GOS 1418010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1092343429547
Annotathon code: GOS_1418010
Sample :
  • GPS :0°18'4s; 91°39'6w
  • Galapagos Islands: Upwelling, Fernandina Island - Ecuador
  • Coastal upwelling (-12m, 18.6°C, 0.1-0.8 microns)
Authors
Team : Algarve
Username : 768990bio1
Annotated on : 2010-07-30 14:30:16
  • a37076 AnaSofiaCarraçoCosta
  • a37089 LilianaSofiaGriloSantos
  • a37090 ManuelAlexanderGuerreiroVieira

Synopsis

  • Taxonomy: Gammaproteobacteria (NCBI info)
    Rank: class - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 1236
    Kingdom: Bacteria - Phylum: Proteobacteria - Class: Gammaproteobacteria - Order:
    Bacteria; Proteobacteria; Gammaproteobacteria;

Genomic Sequence

>JCVI_READ_1092343429547 GOS_1418010 Genomic DNA
TCGAAGCTTCTTGATTTTACTAACGAAGGAAATAAATTATTTTTTATTGCTGGTAATAGAGATTTTCTTCTTGATAAGGAATTTGCATCCTCAACCAATA
TTGAAATTCTTGAAGATCCCTTCTCTATGATGTTCAATGAAATGAAAGTTGTCATAAGTCATGGAGATTTTCTCTGTACAAATGATTCAGAATATATGGA
ATTCAGAGAGCAGGTTCGCTCTCCCTCTTGGAAAAGTGAATTCCTCAGTAAGCCTTTGCATGAAAGAAAGAAGATTGCTGATAGCATGAGAGATGCTAGT
AATTCTGCCAGTAAGGACAAGTCTTCTGAAATTACTGATGTAAACCTAGGTGATGTAGACTTATTTCTTCAAAAAGAGAAGCCAAATCTGTTTATTCATG
GTCATACCCACAGACCTGATCTGCATGATTTAGAGTATGAAGATTTTTCAACGCAGCGCATTGTTTTAGGCGATTGGGATACTTTTGGTTGGTGTTTAAA
ACTTGATATTAATGGTCCTGATTTATTCAAATTTAAGATCCAATAAAGCATTGAAACCCCTCTAAAAGTACTGTATATTTATACAGTATTTTTAGCATTC
CTATATTATGAAAATTAATTACATCGGTACGGTGATTGCAGATAATTTATCTGAGCTAATGCTGCCATATTTCCAGGATATGGTGCACGCAGGATTCCCA
AGTCCTGCAAGTGATTTCATAGAGTCGCCCATAGATTTAAATAAATATCTAATAAAAAATAATGCTGCCACTTTTCTTGTAAGGGTAAGTGGAAAATCAA
TGATAGGTGCAGGCATCAATGATGGTGCAACTTTAATTATAGATAGAAGTATTAAGCCCTCTCACAATAGTATTATAGTAGCAGCAGTTGACGGTGAGTT
TGTTTGCAGAAGACTT

Translation

[1 - 543/916]   direct strand
>GOS_1418010 Translation [1-543   direct strand]
SKLLDFTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCTNDSEYMEFREQVRSPSWKSEFLSKPLHERKKIADSMRDAS
NSASKDKSSEITDVNLGDVDLFLQKEKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWCLKLDINGPDLFKFKIQ

[ Warning ] 5' incomplete: does not start with a Methionine

Annotator commentaries

The query utilized is a good potencial ORF with know function, with more than 180 codons, goods homologs and with a known domain. The query is incomplete in 5'end.

The UDP-2,3-diacylglucosamine hydrolase contains a Metallophosphoesterase domain, so because the translation of incomplete ORF finded have a significant (E-value of 7.5e-08, under e-06) unintegrated domain of Metallo dependent phophatase ( a domain contained in UDP-2,3-diacylglucosamine hydrolase proteins) and a high homology with UDP-2,3-diacylglucosamine hydrolase proteins this ORF may represent a UDP-2,3-diacylglucosamine hydrolase or a very similar protein.

Like UDP-2,3-diacylglucosamine hydrolase this protein should integrate in the process of lipid biosynthesis (biosynthetic process) with the phosphatase function (hydrolase activity).

The GOS_1418010 is a Gamaproteobacteria, that is the in group choose in the trees. There aren't any rank under the class that can be truly associated with GOS_1418010.

ORF finding

PROTOCOL


a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code



RESULTS ANALYSIS

There are two potencial ORFs with more than 60 amino-acids in direct strand and others two on reverse strand.

The larger ORF (ORF number 1 in reading frame 1 on the direct strand extends from base 1 to base 546) was the sequence analysed, and is coding and incomplete on the 5'end (see the Multiple Alignement).

The ORF number 1 in reading frame 2 of direct strand have coherent results on protein domains and BLASTp vs NR (with more than 40 results with E-values under e-20)that indicate a possible function on the DNA repair process;this BLASTp taxonomy report indicate that the sequence is of a d-proteobacterium.

The ORF number 1 in reading frame 2 of reverse strand (is overlapping with the ORF number 1 in reading frame 2 of direct strand) don´t have results on BLASTp but have a unintegrated domain of a peptide signal.

The ORF number 1 in reading frame 3 on the reverse strand (is overlapping with the larger ORF)also don't have results on BLASTp but have a unintregrated domain of transmembrane regions.



RAW RESULTS

a) forward strand

>ORF number 1 in reading frame 1 on the direct strand extends from base 1 to base 546.
TCGAAGCTTCTTGATTTTACTAACGAAGGAAATAAATTATTTTTTATTGCTGGTAATAGA
GATTTTCTTCTTGATAAGGAATTTGCATCCTCAACCAATATTGAAATTCTTGAAGATCCC
TTCTCTATGATGTTCAATGAAATGAAAGTTGTCATAAGTCATGGAGATTTTCTCTGTACA
AATGATTCAGAATATATGGAATTCAGAGAGCAGGTTCGCTCTCCCTCTTGGAAAAGTGAA
TTCCTCAGTAAGCCTTTGCATGAAAGAAAGAAGATTGCTGATAGCATGAGAGATGCTAGT
AATTCTGCCAGTAAGGACAAGTCTTCTGAAATTACTGATGTAAACCTAGGTGATGTAGAC
TTATTTCTTCAAAAAGAGAAGCCAAATCTGTTTATTCATGGTCATACCCACAGACCTGAT
CTGCATGATTTAGAGTATGAAGATTTTTCAACGCAGCGCATTGTTTTAGGCGATTGGGAT
ACTTTTGGTTGGTGTTTAAAACTTGATATTAATGGTCCTGATTTATTCAAATTTAAGATC
CAATAA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
SKLLDFTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCT
NDSEYMEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVD
LFLQKEKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWCLKLDINGPDLFKFKI
Q*

>ORF number 1 in reading frame 2 on the direct strand extends from base 596 to base 916.
CATTCCTATATTATGAAAATTAATTACATCGGTACGGTGATTGCAGATAATTTATCTGAG
CTAATGCTGCCATATTTCCAGGATATGGTGCACGCAGGATTCCCAAGTCCTGCAAGTGAT
TTCATAGAGTCGCCCATAGATTTAAATAAATATCTAATAAAAAATAATGCTGCCACTTTT
CTTGTAAGGGTAAGTGGAAAATCAATGATAGGTGCAGGCATCAATGATGGTGCAACTTTA
ATTATAGATAGAAGTATTAAGCCCTCTCACAATAGTATTATAGTAGCAGCAGTTGACGGT
GAGTTTGTTTGCAGAAGACTT

>Translation of ORF number 1 in reading frame 2 on the direct strand.
HSYIMKINYIGTVIADNLSELMLPYFQDMVHAGFPSPASDFIESPIDLNKYLIKNNAATF
LVRVSGKSMIGAGINDGATLIIDRSIKPSHNSIIVAAVDGEFVCRRL

No ORFs were found in reading frame 3.

b) reverse strand

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 56 to base 298.
GAGGGCTTAATACTTCTATCTATAATTAAAGTTGCACCATCATTGATGCCTGCACCTATC
ATTGATTTTCCACTTACCCTTACAAGAAAAGTGGCAGCATTATTTTTTATTAGATATTTA
TTTAAATCTATGGGCGACTCTATGAAATCACTTGCAGGACTTGGGAATCCTGCGTGCACC
ATATCCTGGAAATATGGCAGCATTAGCTCAGATAAATTATCTGCAATCACCGTACCGATG
TAA

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
EGLILLSIIKVAPSLMPAPIIDFPLTLTRKVAALFFIRYLFKSMGDSMKSLAGLGNPACT
ISWKYGSISSDKLSAITVPM*

>ORF number 1 in reading frame 3 on the reverse strand extends from base 549 to base 758.
AGAAATAAGTCTACATCACCTAGGTTTACATCAGTAATTTCAGAAGACTTGTCCTTACTG
GCAGAATTACTAGCATCTCTCATGCTATCAGCAATCTTCTTTCTTTCATGCAAAGGCTTA
CTGAGGAATTCACTTTTCCAAGAGGGAGAGCGAACCTGCTCTCTGAATTCCATATATTCT
GAATCATTTGTACAGAGAAAATCTCCATGA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
RNKSTSPRFTSVISEDLSLLAELLASLMLSAIFFLSCKGLLRNSLFQEGERTCSLNSIYS
ESFVQRKSP*

Multiple Alignement

PROTOCOL

a)MUSCLE sequence alignment / default parameters;


RESULTS ANALYSIS

The GOS_141801 is 5' incomplete and the complete sequence must begin with a methionine; this can be seen in the multiple alignment because all the other sequences begin more upstream and with a methionine. The sequences have good similarity.

RAW RESULTS

a)Muscle
CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


GOS_141801      ------------------------------------------------------------
Ma.sp._in       ----------------MTHYFISDLHLSDKRPDLIRAFTSLSDLICLKQHQEGNIKLSVV
Th.sp._in       ------------MASSAPALVISDLHLDREPGPLLEATLAF-----LKGPARSASALYIL
N.c.in          ----------------MTVYFVSDIHLKPERPDLTRAFSYF-----LTETAQDASELFLL
K.k.in          -----------------MIHIISDLHLCEERPDLTALFTQY-----MNDIAPKSDALYVL
B.mar.in        -MSNNYKTQNSAFAPQGTSWFISDLHLAPEETRITAGFYDF-----MLQP-QAGDTLFIL
Te.t.in         ---------------MAIQYFISDLHLQPDRPDLVAAFYRF-----IDTYLQDADELYIL
Sa.d.in         ----------------MARYFISDLHLQPSRMDLAKGYYDF-----CEQHLSQGDELYIL
St.mal.in       ----------------MTTLFISDLHLDPSRPEITDLFLRF-----LREQAPTADALYIL
Pa.an.in        ---------------MPRTLFIADLHLCQEEPAITAGFLHF-----LQREAPHCDALYIL
Se.o.in         ----------------MNTLFIADLHLCTQEPAITAGFLRF-----LRHDAIHAEALYIL
J.sp._out       MSSSLSSASTNQAQPAMAALFVSDLHLQAAMPRTTQAFFNF-----LQNQALHTKQLYLL
Ar.ar.out       ----------------MSALFISDLHLCEQRPVTLRAFFAF-----LQGPARSVQALYIL
Met.mo.out      ----MVNLNTDSPDPSGVTLFISDLHLCASRPQITDAFLQF-----LSSTAKSAKALYIL
Meb.fa.out      -------MESADQDKTAFSLLISDLHLCDSRPAITAQFLDF-----LHRQATQARALYIL
Mev.sp.out      -----MSDGNALSATLPYSLFISDLHLCDARPEISRAFLHL-----LQGEARHAERLYIL
Co.l.in         --------------MSERHFFISDLHLDASRPHVTTALKTF-----LDER-RDAAALYIL
g.p.in          ---------------MSECLFISDLHLSEEHPAVEQALTDF-----LHRE-QKANALYVL
m.g.proteo      ----------------MTTLFISDLHLDPSRPAVSRAFFQF-----LKSEVTNADALYIL
m2_in           ---------------MSRTLFISDLHLDPARPAVIAALAEF-----LQEN-SNCDALYIL
Al.sp._in       ---------------MSYTLFISDLHLDPARPEHLDALEKL-----LAEHAGKADALYVL
Al.b.in         ---------------MSYSLFISDLHLDPARPEHLDGLKKL-----LAQHAGKADALYVL
Ch.sa.in        ----------------MTTLLISDLHLHTGQPDITRGFLDY-----LERDARHADTLYLL
Az.v.in         ----------------MTTLLISDLHLDEERPDIARAFLRF-----LKERASQAEALYIL
Ps.fu.in        -----------------MILLISDLHLEEERPDITRAFLDL-----LAGRARSASALYIL
Ps.sy.in        -----------------MILLISDLHLEQERQDITRAFLAL-----LAGRARTAEALYIL
Ps.sy2.in       -----------------MILLISDLHLEQERPDITRAFLAL-----LAGRARTAEALYIL
                                                                            

GOS_141801      ----------------------SKLLDFTNEGNKLFFIAGNRDFLLDKEFASSTNIEILE
Ma.sp._in       GDFYEAWIGDDFTS-SWNDDIEAALIKLSHAGVKLRVFHGNRDFLLGQLWANRVQAELIE
Th.sp._in       GDLFEYWVGDDAGF-PAAEQLAEALKSLE---IPVAFIHGNRDFLVGEAYAARAGMQLAP
N.c.in          GDIFEAWIGDDAPI-PGLDELFSQLKALSDKGCKVYFQHGNRDFLVGQTFVSGIGAELLP
K.k.in          GDLFESWIGDDDDS-EFVKSIIAKFKAYSDSGKPLYFQHGNRDFLLGDEFAKATGGVIVR
B.mar.in        GDFFNYWIGDDVPH-PFSEKIKQLLKATSERGVKIYIMHGNRDFLIGERFCEESGCELLE
Te.t.in         GDFFDAWIGDDEDA-SFYLDIAARLNLLSTQGVAIYFQHGNRDFLIGEQFAKSAGVTLLP
Sa.d.in         GDFFDAWIGDDEDG-AFYKDVIQQLAALKGRGVSTYFMHGNRDFLVGGKFAELTGATLLE
St.mal.in       GDLFEAWIGDDTPS-PAADAVADALKVLTDSGVPAYFIRGNRDFLLGEDYARRAGLRILP
Pa.an.in        GDLFEAWIGDDDPN-PLHQQVADALRSVP---VPVYFIHGNRDFLIGQRFARASGMTLLP
Se.o.in         GDLFEAWIGDDDPE-PLHAEIADALKTLQQAGVPCYFIHGNRDFLLGKRFARASGMQLLP
J.sp._out       GDIFEAWAGDDDLDDPYHQQVVNALKKVSASGVEVFWMAGNRDFLVGQKFAEVTGISLLP
Ar.ar.out       GDLFEYWAGDDDAT-PLDNAVSDALAALAETGTSLFFLPGNRDFLLGESFARRARLRILP
Met.mo.out      GDLFEYWAGDDDIEDAFNQQIIQGFKALATSGVSIYLMHGNRDFLITEDFCKAAHIQLIN
Meb.fa.out      GDFFEYWAGDDDLA--HYQPIIQALRALSDHGTQLYFMHGNRDFLIGEAFAYAAGLKLLP
Mev.sp._ou      GDLFEYWAGDDEVNDPHHQTIIHGLRALTQSGTACYFMHGNRDFLIGERFAEASGVTLLA
Co.l.in         GDLFEFWIGDDDDT-AIAVDVARLLHDYQQAGPDLYFMHGNRDFLLGESFMDKVGGQLLP
g.p.in          GDLFEVWIGDDDDT-PLAERVADRFKAYSDNGPALFFMVGNRDFLMGPYYAGRCGATLLE
m.g.proteo      GDFFEVWIGDDDDS-ELAQSVISSLRDLTASGIPIFLMHGNRDFLIGTQFLEQSGCQLLE
m2_in           GDLFEAWVGDDDDA-PLALDIANLFRTFIAAGSPLFLMVGNRDFMLGTAFCEAVGAQLLQ
Al.sp._in       GDLFEAWIGDDDDT-PFNLDAIAAFRQFSDSGSKLYFMHGNRDFMLGNDFATACGGTLLD
Al.b.in         GDLFEAWIGDDDDT-PFNLEAIAAFRQFSDSGSKLYFMHGNRDFMLGNDFAAACGGTLLG
Ch.sa.in        GDIFEAWIGDDYLG-DLERQVIEALRRLSDAGTQLYFMHGNRDFLVGEDFAAAAGATLLD
Az.v.in         GDFFEAWIGDDAMT-SFQRDIAAALREVAERGTRVFLMHGNRDFLVGHSFCRQAGCTLLR
Ps.fu.in        GDFFEAWIGDDAMT-PFQRSICQALRELSDSGTAIFLMHGNRDFMLGKAFCKQAGCTLLK
Ps.sy.in        GDFFEAWIGDDAIS-PFQLSICQALRELSDSGTRIFLMHGNRDFMLGKGFCKAAGCTLLS
Ps.sy2.in       GDFFEAWIGDDAMS-PFQRSICQALRELSDSGTRIFLMHGNRDFMLGKGFCKAAGCTLLS
                                        :              *****::   :       :  

GOS_141801      DPFSMMF-NEMKVVISHGDFLCTNDSEYMEFREQVRSPSWKSEFLSKPLHERKKIADSMR
Ma.sp._in       GSFCLSH-NAQTILISHGDEACLDDVEYQAFRSMVRQGAWQKQVLSMPLENRIALASKLR
Th.sp._in       EPLHAALPCG-PAVLLHGDSLCTDDTEHMAFRQQVRSGEWQKGFLSHPLEERIRQAEAMR
N.c.in          EEILIDLPCG-PALIMHGDQLCTDDQEYMQFRAMVRDPQWQSAFKAKSLEERLAVARQLR
K.k.in          EVHPVTI-GDKEAILMHGDSLCWDDKEYMQFRQMVRSQEWQQQLLSQPLAVRRGIAADLR
B.mar.in        DPTVIEL-NGEPTLLMHGDSLCTLDEAYMEFRQMARNPSWQAEFLSKSIEERMAFANQAR
Te.t.in         EQHKTLV-AGKPVLLMHGDSLCIDDTEYMAFRNQVRSAAWQQQVLALPLEQRRAMAAQLR
Sa.d.in         ENCTITLTDGRTALLLHGDSLCTGDIEYMAFRQQVRNPAWQAQILALPLEHRRAMAADLR
St.mal.in       DPCVIEL-YGRPVLLQHGDLLCTDDIPYQQFRAQTRDPAFQAQFLSQPLAARIAFAQKAR
Pa.an.in        EARVLTL-YGHRVLIMHGDTLCTDDVGYLQFRAKVHNPWIQRLFLALPLFIRKRIAERMR
Se.o.in         EEKVLEL-YGRKILILHGDTLCTDDQAYQQFRRKVHNPLIQKLFLAMPLRWRLKIAAKMR
J.sp._out       DPFVTSL-AGRLLVLTHGDAYCTDDAAYMEFRAQVRQAEWQQNFLALPLAQRKAIIENLR
Ar.ar.out       DPTLIDF-DNEGVLLSHGDILCTDDEHYQSFRRLVRDPAWQLAFLERPLAQRKQVIEGLR
Met.mo.out      DPTLIDL-CETATLLSHGDALCTDDVTYQQFRTQVRNKQWQAQFLSQPLQARKDQIAAIR
Meb.fa.out      DPSLLIL-HGKRALLSHGDALCTDDAAYQAFRRQVRHPTWQQEFLQQPLDMRKAQIAALR
Mev.sp._ou      DPVLHEL-YDKRVLLSHGDLLCTDDVAYQEFRQLVRKLDWQQVFLQQPLATRKMQIEAIR
Co.l.in         DPSVVEI-DGQKLLLMHGDSLCTRDVDYQAFRSLARDPNWQAEILSKSLETRRELAQQLR
g.p.in          DPTVHNI-GGEPTLLMHGDSLCTEDIDYQAFRAQSRQPQWQQPVLAKPLEERRQLAQSLR
m.g.proteo      DPTVIDL-YGQAILLMHGDTLCTEDLAYIKFRAECRSEPWQSDLLSRPLAERRRLAIQMR
m2_in           DPTVIDL-YGTPTLLMHGDSLCTRDEEYMKFRAMARSPQWQAQMMASSLNDRRALAAQLR
Al.sp._in       EGTVVDL-YGTDAILMHGDSLCTLDTAYQQFRTMARNPQWQQGMLAKPLEERRMIAQGMR
Al.b.in         EGTVVDL-YGTAAILMHGDSLCTLDTAYQQFRTMARDPQWQQGMLAKPLEERRMIAQGMR
Ch.sa.in        DPCLATL-GRQTVLLMHGDSLCTGDEEYMKFRAMARDPEWQAQILALPIEQRLELAKSLR
Az.v.in         DPSRVIL-NGAPVLLMHGDTLCTRDIAYMRFRRRLRNPVSVWLLRHLPLSKRRQLARKWR
Ps.fu.in        DPSVVQF-YGEPVLLMHGDSLCTRDESYMKLRRYLRNPLSLFILRNLPLRTRHKLARKLR
Ps.sy.in        DPSVVQL-NGEPVLLMHGDSLCTRDEGYMRMRRYLRHPLTLFILRHLPLSTRHKLARKLR
Ps.sy2.in       DPSVVQL-NGEPVLLMHGDSLCTRDEGYMRMRRYLRHPLTLFILRHLPLSTRHKLARKLR
                             :: ***  *  *  :  :*   .       .   .:  *       *

GOS_141801      DASNSASKDKS-------SEITDVNLGDVDLFLQKEKPNLFI-HGHTHRPDLHD---LEY
Ma.sp._in       EDSKSSNSEKM-------LDIMDVHGDEIKRLMTLHNAKVMI-HGHTHRPDLHK---LS-
Th.sp._in       AASRDNGQMKA-------AAIMDVNPTAVADVFRDADVPLMI-HGHTHRPAIHE---LTV
N.c.in          EASKERGAEKS-------EYITDVNTESVVKALNDNKCDLLI-HGHTHRPAIHQ---ITS
K.k.in          QKSREAQANKA-------SAITDVHPDAVKEVLQKHNADILI-HGHTHRPDFHD---IEV
B.mar.in        DESQSSNSMKD-------EAIMDVTPEEVDLALTQNHCRHMI-HGHTHRPNIHQ---WEN
Te.t.in         SQSSSMNAMKA-------EDIMDVNPEAVAQAMRKFDVSTIL-HGHTHRPAVHE---IEL
Sa.d.in         AKSKSMNSNKA-------EDIMDVAETSVNAAFEQANTSLMI-HGHTHRPNRHK---HTN
St.mal.in       ETSQARQSEMKQGDRATFENVTDVAPAEVDATFVRHGVDTMI-HGHTHRPAIHA---LQA
Pa.an.in        ANSKQANQHKS-------LEIMDVNQQAVIDALLQHKAPLLI-HGHTHRPAIHD---LSL
Se.o.in         ARSRQSNQGKS-------QAIMDVNPQAVEQAMLSHNVHWMI-HGHTHRPAVHE---LEL
J.sp._out       AGSRAAQRDKS-------YDIMDVNQDAIAGLFRHSRSATMI-HGHTHRPARHQ---HQV
Ar.ar.out       FQSETAKQEKA-------SDIMDVNAFAVETLLREHGYPTLI-HGHTHRPAHHV---HVV
Met.mo.out      LRSEQEKSNKS-------AVIMDVNAEAVNQLLKEYDYPSLLIHGHTHRPHQHQ---LQV
Meb.fa.out      QRSEQEKSGKQ-------ESIMDVNPEAVAALLREYDYPELLIHGHTHRPALHP---LEV
Mev.sp._ou      MRSESEKSIKQ-------ADIMDVNDEAVAALFSDWAYPELLIHGHTHRPACHQ---LTL
Co.l.in         KTSRDAGSRKA-------DDIMDVTKEEVDATMASTGCGTLI-HGHTHRPAKHA---ET-
g.p.in          AMSRDAGSNKA-------EDIMDVTHSAVNAAMETAGVTRLI-HGHTHRPAHHR---VD-
m.g.proteo      ADSKEANSNKA-------SAIMDVSQHEVLRVMQSNQVTRMI-HGHTHRPAVHEFNLLET
m2_in           TISKDAGSNKA-------QDIMDVTPEEVDRLMSEARVTRLI-HGHTHRPARHQ---VA-
Al.sp._in       MQSQGNNANKA-------ENIMDVTPEEVVREMQDAGVKHLI-HGHTHRPDVHD---VAL
Al.b.in         MQSQGNNANKA-------ENIMDVTPQEVVREMQEAGVQHLI-HGHTHRPDVHD---IAL
Ch.sa.in        MQSSDANTQKA-------DAIMDVTPAEVEAIMREHGVSTLI-HGHTHRPAVHE---FTL
Az.v.in         DASRMQVRRKA-------TEIVDVTPEEVPRIMAAHGVLTLI-HGHTHRPAVHE---LQV
Ps.fu.in        SESRAQTRMKA-------NDIVDVTPEEIPRIMQEYGVKTLV-HGHTHRPAIHK---LQI
Ps.sy.in        NESRAQTRMKA-------NDIVDVTPDEVPRIMQQFGVRTLV-HGHTHRPAIHK---LQI
Ps.sy2.in       NESRAQTRMKA-------NDIVDVTPDEVPRIMQQFGVRTLV-HGHTHRPAIHK---LQI
                  *                 : **    :   :       :: *******  *       

GOS_141801      EDFSTQRIVLGDWD-----T-FGWCLKLDING-PDLFKFKIQ------------------
Ma.sp._in       ---NGSRLVLGDWD-----K-FAWLSILDETG-LSQYKFDVNELSEEKNDLDSLLAVSKR
Th.sp._in       DGQPRQRCVLPAWD-----E-HPGYLEIDATG-PVLRQLDGSPYPAHLLHA---------
N.c.in          AQGPSTRVVLGDWD-----E-KGWYLKVDSSG-YELISFDIAEA----------------
K.k.in          DGNHCQRIVLSDWG-----D-KGHYLTIAGDE-IDSHYFE--------------------
B.mar.in        QGELRQRLVLGDWY-----R-KGWYLKVDADG-FDFVQFDLPRIDESN------------
Te.t.in         NSHHGKRFVLGDWN-----T-TGWFIRANASE-LQLVEFDF-------------------
Sa.d.in         SLGVCERIVLGDWE-----Q-TGWYLKDDNSA-VELVEFPL-------------------
St.mal.in       GGRACTRIVLGDWY-----E-QGSVLRVDANG-WTLDTLSRE------------------
Pa.an.in        NGVNAQRAVLGAWH-----S-RGSMIQLDASG-IQLIDFDF-------------------
Se.o.in         SNGKAHRVVLGAWH-----T-EGSMIKVSVDA-VELIQFPF-------------------
J.sp._out       DGAERLRYVLSDWDLDHTTASRGDWLALDTAGEIHRFTLDGTEIDS--------------
Ar.ar.out       DGRSCERWVLADWH-----D-DAPYLRWDGAGPPVALRFGAKLGT---------------
Met.mo.out      DGKTITRWVLGDWY-----E-QGSYLACDASG-CRSVDLNSN------------------
Meb.fa.out      DGHRIDRWVLGDWY-----E-QGSYLLIDQQG-IHSQPLP--------------------
Mev.sp._ou      HGHSCQRWVLGDWY-----E-QGSYLRLDATG-CNSSLL---------------------
Co.l.in         ---EGNRWVLGDWD-----H-SGWYLKLENGA-IELIEFDINQ-----------------
g.p.in          ---RGDRWVLGDWL-----E-LGWCLRARDSG-LSLEKFDIGS-----------------
m.g.proteo      DDSTGTRIVLGDWH-----A-TGWVLSYQSDSSYALEEFVID------------------
m2_in           ---EGERIVMGDWD-----A-KGWYIEATSKD-LNLVEFAINQ-----------------
Al.sp._in       PDGTGKRWVLGDWG-----K-LGWQIVADSERGLRLESFDIN------------------
Al.b.in         PEGTGKRWVLGDWG-----E-LGWQIVADSKTGLTLESFEIS------------------
Ch.sa.in        DGQPAQRIVLGDWR-----PGRGWEVRVEDDAPPRLREFAFQARA---------------
Az.v.in         DGRQARRIVLGDWN-----R-QGWVLQVDGSG-YHLTPFPID------------------
Ps.fu.in        GDQAAKRIVLGDWD-----R-QGWALQVDENG-FALAPFDFAPPLALPHG----------
Ps.sy.in        GDQSAKRIVLGDWD-----R-QGWVLQVDEQG-MNLGSFDFVPETVALLN----------
Ps.sy2.in       GDQSAKRIVLGDWD-----R-QGWVLQVDEQG-MNLGSFDFVPETVALLN----------
                      * *:  *                         :                     

GOS_141801      ------
Ma.sp._in       MHVLKI
Th.sp._in       ------
N.c.in          ------
K.k.in          ------
B.mar.in        ------
Te.t.in         ------
Sa.d.in         ------
St.mal.in       ------
Pa.an.in        ------
Se.o.in         ------
J.sp._out       ------
Ar.ar.out       ------
Met.mo.out      ------
Meb.fa.out      ------
Mev.sp._ou      ------
Co.l.in         ------
g.p.in          ------
m.g.proteo      ------
m2_in           ------
Al.sp._in       ------
Al.b.in         ------
Ch.sa.in        ------
Az.v.in         ------
Ps.fu.in        ------
Ps.sy.in        ------
Ps.sy2.in

Protein Domains

PROTOCOL


a) InterProScan; default parameters at EBI



RESULTS ANALYSIS

There is only one result. The E-value is not great but have a acceptable significance .

Knowing the domain founded, the protein might have a phosphatase function.

There isn't a accession number in the sequence because the only domain founded is unintegrated.


RAW RESULTS

Translation	48924A3FC3BF9097	181	superfamily	SSF56300	Metallo-dependent phosphatases	10	180	7.5e-08	T	16-Mar-2010	NULL	NULL	

Phylogeny

PROTOCOL

a) Phylogeny.fr / BioNJ method /1000 bootstrap / out group: Methylobacillus flagellatus out(b-proteobacteria),Janthinobacterium sp. out(b-proteobacteria),Aromatoleum aromaticum out (b-proteobacteria), Methylovorus sp. out(b-proteobacteria),Methylotenera mobilis out (b-proteobacteria).

b)Phylogeny.fr / PhyML method /100 bootstrap / default substitution model / out group: Methylobacillus flagellatus out(b-proteobacteria),Janthinobacterium sp. out(b-proteobacteria),Aromatoleum aromaticum out (b-proteobacteria), Methylovorus sp. out(b-proteobacteria),Methylotenera mobilis out (b-proteobacteria).


RESULTS ANALYSIS

The trees don't are very consistent, and have very low bootstrap values, even in the roots that separate in and out groups (bootstrand with values under 0,6). One reason for this low values is the taxonomical proximity of beta and gama-proteobacterias.






In a) (BioNJ results) the branchs 1 to 18, are the ones with bootstrap values under 0.7:

1-0.47; 2-0.03; 3-0.17; 4-0.3; 5-0.082; 6-0.26; 7-0.2; 8-0.25; 9-0.1; 10-0.039; 11-0.31; 12-0.06; 13-0.37; 14-0.28. 15- 16- 17- 18-


In b) (PhyML results) the branchs 1 to 18, are the ones with bootstrap values under 0.7:

1-0.57; 2-0.08; 3-0.14; 4-0.01; 5-0.18; 6-0.07; 7-0.13; 8-0.27; 9-0.13; 10-0.25; 11-0.16; 12-0.25; 13-0.21; 14-0.17; 15-0.22; 10-0.45; 17-0.57; 18-0.36.



RAW RESULTS
a) BioNJ method

                                                                                                     ------0.1-----
 
            +-----------------------------------------------------------------------Marinomonas_sp._in                     [g-proteobacteria]
            |
      +----3+ +----------------------------------------------------------------GOS_1418010                                 
      |     +4+
      |       +--------------------------------------------------Kangiella_koreensis_in                                    [g-proteobacteria]
      |
      |      +---------------------------------------------------Neptuniibacter_caesariensis_in                            [g-proteobacteria]
     2+      |
     ||  +--6+                        +------------------------Pantoea_ananatis_in                                         [g-proteobacteria]
     ||  |   |                        |
     ||  |   +------------------------+
     ||  |                            +-------------------------Serratia_odorifera_in                                      [g-proteobacteria]
     |+-5+
     |   |   +--------------------------------------------------------Stenotrophomonas_maltophilia_in                      [g-proteobacteria]
     |   |   |
     |   |   |     +-------------------------------------------Bermanella_marisrubri_in                                    [g-proteobacteria]
     |   |   |     |
     |   +--7+     |            +------------------------------------Congregibacter_litoralis_in                           [g-proteobacteria]
     |       |     |      +---13+
     |       |     |      |     +----------------------------------gamma_proteobacterium_in                                [g-proteobacteria]
     |       |     |    +12+
     |       +----8+    | |   +--------------------------------------marine_gamma_o                                        [g-proteobacteria]
     |             |    | +-14+
     |             |  +10+     +-------------------------------marine_gamma_t                                              [g-proteobacteria]
 +--1+             |  | |
 |   |             |  | |                                       +---Alcanivorax_sp._in                                     [g-proteobacteria]
 |   |             |  | +---------------------------------------+
 |   |             +-9+                                         |
 |   |                |                                         +----Alcanivorax_borkumensis_in                            [g-proteobacteria]
 |   |                |
 |   |                |   +-----------------------------Chromohalobacter_salexigens_in                                     [g-proteobacteria]
 |   |                |   |
 |   |                +-11+                                      +-------------------------Azotobacter_vinelandii_in       [g-proteobacteria]
 |   |                    |                                      |
 |   |                    +--------------------------------------+                 +----------Pseudomonas_fluorescens_in   [g-proteobacteria]
 |   |                                                           +-----------------+
 |   |                                                                             |          +Pseudomonas_syringae_in     [g-proteobacteria]
 |   |                                                                             +----------+
 |   |                                                                                        +Pseudomonas_syringae2_in    [g-proteobacteria]
 |   |
 |   |  +-----------------------------------------------Thioalkalivibrio_sp._in                                            [g-proteobacteria]
 |   |  |
 |   +15+     +------------------------------------Teredinibacter_turnerae_in                                              [g-proteobacteria]
 |      +-16--+
 |            +--------------------------------------Saccharophagus_degradans_in                                           [g-proteobacteria]
 |
 |
 |   +---------------------------------------------Janthinobacterium_sp._out                                               [b-proteobacteria]
 |   |
 +-17+              +---------------------------------------Aromatoleum_aromaticum_out                                     [b-proteobacteria]
     |              |
     +--------------+         +----------------------------------Methylotenera_mobilis_out                                 [b-proteobacteria]
                    +---------+
                              |  +-------------------Methylobacillus_flagellatus_out                                       [b-proteobacteria]
                              +18+
                                 +--------------------------------Methylovorus_sp._out                                     [b-proteobacteria]

------------------------------------------------------------------------------------------------------
b)PhyML method

                                                                                                  -------0.1------
             +------------------------------------------------Neptuniibacter_caesariensis_in                                [g-proteobacteria]
             |
         +--3+                       +--------------------Pantoea_ananatis_in                                                [g-proteobacteria]
         |   +-----------------------+
         |                           +----------------Serratia_odorifera_in                                                  [g-proteobacteria]
         |
      +-2+             +-----------------------------------------------------------------GOS_1418010
      |  |             |
      |  |    +-------5+        +---------------------------Kangiella_koreensis_in                                           [g-proteobacteria]
      |  |    |        |        |
      |  |    |        +-------7+
      |  +---4+                 +--------------------------------------------------------------------Marinomonas_sp._in       [g-proteobacteria]
      |       |
      |       | +------------------------------------------Thioalkalivibrio_sp._in                                            [g-proteobacteria]
      |       +6+
      |         |         +-------------------Teredinibacter_turnerae_in                                                      [g-proteobacteria]
      |         +--------8+
      |                   +-------------------------------Saccharophagus_degradans_in                                         [g-proteobacteria]
      |
      |                                                                                     +Pseudomonas_syringae_in          [g-proteobacteria]
      |                                                                              +------+
      |                                                                              |      +Pseudomonas_syringae2_in         [g-proteobacteria]
      |                                                                   +----------+
 +---1+                                                                   |          +-----Pseudomonas_fluorescens_in         [g-proteobacteria]
 |    |                           +---------------------------------------+
 |    |                           |                                       +--------------------Azotobacter_vinelandii_in      [g-proteobacteria]
 |    |                      +--13+
 |    |                      |    |
 |    |                      |    +-----------------------Chromohalobacter_salexigens_in                                      [g-proteobacteria]
 |    |                      |
 |    |                +---11+                   +-----------------------Congregibacter_litoralis_in                          [g-proteobacteria]
 |    |                |     |       +---------16+
 |    |                |     |  +--15+           +-------------------------gamma_proteobacterium_in                           [g-proteobacteria]
 |    |                |     |  |    |
 |    |                |     |  |    +---------------marine_gamma_t                                                           [g-proteobacteria]
 |    |                |     +14+
 |    |      +-------10+        |                              +Alcanivorax_sp._in                                            [g-proteobacteria]
 |    |      |         |        +------------------------------+
 |    |      |         |                                       +----Alcanivorax_borkumensis_in                                [g-proteobacteria]
 |    |      |         |
 |    +-----9+         |    +---------------------------Bermanella_marisrubri_in                                              [g-proteobacteria]
 |           |         +--12+
 |           |              +----------------------------marine_gamma_o                                                       [g-proteobacteria]
 |           |
 |           +-------------------------------------------------Stenotrophomonas_maltophilia_in                                [g-proteobacteria] 
 |
 |
 |    +---------------------------------------Janthinobacterium_sp._out                                                       [b-proteobacteria]
 |    |
 +--17+            +----------------------------------Aromatoleum_aromaticum_out                                              [b-proteobacteria]
      |            |
      +------------+      +----------------------Methylotenera_mobilis_out                                                    [b-proteobacteria]
                   +------+
                          |  +------------Methylobacillus_flagellatus_out                                                     [b-proteobacteria]
                          +18+
                             +-----------------------------Methylovorus_sp._out                                               [b-proteobacteria]

Taxonomy report

PROTOCOL

1) BLASTp vs NR

2) BLASTp vs SWISSPROT


RESULTS ANALYSIS

The two taxonomy lineage pasted on raw results are different. The Taxonomy lineage finded with BLASTp vs NR have more hits, so the choose of in and out groups was based on BLASTp vs NR.

The choose of the sequence to the groups (in and out) was almost entirely based only on taxonomy report, although having always in consideration de E-values of BLASTp results and the variability of organisms choosen. The in groups are of the gama proteobacteria, and the out group are of the betaproteobacteria



In group: g-proteobacteria

ZP_01306022.1 Bermanella marisrubri in 2e-37 Oceanobacter sp. RED65 (g-proteobacteria)

ZP_01168199.1 Neptuniibacter caesariensis in 8e-37 Oceanospirillum sp. MED92 (g-proteobacteria)

ZP_01078235.1 Marinomonas sp. in 8e-32 Marinomonas sp. MED121 (g-proteobacteria)

YP_574104.1 Chromohalobacter salexigens in 1e-33 Chromohalobacter salexigens DSM 3043 (g-proteobacteria)

ZP_05041878.1 Alcanivorax sp. in 6e-32 Alcanivorax sp. DG881 (g-proteobacteria)

YP_692924.1 Alcanivorax borkumensis in 8e-32 Alcanivorax borkumensis SK2 (g-proteobacteria)

YP_003147145.1 Kangiella koreensis in 1e-34 Kangiella koreensis DSM 16069 (g-proteobacteria)

ZP_01618249.1 marine gamma proteobacterium in 4e-34 marine gamma proteobacterium HTCC2143 (g-proteobacteria)

ZP_04959300.1 gamma proteobacterium in 7e-33 gamma proteobacterium NOR51-B (g-proteobacteria)

YP_002799513.1 Azotobacter vinelandii in 9e-33 Azotobacter vinelandii DJ (g-proteobacteria)

YP_003073401.1 Teredinibacter turnerae in 1e-32 Teredinibacter turnerae T7901 (g-proteobacteria)

YP_003519350.1 Pantoea ananatis in 1e-32 Pantoea ananatis LMG 20103 (g-proteobacteria)

ZP_03396957.1 Pseudomonas syringae in 4e-32 Pseudomonas syringae pv. tomato T1 (g-proteobacteria)

ZP_06191906.1 Serratia odorifera in 2e-31 Serratia odorifera 4Rx13 (g-proteobacteria)

YP_003461145.1 Thioalkalivibrio sp. in 1e-31 Thioalkalivibrio sp. K90mix (g-proteobacteria)

YP_349370.1 Pseudomonas fluorescens in 9e-32 Pseudomonas fluorescens Pf0-1 (g-proteobacteria)

ZP_05093831.1 marine gamma proteobacterium2 in5e-32 marine gamma proteobacterium HTCC2148 (g-proteobacteria)

YP_527372.1 Saccharophagus degradans in 5e-32 Saccharophagus degradans 2-40 (g-proteobacteria)

NP_793519.1 Pseudomonas syringae2 in 4e-32 Pseudomonas syringae pv. tomato str. DC3000(g-proteobacteria)

ZP_01102763.1 Congregibacter litoralis in 3e-31 Congregibacter litoralis KT71 (g-proteobacteria)

YP_002027204.1 Stenotrophomonas maltophilia in 4e-31 Stenotrophomonas maltophilia R551-3 (g-proteobacteria)


Out group: other bacteria (_non g-proteobacteria: b-proteobacteria)

YP_544606.1 Methylobacillus flagellatus out 1e-33 Methylobacillus flagellatus KT (b-proteobacteria)

YP_001353801.1 Janthinobacterium sp. out 1e-32 Janthinobacterium sp. Marseille (b-proteobacteria)

YP_159733.1 Aromatoleum aromaticum out 2e-32 Aromatoleum aromaticum EbN1 (b-proteobacteria)

YP_003052023.1 Methylovorus sp. out 7e-32 Methylovorus sp. SIP3-4 (b-proteobacteria)

ZP_01552589.1 Methylotenera mobilis out 2e-30 Methylophilales bacterium HTCC2181 (b-proteobacteria)



RAW RESULTS

1) BLASTp vs NR
root
. Bacteria            [bacteria]
. . Proteobacteria      [proteobacteria]
. . . Gammaproteobacteria [g-proteobacteria]
. . . . Oceanospirillales   [g-proteobacteria]
. . . . . Oceanospirillaceae  [g-proteobacteria]
. . . . . . Bermanella marisrubri ------------------------------------------------  158 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Oceanobacter sp. RED65
. . . . . . Neptuniibacter caesariensis ..........................................  156 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Oceanospirillum sp. ME
. . . . . . Marinomonas sp. MED121 ...............................................  140 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Marinomonas sp. MED121
. . . . . . Marinomonas sp. MWYL1 ................................................  122 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Marinomonas sp. MWYL1]
. . . . . Chromohalobacter salexigens DSM 3043 -----------------------------------  146 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Chromohalobacter salex
. . . . . Alcanivorax sp. DG881 ..................................................  140 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Alcanivorax sp. DG881]
. . . . . Alcanivorax borkumensis SK2 ............................................  140 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Alcanivorax borkumensi
. . . . . Hahella chejuensis KCTC 2396 ...........................................  120 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Hahella chejuensis KCT
. . . . . uncultured SUP05 cluster bacterium .....................................   97 1 hit  [g-proteobacteria]       hypothetical protein Sup05_1292 [uncultured SUP05 cluster b
. . . . Kangiella koreensis DSM 16069 --------------------------------------------  149 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Kangiella koreensis DS
. . . . marine gamma proteobacterium HTCC2143 ....................................  147 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [marine gamma proteobac
. . . . gamma proteobacterium NOR51-B ............................................  143 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [gamma proteobacterium 
. . . . Azotobacter vinelandii DJ ................................................  143 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Azotobacter vinelandii
. . . . Teredinibacter turnerae T7901 ............................................  143 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Teredinibacter turnera
. . . . Pantoea ananatis LMG 20103 ...............................................  142 1 hit  [enterobacteria]         LpxH [Pantoea ananatis LMG 20103]
. . . . Pseudomonas syringae pv. tomato T1 .......................................  140 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas syringae p
. . . . Pseudomonas syringae pv. tomato str. DC3000 ..............................  140 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas syringae p
. . . . Pseudomonas syringae pv. tomato ..........................................  140 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas syringae p
. . . . Saccharophagus degradans 2-40 ............................................  140 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Saccharophagus degrada
. . . . marine gamma proteobacterium HTCC2148 ....................................  140 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [marine gamma proteobac
. . . . Pseudomonas fluorescens Pf0-1 ............................................  139 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas fluorescen
. . . . Thioalkalivibrio sp. K90mix ..............................................  139 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Thioalkalivibrio sp. K
. . . . Serratia odorifera 4Rx13 .................................................  138 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Serratia odorifera 4Rx
. . . . Congregibacter litoralis KT71 ............................................  137 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Congregibacter litoral
. . . . Stenotrophomonas maltophilia R551-3 ......................................  137 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Stenotrophomonas malto
. . . . Colwellia psychrerythraea 34H ............................................  137 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Colwellia psychrerythr
. . . . Pseudomonas syringae pv. oryzae str. 1_6 .................................  137 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas syringae p
. . . . Pseudomonas fluorescens Pf-5 .............................................  137 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas fluorescen
. . . . Thioalkalivibrio sp. HL-EbGR7 ............................................  137 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Thioalkalivibrio sp. H
. . . . Pseudomonas fluorescens SBW25 ............................................  137 3 hits [g-proteobacteria]       hypothetical protein PFLU3874 [Pseudomonas fluorescens SBW2
. . . . Halothiobacillus neapolitanus c2 .........................................  137 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Halothiobacillus neapo
. . . . Pseudomonas syringae pv. syringae FF5 ....................................  137 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas syringae p
. . . . Stenotrophomonas maltophilia K279a .......................................  137 3 hits [g-proteobacteria]       putative UDP-2,3-diacylglucosamine hydrolase (ec 3.6.1.-) [
. . . . Stenotrophomonas sp. SKA14 ...............................................  137 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Stenotrophomonas sp. S
. . . . Pseudomonas syringae pv. syringae B728a ..................................  137 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas syringae p
. . . . Enterobacter sp. 638 .....................................................  136 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Enterobacter sp. 638] 
. . . . Pseudomonas mendocina ymp ................................................  136 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas mendocina 
. . . . Pseudomonas syringae pv. phaseolicola 1448A ..............................  135 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas syringae p
. . . . Pseudomonas syringae pv. aesculi str. NCPPB3681 ..........................  135 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas syringae p
. . . . Pseudomonas syringae pv. aesculi str. 2250 ...............................  135 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas syringae p
. . . . Pseudomonas syringae pv. tabaci ATCC 11528 ...............................  135 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas syringae p
. . . . Beggiatoa sp. PS .........................................................  134 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Beggiatoa sp. PS] >gi|
. . . . gamma proteobacterium NOR5-3 .............................................  134 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [gamma proteobacterium 
. . . . Citrobacter sp. 30_2 .....................................................  134 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Citrobacter sp. 30_2] 
. . . . Sodalis glossinidius str. 'morsitans' ....................................  133 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Sodalis glossinidius s
. . . . Pseudomonas aeruginosa PA7 ...............................................  133 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas aeruginosa
. . . . Escherichia albertii TW07627 .............................................  133 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia albertii T
. . . . Serratia proteamaculans 568 ..............................................  132 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Serratia proteamaculan
. . . . Yersinia mollaretii ATCC 43969 ...........................................  132 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia mollaretii AT
. . . . Marinobacter algicola DG893 ..............................................  132 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Marinobacter algicola 
. . . . Pseudomonas entomophila L48 ..............................................  131 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas entomophil
. . . . Serratia odorifera DSM 4582 ..............................................  131 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Serratia odorifera DSM
. . . . gamma proteobacterium HTCC2207 ...........................................  131 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [marine gamma proteobac
. . . . Aliivibrio salmonicida LFI1238 ...........................................  130 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Aliivibrio salmonicida
. . . . Escherichia coli 536 .....................................................  130 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli 536] 
. . . . Escherichia coli F11 .....................................................  130 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli 536] 
. . . . Escherichia coli SE15 ....................................................  130 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli 536] 
. . . . Escherichia coli ED1a ....................................................  130 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli ED1a]
. . . . Escherichia coli CFT073 ..................................................  130 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli CFT07
. . . . Escherichia coli 83972 ...................................................  130 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli CFT07
. . . . Escherichia coli O6 ......................................................  130 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli CFT07
. . . . Aeromonas hydrophila subsp. hydrophila ATCC 7966 .........................  130 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Aeromonas hydrophila s
. . . . Halorhodospira halophila SL1 .............................................  130 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Halorhodospira halophi
. . . . Citrobacter koseri ATCC BAA-895 ..........................................  130 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Citrobacter koseri ATC
. . . . Pseudomonas putida W619 ..................................................  130 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas putida W61
. . . . Escherichia coli UMN026 ..................................................  129 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli UMN02
. . . . Escherichia coli 042 .....................................................  129 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli UMN02
. . . . Escherichia coli FVEC1412 ................................................  129 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli UMN02
. . . . Escherichia coli SMS-3-5 .................................................  129 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli SMS-3
. . . . Escherichia coli 53638 ...................................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli SMS-3
. . . . Escherichia coli SE11 ....................................................  129 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli SMS-3
. . . . Escherichia sp. 4_1_40B ..................................................  129 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli SMS-3
. . . . Escherichia coli B354 ....................................................  129 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli SMS-3
. . . . Pantoea sp. At-9b ........................................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Pantoea sp. At-9b] >gi
. . . . Pseudomonas putida GB-1 ..................................................  129 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas putida GB-
. . . . Escherichia coli UTI89 ...................................................  129 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli UTI89
. . . . Escherichia coli APEC O1 .................................................  129 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli UTI89
. . . . Escherichia coli S88 .....................................................  129 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli UTI89
. . . . Escherichia sp. 3_2_53FAA ................................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli UTI89
. . . . Shigella dysenteriae Sd197 ...............................................  129 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Shigella dysenteriae S
. . . . Escherichia coli str. K-12 substr. MG1655 ................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine pyrophosphatase [Escherichia coli
. . . . Escherichia coli str. K-12 substr. W3110 .................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine pyrophosphatase [Escherichia coli
. . . . Escherichia coli HS ......................................................  129 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine pyrophosphatase [Escherichia coli
. . . . Escherichia coli ATCC 8739 ...............................................  129 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine pyrophosphatase [Escherichia coli
. . . . Escherichia coli str. K-12 substr. DH10B .................................  129 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine pyrophosphatase [Escherichia coli
. . . . Escherichia coli BW2952 ..................................................  129 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine pyrophosphatase [Escherichia coli
. . . . Escherichia coli K-12 ....................................................  129 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine pyrophosphatase [Escherichia coli
. . . . Escherichia coli .........................................................  129 7 hits [enterobacteria]         UDP-2,3-diacylglucosamine pyrophosphatase [Escherichia coli
. . . . Escherichia coli LW1655F+ ................................................  129 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine pyrophosphatase [Escherichia coli
. . . . Escherichia coli DH1 .....................................................  129 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine pyrophosphatase [Escherichia coli
. . . . Shigella dysenteriae 1012 ................................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Shigella dysenteriae 1
. . . . Escherichia coli B185 ....................................................  129 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Shigella dysenteriae 1
. . . . Xanthomonas campestris pv. campestris str. ATCC 33913 ....................  129 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Xanthomonas campestris
. . . . Xanthomonas campestris pv. campestris str. 8004 ..........................  129 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Xanthomonas campestris
. . . . Xanthomonas campestris pv. campestris ....................................  129 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Xanthomonas campestris
. . . . Marinobacter aquaeolei VT8 ...............................................  129 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Marinobacter aquaeolei
. . . . Shigella flexneri 2002017 ................................................  129 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Shigella flexneri 2002
. . . . Escherichia coli O127:H6 str. E2348/69 ...................................  129 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O127:
. . . . Vibrio harveyi HY01 ......................................................  129 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio harveyi HY01] >
. . . . Escherichia coli O157:H7 EDL933 ..........................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O157:
. . . . Escherichia coli O157:H7 str. Sakai ......................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O157:
. . . . Escherichia coli O157:H7 str. EC4113 .....................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O157:
. . . . Escherichia coli O157:H7 str. EC4401 .....................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O157:
. . . . Escherichia coli O157:H7 str. EC4501 .....................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O157:
. . . . Escherichia coli O157:H7 str. EC4486 .....................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O157:
. . . . Escherichia coli O157:H7 str. EC4196 .....................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O157:
. . . . Escherichia coli O157:H7 str. EC4076 .....................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O157:
. . . . Escherichia coli O157:H7 str. EC869 ......................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O157:
. . . . Escherichia coli O157:H7 str. EC508 ......................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O157:
. . . . Escherichia coli O157:H7 str. EC4024 .....................................  129 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O157:
. . . . Escherichia coli O157:H7 str. EC4206 .....................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O157:
. . . . Escherichia coli O157:H7 str. EC4045 .....................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O157:
. . . . Escherichia coli O157:H7 str. EC4042 .....................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O157:
. . . . Escherichia coli O157:H7 str. EC4115 .....................................  129 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O157:
. . . . Escherichia coli O157:H7 str. TW14588 ....................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O157:
. . . . Escherichia coli O157:H7 str. TW14359 ....................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O157:
. . . . Escherichia coli O157:H7 str. FRIK2000 ...................................  129 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O157:
. . . . Escherichia coli O157:H7 str. FRIK966 ....................................  129 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O157:
. . . . Escherichia coli O55:H7 str. CB9615 ......................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O157:
. . . . Escherichia coli O157:H7 .................................................  129 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli O157:
. . . . Photobacterium damselae subsp. damselae CIP 102761 .......................  129 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Photobacterium damsela
. . . . Vibrio harveyi ATCC BAA-1116 .............................................  129 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio harveyi ATCC BA
. . . . Pseudomonas putida KT2440 ................................................  129 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas putida KT2
. . . . Xanthomonas campestris pv. campestris str. B100 ..........................  129 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Xanthomonas campestris
. . . . Citrobacter youngae ATCC 29220 ...........................................  129 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Citrobacter youngae AT
. . . . Pseudomonas putida F1 ....................................................  129 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas putida F1]
. . . . Shigella sonnei Ss046 ....................................................  128 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Shigella sonnei Ss046]
. . . . Escherichia coli E22 .....................................................  128 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli E22] 
. . . . Escherichia coli B171 ....................................................  128 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli E22] 
. . . . Escherichia coli O103:H2 str. 12009 ......................................  128 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli E22] 
. . . . Erwinia tasmaniensis Et1/99 ..............................................  128 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Erwinia tasmaniensis E
. . . . Marinobacter sp. ELB17 ...................................................  128 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Marinobacter sp. ELB17
. . . . Pseudomonas aeruginosa PACS2 .............................................  128 1 hit  [g-proteobacteria]       hypothetical protein PaerPA_01002255 [Pseudomonas aeruginos
. . . . Pseudomonas aeruginosa C3719 .............................................  128 2 hits [g-proteobacteria]       hypothetical protein PaerPA_01002255 [Pseudomonas aeruginos
. . . . Shigella flexneri 2a str. 301 ............................................  128 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Shigella flexneri 2a s
. . . . Shigella flexneri 2a str. 2457T ..........................................  128 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Shigella flexneri 2a s
. . . . Shigella boydii Sb227 ....................................................  128 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Shigella flexneri 2a s
. . . . Shigella flexneri 5 str. 8401 ............................................  128 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Shigella flexneri 2a s
. . . . Escherichia coli E24377A .................................................  128 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Shigella flexneri 2a s
. . . . Shigella boydii CDC 3083-94 ..............................................  128 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Shigella flexneri 2a s
. . . . Escherichia coli B7A .....................................................  128 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Shigella flexneri 2a s
. . . . Escherichia coli E110019 .................................................  128 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Shigella flexneri 2a s
. . . . Escherichia coli 101-1 ...................................................  128 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Shigella flexneri 2a s
. . . . Escherichia coli IAI1 ....................................................  128 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Shigella flexneri 2a s
. . . . Escherichia coli 55989 ...................................................  128 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Shigella flexneri 2a s
. . . . Shigella sp. D9 ..........................................................  128 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Shigella flexneri 2a s
. . . . Escherichia coli O26:H11 str. 11368 ......................................  128 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Shigella flexneri 2a s
. . . . Escherichia coli O111:H- str. 11128 ......................................  128 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Shigella flexneri 2a s
. . . . Shigella flexneri ........................................................  128 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Shigella flexneri 2a s
. . . . Escherichia coli B088 ....................................................  128 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Shigella flexneri 2a s
. . . . Escherichia coli BL21(DE3) ...............................................  128 4 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli BL21(
. . . . Escherichia coli B str. REL606 ...........................................  128 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli BL21(
. . . . Tolumonas auensis DSM 9187 ...............................................  128 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Tolumonas auensis DSM 
. . . . Citrobacter rodentium ICC168 .............................................  128 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Citrobacter rodentium 
. . . . Escherichia coli IAI39 ...................................................  128 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia coli IAI39
. . . . Yersinia bercovieri ATCC 43970 ...........................................  128 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia bercovieri AT
. . . . Escherichia fergusonii ATCC 35469 ........................................  128 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Escherichia fergusonii
. . . . Vibrio harveyi 1DA3 ......................................................  127 2 hits [g-proteobacteria]       conserved hypothetical protein [Vibrio harveyi 1DA3] >gi|26
. . . . Coxiella burnetii RSA 493 ................................................  127 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Coxiella burnetii RSA 
. . . . Coxiella burnetii RSA 331 ................................................  127 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Coxiella burnetii RSA 
. . . . Coxiella burnetii ........................................................  127 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Coxiella burnetii RSA 
. . . . Coxiella burnetii RSA 334 ................................................  127 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Coxiella burnetii RSA 
. . . . Pseudomonas aeruginosa PAO1 ..............................................  127 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas aeruginosa
. . . . Pseudomonas aeruginosa UCBPP-PA14 ........................................  127 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas aeruginosa
. . . . Pseudomonas aeruginosa LESB58 ............................................  127 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas aeruginosa
. . . . Pseudomonas aeruginosa 2192 ..............................................  127 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas aeruginosa
. . . . Pseudomonas aeruginosa ...................................................  127 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas aeruginosa
. . . . Vibrio vulnificus YJ016 ..................................................  126 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio vulnificus YJ01
. . . . Xylella fastidiosa Dixon .................................................  126 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Xylella fastidiosa Dix
. . . . Xylella fastidiosa subsp. sandyi Ann-1 ...................................  126 4 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Xylella fastidiosa Dix
. . . . Coxiella burnetii CbuG_Q212 ..............................................  126 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Coxiella burnetii CbuG
. . . . Vibrio fischeri MJ11 .....................................................  126 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio fischeri MJ11] 
. . . . Pseudomonas stutzeri A1501 ...............................................  126 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudomonas stutzeri A
. . . . Yersinia enterocolitica subsp. enterocolitica 8081 .......................  125 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia enterocolitic
. . . . Yersinia rohdei ATCC 43380 ...............................................  125 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia rohdei ATCC 4
. . . . Enterobacter cancerogenus ATCC 35316 .....................................  125 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Enterobacter canceroge
. . . . Pseudoalteromonas tunicata D2 ............................................  125 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudoalteromonas tuni
. . . . Xylella fastidiosa 9a5c ..................................................  125 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Xylella fastidiosa 9a5
. . . . Xylella fastidiosa .......................................................  125 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Xylella fastidiosa 9a5
. . . . Dickeya zeae Ech1591 .....................................................  125 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Dickeya zeae Ech1591] 
. . . . Vibrio fischeri ES114 ....................................................  125 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio fischeri ES114]
. . . . Coxiella burnetii Dugway 5J108-111 .......................................  125 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Coxiella burnetii Dugw
. . . . Moritella sp. PE36 .......................................................  125 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Moritella sp. PE36] >g
. . . . Xylella fastidiosa M12 ...................................................  124 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Xylella fastidiosa M12
. . . . Vibrio parahaemolyticus AN-5034 ..........................................  124 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio parahaemolyticu
. . . . Vibrio parahaemolyticus Peru-466 .........................................  124 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio parahaemolyticu
. . . . Coxiella burnetii 'MSU Goat Q177' ........................................  124 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Coxiella burnetii 'MSU
. . . . Nitrococcus mobilis Nb-231 ...............................................  124 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Nitrococcus mobilis Nb
. . . . Yersinia intermedia ATCC 29909 ...........................................  124 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia intermedia AT
. . . . Vibrio parahaemolyticus RIMD 2210633 .....................................  124 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio parahaemolyticu
. . . . Vibrio parahaemolyticus ..................................................  124 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio parahaemolyticu
. . . . Dickeya dadantii Ech703 ..................................................  124 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Dickeya dadantii Ech70
. . . . Xylella fastidiosa Temecula1 .............................................  124 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Xylella fastidiosa Tem
. . . . Xylella fastidiosa M23 ...................................................  124 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Xylella fastidiosa Tem
. . . . Coxiella burnetii CbuK_Q154 ..............................................  124 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Coxiella burnetii CbuK
. . . . Yersinia pestis KIM 10 ...................................................  124 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis biovar Microtus str. 91001 ...............................  124 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pseudotuberculosis IP 32953 .....................................  124 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis Antiqua ..................................................  124 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis Nepal516 .................................................  124 5 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis Pestoides F ..............................................  124 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis CA88-4125 ................................................  124 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis Angola ...................................................  124 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis biovar Orientalis str. F1991016 ..........................  124 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis biovar Orientalis str. IP275 .............................  124 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis biovar Antiqua str. E1979001 .............................  124 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis biovar Antiqua str. B42003004 ............................  124 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis biovar Antiqua str. UG05-0454 ............................  124 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis biovar Orientalis str. MG05-1020 .........................  124 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis biovar Mediaevalis str. K1973002 .........................  124 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis FV-1 .....................................................  124 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pseudotuberculosis YPIII ........................................  124 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pseudotuberculosis PB1/+ ........................................  124 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis CO92 .....................................................  124 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis biovar Orientalis str. PEXU2 .............................  124 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis Pestoides A ..............................................  124 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis biovar Orientalis str. India 195 .........................  124 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis KIM D27 ..................................................  124 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis ..........................................................  124 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pseudotuberculosis ..............................................  124 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis D106004 ..................................................  124 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pestis D182038 ..................................................  124 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pestis KIM 10
. . . . Yersinia pseudotuberculosis IP 31758 .....................................  124 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia pseudotubercu
. . . . Aeromonas salmonicida subsp. salmonicida A449 ............................  124 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Aeromonas salmonicida 
. . . . Yersinia kristensenii ATCC 33638 .........................................  124 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia kristensenii 
. . . . Haemophilus somnus 2336 ..................................................  124 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Haemophilus somnus 233
. . . . Yersinia aldovae ATCC 35236 ..............................................  124 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia aldovae ATCC 
. . . . Erwinia pyrifoliae Ep1/96 ................................................  123 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Erwinia pyrifoliae Ep1
. . . . Erwinia pyrifoliae DSM 12163 .............................................  123 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Erwinia pyrifoliae Ep1
. . . . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ........................  123 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Klebsiella pneumoniae 
. . . . Cellvibrio japonicus Ueda107 .............................................  123 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Cellvibrio japonicus U
. . . . Yersinia frederiksenii ATCC 33641 ........................................  123 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia frederiksenii
. . . . Providencia alcalifaciens DSM 30120 ......................................  123 2 hits [enterobacteria]         hypothetical protein PROVALCAL_02320 [Providencia alcalifac
. . . . Erwinia amylovora ATCC 49946 .............................................  123 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Erwinia amylovora ATCC
. . . . Vibrio vulnificus ........................................................  123 1 hit  [g-proteobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . Vibrio vulnificus CMCP6 ..................................................  123 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio vulnificus CMCP
. . . . Alkalilimnicola ehrlichii MLHE-1 .........................................  122 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Alkalilimnicola ehrlic
. . . . marine gamma proteobacterium HTCC2080 ....................................  122 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [marine gamma proteobac
. . . . Vibrio alginolyticus 40B .................................................  122 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio alginolyticus 4
. . . . Vibrio splendidus LGP32 ..................................................  122 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio splendidus LGP3
. . . . Xenorhabdus bovienii SS-2004 .............................................  122 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Xenorhabdus bovienii S
. . . . Vibrio alginolyticus 12G01 ...............................................  122 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio alginolyticus 1
. . . . Vibrio splendidus 12B01 ..................................................  122 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio splendidus 12B0
. . . . Vibrio sp. MED222 ........................................................  121 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio sp. MED222] >gi
. . . . Arsenophonus nasoniae ....................................................  121 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Arsenophonus nasoniae]
. . . . Methylococcus capsulatus str. Bath .......................................  121 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Methylococcus capsulat
. . . . Haemophilus influenzae PittHH ............................................  121 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Haemophilus influenzae
. . . . Haemophilus somnus 129PT .................................................  121 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Haemophilus somnus 129
. . . . Photorhabdus luminescens subsp. laumondii TTO1 ...........................  120 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Photorhabdus luminesce
. . . . Photorhabdus luminescens subsp. laumondii ................................  120 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Photorhabdus luminesce
. . . . Providencia stuartii ATCC 25827 ..........................................  120 2 hits [enterobacteria]         hypothetical protein PROSTU_03561 [Providencia stuartii ATC
. . . . Vibrionales bacterium SWAT-3 .............................................  120 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrionales bacterium 
. . . . Pectobacterium carotovorum subsp. carotovorum PC1 ........................  120 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Pectobacterium carotov
. . . . Xanthomonas axonopodis pv. citri str. 306 ................................  120 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Xanthomonas axonopodis
. . . . Xanthomonas axonopodis pv. citri .........................................  120 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Xanthomonas axonopodis
. . . . Xanthomonas oryzae pv. oryzae KACC10331 ..................................  120 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Xanthomonas oryzae pv.
. . . . Xanthomonas oryzae pv. oryzae MAFF 311018 ................................  120 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Xanthomonas oryzae pv.
. . . . Xanthomonas oryzae pv. oryzae PXO99A .....................................  120 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Xanthomonas oryzae pv.
. . . . Xanthomonas oryzae pv. oryzae ............................................  120 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Xanthomonas oryzae pv.
. . . . Haemophilus influenzae 22.4-21 ...........................................  120 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Haemophilus influenzae
. . . . Acinetobacter junii SH205 ................................................  120 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Acinetobacter junii SH
. . . . Vibrio sp. AND4 ..........................................................  120 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio sp. AND4] >gi|1
. . . . Pectobacterium carotovorum subsp. carotovorum WPP14 ......................  120 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Pectobacterium carotov
. . . . Vibrio sp. Ex25 ..........................................................  119 4 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio sp. Ex25] >gi|2
. . . . Enhydrobacter aerosaccus SK60 ............................................  119 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Enhydrobacter aerosacc
. . . . Acinetobacter johnsonii SH046 ............................................  119 2 hits [g-proteobacteria]       UDP-23-diacylglucosamine hydrolase [Acinetobacter johnsonii
. . . . Xanthomonas campestris pv. vasculorum NCPPB702 ...........................  119 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Xanthomonas campestris
. . . . Dickeya dadantii Ech586 ..................................................  119 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Dickeya dadantii Ech58
. . . . gamma proteobacterium HTCC5015 ...........................................  119 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [gamma proteobacterium 
. . . . Haemophilus influenzae 86-028NP ..........................................  119 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Haemophilus influenzae
. . . . Haemophilus influenzae 6P18H1 ............................................  119 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Haemophilus influenzae
. . . . Xanthomonas campestris pv. vesicatoria str. 85-10 ........................  119 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Xanthomonas campestris
. . . . Vibrio coralliilyticus ATCC BAA-450 ......................................  119 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio coralliilyticus
. . . . Photorhabdus asymbiotica .................................................  119 2 hits [enterobacteria]         udp-2,3-diacylglucosamine hydrolase [Photorhabdus asymbioti
. . . . Providencia rettgeri DSM 1131 ............................................  118 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Providencia rettgeri D
. . . . Glaciecola sp. HTCC2999 ..................................................  118 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [alpha proteobacterium 
. . . . Vibrio cholerae 1587 .....................................................  118 2 hits [g-proteobacteria]       conserved hypothetical protein [Vibrio cholerae 1587] >gi|1
. . . . Haemophilus influenzae PittGG ............................................  117 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Haemophilus influenzae
. . . . Actinobacillus pleuropneumoniae serovar 7 str. AP76 ......................  117 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Actinobacillus pleurop
. . . . Mannheimia haemolytica PHL213 ............................................  117 2 hits [g-proteobacteria]       hypothetical protein MHA_1959 [Mannheimia haemolytica PHL21
. . . . Mannheimia haemolytica serotype A2 str. BOVINE ...........................  117 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Mannheimia haemolytica
. . . . Mannheimia haemolytica serotype A2 str. OVINE ............................  117 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Mannheimia haemolytica
. . . . Actinobacillus pleuropneumoniae serovar 1 str. 4074 ......................  117 1 hit  [g-proteobacteria]       COG2908: Uncharacterized protein conserved in bacteria [Act
. . . . Actinobacillus pleuropneumoniae L20 ......................................  117 2 hits [g-proteobacteria]       COG2908: Uncharacterized protein conserved in bacteria [Act
. . . . Pseudoalteromonas atlantica T6c ..........................................  117 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudoalteromonas atla
. . . . Actinobacillus pleuropneumoniae serovar 3 str. JL03 ......................  117 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Actinobacillus pleurop
. . . . Providencia rustigianii DSM 4541 .........................................  117 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Providencia rustigiani
. . . . Xanthomonas oryzae pv. oryzicola BLS256 ..................................  117 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Xanthomonas oryzae pv.
. . . . Thiomicrospira crunogena XCL-2 ...........................................  116 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Thiomicrospira crunoge
. . . . Vibrio shilonii AK1 ......................................................  116 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio shilonii AK1] >
. . . . Vibrio mimicus MB-451 ....................................................  116 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio mimicus MB-451]
. . . . Vibrio mimicus VM603 .....................................................  115 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio mimicus VM603] 
. . . . Acinetobacter sp. ATCC 27244 .............................................  115 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Acinetobacter sp. ATCC
. . . . Photobacterium sp. SKA34 .................................................  115 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Photobacterium sp. SKA
. . . . Shewanella oneidensis MR-1 ...............................................  115 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella oneidensis 
. . . . Shewanella oneidensis ....................................................  115 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella oneidensis 
. . . . Xanthomonas campestris pv. musacearum NCPPB4381 ..........................  115 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Xanthomonas campestris
. . . . Vibrio cholerae TMA 21 ...................................................  115 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio cholerae TMA 21
. . . . Vibrio orientalis CIP 102891 .............................................  115 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio orientalis CIP 
. . . . Vibrio cholerae O1 biovar El Tor str. N16961 .............................  115 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio cholerae O1 bio
. . . . Vibrio cholerae ..........................................................  115 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio cholerae O1 bio
. . . . Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ......  115 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Vibrio cholerae V52 ......................................................  115 2 hits [g-proteobacteria]       conserved hypothetical protein [Vibrio cholerae V52] >gi|14
. . . . Vibrio cholerae O395 .....................................................  115 4 hits [g-proteobacteria]       conserved hypothetical protein [Vibrio cholerae V52] >gi|14
. . . . Vibrio cholerae B33 ......................................................  115 4 hits [g-proteobacteria]       conserved hypothetical protein [Vibrio cholerae V52] >gi|14
. . . . Vibrio cholerae M66-2 ....................................................  115 3 hits [g-proteobacteria]       conserved hypothetical protein [Vibrio cholerae V52] >gi|14
. . . . Vibrio cholerae BX 330286 ................................................  115 2 hits [g-proteobacteria]       conserved hypothetical protein [Vibrio cholerae V52] >gi|14
. . . . Vibrio cholerae RC9 ......................................................  115 2 hits [g-proteobacteria]       conserved hypothetical protein [Vibrio cholerae V52] >gi|14
. . . . Vibrio cholerae MJ-1236 ..................................................  115 2 hits [g-proteobacteria]       conserved hypothetical protein [Vibrio cholerae V52] >gi|14
. . . . Vibrio cholerae MO10 .....................................................  115 2 hits [g-proteobacteria]       conserved hypothetical protein [Vibrio cholerae V52] >gi|14
. . . . Vibrio cholera CIRS 101 ..................................................  115 2 hits [g-proteobacteria]       conserved hypothetical protein [Vibrio cholerae V52] >gi|14
. . . . Vibrio cholerae RC27 .....................................................  115 2 hits [g-proteobacteria]       conserved hypothetical protein [Vibrio cholerae V52] >gi|14
. . . . Vibrio cholerae bv. albensis VL426 .......................................  115 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio cholerae bv. al
. . . . Salmonella enterica subsp. enterica serovar Agona str. SL483 .............  115 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191 ....  115 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Methylophaga thiooxidans DMS010 ..........................................  115 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Methylophaga thiooxida
. . . . Vibrio cholerae 623-39 ...................................................  115 2 hits [g-proteobacteria]       conserved hypothetical protein [Vibrio cholerae 623-39] >gi
. . . . Vibrio cholerae 12129(1) .................................................  115 2 hits [g-proteobacteria]       conserved hypothetical protein [Vibrio cholerae 623-39] >gi
. . . . Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 ...  114 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ........  114 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 ...  114 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .......  114 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 .....  114 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Paratyphi A ..................  114 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Allochromatium vinosum DSM 180 ...........................................  114 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Allochromatium vinosum
. . . . Haemophilus influenzae Rd KW20 ...........................................  114 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Haemophilus influenzae
. . . . Haemophilus influenzae RdAW ..............................................  114 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Haemophilus influenzae
. . . . Haemophilus influenzae ...................................................  114 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Haemophilus influenzae
. . . . Edwardsiella tarda ATCC 23685 ............................................  114 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Edwardsiella tarda ATC
. . . . Shewanella baltica OS195 .................................................  114 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella baltica OS1
. . . . Vibrio mimicus VM573 .....................................................  114 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio mimicus VM573] 
. . . . Photobacterium angustum S14 ..............................................  114 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio angustum S14] >
. . . . Haemophilus influenzae 3655 ..............................................  114 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Haemophilus influenzae
. . . . Haemophilus influenzae PittAA ............................................  114 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Haemophilus influenzae
. . . . Xanthomonas albilineans ..................................................  114 2 hits [g-proteobacteria]       probable udp-2,3-diacylglucosamine hydrolase protein [Xanth
. . . . Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191 ........  114 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 .......  114 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Haemophilus influenzae 7P49H1 ............................................  114 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Haemophilus influenzae
. . . . Haemophilus influenzae R2866 .............................................  114 1 hit  [g-proteobacteria]       COG2908: Uncharacterized protein conserved in bacteria [Hae
. . . . Haemophilus influenzae 22.1-21 ...........................................  114 2 hits [g-proteobacteria]       COG2908: Uncharacterized protein conserved in bacteria [Hae
. . . . Haemophilus influenzae PittII ............................................  114 2 hits [g-proteobacteria]       COG2908: Uncharacterized protein conserved in bacteria [Hae
. . . . Vibrio metschnikovii CIP 69.14 ...........................................  114 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio metschnikovii C
. . . . Pectobacterium carotovorum subsp. brasiliensis PBR1692 ...................  114 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Pectobacterium carotov
. . . . Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433 ...  114 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Reinekea blandensis MED297 ...............................................  114 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Reinekea sp. MED297] >
. . . . Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 .........  114 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella typhimurium
. . . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29 ........  114 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella typhimurium
. . . . Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701 ...  114 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella typhimurium
. . . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL486 ........  114 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella typhimurium
. . . . Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066 .........  114 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella typhimurium
. . . . Salmonella enterica subsp. enterica serovar Newport str. SL254 ...........  114 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella typhimurium
. . . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ........  114 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella typhimurium
. . . . Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23 ........  114 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella typhimurium
. . . . Salmonella enterica subsp. enterica serovar Typhimurium ..................  114 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella typhimurium
. . . . Salmonella enterica subsp. enterica serovar Typhimurium str. D23580 ......  114 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella typhimurium
. . . . Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S ......  114 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella typhimurium
. . . . Shewanella baltica OS223 .................................................  114 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella baltica OS2
. . . . Proteus mirabilis HI4320 .................................................  114 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Proteus mirabilis HI43
. . . . Proteus mirabilis ATCC 29906 .............................................  114 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Proteus mirabilis HI43
. . . . Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 .....  114 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Virchow str. SL491 ...........  114 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...  114 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Salmonella enterica ......................................................  114 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Shewanella baltica OS155 .................................................  113 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella baltica OS1
. . . . Haemophilus influenzae R2846 .............................................  113 1 hit  [g-proteobacteria]       COG2908: Uncharacterized protein conserved in bacteria [Hae
. . . . Haemophilus influenzae PittEE ............................................  113 3 hits [g-proteobacteria]       COG2908: Uncharacterized protein conserved in bacteria [Hae
. . . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480 ....  113 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .  113 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Vibrio sp. RC586 .........................................................  113 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio sp. RC586] >gi|
. . . . Salmonella enterica subsp. enterica serovar Typhi str. CT18 ..............  113 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Typhi str. Ty2 ...............  113 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Typhi str. E00-7866 ..........  113 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Typhi str. E02-1180 ..........  113 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Typhi str. E98-0664 ..........  113 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Typhi str. J185 ..............  113 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Typhi str. M223 ..............  113 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Typhi str. E98-3139 ..........  113 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Typhi ........................  113 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Vibrio cholerae MZO-3 ....................................................  113 2 hits [g-proteobacteria]       conserved hypothetical protein [Vibrio cholerae MZO-3] >gi|
. . . . Vibrio cholerae MZO-2 ....................................................  113 2 hits [g-proteobacteria]       conserved hypothetical protein [Vibrio cholerae MZO-3] >gi|
. . . . Vibrio cholerae AM-19226 .................................................  113 2 hits [g-proteobacteria]       conserved hypothetical protein [Vibrio cholerae MZO-3] >gi|
. . . . Vibrio cholerae TM 11079-80 ..............................................  113 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio cholerae TM 110
. . . . Shewanella baltica OS185 .................................................  113 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella baltica OS1
. . . . Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537 ..  113 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Haemophilus influenzae NT127 .............................................  113 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Haemophilus influenzae
. . . . Photobacterium profundum SS9 .............................................  112 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Photobacterium profund
. . . . Photobacterium profundum .................................................  112 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Photobacterium profund
. . . . Vibrio mimicus VM223 .....................................................  112 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio mimicus VM223] 
. . . . Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .................  112 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Salmonella enterica subsp. enterica serovar Newport str. SL317 ...........  112 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Yersinia ruckeri ATCC 29473 ..............................................  112 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Yersinia ruckeri ATCC 
. . . . Pectobacterium wasabiae WPP163 ...........................................  112 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Pectobacterium wasabia
. . . . Acinetobacter lwoffii SH145 ..............................................  112 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Acinetobacter lwoffii 
. . . . Photobacterium profundum 3TCK ............................................  112 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Photobacterium profund
. . . . Vibrio parahaemolyticus K5030 ............................................  111 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio parahaemolyticu
. . . . Alteromonadales bacterium TW-7 ...........................................  111 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Alteromonadales bacter
. . . . Vibrio sp. RC341 .........................................................  111 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio sp. RC341] >gi|
. . . . Psychrobacter sp. PRwf-1 .................................................  111 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Psychrobacter sp. PRwf
. . . . Haemophilus ducreyi 35000HP ..............................................  110 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Haemophilus ducreyi 35
. . . . Haemophilus ducreyi ......................................................  110 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Haemophilus ducreyi 35
. . . . Acinetobacter radioresistens SK82 ........................................  110 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Acinetobacter radiores
. . . . Acinetobacter radioresistens SH164 .......................................  110 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Acinetobacter radiores
. . . . Acinetobacter calcoaceticus RUH2202 ......................................  110 2 hits [g-proteobacteria]       UDP-23-diacylglucosamine hydrolase [Acinetobacter calcoacet
. . . . Klebsiella pneumoniae NTUH-K2044 .........................................  110 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Klebsiella pneumoniae 
. . . . Pseudoalteromonas haloplanktis TAC125 ....................................  110 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pseudoalteromonas halo
. . . . Shewanella loihica PV-4 ..................................................  110 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella loihica PV-
. . . . Klebsiella pneumoniae 342 ................................................  110 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Klebsiella pneumoniae 
. . . . Endoriftia persephone 'Hot96_1+Hot96_2' ..................................  109 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Endoriftia persephone 
. . . . Actinobacillus minor NM305 ...............................................  109 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Actinobacillus minor N
. . . . Grimontia hollisae CIP 101886 ............................................  109 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Grimontia hollisae CIP
. . . . Dichelobacter nodosus VCS1703A ...........................................  109 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Dichelobacter nodosus 
. . . . Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 .................  109 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Klebsiella pneumoniae 
. . . . Klebsiella sp. 1_1_55 ....................................................  109 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Klebsiella sp. 1_1_55]
. . . . Klebsiella variicola At-22 ...............................................  109 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Klebsiella variicola A
. . . . Actinobacillus minor 202 .................................................  109 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Actinobacillus minor 2
. . . . Acinetobacter baumannii ATCC 17978 .......................................  108 2 hits [g-proteobacteria]       UDP-23-diacylglucosamine hydrolase [Acinetobacter baumannii
. . . . Shewanella sp. MR-7 ......................................................  108 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella sp. MR-7] >
. . . . Acinetobacter baumannii ACICU ............................................  108 2 hits [g-proteobacteria]       hypothetical protein ACICU_02306 [Acinetobacter baumannii A
. . . . Shewanella putrefaciens 200 ..............................................  108 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella putrefacien
. . . . Acinetobacter baumannii ATCC 19606 .......................................  108 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Acinetobacter baumanni
. . . . Acinetobacter baumannii AB900 ............................................  108 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Acinetobacter baumanni
. . . . Acinetobacter baumannii SDF ..............................................  108 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Acinetobacter baumanni
. . . . Acinetobacter baumannii ..................................................  108 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Acinetobacter baumanni
. . . . Vibrio furnissii CIP 102972 ..............................................  108 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio furnissii CIP 1
. . . . Alteromonas macleodii 'Deep ecotype' .....................................  108 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Alteromonas macleodii 
. . . . Acinetobacter baumannii AYE ..............................................  108 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Acinetobacter baumanni
. . . . Acinetobacter baumannii AB0057 ...........................................  108 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Acinetobacter baumanni
. . . . Acinetobacter baumannii AB307-0294 .......................................  108 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Acinetobacter baumanni
. . . . Acinetobacter sp. RUH2624 ................................................  107 2 hits [g-proteobacteria]       UDP-23-diacylglucosamine hydrolase [Acinetobacter sp. RUH26
. . . . Shewanella sp. W3-18-1 ...................................................  107 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella sp. W3-18-1
. . . . Shewanella putrefaciens CN-32 ............................................  107 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella sp. W3-18-1
. . . . Shewanella denitrificans OS217 ...........................................  107 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella denitrifica
. . . . Mannheimia succiniciproducens MBEL55E ....................................  107 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Mannheimia succinicipr
. . . . Alteromonas macleodii ATCC 27126 .........................................  106 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Alteromonas macleodii 
. . . . Shewanella pealeana ATCC 700345 ..........................................  106 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella pealeana AT
. . . . Haemophilus parasuis SH0165 ..............................................  106 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Haemophilus parasuis S
. . . . Haemophilus parasuis 29755 ...............................................  106 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Haemophilus parasuis 2
. . . . Nitrosococcus oceani ATCC 19707 ..........................................  105 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Nitrosococcus oceani A
. . . . Nitrosococcus oceani AFC27 ...............................................  105 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Nitrosococcus oceani A
. . . . Shewanella sp. MR-4 ......................................................  105 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella sp. MR-4] >
. . . . Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica) ..............  105 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Candidatus Ruthia magn
. . . . Candidatus Vesicomyosocius okutanii HA ...................................  105 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Candidatus Vesicomyoso
. . . . Shewanella sp. ANA-3 .....................................................  105 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella sp. ANA-3] 
. . . . Cronobacter sakazakii ATCC BAA-894 .......................................  104 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Cronobacter sakazakii 
. . . . Idiomarina loihiensis L2TR ...............................................  104 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Idiomarina loihiensis 
. . . . Actinobacillus succinogenes 130Z .........................................  103 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Actinobacillus succino
. . . . Shewanella frigidimarina NCIMB 400 .......................................  103 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella frigidimari
. . . . Acinetobacter sp. ADP1 ...................................................  102 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Acinetobacter sp. ADP1
. . . . Cronobacter turicensis z3032 .............................................  102 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Cronobacter turicensis
. . . . Shewanella benthica KT99 .................................................  102 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella benthica KT
. . . . Pasteurella dagmatis ATCC 43325 ..........................................  102 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pasteurella dagmatis A
. . . . Psychromonas ingrahamii 37 ...............................................  101 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Psychromonas ingrahami
. . . . Legionella pneumophila str. Paris ........................................  100 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Legionella pneumophila
. . . . Shewanella amazonensis SB2B ..............................................  100 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella amazonensis
. . . . Pasteurella multocida subsp. multocida str. Pm70 .........................  100 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pasteurella multocida 
. . . . Pasteurella multocida ....................................................  100 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Pasteurella multocida 
. . . . Psychrobacter arcticus 273-4 .............................................  100 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Psychrobacter arcticus
. . . . Candidatus Blochmannia pennsylvanicus str. BPEN ..........................  100 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Candidatus Blochmannia
. . . . Idiomarina baltica OS145 .................................................   99 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Idiomarina baltica OS1
. . . . Legionella pneumophila subsp. pneumophila str. Philadelphia 1 ............   99 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Legionella pneumophila
. . . . Legionella pneumophila str. Lens .........................................   99 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Legionella pneumophila
. . . . Shewanella halifaxensis HAW-EB4 ..........................................   99 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella halifaxensi
. . . . Psychrobacter cryohalolentis K5 ..........................................   99 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Psychrobacter cryohalo
. . . . Cardiobacterium hominis ATCC 15826 .......................................   98 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Cardiobacterium homini
. . . . Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis ..........   98 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Wigglesworthia glossin
. . . . Shewanella sediminis HAW-EB3 .............................................   98 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella sediminis H
. . . . Edwardsiella ictaluri 93-146 .............................................   98 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase, putative [Edwardsiella
. . . . Pectobacterium atrosepticum SCRI1043 .....................................   97 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Pectobacterium atrosep
. . . . Pectobacterium atrosepticum ..............................................   97 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Pectobacterium atrosep
. . . . Acidithiobacillus ferrooxidans ATCC 53993 ................................   97 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Acidithiobacillus ferr
. . . . Acidithiobacillus ferrooxidans ATCC 23270 ................................   97 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Acidithiobacillus ferr
. . . . Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum) ................   97 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine pyrophosphatase [Candidatus Hamil
. . . . Shewanella piezotolerans WP3 .............................................   97 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella piezotolera
. . . . Francisella philomiragia subsp. philomiragia ATCC 25017 ..................   96 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Francisella philomirag
. . . . Aggregatibacter aphrophilus NJ8700 .......................................   96 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Aggregatibacter aphrop
. . . . Francisella philomiragia subsp. philomiragia ATCC 25015 ..................   96 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Francisella philomirag
. . . . Francisella novicida U112 ................................................   95 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Francisella tularensis
. . . . Francisella novicida FTE .................................................   95 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Francisella tularensis
. . . . Francisella tularensis subsp. tularensis SCHU S4 .........................   95 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Francisella tularensis
. . . . Francisella tularensis subsp. tularensis FSC198 ..........................   95 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Francisella tularensis
. . . . Francisella tularensis subsp. tularensis MA00-2987 .......................   95 3 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Francisella tularensis
. . . . Francisella tularensis subsp. tularensis FSC033 ..........................   95 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Francisella tularensis
. . . . Francisella tularensis subsp. tularensis NE061598 ........................   95 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Francisella tularensis
. . . . Francisella tularensis subsp. holarctica .................................   95 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Francisella tularensis
. . . . Francisella tularensis subsp. holarctica OSU18 ...........................   95 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Francisella tularensis
. . . . Francisella tularensis subsp. tularensis WY96-3418 .......................   95 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Francisella tularensis
. . . . Francisella tularensis subsp. holarctica FTNF002-00 ......................   95 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Francisella tularensis
. . . . Francisella tularensis subsp. holarctica FSC200 ..........................   95 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Francisella tularensis
. . . . Francisella tularensis subsp. mediasiatica FSC147 ........................   95 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Francisella tularensis
. . . . Francisella tularensis subsp. holarctica 257 .............................   95 4 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Francisella tularensis
. . . . Francisella tularensis subsp. holarctica FSC022 ..........................   95 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Francisella tularensis
. . . . Francisella novicida GA99-3549 ...........................................   95 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Francisella tularensis
. . . . Francisella tularensis subsp. holarctica URFT1 ...........................   95 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Francisella tularensis
. . . . Francisella tularensis subsp. holarctica LVS .............................   95 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Francisella tularensis
. . . . Rickettsiella grylli .....................................................   95 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Rickettsiella grylli] 
. . . . Aggregatibacter actinomycetemcomitans D7S-1 ..............................   95 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Aggregatibacter actino
. . . . Candidatus Blochmannia floridanus ........................................   94 3 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Candidatus Blochmannia
. . . . Aggregatibacter actinomycetemcomitans D11S-1 .............................   94 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Aggregatibacter actino
. . . . Legionella drancourtii LLAP12 ............................................   94 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Legionella drancourtii
. . . . Legionella pneumophila str. Corby ........................................   94 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Legionella pneumophila
. . . . Francisella novicida FTG .................................................   93 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Francisella novicida F
. . . . Francisella novicida GA99-3548 ...........................................   93 2 hits [g-proteobacteria]       hypothetical protein FTDG_00112 [Francisella novicida GA99-
. . . . Legionella longbeachae D-4968 ............................................   93 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Legionella longbeachae
. . . . Legionella longbeachae NSW150 ............................................   93 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Legionella longbeachae
. . . . Psychromonas sp. CNPT3 ...................................................   93 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Psychromonas sp. CNPT3
. . . . Vibrio parahaemolyticus AQ4037 ...........................................   92 1 hit  [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio parahaemolyticu
. . . . Shewanella woodyi ATCC 51908 .............................................   90 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Shewanella woodyi ATCC
. . . . Acidithiobacillus caldus ATCC 51756 ......................................   90 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Acidithiobacillus cald
. . . . Salmonella enterica subsp. enterica serovar Typhi str. 404ty .............   86 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Proteus penneri ATCC 35198 ...............................................   82 2 hits [enterobacteria]         hypothetical protein PROPEN_02445 [Proteus penneri ATCC 351
. . . . Salmonella enterica subsp. enterica serovar Typhi str. E01-6750 ..........   73 2 hits [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . . Haemophilus influenzae R3021 .............................................   66 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Haemophilus influenzae
. . . . Vibrio parahaemolyticus AQ3810 ...........................................   62 2 hits [g-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Vibrio parahaemolyticu
. . . . Salmonella enterica subsp. enterica serovar Typhi str. E98-2068 ..........   57 1 hit  [enterobacteria]         UDP-2,3-diacylglucosamine hydrolase [Salmonella enterica su
. . . Herminiimonas arsenicoxydans -----------------------------------------------  153 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase (partial) [Herminiimona
. . . Methylobacillus flagellatus KT .............................................  146 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Methylobacillus flagel
. . . Janthinobacterium sp. Marseille ............................................  142 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Janthinobacterium sp. 
. . . Aromatoleum aromaticum EbN1 ................................................  142 3 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Aromatoleum aromaticum
. . . Methylovorus sp. SIP3-4 ....................................................  140 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Methylovorus sp. SIP3-
. . . Variovorax paradoxus S110 ..................................................  140 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Variovorax paradoxus S
. . . Methylotenera mobilis JLW8 .................................................  137 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Methylotenera mobilis 
. . . Methylophilales bacterium HTCC2181 .........................................  135 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Methylophilales bacter
. . . Candidatus Accumulibacter phosphatis clade IIA str. UW-1 ...................  133 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Candidatus Accumulibac
. . . Thauera sp. MZ1T ...........................................................  128 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Thauera sp. MZ1T] >gi|
. . . Azoarcus sp. BH72 ..........................................................  128 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Azoarcus sp. BH72] >gi
. . . Bordetella pertussis .......................................................  127 1 hit  [b-proteobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . Oxalobacter formigenes HOxBLS ..............................................  127 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Oxalobacter formigenes
. . . Bordetella pertussis Tohama I ..............................................  127 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Bordetella pertussis T
. . . Bordetella parapertussis 12822 .............................................  125 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Bordetella parapertuss
. . . Bordetella bronchiseptica RB50 .............................................  125 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Bordetella parapertuss
. . . Bordetella parapertussis ...................................................  125 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Bordetella parapertuss
. . . Bordetella bronchiseptica ..................................................  125 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Bordetella parapertuss
. . . Sideroxydans lithotrophicus ES-1 ...........................................  124 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Sideroxydans lithotrop
. . . Dechloromonas aromatica RCB ................................................  123 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Dechloromonas aromatic
. . . Polaromonas sp. JS666 ......................................................  122 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Polaromonas sp. JS666]
. . . Gallionella capsiferriformans ES-2 .........................................  120 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Gallionella ferruginea
. . . Bordetella avium 197N ......................................................  120 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Bordetella avium 197N]
. . . Acidovorax ebreus TPSY .....................................................  119 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Acidovorax ebreus TPSY
. . . Acidovorax sp. JS42 ........................................................  119 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Acidovorax sp. JS42] >
. . . beta proteobacterium KB13 ..................................................  118 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [beta proteobacterium K
. . . Polaromonas naphthalenivorans CJ2 ..........................................  118 2 hits [b-proteobacteria]       metallophosphoesterase [Polaromonas naphthalenivorans CJ2] 
. . . Rhodobacterales bacterium HTCC2255 .........................................  118 1 hit  [a-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [alpha proteobacterium 
. . . Curvibacter putative symbiont of Hydra magnipapillata ......................  116 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Curvibacter putative s
. . . Oxalobacter formigenes OXCC13 ..............................................  115 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Oxalobacter formigenes
. . . Eikenella corrodens ATCC 23834 .............................................  114 2 hits [b-proteobacteria]       hypothetical protein EIKCOROL_02583 [Eikenella corrodens AT
. . . Bordetella petrii DSM 12804 ................................................  114 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Bordetella petrii DSM 
. . . Bordetella petrii ..........................................................  114 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Bordetella petrii DSM 
. . . Rhodoferax ferrireducens T118 ..............................................  112 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Rhodoferax ferrireduce
. . . Lutiella nitroferrum 2002 ..................................................  112 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Lutiella nitroferrum 2
. . . Leptothrix cholodnii SP-6 ..................................................  111 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Leptothrix cholodnii S
. . . Ralstonia pickettii 12J ....................................................  111 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Ralstonia pickettii 12
. . . Ralstonia solanacearum GMI1000 .............................................  110 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Ralstonia solanacearum
. . . Ralstonia solanacearum .....................................................  110 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Ralstonia solanacearum
. . . Ralstonia pickettii 12D ....................................................  110 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Ralstonia pickettii 12
. . . Neisseria sicca ATCC 29256 .................................................  110 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria sicca ATCC 2
. . . Comamonas testosteroni KF-1 ................................................  109 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Comamonas testosteroni
. . . Neisseria elongata subsp. glycolytica ATCC 29315 ...........................  108 1 hit  [b-proteobacteria]       hypothetical protein NEIELOOT_00296 [Neisseria elongata sub
. . . Ralstonia eutropha JMP134 ..................................................  107 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Ralstonia eutropha JMP
. . . Verminephrobacter eiseniae EF01-2 ..........................................  107 2 hits [b-proteobacteria]       metallophosphoesterase [Verminephrobacter eiseniae EF01-2] 
. . . Chromobacterium violaceum ATCC 12472 .......................................  107 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Chromobacterium violac
. . . Chromobacterium violaceum ..................................................  107 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Chromobacterium violac
. . . Limnobacter sp. MED105 .....................................................  107 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Limnobacter sp. MED105
. . . Burkholderia cenocepacia MC0-3 .............................................  105 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia cenocepac
. . . Burkholderia cenocepacia AU 1054 ...........................................  105 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia cenocepac
. . . Burkholderia cenocepacia HI2424 ............................................  105 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia cenocepac
. . . Burkholderia cenocepacia PC184 .............................................  105 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia cenocepac
. . . Delftia acidovorans SPH-1 ..................................................  105 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Delftia acidovorans SP
. . . Comamonas testosteroni CNB-2 ...............................................  105 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Comamonas testosteroni
. . . Burkholderia ambifaria MC40-6 ..............................................  105 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia ambifaria
. . . Burkholderia ambifaria MEX-5 ...............................................  105 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia ambifaria
. . . Burkholderia cenocepacia J2315 .............................................  105 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia cenocepac
. . . Burkholderia ambifaria IOP40-10 ............................................  105 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia ambifaria
. . . Burkholderia ambifaria AMMD ................................................  105 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia ambifaria
. . . Burkholderia phytofirmans PsJN .............................................  105 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia phytofirm
. . . Burkholderia sp. 383 .......................................................  104 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia sp. 383] 
. . . Laribacter hongkongensis HLHK9 .............................................  103 3 hits [b-proteobacteria]       YbbF [Laribacter hongkongensis HLHK9] >gi|254810179|sp|C1D6
. . . Burkholderia ubonensis Bu ..................................................  103 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia ubonensis
. . . Burkholderia vietnamiensis G4 ..............................................  102 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia vietnamie
. . . Cupriavidus metallidurans CH34 .............................................  101 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Cupriavidus metallidur
. . . Neisseria lactamica ATCC 23970 .............................................  101 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria lactamica AT
. . . Neisseria meningitidis 8013 ................................................  101 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria meningitidis
. . . Cupriavidus taiwanensis ....................................................  101 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Cupriavidus taiwanensi
. . . Ralstonia solanacearum UW551 ...............................................  100 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Ralstonia solanacearum
. . . Neisseria meningitidis alpha14 .............................................  100 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria meningitidis
. . . Burkholderia phymatum STM815 ...............................................  100 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia phymatum 
. . . Acidovorax avenae subsp. avenae ATCC 19860 .................................  100 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Acidovorax avenae subs
. . . Neisseria meningitidis alpha153 ............................................  100 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria meningitidis
. . . Neisseria meningitidis FAM18 ...............................................  100 3 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria meningitidis
. . . Neisseria meningitidis MC58 ................................................  100 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria meningitidis
. . . Neisseria meningitidis serogroup B .........................................  100 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria meningitidis
. . . Neisseria meningitidis Z2491 ...............................................  100 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria meningitidis
. . . Neisseria meningitidis serogroup A .........................................  100 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria meningitidis
. . . Neisseria meningitidis 053442 ..............................................  100 3 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria meningitidis
. . . Ralstonia solanacearum IPO1609 .............................................  100 2 hits [b-proteobacteria]       udp-2,3-diacylglucosamine hydrolase protein [Ralstonia sola
. . . Burkholderia multivorans CGD2M .............................................  100 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia multivora
. . . Burkholderia multivorans CGD2 ..............................................  100 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia multivora
. . . Burkholderia xenovorans LB400 ..............................................  100 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia xenovoran
. . . Burkholderia multivorans ATCC 17616 ........................................   99 4 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia multivora
. . . Burkholderia multivorans CGD1 ..............................................   99 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia multivora
. . . Burkholderia sp. H160 ......................................................   99 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia sp. H160]
. . . Neisseria gonorrhoeae SK-93-1035 ...........................................   99 3 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria gonorrhoeae 
. . . Neisseria gonorrhoeae NCCP11945 ............................................   99 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria gonorrhoeae 
. . . Ralstonia eutropha H16 .....................................................   99 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Ralstonia eutropha H16
. . . Neisseria gonorrhoeae FA 1090 ..............................................   98 3 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria gonorrhoeae 
. . . Neisseria gonorrhoeae 35/02 ................................................   98 3 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria gonorrhoeae 
. . . Neisseria gonorrhoeae DGI18 ................................................   98 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria gonorrhoeae 
. . . Neisseria gonorrhoeae FA6140 ...............................................   98 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria gonorrhoeae 
. . . Neisseria gonorrhoeae FA19 .................................................   98 3 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria gonorrhoeae 
. . . Neisseria gonorrhoeae MS11 .................................................   98 3 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria gonorrhoeae 
. . . Neisseria gonorrhoeae PID18 ................................................   98 3 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria gonorrhoeae 
. . . Neisseria gonorrhoeae PID1 .................................................   98 3 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria gonorrhoeae 
. . . Neisseria gonorrhoeae PID24-1 ..............................................   98 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria gonorrhoeae 
. . . Neisseria gonorrhoeae PID332 ...............................................   98 3 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria gonorrhoeae 
. . . Neisseria gonorrhoeae SK-92-679 ............................................   98 3 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria gonorrhoeae 
. . . Neisseria gonorrhoeae 1291 .................................................   98 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria gonorrhoeae 
. . . Neisseria gonorrhoeae DGI2 .................................................   98 3 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria gonorrhoeae 
. . . Burkholderia sp. CCGE1002 ..................................................   98 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia sp. CCGE1
. . . Polynucleobacter necessarius subsp. necessarius STIR1 ......................   98 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Polynucleobacter neces
. . . Thiobacillus denitrificans ATCC 25259 ......................................   98 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Thiobacillus denitrifi
. . . Neisseria mucosa ATCC 25996 ................................................   98 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria mucosa ATCC 
. . . Ralstonia solanacearum MolK2 ...............................................   98 2 hits [b-proteobacteria]       udp-2,3-diacylglucosamine hydrolase protein [Ralstonia sola
. . . Neisseria cinerea ATCC 14685 ...............................................   98 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria cinerea ATCC
. . . Kingella oralis ATCC 51147 .................................................   98 2 hits [b-proteobacteria]       hypothetical protein GCWU000324_01783 [Kingella oralis ATCC
. . . Burkholderia glumae BGR1 ...................................................   98 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia glumae BG
. . . Acidovorax citrulli AAC00-1 ................................................   97 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Acidovorax avenae subs
. . . Burkholderia graminis C4D1M ................................................   97 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia graminis 
. . . Methylibium petroleiphilum PM1 .............................................   97 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Methylibium petroleiph
. . . Burkholderia pseudomallei MSHR346 ..........................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia pseudomal
. . . Burkholderia pseudomallei 112 ..............................................   96 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia pseudomal
. . . Burkholderia pseudomallei 305 ..............................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia pseudomal
. . . Burkholderia pseudomallei K96243 ...........................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia pseudomal
. . . Burkholderia mallei FMH ....................................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia pseudomal
. . . Burkholderia pseudomallei NCTC 13177 .......................................   96 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia pseudomal
. . . Burkholderia mallei ATCC 23344 .............................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia mallei AT
. . . Burkholderia mallei GB8 horse 4 ............................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia mallei AT
. . . Burkholderia mallei SAVP1 ..................................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia mallei AT
. . . Burkholderia mallei NCTC 10229 .............................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia mallei AT
. . . Burkholderia pseudomallei 668 ..............................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia mallei AT
. . . Burkholderia mallei NCTC 10247 .............................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia mallei AT
. . . Burkholderia pseudomallei 1106a ............................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia mallei AT
. . . Burkholderia mallei PRL-20 .................................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia mallei AT
. . . Burkholderia pseudomallei DM98 .............................................   96 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia mallei AT
. . . Burkholderia pseudomallei 14 ...............................................   96 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia mallei AT
. . . Burkholderia pseudomallei 91 ...............................................   96 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia mallei AT
. . . Burkholderia pseudomallei B7210 ............................................   96 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia mallei AT
. . . Burkholderia pseudomallei 576 ..............................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia mallei AT
. . . Burkholderia pseudomallei 1106b ............................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia mallei AT
. . . Burkholderia mallei ATCC 10399 .............................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia mallei AT
. . . Burkholderia pseudomallei S13 ..............................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia mallei AT
. . . Burkholderia mallei JHU ....................................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia mallei AT
. . . Burkholderia pseudomallei 406e .............................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia mallei AT
. . . Burkholderia mallei 2002721280 .............................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia mallei AT
. . . Burkholderia pseudomallei 1655 .............................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia pseudomal
. . . Burkholderia sp. CCGE1003 ..................................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia sp. CCGE1
. . . Burkholderia pseudomallei 1710b ............................................   96 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia pseudomal
. . . Burkholderia pseudomallei Pasteur 52237 ....................................   95 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia pseudomal
. . . Burkholderia pseudomallei 9 ................................................   95 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia pseudomal
. . . Burkholderia pseudomallei 7894 .............................................   95 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia pseudomal
. . . Burkholderia pseudomallei BCC215 ...........................................   95 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia pseudomal
. . . Burkholderia pseudomallei Pakistan 9 .......................................   95 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia pseudomal
. . . Burkholderia pseudomallei 1710a ............................................   95 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia pseudomal
. . . Burkholderia thailandensis E264 ............................................   95 3 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia thailande
. . . Burkholderia thailandensis TXDOH ...........................................   95 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia thailande
. . . Burkholderia thailandensis Bt4 .............................................   95 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia thailande
. . . Neisseria subflava NJ9703 ..................................................   95 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria subflava NJ9
. . . Burkholderia thailandensis MSMB43 ..........................................   94 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia thailande
. . . Neisseria flavescens SK114 .................................................   94 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria flavescens S
. . . Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1 ..............   93 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Polynucleobacter neces
. . . Burkholderia oklahomensis C6786 ............................................   93 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia oklahomen
. . . Neisseria flavescens NRL30031/H210 .........................................   93 2 hits [b-proteobacteria]       hypothetical protein NEIFLAOT_01052 [Neisseria flavescens N
. . . Burkholderia oklahomensis EO147 ............................................   93 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia oklahomen
. . . Burkholderia sp. CCGE1001 ..................................................   93 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Burkholderia sp. CCGE1
. . . Burkholderia dolosa AUO158 .................................................   92 2 hits [b-proteobacteria]       hypothetical protein BDAG_01214 [Burkholderia dolosa AUO158
. . . Thiomonas intermedia K12 ...................................................   87 2 hits [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Thiomonas intermedia K
. . . Neisseria meningitidis alpha275 ............................................   75 1 hit  [b-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Neisseria meningitidis
. . . Bdellovibrio bacteriovorus HD100 ...........................................   63 2 hits [d-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase [Bdellovibrio bacteriov
. . . Syntrophus aciditrophicus SB ...............................................   55 2 hits [d-proteobacteria]       calcineurin-like phosphoesterase [Syntrophus aciditrophicus
. . . Pelobacter carbinolicus DSM 2380 ...........................................   55 2 hits [d-proteobacteria]       UDP-2,3-diacylglucosamine hydrolase, putative [Pelobacter c
. . . Geobacter sp. M18 ..........................................................   48 2 hits [d-proteobacteria]       metallophosphoesterase [Geobacter sp. M18] >gi|254984028|gb
. . . Geobacter uraniireducens Rf4 ...............................................   46 2 hits [d-proteobacteria]       metallophosphoesterase [Geobacter uraniireducens Rf4] >gi|1
. . . Geobacter lovleyi SZ .......................................................   45 2 hits [d-proteobacteria]       metallophosphoesterase [Geobacter lovleyi SZ] >gi|189422229
. . . Geobacter bemidjiensis Bem .................................................   43 2 hits [d-proteobacteria]       metallophosphoesterase [Geobacter bemidjiensis Bem] >gi|197
. . . Beijerinckia indica subsp. indica ATCC 9039 ................................   41 2 hits [a-proteobacteria]       redoxin domain-containing protein [Beijerinckia indica subs
. . carbazole-degrading bacterium CAR-SF -----------------------------------------  155 1 hit  [bacteria]               UDP-2,3-diacylglucosamine hydrolase [carbazole-degrading ba
. . Flavobacteriaceae bacterium 3519-10 ..........................................   56 2 hits [CFB group bacteria]     UDP-2,3-diacylglucosamine hydrolase [Flavobacteriaceae bact
. . Candidatus Cloacamonas acidaminovorans .......................................   56 2 hits [bacteria]               putative UDP-2,3-diacylglucosamine hydrolase (lpxH-like) [C
. . Pedobacter heparinus DSM 2366 ................................................   54 2 hits [CFB group bacteria]     metallophosphoesterase [Pedobacter heparinus DSM 2366] >gi|
. . Alistipes putredinis DSM 17216 ...............................................   53 2 hits [CFB group bacteria]     hypothetical protein ALIPUT_00909 [Alistipes putredinis DSM
. . Kordia algicida OT-1 .........................................................   52 2 hits [CFB group bacteria]     UDP-2,3-diacylglucosamine hydrolase [Kordia algicida OT-1] 
. . Polaribacter sp. MED152 ......................................................   52 2 hits [CFB group bacteria]     calcineurin-like phosphoesterase [Polaribacter sp. MED152] 
. . Flavobacteriales bacterium HTCC2170 ..........................................   51 2 hits [CFB group bacteria]     putative UDP-2,3-diacylglucosamine hydrolase [Flavobacteria
. . Gramella forsetii KT0803 .....................................................   50 2 hits [CFB group bacteria]     metallophosphoesterase domain-containing protein [Gramella 
. . Pedobacter sp. BAL39 .........................................................   50 2 hits [CFB group bacteria]     UDP-2,3-diacylglucosamine hydrolase [Pedobacter sp. BAL39] 
. . Capnocytophaga ochracea DSM 7271 .............................................   49 2 hits [CFB group bacteria]     metallophosphoesterase [Capnocytophaga ochracea DSM 7271] >
. . Flavobacterium psychrophilum JIP02/86 ........................................   48 2 hits [CFB group bacteria]     UDP-2,3-diacylglucosamine hydrolase [Flavobacterium psychro
. . Gemmatimonas aurantiaca T-27 .................................................   47 2 hits [bacteria]               UDP-2,3-diacylglucosamine hydrolase [Gemmatimonas aurantiac
. . Flavobacteria bacterium BAL38 ................................................   47 2 hits [CFB group bacteria]     UDP-2,3-diacylglucosamine hydrolase [Flavobacteria bacteriu
. . Robiginitalea biformata HTCC2501 .............................................   46 2 hits [CFB group bacteria]     putative UDP-2,3-diacylglucosamine hydrolase [Robiginitalea
. . Croceibacter atlanticus HTCC2559 .............................................   46 2 hits [CFB group bacteria]     putative UDP-2,3-diacylglucosamine hydrolase [Croceibacter 
. . Flavobacteriales bacterium ALC-1 .............................................   46 2 hits [CFB group bacteria]     UDP-2,3-diacylglucosamine hydrolase [Flavobacteriales bacte
. . Capnocytophaga gingivalis ATCC 33624 .........................................   45 2 hits [CFB group bacteria]     Ser/Thr protein phosphatase family protein [Capnocytophaga 
. . Chryseobacterium gleum ATCC 35910 ............................................   45 2 hits [CFB group bacteria]     UDP-2,3-diacylglucosamine hydrolase [Chryseobacterium gleum
. . Bacteroides fragilis YCH46 ...................................................   45 2 hits [CFB group bacteria]     UDP-2,3-diacylglucosamine hydrolase [Bacteroides fragilis Y
. . Bacteroides fragilis NCTC 9343 ...............................................   45 2 hits [CFB group bacteria]     UDP-2,3-diacylglucosamine hydrolase [Bacteroides fragilis Y
. . Bacteroides sp. 3_2_5 ........................................................   45 2 hits [CFB group bacteria]     UDP-2,3-diacylglucosamine hydrolase [Bacteroides fragilis Y
. . Polaribacter irgensii 23-P ...................................................   45 2 hits [CFB group bacteria]     putative UDP-2,3-diacylglucosamine hydrolase [Polaribacter 
. . Bacteroides sp. 2_1_16 .......................................................   45 2 hits [CFB group bacteria]     UDP-2,3-diacylglucosamine hydrolase [Bacteroides sp. 2_1_16
. . Capnocytophaga sputigena ATCC 33612 ..........................................   45 2 hits [CFB group bacteria]     Ser/Thr protein phosphatase family protein [Capnocytophaga 
. . Chlorobium chlorochromatii CaD3 ..............................................   45 2 hits [green sulfur bacteria]  hypothetical protein Cag_0210 [Chlorobium chlorochromatii C
. . Microscilla marina ATCC 23134 ................................................   45 2 hits [CFB group bacteria]     UDP-2,3-diacylglucosamine hydrolase [Microscilla marina ATC
. . Bacteroides stercoris ATCC 43183 .............................................   44 2 hits [CFB group bacteria]     hypothetical protein BACSTE_02664 [Bacteroides stercoris AT
. . Leeuwenhoekiella blandensis MED217 ...........................................   44 2 hits [CFB group bacteria]     putative UDP-2,3-diacylglucosamine hydrolase [Leeuwenhoekie
. . Bacteroides uniformis ATCC 8492 ..............................................   44 2 hits [CFB group bacteria]     hypothetical protein BACUNI_00210 [Bacteroides uniformis AT
. . Bacteroides sp. D20 ..........................................................   44 2 hits [CFB group bacteria]     hypothetical protein BACUNI_00210 [Bacteroides uniformis AT
. . Bacteroides eggerthii DSM 20697 ..............................................   44 2 hits [CFB group bacteria]     hypothetical protein BACEGG_03588 [Bacteroides eggerthii DS
. . Dokdonia donghaensis MED134 ..................................................   44 2 hits [CFB group bacteria]     putative UDP-2,3-diacylglucosamine hydrolase [Dokdonia dong
. . Flavobacteria bacterium MS024-2A .............................................   44 2 hits [CFB group bacteria]     metallophosphoesterase [Flavobacteria bacterium MS024-2A] >
. . Chlorobium phaeobacteroides DSM 266 ..........................................   43 2 hits [green sulfur bacteria]  metallophosphoesterase [Chlorobium phaeobacteroides DSM 266
. . Chitinophaga pinensis DSM 2588 ...............................................   43 2 hits [CFB group bacteria]     metallophosphoesterase [Chitinophaga pinensis DSM 2588] >gi
. . Chloroherpeton thalassium ATCC 35110 .........................................   43 2 hits [green sulfur bacteria]  metallophosphoesterase [Chloroherpeton thalassium ATCC 3511
. . Flavobacteria bacterium MS024-3C .............................................   43 2 hits [CFB group bacteria]     metallophosphoesterase [Flavobacteria bacterium MS024-3C] >
. . Sphingobacterium spiritivorum ATCC 33300 .....................................   43 2 hits [CFB group bacteria]     UDP-2,3-diacylglucosamine hydrolase [Sphingobacterium spiri
. . Flavobacteria bacterium BBFL7 ................................................   43 2 hits [CFB group bacteria]     UDP-2, 3-diacylglucosamine hydrolase [Flavobacteria bacteri
. . Bacteroides ovatus ATCC 8483 .................................................   43 2 hits [CFB group bacteria]     hypothetical protein BACOVA_03513 [Bacteroides ovatus ATCC 
. . Bacteroides sp. D2 ...........................................................   43 1 hit  [CFB group bacteria]     hypothetical protein BACOVA_03513 [Bacteroides ovatus ATCC 
. . Bacteroides caccae ATCC 43185 ................................................   42 2 hits [CFB group bacteria]     hypothetical protein BACCAC_03254 [Bacteroides caccae ATCC 
. . Bacteroides fragilis 3_1_12 ..................................................   41 1 hit  [CFB group bacteria]     putative UDP-2,3-diacylglucosamine hydrolase [Bacteroides f
. . Bacteroides dorei DSM 17855 ..................................................   41 2 hits [CFB group bacteria]     hypothetical protein BACDOR_01244 [Bacteroides dorei DSM 17
. . Bacteroides sp. 9_1_42FAA ....................................................   41 2 hits [CFB group bacteria]     hypothetical protein BACDOR_01244 [Bacteroides dorei DSM 17
. . Bacteroides dorei 5_1_36/D4 ..................................................   41 2 hits [CFB group bacteria]     hypothetical protein BACDOR_01244 [Bacteroides dorei DSM 17
. . Bacteroides sp. 3_1_33FAA ....................................................   41 2 hits [CFB group bacteria]     hypothetical protein BACDOR_01244 [Bacteroides dorei DSM 17
. . Bacteroides vulgatus ATCC 8482 ...............................................   41 2 hits [CFB group bacteria]     UDP-2,3-diacylglucosamine hydrolase [Bacteroides vulgatus A
. . Bacteroides sp. 4_3_47FAA ....................................................   41 2 hits [CFB group bacteria]     UDP-2,3-diacylglucosamine hydrolase [Bacteroides vulgatus A
. . Sphingobacterium spiritivorum ATCC 33861 .....................................   41 2 hits [CFB group bacteria]     UDP-2,3-diacylglucosamine hydrolase [Sphingobacterium spiri
. . Bacteroides coprophilus DSM 18228 ............................................   41 2 hits [CFB group bacteria]     hypothetical protein BACCOPRO_01317 [Bacteroides coprophilu
. . Prosthecochloris aestuarii DSM 271 ...........................................   40 2 hits [green sulfur bacteria]  metallophosphoesterase [Prosthecochloris aestuarii DSM 271]
. . Algoriphagus sp. PR1 .........................................................   40 2 hits [CFB group bacteria]     putative UDP-2,3-diacylglucosamine hydrolase [Algoriphagus 
. . Bacteroides coprocola DSM 17136 ..............................................   40 2 hits [CFB group bacteria]     hypothetical protein BACCOP_03674 [Bacteroides coprocola DS
. . Flavobacterium johnsoniae UW101 ..............................................   40 2 hits [CFB group bacteria]     metallophosphoesterase [Flavobacterium johnsoniae UW101] >g
. . Bacteroides sp. D1 ...........................................................   40 2 hits [CFB group bacteria]     UDP-2,3-diacylglucosamine hydrolase [Bacteroides sp. D1] >g
. . Bacteroides sp. 2_2_4 ........................................................   40 2 hits [CFB group bacteria]     UDP-2,3-diacylglucosamine hydrolase [Bacteroides sp. D1] >g
. . Bacteroides sp. 2_1_22 .......................................................   40 2 hits [CFB group bacteria]     UDP-2,3-diacylglucosamine hydrolase [Bacteroides sp. D1] >g
. synthetic construct ------------------------------------------------------------  127 2 hits [other sequences]        PA1792 [synthetic construct]

-----------------------------------------------------------------------------------------------------------
2) BLASTp vs SWISSPROT 

root
. cellular organisms
. . Bacteria            [bacteria]
. . . Proteobacteria      [proteobacteria]
. . . . Gammaproteobacteria [g-proteobacteria]
. . . . . Oceanospirillales   [g-proteobacteria]
. . . . . . Chromohalobacter salexigens DSM 3043 -----------------------------------  146 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . . Hahella chejuensis KCTC 2396 ...........................................  120 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Azotobacter vinelandii DJ ------------------------------------------------  143 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Pseudomonas syringae pv. tomato ..........................................  140 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Pseudomonas fluorescens Pf0-1 ............................................  139 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Stenotrophomonas maltophilia R551-3 ......................................  137 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Pseudomonas fluorescens Pf-5 .............................................  137 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Pseudomonas fluorescens SBW25 ............................................  137 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Stenotrophomonas maltophilia K279a .......................................  137 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Pseudomonas syringae pv. syringae B728a ..................................  137 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Enterobacter sp. 638 .....................................................  136 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Pseudomonas mendocina ymp ................................................  136 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Pseudomonas syringae pv. phaseolicola 1448A ..............................  135 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Sodalis glossinidius str. 'morsitans' ....................................  133 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Pseudomonas aeruginosa PA7 ...............................................  133 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Serratia proteamaculans 568 ..............................................  132 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Pseudomonas entomophila L48 ..............................................  131 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Aliivibrio salmonicida LFI1238 ...........................................  130 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Escherichia coli 536 .....................................................  130 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Escherichia coli ED1a ....................................................  130 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Escherichia coli O6 ......................................................  130 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Aeromonas hydrophila subsp. hydrophila ATCC 7966 .........................  130 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Pseudomonas putida W619 ..................................................  130 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Escherichia coli UMN026 ..................................................  129 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Escherichia coli SE11 ....................................................  129 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|22674
. . . . . Escherichia coli SMS-3-5 .................................................  129 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|22674
. . . . . Pseudomonas putida GB-1 ..................................................  129 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Escherichia coli UTI89 ...................................................  129 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|16619
. . . . . Escherichia coli APEC O1 .................................................  129 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|16619
. . . . . Escherichia coli S88 .....................................................  129 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|16619
. . . . . Shigella dysenteriae Sd197 ...............................................  129 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Escherichia coli K-12 ....................................................  129 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|16700
. . . . . Escherichia coli HS ......................................................  129 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|16700
. . . . . Escherichia coli ATCC 8739 ...............................................  129 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|16700
. . . . . Escherichia coli str. K-12 substr. DH10B .................................  129 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|16700
. . . . . Escherichia coli BW2952 ..................................................  129 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|16700
. . . . . Xanthomonas campestris pv. campestris ....................................  129 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|81304
. . . . . Xanthomonas campestris pv. campestris str. 8004 ..........................  129 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|81304
. . . . . Marinobacter aquaeolei VT8 ...............................................  129 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Escherichia coli O127:H6 str. E2348/69 ...................................  129 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Escherichia coli O157:H7 .................................................  129 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|22674
. . . . . Escherichia coli O157:H7 str. EC4115 .....................................  129 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|22674
. . . . . Pseudomonas putida KT2440 ................................................  129 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Xanthomonas campestris pv. campestris str. B100 ..........................  129 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Pseudomonas putida F1 ....................................................  129 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Shigella sonnei Ss046 ....................................................  128 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Shigella flexneri ........................................................  128 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|12334
. . . . . Shigella flexneri 5 str. 8401 ............................................  128 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|12334
. . . . . Shigella boydii Sb227 ....................................................  128 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|12334
. . . . . Escherichia coli E24377A .................................................  128 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|12334
. . . . . Escherichia coli IAI1 ....................................................  128 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|12334
. . . . . Shigella boydii CDC 3083-94 ..............................................  128 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|12334
. . . . . Escherichia coli 55989 ...................................................  128 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|12334
. . . . . Tolumonas auensis DSM 9187 ...............................................  128 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Escherichia coli IAI39 ...................................................  128 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Escherichia fergusonii ATCC 35469 ........................................  128 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Coxiella burnetii ........................................................  127 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|18902
. . . . . Coxiella burnetii RSA 331 ................................................  127 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|18902
. . . . . Pseudomonas aeruginosa ...................................................  127 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|12225
. . . . . Pseudomonas aeruginosa UCBPP-PA14 ........................................  127 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|12225
. . . . . Pseudomonas aeruginosa LESB58 ............................................  127 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|12225
. . . . . Vibrio vulnificus YJ016 ..................................................  126 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Coxiella burnetii CbuG_Q212 ..............................................  126 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Vibrio fischeri MJ11 .....................................................  126 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Pseudomonas stutzeri A1501 ...............................................  126 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Yersinia enterocolitica subsp. enterocolitica 8081 .......................  125 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Xylella fastidiosa .......................................................  125 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Vibrio fischeri ES114 ....................................................  125 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Coxiella burnetii Dugway 5J108-111 .......................................  125 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Xylella fastidiosa M12 ...................................................  124 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Vibrio parahaemolyticus ..................................................  124 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Xylella fastidiosa Temecula1 .............................................  124 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|22674
. . . . . Xylella fastidiosa M23 ...................................................  124 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|22674
. . . . . Yersinia pestis ..........................................................  124 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|81640
. . . . . Yersinia pseudotuberculosis ..............................................  124 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|81640
. . . . . Yersinia pestis Nepal516 .................................................  124 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|81640
. . . . . Yersinia pestis Antiqua ..................................................  124 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|81640
. . . . . Yersinia pestis Pestoides F ..............................................  124 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|81640
. . . . . Yersinia pseudotuberculosis PB1/+ ........................................  124 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|81640
. . . . . Yersinia pestis Angola ...................................................  124 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|81640
. . . . . Yersinia pseudotuberculosis YPIII ........................................  124 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|81640
. . . . . Yersinia pseudotuberculosis IP 31758 .....................................  124 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Aeromonas salmonicida subsp. salmonicida A449 ............................  124 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Haemophilus somnus 2336 ..................................................  124 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Klebsiella pneumoniae subsp. pneumoniae MGH 78578 ........................  123 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Cellvibrio japonicus Ueda107 .............................................  123 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Vibrio vulnificus ........................................................  123 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Vibrio splendidus LGP32 ..................................................  122 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Haemophilus somnus 129PT .................................................  121 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Photorhabdus luminescens subsp. laumondii ................................  120 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Pectobacterium carotovorum subsp. carotovorum PC1 ........................  120 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Xanthomonas axonopodis pv. citri .........................................  120 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Xanthomonas oryzae pv. oryzae ............................................  120 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|12352
. . . . . Xanthomonas oryzae pv. oryzae MAFF 311018 ................................  120 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|12352
. . . . . Xanthomonas oryzae pv. oryzae PXO99A .....................................  120 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|12352
. . . . . Haemophilus influenzae 86-028NP ..........................................  119 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Haemophilus influenzae PittGG ............................................  117 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Shewanella oneidensis ....................................................  115 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Vibrio cholerae ..........................................................  115 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 ......  115 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Vibrio cholerae O395 .....................................................  115 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|25481
. . . . . Vibrio cholerae M66-2 ....................................................  115 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|25481
. . . . . Salmonella enterica subsp. enterica serovar Agona str. SL483 .............  115 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Salmonella enterica subsp. enterica serovar Paratyphi A ..................  114 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|18902
. . . . . Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7 ........  114 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|18902
. . . . . Salmonella enterica subsp. enterica serovar Enteritidis str. P125109 .....  114 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|18902
. . . . . Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 .......  114 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|18902
. . . . . Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 ...  114 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|18902
. . . . . Haemophilus influenzae ...................................................  114 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Shewanella baltica OS195 .................................................  114 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Salmonella enterica subsp. enterica serovar Typhimurium ..................  114 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|22674
. . . . . Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 ........  114 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|22674
. . . . . Salmonella enterica subsp. enterica serovar Newport str. SL254 ...........  114 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|22674
. . . . . Shewanella baltica OS223 .................................................  114 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Proteus mirabilis HI4320 .................................................  114 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Salmonella enterica ......................................................  114 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|25481
. . . . . Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 ...  114 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|25481
. . . . . Shewanella baltica OS155 .................................................  113 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Haemophilus influenzae PittEE ............................................  113 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 .  113 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Salmonella enterica subsp. enterica serovar Typhi ........................  113 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Shewanella baltica OS185 .................................................  113 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Photobacterium profundum .................................................  112 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- .................  112 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Haemophilus ducreyi ......................................................  110 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Shewanella loihica PV-4 ..................................................  110 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Klebsiella pneumoniae 342 ................................................  110 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Shewanella sp. MR-7 ......................................................  108 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Shewanella putrefaciens CN-32 ............................................  107 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|16619
. . . . . Shewanella sp. W3-18-1 ...................................................  107 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|16619
. . . . . Mannheimia succiniciproducens MBEL55E ....................................  107 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Shewanella pealeana ATCC 700345 ..........................................  106 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Nitrosococcus oceani ATCC 19707 ..........................................  105 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Shewanella sp. MR-4 ......................................................  105 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Shewanella sp. ANA-3 .....................................................  105 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Cronobacter sakazakii ATCC BAA-894 .......................................  104 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Actinobacillus succinogenes 130Z .........................................  103 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Shewanella frigidimarina NCIMB 400 .......................................  103 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Psychromonas ingrahamii 37 ...............................................  101 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Shewanella amazonensis SB2B ..............................................  100 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Pasteurella multocida ....................................................  100 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Candidatus Blochmannia pennsylvanicus str. BPEN ..........................  100 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Shewanella halifaxensis HAW-EB4 ..........................................   99 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis ..........   98 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Edwardsiella ictaluri 93-146 .............................................   98 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Pectobacterium atrosepticum ..............................................   97 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum) ................   97 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Shewanella piezotolerans WP3 .............................................   97 1 hit  [g-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . . Candidatus Blochmannia floridanus ........................................   94 1 hit  [enterobacteria]       RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . Aromatoleum aromaticum EbN1 ------------------------------------------------  142 1 hit  [b-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . Bordetella pertussis .......................................................  127 1 hit  [b-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . Bordetella parapertussis ...................................................  125 1 hit  [b-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|47605
. . . . Bordetella bronchiseptica ..................................................  125 1 hit  [b-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase >gi|47605
. . . . Ralstonia solanacearum .....................................................  110 1 hit  [b-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . Chromobacterium violaceum ..................................................  107 1 hit  [b-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . Laribacter hongkongensis HLHK9 .............................................  103 1 hit  [b-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . Neisseria meningitidis FAM18 ...............................................  100 1 hit  [b-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . Neisseria meningitidis serogroup B .........................................  100 1 hit  [b-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . Neisseria meningitidis serogroup A .........................................  100 1 hit  [b-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . Neisseria meningitidis 053442 ..............................................  100 1 hit  [b-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . . Neisseria gonorrhoeae FA 1090 ..............................................   98 1 hit  [b-proteobacteria]     RecName: Full=UDP-2,3-diacylglucosamine hydrolase
. . . Akkermansia muciniphila ATCC BAA-835 -----------------------------------------   31 1 hit  [verrucomicrobia]      RecName: Full=Polyribonucleotide nucleotidyltransferase; Al
. . Mus musculus (mouse) -----------------------------------------------------------   32 1 hit  [rodents]              RecName: Full=Calsequestrin-2; AltName: Full=Calsequestrin,
. . Rattus norvegicus (brown rat) ..................................................   32 1 hit  [rodents]              RecName: Full=Calsequestrin-2; AltName: Full=Calsequestrin,
. . Bos taurus (cow) ...............................................................   31 1 hit  [even-toed ungulates]  RecName: Full=Molybdenum cofactor sulfurase; Short=MoCo sul
. . Homo sapiens (man) .............................................................   29 1 hit  [primates]             RecName: Full=Molybdenum cofactor sulfurase; Short=MoCo sul
. Human parainfluenza virus 4a (strain Toshiba) ------------------------------------   30 1 hit  [viruses]              RecName: Full=Nucleoprotein; AltName: Full=Nucleocapsid pro

BLAST

PROTOCOL


1) BLASTp vs NR, defaut NCBI parameters * "1000 Max target sequences"

2) BLASTp vs SWISSPROT, defaut NCBI parameters * "1000 Max target sequences"


RESULTS ANALYSIS

The BLASTp results have significant results.

The sequences finded are all with the same function, are UDP-2,3-diacylglucosamine hydrolase.

The E-values are very significant, are many values with E-value under e-25 (E-value<< e-6).

The alignement have indentity no under 36% and is done with almost all GOS sequence.

The results of BLASTp vs NR and BLASTp vs SWISSPROT are very similar in E-values; But the sequence of homologs are in diferent organization.

Because the SWISSPROT data base is very limited, and the BLASTp vs SWISSPROT doesn't contradict the BLASTp vs NR results, the others protocols were based only on BLASTp vs NR.





RAW RESULTS

1) BLASTp vs NR
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_01306022.1|  UDP-2,3-diacylglucosamine hydrolase [Ocean...   158    2e-37
ref|ZP_01168199.1|  UDP-2,3-diacylglucosamine hydrolase [Ocean...   156    8e-37
dbj|BAG30833.1|  UDP-2,3-diacylglucosamine hydrolase [carbazol...   155    2e-36
ref|YP_001099582.1|  UDP-2,3-diacylglucosamine hydrolase (part...   153    7e-36
ref|YP_003147145.1|  UDP-2,3-diacylglucosamine hydrolase [Kang...   149    1e-34
ref|ZP_01618249.1|  UDP-2,3-diacylglucosamine hydrolase [marin...   147    4e-34
ref|YP_544606.1|  UDP-2,3-diacylglucosamine hydrolase [Methylo...   146    1e-33
ref|YP_574104.1|  UDP-2,3-diacylglucosamine hydrolase [Chromoh...   146    1e-33
ref|ZP_04959300.1|  UDP-2,3-diacylglucosamine hydrolase [gamma...   143    7e-33
ref|YP_002799513.1|  UDP-2,3-diacylglucosamine hydrolase [Azot...   143    9e-33
ref|YP_003073401.1|  UDP-2,3-diacylglucosamine hydrolase [Tere...   143    1e-32
ref|YP_001353801.1|  UDP-2,3-diacylglucosamine hydrolase [Jant...   142    1e-32
ref|YP_159733.1|  UDP-2,3-diacylglucosamine hydrolase [Aromato...   142    2e-32
ref|ZP_03396957.1|  UDP-2,3-diacylglucosamine hydrolase [Pseud...   140    4e-32
ref|NP_793519.1|  UDP-2,3-diacylglucosamine hydrolase [Pseudom...   140    4e-32
ref|YP_527372.1|  UDP-2,3-diacylglucosamine hydrolase [Sacchar...   140    5e-32
ref|ZP_05093831.1|  UDP-2,3-diacylglucosamine hydrolase [marin...   140    5e-32
ref|ZP_05041878.1|  UDP-2,3-diacylglucosamine hydrolase [Alcan...   140    6e-32
ref|YP_003052023.1|  UDP-2,3-diacylglucosamine hydrolase [Meth...   140    7e-32
ref|YP_692924.1|  UDP-2,3-diacylglucosamine hydrolase [Alcaniv...   140    8e-32
ref|ZP_01078235.1|  UDP-2,3-diacylglucosamine hydrolase [Marin...   140    8e-32
ref|YP_002944979.1|  UDP-2,3-diacylglucosamine hydrolase [Vari...   140    8e-32
ref|YP_349370.1|  UDP-2,3-diacylglucosamine hydrolase [Pseudom...   139    9e-32
ref|YP_003461145.1|  UDP-2,3-diacylglucosamine hydrolase [Thio...   139    1e-31
ref|ZP_06191906.1|  UDP-2,3-diacylglucosamine hydrolase [Serra...   138    2e-31
ref|ZP_01102763.1|  UDP-2,3-diacylglucosamine hydrolase [Congr...   137    3e-31
ref|YP_002027204.1|  UDP-2,3-diacylglucosamine hydrolase [Sten...   137    4e-31
ref|YP_270457.1|  UDP-2,3-diacylglucosamine hydrolase [Colwell...   137    4e-31
ref|ZP_04591197.1|  UDP-2,3-diacylglucosamine hydrolase [Pseud...   137    4e-31
ref|YP_003047943.1|  UDP-2,3-diacylglucosamine hydrolase [Meth...   137    4e-31
ref|YP_261015.1|  UDP-2,3-diacylglucosamine hydrolase [Pseudom...   137    5e-31
ref|YP_002513008.1|  UDP-2,3-diacylglucosamine hydrolase [Thio...   137    5e-31
ref|YP_002873426.1|  hypothetical protein PFLU3874 [Pseudomona...   137    5e-31
ref|YP_003262965.1|  UDP-2,3-diacylglucosamine hydrolase [Halo...   137    5e-31
ref|ZP_06500284.1|  UDP-2,3-diacylglucosamine hydrolase [Pseud...   137    6e-31
ref|YP_001970849.1|  putative UDP-2,3-diacylglucosamine hydrol...   137    6e-31
ref|ZP_05135778.1|  UDP-2,3-diacylglucosamine hydrolase [Steno...   137    6e-31
ref|YP_234818.1|  UDP-2,3-diacylglucosamine hydrolase [Pseudom...   137    7e-31
ref|YP_001175713.1|  UDP-2,3-diacylglucosamine hydrolase [Ente...   136    9e-31
ref|YP_001188062.1|  UDP-2,3-diacylglucosamine hydrolase [Pseu...   136    1e-30
ref|YP_273916.1|  UDP-2,3-diacylglucosamine hydrolase [Pseudom...   135    2e-30
ref|ZP_06458861.1|  UDP-2,3-diacylglucosamine hydrolase [Pseud...   135    2e-30
ref|ZP_05637870.1|  UDP-2,3-diacylglucosamine hydrolase [Pseud...   135    2e-30
ref|ZP_01552589.1|  UDP-2,3-diacylglucosamine hydrolase [Methy...   135    2e-30
ref|ZP_02001536.1|  UDP-2,3-diacylglucosamine hydrolase [Beggi...   134    3e-30
ref|ZP_05126561.1|  UDP-2,3-diacylglucosamine hydrolase [gamma...   134    3e-30
ref|ZP_04560975.1|  UDP-2,3-diacylglucosamine hydrolase [Citro...   134    5e-30
ref|YP_003166213.1|  UDP-2,3-diacylglucosamine hydrolase [Cand...   133    8e-30
ref|YP_454383.1|  UDP-2,3-diacylglucosamine hydrolase [Sodalis...   133    8e-30
ref|YP_001348865.1|  UDP-2,3-diacylglucosamine hydrolase [Pseu...   133    9e-30
ref|ZP_02902122.1|  UDP-2,3-diacylglucosamine hydrolase [Esche...   133    1e-29
ref|YP_001477396.1|  UDP-2,3-diacylglucosamine hydrolase [Serr...   132    1e-29
ref|ZP_04638955.1|  UDP-2,3-diacylglucosamine hydrolase [Yersi...   132    2e-29
ref|ZP_01894477.1|  UDP-2,3-diacylglucosamine hydrolase [Marin...   132    2e-29
ref|YP_607717.1|  UDP-2,3-diacylglucosamine hydrolase [Pseudom...   131    3e-29
ref|ZP_01223892.1|  UDP-2,3-diacylglucosamine hydrolase [marin...   131    4e-29
ref|YP_002263330.1|  UDP-2,3-diacylglucosamine hydrolase [Alii...   130    4e-29
ref|YP_668513.1|  UDP-2,3-diacylglucosamine hydrolase [Escheri...   130    5e-29
ref|YP_002396595.1|  UDP-2,3-diacylglucosamine hydrolase [Esch...   130    5e-29
ref|NP_752572.1|  UDP-2,3-diacylglucosamine hydrolase [Escheri...   130    5e-29
ref|YP_857267.1|  UDP-2,3-diacylglucosamine hydrolase [Aeromon...   130    5e-29
ref|YP_001001705.1|  UDP-2,3-diacylglucosamine hydrolase [Halo...   130    6e-29
ref|YP_001454178.1|  UDP-2,3-diacylglucosamine hydrolase [Citr...   130    7e-29
ref|YP_001749273.1|  UDP-2,3-diacylglucosamine hydrolase [Pseu...   130    8e-29
ref|YP_002411327.1|  UDP-2,3-diacylglucosamine hydrolase [Esch...   129    9e-29
ref|YP_001742668.1|  UDP-2,3-diacylglucosamine hydrolase [Esch...   129    9e-29
ref|ZP_05727548.1|  UDP-2,3-diacylglucosamine hydrolase [Panto...   129    1e-28
ref|YP_001669111.1|  UDP-2,3-diacylglucosamine hydrolase [Pseu...   129    1e-28
ref|YP_539585.1|  UDP-2,3-diacylglucosamine hydrolase [Escheri...   129    1e-28
ref|YP_401984.1|  UDP-2,3-diacylglucosamine hydrolase [Shigell...   129    1e-28
ref|NP_415057.1|  UDP-2,3-diacylglucosamine pyrophosphatase [E...   129    1e-28
ref|ZP_03064989.1|  UDP-2,3-diacylglucosamine hydrolase [Shige...   129    1e-28
ref|NP_636343.1|  UDP-2,3-diacylglucosamine hydrolase [Xanthom...   129    1e-28
ref|YP_959116.1|  UDP-2,3-diacylglucosamine hydrolase [Marinob...   129    1e-28
gb|ADA72834.1|  UDP-2,3-diacylglucosamine hydrolase [Shigella ...   129    1e-28
ref|YP_002328032.1|  UDP-2,3-diacylglucosamine hydrolase [Esch...   129    2e-28
ref|ZP_01987852.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   129    2e-28
ref|NP_286273.1|  UDP-2,3-diacylglucosamine hydrolase [Escheri...   129    2e-28
ref|ZP_06155734.1|  UDP-2,3-diacylglucosamine hydrolase [Photo...   129    2e-28
ref|YP_001445035.1|  UDP-2,3-diacylglucosamine hydrolase [Vibr...   129    2e-28
ref|NP_745046.1|  UDP-2,3-diacylglucosamine hydrolase [Pseudom...   129    2e-28
ref|YP_001904799.1|  UDP-2,3-diacylglucosamine hydrolase [Xant...   129    2e-28
ref|ZP_06353911.1|  UDP-2,3-diacylglucosamine hydrolase [Citro...   129    2e-28
ref|YP_001268105.1|  UDP-2,3-diacylglucosamine hydrolase [Pseu...   129    2e-28
ref|YP_309504.1|  UDP-2,3-diacylglucosamine hydrolase [Shigell...   128    2e-28
ref|ZP_03045290.1|  UDP-2,3-diacylglucosamine hydrolase [Esche...   128    2e-28
ref|YP_001908364.1|  UDP-2,3-diacylglucosamine hydrolase [Erwi...   128    2e-28
ref|ZP_01739112.1|  UDP-2,3-diacylglucosamine hydrolase [Marin...   128    2e-28
ref|ZP_01365141.1|  hypothetical protein PaerPA_01002255 [Pseu...   128    2e-28
ref|NP_706402.1|  UDP-2,3-diacylglucosamine hydrolase [Shigell...   128    2e-28
ref|YP_003037319.1|  UDP-2,3-diacylglucosamine hydrolase [Esch...   128    2e-28
ref|YP_002893109.1|  UDP-2,3-diacylglucosamine hydrolase [Tolu...   128    2e-28
ref|YP_003364190.1|  UDP-2,3-diacylglucosamine hydrolase [Citr...   128    3e-28
ref|YP_002406518.1|  UDP-2,3-diacylglucosamine hydrolase [Esch...   128    3e-28
ref|ZP_04629340.1|  UDP-2,3-diacylglucosamine hydrolase [Yersi...   128    3e-28
ref|YP_002381752.1|  UDP-2,3-diacylglucosamine hydrolase [Esch...   128    3e-28
ref|YP_002890024.1|  UDP-2,3-diacylglucosamine hydrolase [Thau...   128    3e-28
ref|YP_932559.1|  UDP-2,3-diacylglucosamine hydrolase [Azoarcu...   128    3e-28
ref|ZP_06175207.1|  conserved hypothetical protein [Vibrio har...   127    4e-28
sp|Q7VX99.2|LPXH_BORPE  RecName: Full=UDP-2,3-diacylglucosamin...   127    4e-28
ref|ZP_04575923.1|  UDP-2,3-diacylglucosamine hydrolase [Oxalo...   127    4e-28
ref|NP_820472.1|  UDP-2,3-diacylglucosamine hydrolase [Coxiell...   127    4e-28
ref|ZP_02219474.1|  UDP-2,3-diacylglucosamine hydrolase [Coxie...   127    4e-28
ref|NP_880591.1|  UDP-2,3-diacylglucosamine hydrolase [Bordete...   127    4e-28
gb|AAT50463.1|  PA1792 [synthetic construct]                        127    5e-28
ref|NP_250483.1|  UDP-2,3-diacylglucosamine hydrolase [Pseudom...   127    6e-28
ref|NP_934153.1|  UDP-2,3-diacylglucosamine hydrolase [Vibrio ...   126    9e-28
ref|ZP_00651501.1|  UDP-2,3-diacylglucosamine hydrolase [Xylel...   126    1e-27
ref|YP_002303081.1|  UDP-2,3-diacylglucosamine hydrolase [Coxi...   126    1e-27
ref|YP_002156419.1|  UDP-2,3-diacylglucosamine hydrolase [Vibr...   126    1e-27
ref|YP_001172563.1|  UDP-2,3-diacylglucosamine hydrolase [Pseu...   126    1e-27
ref|YP_001007233.1|  UDP-2,3-diacylglucosamine hydrolase [Yers...   125    1e-27
ref|ZP_04612574.1|  UDP-2,3-diacylglucosamine hydrolase [Yersi...   125    1e-27
ref|NP_884526.1|  UDP-2,3-diacylglucosamine hydrolase [Bordete...   125    2e-27
ref|ZP_05968969.1|  UDP-2,3-diacylglucosamine hydrolase [Enter...   125    2e-27
ref|ZP_01135077.1|  UDP-2,3-diacylglucosamine hydrolase [Pseud...   125    2e-27
ref|NP_299865.1|  UDP-2,3-diacylglucosamine hydrolase [Xylella...   125    2e-27
ref|YP_003003588.1|  UDP-2,3-diacylglucosamine hydrolase [Dick...   125    2e-27
ref|YP_204985.1|  UDP-2,3-diacylglucosamine hydrolase [Vibrio ...   125    2e-27
ref|YP_001423946.1|  UDP-2,3-diacylglucosamine hydrolase [Coxi...   125    2e-27
ref|ZP_01899159.1|  UDP-2,3-diacylglucosamine hydrolase [Morit...   125    3e-27
ref|YP_001776642.1|  UDP-2,3-diacylglucosamine hydrolase [Xyle...   124    3e-27
ref|ZP_05889434.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   124    3e-27
ref|ZP_05905364.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   124    3e-27
ref|ZP_01947402.1|  UDP-2,3-diacylglucosamine hydrolase [Coxie...   124    3e-27
ref|ZP_01126998.1|  UDP-2,3-diacylglucosamine hydrolase [Nitro...   124    3e-27
ref|ZP_04635145.1|  UDP-2,3-diacylglucosamine hydrolase [Yersi...   124    3e-27
ref|NP_797527.1|  UDP-2,3-diacylglucosamine hydrolase [Vibrio ...   124    4e-27
ref|YP_002988262.1|  UDP-2,3-diacylglucosamine hydrolase [Dick...   124    4e-27
ref|NP_780145.1|  UDP-2,3-diacylglucosamine hydrolase [Xylella...   124    4e-27
ref|YP_002305999.1|  UDP-2,3-diacylglucosamine hydrolase [Coxi...   124    4e-27
ref|NP_668432.1|  UDP-2,3-diacylglucosamine hydrolase [Yersini...   124    4e-27
ref|YP_001401976.1|  UDP-2,3-diacylglucosamine hydrolase [Yers...   124    4e-27
ref|ZP_00682097.1|  UDP-2,3-diacylglucosamine hydrolase [Xylel...   124    5e-27
ref|YP_001141444.1|  UDP-2,3-diacylglucosamine hydrolase [Aero...   124    5e-27
ref|ZP_04623879.1|  UDP-2,3-diacylglucosamine hydrolase [Yersi...   124    6e-27
ref|YP_001785093.1|  UDP-2,3-diacylglucosamine hydrolase [Haem...   124    6e-27
ref|ZP_05340196.1|  UDP-2,3-diacylglucosamine hydrolase [Sider...   124    6e-27
ref|ZP_04621536.1|  UDP-2,3-diacylglucosamine hydrolase [Yersi...   124    6e-27
ref|YP_002649544.1|  UDP-2,3-diacylglucosamine hydrolase [Erwi...   123    6e-27
ref|YP_001334161.1|  UDP-2,3-diacylglucosamine hydrolase [Kleb...   123    7e-27
ref|YP_284140.1|  UDP-2,3-diacylglucosamine hydrolase [Dechlor...   123    7e-27
ref|YP_001982461.1|  UDP-2,3-diacylglucosamine hydrolase [Cell...   123    7e-27
ref|ZP_04634604.1|  UDP-2,3-diacylglucosamine hydrolase [Yersi...   123    9e-27
ref|ZP_03319376.1|  hypothetical protein PROVALCAL_02320 [Prov...   123    9e-27
sp|Q8D8Q9.2|LPXH_VIBVU  RecName: Full=UDP-2,3-diacylglucosamin...   123    1e-26
ref|NP_761716.1|  UDP-2,3-diacylglucosamine hydrolase [Vibrio ...   123    1e-26
ref|YP_549682.1|  UDP-2,3-diacylglucosamine hydrolase [Polarom...   122    1e-26
ref|YP_742646.1|  UDP-2,3-diacylglucosamine hydrolase [Alkalil...   122    1e-26
ref|YP_001340959.1|  UDP-2,3-diacylglucosamine hydrolase [Mari...   122    1e-26
ref|ZP_01627786.1|  UDP-2,3-diacylglucosamine hydrolase [marin...   122    1e-26
ref|ZP_06182722.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   122    2e-26
ref|YP_002417618.1|  UDP-2,3-diacylglucosamine hydrolase [Vibr...   122    2e-26
ref|YP_003468982.1|  UDP-2,3-diacylglucosamine hydrolase [Xeno...   122    2e-26
ref|ZP_01260948.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   122    2e-26
ref|ZP_00991653.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   122    2e-26
ref|ZP_01065402.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   121    3e-26
emb|CBA72078.1|  UDP-2,3-diacylglucosamine hydrolase [Arsenoph...   121    3e-26
ref|YP_113780.1|  UDP-2,3-diacylglucosamine hydrolase [Methylo...   121    3e-26
ref|ZP_01793380.1|  UDP-2,3-diacylglucosamine hydrolase [Haemo...   121    3e-26
ref|YP_718709.1|  UDP-2,3-diacylglucosamine hydrolase [Haemoph...   121    3e-26
ref|YP_433406.1|  UDP-2,3-diacylglucosamine hydrolase [Hahella...   120    4e-26
ref|NP_931012.1|  UDP-2,3-diacylglucosamine hydrolase [Photorh...   120    5e-26
ref|ZP_02961523.1|  hypothetical protein PROSTU_03561 [Provide...   120    5e-26
ref|ZP_01816062.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   120    5e-26
ref|YP_003018495.1|  UDP-2,3-diacylglucosamine hydrolase [Pect...   120    5e-26
ref|NP_641383.1|  UDP-2,3-diacylglucosamine hydrolase [Xanthom...   120    5e-26
ref|YP_202311.1|  UDP-2,3-diacylglucosamine hydrolase [Xanthom...   120    6e-26
ref|ZP_01796396.1|  UDP-2,3-diacylglucosamine hydrolase [Haemo...   120    6e-26
ref|ZP_04830435.1|  UDP-2,3-diacylglucosamine hydrolase [Galli...   120    6e-26
ref|ZP_06065501.1|  UDP-2,3-diacylglucosamine hydrolase [Acine...   120    7e-26
ref|YP_787073.1|  UDP-2,3-diacylglucosamine hydrolase [Bordete...   120    8e-26
ref|ZP_02195081.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   120    9e-26
ref|ZP_03833486.1|  UDP-2,3-diacylglucosamine hydrolase [Pecto...   120    9e-26
ref|YP_003286464.1|  UDP-2,3-diacylglucosamine hydrolase [Vibr...   119    1e-25
ref|ZP_05620512.1|  UDP-2,3-diacylglucosamine hydrolase [Enhyd...   119    1e-25
ref|ZP_06063774.1|  UDP-23-diacylglucosamine hydrolase [Acinet...   119    1e-25
ref|ZP_06485785.1|  UDP-2,3-diacylglucosamine hydrolase [Xanth...   119    1e-25
ref|YP_003334510.1|  UDP-2,3-diacylglucosamine hydrolase [Dick...   119    1e-25
ref|ZP_05062339.1|  UDP-2,3-diacylglucosamine hydrolase [gamma...   119    1e-25
ref|YP_002553550.1|  UDP-2,3-diacylglucosamine hydrolase [Acid...   119    1e-25
ref|ZP_04923550.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   119    1e-25
ref|YP_985888.1|  UDP-2,3-diacylglucosamine hydrolase [Acidovo...   119    1e-25
ref|YP_248446.1|  UDP-2,3-diacylglucosamine hydrolase [Haemoph...   119    1e-25
ref|YP_362797.1|  UDP-2,3-diacylglucosamine hydrolase [Xanthom...   119    1e-25
ref|ZP_05888107.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   119    2e-25
ref|YP_003039835.1|  udp-2,3-diacylglucosamine hydrolase [Phot...   119    2e-25
ref|ZP_06125446.1|  UDP-2,3-diacylglucosamine hydrolase [Provi...   118    2e-25
ref|ZP_05082283.1|  UDP-2,3-diacylglucosamine hydrolase [beta ...   118    3e-25
ref|YP_983117.1|  metallophosphoesterase [Polaromonas naphthal...   118    3e-25
ref|ZP_01450070.1|  UDP-2,3-diacylglucosamine hydrolase [alpha...   118    3e-25
ref|ZP_01951326.1|  conserved hypothetical protein [Vibrio cho...   118    3e-25
ref|YP_001292676.1|  UDP-2,3-diacylglucosamine hydrolase [Haem...   117    4e-25
ref|YP_001969689.1|  UDP-2,3-diacylglucosamine hydrolase [Acti...   117    4e-25
ref|ZP_04978463.1|  hypothetical protein MHA_1959 [Mannheimia ...   117    4e-25
ref|ZP_05989498.1|  UDP-2,3-diacylglucosamine hydrolase [Mannh...   117    4e-25
ref|ZP_00134809.2|  COG2908: Uncharacterized protein conserved...   117    4e-25
ref|YP_661460.1|  UDP-2,3-diacylglucosamine hydrolase [Pseudoa...   117    4e-25
ref|YP_001652838.1|  UDP-2,3-diacylglucosamine hydrolase [Acti...   117    5e-25
ref|ZP_05973373.1|  UDP-2,3-diacylglucosamine hydrolase [Provi...   117    5e-25
ref|ZP_02242117.1|  UDP-2,3-diacylglucosamine hydrolase [Xanth...   117    6e-25
ref|YP_391189.1|  UDP-2,3-diacylglucosamine hydrolase [Thiomic...   116    8e-25
ref|ZP_01869520.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   116    1e-24
ref|ZP_06038864.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   116    1e-24
emb|CBA29459.1|  UDP-2,3-diacylglucosamine hydrolase [Curvibac...   116    1e-24
ref|ZP_05721639.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   115    1e-24
ref|ZP_03823164.1|  UDP-2,3-diacylglucosamine hydrolase [Acine...   115    1e-24
ref|ZP_01162150.1|  UDP-2,3-diacylglucosamine hydrolase [Photo...   115    1e-24
ref|NP_717398.1|  UDP-2,3-diacylglucosamine hydrolase [Shewane...   115    2e-24
ref|ZP_04578120.1|  UDP-2,3-diacylglucosamine hydrolase [Oxalo...   115    2e-24
ref|ZP_06489868.1|  UDP-2,3-diacylglucosamine hydrolase [Xanth...   115    2e-24
ref|ZP_04404690.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   115    2e-24
ref|ZP_05945017.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   115    2e-24
ref|NP_231484.1|  UDP-2,3-diacylglucosamine hydrolase [Vibrio ...   115    2e-24
ref|YP_002214490.1|  UDP-2,3-diacylglucosamine hydrolase [Salm...   115    2e-24
ref|ZP_01682614.1|  conserved hypothetical protein [Vibrio cho...   115    2e-24
ref|ZP_04413273.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   115    3e-24
ref|YP_002145518.1|  UDP-2,3-diacylglucosamine hydrolase [Salm...   115    3e-24
ref|ZP_05105766.1|  UDP-2,3-diacylglucosamine hydrolase [Methy...   115    3e-24
ref|ZP_01983252.1|  conserved hypothetical protein [Vibrio cho...   115    3e-24
ref|YP_151389.1|  UDP-2,3-diacylglucosamine hydrolase [Salmone...   114    3e-24
ref|YP_003443439.1|  UDP-2,3-diacylglucosamine hydrolase [Allo...   114    3e-24
ref|ZP_03714873.1|  hypothetical protein EIKCOROL_02583 [Eiken...   114    3e-24
ref|NP_438894.1|  UDP-2,3-diacylglucosamine hydrolase [Haemoph...   114    3e-24
ref|YP_001554055.1|  UDP-2,3-diacylglucosamine hydrolase [Shew...   114    4e-24
ref|ZP_05716438.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   114    4e-24
ref|ZP_01235905.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   114    4e-24
ref|ZP_01787819.1|  UDP-2,3-diacylglucosamine hydrolase [Haemo...   114    4e-24
ref|YP_003375086.1|  probable udp-2,3-diacylglucosamine hydrol...   114    4e-24
ref|ZP_02656590.1|  UDP-2,3-diacylglucosamine hydrolase [Salmo...   114    4e-24
ref|ZP_04465893.1|  UDP-2,3-diacylglucosamine hydrolase [Haemo...   114    4e-24
ref|ZP_00156595.1|  COG2908: Uncharacterized protein conserved...   114    5e-24
ref|ZP_05881431.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   114    5e-24
ref|ZP_03826494.1|  UDP-2,3-diacylglucosamine hydrolase [Pecto...   114    5e-24
ref|ZP_03221473.1|  UDP-2,3-diacylglucosamine hydrolase [Salmo...   114    5e-24
ref|ZP_01115607.1|  UDP-2,3-diacylglucosamine hydrolase [Reine...   114    5e-24
ref|NP_459530.1|  UDP-2,3-diacylglucosamine hydrolase [Salmone...   114    5e-24
ref|YP_002358666.1|  UDP-2,3-diacylglucosamine hydrolase [Shew...   114    6e-24
ref|YP_002151879.1|  UDP-2,3-diacylglucosamine hydrolase [Prot...   114    6e-24
ref|YP_001632065.1|  UDP-2,3-diacylglucosamine hydrolase [Bord...   114    6e-24
ref|YP_215561.1|  UDP-2,3-diacylglucosamine hydrolase [Salmone...   114    6e-24
ref|YP_001049982.1|  UDP-2,3-diacylglucosamine hydrolase [Shew...   113    7e-24
ref|ZP_00154506.1|  COG2908: Uncharacterized protein conserved...   113    7e-24
ref|ZP_02664092.1|  UDP-2,3-diacylglucosamine hydrolase [Salmo...   113    8e-24
ref|ZP_06080749.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   113    8e-24
ref|NP_455127.1|  UDP-2,3-diacylglucosamine hydrolase [Salmone...   113    8e-24
ref|ZP_01958324.1|  conserved hypothetical protein [Vibrio cho...   113    9e-24
ref|ZP_04409736.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   113    1e-23
ref|YP_001365798.1|  UDP-2,3-diacylglucosamine hydrolase [Shew...   113    1e-23
ref|ZP_02830843.1|  UDP-2,3-diacylglucosamine hydrolase [Salmo...   113    1e-23
ref|ZP_05850949.1|  UDP-2,3-diacylglucosamine hydrolase [Haemo...   113    1e-23
ref|YP_129309.1|  UDP-2,3-diacylglucosamine hydrolase [Photoba...   112    1e-23
ref|ZP_06033696.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   112    1e-23
ref|YP_001571422.1|  UDP-2,3-diacylglucosamine hydrolase [Salm...   112    1e-23
ref|ZP_02699520.1|  UDP-2,3-diacylglucosamine hydrolase [Salmo...   112    1e-23
ref|ZP_04615657.1|  UDP-2,3-diacylglucosamine hydrolase [Yersi...   112    2e-23
ref|YP_003258754.1|  UDP-2,3-diacylglucosamine hydrolase [Pect...   112    2e-23
ref|ZP_06069389.1|  UDP-2,3-diacylglucosamine hydrolase [Acine...   112    2e-23
ref|YP_522609.1|  UDP-2,3-diacylglucosamine hydrolase [Rhodofe...   112    2e-23
ref|ZP_03698791.1|  UDP-2,3-diacylglucosamine hydrolase [Lutie...   112    2e-23
ref|ZP_01219654.1|  UDP-2,3-diacylglucosamine hydrolase [Photo...   112    2e-23
ref|YP_001790698.1|  UDP-2,3-diacylglucosamine hydrolase [Lept...   111    3e-23
ref|ZP_05777068.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   111    3e-23
ref|ZP_01613947.1|  UDP-2,3-diacylglucosamine hydrolase [Alter...   111    3e-23
ref|ZP_05924787.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   111    4e-23
ref|YP_001279714.1|  UDP-2,3-diacylglucosamine hydrolase [Psyc...   111    4e-23
ref|YP_001898584.1|  UDP-2,3-diacylglucosamine hydrolase [Rals...   111    4e-23
ref|NP_874269.1|  UDP-2,3-diacylglucosamine hydrolase [Haemoph...   110    4e-23
ref|NP_519284.1|  UDP-2,3-diacylglucosamine hydrolase [Ralston...   110    4e-23
ref|ZP_05360556.1|  UDP-2,3-diacylglucosamine hydrolase [Acine...   110    5e-23
ref|ZP_06057282.1|  UDP-23-diacylglucosamine hydrolase [Acinet...   110    5e-23
ref|YP_002918220.1|  UDP-2,3-diacylglucosamine hydrolase [Kleb...   110    5e-23
ref|YP_340566.1|  UDP-2,3-diacylglucosamine hydrolase [Pseudoa...   110    5e-23
ref|YP_002981062.1|  UDP-2,3-diacylglucosamine hydrolase [Rals...   110    5e-23
ref|ZP_05318618.1|  UDP-2,3-diacylglucosamine hydrolase [Neiss...   110    7e-23
ref|YP_001094638.1|  UDP-2,3-diacylglucosamine hydrolase [Shew...   110    7e-23
ref|YP_002239999.1|  UDP-2,3-diacylglucosamine hydrolase [Kleb...   110    8e-23
ref|ZP_02534837.1|  UDP-2,3-diacylglucosamine hydrolase [Endor...   109    1e-22
ref|ZP_04753183.1|  UDP-2,3-diacylglucosamine hydrolase [Actin...   109    1e-22
ref|ZP_06053961.1|  UDP-2,3-diacylglucosamine hydrolase [Grimo...   109    1e-22
ref|YP_001209137.1|  UDP-2,3-diacylglucosamine hydrolase [Dich...   109    1e-22
ref|ZP_06014827.1|  UDP-2,3-diacylglucosamine hydrolase [Klebs...   109    1e-22
ref|ZP_06549562.1|  UDP-2,3-diacylglucosamine hydrolase [Klebs...   109    1e-22
ref|ZP_03544583.1|  UDP-2,3-diacylglucosamine hydrolase [Comam...   109    1e-22
ref|YP_003440812.1|  UDP-2,3-diacylglucosamine hydrolase [Kleb...   109    1e-22
ref|ZP_05629662.1|  UDP-2,3-diacylglucosamine hydrolase [Actin...   109    2e-22
gb|ABO12537.2|  UDP-23-diacylglucosamine hydrolase [Acinetobac...   108    2e-22
ref|YP_738610.1|  UDP-2,3-diacylglucosamine hydrolase [Shewane...   108    2e-22
ref|YP_001846965.1|  hypothetical protein ACICU_02306 [Acineto...   108    2e-22
ref|ZP_01706287.1|  UDP-2,3-diacylglucosamine hydrolase [Shewa...   108    2e-22
ref|ZP_05826849.1|  UDP-2,3-diacylglucosamine hydrolase [Acine...   108    2e-22
ref|ZP_04660813.1|  UDP-2,3-diacylglucosamine hydrolase [Acine...   108    2e-22
ref|YP_001707023.1|  UDP-2,3-diacylglucosamine hydrolase [Acin...   108    2e-22
ref|ZP_05877813.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...   108    2e-22
ref|YP_002126273.1|  UDP-2,3-diacylglucosamine hydrolase [Alte...   108    3e-22
ref|YP_001713360.1|  UDP-2,3-diacylglucosamine hydrolase [Acin...   108    3e-22
ref|YP_295340.1|  UDP-2,3-diacylglucosamine hydrolase [Ralston...   107    4e-22
ref|YP_998951.1|  metallophosphoesterase [Verminephrobacter ei...   107    4e-22
ref|NP_902856.1|  UDP-2,3-diacylglucosamine hydrolase [Chromob...   107    4e-22
ref|ZP_05823563.1|  UDP-23-diacylglucosamine hydrolase [Acinet...   107    4e-22
ref|YP_963993.1|  UDP-2,3-diacylglucosamine hydrolase [Shewane...   107    5e-22
ref|ZP_01915054.1|  UDP-2,3-diacylglucosamine hydrolase [Limno...   107    5e-22
ref|YP_563503.1|  UDP-2,3-diacylglucosamine hydrolase [Shewane...   107    6e-22
ref|YP_087701.1|  UDP-2,3-diacylglucosamine hydrolase [Mannhei...   107    7e-22
ref|ZP_04715969.1|  UDP-2,3-diacylglucosamine hydrolase [Alter...   106    8e-22
ref|YP_001502541.1|  UDP-2,3-diacylglucosamine hydrolase [Shew...   106    1e-21
ref|YP_002475598.1|  UDP-2,3-diacylglucosamine hydrolase [Haem...   106    1e-21
ref|ZP_02478152.1|  UDP-2,3-diacylglucosamine hydrolase [Haemo...   106    1e-21
ref|YP_001765384.1|  UDP-2,3-diacylglucosamine hydrolase [Burk...   105    2e-21
ref|YP_625833.1|  UDP-2,3-diacylglucosamine hydrolase [Burkhol...   105    2e-21
ref|YP_001563526.1|  UDP-2,3-diacylglucosamine hydrolase [Delf...   105    2e-21
ref|YP_003277240.1|  UDP-2,3-diacylglucosamine hydrolase [Coma...   105    2e-21
ref|YP_001808684.1|  UDP-2,3-diacylglucosamine hydrolase [Burk...   105    2e-21
ref|YP_344240.1|  UDP-2,3-diacylglucosamine hydrolase [Nitroso...   105    2e-21
ref|YP_734628.1|  UDP-2,3-diacylglucosamine hydrolase [Shewane...   105    2e-21
ref|YP_904105.1|  UDP-2,3-diacylglucosamine hydrolase [Candida...   105    2e-21
ref|ZP_02909757.1|  UDP-2,3-diacylglucosamine hydrolase [Burkh...   105    2e-21
ref|YP_001219657.1|  UDP-2,3-diacylglucosamine hydrolase [Cand...   105    2e-21
ref|YP_002231282.1|  UDP-2,3-diacylglucosamine hydrolase [Burk...   105    3e-21
ref|ZP_02890360.1|  UDP-2,3-diacylglucosamine hydrolase [Burkh...   105    3e-21
ref|YP_870299.1|  UDP-2,3-diacylglucosamine hydrolase [Shewane...   105    3e-21
ref|YP_774007.1|  UDP-2,3-diacylglucosamine hydrolase [Burkhol...   105    3e-21
ref|YP_001896133.1|  UDP-2,3-diacylglucosamine hydrolase [Burk...   105    3e-21
ref|YP_369626.1|  UDP-2,3-diacylglucosamine hydrolase [Burkhol...   104    3e-21
ref|YP_001438830.1|  UDP-2,3-diacylglucosamine hydrolase [Ente...   104    3e-21
ref|YP_155420.1|  UDP-2,3-diacylglucosamine hydrolase [Idiomar...   104    5e-21
ref|YP_002795229.1|  YbbF [Laribacter hongkongensis HLHK9] >sp...   103    1e-20
ref|YP_001345351.1|  UDP-2,3-diacylglucosamine hydrolase [Acti...   103    1e-20
ref|YP_751280.1|  UDP-2,3-diacylglucosamine hydrolase [Shewane...   103    1e-20
ref|ZP_02379184.1|  UDP-2,3-diacylglucosamine hydrolase [Burkh...   103    1e-20
ref|YP_046572.1|  UDP-2,3-diacylglucosamine hydrolase [Acineto...   102    1e-20
ref|YP_003209472.1|  UDP-2,3-diacylglucosamine hydrolase [Cron...   102    1e-20
ref|ZP_02159199.1|  UDP-2,3-diacylglucosamine hydrolase [Shewa...   102    2e-20
ref|YP_001119822.1|  UDP-2,3-diacylglucosamine hydrolase [Burk...   102    2e-20
ref|ZP_05920215.1|  UDP-2,3-diacylglucosamine hydrolase [Paste...   102    3e-20
ref|YP_583236.1|  UDP-2,3-diacylglucosamine hydrolase [Ralston...   101    3e-20
ref|ZP_05987937.1|  UDP-2,3-diacylglucosamine hydrolase [Neiss...   101    3e-20
ref|YP_943526.1|  UDP-2,3-diacylglucosamine hydrolase [Psychro...   101    3e-20
emb|CAX50682.1|  UDP-2,3-diacylglucosamine hydrolase [Neisseri...   101    3e-20
ref|YP_002005226.1|  UDP-2,3-diacylglucosamine hydrolase [Cupr...   101    4e-20
ref|ZP_00945253.1|  UDP-2,3-diacylglucosamine hydrolase [Ralst...   100    5e-20
ref|YP_003082649.1|  UDP-2,3-diacylglucosamine hydrolase [Neis...   100    5e-20
ref|YP_123833.1|  UDP-2,3-diacylglucosamine hydrolase [Legione...   100    5e-20
ref|YP_001857622.1|  UDP-2,3-diacylglucosamine hydrolase [Burk...   100    6e-20
ref|ZP_06212735.1|  UDP-2,3-diacylglucosamine hydrolase [Acido...   100    6e-20
emb|CBA08971.1|  UDP-2,3-diacylglucosamine hydrolase [Neisseri...   100    6e-20
ref|YP_974584.1|  UDP-2,3-diacylglucosamine hydrolase [Neisser...   100    6e-20
ref|NP_273589.1|  UDP-2,3-diacylglucosamine hydrolase [Neisser...   100    6e-20
ref|YP_002342178.1|  UDP-2,3-diacylglucosamine hydrolase [Neis...   100    6e-20
ref|YP_001598640.1|  UDP-2,3-diacylglucosamine hydrolase [Neis...   100    6e-20
ref|YP_002259887.1|  udp-2,3-diacylglucosamine hydrolase prote...   100    6e-20
ref|YP_927096.1|  UDP-2,3-diacylglucosamine hydrolase [Shewane...   100    7e-20
ref|ZP_03571432.1|  UDP-2,3-diacylglucosamine hydrolase [Burkh...   100    7e-20
ref|NP_245039.1|  UDP-2,3-diacylglucosamine hydrolase [Pasteur...   100    7e-20
ref|YP_559385.1|  UDP-2,3-diacylglucosamine hydrolase [Burkhol...   100    8e-20
ref|YP_263985.1|  UDP-2,3-diacylglucosamine hydrolase [Psychro...   100    9e-20
ref|YP_277815.1|  UDP-2,3-diacylglucosamine hydrolase [Candida...   100    1e-19
ref|ZP_01044352.1|  UDP-2,3-diacylglucosamine hydrolase [Idiom...  99.8    1e-19
ref|YP_095581.1|  UDP-2,3-diacylglucosamine hydrolase [Legione...  99.8    1e-19
ref|YP_001579384.1|  UDP-2,3-diacylglucosamine hydrolase [Burk...  99.8    1e-19
ref|YP_126820.1|  UDP-2,3-diacylglucosamine hydrolase [Legione...  99.8    1e-19
ref|ZP_03266880.1|  UDP-2,3-diacylglucosamine hydrolase [Burkh...  99.4    1e-19
ref|ZP_04741382.1|  UDP-2,3-diacylglucosamine hydrolase [Neiss...  99.4    1e-19
ref|YP_001674985.1|  UDP-2,3-diacylglucosamine hydrolase [Shew...  99.4    1e-19
ref|YP_579930.1|  UDP-2,3-diacylglucosamine hydrolase [Psychro...  99.4    2e-19
ref|YP_002002333.1|  UDP-2,3-diacylglucosamine hydrolase [Neis...  99.4    2e-19
ref|YP_725726.1|  UDP-2,3-diacylglucosamine hydrolase [Ralston...  99.4    2e-19
ref|YP_208502.1|  UDP-2,3-diacylglucosamine hydrolase [Neisser...  99.0    2e-19
ref|ZP_06225618.1|  UDP-2,3-diacylglucosamine hydrolase [Burkh...  99.0    2e-19
ref|YP_001797782.1|  UDP-2,3-diacylglucosamine hydrolase [Poly...  99.0    2e-19
ref|YP_315663.1|  UDP-2,3-diacylglucosamine hydrolase [Thiobac...  99.0    2e-19
ref|ZP_05978621.1|  UDP-2,3-diacylglucosamine hydrolase [Neiss...  99.0    2e-19
ref|ZP_05704990.1|  UDP-2,3-diacylglucosamine hydrolase [Cardi...  99.0    2e-19
ref|NP_871247.1|  UDP-2,3-diacylglucosamine hydrolase [Wiggles...  99.0    2e-19
ref|YP_001473275.1|  UDP-2,3-diacylglucosamine hydrolase [Shew...  98.6    2e-19
ref|YP_002253334.1|  udp-2,3-diacylglucosamine hydrolase prote...  98.6    2e-19
ref|ZP_06158159.1|  UDP-2,3-diacylglucosamine hydrolase [Neiss...  98.6    2e-19
ref|ZP_04602305.1|  hypothetical protein GCWU000324_01783 [Kin...  98.6    2e-19
ref|YP_002912155.1|  UDP-2,3-diacylglucosamine hydrolase [Burk...  98.6    3e-19
ref|YP_002934396.1|  UDP-2,3-diacylglucosamine hydrolase, puta...  98.2    3e-19
ref|YP_001085139.1|  UDP-23-diacylglucosamine hydrolase [Acine...  97.8    4e-19
gb|EEZ80049.1|  hypothetical protein Sup05_1292 [uncultured SU...  97.8    4e-19
ref|YP_051244.1|  UDP-2,3-diacylglucosamine hydrolase [Pectoba...  97.4    5e-19
ref|YP_970665.1|  UDP-2,3-diacylglucosamine hydrolase [Acidovo...  97.4    5e-19
ref|YP_002220085.1|  UDP-2,3-diacylglucosamine hydrolase [Acid...  97.4    6e-19
ref|ZP_02886092.1|  UDP-2,3-diacylglucosamine hydrolase [Burkh...  97.4    6e-19
ref|YP_002924311.1|  UDP-2,3-diacylglucosamine pyrophosphatase...  97.4    6e-19
ref|YP_001021649.1|  UDP-2,3-diacylglucosamine hydrolase [Meth...  97.1    8e-19
ref|YP_002312557.1|  UDP-2,3-diacylglucosamine hydrolase [Shew...  97.1    8e-19
ref|YP_001677025.1|  UDP-2,3-diacylglucosamine hydrolase [Fran...  96.7    9e-19
ref|YP_002897361.1|  UDP-2,3-diacylglucosamine hydrolase [Burk...  96.7    9e-19
ref|YP_003006649.1|  UDP-2,3-diacylglucosamine hydrolase [Aggr...  96.7    1e-18
ref|ZP_02503935.1|  UDP-2,3-diacylglucosamine hydrolase [Burkh...  96.7    1e-18
ref|ZP_01764218.1|  UDP-2,3-diacylglucosamine hydrolase [Burkh...  96.7    1e-18
ref|YP_108842.1|  UDP-2,3-diacylglucosamine hydrolase [Burkhol...  96.7    1e-18
ref|ZP_02490581.1|  UDP-2,3-diacylglucosamine hydrolase [Burkh...  96.7    1e-18
ref|YP_103286.1|  UDP-2,3-diacylglucosamine hydrolase [Burkhol...  96.7    1e-18
ref|ZP_04756538.1|  UDP-2,3-diacylglucosamine hydrolase [Franc...  96.3    1e-18
ref|ZP_04891003.1|  UDP-2,3-diacylglucosamine hydrolase [Burkh...  96.3    1e-18
ref|ZP_06467510.1|  UDP-2,3-diacylglucosamine hydrolase [Burkh...  96.3    1e-18
ref|YP_334071.1|  UDP-2,3-diacylglucosamine hydrolase [Burkhol...  96.3    1e-18
ref|ZP_04897951.1|  UDP-2,3-diacylglucosamine hydrolase [Burkh...  95.9    1e-18
ref|ZP_02461639.1|  UDP-2,3-diacylglucosamine hydrolase [Burkh...  95.9    2e-18
ref|YP_898177.1|  UDP-2,3-diacylglucosamine hydrolase [Francis...  95.5    2e-18
ref|YP_169476.1|  UDP-2,3-diacylglucosamine hydrolase [Francis...  95.5    2e-18
ref|YP_513275.1|  UDP-2,3-diacylglucosamine hydrolase [Francis...  95.1    2e-18
ref|ZP_02062709.1|  UDP-2,3-diacylglucosamine hydrolase [Ricke...  95.1    3e-18
gb|AAX77770.1|  unknown protein [synthetic construct]              95.1    3e-18
ref|YP_442467.1|  UDP-2,3-diacylglucosamine hydrolase [Burkhol...  95.1    3e-18
ref|ZP_05983856.1|  UDP-2,3-diacylglucosamine hydrolase [Neiss...  95.1    3e-18
gb|EFE02521.1|  UDP-2,3-diacylglucosamine hydrolase [Aggregati...  95.1    3e-18
ref|NP_878599.1|  UDP-2,3-diacylglucosamine hydrolase [Candida...  94.7    3e-18
ref|YP_003256517.1|  UDP-2,3-diacylglucosamine hydrolase [Aggr...  94.7    4e-18
ref|ZP_02464000.1|  UDP-2,3-diacylglucosamine hydrolase [Burkh...  94.4    4e-18
ref|ZP_05111999.1|  UDP-2,3-diacylglucosamine hydrolase [Legio...  94.4    5e-18
ref|ZP_04758913.1|  UDP-2,3-diacylglucosamine hydrolase [Neiss...  94.4    5e-18
ref|YP_001250293.1|  UDP-2,3-diacylglucosamine hydrolase [Legi...  94.4    5e-18
ref|YP_001155637.1|  UDP-2,3-diacylglucosamine hydrolase [Poly...  94.0    6e-18
ref|ZP_03246266.1|  UDP-2,3-diacylglucosamine hydrolase [Franc...  94.0    7e-18
ref|ZP_02363351.1|  UDP-2,3-diacylglucosamine hydrolase [Burkh...  94.0    7e-18
ref|ZP_03719224.1|  hypothetical protein NEIFLAOT_01052 [Neiss...  94.0    7e-18
ref|ZP_04989438.1|  hypothetical protein FTDG_00112 [Francisel...  93.6    8e-18
ref|ZP_06185352.1|  UDP-2,3-diacylglucosamine hydrolase [Legio...  93.6    9e-18
ref|ZP_02356221.1|  UDP-2,3-diacylglucosamine hydrolase [Burkh...  93.6    9e-18
ref|ZP_06294264.1|  UDP-2,3-diacylglucosamine hydrolase [Burkh...  93.2    1e-17
ref|ZP_01215894.1|  UDP-2,3-diacylglucosamine hydrolase [Psych...  93.2    1e-17
ref|ZP_04945322.1|  hypothetical protein BDAG_01214 [Burkholde...  92.4    2e-17
ref|ZP_05910804.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...  92.0    2e-17
ref|YP_001761484.1|  UDP-2,3-diacylglucosamine hydrolase [Shew...  90.9    5e-17
ref|ZP_05291894.1|  UDP-2,3-diacylglucosamine hydrolase [Acidi...  90.1    1e-16
ref|ZP_05501202.1|  UDP-2,3-diacylglucosamine hydrolase [Thiom...  87.0    9e-16
ref|ZP_03341200.1|  UDP-2,3-diacylglucosamine hydrolase [Salmo...  86.7    1e-15
ref|ZP_03804068.1|  hypothetical protein PROPEN_02445 [Proteus...  82.8    2e-14
emb|CBA03956.1|  UDP-2,3-diacylglucosamine hydrolase [Neisseri...  75.9    2e-12
ref|ZP_03356424.1|  UDP-2,3-diacylglucosamine hydrolase [Salmo...  73.6    9e-12
ref|ZP_01786255.1|  UDP-2,3-diacylglucosamine hydrolase [Haemo...  66.6    1e-09
ref|NP_969950.1|  UDP-2,3-diacylglucosamine hydrolase [Bdellov...  63.5    1e-08
ref|ZP_01990941.1|  UDP-2,3-diacylglucosamine hydrolase [Vibri...  62.4    2e-08
ref|ZP_03375609.1|  UDP-2,3-diacylglucosamine hydrolase [Salmo...  57.4    6e-07
ref|YP_003095189.1|  UDP-2,3-diacylglucosamine hydrolase [Flav...  56.6    1e-06
ref|YP_001741475.1|  putative UDP-2,3-diacylglucosamine hydrol...  56.2    1e-06
ref|YP_461146.1|  calcineurin-like phosphoesterase [Syntrophus...  55.8    2e-06
ref|YP_357389.2|  UDP-2,3-diacylglucosamine hydrolase, putativ...  55.5    3e-06
ref|YP_003094371.1|  metallophosphoesterase [Pedobacter hepari...  54.7    4e-06
ref|ZP_02424780.1|  hypothetical protein ALIPUT_00909 [Alistip...  53.5    1e-05
ref|ZP_02161806.1|  UDP-2,3-diacylglucosamine hydrolase [Kordi...  52.8    2e-05
ref|ZP_01053417.1|  calcineurin-like phosphoesterase [Polariba...  52.4    2e-05
ref|ZP_01105811.1|  putative UDP-2,3-diacylglucosamine hydrola...  52.0    3e-05
ref|YP_863370.1|  metallophosphoesterase domain-containing pro...  50.4    8e-05
ref|ZP_01886812.1|  UDP-2,3-diacylglucosamine hydrolase [Pedob...  50.1    1e-04
ref|YP_003140733.1|  metallophosphoesterase [Capnocytophaga oc...  49.7    1e-04
ref|ZP_03355400.1|  UDP-2,3-diacylglucosamine hydrolase [Salmo...  49.3    2e-04
ref|YP_001297227.1|  UDP-2,3-diacylglucosamine hydrolase [Flav...  48.9    2e-04
ref|ZP_05312279.1|  metallophosphoesterase [Geobacter sp. M18]...  48.1    4e-04
ref|YP_002761077.1|  UDP-2,3-diacylglucosamine hydrolase [Gemm...  47.8    5e-04
ref|ZP_01733537.1|  UDP-2,3-diacylglucosamine hydrolase [Flavo...  47.4    7e-04
ref|YP_003194495.1|  putative UDP-2,3-diacylglucosamine hydrol...  47.0    9e-04
ref|ZP_00949517.1|  putative UDP-2,3-diacylglucosamine hydrola...  46.6    0.001
ref|ZP_02181268.1|  UDP-2,3-diacylglucosamine hydrolase [Flavo...  46.2    0.001
ref|YP_001229420.1|  metallophosphoesterase [Geobacter uraniir...  46.2    0.001
ref|ZP_04057283.1|  Ser/Thr protein phosphatase family protein...  45.8    0.002
ref|ZP_03851563.1|  UDP-2,3-diacylglucosamine hydrolase [Chrys...  45.8    0.002
ref|YP_097765.1|  UDP-2,3-diacylglucosamine hydrolase [Bactero...  45.8    0.002
ref|ZP_01117098.1|  putative UDP-2,3-diacylglucosamine hydrola...  45.8    0.002
ref|YP_001953147.1|  metallophosphoesterase [Geobacter lovleyi...  45.8    0.002
ref|ZP_06093429.1|  UDP-2,3-diacylglucosamine hydrolase [Bacte...  45.8    0.002
ref|ZP_03391236.1|  Ser/Thr protein phosphatase family protein...  45.4    0.002
ref|YP_378531.1|  hypothetical protein Cag_0210 [Chlorobium ch...  45.4    0.003
ref|ZP_01687894.1|  UDP-2,3-diacylglucosamine hydrolase [Micro...  45.4    0.003
ref|ZP_02436406.1|  hypothetical protein BACSTE_02664 [Bactero...  44.7    0.004
ref|ZP_01062518.1|  putative UDP-2,3-diacylglucosamine hydrola...  44.7    0.005
ref|ZP_02068810.1|  hypothetical protein BACUNI_00210 [Bactero...  44.7    0.005
ref|ZP_03460769.1|  hypothetical protein BACEGG_03588 [Bactero...  44.3    0.005
ref|ZP_01049634.1|  putative UDP-2,3-diacylglucosamine hydrola...  44.3    0.005
ref|ZP_03702455.1|  metallophosphoesterase [Flavobacteria bact...  44.3    0.006
ref|YP_002137402.1|  metallophosphoesterase [Geobacter bemidji...  43.9    0.006
ref|YP_912770.1|  metallophosphoesterase [Chlorobium phaeobact...  43.5    0.008
ref|YP_003120162.1|  metallophosphoesterase [Chitinophaga pine...  43.5    0.009
ref|YP_001995499.1|  metallophosphoesterase [Chloroherpeton th...  43.5    0.009
ref|ZP_03700749.1|  metallophosphoesterase [Flavobacteria bact...  43.1    0.012
ref|ZP_03968646.1|  UDP-2,3-diacylglucosamine hydrolase [Sphin...  43.1    0.012
ref|ZP_01201421.1|  UDP-2, 3-diacylglucosamine hydrolase [Flav...  43.1    0.013
ref|ZP_02066516.1|  hypothetical protein BACOVA_03513 [Bactero...  43.1    0.014
ref|ZP_01961621.1|  hypothetical protein BACCAC_03254 [Bactero...  42.4    0.022
ref|ZP_05282062.1|  putative UDP-2,3-diacylglucosamine hydrola...  42.0    0.024
ref|ZP_03299877.1|  hypothetical protein BACDOR_01244 [Bactero...  42.0    0.026
ref|YP_001297857.1|  UDP-2,3-diacylglucosamine hydrolase [Bact...  41.6    0.034
ref|YP_001834658.1|  redoxin domain-containing protein [Beijer...  41.6    0.036
ref|ZP_04778254.1|  UDP-2,3-diacylglucosamine hydrolase [Sphin...  41.6    0.039
ref|ZP_03642957.1|  hypothetical protein BACCOPRO_01317 [Bacte...  41.6    0.041
ref|YP_002016655.1|  metallophosphoesterase [Prosthecochloris ...  40.8    0.057
ref|ZP_01721531.1|  putative UDP-2,3-diacylglucosamine hydrola...  40.4    0.071
ref|ZP_03011757.1|  hypothetical protein BACCOP_03674 [Bactero...  40.4    0.075
ref|YP_001192949.1|  metallophosphoesterase [Flavobacterium jo...  40.4    0.078
ref|ZP_04545818.1|  UDP-2,3-diacylglucosamine hydrolase [Bacte...  40.4    0.090
ref|ZP_03207082.1|  hypothetical protein BACPLE_00702 [Bactero...  40.0    0.099
ref|YP_385719.1|  metallophosphoesterase [Geobacter metallired...  40.0    0.10 
ref|YP_001960610.1|  metallophosphoesterase [Chlorobium phaeob...  40.0    0.12 
ref|ZP_01386433.1|  Metallophosphoesterase [Chlorobium ferroox...  39.7    0.12 
ref|YP_002536287.1|  metallophosphoesterase [Geobacter sp. FRC...  39.7    0.12 
ref|ZP_01889115.1|  UDP-2,3-diacylglucosamine hydrolase [unide...  39.7    0.14 
ref|NP_812608.1|  UDP-2,3-diacylglucosamine hydrolase [Bactero...  39.7    0.15 
ref|YP_003020423.1|  metallophosphoesterase [Geobacter sp. M21...  39.7    0.16 
ref|ZP_05416118.2|  UDP-2,3-diacylglucosamine hydrolase [Bacte...  39.3    0.19 
ref|ZP_01312209.1|  metallophosphoesterase [Desulfuromonas ace...  38.9    0.21 
ref|YP_003387220.1|  metallophosphoesterase [Spirosoma lingual...  38.9    0.22 
ref|YP_782362.1|  metallophosphoesterase [Rhodopseudomonas pal...  38.9    0.23 
ref|YP_677242.1|  UDP-2,3-diacylglucosamine hydrolase [Cytopha...  38.5    0.29 
ref|ZP_01734000.1|  Ser/Thr protein phosphatase family protein...  38.5    0.32 
ref|ZP_03676937.1|  hypothetical protein BACCELL_01272 [Bacter...  38.1    0.42 
ref|XP_002598282.1|  hypothetical protein BRAFLDRAFT_69639 [Br...  37.7    0.46 
ref|ZP_01060120.1|  Metallophosphoesterase [Leeuwenhoekiella b...  37.4    0.70 
ref|ZP_01050893.1|  hypothetical protein MED134_03774 [Dokdoni...  37.0    0.89 
ref|ZP_06256002.1|  UDP-2,3-diacylglucosamine hydrolase [Prevo...  37.0    0.99 
ref|ZP_06007590.1|  UDP-2,3-diacylglucosamine hydrolase [Prevo...  36.6    1.0  
ref|XP_002541448.1|  vacuolar transporter chaperone 4 [Uncinoc...  36.6    1.2  
ref|ZP_03804067.1|  hypothetical protein PROPEN_02444 [Proteus...  35.0    3.3  
ref|YP_001709184.1|  putative ATP-dependent DNA helicase [Clav...  35.0    3.4  
ref|YP_001223393.1|  putative ATP-dependent helicase [Clavibac...  35.0    3.4  
ref|ZP_01252466.1|  putative UDP-2,3-diacylglucosamine hydrola...  35.0    3.4  
ref|YP_001295298.1|  hypothetical protein FP0367 [Flavobacteri...  34.7    3.9  
ref|YP_001196895.1|  metallophosphoesterase [Flavobacterium jo...  34.7    4.1  
ref|ZP_01202729.1|  metallophosphoesterase [Flavobacteria bact...  34.7    4.2  
ref|ZP_06406503.1|  UDP-2,3-diacylglucosamine hydrolase [Prevo...  34.7    4.2  
ref|ZP_02162185.1|  fused predicted transporter subunit of ABC...  34.7    4.3  
ref|YP_001129830.1|  metallophosphoesterase [Prosthecochloris ...  34.3    5.4  
ref|NP_953502.1|  UDP-2,3-diacylglucosamine hydrolase, putativ...  34.3    5.8  
ref|ZP_03013129.1|  hypothetical protein BACINT_00685 [Bactero...  34.3    5.8  
gb|EDZ39755.1|  Putative metallophosphoesterase [Leptospirillu...  34.3    6.1  
emb|CAK99333.1|  hypothetical lipoprotein transmembrane [Spiro...  34.3    6.2  
ref|ZP_06287945.1|  Ser/Thr phosphatase family protein [Prevot...  33.9    6.9  
ref|ZP_05071744.1|  metallophosphoesterase [Campylobacterales ...  33.9    7.7  
ref|YP_003250335.1|  metallophosphoesterase [Fibrobacter succi...  33.5    9.2  
ref|YP_001997873.1|  metallophosphoesterase [Chlorobaculum par...  33.5    9.4  
ref|YP_064657.1|  hydantoin utilization protein A [Desulfotale...  33.5    9.6  

ALIGNMENTS
>ref|ZP_01306022.1| UDP-2,3-diacylglucosamine hydrolase [Oceanobacter sp. RED65]
 gb|EAT13212.1| UDP-2,3-diacylglucosamine hydrolase [Oceanobacter sp. RED65]
Length=261

 Score =  158 bits (400),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 110/180 (61%), Gaps = 1/180 (0%)

Query  2    KLLDFTNE-GNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCT  60
            +LL  T+E G K++ + GNRDFL+ + F   +  E+LEDP  +  N    ++ HGD LCT
Sbjct  75   QLLKATSERGVKIYIMHGNRDFLIGERFCEESGCELLEDPTVIELNGEPTLLMHGDSLCT  134

Query  61   NDSEYMEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVD  120
             D  YMEFR+  R+PSW++EFLSK + ER   A+  RD S S++  K   I DV   +VD
Sbjct  135  LDEAYMEFRQMARNPSWQAEFLSKSIEERMAFANQARDESQSSNSMKDEAIMDVTPEEVD  194

Query  121  LFLQKEKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWCLKLDINGPDLFKFKI  180
            L L +      IHGHTHRP++H  E +    QR+VLGDW   GW LK+D +G D  +F +
Sbjct  195  LALTQNHCRHMIHGHTHRPNIHQWENQGELRQRLVLGDWYRKGWYLKVDADGFDFVQFDL  254


>ref|ZP_01168199.1| UDP-2,3-diacylglucosamine hydrolase [Oceanospirillum sp. MED92]
 gb|EAR59694.1| UDP-2,3-diacylglucosamine hydrolase [Oceanospirillum sp. MED92]
Length=243

 Score =  156 bits (395),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 106/180 (58%), Gaps = 0/180 (0%)

Query  1    SKLLDFTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCT  60
            S+L   +++G K++F  GNRDFL+ + F S    E+L +   +       +I HGD LCT
Sbjct  61   SQLKALSDKGCKVYFQHGNRDFLVGQTFVSGIGAELLPEEILIDLPCGPALIMHGDQLCT  120

Query  61   NDSEYMEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVD  120
            +D EYM+FR  VR P W+S F +K L ER  +A  +R+AS     +KS  ITDVN   V 
Sbjct  121  DDQEYMQFRAMVRDPQWQSAFKAKSLEERLAVARQLREASKERGAEKSEYITDVNTESVV  180

Query  121  LFLQKEKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWCLKLDINGPDLFKFKI  180
              L   K +L IHGHTHRP +H +      + R+VLGDWD  GW LK+D +G +L  F I
Sbjct  181  KALNDNKCDLLIHGHTHRPAIHQITSAQGPSTRVVLGDWDEKGWYLKVDSSGYELISFDI  240


>dbj|BAG30833.1| UDP-2,3-diacylglucosamine hydrolase [carbazole-degrading bacterium 
CAR-SF]
Length=244

 Score =  155 bits (392),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 105/180 (58%), Gaps = 0/180 (0%)

Query  1    SKLLDFTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCT  60
            ++L   ++ G K++F  GNRDFL+  +F      E+L +         K +I HGD LCT
Sbjct  61   AQLKQLSDGGCKIYFQHGNRDFLVGSDFTDRIGAELLPEQTVHTLPIGKALILHGDQLCT  120

Query  61   NDSEYMEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVD  120
            +D EYM+FR  VR+P+W+ + LSKP+ ER  +A  +R  S   + +K   ITDVN  +V+
Sbjct  121  DDQEYMQFRAMVRNPAWQQQILSKPIDERIALAKQLRATSQERTAEKDDYITDVNADEVN  180

Query  121  LFLQKEKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWCLKLDINGPDLFKFKI  180
              L K    L IHGHTHRP +H  + +     RIVLGDWDT GW LK+D +   L  F I
Sbjct  181  KQLNKADVTLMIHGHTHRPAIHTFDTQGHEATRIVLGDWDTQGWYLKVDHDNYQLISFDI  240


>ref|YP_001099582.1| UDP-2,3-diacylglucosamine hydrolase (partial) [Herminiimonas 
arsenicoxydans]
 emb|CAL61455.1| UDP-2,3-diacylglucosamine hydrolase [Herminiimonas arsenicoxydans]
Length=270

 Score =  153 bits (387),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/177 (41%), Positives = 104/177 (58%), Gaps = 5/177 (2%)

Query  1    SKLLDFTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCT  60
            S+L   +++G  +F++AGNRDFL+ +EFA++T I +L DPF        +V++HGD  CT
Sbjct  80   SRLKQLSDDGIAIFWMAGNRDFLVGQEFAATTGITLLPDPFVTTIANRPLVLTHGDAYCT  139

Query  61   NDSEYMEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVD  120
            +D  YM+FR QVR   W+  FL+ PL +RK I +S+R  S +A +DKS +I DVN   + 
Sbjct  140  DDEAYMQFRAQVRQDEWQKNFLALPLTQRKNIIESLRAGSRAAQRDKSYDIMDVNKTAIA  199

Query  121  LFLQKEKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWC-----LKLDING  172
                +      IHGHTHRP  HD  ++  +  R VL DWD  G       L LD  G
Sbjct  200  TLFSQSASATMIHGHTHRPARHDETHDGQTRTRYVLSDWDLDGAVPRGDWLALDAAG  256


>ref|YP_003147145.1| UDP-2,3-diacylglucosamine hydrolase [Kangiella koreensis DSM 
16069]
 gb|ACV27377.1| UDP-2,3-diacylglucosamine hydrolase [Kangiella koreensis DSM 
16069]
Length=238

 Score =  149 bits (376),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/168 (42%), Positives = 101/168 (60%), Gaps = 0/168 (0%)

Query  1    SKLLDFTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCT  60
            +K   +++ G  L+F  GNRDFLL  EFA +T   I+ +   +   + + ++ HGD LC 
Sbjct  60   AKFKAYSDSGKPLYFQHGNRDFLLGDEFAKATGGVIVREVHPVTIGDKEAILMHGDSLCW  119

Query  61   NDSEYMEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVD  120
            +D EYM+FR+ VRS  W+ + LS+PL  R+ IA  +R  S  A  +K+S ITDV+   V 
Sbjct  120  DDKEYMQFRQMVRSQEWQQQLLSQPLAVRRGIAADLRQKSREAQANKASAITDVHPDAVK  179

Query  121  LFLQKEKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWCLKL  168
              LQK   ++ IHGHTHRPD HD+E +    QRIVL DW   G  L +
Sbjct  180  EVLQKHNADILIHGHTHRPDFHDIEVDGNHCQRIVLSDWGDKGHYLTI  227


>ref|ZP_01618249.1| UDP-2,3-diacylglucosamine hydrolase [marine gamma proteobacterium 
HTCC2143]
 gb|EAW29946.1| UDP-2,3-diacylglucosamine hydrolase [marine gamma proteobacterium 
HTCC2143]
Length=245

 Score =  147 bits (371),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/170 (41%), Positives = 102/170 (60%), Gaps = 3/170 (1%)

Query  1    SKLLDFTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCT  60
            S L D T  G  +F + GNRDFL+  +F   +  ++LEDP  +      +++ HGD LCT
Sbjct  61   SSLRDLTASGIPIFLMHGNRDFLIGTQFLEQSGCQLLEDPTVIDLYGQAILLMHGDTLCT  120

Query  61   NDSEYMEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVD  120
             D  Y++FR + RS  W+S+ LS+PL ER+++A  MR  S  A+ +K+S I DV+  +V 
Sbjct  121  EDLAYIKFRAECRSEPWQSDLLSRPLAERRRLAIQMRADSKEANSNKASAIMDVSQHEVL  180

Query  121  LFLQKEKPNLFIHGHTHRPDLHD---LEYEDFSTQRIVLGDWDTFGWCLK  167
              +Q  +    IHGHTHRP +H+   LE +D +  RIVLGDW   GW L 
Sbjct  181  RVMQSNQVTRMIHGHTHRPAVHEFNLLETDDSTGTRIVLGDWHATGWVLS  230


>ref|YP_544606.1| UDP-2,3-diacylglucosamine hydrolase [Methylobacillus flagellatus 
KT]
 gb|ABE48765.1| UDP-2,3-diacylglucosamine hydrolase [Methylobacillus flagellatus 
KT]
Length=248

 Score =  146 bits (368),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/171 (41%), Positives = 100/171 (58%), Gaps = 1/171 (0%)

Query  3    LLDFTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCTND  62
            L   ++ G +L+F+ GNRDFL+ + FA +  +++L DP  ++ +  + ++SHGD LCT+D
Sbjct  71   LRALSDHGTQLYFMHGNRDFLIGEAFAYAAGLKLLPDPSLLILHGKRALLSHGDALCTDD  130

Query  63   SEYMEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVDLF  122
            + Y  FR QVR P+W+ EFL +PL  RK    ++R  S      K   I DVN   V   
Sbjct  131  AAYQAFRRQVRHPTWQQEFLQQPLDMRKAQIAALRQRSEQEKSGKQESIMDVNPEAVAAL  190

Query  123  LQK-EKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWCLKLDING  172
            L++ + P L IHGHTHRP LH LE +     R VLGDW   G  L +D  G
Sbjct  191  LREYDYPELLIHGHTHRPALHPLEVDGHRIDRWVLGDWYEQGSYLLIDQQG  241


>ref|YP_574104.1| UDP-2,3-diacylglucosamine hydrolase [Chromohalobacter salexigens 
DSM 3043]
 sp|Q1QVV3.1|LPXH_CHRSD RecName: Full=UDP-2,3-diacylglucosamine hydrolase
 gb|ABE59405.1| UDP-2,3-diacylglucosamine hydrolase [Chromohalobacter salexigens 
DSM 3043]
Length=246

 Score =  146 bits (368),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 104/169 (61%), Gaps = 1/169 (0%)

Query  6    FTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCTNDSEY  65
             ++ G +L+F+ GNRDFL+ ++FA++    +L+DP         V++ HGD LCT D EY
Sbjct  66   LSDAGTQLYFMHGNRDFLVGEDFAAAAGATLLDDPCLATLGRQTVLLMHGDSLCTGDEEY  125

Query  66   MEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVDLFLQK  125
            M+FR   R P W+++ L+ P+ +R ++A S+R  S+ A+  K+  I DV   +V+  +++
Sbjct  126  MKFRAMARDPEWQAQILALPIEQRLELAKSLRMQSSDANTQKADAIMDVTPAEVEAIMRE  185

Query  126  EKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTF-GWCLKLDINGP  173
               +  IHGHTHRP +H+   +    QRIVLGDW    GW ++++ + P
Sbjct  186  HGVSTLIHGHTHRPAVHEFTLDGQPAQRIVLGDWRPGRGWEVRVEDDAP  234


>ref|ZP_04959300.1| UDP-2,3-diacylglucosamine hydrolase [gamma proteobacterium NOR51-B]
 gb|EED36884.1| UDP-2,3-diacylglucosamine hydrolase [gamma proteobacterium NOR51-B]
Length=238

 Score =  143 bits (361),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 96/175 (54%), Gaps = 4/175 (2%)

Query  6    FTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCTNDSEY  65
            +++ G  LFF+ GNRDFL+   +A      +LEDP          ++ HGD LCT D +Y
Sbjct  66   YSDNGPALFFMVGNRDFLMGPYYAGRCGATLLEDPTVHNIGGEPTLLMHGDSLCTEDIDY  125

Query  66   MEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVDLFLQK  125
              FR Q R P W+   L+KPL ER+++A S+R  S  A  +K+ +I DV    V+  ++ 
Sbjct  126  QAFRAQSRQPQWQQPVLAKPLEERRQLAQSLRAMSRDAGSNKAEDIMDVTHSAVNAAMET  185

Query  126  EKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWCLKLDINGPDLFKFKI  180
                  IHGHTHRP  H ++  D    R VLGDW   GWCL+   +G  L KF I
Sbjct  186  AGVTRLIHGHTHRPAHHRVDRGD----RWVLGDWLELGWCLRARDSGLSLEKFDI  236


>ref|YP_002799513.1| UDP-2,3-diacylglucosamine hydrolase [Azotobacter vinelandii DJ]
 sp|C1DHE3.1|LPXH_AZOVD RecName: Full=UDP-2,3-diacylglucosamine hydrolase
 gb|ACO78538.1| UDP-2,3-diacylglucosamine hydrolase [Azotobacter vinelandii DJ]
Length=241

 Score =  143 bits (360),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 99/180 (55%), Gaps = 0/180 (0%)

Query  1    SKLLDFTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCT  60
            + L +    G ++F + GNRDFL+   F       +L DP  ++ N   V++ HGD LCT
Sbjct  61   AALREVAERGTRVFLMHGNRDFLVGHSFCRQAGCTLLRDPSRVILNGAPVLLMHGDTLCT  120

Query  61   NDSEYMEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVD  120
             D  YM FR ++R+P         PL +R+++A   RDAS    + K++EI DV   +V 
Sbjct  121  RDIAYMRFRRRLRNPVSVWLLRHLPLSKRRQLARKWRDASRMQVRRKATEIVDVTPEEVP  180

Query  121  LFLQKEKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWCLKLDINGPDLFKFKI  180
              +        IHGHTHRP +H+L+ +    +RIVLGDW+  GW L++D +G  L  F I
Sbjct  181  RIMAAHGVLTLIHGHTHRPAVHELQVDGRQARRIVLGDWNRQGWVLQVDGSGYHLTPFPI  240


>ref|YP_003073401.1| UDP-2,3-diacylglucosamine hydrolase [Teredinibacter turnerae 
T7901]
 gb|ACR11200.1| UDP-2,3-diacylglucosamine hydrolase [Teredinibacter turnerae 
T7901]
Length=241

 Score =  143 bits (360),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/178 (36%), Positives = 108/178 (60%), Gaps = 0/178 (0%)

Query  1    SKLLDFTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCT  60
            ++L   + +G  ++F  GNRDFL+ ++FA S  + +L +    +     V++ HGD LC 
Sbjct  62   ARLNLLSTQGVAIYFQHGNRDFLIGEQFAKSAGVTLLPEQHKTLVAGKPVLLMHGDSLCI  121

Query  61   NDSEYMEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVD  120
            +D+EYM FR QVRS +W+ + L+ PL +R+ +A  +R  S+S +  K+ +I DVN   V 
Sbjct  122  DDTEYMAFRNQVRSAAWQQQVLALPLEQRRAMAAQLRSQSSSMNAMKAEDIMDVNPEAVA  181

Query  121  LFLQKEKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWCLKLDINGPDLFKF  178
              ++K   +  +HGHTHRP +H++E      +R VLGDW+T GW ++ + +   L +F
Sbjct  182  QAMRKFDVSTILHGHTHRPAVHEIELNSHHGKRFVLGDWNTTGWFIRANASELQLVEF  239


>ref|YP_001353801.1| UDP-2,3-diacylglucosamine hydrolase [Janthinobacterium sp. Marseille]
 gb|ABR88424.1| UDP-2,3-diacylglucosamine hydrolase [Janthinobacterium sp. Marseille]
Length=269

 Score =  142 bits (358),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 93/154 (60%), Gaps = 0/154 (0%)

Query  7    TNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCTNDSEYM  66
            +  G ++F++AGNRDFL+ ++FA  T I +L DPF        +V++HGD  CT+D+ YM
Sbjct  84   SASGVEVFWMAGNRDFLVGQKFAEVTGISLLPDPFVTSLAGRLLVLTHGDAYCTDDAAYM  143

Query  67   EFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVDLFLQKE  126
            EFR QVR   W+  FL+ PL +RK I +++R  S +A +DKS +I DVN   +    +  
Sbjct  144  EFRAQVRQAEWQQNFLALPLAQRKAIIENLRAGSRAAQRDKSYDIMDVNQDAIAGLFRHS  203

Query  127  KPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWD  160
            +    IHGHTHRP  H  + +     R VL DWD
Sbjct  204  RSATMIHGHTHRPARHQHQVDGAERLRYVLSDWD  237


-----------------------------------------------------------------------------------------------------
2)BLASTp vs SWISSPROT 
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q1QVV3.1|LPXH_CHRSD  RecName: Full=UDP-2,3-diacylglucosamin...   146    7e-35
sp|C1DHE3.1|LPXH_AZOVD  RecName: Full=UDP-2,3-diacylglucosamin...   143    6e-34
sp|Q5P1I2.1|LPXH_AZOSE  RecName: Full=UDP-2,3-diacylglucosamin...   142    1e-33
sp|Q87YP9.1|LPXH_PSESM  RecName: Full=UDP-2,3-diacylglucosamin...   140    3e-33
sp|Q3KA25.1|LPXH_PSEPF  RecName: Full=UDP-2,3-diacylglucosamin...   139    6e-33
sp|B4SLL1.1|LPXH_STRM5  RecName: Full=UDP-2,3-diacylglucosamin...   137    2e-32
sp|Q4K9R8.1|LPXH_PSEF5  RecName: Full=UDP-2,3-diacylglucosamin...   137    3e-32
sp|C3JYD6.1|LPXH_PSEFS  RecName: Full=UDP-2,3-diacylglucosamin...   137    4e-32
sp|B2FQP4.1|LPXH_STRMK  RecName: Full=UDP-2,3-diacylglucosamin...   137    4e-32
sp|Q4ZVP2.1|LPXH_PSEU2  RecName: Full=UDP-2,3-diacylglucosamin...   137    5e-32
sp|A4W7I2.1|LPXH_ENT38  RecName: Full=UDP-2,3-diacylglucosamin...   136    6e-32
sp|A4XVG4.1|LPXH_PSEMY  RecName: Full=UDP-2,3-diacylglucosamin...   136    7e-32
sp|Q48L09.1|LPXH_PSE14  RecName: Full=UDP-2,3-diacylglucosamin...   135    1e-31
sp|Q2NV47.1|LPXH_SODGM  RecName: Full=UDP-2,3-diacylglucosamin...   133    5e-31
sp|A6V730.1|LPXH_PSEA7  RecName: Full=UDP-2,3-diacylglucosamin...   133    6e-31
sp|A8GAX8.1|LPXH_SERP5  RecName: Full=UDP-2,3-diacylglucosamin...   132    1e-30
sp|Q1IBQ2.1|LPXH_PSEE4  RecName: Full=UDP-2,3-diacylglucosamin...   131    2e-30
sp|B6EH41.1|LPXH_ALISL  RecName: Full=UDP-2,3-diacylglucosamin...   130    3e-30
sp|Q0TKB7.1|LPXH_ECOL5  RecName: Full=UDP-2,3-diacylglucosamin...   130    3e-30
sp|B7MRI7.1|LPXH_ECO81  RecName: Full=UDP-2,3-diacylglucosamin...   130    3e-30
sp|Q8FK47.1|LPXH_ECOL6  RecName: Full=UDP-2,3-diacylglucosamin...   130    4e-30
sp|A0KLW6.1|LPXH_AERHH  RecName: Full=UDP-2,3-diacylglucosamin...   130    4e-30
sp|B1J842.1|LPXH_PSEPW  RecName: Full=UDP-2,3-diacylglucosamin...   130    5e-30
sp|B7N978.1|LPXH_ECOLU  RecName: Full=UDP-2,3-diacylglucosamin...   129    6e-30
sp|B6I0G9.1|LPXH_ECOSE  RecName: Full=UDP-2,3-diacylglucosamin...   129    6e-30
sp|B0KUU3.1|LPXH_PSEPG  RecName: Full=UDP-2,3-diacylglucosamin...   129    7e-30
sp|Q1RF10.1|LPXH_ECOUT  RecName: Full=UDP-2,3-diacylglucosamin...   129    7e-30
sp|Q32JL2.1|LPXH_SHIDS  RecName: Full=UDP-2,3-diacylglucosamin...   129    7e-30
sp|P43341.2|LPXH_ECOLI  RecName: Full=UDP-2,3-diacylglucosamin...   129    7e-30
sp|P58976.1|LPXH_XANCP  RecName: Full=UDP-2,3-diacylglucosamin...   129    7e-30
sp|A1U1R0.1|LPXH_MARAV  RecName: Full=UDP-2,3-diacylglucosamin...   129    1e-29
sp|B7UKK1.1|LPXH_ECO27  RecName: Full=UDP-2,3-diacylglucosamin...   129    1e-29
sp|Q8XCU1.1|LPXH_ECO57  RecName: Full=UDP-2,3-diacylglucosamin...   129    1e-29
sp|Q88IU7.1|LPXH_PSEPK  RecName: Full=UDP-2,3-diacylglucosamin...   129    1e-29
sp|B0RU17.1|LPXH_XANCB  RecName: Full=UDP-2,3-diacylglucosamin...   129    1e-29
sp|A5W461.1|LPXH_PSEP1  RecName: Full=UDP-2,3-diacylglucosamin...   129    1e-29
sp|Q3Z4P3.1|LPXH_SHISS  RecName: Full=UDP-2,3-diacylglucosamin...   128    1e-29
sp|Q83M28.1|LPXH_SHIFL  RecName: Full=UDP-2,3-diacylglucosamin...   128    2e-29
sp|C4LG06.1|LPXH_TOLAT  RecName: Full=UDP-2,3-diacylglucosamin...   128    2e-29
sp|B7NL16.1|LPXH_ECO7I  RecName: Full=UDP-2,3-diacylglucosamin...   128    2e-29
sp|B7LJI2.1|LPXH_ESCF3  RecName: Full=UDP-2,3-diacylglucosamin...   128    2e-29
sp|Q7VX99.2|LPXH_BORPE  RecName: Full=UDP-2,3-diacylglucosamin...   127    3e-29
sp|Q83BL5.1|LPXH_COXBU  RecName: Full=UDP-2,3-diacylglucosamin...   127    3e-29
sp|Q9I2V0.1|LPXH_PSEAE  RecName: Full=UDP-2,3-diacylglucosamin...   127    4e-29
sp|Q7MLR7.1|LPXH_VIBVY  RecName: Full=UDP-2,3-diacylglucosamin...   126    6e-29
sp|B6IZ08.1|LPXH_COXB2  RecName: Full=UDP-2,3-diacylglucosamin...   126    7e-29
sp|B5FF31.1|LPXH_VIBFM  RecName: Full=UDP-2,3-diacylglucosamin...   126    8e-29
sp|A4VL70.1|LPXH_PSEU5  RecName: Full=UDP-2,3-diacylglucosamin...   126    9e-29
sp|A1JNQ2.1|LPXH_YERE8  RecName: Full=UDP-2,3-diacylglucosamin...   125    9e-29
sp|Q7W865.1|LPXH_BORPA  RecName: Full=UDP-2,3-diacylglucosamin...   125    1e-28
sp|Q9PAD0.1|LPXH_XYLFA  RecName: Full=UDP-2,3-diacylglucosamin...   125    1e-28
sp|Q5E4E9.1|LPXH_VIBF1  RecName: Full=UDP-2,3-diacylglucosamin...   125    2e-28
sp|A9KBJ4.1|LPXH_COXBN  RecName: Full=UDP-2,3-diacylglucosamin...   125    2e-28
sp|B0U5J4.1|LPXH_XYLFM  RecName: Full=UDP-2,3-diacylglucosamin...   124    2e-28
sp|Q87QK1.1|LPXH_VIBPA  RecName: Full=UDP-2,3-diacylglucosamin...   124    2e-28
sp|Q87A66.1|LPXH_XYLFT  RecName: Full=UDP-2,3-diacylglucosamin...   124    3e-28
sp|Q8ZCB8.1|LPXH_YERPE  RecName: Full=UDP-2,3-diacylglucosamin...   124    3e-28
sp|A7FL48.1|LPXH_YERP3  RecName: Full=UDP-2,3-diacylglucosamin...   124    3e-28
sp|A4SLC4.1|LPXH_AERS4  RecName: Full=UDP-2,3-diacylglucosamin...   124    4e-28
sp|B0UVZ2.1|LPXH_HAES2  RecName: Full=UDP-2,3-diacylglucosamin...   124    4e-28
sp|A6T5R0.1|LPXH_KLEP7  RecName: Full=UDP-2,3-diacylglucosamin...   123    5e-28
sp|B3PHJ5.1|LPXH_CELJU  RecName: Full=UDP-2,3-diacylglucosamin...   123    5e-28
sp|Q8D8Q9.2|LPXH_VIBVU  RecName: Full=UDP-2,3-diacylglucosamin...   123    7e-28
sp|B7VGZ3.1|LPXH_VIBSL  RecName: Full=UDP-2,3-diacylglucosamin...   122    1e-27
sp|Q0I254.1|LPXH_HAES1  RecName: Full=UDP-2,3-diacylglucosamin...   121    2e-27
sp|Q2SK43.1|LPXH_HAHCH  RecName: Full=UDP-2,3-diacylglucosamin...   120    3e-27
sp|Q7N0S3.1|LPXH_PHOLL  RecName: Full=UDP-2,3-diacylglucosamin...   120    3e-27
sp|C6DAX5.1|LPXH_PECCP  RecName: Full=UDP-2,3-diacylglucosamin...   120    4e-27
sp|P58975.1|LPXH_XANAC  RecName: Full=UDP-2,3-diacylglucosamin...   120    4e-27
sp|Q5GWJ5.1|LPXH_XANOR  RecName: Full=UDP-2,3-diacylglucosamin...   120    4e-27
sp|Q4QMG1.1|LPXH_HAEI8  RecName: Full=UDP-2,3-diacylglucosamin...   119    9e-27
sp|A5UHN7.1|LPXH_HAEIG  RecName: Full=UDP-2,3-diacylglucosamin...   117    3e-26
sp|Q8EG24.1|LPXH_SHEON  RecName: Full=UDP-2,3-diacylglucosamin...   115    1e-25
sp|Q9KQZ7.1|LPXH_VIBCH  RecName: Full=UDP-2,3-diacylglucosamin...   115    2e-25
sp|B5FLP5.1|LPXH_SALDC  RecName: Full=UDP-2,3-diacylglucosamin...   115    2e-25
sp|A5F743.1|LPXH_VIBC3  RecName: Full=UDP-2,3-diacylglucosamin...   115    2e-25
sp|B5EYD5.1|LPXH_SALA4  RecName: Full=UDP-2,3-diacylglucosamin...   115    2e-25
sp|Q5PCF3.1|LPXH_SALPA  RecName: Full=UDP-2,3-diacylglucosamin...   114    2e-25
sp|P44046.1|LPXH_HAEIN  RecName: Full=UDP-2,3-diacylglucosamin...   114    2e-25
sp|A9KWH2.1|LPXH_SHEB9  RecName: Full=UDP-2,3-diacylglucosamin...   114    2e-25
sp|Q8ZR69.1|LPXH_SALTY  RecName: Full=UDP-2,3-diacylglucosamin...   114    4e-25
sp|B8E5F4.1|LPXH_SHEB2  RecName: Full=UDP-2,3-diacylglucosamin...   114    4e-25
sp|B4F1M8.1|LPXH_PROMH  RecName: Full=UDP-2,3-diacylglucosamin...   114    4e-25
sp|Q57S31.1|LPXH_SALCH  RecName: Full=UDP-2,3-diacylglucosamin...   114    4e-25
sp|A3D300.1|LPXH_SHEB5  RecName: Full=UDP-2,3-diacylglucosamin...   113    5e-25
sp|A5UDZ1.1|LPXH_HAEIE  RecName: Full=UDP-2,3-diacylglucosamin...   113    5e-25
sp|B4TN57.1|LPXH_SALSV  RecName: Full=UDP-2,3-diacylglucosamin...   113    5e-25
sp|Q8Z8P7.1|LPXH_SALTI  RecName: Full=UDP-2,3-diacylglucosamin...   113    5e-25
sp|A6WLP6.1|LPXH_SHEB8  RecName: Full=UDP-2,3-diacylglucosamin...   113    7e-25
sp|Q6LT69.1|LPXH_PHOPR  RecName: Full=UDP-2,3-diacylglucosamin...   112    9e-25
sp|A9MLB0.1|LPXH_SALAR  RecName: Full=UDP-2,3-diacylglucosamin...   112    9e-25
sp|Q7VKH0.1|LPXH_HAEDU  RecName: Full=UDP-2,3-diacylglucosamin...   110    3e-24
sp|Q8Y081.1|LPXH_RALSO  RecName: Full=UDP-2,3-diacylglucosamin...   110    3e-24
sp|A3QFY1.1|LPXH_SHELP  RecName: Full=UDP-2,3-diacylglucosamin...   110    5e-24
sp|B5Y0K8.1|LPXH_KLEP3  RecName: Full=UDP-2,3-diacylglucosamin...   110    6e-24
sp|Q0HTK2.1|LPXH_SHESR  RecName: Full=UDP-2,3-diacylglucosamin...   108    1e-23
sp|Q7NT75.1|LPXH_CHRVO  RecName: Full=UDP-2,3-diacylglucosamin...   107    3e-23
sp|A4Y5H7.1|LPXH_SHEPC  RecName: Full=UDP-2,3-diacylglucosamin...   107    3e-23
sp|Q65V94.1|LPXH_MANSM  RecName: Full=UDP-2,3-diacylglucosamin...   107    5e-23
sp|A8H619.1|LPXH_SHEPA  RecName: Full=UDP-2,3-diacylglucosamin...   106    7e-23
sp|Q3J8Y6.1|LPXH_NITOC  RecName: Full=UDP-2,3-diacylglucosamin...   105    1e-22
sp|Q0HH96.1|LPXH_SHESM  RecName: Full=UDP-2,3-diacylglucosamin...   105    1e-22
sp|A0KYM4.1|LPXH_SHESA  RecName: Full=UDP-2,3-diacylglucosamin...   105    2e-22
sp|A7MJY7.1|LPXH_ENTS8  RecName: Full=UDP-2,3-diacylglucosamin...   104    2e-22
sp|C1D6W3.1|LPXH_LARHH  RecName: Full=UDP-2,3-diacylglucosamin...   103    7e-22
sp|A6VR19.1|LPXH_ACTSZ  RecName: Full=UDP-2,3-diacylglucosamin...   103    7e-22
sp|Q07ZX3.1|LPXH_SHEFN  RecName: Full=UDP-2,3-diacylglucosamin...   103    7e-22
sp|A1SWR2.1|LPXH_PSYIN  RecName: Full=UDP-2,3-diacylglucosamin...   101    2e-21
sp|A1KSF3.1|LPXH_NEIMF  RecName: Full=UDP-2,3-diacylglucosamin...   100    4e-21
sp|Q9K0P2.1|LPXH_NEIMB  RecName: Full=UDP-2,3-diacylglucosamin...   100    4e-21
sp|Q9JVS0.1|LPXH_NEIMA  RecName: Full=UDP-2,3-diacylglucosamin...   100    4e-21
sp|A9M211.1|LPXH_NEIM0  RecName: Full=UDP-2,3-diacylglucosamin...   100    4e-21
sp|A1S4X0.1|LPXH_SHEAM  RecName: Full=UDP-2,3-diacylglucosamin...   100    4e-21
sp|Q9CPE3.1|LPXH_PASMU  RecName: Full=UDP-2,3-diacylglucosamin...   100    5e-21
sp|Q493A2.1|LPXH_BLOPB  RecName: Full=UDP-2,3-diacylglucosamin...   100    7e-21
sp|B0TLV4.1|LPXH_SHEHH  RecName: Full=UDP-2,3-diacylglucosamin...  99.4    1e-20
sp|Q5F6U7.1|LPXH_NEIG1  RecName: Full=UDP-2,3-diacylglucosamin...  99.0    1e-20
sp|Q8D2V8.1|LPXH_WIGBR  RecName: Full=UDP-2,3-diacylglucosamin...  99.0    1e-20
sp|C5B8V8.1|LPXH_EDWI9  RecName: Full=UDP-2,3-diacylglucosamin...  98.2    2e-20
sp|Q6D2E1.1|LPXH_ERWCT  RecName: Full=UDP-2,3-diacylglucosamin...  97.4    3e-20
sp|C4K6H0.1|LPXH_HAMD5  RecName: Full=UDP-2,3-diacylglucosamin...  97.4    4e-20
sp|B8CRG2.1|LPXH_SHEPW  RecName: Full=UDP-2,3-diacylglucosamin...  97.1    5e-20
sp|Q7VRB5.1|LPXH_BLOFL  RecName: Full=UDP-2,3-diacylglucosamin...  94.7    2e-19
sp|O09161.2|CASQ2_MOUSE  RecName: Full=Calsequestrin-2; AltNam...  32.3    1.4  
sp|P51868.2|CASQ2_RAT  RecName: Full=Calsequestrin-2; AltName:...  32.3    1.4  
sp|Q9N0E7.2|MOCOS_BOVIN  RecName: Full=Molybdenum cofactor sul...  32.0    1.8  
sp|B2UNA9.1|PNP_AKKM8  RecName: Full=Polyribonucleotide nucleo...  32.0    1.9  
sp|P17240.1|NCAP_PI4HA  RecName: Full=Nucleoprotein; AltName: ...  30.8    4.8  
sp|Q96EN8.1|MOCOS_HUMAN  RecName: Full=Molybdenum cofactor sul...  29.6    9.3  

ALIGNMENTS
>sp|Q1QVV3.1|LPXH_CHRSD RecName: Full=UDP-2,3-diacylglucosamine hydrolase
Length=246

 Score =  146 bits (368),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 104/169 (61%), Gaps = 1/169 (0%)

Query  6    FTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCTNDSEY  65
             ++ G +L+F+ GNRDFL+ ++FA++    +L+DP         V++ HGD LCT D EY
Sbjct  66   LSDAGTQLYFMHGNRDFLVGEDFAAAAGATLLDDPCLATLGRQTVLLMHGDSLCTGDEEY  125

Query  66   MEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVDLFLQK  125
            M+FR   R P W+++ L+ P+ +R ++A S+R  S+ A+  K+  I DV   +V+  +++
Sbjct  126  MKFRAMARDPEWQAQILALPIEQRLELAKSLRMQSSDANTQKADAIMDVTPAEVEAIMRE  185

Query  126  EKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTF-GWCLKLDINGP  173
               +  IHGHTHRP +H+   +    QRIVLGDW    GW ++++ + P
Sbjct  186  HGVSTLIHGHTHRPAVHEFTLDGQPAQRIVLGDWRPGRGWEVRVEDDAP  234


>sp|C1DHE3.1|LPXH_AZOVD RecName: Full=UDP-2,3-diacylglucosamine hydrolase
Length=241

 Score =  143 bits (360),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 99/180 (55%), Gaps = 0/180 (0%)

Query  1    SKLLDFTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCT  60
            + L +    G ++F + GNRDFL+   F       +L DP  ++ N   V++ HGD LCT
Sbjct  61   AALREVAERGTRVFLMHGNRDFLVGHSFCRQAGCTLLRDPSRVILNGAPVLLMHGDTLCT  120

Query  61   NDSEYMEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVD  120
             D  YM FR ++R+P         PL +R+++A   RDAS    + K++EI DV   +V 
Sbjct  121  RDIAYMRFRRRLRNPVSVWLLRHLPLSKRRQLARKWRDASRMQVRRKATEIVDVTPEEVP  180

Query  121  LFLQKEKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWCLKLDINGPDLFKFKI  180
              +        IHGHTHRP +H+L+ +    +RIVLGDW+  GW L++D +G  L  F I
Sbjct  181  RIMAAHGVLTLIHGHTHRPAVHELQVDGRQARRIVLGDWNRQGWVLQVDGSGYHLTPFPI  240


>sp|Q5P1I2.1|LPXH_AZOSE RecName: Full=UDP-2,3-diacylglucosamine hydrolase
Length=245

 Score =  142 bits (358),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 98/172 (56%), Gaps = 0/172 (0%)

Query  2    KLLDFTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCTN  61
             L      G  LFF+ GNRDFLL + FA    + IL DP  + F+   V++SHGD LCT+
Sbjct  62   ALAALAETGTSLFFLPGNRDFLLGESFARRARLRILPDPTLIDFDNEGVLLSHGDILCTD  121

Query  62   DSEYMEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVDL  121
            D  Y  FR  VR P+W+  FL +PL +RK++ + +R  S +A ++K+S+I DVN   V+ 
Sbjct  122  DEHYQSFRRLVRDPAWQLAFLERPLAQRKQVIEGLRFQSETAKQEKASDIMDVNAFAVET  181

Query  122  FLQKEKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWCLKLDINGP  173
             L++      IHGHTHRP  H    +  S +R VL DW      L+ D  GP
Sbjct  182  LLREHGYPTLIHGHTHRPAHHVHVVDGRSCERWVLADWHDDAPYLRWDGAGP  233


>sp|Q87YP9.1|LPXH_PSESM RecName: Full=UDP-2,3-diacylglucosamine hydrolase
Length=248

 Score =  140 bits (354),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 99/176 (56%), Gaps = 0/176 (0%)

Query  3    LLDFTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCTND  62
            L + ++ G ++F + GNRDF+L K F  +    +L DP  +  N   V++ HGD LCT D
Sbjct  62   LRELSDSGTRIFLMHGNRDFMLGKGFCKAAGCTLLSDPSVVQLNGEPVLLMHGDSLCTRD  121

Query  63   SEYMEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVDLF  122
              YM  R  +R P         PL  R K+A  +R+ S + ++ K+++I DV   +V   
Sbjct  122  EGYMRMRRYLRHPLTLFILRHLPLSTRHKLARKLRNESRAQTRMKANDIVDVTPDEVPRI  181

Query  123  LQKEKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWCLKLDINGPDLFKF  178
            +Q+      +HGHTHRP +H L+  D S +RIVLGDWD  GW L++D  G +L  F
Sbjct  182  MQQFGVRTLVHGHTHRPAIHKLQIGDQSAKRIVLGDWDRQGWVLQVDEQGMNLGSF  237


>sp|Q3KA25.1|LPXH_PSEPF RecName: Full=UDP-2,3-diacylglucosamine hydrolase
Length=248

 Score =  139 bits (351),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/176 (37%), Positives = 100/176 (56%), Gaps = 0/176 (0%)

Query  3    LLDFTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCTND  62
            L + ++ G  +F + GNRDF+L K F       +L+DP  + F    V++ HGD LCT D
Sbjct  62   LRELSDSGTAIFLMHGNRDFMLGKAFCKQAGCTLLKDPSVVQFYGEPVLLMHGDSLCTRD  121

Query  63   SEYMEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVDLF  122
              YM+ R  +R+P       + PL  R K+A  +R  S + ++ K+++I DV   ++   
Sbjct  122  ESYMKLRRYLRNPLSLFILRNLPLRTRHKLARKLRSESRAQTRMKANDIVDVTPEEIPRI  181

Query  123  LQKEKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWCLKLDINGPDLFKF  178
            +Q+      +HGHTHRP +H L+  D + +RIVLGDWD  GW L++D NG  L  F
Sbjct  182  MQEYGVKTLVHGHTHRPAIHKLQIGDQAAKRIVLGDWDRQGWALQVDENGFALAPF  237


>sp|B4SLL1.1|LPXH_STRM5 RecName: Full=UDP-2,3-diacylglucosamine hydrolase
Length=248

 Score =  137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/174 (38%), Positives = 98/174 (56%), Gaps = 7/174 (4%)

Query  6    FTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCTNDSEY  65
             T+ G   +FI GNRDFLL +++A    + IL DP  +      V++ HGD LCT+D  Y
Sbjct  66   LTDSGVPAYFIRGNRDFLLGEDYARRAGLRILPDPCVIELYGRPVLLQHGDLLCTDDIPY  125

Query  66   MEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASK-----DKSS--EITDVNLGD  118
             +FR Q R P+++++FLS+PL  R   A   R+ S +        D+++   +TDV   +
Sbjct  126  QQFRAQTRDPAFQAQFLSQPLAARIAFAQKARETSQARQSEMKQGDRATFENVTDVAPAE  185

Query  119  VDLFLQKEKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWCLKLDING  172
            VD    +   +  IHGHTHRP +H L+    +  RIVLGDW   G  L++D NG
Sbjct  186  VDATFVRHGVDTMIHGHTHRPAIHALQAGGRACTRIVLGDWYEQGSVLRVDANG  239


>sp|Q4K9R8.1|LPXH_PSEF5 RecName: Full=UDP-2,3-diacylglucosamine hydrolase
Length=250

 Score =  137 bits (345),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/176 (36%), Positives = 100/176 (56%), Gaps = 0/176 (0%)

Query  3    LLDFTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCTND  62
            L + ++ G ++F + GNRDF+L K F  +    +L+DP  + F    V++ HGD LCT D
Sbjct  62   LRELSDSGTQIFLMHGNRDFMLGKAFCKAAGATLLKDPSVVDFYGEPVLLMHGDSLCTRD  121

Query  63   SEYMEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVDLF  122
              YM  R  +R+P         PL  R+K+A  +R+ S + ++ K+++I DV    V   
Sbjct  122  EAYMRMRRYLRNPLSLWILRHLPLGTRRKLARKLRNESRAQTRMKANDIVDVTPDQVPQV  181

Query  123  LQKEKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWCLKLDINGPDLFKF  178
            +Q+      +HGHTHRP +H L+  + + +RIVLGDWD  GW L++D  G  L  F
Sbjct  182  MQEHGVRTLVHGHTHRPAIHKLQIGEQAAKRIVLGDWDRQGWALQVDEQGFQLAAF  237


>sp|C3JYD6.1|LPXH_PSEFS RecName: Full=UDP-2,3-diacylglucosamine hydrolase
Length=249

 Score =  137 bits (345),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/178 (36%), Positives = 100/178 (56%), Gaps = 0/178 (0%)

Query  1    SKLLDFTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCT  60
            + L + ++ G  +F + GNRDFL+ K F  +    +L+DP  +  +   V++ HGD LCT
Sbjct  60   AALRELSDSGTPIFIMHGNRDFLIGKAFCKAAGATLLKDPSVVQLHGEPVLLMHGDSLCT  119

Query  61   NDSEYMEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVD  120
             D  YM+ R  +R+P         PL  R K+A  +R  S + ++ K+++I DV   +V 
Sbjct  120  RDVGYMKLRRILRNPIVLFILRHLPLRTRHKLARKLRSESRAQTRMKANDIVDVTPEEVP  179

Query  121  LFLQKEKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWCLKLDINGPDLFKF  178
              +Q+      +HGHTHRP +H L+  D + +RIVLGDWD  GW L++D  G  L  F
Sbjct  180  RVMQQFGVRTLVHGHTHRPAIHKLQIGDQAAKRIVLGDWDKQGWALQVDEQGFQLAAF  237


>sp|B2FQP4.1|LPXH_STRMK RecName: Full=UDP-2,3-diacylglucosamine hydrolase
Length=248

 Score =  137 bits (344),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 97/174 (55%), Gaps = 7/174 (4%)

Query  6    FTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCTNDSEY  65
             ++ G  ++FI GNRDFLL +++A    + IL DP  +      V++ HGD LCT+D  Y
Sbjct  66   LSDSGVPVYFIRGNRDFLLGEDYARRAGLRILPDPCMIDLYGRPVLLQHGDLLCTDDIPY  125

Query  66   MEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNS-------ASKDKSSEITDVNLGD  118
             +FR Q R P+++++FLS+PL  R   A   R+AS +         + +   +TDV   +
Sbjct  126  QQFRAQTRDPAFQAQFLSQPLAARIAFAQKAREASQARQSEMKQGDRAQFETVTDVAPSE  185

Query  119  VDLFLQKEKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWCLKLDING  172
            VD    +   +  IHGHTHRP +H L+    +  RIVLGDW   G  L++D  G
Sbjct  186  VDATFARHGVDTMIHGHTHRPAIHSLQAGGRACTRIVLGDWYEQGSVLRVDAGG  239


>sp|Q4ZVP2.1|LPXH_PSEU2 RecName: Full=UDP-2,3-diacylglucosamine hydrolase
Length=248

 Score =  137 bits (344),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/176 (36%), Positives = 99/176 (56%), Gaps = 0/176 (0%)

Query  3    LLDFTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCTND  62
            L + ++ G ++F + GNRDF+L K F  +    +L DP  +  N   V++ HGD LCT D
Sbjct  62   LRELSDSGTRIFLMHGNRDFMLGKGFCKAAGCTLLSDPSVVQLNGEPVLLMHGDSLCTRD  121

Query  63   SEYMEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVDLF  122
              Y+  R  +R P         PL  R K+A  +R+ S + ++ K+++I DV   +V   
Sbjct  122  EGYIRMRRYLRHPLTLFILRHLPLGTRHKLARKLRNESRAQTRMKANDIVDVTPDEVPRI  181

Query  123  LQKEKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWCLKLDINGPDLFKF  178
            +Q+      +HGHTHRP +H L+  D + +RIVLGDWD  GW L++D  G +L  F
Sbjct  182  MQQFGVRTLVHGHTHRPAIHKLQIGDQAARRIVLGDWDRQGWVLQVDEQGFNLSSF  237


>sp|A4W7I2.1|LPXH_ENT38 RecName: Full=UDP-2,3-diacylglucosamine hydrolase
Length=240

 Score =  136 bits (343),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 97/173 (56%), Gaps = 0/173 (0%)

Query  6    FTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCTNDSEY  65
              + G   +FI GNRDFL+ K FA  + + +L D   +      V+I HGD LCT+D+ Y
Sbjct  66   LVDSGVPCYFIHGNRDFLIGKRFARESGMTLLPDENVLELYGRNVLIMHGDTLCTDDTGY  125

Query  66   MEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVDLFLQK  125
            + FR +V +P  ++ FL+ PL  R +IA  MR  S +A+  KS  I DVN   V   ++K
Sbjct  126  LAFRAKVHTPWIQTLFLALPLFIRNRIAAKMRAGSKAANSSKSMTIMDVNPQAVVEVMEK  185

Query  126  EKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWCLKLDINGPDLFKF  178
             +    IHGHTHRPD+H L        R+VLG W + G  +K+   G +L +F
Sbjct  186  HRVQWLIHGHTHRPDVHQLTANGEPAHRVVLGAWHSEGSMVKVTSEGVELIQF  238


>sp|A4XVG4.1|LPXH_PSEMY RecName: Full=UDP-2,3-diacylglucosamine hydrolase
Length=242

 Score =  136 bits (342),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 97/172 (56%), Gaps = 0/172 (0%)

Query  1    SKLLDFTNEGNKLFFIAGNRDFLLDKEFASSTNIEILEDPFSMMFNEMKVVISHGDFLCT  60
              L + ++ G +++ + GNRDFL+ K F       +L DP  +  N   V++ HGD LCT
Sbjct  60   GALRELSDSGTRIYLMHGNRDFLIGKRFCREAGCTLLGDPHRVQMNGEPVLLMHGDSLCT  119

Query  61   NDSEYMEFREQVRSPSWKSEFLSKPLHERKKIADSMRDASNSASKDKSSEITDVNLGDVD  120
             D  YM+ R  +R+P       + PL  R+K+A  +R+ S + ++ K+SEI DV   +V 
Sbjct  120  LDVGYMKLRRWLRNPLSLLILRNLPLATRQKLARKLRNESRAQTRMKASEIVDVTPEEVV  179

Query  121  LFLQKEKPNLFIHGHTHRPDLHDLEYEDFSTQRIVLGDWDTFGWCLKLDING  172
              + +      IHGHTHRP +H+LE      +RIVLGDWD  GW L++D  G
Sbjct  180  RVMGEYDVRTLIHGHTHRPAVHELEVNGQPARRIVLGDWDRQGWALQVDGEG  231