidoreduct...   120    4e-27
sp|B3E9W7.1|NUOC_GEOLS  RecName: Full=NADH-quinone oxidoreduct...   114    3e-25
sp|A5UZH8.1|NUOC_ROSS1  RecName: Full=NADH-quinone oxidoreduct...   112    1e-24
sp|A7NIW0.1|NUOC_ROSCS  RecName: Full=NADH-quinone oxidoreduct...   111    3e-24
sp|A0LJM5.1|NUBCD_SYNFM  RecName: Full=NADH-quinone oxidoreduc...   108    1e-23
sp|P56896.1|NUOC2_RHIME  RecName: Full=NADH-quinone oxidoreduc...   105    1e-22
sp|A5G9B7.1|NUOC_GEOUR  RecName: Full=NADH-quinone oxidoreduct...   104    3e-22
sp|Q39QA9.1|NUOC_GEOMG  RecName: Full=NADH-quinone oxidoreduct...   104    4e-22
sp|B3PY58.1|NUOC2_RHIE6  RecName: Full=NADH-quinone oxidoreduc...   103    5e-22
sp|B5EFG1.1|NUOC_GEOBB  RecName: Full=NADH-quinone oxidoreduct...   103    5e-22
sp|A0RMD1.1|NUOCD_CAMFF  RecName: Full=NADH-quinone oxidoreduc...   101    2e-21
sp|A4FPT9.1|NUOC_SACEN  RecName: Full=NADH-quinone oxidoreduct...   101    3e-21
sp|Q74GA6.1|NUOC_GEOSL  RecName: Full=NADH-quinone oxidoreduct...   100    5e-21
sp|Q6MIR5.1|NUOCD_BDEBA  RecName: Full=NADH-quinone oxidoreduc...   100    7e-21
sp|A1SE29.1|NUOC_NOCSJ  RecName: Full=NADH-quinone oxidoreduct...  99.4    1e-20
sp|Q3A825.1|NUBCD_PELCD  RecName: Full=NADH-quinone oxidoreduc...  98.6    2e-20
sp|Q746S4.1|NUBCD_GEOSL  RecName: Full=NADH-quinone oxidoreduc...  97.1    5e-20
sp|A5GCZ4.1|NUBCD_GEOUR  RecName: Full=NADH-quinone oxidoreduc...  95.9    1e-19
sp|A4XC36.1|NUOC_SALTO  RecName: Full=NADH-quinone oxidoreduct...  95.5    2e-19
sp|Q2RJU5.1|NUOC_MOOTA  RecName: Full=NADH-quinone oxidoreduct...  94.7    3e-19
sp|B5E972.1|NUBCD_GEOBB  RecName: Full=NADH-quinone oxidoreduc...  94.0    5e-19
sp|B1MPG6.1|NUOC_MYCA9  RecName: Full=NADH-quinone oxidoreduct...  94.0    5e-19
sp|O67335.1|NUCD2_AQUAE  RecName: Full=NADH-quinone oxidoreduc...  93.2    9e-19
sp|A9B4Z6.1|NUOC_HERA2  RecName: Full=NADH-quinone oxidoreduct...  93.2    9e-19
sp|A5FXJ8.1|NUOCD_ACICJ  RecName: Full=NADH-quinone oxidoreduc...  92.8    1e-18
sp|A8M620.1|NUOC_SALAI  RecName: Full=NADH-quinone oxidoreduct...  92.4    1e-18
sp|B2V8J2.1|NUOCD_SULSY  RecName: Full=NADH-quinone oxidoreduc...  92.4    2e-18
sp|Q608X9.1|NUOCD_METCA  RecName: Full=NADH-quinone oxidoreduc...  92.4    2e-18
sp|Q39ZC4.1|NUBCD_GEOMG  RecName: Full=NADH-quinone oxidoreduc...  91.7    3e-18
sp|Q1QST4.1|NUOCD_CHRSD  RecName: Full=NADH-quinone oxidoreduc...  91.3    3e-18
sp|Q3KA61.1|NUOCD_PSEPF  RecName: Full=NADH-quinone oxidoreduc...  89.7    9e-18
sp|B2HU43.1|NUOCD_ACIBC  RecName: Full=NADH-quinone oxidoreduc...  89.7    1e-17
sp|B1KJV0.1|NUOCD_SHEWM  RecName: Full=NADH-quinone oxidoreduc...  89.4    1e-17
sp|Q48H52.1|NUOCD_PSE14  RecName: Full=NADH-quinone oxidoreduc...  89.4    1e-17
sp|Q4ZRJ1.1|NUOCD_PSEU2  RecName: Full=NADH-quinone oxidoreduc...  89.4    1e-17
sp|Q87ZQ7.1|NUOCD_PSESM  RecName: Full=NADH-quinone oxidoreduc...  89.4    1e-17
sp|A4TDC0.1|NUOC_MYCGI  RecName: Full=NADH-quinone oxidoreduct...  89.4    1e-17
sp|A5WG46.1|NUOCD_PSYWF  RecName: Full=NADH-quinone oxidoreduc...  89.0    2e-17
sp|Q3JC17.1|NUOCD_NITOC  RecName: Full=NADH-quinone oxidoreduc...  88.6    2e-17
sp|A0PR40.1|NUOC_MYCUA  RecName: Full=NADH-quinone oxidoreduct...  87.8    4e-17
sp|A0QJU9.1|NUOC_MYCA1  RecName: Full=NADH-quinone oxidoreduct...  87.8    4e-17
sp|B2HGE6.1|NUOC_MYCMM  RecName: Full=NADH-quinone oxidoreduct...  87.8    4e-17
sp|Q73V13.1|NUOC_MYCPA  RecName: Full=NADH-quinone oxidoreduct...  87.4    5e-17
sp|Q2YAA3.1|NUOCD_NITMU  RecName: Full=NADH-quinone oxidoreduc...  87.4    5e-17
sp|C6DA44.1|NUOCD_PECCP  RecName: Full=NADH-quinone oxidoreduc...  87.0    6e-17
sp|Q6D2R9.1|NUOCD_ERWCT  RecName: Full=NADH-quinone oxidoreduc...  87.0    6e-17
sp|Q057X3.1|NUOCD_BUCCC  RecName: Full=NADH-quinone oxidoreduc...  86.7    9e-17
sp|A1T6A4.1|NUOC_MYCVP  RecName: Full=NADH-quinone oxidoreduct...  86.3    1e-16
sp|C1DL16.1|NUOCD_AZOVD  RecName: Full=NADH-quinone oxidoreduc...  86.3    1e-16
sp|A0QU34.1|NUOC_MYCS2  RecName: Full=NADH-quinone oxidoreduct...  86.3    1e-16
sp|A8ERL4.1|NUOCD_ARCB4  RecName: Full=NADH-quinone oxidoreduc...  86.3    1e-16
sp|Q4K9T4.1|NUOCD_PSEF5  RecName: Full=NADH-quinone oxidoreduc...  85.9    1e-16
sp|A1JLG6.1|NUOCD_YERE8  RecName: Full=NADH-quinone oxidoreduc...  85.9    1e-16
sp|Q4FU62.1|NUOCD_PSYA2  RecName: Full=NADH-quinone oxidoreduc...  85.9    1e-16
sp|Q1QD95.1|NUOCD_PSYCK  RecName: Full=NADH-quinone oxidoreduc...  85.9    2e-16
sp|B3QY46.1|NUOC_CHLT3  RecName: Full=NADH-quinone oxidoreduct...  85.5    2e-16
sp|Q669A2.1|NUOCD_YERPS  RecName: Full=NADH-quinone oxidoreduc...  85.5    2e-16
sp|Q6FE69.1|NUOCD_ACIAD  RecName: Full=NADH-quinone oxidoreduc...  84.3    4e-16
sp|P33599.3|NUOCD_ECOLI  RecName: Full=NADH-quinone oxidoreduc...  84.0    5e-16
sp|Q7N2I9.1|NUOCD_PHOLL  RecName: Full=NADH-quinone oxidoreduc...  84.0    5e-16
sp|Q0TFG0.1|NUOCD_ECOL5  RecName: Full=NADH-quinone oxidoreduc...  84.0    5e-16
sp|Q8XCW9.1|NUOCD_ECO57  RecName: Full=NADH-quinone oxidoreduc...  84.0    5e-16
sp|B2VIV5.1|NUOCD_ERWT9  RecName: Full=NADH-quinone oxidoreduc...  84.0    5e-16
sp|A9R6L8.1|NUOCD_YERPG  RecName: Full=NADH-quinone oxidoreduc...  84.0    5e-16
sp|C3JY83.1|NUOCD_PSEFS  RecName: Full=NADH-quinone oxidoreduc...  84.0    5e-16
sp|B1X8Z8.1|NUOCD_ECODH  RecName: Full=NADH-quinone oxidoreduc...  84.0    5e-16
sp|B4EZC8.1|NUOCD_PROMH  RecName: Full=NADH-quinone oxidoreduc...  84.0    5e-16
sp|Q8FFJ7.1|NUOCD_ECOL6  RecName: Full=NADH-quinone oxidoreduc...  84.0    5e-16
sp|B7UFU4.1|NUOCD_ECO27  RecName: Full=NADH-quinone oxidoreduc...  84.0    5e-16
sp|B2TW67.1|NUOCD_SHIB3  RecName: Full=NADH-quinone oxidoreduc...  84.0    5e-16
sp|Q83QS6.1|NUOCD_SHIFL  RecName: Full=NADH-quinone oxidoreduc...  84.0    5e-16
sp|Q9RU88.1|NUOC_DEIRA  RecName: Full=NADH-quinone oxidoreduct...  84.0    6e-16
sp|A1BF34.1|NUOC_CHLPD  RecName: Full=NADH-quinone oxidoreduct...  84.0    6e-16
sp|Q56219.1|NQO5_THET8  RecName: Full=NADH-quinone oxidoreduct...  83.2    1e-15
sp|B1J6N2.1|NUOCD_PSEPW  RecName: Full=NADH-quinone oxidoreduc...  82.8    1e-15
sp|Q0S448.1|NUOC_RHOSR  RecName: Full=NADH-quinone oxidoreduct...  82.8    1e-15
sp|A7MH24.1|NUOCD_ENTS8  RecName: Full=NADH-quinone oxidoreduc...  82.4    1e-15
sp|C5B8I4.1|NUOCD_EDWI9  RecName: Full=NADH-quinone oxidoreduc...  82.4    1e-15
sp|A0KJ65.1|NUOCD_AERHH  RecName: Full=NADH-quinone oxidoreduc...  82.4    1e-15
sp|Q1BBP5.1|NUOC_MYCSS  RecName: Full=NADH-quinone oxidoreduct...  82.4    2e-15
sp|Q9XAQ6.1|NUOC_STRCO  RecName: Full=NADH-quinone oxidoreduct...  82.4    2e-15
sp|A6TBX2.1|NUOCD_KLEP7  RecName: Full=NADH-quinone oxidoreduc...  82.0    2e-15
sp|A0LRI3.1|NUOC_ACIC1  RecName: Full=NADH-quinone oxidoreduct...  81.6    2e-15
sp|Q1I7Z8.1|NUOCD_PSEE4  RecName: Full=NADH-quinone oxidoreduc...  81.6    2e-15
sp|A8GH14.1|NUOCD_SERP5  RecName: Full=NADH-quinone oxidoreduc...  81.6    2e-15
sp|Q5YWC9.1|NUOC_NOCFA  RecName: Full=NADH-quinone oxidoreduct...  81.6    3e-15
sp|B0KMY0.1|NUOCD_PSEPG  RecName: Full=NADH-quinone oxidoreduc...  81.6    3e-15
sp|Q88FH5.1|NUOCD_PSEPK  RecName: Full=NADH-quinone oxidoreduc...  81.6    3e-15
sp|A5W190.1|NUOCD_PSEP1  RecName: Full=NADH-quinone oxidoreduc...  81.6    3e-15
sp|P65572.1|NUOC_MYCBO  RecName: Full=NADH-quinone oxidoreduct...  81.3    3e-15
sp|A4SLP2.1|NUOCD_AERS4  RecName: Full=NADH-quinone oxidoreduc...  80.9    4e-15
sp|B5XNV6.1|NUOCD_KLEP3  RecName: Full=NADH-quinone oxidoreduc...  80.9    4e-15
sp|Q6N1Z0.1|NUOCD_RHOPA  RecName: Full=NADH-quinone oxidoreduc...  80.5    5e-15
sp|Q57M30.2|NUOCD_SALCH  RecName: Full=NADH-quinone oxidoreduc...  80.5    5e-15
sp|P0A1Y7.2|NUOCD_SALTI  RecName: Full=NADH-quinone oxidoreduc...  80.5    5e-15
sp|A9MJ99.1|NUOCD_SALAR  RecName: Full=NADH-quinone oxidoreduc...  80.5    6e-15
sp|C0Q041.1|NUOCD_SALPC  RecName: Full=NADH-quinone oxidoreduc...  80.5    6e-15
sp|Q5PN53.1|NUOCD_SALPA  RecName: Full=NADH-quinone oxidoreduc...  80.5    6e-15
sp|B4SYZ7.1|NUOCD_SALNS  RecName: Full=NADH-quinone oxidoreduc...  80.5    6e-15
sp|A6V4E7.1|NUOCD_PSEA7  RecName: Full=NADH-quinone oxidoreduc...  80.5    6e-15
sp|Q9I0J9.1|NUOCD_PSEAE  RecName: Full=NADH-quinone oxidoreduc...  80.5    6e-15
sp|Q1IZX1.1|NUOC_DEIGD  RecName: Full=NADH-quinone oxidoreduct...  80.5    6e-15
sp|B3Q6T3.1|NUOCD_RHOPT  RecName: Full=NADH-quinone oxidoreduc...  80.1    8e-15
sp|A4XV04.1|NUOCD_PSEMY  RecName: Full=NADH-quinone oxidoreduc...  79.7    1e-14
sp|A8ADV3.1|NUOCD_CITK8  RecName: Full=NADH-quinone oxidoreduc...  79.7    1e-14
sp|Q13BH3.1|NUOCD_RHOPS  RecName: Full=NADH-quinone oxidoreduc...  79.3    1e-14
sp|Q8EI31.1|NUOCD_SHEON  RecName: Full=NADH-quinone oxidoreduc...  77.4    4e-14
sp|Q2NSK1.1|NUOCD_SODGM  RecName: Full=NADH-quinone oxidoreduc...  77.0    6e-14
sp|A4WCR5.1|NUOCD_ENT38  RecName: Full=NADH-quinone oxidoreduc...  76.6    9e-14
sp|Q2J0F1.1|NUOCD_RHOP2  RecName: Full=NADH-quinone oxidoreduc...  76.3    1e-13
sp|A9HN95.1|NUOCD_GLUDA  RecName: Full=NADH-quinone oxidoreduc...  76.3    1e-13
sp|Q89AU4.1|NUOCD_BUCBP  RecName: Full=NADH-quinone oxidoreduc...  75.9    1e-13
sp|Q20Z41.1|NUOCD_RHOPB  RecName: Full=NADH-quinone oxidoreduc...  75.1    2e-13
sp|Q1LT91.1|NUOCD_BAUCH  RecName: Full=NADH-quinone oxidoreduc...  75.1    2e-13
sp|B4U8I3.1|NUOCD_HYDS0  RecName: Full=NADH-quinone oxidoreduc...  73.9    6e-13
sp|B8D8V7.1|NUOCD_BUCA5  RecName: Full=NADH-quinone oxidoreduc...  72.8    1e-12
sp|P57254.1|NUOCD_BUCAI  RecName: Full=NADH-quinone oxidoreduc...  72.8    1e-12
sp|B8D761.1|NUOCD_BUCAT  RecName: Full=NADH-quinone oxidoreduc...  72.8    1e-12
sp|Q07QX3.1|NUOCD_RHOP5  RecName: Full=NADH-quinone oxidoreduc...  70.9    5e-12
sp|Q8K9Y5.1|NUOCD_BUCAP  RecName: Full=NADH-quinone oxidoreduc...  70.5    6e-12
sp|P15601.1|NDUS3_PARPR  RecName: Full=NADH-ubiquinone oxidore...  70.1    7e-12
sp|Q492H8.1|NUOCD_BLOPB  RecName: Full=NADH-quinone oxidoreduc...  69.7    1e-11
sp|Q7VRV4.1|NUOCD_BLOFL  RecName: Full=NADH-quinone oxidoreduc...  69.3    1e-11
sp|B1WZG0.1|NDHJ_CYAA5  RecName: Full=NAD(P)H-quinone oxidored...  67.8    4e-11
sp|Q31P07.1|NDHJ_SYNE7  RecName: Full=NAD(P)H-quinone oxidored...  67.4    6e-11
sp|P19125.4|NDHJ_SYNY3  RecName: Full=NAD(P)H-quinone oxidored...  66.6    8e-11
sp|Q7U9P4.1|NDHJ_SYNPX  RecName: Full=NAD(P)H-quinone oxidored...  65.9    1e-10
sp|Q8KX38.1|NDHJ_SYNP2  RecName: Full=NAD(P)H-quinone oxidored...  65.9    2e-10
sp|A2C0C6.1|NDHJ_PROM1  RecName: Full=NAD(P)H-quinone oxidored...  65.9    2e-10
sp|Q5N561.1|NDHJ_SYNP6  RecName: Full=NAD(P)H-quinone oxidored...  65.5    2e-10
sp|Q3AN51.1|NDHJ_SYNSC  RecName: Full=NAD(P)H-quinone oxidored...  65.5    2e-10
sp|A2CCP5.1|NDHJ_PROM3  RecName: Full=NAD(P)H-quinone oxidored...  64.7    3e-10
sp|Q2JT68.1|NDHJ_SYNJA  RecName: Full=NAD(P)H-quinone oxidored...  64.7    3e-10
sp|Q46H82.1|NDHJ_PROMT  RecName: Full=NAD(P)H-quinone oxidored...  64.7    3e-10
sp|O66826.1|NUCD1_AQUAE  RecName: Full=NADH-quinone oxidoreduc...  64.3    4e-10
sp|Q7NML5.1|NDHJ_GLOVI  RecName: Full=NAD(P)H-quinone oxidored...  64.3    5e-10
sp|A5GIB5.1|NDHJ_SYNPW  RecName: Full=NAD(P)H-quinone oxidored...  64.3    5e-10
sp|Q3B0C1.1|NDHJ_SYNS9  RecName: Full=NAD(P)H-quinone oxidored...  63.9    5e-10
sp|Q44241.3|NDHJ_ANASP  RecName: Full=NAD(P)H-quinone oxidored...  63.9    5e-10
sp|Q9XBL6.4|NDHJ_ANAVT  RecName: Full=NAD(P)H-quinone oxidored...  63.9    6e-10
sp|Q7V4Q6.1|NDHJ_PROMM  RecName: Full=NAD(P)H-quinone oxidored...  63.5    7e-10
sp|Q32RI4.1|NDHJ_ZYGCR  RecName: Full=NAD(P)H-quinone oxidored...  63.2    9e-10
sp|A2BP92.1|NDHJ_PROMS  RecName: Full=NAD(P)H-quinone oxidored...  63.2    1e-09
sp|B2J6S5.1|NDHJ_NOSP7  RecName: Full=NAD(P)H-quinone oxidored...  63.2    1e-09
sp|B1X4R3.1|NDHJ_PAUCH  RecName: Full=NAD(P)H-quinone oxidored...  62.8    1e-09
sp|A2BUS3.1|NDHJ_PROM5  RecName: Full=NAD(P)H-quinone oxidored...  62.8    1e-09
sp|Q0IDJ2.1|NDHJ_SYNS3  RecName: Full=NAD(P)H-quinone oxidored...  62.8    1e-09
sp|Q8DJ01.1|NDHJ_THEEB  RecName: Full=NAD(P)H-quinone oxidored...  62.8    1e-09
sp|B0JSV6.1|NDHJ_MICAN  RecName: Full=NAD(P)H-quinone oxidored...  62.4    2e-09
sp|Q2JJA8.1|NDHJ_SYNJB  RecName: Full=NAD(P)H-quinone oxidored...  62.4    2e-09
sp|B0C6C5.1|NDHJ_ACAM1  RecName: Full=NAD(P)H-quinone oxidored...  62.0    2e-09
sp|P15600.1|NDUS3_PARTE  RecName: Full=NADH-ubiquinone oxidore...  61.2    4e-09
sp|Q8A0F6.2|NUOD_BACTN  RecName: Full=NADH-quinone oxidoreduct...  60.8    4e-09
sp|A1EA11.1|NDHJ_AGRST  RecName: Full=NAD(P)H-quinone oxidored...  60.8    5e-09
sp|Q6YXQ8.1|NDHJ_PHYPA  RecName: Full=NAD(P)H-quinone oxidored...  60.5    5e-09
sp|A6MML0.1|NDHJ_DIOEL  RecName: Full=NAD(P)H-quinone oxidored...  60.5    6e-09
sp|Q7V304.1|NDHJ_PROMP  RecName: Full=NAD(P)H-quinone oxidored...  60.5    6e-09
sp|Q9BBT6.1|NDHJ_LOTJA  RecName: Full=NAD(P)H-quinone oxidored...  60.5    7e-09
sp|A8G2V3.1|NDHJ_PROM2  RecName: Full=NAD(P)H-quinone oxidored...  60.5    7e-09
sp|Q10YT5.1|NDHJ_TRIEI  RecName: Full=NAD(P)H-quinone oxidored...  59.7    1e-08
sp|B3TN54.1|NDHJ_BRADI  RecName: Full=NAD(P)H-quinone oxidored...  59.3    1e-08
sp|Q95H60.1|NDHJ_WHEAT  RecName: Full=NAD(P)H-quinone oxidored...  59.3    1e-08
sp|Q5LH50.1|NUOCD_BACFN  RecName: Full=NADH-quinone oxidoreduc...  59.3    1e-08
sp|Q6ENH1.1|NDHJ_ORYNI  RecName: Full=NAD(P)H-quinone oxidored...  59.3    2e-08
sp|A9L999.1|NDHJ_LEMMI  RecName: Full=NAD(P)H-quinone oxidored...  58.9    2e-08
sp|A6MMU7.1|NDHJ_ILLOL  RecName: Full=NAD(P)H-quinone oxidored...  58.9    2e-08
sp|P19124.1|NDHJ_MAIZE  RecName: Full=NAD(P)H-quinone oxidored...  58.9    2e-08
sp|P31174.2|NDHJ_SOYBN  RecName: Full=NAD(P)H-quinone oxidored...  58.5    2e-08
sp|A8SEA6.1|NDHJ_CERDE  RecName: Full=NAD(P)H-quinone oxidored...  58.5    2e-08
sp|P12199.1|NDHJ_MARPO  RecName: Full=NAD(P)H-quinone oxidored...  58.5    2e-08
sp|Q06FV7.1|NDHJ_PELHO  RecName: Full=NAD(P)H-quinone oxidored...  58.2    3e-08
sp|Q9MTP3.1|NDHJ_OENEH  RecName: Full=NAD(P)H-quinone oxidored...  58.2    3e-08
sp|Q85FL7.2|NDHJ_ADICA  RecName: Full=NAD(P)H-quinone oxidored...  58.2    3e-08
sp|A1XFV8.1|NDHJ_NUPAD  RecName: Full=NAD(P)H-quinone oxidored...  58.2    3e-08
sp|Q6EW45.1|NDHJ_NYMAL  RecName: Full=NAD(P)H-quinone oxidored...  57.8    4e-08
sp|A9BDT9.1|NDHJ_PROM4  RecName: Full=NAD(P)H-quinone oxidored...  57.8    4e-08
sp|A5GQF9.1|NDHJ_SYNR3  RecName: Full=NAD(P)H-quinone oxidored...  57.8    4e-08
sp|Q8M9Y0.1|NDHJ_CHAGL  RecName: Full=NAD(P)H-quinone oxidored...  57.8    4e-08
sp|Q0G9L6.1|NDHJ_LIRTU  RecName: Full=NAD(P)H-quinone oxidored...  57.8    4e-08
sp|Q06GZ4.1|NDHJ_DRIGR  RecName: Full=NAD(P)H-quinone oxidored...  57.8    4e-08
sp|Q9M3M1.1|NDHJ_SPIOL  RecName: Full=NAD(P)H-quinone oxidored...  57.4    5e-08
sp|Q06GQ7.1|NDHJ_PIPCE  RecName: Full=NAD(P)H-quinone oxidored...  57.4    5e-08
sp|Q7YJW9.1|NDHJ_CALFG  RecName: Full=NAD(P)H-quinone oxidored...  57.4    6e-08
sp|Q09G43.1|NDHJ_PLAOC  RecName: Full=NAD(P)H-quinone oxidored...  57.0    7e-08
sp|Q3V531.1|NDHJ_ACOCL  RecName: Full=NAD(P)H-quinone oxidored...  57.0    7e-08
sp|A6MM39.1|NDHJ_BUXMI  RecName: Full=NAD(P)H-quinone oxidored...  57.0    7e-08
sp|A7Y3E0.1|NDHJ_IPOPU  RecName: Full=NAD(P)H-quinone oxidored...  57.0    7e-08
sp|Q09MH5.1|NDHJ_CITSI  RecName: Full=NAD(P)H-quinone oxidored...  57.0    7e-08
sp|A6MMC5.1|NDHJ_CHLSC  RecName: Full=NAD(P)H-quinone oxidored...  57.0    8e-08
sp|B5LML3.1|NDHJ_CICAR  RecName: Full=NAD(P)H-quinone oxidored...  57.0    8e-08
sp|Q19V88.2|NDHJ_CHLAT  RecName: Full=NAD(P)H-quinone oxidored...  56.6    9e-08
sp|A1XGP1.1|NDHJ_RANMC  RecName: Full=NAD(P)H-quinone oxidored...  56.6    9e-08
sp|Q09FV8.1|NDHJ_NANDO  RecName: Full=NAD(P)H-quinone oxidored...  56.6    9e-08
sp|Q09X14.1|NDHJ_MORIN  RecName: Full=NAD(P)H-quinone oxidored...  56.6    9e-08
sp|B1A938.1|NDHJ_CARPA  RecName: Full=NAD(P)H-quinone oxidored...  56.2    1e-07
sp|Q0ZJ17.1|NDHJ_VITVI  RecName: Full=NAD(P)H-quinone oxidored...  56.2    1e-07
sp|A0A338.1|NDHJ_COFAR  RecName: Full=NAD(P)H-quinone oxidored...  55.8    1e-07
sp|A4GG94.1|NDHJ_PHAVU  RecName: Full=NAD(P)H-quinone oxidored...  55.8    1e-07
sp|Q14FF4.1|NDHJ_POPAL  RecName: Full=NAD(P)H-quinone oxidored...  55.8    1e-07
sp|Q2L910.1|NDHJ_GOSHI  RecName: Full=NAD(P)H-quinone oxidored...  55.8    2e-07
sp|Q85BB2.1|NDHJ_ANTFO  RecName: Full=NAD(P)H-quinone oxidored...  55.5    2e-07
sp|Q70Y00.1|NDHJ_AMBTC  RecName: Full=NAD(P)H-quinone oxidored...  55.1    2e-07
sp|B1VKF6.1|NDHJ_CRYJA  RecName: Full=NAD(P)H-quinone oxidored...  55.1    3e-07
sp|A6H5H7.1|NDHJ_CYCTA  RecName: Full=NAD(P)H-quinone oxidored...  54.7    3e-07
sp|A6L169.1|NUOD_BACV8  RecName: Full=NADH-quinone oxidoreduct...  54.7    3e-07
sp|B2XWK7.1|NDHJ_FAGEA  RecName: Full=NAD(P)H-quinone oxidored...  54.7    3e-07
sp|A4WT70.1|NUOCD_RHOS5  RecName: Full=NADH-quinone oxidoreduc...  54.7    4e-07
sp|Q32RZ2.1|NDHJ_STAPU  RecName: Full=NAD(P)H-quinone oxidored...  54.3    4e-07
sp|Q06RC6.1|NDHJ_JASNU  RecName: Full=NAD(P)H-quinone oxidored...  54.3    4e-07
sp|P12201.1|NDHJ_TOBAC  RecName: Full=NAD(P)H-quinone oxidored...  54.3    5e-07
sp|B1NWF3.1|NDHJ_MANES  RecName: Full=NAD(P)H-quinone oxidored...  53.9    5e-07
sp|Q9MUR1.1|NDHJ_MESVI  RecName: Full=NAD(P)H-quinone oxidored...  53.9    5e-07
sp|A2T336.1|NDHJ_ANGEV  RecName: Full=NAD(P)H-quinone oxidored...  53.9    5e-07
sp|Q8WI15.1|NDHJ_PSINU  RecName: Full=NAD(P)H-quinone oxidored...  53.9    5e-07
sp|Q2MII4.1|NDHJ_SOLBU  RecName: Full=NAD(P)H-quinone oxidored...  53.9    6e-07
sp|Q2MI97.1|NDHJ_SOLLC  RecName: Full=NAD(P)H-quinone oxidored...  53.9    6e-07
sp|A4QJB8.1|NDHJ_AETCO  RecName: Full=NAD(P)H-quinone oxidored...  53.9    6e-07
sp|A4QL22.1|NDHJ_DRANE  RecName: Full=NAD(P)H-quinone oxidored...  53.9    6e-07
sp|Q2VEH4.1|NDHJ_SOLTU  RecName: Full=NAD(P)H-quinone oxidored...  53.9    6e-07
sp|A4QK21.1|NDHJ_ARAHI  RecName: Full=NAD(P)H-quinone oxidored...  53.5    7e-07
sp|Q49KZ5.1|NDHJ_EUCGG  RecName: Full=NAD(P)H-quinone oxidored...  53.5    8e-07
sp|Q4VZH2.1|NDHJ_CUCSA  RecName: Full=NAD(P)H-quinone oxidored...  53.5    8e-07
sp|P92309.1|NDHJ_LUPLU  RecName: Full=NAD(P)H-quinone oxidored...  53.1    9e-07
sp|Q0G9V9.1|NDHJ_DAUCA  RecName: Full=NAD(P)H-quinone oxidored...  53.1    1e-06
sp|A9QC92.1|NDHJ_TRACE  RecName: Full=NAD(P)H-quinone oxidored...  52.8    1e-06
sp|P56754.1|NDHJ_ARATH  RecName: Full=NAD(P)H-quinone oxidored...  52.8    1e-06
sp|A4QJT6.1|NDHJ_OLIPU  RecName: Full=NAD(P)H-quinone oxidored...  52.8    1e-06
sp|A4QKA8.1|NDHJ_BARVE  RecName: Full=NAD(P)H-quinone oxidored...  52.8    1e-06
sp|A4QKJ5.1|NDHJ_CAPBU  RecName: Full=NAD(P)H-quinone oxidored...  52.4    2e-06
sp|Q1KXV6.1|NDHJ_HELAN  RecName: Full=NAD(P)H-quinone oxidored...  52.4    2e-06
sp|B2LMJ6.1|NDHJ_GUIAB  RecName: Full=NAD(P)H-quinone oxidored...  52.4    2e-06
sp|Q332X5.1|NDHJ_LACSA  RecName: Full=NAD(P)H-quinone oxidored...  52.0    2e-06
sp|A4QJK2.1|NDHJ_AETGR  RecName: Full=NAD(P)H-quinone oxidored...  51.6    3e-06
sp|Q3J1Q7.1|NUOCD_RHOS4  RecName: Full=NADH-quinone oxidoreduc...  51.6    3e-06
sp|B9KJI1.1|NUOCD_RHOSK  RecName: Full=NADH-quinone oxidoreduc...  51.2    3e-06
sp|A3PKI2.1|NUOCD_RHOS1  RecName: Full=NADH-quinone oxidoreduc...  51.2    3e-06
sp|Q68S03.1|NDHJ_PANGI  RecName: Full=NAD(P)H-quinone oxidored...  51.2    4e-06
sp|P77329.1|HYFG_ECOLI  RecName: Full=Hydrogenase-4 component G    48.1    3e-05
sp|P16431.1|HYCE_ECOLI  RecName: Full=Formate hydrogenlyase su...  47.0    7e-05
sp|Q8Q009.1|CHEB1_METMA  RecName: Full=Chemotaxis response reg...  33.9    0.63 
sp|Q88893.1|POL1_TRSVB  RecName: Full=RNA1 polyprotein; AltNam...  32.7    1.4  
sp|B0VTX2.1|PTH_ACIBS  RecName: Full=Peptidyl-tRNA hydrolase; ...  31.6    3.1  
sp|C1B2N8.1|DDL_RHOOB  RecName: Full=D-alanine--D-alanine liga...  31.6    3.3  
sp|Q4L7D2.1|Y1134_STAHJ  RecName: Full=UPF0161 protein SH1134      31.2    3.7  
sp|B7I7B5.1|PTH_ACIB5  RecName: Full=Peptidyl-tRNA hydrolase; ...  31.2    3.8  
sp|P60838.1|DRL1_ARATH  RecName: Full=Probable disease resista...  30.8    5.2  
sp|Q148V7.1|K1468_MOUSE  RecName: Full=LisH domain and HEAT re...  30.0    9.3  

ALIGNMENTS
>sp|Q1GIP0.1|NUOC_SILST RecName: Full=NADH-quinone oxidoreductase subunit C; AltName: 
Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1 subunit 
C
Length=201

 Score =  213 bits (541),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 5/200 (2%)

Query  1    MKNLEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDIT  60
            ++ L+ L  +I ++    + S  I H  + +++   ++  ++ FL+ +S  +F  L+DIT
Sbjct  2    IEALQDLGHQIEAKRPECVLSWDIAHGELNIDVKPANIAGLVEFLRVDSACRFSTLVDIT  61

Query  61   AVDYPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYG  120
            AVDYPE+  RF +VY  LS   N+RI++   ++E + V SI  + PSANW EREVFDM+G
Sbjct  62   AVDYPERTKRFDVVYHLLSMYQNQRIRLRAAVREEDMVPSIVDVHPSANWFEREVFDMFG  121

Query  121  INFKNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDY  180
            I F  HPDLRR+LTDYGF GHPLRKDFP TG+ EVRY E  K+V+YEPVKL Q YR FD+
Sbjct  122  ILFTGHPDLRRLLTDYGFRGHPLRKDFPTTGYTEVRYDEAQKRVVYEPVKLVQEYRQFDF  181

Query  181  ESPWEGTKYI-----KEISK  195
             SPWEG +YI     KEI+K
Sbjct  182  MSPWEGAEYILPGDEKEIAK  201


>sp|A7IPA5.1|NUOC_XANP2 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName: 
Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1 subunit 
C
Length=209

 Score =  212 bits (539),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/189 (48%), Positives = 126/189 (66%), Gaps = 0/189 (0%)

Query  2    KNLEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDITA  61
            + L  L   +++ L+  +  S + H  + L ID   ++ V  FL+ +    F  ++D+  
Sbjct  3    ETLNDLAAHVSAALSGAVLGSLVAHGELTLQIDPAQIVKVATFLRDDPACLFHCIVDVCG  62

Query  62   VDYPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYGI  121
            VDYP +E RF +VY  LS + N RI++     E+ PV SI S+FP ANW ERE +DMYGI
Sbjct  63   VDYPAREKRFDVVYHLLSLKQNVRIRLKVETDEDTPVPSICSVFPGANWFEREAYDMYGI  122

Query  122  NFKNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDYE  181
             F  HP+LRR+LTDYGFDGHPLRKDFP TG  EVRY ++ K+V+YEPV+L Q +RNFD+ 
Sbjct  123  LFTGHPELRRLLTDYGFDGHPLRKDFPTTGFVEVRYDDEQKRVVYEPVRLPQEFRNFDFL  182

Query  182  SPWEGTKYI  190
            SPWEG +Y+
Sbjct  183  SPWEGVEYV  191


>sp|A8LIT7.1|NUOC_DINSH RecName: Full=NADH-quinone oxidoreductase subunit C; AltName: 
Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1 subunit 
C
Length=215

 Score =  211 bits (538),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 129/187 (68%), Gaps = 0/187 (0%)

Query  4    LEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDITAVD  63
            L+ L   I  +    + S+ I H+ + +      ++ ++ FLKT++  KF  LIDITAVD
Sbjct  14   LQELAAHIEMKRPDCVISTEIAHDELTVVATPNSIVGLVAFLKTDATCKFSTLIDITAVD  73

Query  64   YPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYGINF  123
            YPE+  RF +VY FLS   N RI++   ++E++ V SI S  PSANW EREVFDM+GI F
Sbjct  74   YPERAQRFDVVYHFLSMYQNHRIRIRVPVREDDIVPSIISEHPSANWFEREVFDMFGILF  133

Query  124  KNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDYESP  183
              HPDLRRILTDYGF G+PLRKDFP TG+ EVRY E+ K+V+YEPV L Q YR FD+ SP
Sbjct  134  SGHPDLRRILTDYGFRGYPLRKDFPTTGYTEVRYDEEKKRVVYEPVNLVQEYRQFDFMSP  193

Query  184  WEGTKYI  190
            WEG +YI
Sbjct  194  WEGAEYI  200


>sp|Q5LPR5.1|NUOC_SILPO RecName: Full=NADH-quinone oxidoreductase subunit C; AltName: 
Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1 subunit 
C
Length=200

 Score =  209 bits (533),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 96/172 (55%), Positives = 125/172 (72%), Gaps = 0/172 (0%)

Query  19   INSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDITAVDYPEKEMRFKLVYLFL  78
            I S  +    + +++   +L+D + FL+++S  +F  L+DITAVDYPE+  RF +VY FL
Sbjct  20   ILSWDVTFGELNVDVAPSNLVDFVDFLRSDSSCRFSTLVDITAVDYPERAKRFDVVYHFL  79

Query  79   SHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYGINFKNHPDLRRILTDYGF  138
            S   N+RI++   I+E++ V SIT + PSANW EREVFDM+GI F  HPDLRRILTDYGF
Sbjct  80   SMYQNQRIRLRVSIREDDMVPSITDVHPSANWFEREVFDMFGILFTGHPDLRRILTDYGF  139

Query  139  DGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDYESPWEGTKYI  190
             G+PLRKDFP TG+ EVRY E +K+V+YEPV L Q YR FD+ SPWEG  YI
Sbjct  140  RGYPLRKDFPTTGYTEVRYDEAEKRVVYEPVSLVQEYRQFDFMSPWEGADYI  191


>sp|A4WU32.1|NUOC_RHOS5 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName: 
Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1 subunit 
C
Length=200

 Score =  209 bits (533),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 126/189 (66%), Gaps = 0/189 (0%)

Query  2    KNLEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDITA  61
            + L+ L   +       I    I    + L++    ++ ++ FL+T++  +F  L+DITA
Sbjct  3    EALQELAAHVEMRQPDAILGHRIEFGELTLDVAPNRIVGLVEFLRTDARCRFSSLVDITA  62

Query  62   VDYPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYGI  121
            VD+PE+  RF +VY FLS   N RI++   ++E+  V SI S+ PSANW EREVFDM+GI
Sbjct  63   VDHPERPARFDMVYHFLSMYQNHRIRLKMQVREDETVASIHSVHPSANWFEREVFDMFGI  122

Query  122  NFKNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDYE  181
             F  HPDLRRILTDYGF GHP+RKDFP TG+ EVRY E  K+VIYEPVKL Q YR FD+ 
Sbjct  123  LFTGHPDLRRILTDYGFRGHPMRKDFPTTGYTEVRYDEVQKRVIYEPVKLVQEYRQFDFL  182

Query  182  SPWEGTKYI  190
            SPWEG  YI
Sbjct  183  SPWEGADYI  191


>sp|B1ZA44.1|NUOC_METPB RecName: Full=NADH-quinone oxidoreductase subunit C; AltName: 
Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1 subunit 
C
Length=219

 Score =  209 bits (532),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 122/187 (65%), Gaps = 0/187 (0%)

Query  4    LEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDITAVD  63
            L  + ++I   L   +   SI H  + L +   D++  + +L+ +    F+  IDI  VD
Sbjct  24   LRAMGERITGALGPAVTDWSIAHGELTLIVQGSDIVYALTYLRDDPNCAFRCFIDICGVD  83

Query  64   YPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYGINF  123
            YP++  RF +VY  LS  +N R++V        PV S   +FP+ANW ERE +D+YGI F
Sbjct  84   YPQRARRFDVVYHLLSLRHNMRVRVKVQTDAATPVPSAIPVFPAANWFERETYDLYGILF  143

Query  124  KNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDYESP  183
              HPDLRR+LTDYGF+GHPLRKDFPLTG  EVRY +D+ +V+YEPVKL Q +RNFD+ SP
Sbjct  144  SGHPDLRRLLTDYGFEGHPLRKDFPLTGFVEVRYDQDEARVVYEPVKLTQEFRNFDFLSP  203

Query  184  WEGTKYI  190
            WEGT Y+
Sbjct  204  WEGTDYV  210


>sp|A6U7W5.1|NUOC_SINMW RecName: Full=NADH-quinone oxidoreductase subunit C; AltName: 
Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1 subunit 
C
Length=201

 Score =  208 bits (530),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 123/184 (66%), Gaps = 0/184 (0%)

Query  7    LEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDITAVDYPE  66
            L   I       +  S + +  + L    E L+ ++ FL+ + +  F   ID+  VDYP+
Sbjct  8    LASYIREARGALVAGSEVRYGELTLTTKAESLIALLTFLRDDVQCGFVSFIDVCGVDYPQ  67

Query  67   KEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYGINFKNH  126
            +  RF +VY  LS   N+RI+V     EN PV SITS++P A+W ERE +DMYGI F  H
Sbjct  68   RPDRFDVVYHLLSPRQNQRIRVKVATGENEPVPSITSVYPGADWFEREAYDMYGILFTGH  127

Query  127  PDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDYESPWEG  186
            PDLRRILTDYGF+G+PLRKDFPLTG  EVRY  + K+V+YEPV+L+Q +RNFD+ SPWEG
Sbjct  128  PDLRRILTDYGFEGYPLRKDFPLTGFVEVRYDNEAKRVVYEPVELKQEFRNFDFLSPWEG  187

Query  187  TKYI  190
            T+Y+
Sbjct  188  TEYV  191


>sp|B9KQW2.1|NUOC_RHOSK RecName: Full=NADH-quinone oxidoreductase subunit C; AltName: 
Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1 subunit 
C
Length=200

 Score =  206 bits (525),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 127/189 (67%), Gaps = 0/189 (0%)

Query  2    KNLEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDITA  61
            + L+ L   +       I    +    + L++    ++ ++ FL++++  +F  L+DITA
Sbjct  3    EALQELAAHVQMRQPDAILGHRVEFGELTLDVVPNRIVGLVEFLRSDASCRFSSLVDITA  62

Query  62   VDYPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYGI  121
            +D+PE+  RF +VY FLS   N+RI++   ++E+  V SI S+ PSANW EREVFDM+GI
Sbjct  63   IDHPERPARFDVVYHFLSMYQNQRIRLKMQVREDETVASIHSVHPSANWFEREVFDMFGI  122

Query  122  NFKNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDYE  181
             F  HPDLRRILTDYGF GHP+RKDFP TG+ EVRY E  K+V+YEPVKL Q YR FD+ 
Sbjct  123  LFTGHPDLRRILTDYGFRGHPMRKDFPTTGYTEVRYDEVQKRVVYEPVKLVQEYRQFDFL  182

Query  182  SPWEGTKYI  190
            SPWEG  YI
Sbjct  183  SPWEGADYI  191


>sp|Q3J3F9.1|NUOC_RHOS4 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName: 
Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1 subunit 
C
 sp|A3PIX0.1|NUOC_RHOS1 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName: 
Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1 subunit 
C
Length=200

 Score =  206 bits (525),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 127/189 (67%), Gaps = 0/189 (0%)

Query  2    KNLEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDITA  61
            + L+ L   +       I    +    + L++    ++ ++ FL++++  +F  L+DITA
Sbjct  3    EALQELAAHVRMRQPDAILGHRVEFGELTLDVVPNRIVGLVEFLRSDASCRFSSLVDITA  62

Query  62   VDYPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYGI  121
            +D+PE+  RF +VY FLS   N+RI++   ++E+  V SI S+ PSANW EREVFDM+GI
Sbjct  63   IDHPERPARFDVVYHFLSMYQNQRIRLKMQVREDETVASIHSVHPSANWFEREVFDMFGI  122

Query  122  NFKNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDYE  181
             F  HPDLRRILTDYGF GHP+RKDFP TG+ EVRY E  K+V+YEPVKL Q YR FD+ 
Sbjct  123  LFTGHPDLRRILTDYGFRGHPMRKDFPTTGYTEVRYDEVQKRVVYEPVKLVQEYRQFDFL  182

Query  182  SPWEGTKYI  190
            SPWEG  YI
Sbjct  183  SPWEGADYI  191


>sp|Q11JK4.1|NUOC_MESSB RecName: Full=NADH-quinone oxidoreductase subunit C; AltName: 
Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1 subunit 
C
Length=200

 Score =  206 bits (525),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 131/189 (69%), Gaps = 0/189 (0%)

Query  2    KNLEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDITA  61
            + L  L   I  +L  ++    + ++ + + ++  D++DV+ FLK++ + +F   +DI+ 
Sbjct  3    EALRDLAGYIKEKLDGRVQDWMVAYDELTIFVEPGDIVDVLTFLKSDVQCQFFAFVDISG  62

Query  62   VDYPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYGI  121
            VDYP +E RF++VY  LS   N+RI+V     E  P+ S+  +FP+ANW ERE++D+YG+
Sbjct  63   VDYPARERRFEVVYHLLSPRQNQRIRVKVSTDEETPIPSVIEVFPAANWYEREIYDLYGV  122

Query  122  NFKNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDYE  181
             F  HPDLRRILTDYGF+GHPLRKDFPLTG  EV Y ++ K+V+Y+PV L Q +RNFD+ 
Sbjct  123  LFTEHPDLRRILTDYGFEGHPLRKDFPLTGFVEVHYDDEAKRVVYQPVNLRQEFRNFDFL  182

Query  182  SPWEGTKYI  190
            SPWEGT Y+
Sbjct  183  SPWEGTDYV  191


>sp|Q2K9T3.1|NUOC_RHIEC RecName: Full=NADH-quinone oxidoreductase subunit C; AltName: 
Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1 subunit 
C
Length=200

 Score =  206 bits (523),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/172 (50%), Positives = 124/172 (72%), Gaps = 0/172 (0%)

Query  19   INSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDITAVDYPEKEMRFKLVYLFL  78
            I +S + +  + L    E+L+ ++ FL+ +++  F  +IDI  VD+P++E+RF +VY  L
Sbjct  20   IAASQLKYGELTLTATGENLIALLTFLRDDAKCGFVNMIDICGVDWPQRELRFDVVYHLL  79

Query  79   SHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYGINFKNHPDLRRILTDYGF  138
            S + N RI+V     E+ PV S  +++P A+W ERE +DMYG+ F  HPDLRRILTDYGF
Sbjct  80   SPKKNLRIRVKVATDEDTPVPSACAVYPGADWFERETWDMYGVLFTGHPDLRRILTDYGF  139

Query  139  DGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDYESPWEGTKYI  190
            +GHPLRKDFP TG  EVRY +  K+V+YEPV+L+Q +RNFD+ SPWEGT+Y+
Sbjct  140  EGHPLRKDFPTTGFVEVRYDDAAKRVVYEPVELKQEFRNFDFMSPWEGTEYV  191


>sp|B0ULK6.1|NUOC_METS4 RecName: Full=NADH-quinone oxidoreductase subunit C; AltName: 
Full=NADH dehydrogenase I subunit C; AltName: Full=NDH-1 subunit 
C
Length=215

 Score =  206 bits (523),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/187 (47%), Positives = 125/187 (66%), Gaps = 0/187 (0%)

Query  4    LEILEKKINSELTTKINSSSINHNHIYLNIDEEDLLDVIIFLKTNSETKFKQLIDITAVD  63
            L+ L  ++   L   +   +I  + + L ++  +++ V+  L+ +    F+  IDI   D
Sbjct  20   LQALSDRLAETLGGAVVERAIAFDELTLVVEPSEIVRVLTHLRDDPACGFRSFIDICGAD  79

Query  64   YPEKEMRFKLVYLFLSHENNKRIKVDFFIKENNPVTSITSIFPSANWMEREVFDMYGINF  123
            YP +E RF +VY  LS  +N+RI+V     E  PV S+ ++FP+ANW ERE +D+YGI F
Sbjct  80   YPGREKRFDVVYHLLSLRHNRRIRVKVQTDEATPVPSVITVFPAANWYERETYDLYGILF  139

Query  124  KNHPDLRRILTDYGFDGHPLRKDFPLTGHNEVRYSEDDKKVIYEPVKLEQNYRNFDYESP  183
              HPDLRR+LTDYGF+GHPLRKDFPLTG  EVRY +D+ +V+YEPVKL Q +R FD+ SP
Sbjct  140  SGHPDLRRLLTDYGFEGHPLRKDFPLTGFVEVRYDQDEGRVVYEPVKLSQEFRQFDFLSP  199

Query  184  WEGTKYI  190
            WEGT Y+
Sbjct  200  WEGTDYV  206