GOS 1397010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1091118860043
Annotathon code: GOS_1397010
Sample :
  • GPS :9°9'52n; 79°50'10w
  • Panama Canal: Lake Gatun - Panama
  • Fresh Water (-2m, 28.6°C, 0.1-0.8 microns)
Authors
Team : Algarve
Username : AKS1
Annotated on : 2010-05-19 15:54:29
  • a33825 AndreFilipeBaltazarAlves1
  • a33856 SaraAlexandraGuedesCorreia1
  • a37893 KellySophieCaetano1

Synopsis

  • Taxonomy: Mycobacterium (NCBI info)
    Rank: genus - Genetic Code: Bacterial and Plant Plastid - NCBI Identifier: 1763
    Kingdom: Bacteria - Phylum: Actinobacteria - Class: Actinobacteria (class) - Order: Actinomycetales
    Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales; Corynebacterineae; Mycobacteriaceae; Mycobacterium;

Genomic Sequence

>JCVI_READ_1091118860043 GOS_1397010 Genomic DNA
ATAAGGACTGGGTTGTTCTTAGTACGGCGAGAGAGAACCTGCATGACGCGCTCGATTTCCTTCTCGCGTCCGATAACTGGGTCGAGTTTTCCTTCACGTG
CGGCCACAGTTAGGTTTCTTCCAAATTGATCTAGAACGAGTGATGTTGCTGGAGTTCCTTCAGGTGCGCCCGCAGATACCGCTTCTTTACCTTGGTAACC
GGAGAGAAGTTGGATTACTTGTTGACGAACTCGATTTAAATCAGCGCCGAGTTTTACAAGAACTTGCGCAGCAACGCCTTCACCTTCGCGGATTAAGCCA
AGAAGAATGTGTTCGGTTCCAATGTAGTTATGTCCGAGTTGTAGCGCTTCGCGAAGTGATAATTCCAAAACTTTCTTTGCACGGGGTGTAAAAGGAATGT
GGCCTGATGGAGCTTGCTGTCCTTGGCCGATAATTTCTTCAACTTGCGAACGGACTGCTTCGAGTGAAATTCCGAGCGCTTCGAGGCCTTTTGCGGCTAC
GCCCTCACCTTCATGAATAAGTCCAAGGAGGATGTGCTCGGTACCGATGTAATTGTGATTGAGCATGCGAGCTTCCTCTTGTGCGAGGACAACGACTCGA
CGAGCCCGGTCGGTAAAGCGTTCAAACATTTAACACTCCTTATATTTCTTGAGCCCTAGGGTAGTAGAGGTGGCCATTCGAGGCGACATCTATATTCCAG
CTTCAAGATATGGGACTTTGTAGGGGGTAGAACCTCAATATTTGGGTCTTTATTCCTGCCCTTATTCGAACCCTTATTCGAGAACGAGCAACATTCGGGT
ATTTCCCAGGGTATTGGGCTTTACGCTCTCAAGGTCGAGAAATTCTGCAACACCTTCATCGTAGAGCGAAGTAATTCTTGATAGATCGCATGTTCCACCG
GCGCACCAAC

Translation

[282 - 908/910]   indirect strand
>GOS_1397010 Translation [282-908   indirect strand]
MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKGLEALGISLEAVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGH
NYIGTEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVIQLLSGYQGKEAVSAGAPEGTPATSLVLDQFGRNLTVAAREGKLDPVIGREKEIERVMQVLS
RRTKNNPVL

[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

Our protein was identified as an ATP-Dependent CLP Protease once, on the protein domain, it shows an e-value equal to 2.4e-95. The same has a molecular function that makes her be present on the participation of protein binding. The process of protein binding is usually reversible, creating a chemical equilibrium without changing reactants and products.

Our protein has a Biologic process that makes her be present in protein metabolic, because our protein is involved in degradation of proteins. CLP proteases are activated under stress, becoming toxic.

We can say that a possible taxonomy of our organism, through the analysis of the tree,is on the the group of Mycobacterium and phylum and class Actinobacteria.

Actinobacteria are a group of bacteria with high G+C ratio, that adapt to different environmental conditions, produce antibiotics and are able to colonize the rhizosphere and inner tissue of plants.



ORF finding

PROTOCOL


a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code



RESULTS ANALYSIS


For this study, you will only consider ORFs that verify the following criteria:

- do not contain any STOP codons (basic ORF definition...)

- contains at least 60 codons

- can be on either direct or reverse strands

- can be in frames 1, 2 or 3

- can be incomplete at the 5' or 3' ends, or both!


Analyzing the ORF that initiate on aminoacid 282 and ends on the position 908, we check that the start codon exists and it is right,once it is ATG corresponding to a metionine. On the other hand, the stop codon is absent.

The selected oORF exists in reverse stran, in reading frame 3, and initiates on aa 282 and end on aa 908 and that ORF doesn´t have an internal stop codon.

This ORF is the biggest so this ORF was the one that we select. That ORF will encode a functional protein.

At the forward strand, we have 4 orfs: two in reading frame 3, one in reading frame 2 and other in reading frame 1. Whereas we have 2 orfs on reverse strand, one in reading frame 1 and another in reading frame 2.


We didn’t calculate molecular weight for our unknown protein because this protein is incomplete, due to a absence of stop codon “[ Warning ] 3' incomplete: following codon is not a STOP”

Molecular weight must only be calculate for complete proteins.



RAW RESULTS
a) forward strand

>ORF number 1 in reading frame 1 on the direct strand extends from base 328 to base 516.
TTATGTCCGAGTTGTAGCGCTTCGCGAAGTGATAATTCCAAAACTTTCTTTGCACGGGGT
GTAAAAGGAATGTGGCCTGATGGAGCTTGCTGTCCTTGGCCGATAATTTCTTCAACTTGC
GAACGGACTGCTTCGAGTGAAATTCCGAGCGCTTCGAGGCCTTTTGCGGCTACGCCCTCA
CCTTCATGA

>Translation of ORF number 1 in reading frame 1 on the direct strand.
LCPSCSASRSDNSKTFFARGVKGMWPDGACCPWPIISSTCERTASSEIPSASRPFAATPS
PS*

>ORF number 1 in reading frame 2 on the direct strand extends from base 77 to base 391.
CTGGGTCGAGTTTTCCTTCACGTGCGGCCACAGTTAGGTTTCTTCCAAATTGATCTAGAA
CGAGTGATGTTGCTGGAGTTCCTTCAGGTGCGCCCGCAGATACCGCTTCTTTACCTTGGT
AACCGGAGAGAAGTTGGATTACTTGTTGACGAACTCGATTTAAATCAGCGCCGAGTTTTA
CAAGAACTTGCGCAGCAACGCCTTCACCTTCGCGGATTAAGCCAAGAAGAATGTGTTCGG
TTCCAATGTAGTTATGTCCGAGTTGTAGCGCTTCGCGAAGTGATAATTCCAAAACTTTCT
TTGCACGGGGTGTAA

>Translation of ORF number 1 in reading frame 2 on the direct strand.
LGRVFLHVRPQLGFFQIDLERVMLLEFLQVRPQIPLLYLGNRREVGLLVDELDLNQRRVL
QELAQQRLHLRGLSQEECVRFQCSYVRVVALREVIIPKLSLHGV*

>ORF number 1 in reading frame 3 on the direct strand extends from base 468 to base 659.
AATTCCGAGCGCTTCGAGGCCTTTTGCGGCTACGCCCTCACCTTCATGAATAAGTCCAAG
GAGGATGTGCTCGGTACCGATGTAATTGTGATTGAGCATGCGAGCTTCCTCTTGTGCGAG
GACAACGACTCGACGAGCCCGGTCGGTAAAGCGTTCAAACATTTAACACTCCTTATATTT
CTTGAGCCCTAG

>Translation of ORF number 1 in reading frame 3 on the direct strand.
NSERFEAFCGYALTFMNKSKEDVLGTDVIVIEHASFLLCEDNDSTSPVGKAFKHLTLLIF
LEP*

>ORF number 2 in reading frame 3 on the direct strand extends from base 660 to base 881.
GGTAGTAGAGGTGGCCATTCGAGGCGACATCTATATTCCAGCTTCAAGATATGGGACTTT
GTAGGGGGTAGAACCTCAATATTTGGGTCTTTATTCCTGCCCTTATTCGAACCCTTATTC
GAGAACGAGCAACATTCGGGTATTTCCCAGGGTATTGGGCTTTACGCTCTCAAGGTCGAG
AAATTCTGCAACACCTTCATCGTAGAGCGAAGTAATTCTTGA

>Translation of ORF number 2 in reading frame 3 on the direct strand.
GSRGGHSRRHLYSSFKIWDFVGGRTSIFGSLFLPLFEPLFENEQHSGISQGIGLYALKVE
KFCNTFIVERSNS*

----------------------------------------------------------------------------------------------------------------

b)reverse strand

>ORF number 1 in reading frame 1 on the reverse strand extends from base 415 to base 618.
CCGCAAAAGGCCTCGAAGCGCTCGGAATTTCACTCGAAGCAGTCCGTTCGCAAGTTGAAG
AAATTATCGGCCAAGGACAGCAAGCTCCATCAGGCCACATTCCTTTTACACCCCGTGCAA
AGAAAGTTTTGGAATTATCACTTCGCGAAGCGCTACAACTCGGACATAACTACATTGGAA
CCGAACACATTCTTCTTGGCTTAA

>Translation of ORF number 1 in reading frame 1 on the reverse strand.
PQKASKRSEFHSKQSVRKLKKLSAKDSKLHQATFLLHPVQRKFWNYHFAKRYNSDITTLE
PNTFFLA*

No ORFs were found in reading frame 2.

>ORF number 1 in reading frame 3 on the reverse strand extends from base 282 to base 908.
ATGTTTGAACGCTTTACCGACCGGGCTCGTCGAGTCGTTGTCCTCGCACAAGAGGAAGCT
CGCATGCTCAATCACAATTACATCGGTACCGAGCACATCCTCCTTGGACTTATTCATGAA
GGTGAGGGCGTAGCCGCAAAAGGCCTCGAAGCGCTCGGAATTTCACTCGAAGCAGTCCGT
TCGCAAGTTGAAGAAATTATCGGCCAAGGACAGCAAGCTCCATCAGGCCACATTCCTTTT
ACACCCCGTGCAAAGAAAGTTTTGGAATTATCACTTCGCGAAGCGCTACAACTCGGACAT
AACTACATTGGAACCGAACACATTCTTCTTGGCTTAATCCGCGAAGGTGAAGGCGTTGCT
GCGCAAGTTCTTGTAAAACTCGGCGCTGATTTAAATCGAGTTCGTCAACAAGTAATCCAA
CTTCTCTCCGGTTACCAAGGTAAAGAAGCGGTATCTGCGGGCGCACCTGAAGGAACTCCA
GCAACATCACTCGTTCTAGATCAATTTGGAAGAAACCTAACTGTGGCCGCACGTGAAGGA
AAACTCGACCCAGTTATCGGACGCGAGAAGGAAATCGAGCGCGTCATGCAGGTTCTCTCT
CGCCGTACTAAGAACAACCCAGTCCTT

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKGLEALGISLEAVR
SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA
AQVLVKLGADLNRVRQQVIQLLSGYQGKEAVSAGAPEGTPATSLVLDQFGRNLTVAAREG
KLDPVIGREKEIERVMQVLSRRTKNNPVL

Multiple Alignement

PROTOCOL

EBI, CLUSTAL 2.0.12 multiple sequence alignment.


RESULTS ANALYSIS



The beginning of the ORf was not found based on the results of the MSA sequences, once that, in MSA it has the same size and are highly conserved. These results coincide with the results of the protein domains.

Alignment of the MSA is correct and well presented with each alignment separated by a space. we have no certain whether the names are easy to identify, but must be taken into account that GOS_139701 corresponds to the unknown sequence which was placed in the MSA.

We also don´t known if MSA contains repeated sequences but we know that the same alignement contains repeated names, that had to be modified to make the right alignment.


RAW RESULTS

Phylogeny.fr multiple sequence alignment


CLUSTAL FORMAT: MUSCLE (3.7) multiple sequence alignment


F.s._EUN1f      --MDMNKLTEKSREALDAAQARAVHLGHVEVDGEHLLAALLEPPEGLARRLLIASGGDPA
St.vr.DSM       --MDMNRLTQKSQEALQEAQTAAVRMGQTEVDGEHLLLALLDQEDGLIPRLLQGAGREPE
Mi.au.ATCC      --MDPNRLTQKSQEALHDAQTKALRFGHVEVDGEHLLLALLDQPDGLAPRLLAQAGADPD
Sth1_in         ---MFERFTDRARRAMVMAQEEARDHNHPYVGTEHLLLGLISEEESPAVELLAGLGAWRA
T.r.DSM_51      MADKFEKFTERARKVLALAQEEARRFNHNYIGTEHLLLGLVREGEGVAARVLQSMGVQLP
Gl.vo.PCC       ---MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLK
Gu.tht.out      ---MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLK
E.hu.out        ---MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIGPKILKSMGVNLK
Sy.thr.IAM      ---MFSRYTERAQRVIVLAQDEARRLNYDYVGTEHLLLGLIREGEGIAAKALQSLGIQLE
Sa1_in          --------------MVVLAQEEARTLNHNYIGTEHILLGLVHEGEGVAAKALESLGVSPE
Sa.e.NRRL       ---MFERFTERARRVVVLAQEEARTLNHNYIGTEHILLGLVHEGEGVAAKALESLGVSPE
Ac.u.DSM_1      ---MFERFTDRARRVVVLAQDEARALNHNYIGTEHLLLGLIHEGEGVAAKALESMDISLD
B.c.DSM_12      ---MFERFTDRARRVVVLAQEEARLLNHNYIGTEHILLGLIHEGEGVAAKALESLGISLD
m.ac.PHSC2      ---MFERFTDRARRVVVLAQEEAKMLNHNYIGTEHILLGLIHEGEGVAAKALESLGISLD
m2_in           ---MFERFTDRARRVVVLAQEEAKMLNHNYIGTEHILLGLIHEGEGVAAKALESLGISLD
Ar.chlorop      ---MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKALESLSISLD
St.hy.ATCC      ---MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKALESLGISLE
GOS_139701      ---MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKGLEALGISLE
St.av.MA-4      ---MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKALESLGISLE
My.tu.KZN       ---MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLE
My.l.in         ---MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIPEGEGVAAKSLDSLGISLE
                               :  **  *   .   :. *::* .*:    .     *   .    

F.s._EUN1f      AVTEAVESELRRRPKVSG-PGARPGEVYVTQRLSRLL-DTASREAGRLKDEYVSIEHLLL
St.vr.DSM       ELRAAVREELSRRPKVTG-PGAAPGQVFVTQRLSRLL-DAAEREAKRLKDEYVSVEHLLL
Mi.au.ATCC      QLRNSVEGELGRRPRVSG-PGAQPGQVFVTQRLSRLL-DAADREAKRLKDEYVSVEHLLL
Sth1_in         GIRDRVERALTR-----G-TEPPRGHLRLTPETKRAL-EDAQRESVQLGTDYIGPEHLLL
T.r.DSM_51      KVRSAVEFIIGR-----G-ESTVVGEIGLTPRARKVI-EYAVDEARRLGHHYIGTEHLLL
Gl.vo.PCC       DARIEVEKIIGR-----G-SGFVAVEIPFTPRAKRVL-ELSLEEARQLGHNYIGTEHLLL
Gu.tht.out      DARVEVEKIIGR-----G-SGFVAVEIPFTPRAKRVL-ELSLEEARQLGHNYIGTEHLLL
E.hu.out        DARVEVEKIIGR-----G-SGFVAVEIPFTPRAKRIL-ELSLEEARQLGHNYIGTEHLLL
Sy.thr.IAM      QVRAEVEKMIGK-----G-SASSRGEIGFTPRAKKVMVELAIEEARLLGHNYVGTEHILL
Sa1_in          GVRRQVEEIIGR-----GDQDSPSGNIPFTPRGKKVL-ELSLREALQLGHNYIGTEHILL
Sa.e.NRRL       GVRRQVEEIIGR-----GDQDSPSGNIPFTPRGKKVL-ELSLREALQLGN----------
Ac.u.DSM_1      AVRGQVVEIIGE-----G-QAAPSGHIPFTPRAKKVL-ELSLREALQLGHNYIGTEHILL
B.c.DSM_12      IVRQQVIEIIGE-----G-QQAPTGHIPFTPRAKKVL-ELSLREALQLGHNYIGTEHILL
m.ac.PHSC2      SVREQVQDIIGQ-----G-QQQPTGHIPFTPRAKKVL-ELSLREALQLGHNYIGTEHILL
m2_in           SVREQVQDIIGQ-----G-QQQPTGHIPFTPRAKKVL-ELSLREALQLGHNYIGTEHILL
Ar.chlorop      GVREQVQEIIGQ-----G-QQAPSGHIPFTPRAKKVL-ELSLREALQLGHNYIGTEHILL
St.hy.ATCC      AVRQQVEEIIGQ-----G-QQAPSGHIPFTPRAKKVL-ELSLREALQLGHNYIGTEHILL
GOS_139701      AVRSQVEEIIGQ-----G-QQAPSGHIPFTPRAKKVL-ELSLREALQLGHNYIGTEHILL
St.av.MA-4      AVRQQVEEIIGQ-----G-QQAPSGHIPFTPRAKKVL-ELSLREALQLGHNYIGTEHILL
My.tu.KZN       GVRSQVEEIIGQ-----G-QQAPSGHIPFTPRAKKVL-ELSLREALQLGHNYIGTEHILL
My.l.in         AVRSQVEDIIGQ-----G-QQAPSGHIPFTPRAKKVL-ELSLREALQ-------------
                     *   :       *        : .*    . : : :  *:               

F.s._EUN1f      AL---------------------VDEG---------------------------------
St.vr.DSM       AL---------------------AEEG---------------------------------
Mi.au.ATCC      AL---------------------VEEG---------------------------------
Sth1_in         GLMGQQGTIASAVLGSYGLHLQAVRDGIREPAARDATSSANDFFGRFTDRARQALSEGEK
T.r.DSM_51      GL---------------------VREG---------------------------------
Gl.vo.PCC       GL---------------------IREG---------------------------------
Gu.tht.out      GL---------------------IREG---------------------------------
E.hu.out        GL---------------------IREG---------------------------------
Sy.thr.IAM      GL---------------------IREG---------------------------------
Sa1_in          GL---------------------IREA---------------------------------
Sa.e.NRRL       ------------------------------------------------------------
Ac.u.DSM_1      GL---------------------LREG---------------------------------
B.c.DSM_12      GL---------------------IREG---------------------------------
m.ac.PHSC2      GL---------------------IREG---------------------------------
m2_in           GL---------------------IREG---------------------------------
Ar.chlorop      GL---------------------IREG---------------------------------
St.hy.ATCC      GL---------------------IREG---------------------------------
GOS_139701      GL---------------------IREG---------------------------------
St.av.MA-4      GL---------------------IREG---------------------------------
My.tu.KZN       GL---------------------IREG---------------------------------
My.l.in         ------------------------------------------------------------
                                                                            

F.s._EUN1f      -------------------------QSSAAGRILAHNGLTREKLLT--------------
St.vr.DSM       -------------------------SATAAGRLLKEHGITRDSFLS--------------
Mi.au.ATCC      -------------------------SSSAAGRALKDQGLTRDRLLG--------------
Sth1_in         SARKLNHNHLGTEHILLGLFAVEGVALTALHNLGISHDAVRDQLLRTAGFGTKPPAGPIP
T.r.DSM_51      ----------------------EGIAAGVLESLGVNLEKVRQQVLQ--------------
Gl.vo.PCC       ----------------------EGVAARVLENLGVDLSKVRTQVIR--------------
Gu.tht.out      ----------------------EGVAARVLENLALDLTKVRTQVIR--------------
E.hu.out        ----------------------EGVAARVLENLEVDLSKVRSQIIR--------------
Sy.thr.IAM      ----------------------EGVAAQVLQNLGADLERVRNQVIH--------------
Sa1_in          ----------------------EGVAAQVLVKLDADLDRVRREVNR--------------
Sa.e.NRRL       ------------------------------------------------------------
Ac.u.DSM_1      ----------------------EGVAAQVLTKLGADLSTVRQTVMQ--------------
B.c.DSM_12      ----------------------EGVAAQVLGKLGADLNRVRQQVLQ--------------
m.ac.PHSC2      ----------------------EGVAAQVLVKLGADLNKVRQQVIQ--------------
m2_in           ----------------------EGVAAQVLVKLGADLNKVRQQVIQ--------------
Ar.chlorop      ----------------------EGVAAQVLVKLGADLNRVRQQVIQ--------------
St.hy.ATCC      ----------------------EGVAAQVLVKLGADLNRVRQQVIQ--------------
GOS_139701      ----------------------EGVAAQVLVKLGADLNRVRQQVIQ--------------
St.av.MA-4      ----------------------EGVAAQVLVKLGADLNRVRQQVIQ--------------
My.tu.KZN       ----------------------EGVAAQVLVKLGAELTRVRQQVIQ--------------
My.l.in         ------------------------------------------------------------
                                                                            

F.s._EUN1f      ------------ALTEV-RGNQRVTSA---------NPEATYEALEKYG----------R
St.vr.DSM       ------------ALTQI-RGNQRVTSA---------NPEVAYEALEKYG----------R
Mi.au.ATCC      ------------ALTGI-RGNQRVTSA---------NPEVAYEALDKYG----------R
Sth1_in         FTVRAKKSLEMALKDALTLGHNYIGTEHLLLGLMRESEGAGAQLLRGFAAQHQVRDEVIR
T.r.DSM_51      ------------VLA---QGTAYQQR----------AQQTKTPYLDALG----------F
Gl.vo.PCC       ------------MLGETAEVSAGGNTG-----------RTKTPTLDEFG----------S
Gu.tht.out      ------------LLGDT--AEVSATNG---------QTKGKTPTLEEFG----------S
E.hu.out        ------------SLGES-TDVAAGNSS---------TTRSKTPTLEEFG----------T
Sy.thr.IAM      ------------LLGGV--PHPPAGSSMPGSAKVK-GPKTSTSTLDQFG----------R
Sa1_in          ------------LISDS-------------------------------------------
Sa.e.NRRL       ------------------------------------------------------------
Ac.u.DSM_1      ------------MLSGY-EGKEAVTAG----GPSDKGTPSGSAILDQFG----------R
B.c.DSM_12      ------------LVQGY-QGKEPVAAG----GPTE-GQPSGSAVLDQFG----------R
m.ac.PHSC2      ------------LLGSF-QGKEAVAVG----GNDA-TPDKGSQVLDQFG----------R
m2_in           ------------LLGSF-QGKEAVAVG----GNDA-TPDKGSQVLDQFG----------R
Ar.chlorop      ------------LLSGY-QGKETTGAGVGG-GQPE-GAPAGSVVLDQFG----------R
St.hy.ATCC      ------------LLSGY-QGKEAATAG----GPAE-GTPSTSLVLDQFG----------R
GOS_139701      ------------LLSGY-QGKEAVSA-----GAPE-GTPATSLVLDQFG----------R
St.av.MA-4      ------------LLSGYHQGKESTVEG----GPAE-GTPSTSLVLDQFG----------R
My.tu.KZN       ------------LLSGY-QGKEAAEAGTGGRGGES-GSPSTSLVLDQFG----------R
My.l.in         ------------------------------------------------------------
                                                                            

F.s._EUN1f      DLVAEARDDRLDP-VIGRDSEIRRVVQILSRKTKNNPVLLGDPGVGKTAIVEGLAQRIHR
St.vr.DSM       DLVAEARDGKLDP-VIGRDAEIRRVTQILSRKTKNNPVLIGDPGVGKTAIVEGLAQRIVR
Mi.au.ATCC      DLVADARAGKLDP-VIGRDDEIRRVVQILSRKTKNNPVLIGDPGVGKTAIVEGLAQRVAN
Sth1_in         ILNAPAPAPEPPPVVVGREPEIQRIMQILMRKSRNNALLVGEEGTGRTSIVSGLAQRIAQ
T.r.DSM_51      DLTEAARLGKLDP-VIGRHNEIERVMQILSRRTKNNPALIGEPGVGKTAIVEGLAQRIVA
Gl.vo.PCC       NLTQMAAEGKLDP-VVGREKEIERVIQILGRRTKNNPVLIGEPGVGKTAIAEGLAQRISN
Gu.tht.out      NLTQKAAEGKLDP-VIGRQKEIERVIQILGRRTKNNPILIGEPGVGKTAIAEGLAQRINN
E.hu.out        NLTQKATEGRLDP-VVGRSKEIERVIQILGRRTKNNPVLIGEPGVGKTAVAEGLAQRIAN
Sy.thr.IAM      DLNQMARDGKLDP-VIGREKEIERVIQILTRRTKNNPVLIGEPGVGKTAIAEGLAQRIVD
Sa1_in          ------------------------------------------------------------
Sa.e.NRRL       ------------------------------------------------------------
Ac.u.DSM_1      NLTAAAREGKLDP-VIGRHKEMERVMQILSRRTKNNPVLIGEPGVGKTAVVEGLSQAIVH
B.c.DSM_12      NLTQAAREGKLDP-VIGRETETERVMQVLSRRTKNNPVLVGEPGVGKTAVVEGLAQDIVR
m.ac.PHSC2      NLTQAARDGKLDP-VIGREKEMERVMQILSRRSKNNPVLIGEPGVGKTAVVEGLAIAIVH
m2_in           NLTQAARDGKLDP-VIGREKEMERVMQILSRRSKNNPVLIGEPGVGKTAVVEGLAIAIVH
Ar.chlorop      NLTQAARENKLDP-VIGREQEMERVMQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVR
St.hy.ATCC      NLTQAARESKLDP-VIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVK
GOS_139701      NLTVAAREGKLDP-VIGREKEIERVMQVLSRRTKNNPVL---------------------
St.av.MA-4      NLTQAARESKLDP-VIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVK
My.tu.KZN       NLTAAAMEGKLDP-VIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVH
My.l.in         ------------------------------------------------------------
                                                                            

F.s._EUN1f      GDVPEGLRNRTVFQLDLAALVAGAKYRGEFEERLKAVLSEIKAAEGRILLFVDELHTVVG
St.vr.DSM       GDVPEGLRDKTVFALDMGSLVAGAKYRGEFEERLKAVLSEVKAAQGRILLFVDELHTVVG
Mi.au.ATCC      GDVPEGLRDKTVFSLDMGSLVAGAKYRGEFEERLKAVLSEVKAAEGRILLFVDELHTVVG
Sth1_in         GGVPAGLAEVRLRAVDATT-----------------AARETVEDPDRTVLFVDDVQPWDA
T.r.DSM_51      GDVPEPLQGKRLVALDIGALVAGTKYRGEFEERLKKIVAEVK--ESGTILFIDELHTLVG
Gl.vo.PCC       NDIPDILADKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEIRA-AGNVVLVIDEVHTLIG
Gu.tht.out      RDVPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIIDEIRV-ANNVILVIDEVHTLIG
E.hu.out        RDVPDTLEDKRVVALDIGLLIAGTKYRGEFEERLKKIMDEVRT-ANNIILVIDEVHTLIG
Sy.thr.IAM      GRVPEILKDKRVVALDLASLVAGSKYRGEFEERLKKVLEEIRN-AGNVILFIDELHTIIG
Sa1_in          GEGPE-------------------------------------------------------
Sa.e.NRRL       ------------------------------------------------------------
Ac.u.DSM_1      GDVPETLRDKQLYSLDMGSLVAGSRYRGDFEERLKKVLKEVRT-RGDIILFIDEIHTLVG
B.c.DSM_12      GDVPETLKDKQLYTLDLGALVAGSRYRGDFEERLKKVLKEIRT-RGDIILFIDEIHTLVG
m.ac.PHSC2      GDVPETLKDKQLYSLDLGSLIAGSRYRGDFEERLKKVTKEIRT-RGDIIVFIDEIHTLVG
m2_in           GDVPETLKDKQLYSLDLGSLIAGSRYRGDFEERLKKVTKEIRT-RGDIIVFIDEIHTLVG
Ar.chlorop      GDVPETIKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEIRT-RGDIILFIDEIHTLVG
St.hy.ATCC      GEVPETLKDKHLYTLDLGALVAGSRYRGDFEERLKKVLKEIRT-RGDIILFIDELHTLVG
GOS_139701      ------------------------------------------------------------
St.av.MA-4      GEVPETLKDKHLYTLDLGALVAGSRYRGDFEERLKKVLKEIRT-RGDIILFIDELHTLVG
My.tu.KZN       GEVPETLKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEINT-RGDIILFIDELHTLVG
My.l.in         ------------------------------------------------------------
                                                                            

F.s._EUN1f      A-GAAEGSMDAGNMLKPMLARGELHLIGATTVEEHRRHIESDAAFERRFQPVLVDEPTVE
St.vr.DSM       A-GAAEGAMDAGQMLKPMLARGELHMIGATTLDEYRKHIEKDAALERRFQQVLVDEPSVE
Mi.au.ATCC      AGGGSEGAMDAGNMLKPMLARGELHMIGATTLDEYRKHIEKDAALERRFQPVVVDEPSVE
Sth1_in         D-------------ALRALGRGKPRIIAVTDPGTFTEL----PDLGAYFQTVPVSEPTHD
T.r.DSM_51      A-GAAEGAVDAANILKPALSRGEVQTIGATTLDEYRKYIERDAALERRFQPVIVNEPTVE
Gl.vo.PCC       A-GAAEGAIDAANILKPALARGELQCIGATTLDEYRKHIERDAALERRFQPVMVGEPTVD
Gu.tht.out      A-GAAEGAIDAANILKPALARGEMQCIGATTLEEYRKHIEKDSALERRFQPVMVGEPSVE
E.hu.out        A-GAAEGAIDAANILKPALSRGELQCIGATTIEEYRKHIEKDAALERRFQPVMVGEPTVE
Sy.thr.IAM      A-GAAEGAIDASNILKPALARGELQAIGATTIDEYRKYVEKDAALERRFQPVMVEEPSPE
Sa1_in          ----------------PAEAGARPQAATATTLTS--------------------------
Sa.e.NRRL       ------------------------------------------------------------
Ac.u.DSM_1      A-GAAEGAVDAASILKPMLARGELQTIGATTLEEYRK-IEKDAALERRFQPVTVDQPSIE
B.c.DSM_12      A-GAAEGAIDAASILKPMLARGELQTIGATTLDEYRKYVEKDPALERRFQPITVNEPSLT
m.ac.PHSC2      A-GAAEGAIDAASILKPLLARGELQTIGATTLDEYRKHFEKDAALERRFQSVQVHEPNLP
m2_in           A-GAAEGAIDAASILKPLLARGELQTIGATTLDEYRKHFEKDAALERRFQSVQVHEPNLP
Ar.chlorop      A-GAAEGAIDAASILKPMLARGELQTIGATTLDEYRKHIEKDAALERRFQPIQVKEPSVA
St.hy.ATCC      A-GAAEGAIDAASILKPMLARGELQTIGATTLDEYRKYLEKDAALERRFQPIQVAEPSLP
GOS_139701      ------------------------------------------------------------
St.av.MA-4      A-GAAEGAIDAASILKPMLARGELQTIGATTLDEYKKYLEKDAALERRFQPIQVAEPSLP
My.tu.KZN       A-GAAEGAIDAASILKPKLARGELQTIGATTLDEYRKYIEKDAALERRFQPVQVGEPTVE
My.l.in         ------------------------------------------------------------
                                                                            

F.s._EUN1f      DTISILRGLRERFEIFHGVRIQDGALVAAAVLSHRYISDRFLPDKAIDLVDEACAMLRTD
St.vr.DSM       DTISILRGLRERLEIFHGVKIQDTALVSAATLSHRYITDRFLPDKAIDLVDEACARLRTE
Mi.au.ATCC      DAISILRGLRERLEVFHGVRIQDSALVSAVTLSHRYISDRFLPDKAIDLVDEACAMLRTE
Sth1_in         EAVGILKRLRGEYEAHHQVTITDDALDAAVTLSARHNTGRVLPGKAVEVLDEAGARVR--
T.r.DSM_51      ETIEILKGIRERYEEHHKLKISDEALHAAAVLAARYVTDRFLPDKAIDLVDEAASRVRMY
Gl.vo.PCC       ETIEILRGLRERYEQHHKLKITDEALIAAAQLSDRYISDRYLPDKAIDLVDEAGSRVRLL
Gu.tht.out      ETIEILYGLRDRYEKHHKLVISDEALSAAAKFADQYIADRFLPDKAIDLIDEAGSRVRLM
E.hu.out        ETIEILYGLRDRYERHHKLVISDEALAAAAKFADQYIADRFLPDKAIDLIDEAGSRVRLL
Sy.thr.IAM      DAIQILKGLRDRYEAHHRVEITDAAIEAAVRLSDRYVTDRFLPDKAVDLIDEAASRVRLS
Sa1_in          ------------------------------------------------------------
Sa.e.NRRL       ------------------------------------------------------------
Ac.u.DSM_1      ETIGILNGLRDRYEAFHRVVITDDAIEAAAKLADRYINDRFLPDKAIDLIDEAGARLRIR
B.c.DSM_12      HAIDILKGVRDRYEAHHRVSITDAALVAAATLADRYVNDRYLPDKAIDLIDEAGARLRIR
m.ac.PHSC2      HTINILKGLRDKYESFHKVSITDGAIVAAANLADRYVSDRFLPDKAIDLLDEAGARLRLS
m2_in           HTINILKGLRDKYESFHKVSITDGAIVAAANLADRYVSDRFLPDKAIDLLDEAGARLRLS
Ar.chlorop      HAIEILKGLRDRYEAHHRVTITDGALASAASLAERYISDRFLPDKAIDLIDEAGARLRIR
St.hy.ATCC      HTIEILKGLRDRYEAHHRVSITDSALVAAATLADRYISDRFLPDKAIDLIDEAGSRMRIR
GOS_139701      ------------------------------------------------------------
St.av.MA-4      HTIEILKGLRDRYEAHHRVSITDEALVQAATLADRYVSDRFLPDKAIDLIDEAGSRMRIR
My.tu.KZN       HTIEILKGLRDRYEAHHRVSITDAAMVAAATLADRYINDRFLPDKAIDLIDEAGARMRIR
My.l.in         ------------------------------------------------------------
                                                                            

F.s._EUN1f      IDSMPTALDEITRRVTRLEIEEAALAKESDPASVARLDQLRKELADLRAEADAMRAQWES
St.vr.DSM       IDSMPAELDEITRRVTRLEIEEAALSKETDPASKTRLEELRKELADLRSEADAKHAQWEA
Mi.au.ATCC      IDSQPAELDAASRRLMRLEIEEAALAKEDDPASKARLDQLRKELADLRGEVDAMRAQWQA
Sth1_in         ------------------------------------------------------------
T.r.DSM_51      RSASPPSL----------------------------------------------------
Gl.vo.PCC       SSQLPPAA----------------------------------------------------
Gu.tht.out      NSQLPPAA----------------------------------------------------
E.hu.out        NSQLPPAA----------------------------------------------------
Sy.thr.IAM      TFVAPPNL----------------------------------------------------
Sa1_in          ------------------------------------------------------------
Sa.e.NRRL       ------------------------------------------------------------
Ac.u.DSM_1      RMTAPPEL----------------------------------------------------
B.c.DSM_12      RMTAPPEL----------------------------------------------------
m.ac.PHSC2      ILSAPPEL----------------------------------------------------
m2_in           ILSAPPEL----------------------------------------------------
Ar.chlorop      RMTAPPEL----------------------------------------------------
St.hy.ATCC      RMTAPPDL----------------------------------------------------
GOS_139701      ------------------------------------------------------------
St.av.MA-4      RMTAPPDL----------------------------------------------------
My.tu.KZN       RMTAPPDL----------------------------------------------------
My.l.in         ------------------------------------------------------------
                                                                            

F.s._EUN1f      ERQAIRKVQELREEIEHVRRRADEAERAYDLNTAAELRHGQLPELERRLAAEEERLAGRQ
St.vr.DSM       ERQAIRRVQELRQELEQVRHEAEEAERAYDLNRAAELRYGRLQDLERRLAAEEEQLAAKQ
Mi.au.ATCC      ERQAIRRVQELREEIEQVRVEAEAAERNYDLNTAAELRHGKLPELERRLQAEEERLAAKQ
Sth1_in         ------------------------------------------------------------
T.r.DSM_51      --------KEARRGLESLRRELDAAVASQEFELAAELRERERQLVHRIHELEQHWREEQG
Gl.vo.PCC       --------KELDKELRQILKEKDDAVRGQDYERAGELRDREMEIKSQIRSIAQARKSETA
Gu.tht.out      --------RELDKELREILKQKDEAVRSQDFETAGQLRDREMEIKAQIAAIAHSKKGDEE
E.hu.out        --------KLLDQELRDVLKSKDEAVRNQDFEKAGQLREREMEVRAQINAVIQVSKDPSS
Sy.thr.IAM      --------KELEDKLEEVRKEKEAAVQGQEFEKAARLRDKETKLKEELERQKNEWQ----
Sa1_in          ------------------------------------------------------------
Sa.e.NRRL       ------------------------------------------------------------
Ac.u.DSM_1      --------RAIDDKIAEVKREKEAAIDDQDFERAAALRDDERRLAEERETKEAAWK--SG
B.c.DSM_12      --------RELDDQIAETRRSKESAIDDQDFERAARLRDEEKQLTNRRLDREKAWK--SG
m.ac.PHSC2      --------REFDDKIAEVRGQKEGAIEDQDFEKAASLRDEEKKLLGERLRLEKQWK--SG
m2_in           --------REFDDKIAEVRGQKEGAIEDQDFEKAASLRDEEKKLLGERLRLEKQWK--SG
Ar.chlorop      --------KAMDERIAKLKMEKESAIDAQDFEGAAALRDKEQKMISERSEKERHWK--SG
St.hy.ATCC      --------REFDEKIADVRREKESAIDSQDFEMAAGLRDKEKQLLAAKAKREKEWK--AG
GOS_139701      ------------------------------------------------------------
St.av.MA-4      --------REFDEKIAGVRHDKESAIDSQDFEKAASLRDKEKQLLAAKAKREKEWK--TG
My.tu.KZN       --------REFDEKIAEARREKESAIDAQDFEKAASLRDREKTLVAQRAEREKQWR--SG
My.l.in         ------------------------------------------------------------
                                                                            

F.s._EUN1f      HGQPLLRELVTEEEIADIVSRWTGIPVTRLVEGEREKLLRLDDVLHQRVVGQDEAVSLVA
St.vr.DSM       GENRLLREVVTEEEIAEIVAAWTGVPVARLQEGEREKLLRLDEILRERVIGQDEAVKLVA
Mi.au.ATCC      GERRLLREVVTDDEIAGIVARWTGIPVSRLVEGERQKLLRLDEILHERVVGQDEAVQLVA
Sth1_in         ------------------------------------------------------------
T.r.DSM_51      QEEPI----VTEEDIAQVVSMWTGIPLTRLHTEESERLLHMEEALHERVIGQDEAISTLA
Gl.vo.PCC       NEES---PNVTEEDIAYIVSSWTGVPVSKLTESETEKLLHMEDVLHQRLIGQEEAVKAIS
Gu.tht.out      NTKEV--SVVTEEDIAQIVAAWTGIPVNKMTRSESEKLLQMEETLHGRIIGQDEAVVAVS
E.hu.out        SVPT---PTVTEEDIAQIVAAWTSIPVNKLTKSESEKLLQMEETLHSRIIGQDEAVVAVS
Sy.thr.IAM      QKKVTAKCVVNEEDIATIVSQWTGIPATKLTMDESQRLLNLEKVLHEKVVGQDEAVAAVA
Sa1_in          ------------------------------------------------------------
Sa.e.NRRL       ------------------------------------------------------------
Ac.u.DSM_1      EVEQV--AEVNEELVAEVLAMSTGIPVVKLTEAESAKLLGMEAELHKRIIGQDKAIEALS
B.c.DSM_12      DLDAV--AEVDEELIAEVLAASTGIPVFKLTEEESSRLLRMEDELHKRIVGQEAAVKALS
m.ac.PHSC2      DVGAS--GIVDEGLIAEVLAAATGIPVFKLTEEESSRLIFMEKALHMRVIGQEEAISVLS
m2_in           DVGAS--GIVDEGLIAEVLAAATGIPVFKLTEEESSRLIFMEKALHMRVIGQEEAISVLS
Ar.chlorop      GMDDI--SEVDEDLIAEVLANSTGIPVFKLTEEESSRLLKMEDELHKRVVGQDEAIKALS
St.hy.ATCC      DMDVV--AEVDEELIAEVLATATGIPVFKLTEEESSRLLRMEDELHKRVIGQKDAIKALS
GOS_139701      ------------------------------------------------------------
St.av.MA-4      DMDVV--AEVDGELIAEVLAASTGIPVFKLTEEESSRLLRMEDELHKRVIGQKDAVKALS
My.tu.KZN       DLDVV--AEVDDEQIAEVLGNWTGIPVFKLTEAETTRLLRMEEELHKRIIGQEDAVKAVS
My.l.in         ------------------------------------------------------------
                                                                            

F.s._EUN1f      DAVIRARSGIRDPRRPVGSFIFLGPTGVGKTELARTLSEALFDSEEAMIRIDMSEYQERH
St.vr.DSM       DAIIRARSGIRDPRRPIGSFIFLGPTGVGKTELAKTLARALFDSEDNMVRLDMSEYQERH
Mi.au.ATCC      DAVIRARSGVKDPRRPIGSFLFLGPTGVGKTELAKTLAAALFDTEDNMVRLDMSEYQERH
Sth1_in         ------------------------------------------------------------
T.r.DSM_51      RAVRRARAGLKDPRRPIGTFIFLGPTGVGKTLLARALAEFMFGSEDALIKIDMSEFMERH
Gl.vo.PCC       RAIRRARVGLKNPKRPIASFIFSGPTGVGKTELAKSLATYFFGSEDAMIRLDMSEYMERH
Gu.tht.out      KAIRRARVGLKNPNRPIASFIFSGPTGVGKTELTKALASYFFGSEEAMVRLDMSEYMERH
E.hu.out        RAIRRARVGLKNPNRPIASFLFSGPTGVGKTELTKALATYFFGSEEAMIRLDMSEFMERH
Sy.thr.IAM      RAIRRARAGLKDPKRPIGSFIFLGPTGTGKTHLAKALAEALFGDEDAMVRIDMSEYMERH
Sa1_in          ----------------------SGP-----------------------------------
Sa.e.NRRL       ---------------------TSGP-----------------------------------
Ac.u.DSM_1      KSIRRTRAGLKDPKRPGGSFIFAGPTGVGKTELAKALAEFLFDDEDALIQLDMSEFAEKH
B.c.DSM_12      QAIRRTRAGLKDPKRPGGSFIFAGPTGVGKTLLARTLAEFLFGDEDALIQLDMSEFSEKH
m.ac.PHSC2      KTIRRTRAGLKDPNRPSGSFIFAGPTGVGKTELAKALAEFLFDDESAMISLDMSEYGEKH
m2_in           KTIRRTRAGLKDPNRPSGSFIFAGPTGVGKTELAKALAEFLFDDESAMISLDMSEYGEKH
Ar.chlorop      QAIRRTRAGLKDPKRPGGSFIFAGPTGVGKTELAKALAEFLFGEEDALITLDMSEYSEKH
St.hy.ATCC      QAIRRTRAGLKDPKRPGGSFIFAGPSGVGKTELSKTLAEFLFGDEDAMISLDMSEFSEKH
GOS_139701      ------------------------------------------------------------
St.av.MA-4      KAIRRTRAGLKDPKRPGGSFIFAGPSGVGKTELSRALAEFLFGDEDALISLDMSEFSEKH
My.tu.KZN       KAIRRTRAGLKDPKRPSGSFIFAGPSGVGKTELSKALANFLFGDDDALIQIDMGEFHDRF
My.l.in         ------------------------------------------------------------
                                                                            

F.s._EUN1f      TVSRLIGSPPGYVGYEEGGQLTEAVRRKPYSVILFDEIEKAHPDVFNTLLQVLDDGRLTD
St.vr.DSM       TVSRLMGAPPGYVGYEEGGQLTEAVRRKPYSVVLFDEIEKAHTDVFNTLLQILDDGRITD
Mi.au.ATCC      TVSRLVGAPPGYVGYDEGGQLTEAVRRKPYSVVLFDEVEKAHPDVFNTLLQLLDDGRLTD
Sth1_in         ---------------------------------------------------------MTD
T.r.DSM_51      TVSRLVGAPPGYIGYEEGGQLTEAVRRKPYSVILLDEIEKAHPEAFNILLQIMEDGNLTD
Gl.vo.PCC       TVSKLIGSPPGYVGYNEGGQLTEAVRRRPYTVILFDEIEKAHPDVFNVLLQILEDGRLTD
Gu.tht.out      TVSKLIGSPPGYVGYNEGGQLTESVRRRPYTVVLFDEIEKGHPDVFNLLLQILEDGRLTD
E.hu.out        TVSKLIGSPPGYVGYNEGGQLTEAVRRRPYTVVLFDEVEKAHPDVFNLMLQIFEDGRLTD
Sy.thr.IAM      TTSRLVGAPPGYVGYEEGGQLTEAVRRRPYCVVLLDEIEKAHPEVFNILLQVLEDGRLTE
Sa1_in          ------------------------------------------------------------
Sa.e.NRRL       ------------------------------------------------------------
Ac.u.DSM_1      TVSRLFGAPPGYVGYDEGGQLTEKVRRRPFSVVLFDEVEKAHPDIFNSLLQILEDGHLTD
B.c.DSM_12      TVSRLFGSPPGYVGYEEGGQLTEKVRRRPFSVVLFDEVEKAHADIFNSLLQILEDGRLTD
m.ac.PHSC2      TVSRLFGAPPGFVGFEEGGQLTEKVRRKPFSVVLFDEIEKAHPDIFNSLLQILEEGRLTD
m2_in           TVSRLFGAPPGFVGFEEGGQLTEKVRRKPFSVVLFDEIEKAHPDIFNSLLQILEEGRLTD
Ar.chlorop      TVSRLFGAPPGYVGYEEGGQLTEKVRRRPFSVVLFDEVEKAHADLFNSLLQILEDGRLTD
St.hy.ATCC      TVSRLFGSPPGYVGYEEGGQLTEKVRRKPFSVVLFDEVEKAHPDIFNSLLQILEDGRLTD
GOS_139701      ------------------------------------------------------------
St.av.MA-4      TVSRLFGSPPGYVGYEEGGQLTEKVRRKPFSVVLFDEVEKAHADIFNSLLQILEDGRLTD
My.tu.KZN       TASRLFGAPPGYVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHQEIYNSLLQVLEDGRLTD
My.l.in         ------------------------------------------------------------
                                                                            

F.s._EUN1f      ARGRTVNFTNTVIIMTSNIGSQWLMD-----AVTPDGDIE-------PEARARVMADLRE
St.vr.DSM       AQGRTVDFRNTVIIMTSNIGSEHLLD-----GVTAEGEIK-------PDARALVMGELRG
Mi.au.ATCC      AQGRTVDFRNTVVVMTSNIGSQHLLA-----GVTPDGEIK-------DDARTAVMTELRA
Sth1_in         GAAQTVDARH-----------------------------------------------IAE
T.r.DSM_51      AKGRRVDFRNTILIMTSNIGAELIQR-EGSLGFAVADDPTKKMQADYTAMKDKVLSQLKQ
Gl.vo.PCC       AKGRTVDFKNTLMIMTSNVGSKVIEKGGGGLGFNTAGTEE---EQRYNRISELVKEELKQ
Gu.tht.out      SKGRTVDFKNTLLILTSNVGSKVIEKGGGGLGFDLSEDQT---ESQYGRIKALVNEELKQ
E.hu.out        SKGRVIDFKNTLLIMTSNIGSKVIEKGGGGLGFELGEDQD---NSAYNRIKSLVNEELKQ
Sy.thr.IAM      AKGRTVDFRNTVIIMTSNAGAQAIQG-DKKLGFTVQEDEK----ERYERMKSRVMDEVKR
Sa1_in          ------------------------------------------------------------
Sa.e.NRRL       ------------------------------------------------------------
Ac.u.DSM_1      AQGRVVDFKNTVIIMTTNLGSKDIGK-AVATGFQSTEGGT---M-EYEEMKAHVNRELKS
B.c.DSM_12      SQGRVVDFKNTVIIMTTNLGTRDIAK-GLQTGFQAGGDLS---T-SYERMKAKVNDELKQ
m.ac.PHSC2      GQGRVIDFKNTVIIMTTNLGTKDITA-G-PMGFQVEGDSA---T-SYDRMRGKVVEELKK
m2_in           GQGRVIDFKNTVIIMTTNLGTKDITA-G-PMGFQVEGDSA---T-SYDRMRGKVVEELKK
Ar.chlorop      SQGRVVDFKNTVIIMTTNLGTRDISK-SVATGFQSGTDTQ---T-GYNRMRARVTEELKQ
St.hy.ATCC      SQGRVVDFKNTVIIMTTNLGTRDISK-GFNLGFAAQGDVK---T-GYERMKNKVNEELKQ
GOS_139701      ------------------------------------------------------------
St.av.MA-4      SQGRVVDFKNTVIIMTTNLGTRDISK-GFNLGFAAQGDSK---S-TYERMKNKVADELKR
My.tu.KZN       GQGRTVDFKNTVLIFTSNLGTSDISK-PVGLGFSKGGGEN-----DYERMKQKVNDELKK
My.l.in         ------------------------------------------------------------
                                                                            

F.s._EUN1f      RFRPEFLNRLDEIVLFKPLTLTEIEQVVDLLVEDLRRRLADRQITLKITESARLFIAREG
St.vr.DSM       HFRPEFLNRVDDIVLFKPLGEQQIERIVELQFDELRRRLAERRITVELTEEARELIAHQG
Mi.au.ATCC      HFRPEFLNRVDDIVLFKPLTLPEIERVVDLLVQDLRNRLADRQLTLELTEAARRHVAAEG
Sth1_in         LFADQTADRADRAADGPSVDDRYIWAMS--------------------------------
T.r.DSM_51      TFRPEFLNRIDAVIVFHPLTPEHVRQIVDLELKRIRKQLAEQQIGLEVTDAAKDLLAKRG
Gl.vo.PCC       YFRPEFLNRLDEIIVFHPLTREEVKQIAVIMLREVFARLEEQNMKIEITDAFNRKLIEEG
Gu.tht.out      YFRPEFLNRLDEIIVFRQLTKDEVGEIAEIMLKEVFTRISEKGIQLEVTARFKTHLINEG
E.hu.out        YFRPEFLNRLDEIIVFRQLTKSEVGEIAEIMLKEVFDRISQKGIELAVTDRFKARLIDEG
Sy.thr.IAM      LFRPEFLNRLDEIIIFHSLTKDHLKEIVRLEVKKVADRLKEQGVELTLSDSALEKLVAEG
Sa1_in          ------------------------------------------------------------
Sa.e.NRRL       ------------------------------------------------------------
Ac.u.DSM_1      QFRPEFLNRVDDLIVFPQLTKAEVRQIVDLMIARLDKRLVEQEMTIELTDAAKELLAERG
B.c.DSM_12      HFRPEFLNRVDDVIVFPTLSQEEIFAIVDFEIAKVDKRLADKDMAIEITPAAKALLAEKG
m.ac.PHSC2      HFKPEFLNRVDETIVFPQLSKPELLQIVDLFIKRLSERMMDRDLTVELTVPAKERLIEVG
m2_in           HFKPEFLNRVDETIVFPQLSKPELLQIVDLFIKRLSERMMDRDLTVELTVPAKERLIEVG
Ar.chlorop      HFRPEFLNRVDDVVVFPQLTQDEIIEIVDLFVTRLEKRLKDKDMGIELTSAAKVLLATRG
St.hy.ATCC      HFRPEFLNRVDDTVVFHQLTEEDIIQIVDLMITKVDERLKDRDMGIELSGVAKKLLAKRG
GOS_139701      ------------------------------------------------------------
St.av.MA-4      HFRPEFLNRVDDVVVFPQLTRDDILAIVDLMITKVDERLKDRDMGIELAQSAKELLAQKG
My.tu.KZN       HFRPEFLNRIDDIIVFHQLTREEIIRMVDLMISRVAGQLKSKDMALVLTDAAKALLAKRG
My.l.in         ------------------------------------------------------------
                                                                            

F.s._EUN1f      FDPVFGARPLRRYIQREVETRIGRALVAGDLTDGSRVTVDL---------IEGRLA----
St.vr.DSM       YDPVYGARPLRRYISHEVETLVGRALLRGDVQDGATVRVDV---------QAGELV----
Mi.au.ATCC      FDPVYGARPLRRYLQREVETRIGRALLSGDVTDGSTVVVDH--------TDDAGLT----
Sth1_in         ------------------------------------------------------------
T.r.DSM_51      YDRQFGARPLRRIIQNLIEDPLAEAILAGRFKPGSTVVINV---------RDDLLT----
Gl.vo.PCC       YSATYGARPLRRAIQRMLEDQLAEEILAARLKEGDTVLVDV--------DSDGKPTFI--
Gu.tht.out      YNPIYGARPLRRAVMRLLEDTLSEEFLAEKIKEGDTAVVDV--------DDDGK------
E.hu.out        YNPAYGARPLRRAVMRLLEDSLSEEVLSERLQSGDAAVVDV--------DENGK------
Sy.thr.IAM      YDEKFGARPLRRAIQRLVEDPLSEEMLRQPFKYGEQVYVDT--------DAEGKIVFKR-
Sa1_in          ------------------------------------------------------------
Sa.e.NRRL       ------------------------------------------------------------
Ac.u.DSM_1      FDPVLGARPLRRAIQRDIEDALSEKILFGEIERGQKVIVDA-----QGEGILGEFTFRGE
B.c.DSM_12      YDPVLGARPLRRAIQREIEDQLSEKILFGELKAGQKVTVDA-----VGEGLLGEFTFVGS
m.ac.PHSC2      FDPTLGARPLRRAVQHEVEDALSEKILHGELNAGDHVHVDF---------VDSLFVFTTS
m2_in           FDPTLGARPLRRAVQHEVEDALSEKILHGELNAGDHVHVDF---------VDSLFVFTTS
Ar.chlorop      YDPAMGARPLRRTIQREIEDQLSEKILFGEIHPGDIVVVDV-----EGEGDDAKFTFAGN
St.hy.ATCC      YDPVLGARPLRRTIQREIEDVLSEKILFGELRPGHIVVVDT-----EGEGEEKKFTFRGE
GOS_139701      ------------------------------------------------------------
St.av.MA-4      YDPMLGARPLRRTIQREIEDTLSEKILFGELRPGHIVVVDT-----EGEGETKTFTFRGE
My.tu.KZN       FDPVLGARPLRRTIQREIEDQLSEKILFEEVGPGQVVTVDVDNWDGEGPGEDAVFTFTGT
My.l.in         ------------------------------------------------------------
                                                                            

F.s._EUN1f      -------VTHDVPAMQRG---------------------------
St.vr.DSM       -------VTYDQAEDVKGAQAA-----------------------
Mi.au.ATCC      -------VAWRAPEPASQVV-------------------------
Sth1_in         ---------------------------------------------
T.r.DSM_51      -------IEPAEALSTVS---------------------------
Gl.vo.PCC       -------VKDRTLATAEG---------------------------
Gu.tht.out      -------VKVLLGEKLELVAN------------------------
E.hu.out        -------VQVLTADKFETL--------------------------
Sy.thr.IAM      -------TEPSAESVGVGSGETTQA--------------------
Sa1_in          -------TSPRAPASPSSTR-------------------------
Sa.e.NRRL       -------STSCSA--------------------------------
Ac.u.DSM_1      PWDPKIGSDPLSAEIAAEQEAERTVGSVEGSVVSEAEATTEAHSA
B.c.DSM_12      ---------PRSADAEPVAVGAGPGGTVTDAELPRLD--------
m.ac.PHSC2      -------RQPGLPEKEAAEVEA-----------------------
m2_in           -------RQPGLPEKEAAEVEA-----------------------
Ar.chlorop      -------AKPRIPEIAPSV--------------------------
St.hy.ATCC      -------EKSALPDTPPIESAAGGGPNLSKDA-------------
GOS_139701      ---------------------------------------------
St.av.MA-4      -------EKSALPDVPPIEQATGGDRPGSGTES------------
My.tu.KZN       R------KPPAEPDLAKAGAHSAGGPEPAAR--------------
My.l.in

Protein Domains

PROTOCOL

InterPro, default parameters at EBI


RESULTS ANALYSIS



In raw results, we have a list with 7 domain, some of them overlapping. E-values are quite different, being the highest 1.8e-08 referent to a domain P-loop, containing nucleoside triphosphate hydrolases. The lowest E-value is 2.4e-95 and corresponds to a domain ATP-DEPENDENT CLP PROTEASE.

A low E-value (<10-6) indicates that is very likely that the founded sequence has a biologic meaning.

On the other hand, a high E-value (>10-2) tell us that the sequence was found by chance and has little biologic meaning.

ATP-DEPENDENT CLP PROTEASE domains have better e-value comparative to the lowest e-value. Whereas, domains that are overlapping and integrated, shows on the results a “unintegrated” note. It´s not advisable to use “unintegrated” results because those results where not investigated yet.

In our case, that result was the better result obtained, once it has the most significant e-value (2.4e-95) and is the broader domain which include two similar domains. Also is not advisable use overlapping domains but, again, those domains have most significant e-value among all the other branches.

That domain corresponds to ATP-Dependent CLP Protease.

CLP proteases represents a large family of ATP-dependent proteases that in higher plants,are located in chloroplasts. In Bacillus subtilis, CLP participates in many activities such as sporulation, power cell, stress tolerance and regulation of gene expression.

ATP-Dependent CLP proteases are involved in protein catabolism under optimal conditions and under stress conditions and participates in many crucial regulatory mechanisms.

ATP-Dependent CLP proteases are important both in cyanobacteria or plants for growth and acclimatization to stress.

Proteases have a biochemical function because they have an catalytic action. Ist function is to degrade proteins.

In the schema graph, the area is well represented.




RAW RESULTS

Translation	BE7D561F319A5F19	209	superfamily	SSF81923	Double Clp-N motif	                                     3	140	2.9e-37	T        16-Mar-2010	NULL	            NULL	
Translation	BE7D561F319A5F19	209	superfamily	SSF52540	P-loop containing nucleoside triphosphate hydrolases	162	209	1.8e-08	T	16-Mar-2010	NULL	            NULL	
Translation	BE7D561F319A5F19	209	HMMPanther	PTHR11638:SF19	ATP-DEPENDENT CLP PROTEASE	                   1	209	2.4e-95	T	16-Mar-2010	NULL	            NULL	
Translation	BE7D561F319A5F19	209	HMMPanther	PTHR11638	ATP-DEPENDENT CLP PROTEASE	                            1	209	2.4e-95	T	16-Mar-2010	NULL	            NULL	
Translation	BE7D561F319A5F19	209	HMMPfam	PF02861	Clp_N	                                                       16	68	1.9e-19	T	16-Mar-2010	IPR004176	Clp, N-terminal	Molecular Function: protein binding (GO:0005515), Biological Process: protein metabolic process (GO:0019538)
Translation	BE7D561F319A5F19	209	HMMPfam	PF02861	Clp_N	                                                       92	142	4.9e-19	T	16-Mar-2010	IPR004176	Clp, N-terminal	Molecular Function: protein binding (GO:0005515), Biological Process: protein metabolic process (GO:0019538)
Translation	BE7D561F319A5F19	209	Gene3D	G3DSA:3.40.50.300	no description	                                    162	209	3.7e-11	T	16-Mar-2010	NULL	            NULL

Phylogeny

PROTOCOL


Phylogeny.fr;"a la carte";ProtDist/FastDist + BioNJ


Phylogeny.fr;"a la carte";PhyML



RESULTS ANALYSIS



Identification below to 0,7 of bootstrap using bioNJ

1)0.62

2)0.62

3)0.62

4)0.51

5)0.51

6)0.28

7)0.37

8)0.34

9)0.42

10)0.44

11)0.62


Identification up to 0,7 of bootstrap using PhyML


1)1

2)1

3)0,83

4)0,85

5)0,79

6)0,99

7)0,98

8)0,84

9)0,71



The tree is well presented with the names of species in leaves. The tree was drawn by two methods: NJ and ML. These two methods yielded two identical trees in which outgroups are separated from ingroups. Unknown sequence (GOS_139701) is between ingroups, as expected, indicating that the unknown sequence may belong to the same taxa as the other ingroups next.

You can check that in both trees the unknown sequence is in the same node of the two other taxa: Mycobacterium_leprae_ and Mycobacterium_tuberculosis.

This indicates that the unknown sequence is quite similar to these two taxa.

In the tree produced by NJ, where the node is unknown sequence (GOS_139701) has a value 0.34. This value is not very significant.

In the tree produced by PhyML, the node containing the unknown sequence has a value 0,71. This value is much more significant, ie, sequences are very close.

However, despite this different in the value of the nodes in both trees is possible to verify that the three sequences are in the same node. These figures may indicate that the second method is more accurate.

Then, the taxonomic group is more likely Mycobacterium.



RAW RESULTS


a)BioNJ
                                                                                   
 
                                                                                                        -----0.1---
 
           +----Actinomyces_urogenitalis_DSM_15434_in
           |
       3   |     +marine_actinobacterium_PHSC20C1_1_in
    +------++----+
    |      ||    +marine_actinobacterium_PHSC20C1_2_in
    |      ||
    |     5  +++--Arthrobacter_chlorophenolicus_A6_in
    |       ||
    |       ||
    |     6  ++---Beutenbergia_cavernae_DSM_12333_in
    |        |
    |        |  +Streptomyces_hygroscopicus_ATCC_53653_2_in
  1 |        | |+Streptomyces_avermitilis_MA-4680_in
 +--+      7 | |
 |  |        +-+             +----Saccharopolyspora_erythraea_NRRL_2338_1_in
 |  |          |-------------+
 |  |          |             +Saccharopolyspora_erythraea_NRRL_2338_2_in
 |  |          |
 |  |          |+--GOS_1397010
 |  |          ||
 |  |       8  ++-Mycobacterium_tuberculosis_KZN_1435_in
 |  |           |
 |  |        9  |
 |  |           +----Mycobacterium_leprae_in
 |  |
 |  +-------------------------------------------------------------------------Streptomyces_hygroscopicus_ATCC_53653_1_in
 |
 |                                                            +---------------Frankia_sp._EUN1f_in
 |                                                            |
 |             +----------------------------------------------+  +-------Streptomyces_viridochromogenes_DSM_40736_in
 |        4    |                                              +--+
 |    +--------+                                                 +-------Micromonospora_aurantiaca_ATCC_27029_in
 |    |        |
 |    |        +----------Thermomicrobium_roseum_DSM_5159_out
 |2   |
 +----+
      |                +--Gloeobacter_violaceus_PCC_7421_out
      |+---------------+
      ||               |+--Guillardia_theta_out
      ||            11 ++
   10 ++                +-----Emiliania_huxleyi_out
       |
       +------------Symbiobacterium_thermophilum_IAM_14863_out





b) PhyML

                                                                                                           ----0.2---
 
                                                            +------------------------Frankia_sp._EUN1f_in
            1                                              ++
                                                           |+----Micromonospora_aurantiaca_ATCC_27029_in
 +---------------------------------------------------------+
 |                                                         +--------------Streptomyces_viridochromogenes_DSM_40736_in
 |
 |                     +------------------------------Streptomyces_hygroscopicus_ATCC_53653_1_in
 |                     |
 |                     |
 |                     |                    3-Saccharopolyspora_erythraea_NRRL_2338_1_in
 |                     |                      +--+
 |       2                                      +Saccharopolyspora_erythraea_NRRL_2338_2_in
 +---------------------+                      |
                       |                      |  +Streptomyces_hygroscopicus_ATCC_53653_2_in
                       |                      |  |
                       |                      |  |Streptomyces_avermitilis_MA-4680_in
                       |                      |  |
                       |      4              |  |marine_actinobacterium_PHSC20C1_1_in
                       +----------------------+  | +--+
                                              |  | |  +marine_actinobacterium_PHSC20C1_2_in
                                              |  |++
                                              |  ||+-Arthrobacter_chlorophenolicus_A6_in
                                              |  |+
                                              |  ||
                                              |  ||--Beutenbergia_cavernae_DSM_12333_in
                                              |  ||
                                              |  |+-----Actinomyces_urogenitalis_DSM_15434_in
                                              +--+
                                            5|   |                      +-Gloeobacter_violaceus_PCC_7421_out
                                                 |                 6     |
                                                 |            +-------------+Guillardia_theta_out
                                                 |            |             |
                                                 |    7   |             +--Emiliania_huxleyi_out
                                                 |------------+
                                                 |            |8 +---------------Thermomicrobium_roseum_DSM_5159_out
                                                 |            +----+
                                                 |                 |
                                                 |                 +------Symbiobacterium_thermophilum_IAM_14863_out
                                                 |
                                                 |+-GOS_1397010
                                                 ++
                                           9      +|--Mycobacterium_leprae_in
                                                  |
                                                  +-Mycobacterium_tuberculosis_KZN_1435_in

Taxonomy report

PROTOCOL


BLASTp versus NR, NCBI default parameters apart from "Number of descriptions_1000"



RESULTS ANALYSIS


Selected ingroups corresponds to a domain [high GC Gram+]. On the other hand the selected outgroups are corresponding to domains more distant,such as firmutes, cyanobacterias, planctomycetes, verrucomicrobia.

Multiple alignment were elaborated with found sequence and with ingroups and outgroups.

The selected sequences corresponding to 15 selected ingroups and to 5 selected ingroups.

The sequences corresponding to outgroups were chosen according to thesignificance of the e-value and belong to different domains.

Sequences corresponding to ingroups belong, all of them ,to different domains, and where chosen according to the e-value. As some of the E-values are identical, we have selected sequences with differents e-values, once that,would create a non reliable phylogenetic tree for the sequences. Sequences with a large gradient of similarity are going to be responsable for sequences belonging to a same node in tree.


we have a hit list with 15 ingroups, 5 outgroups and our unknown sequence.


RAW RESULTS

Lineage Report

root
. cellular organisms
. . Bacteria               [bacteria]
. . . Actinobacteria (class) [high GC Gram+]
. . . . Actinobacteridae       [high GC Gram+]
. . . . . Actinomycetales        [high GC Gram+]
. . . . . . Streptomyces           [high GC Gram+]
. . . . . . . Streptomyces hygroscopicus ATCC 53653 ------------------  396  1 hit  [high GC Gram+]       putative ATP-dependent Clp protease [Streptomyces hygroscop
. . . . . . . Streptomyces pristinaespiralis ATCC 25486 ..............  396  2 hits [high GC Gram+]       ATP-dependent Clp protease [Streptomyces pristinaespiralis 
. . . . . . . Streptomyces scabiei 87.22 .............................  395  2 hits [high GC Gram+]       putative Clp family ATP-binding protease [Streptomyces scab
. . . . . . . Streptomyces sviceus ATCC 29083 ........................  395  2 hits [high GC Gram+]       ATP-dependent Clp protease [Streptomyces sviceus ATCC 29083
. . . . . . . Streptomyces griseoflavus Tu4000 .......................  395  1 hit  [high GC Gram+]       Clp-family ATP-binding protease [Streptomyces griseoflavus 
. . . . . . . Streptomyces coelicolor A3(2) ..........................  395  2 hits [high GC Gram+]       Clp-family ATP-binding protease [Streptomyces coelicolor A3
. . . . . . . Streptomyces lividans TK24 .............................  395  3 hits [high GC Gram+]       Clp-family ATP-binding protease [Streptomyces coelicolor A3
. . . . . . . Streptomyces viridochromogenes DSM 40736 ...............  395  1 hit  [high GC Gram+]       ATP-dependent Clp protease [Streptomyces viridochromogenes 
. . . . . . . Streptomyces ghanaensis ATCC 14672 .....................  395  1 hit  [high GC Gram+]       ATP-dependent Clp protease [Streptomyces ghanaensis ATCC 14
. . . . . . . Streptomyces avermitilis MA-4680 .......................  394  4 hits [high GC Gram+]       ATP-dependent Clp protease [Streptomyces avermitilis MA-468
. . . . . . . Streptomyces sp. SPB78 .................................  390  1 hit  [high GC Gram+]       ATP-dependent Clp protease [Streptomyces sp. SPB78]
. . . . . . . Streptomyces sp. SPB74 .................................  390  2 hits [high GC Gram+]       ATP-dependent Clp protease [Streptomyces sp. SPB74] >gi|197
. . . . . . . Streptomyces sp. ACT-1 .................................  390  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Streptomyces sp. ACT-1] >gi|28
. . . . . . . Streptomyces albus J1074 ...............................  390  1 hit  [high GC Gram+]       ATP-dependent Clp protease [Streptomyces albus J1074]
. . . . . . . Streptomyces sp. ACTE ..................................  389  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Streptomyces sp. ACTE] >gi|282
. . . . . . . Streptomyces flavogriseus ATCC 33331 ...................  389  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Streptomyces flavogriseus ATCC
. . . . . . . Streptomyces griseus subsp. griseus NBRC 13350 .........  389  2 hits [high GC Gram+]       putative ATP-dependent Clp protease [Streptomyces griseus s
. . . . . . . Streptomyces clavuligerus ATCC 27064 ...................  389  2 hits [high GC Gram+]       ATP-dependent Clp protease [Streptomyces clavuligerus ATCC 
. . . . . . . Streptomyces tenjimariensis ............................  388  1 hit  [high GC Gram+]       putative Clp-family ATP-binding protease [Streptomyces tenj
. . . . . . . Streptomyces sp. Mg1 ...................................  388  2 hits [high GC Gram+]       clp-family ATP-binding protease [Streptomyces sp. Mg1] >gi|
. . . . . . . Streptomyces sp. C .....................................  387  1 hit  [high GC Gram+]       putative ATP-dependent Clp protease [Streptomyces sp. C]
. . . . . . . Streptomyces roseosporus NRRL 15998 ....................  387  1 hit  [high GC Gram+]       putative ATP-dependent Clp protease [Streptomyces roseospor
. . . . . . . Streptomyces roseosporus NRRL 11379 ....................  387  1 hit  [high GC Gram+]       putative ATP-dependent Clp protease [Streptomyces roseospor
. . . . . . . Streptomyces sp. AA4 ...................................  375  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Streptomyces sp. AA4]
. . . . . . Frankia sp. CcI3 -----------------------------------------  392  2 hits [high GC Gram+]       ATPase AAA-2 [Frankia sp. CcI3] >gi|86569920|gb|ABD13729.1|
. . . . . . Frankia alni ACN14a ......................................  391  2 hits [high GC Gram+]       ATP-dependent protease, Hsp 100, part of multi-chaperone sy
. . . . . . Frankia sp. EuI1c ........................................  391  6 hits [high GC Gram+]       ATPase AAA-2 domain protein [Frankia sp. EuI1c] >gi|2707303
. . . . . . Frankia symbiont of Datisca glomerata ....................  391  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Frankia symbiont of Datisca gl
. . . . . . Frankia sp. EUN1f ........................................  391  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Frankia sp. EUN1f] >gi|2883481
. . . . . . Frankia sp. EAN1pec ......................................  390  2 hits [high GC Gram+]       ATPase [Frankia sp. EAN1pec] >gi|158107460|gb|ABW09657.1| A
. . . . . . Kribbella flavida DSM 17836 ..............................  389  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Kribbella flavida DSM 17836] >
. . . . . . Geodermatophilus obscurus DSM 43160 ......................  388  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Geodermatophilus obscurus DSM 
. . . . . . Acidothermus cellulolyticus 11B ..........................  388  2 hits [high GC Gram+]       ATPase [Acidothermus cellulolyticus 11B] >gi|117647892|gb|A
. . . . . . Thermomonospora curvata DSM 43183 ........................  387  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Thermomonospora curvata DSM 43
. . . . . . Sanguibacter keddieii DSM 10542 ..........................  387  2 hits [high GC Gram+]       ATPase with chaperone activity, ATP-binding subunit [Sangui
. . . . . . Salinispora arenicola CNS-205 ............................  387  4 hits [high GC Gram+]       ATPase [Salinispora arenicola CNS-205] >gi|157919035|gb|ABW
. . . . . . Salinispora tropica CNB-440 ..............................  387  2 hits [high GC Gram+]       ATPase [Salinispora tropica CNB-440] >gi|145306121|gb|ABP56
. . . . . . Nakamurella multipartita DSM 44233 .......................  386  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Nakamurella multipartita DSM 4
. . . . . . Gordonia bronchialis DSM 43247 ...........................  386  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Gordonia bronchialis DSM 43247
. . . . . . Nocardia farcinica IFM 10152 .............................  386  2 hits [high GC Gram+]       putative Clp protease [Nocardia farcinica IFM 10152] >gi|54
. . . . . . Thermobifida fusca YX ....................................  386  2 hits [high GC Gram+]       ATPase [Thermobifida fusca YX] >gi|71917007|gb|AAZ56909.1| 
. . . . . . Streptosporangium roseum DSM 43021 .......................  386  6 hits [high GC Gram+]       class III stress response-related ATPase [Streptosporangium
. . . . . . Saccharomonospora viridis DSM 43017 ......................  386  2 hits [high GC Gram+]       ATPase with chaperone activity, ATP-binding subunit [Saccha
. . . . . . Kineococcus radiotolerans SRS30216 .......................  385  4 hits [high GC Gram+]       ATPase AAA-2 domain protein [Kineococcus radiotolerans SRS3
. . . . . . Rhodococcus jostii RHA1 ..................................  384  2 hits [high GC Gram+]       ATP-binding subunit of ATP-dependent Clp protease [Rhodococ
. . . . . . Jonesia denitrificans DSM 20603 ..........................  383  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Jonesia denitrificans DSM 2060
. . . . . . Rhodococcus opacus B4 ....................................  383  2 hits [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit ClpC [Rhodoc
. . . . . . Saccharopolyspora erythraea NRRL 2338 ....................  382  7 hits [high GC Gram+]       putative ATP-dependent Clp protease [Saccharopolyspora eryt
. . . . . . Rhodococcus erythropolis PR4 .............................  382  2 hits [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit ClpC [Rhodoc
. . . . . . Rhodococcus erythropolis SK121 ...........................  382  2 hits [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit ClpC [Rhodoc
. . . . . . Arthrobacter sp. FB24 ....................................  381  2 hits [high GC Gram+]       ATPase [Arthrobacter sp. FB24] >gi|116608845|gb|ABK01569.1|
. . . . . . Tsukamurella paurometabola DSM 20162 .....................  381  2 hits [high GC Gram+]       ATPase with chaperone activity, ATP-binding subunit [Tsukam
. . . . . . Aeromicrobium marinum DSM 15272 ..........................  380  1 hit  [high GC Gram+]       ATPase [Aeromicrobium marinum DSM 15272]
. . . . . . Arthrobacter aurescens TC1 ...............................  380  2 hits [high GC Gram+]       putative ATP-dependent Clp protease, ATP-binding subunit [A
. . . . . . Xylanimonas cellulosilytica DSM 15894 ....................  378  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Xylanimonas cellulosilytica DS
. . . . . . Arthrobacter chlorophenolicus A6 .........................  378  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Arthrobacter chlorophenolicus 
. . . . . . Mycobacterium kansasii ATCC 12478 ........................  378  1 hit  [high GC Gram+]       ClpC [Mycobacterium kansasii ATCC 12478]
. . . . . . Cellulomonas flavigena DSM 20109 .........................  377  2 hits [high GC Gram+]       ATPase with chaperone activity, ATP-binding subunit [Cellul
. . . . . . Mycobacterium smegmatis str. MC2 155 .....................  376  2 hits [high GC Gram+]       negative regulator of genetic competence ClpC/mecB [Mycobac
. . . . . . Mycobacterium abscessus ATCC 19977 .......................  375  1 hit  [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit [Mycobacteri
. . . . . . Mycobacterium abscessus ..................................  375  1 hit  [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit [Mycobacteri
. . . . . . Actinosynnema mirum DSM 43827 ............................  375  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Actinosynnema mirum DSM 43827]
. . . . . . Mycobacterium sp. JLS ....................................  375  2 hits [high GC Gram+]       ATPase [Mycobacterium sp. JLS] >gi|126237506|gb|ABO00907.1|
. . . . . . Mycobacterium sp. MCS ....................................  374  2 hits [high GC Gram+]       ATPase AAA-2 [Mycobacterium sp. MCS] >gi|119870870|ref|YP_9
. . . . . . Mycobacterium sp. KMS ....................................  374  2 hits [high GC Gram+]       ATPase AAA-2 [Mycobacterium sp. MCS] >gi|119870870|ref|YP_9
. . . . . . Renibacterium salmoninarum ATCC 33209 ....................  374  2 hits [high GC Gram+]       hemolysin [Renibacterium salmoninarum ATCC 33209] >gi|16295
. . . . . . Catenulispora acidiphila DSM 44928 .......................  372  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Catenulispora acidiphila DSM 4
. . . . . . Janibacter sp. HTCC2649 ..................................  372  2 hits [high GC Gram+]       putative ATP-dependent Clp protease [Janibacter sp. HTCC264
. . . . . . Mycobacterium vanbaalenii PYR-1 ..........................  372  2 hits [high GC Gram+]       ATPase [Mycobacterium vanbaalenii PYR-1] >gi|119959124|gb|A
. . . . . . Stackebrandtia nassauensis DSM 44728 .....................  371  1 hit  [high GC Gram+]       ATPase AAA-2 domain protein [Stackebrandtia nassauensis DSM
. . . . . . Mycobacterium tuberculosis KZN 4207 ......................  371  1 hit  [high GC Gram+]       putative ATP-dependent Clp protease ATP-binding subunit [My
. . . . . . Micromonospora aurantiaca ATCC 27029 .....................  371  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Micromonospora aurantiaca ATCC
. . . . . . Micromonospora sp. L5 ....................................  371  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Micromonospora aurantiaca ATCC
. . . . . . Mycobacterium ulcerans Agy99 .............................  371  2 hits [high GC Gram+]       ATP-dependent protease ATP-binding subunit ClpC1 [Mycobacte
. . . . . . Mycobacterium avium subsp. paratuberculosis K-10 .........  371  2 hits [high GC Gram+]       ClpC [Mycobacterium avium subsp. paratuberculosis K-10] >gi
. . . . . . Mycobacterium intracellulare ATCC 13950 ..................  370  1 hit  [high GC Gram+]       ATP-dependent protease ATP-binding subunit ClpC1 [Mycobacte
. . . . . . Mycobacterium marinum M ..................................  370  2 hits [high GC Gram+]       ATP-dependent protease ATP-binding subunit ClpC1 [Mycobacte
. . . . . . Mycobacterium tuberculosis GM 1503 .......................  370  2 hits [high GC Gram+]       ATP-dependent protease ATP-binding subunit clpC1 [Mycobacte
. . . . . . Mycobacterium gilvum PYR-GCK .............................  370  2 hits [high GC Gram+]       ATPase [Mycobacterium gilvum PYR-GCK] >gi|145214508|gb|ABP4
. . . . . . Mycobacterium tuberculosis 94_M4241A .....................  370  1 hit  [high GC Gram+]       ATP-dependent protease ATP-binding subunit clpC1 [Mycobacte
. . . . . . Mycobacterium bovis AF2122/97 ............................  370  2 hits [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit CLPC [Mycoba
. . . . . . Mycobacterium tuberculosis H37Rv .........................  370  2 hits [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit CLPC [Mycoba
. . . . . . Mycobacterium bovis BCG str. Pasteur 1173P2 ..............  370  2 hits [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit CLPC [Mycoba
. . . . . . Mycobacterium tuberculosis H37Ra .........................  370  3 hits [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit CLPC [Mycoba
. . . . . . Mycobacterium tuberculosis F11 ...........................  370  2 hits [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit CLPC [Mycoba
. . . . . . Mycobacterium tuberculosis 02_1987 .......................  370  3 hits [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit CLPC [Mycoba
. . . . . . Mycobacterium bovis BCG str. Tokyo 172 ...................  370  2 hits [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit CLPC [Mycoba
. . . . . . Mycobacterium tuberculosis KZN 1435 ......................  370  2 hits [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit CLPC [Mycoba
. . . . . . Mycobacterium tuberculosis CPHL_A ........................  370  3 hits [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit CLPC [Mycoba
. . . . . . Mycobacterium tuberculosis KZN 605 .......................  370  2 hits [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit CLPC [Mycoba
. . . . . . Mycobacterium tuberculosis ...............................  370  1 hit  [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit CLPC [Mycoba
. . . . . . Mycobacterium bovis ......................................  370  1 hit  [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit CLPC [Mycoba
. . . . . . Mycobacterium tuberculosis CDC1551 .......................  369  2 hits [high GC Gram+]       ATP-dependent Clp protease, ATP-binding subunit ClpC [Mycob
. . . . . . Mycobacterium leprae TN ..................................  369  1 hit  [high GC Gram+]       putative ATP-dependent Clp protease [Mycobacterium leprae T
. . . . . . Mycobacterium leprae Br4923 ..............................  369  2 hits [high GC Gram+]       putative ATP-dependent Clp protease [Mycobacterium leprae T
. . . . . . Mycobacterium leprae .....................................  369  5 hits [high GC Gram+]       putative ATP-dependent Clp protease [Mycobacterium leprae T
. . . . . . Mycobacterium tuberculosis T85 ...........................  369  3 hits [high GC Gram+]       negative regulator of genetic competence ClpC/mecB [Mycobac
. . . . . . Mycobacterium tuberculosis K85 ...........................  368  1 hit  [high GC Gram+]       negative regulator of genetic competence ClpC/mecB [Mycobac
. . . . . . Beutenbergia cavernae DSM 12333 ..........................  367  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Beutenbergia cavernae DSM 1233
. . . . . . Nocardioides sp. JS614 ...................................  363  2 hits [high GC Gram+]       ATPase [Nocardioides sp. JS614] >gi|119535391|gb|ABL80008.1
. . . . . . Actinomyces urogenitalis DSM 15434 .......................  362  2 hits [high GC Gram+]       ATP-dependent protease, ATPase subunit [Actinomyces urogeni
. . . . . . Brevibacterium linens BL2 ................................  360  1 hit  [high GC Gram+]       ATPase [Brevibacterium linens BL2]
. . . . . . Kytococcus sedentarius DSM 20547 .........................  356  2 hits [high GC Gram+]       ATPase with chaperone activity, ATP-binding subunit [Kytoco
. . . . . . Clavibacter michiganensis subsp. michiganensis NCPPB 382 .  353  2 hits [high GC Gram+]       ATP-dependent protease, ATPase subunit [Clavibacter michiga
. . . . . . Clavibacter michiganensis subsp. sepedonicus .............  353  2 hits [high GC Gram+]       Clp family ATP-binding protease [Clavibacter michiganensis 
. . . . . . Corynebacterium amycolatum SK46 ..........................  348  2 hits [high GC Gram+]       ATPase family associated with various cellular activities (
. . . . . . Corynebacterium jeikeium ATCC 43734 ......................  347  2 hits [high GC Gram+]       ATP-dependent Clp protease, ATP-binding subunit ClpC [Coryn
. . . . . . Leifsonia xyli subsp. xyli str. CTCB07 ...................  345  2 hits [high GC Gram+]       ATP-dependent Clp protease, ATP-binding subunit [Leifsonia 
. . . . . . Micrococcus luteus SK58 ..................................  344  2 hits [high GC Gram+]       negative regulator of genetic competence ClpC/MecB [Microco
. . . . . . Corynebacterium jeikeium K411 ............................  344  2 hits [high GC Gram+]       ATP-dependent Clp protease [Corynebacterium jeikeium K411] 
. . . . . . Micromonospora sp. ATCC 39149 ............................  344  4 hits [high GC Gram+]       ATPase [Micromonospora sp. ATCC 39149] >gi|237883242|gb|EEP
. . . . . . Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111 ..  344  4 hits [high GC Gram+]       ATPase with chaperone activity, ATP-binding subunit [Nocard
. . . . . . Brachybacterium faecium DSM 4810 .........................  343  2 hits [high GC Gram+]       ATPase with chaperone activity, ATP-binding subunit [Brachy
. . . . . . Corynebacterium kroppenstedtii DSM 44385 .................  342  2 hits [high GC Gram+]       ATP-dependent Clp protease [Corynebacterium kroppenstedtii 
. . . . . . Kocuria rhizophila DC2201 ................................  341  2 hits [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit ClpC [Kocuri
. . . . . . Corynebacterium efficiens YS-314 .........................  338  4 hits [high GC Gram+]       putative endopeptidase Clp ATP-binding chain C [Corynebacte
. . . . . . Propionibacterium acnes J139 .............................  338  2 hits [high GC Gram+]       negative regulator of genetic competence ClpC/MecB [Propion
. . . . . . Propionibacterium acnes KPA171202 ........................  338  2 hits [high GC Gram+]       Clp family ATP-binding protease [Propionibacterium acnes KP
. . . . . . Propionibacterium acnes SK137 ............................  338  2 hits [high GC Gram+]       Clp family ATP-binding protease [Propionibacterium acnes KP
. . . . . . Propionibacterium acnes SK187 ............................  338  2 hits [high GC Gram+]       Clp family ATP-binding protease [Propionibacterium acnes KP
. . . . . . Propionibacterium acnes J165 .............................  338  2 hits [high GC Gram+]       Clp family ATP-binding protease [Propionibacterium acnes KP
. . . . . . Corynebacterium glutamicum ATCC 13032 ....................  337  4 hits [high GC Gram+]       ATPase with chaperone activity, ATP-binding subunit [Coryne
. . . . . . Corynebacterium matruchotii ATCC 14266 ...................  335  2 hits [high GC Gram+]       negative regulator of genetic competence ClpC/mecB [Coryneb
. . . . . . Corynebacterium matruchotii ATCC 33806 ...................  335  2 hits [high GC Gram+]       hypothetical protein CORMATOL_02157 [Corynebacterium matruc
. . . . . . Micrococcus luteus NCTC 2665 .............................  333  3 hits [high GC Gram+]       ATPase with chaperone activity, ATP-binding subunit [Microc
. . . . . . Corynebacterium diphtheriae NCTC 13129 ...................  332  1 hit  [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit [Corynebacte
. . . . . . Corynebacterium diphtheriae ..............................  332  1 hit  [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit [Corynebacte
. . . . . . Corynebacterium striatum ATCC 6940 .......................  330  2 hits [high GC Gram+]       ATPase with chaperone activity, ATP-binding subunit [Coryne
. . . . . . Corynebacterium glutamicum R .............................  330  2 hits [high GC Gram+]       hypothetical protein cgR_2580 [Corynebacterium glutamicum R
. . . . . . Mycobacterium avium 104 ..................................  330  4 hits [high GC Gram+]       negative regulator of genetic competence ClpC/mecB [Mycobac
. . . . . . Mycobacterium avium subsp. avium ATCC 25291 ..............  330  2 hits [high GC Gram+]       negative regulator of genetic competence ClpC/mecB [Mycobac
. . . . . . Corynebacterium glucuronolyticum ATCC 51867 ..............  328  2 hits [high GC Gram+]       ATP-dependent protease, ATPase subunit [Corynebacterium glu
. . . . . . Corynebacterium glucuronolyticum ATCC 51866 ..............  328  2 hits [high GC Gram+]       ATP-dependent protease, ATPase subunit [Corynebacterium glu
. . . . . . Corynebacterium aurimucosum ATCC 700975 ..................  328  3 hits [high GC Gram+]       ATP-dependent Clp protease [Corynebacterium aurimucosum ATC
. . . . . . Corynebacterium urealyticum DSM 7109 .....................  327  2 hits [high GC Gram+]       ATP-dependent Clp protease [Corynebacterium urealyticum DSM
. . . . . . Mobiluncus curtisii ATCC 43063 ...........................  326  2 hits [high GC Gram+]       ATPase with chaperone activity, ATP-binding subunit [Mobilu
. . . . . . Rothia mucilaginosa ATCC 25296 ...........................  324  2 hits [high GC Gram+]       negative regulator of genetic competence ClpC/mecB [Rothia 
. . . . . . Rothia mucilaginosa DY-18 ................................  324  2 hits [high GC Gram+]       ATPase with chaperone activity, ATP-binding subunit [Rothia
. . . . . . Corynebacterium genitalium ATCC 33030 ....................  322  2 hits [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit [Corynebacte
. . . . . . Actinomyces coleocanis DSM 15436 .........................  320  2 hits [high GC Gram+]       ATPase with chaperone activity, ATP-binding subunit [Actino
. . . . . . Actinomyces sp. oral taxon 848 str. F0332 ................  319  2 hits [high GC Gram+]       negative regulator of genetic competence ClpC/MecB [Actinom
. . . . . . Mobiluncus mulieris ATCC 35243 ...........................  318  2 hits [high GC Gram+]       ATPase with chaperone activity, ATP-binding subunit [Mobilu
. . . . . . Mobiluncus mulieris 28-1 .................................  318  2 hits [high GC Gram+]       ATPase with chaperone activity, ATP-binding subunit [Mobilu
. . . . . . Corynebacterium accolens ATCC 49725 ......................  318  2 hits [high GC Gram+]       ATPase with chaperone activity, ATP-binding subunit [Coryne
. . . . . . Corynebacterium tuberculostearicum SK141 .................  313  2 hits [high GC Gram+]       negative regulator of genetic competence ClpC/mecB [Coryneb
. . . . . . Corynebacterium pseudogenitalium ATCC 33035 ..............  313  2 hits [high GC Gram+]       ATPase with chaperone activity, ATP-binding subunit [Coryne
. . . . . . Tropheryma whipplei str. Twist ...........................  304  2 hits [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit [Tropheryma 
. . . . . . Tropheryma whipplei TW08/27 ..............................  304  2 hits [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit [Tropheryma 
. . . . . . Micromonospora echinospora ...............................  285  2 hits [high GC Gram+]       CalR4 [Micromonospora echinospora]
. . . . . . Actinomyces odontolyticus ATCC 17982 .....................  270  2 hits [high GC Gram+]       hypothetical protein ACTODO_01017 [Actinomyces odontolyticu
. . . . . . Corynebacterium glutamicum ...............................  253  1 hit  [high GC Gram+]       Chain A, The Crystal Structure Of The Probable Atp-Dependen
. . . . . . Corynebacterium lipophiloflavum DSM 44291 ................  235  2 hits [high GC Gram+]       conserved hypothetical protein [Corynebacterium lipophilofl
. . . . . . Mycobacterium tuberculosis EAS054 ........................  214  2 hits [high GC Gram+]       ATP-dependent Clp protease, ATP-binding subunit ClpC [Mycob
. . . . . Bifidobacterium gallicum DSM 20093 -------------------------  295  2 hits [high GC Gram+]       negative regulator of genetic competence ClpC/MecB [Bifidob
. . . . . Bifidobacterium animalis subsp. lactis BB-12 ...............  295  1 hit  [high GC Gram+]       Negative regulator of genetic competence clpC/mecB [Bifidob
. . . . . Bifidobacterium animalis subsp. lactis HN019 ...............  295  2 hits [high GC Gram+]       probable ATP-dependent Clp protease ATP-binding subunit [Bi
. . . . . Bifidobacterium animalis subsp. lactis AD011 ...............  295  2 hits [high GC Gram+]       probable ATP-dependent Clp protease ATP-binding subunit [Bi
. . . . . Bifidobacterium animalis subsp. lactis Bl-04 ...............  295  2 hits [high GC Gram+]       probable ATP-dependent Clp protease ATP-binding subunit [Bi
. . . . . Bifidobacterium animalis subsp. lactis DSM 10140 ...........  295  2 hits [high GC Gram+]       probable ATP-dependent Clp protease ATP-binding subunit [Bi
. . . . . Bifidobacterium animalis subsp. animalis ATCC 25527 ........  295  1 hit  [high GC Gram+]       probable ATP-dependent Clp protease ATP-binding subunit [Bi
. . . . . Bifidobacterium longum subsp. infantis ATCC 15697 ..........  292  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Bifidobacterium longum subsp. 
. . . . . Bifidobacterium breve UCC2003 ..............................  291  1 hit  [high GC Gram+]       ClpC [Bifidobacterium breve UCC2003]
. . . . . Bifidobacterium bifidum NCIMB 41171 ........................  288  1 hit  [high GC Gram+]       ATPase AAA-2 domain protein [Bifidobacterium bifidum NCIMB 
. . . . . Gardnerella vaginalis 409-05 ...............................  287  2 hits [high GC Gram+]       negative regulator of genetic competence ClpC/MecB [Gardner
. . . . . Bifidobacterium longum DJO10A ..............................  285  3 hits [high GC Gram+]       COG0542: ATPases with chaperone activity, ATP-binding subun
. . . . . Bifidobacterium longum subsp. infantis ATCC 55813 ..........  285  2 hits [high GC Gram+]       COG0542: ATPases with chaperone activity, ATP-binding subun
. . . . . Bifidobacterium longum subsp. infantis CCUG 52486 ..........  285  2 hits [high GC Gram+]       COG0542: ATPases with chaperone activity, ATP-binding subun
. . . . . Bifidobacterium longum NCC2705 .............................  285  2 hits [high GC Gram+]       protease [Bifidobacterium longum NCC2705] >gi|23325195|gb|A
. . . . . Gardnerella vaginalis ATCC 14019 ...........................  283  2 hits [high GC Gram+]       ATPase with chaperone activity, ATP-binding subunit [Gardne
. . . . . Bifidobacterium dentium Bd1 ................................  280  2 hits [high GC Gram+]       clpC Negative regulator of genetic competence clpC/mecB [Bi
. . . . . Bifidobacterium dentium ATCC 27678 .........................  280  2 hits [high GC Gram+]       hypothetical protein BIFDEN_02459 [Bifidobacterium dentium 
. . . . . Bifidobacterium adolescentis L2-32 .........................  279  2 hits [high GC Gram+]       hypothetical protein BIFADO_00889 [Bifidobacterium adolesce
. . . . . Bifidobacterium adolescentis ATCC 15703 ....................  279  2 hits [high GC Gram+]       ATP-dependent Clp protease ATP-binding subunit [Bifidobacte
. . . . . Bifidobacterium angulatum DSM 20098 ........................  276  2 hits [high GC Gram+]       hypothetical protein BIFANG_02085 [Bifidobacterium angulatu
. . . . . Bifidobacterium catenulatum DSM 16992 ......................  275  2 hits [high GC Gram+]       hypothetical protein BIFCAT_01876 [Bifidobacterium catenula
. . . . . Bifidobacterium pseudocatenulatum DSM 20438 ................  275  2 hits [high GC Gram+]       hypothetical protein BIFPSEUDO_04381 [Bifidobacterium pseud
. . . . marine actinobacterium PHSC20C1 ------------------------------  346  2 hits [high GC Gram+]       ATP-dependent Clp protease, ATP-binding subunit [marine act
. . . . Acidimicrobium ferrooxidans DSM 10331 ........................  279  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Acidimicrobium ferrooxidans DS
. . . . Conexibacter woesei DSM 14684 ................................  271  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Conexibacter woesei DSM 14684]
. . . . Rubrobacter xylanophilus DSM 9941 ............................  270  2 hits [high GC Gram+]       ATPase AAA-2 [Rubrobacter xylanophilus DSM 9941] >gi|108766
. . . . Eggerthella lenta DSM 2243 ...................................  216  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Eggerthella lenta DSM 2243] >g
. . . . Atopobium rimae ATCC 49626 ...................................  204  2 hits [high GC Gram+]       ClpC ATPase [Atopobium rimae ATCC 49626] >gi|221185681|gb|E
. . . . Atopobium parvulum DSM 20469 .................................  200  2 hits [high GC Gram+]       ATPase AAA-2 domain protein [Atopobium parvulum DSM 20469] 
. . . . Cryptobacterium curtum DSM 15641 .............................  197  2 hits [high GC Gram+]       ATPase with chaperone activity, ATP-binding subunit [Crypto
. . . . Collinsella intestinalis DSM 13280 ...........................  180  2 hits [high GC Gram+]       hypothetical protein COLINT_02895 [Collinsella intestinalis
. . . . Slackia heliotrinireducens DSM 20476 .........................  179  2 hits [high GC Gram+]       ATPase with chaperone activity, ATP-binding subunit [Slacki
. . . . Collinsella stercoris DSM 13279 ..............................  174  4 hits [high GC Gram+]       hypothetical protein COLSTE_01268 [Collinsella stercoris DS
. . . . Slackia exigua ATCC 700122 ...................................  173  2 hits [high GC Gram+]       negative regulator of genetic competence ClpC/MecB [Slackia
. . . Symbiobacterium thermophilum IAM 14863 -------------------------  272  2 hits [firmicutes]          class III stress response-related ATPase [Symbiobacterium t
. . . Thermosinus carboxydivorans Nor1 ...............................  260  2 hits [firmicutes]          ATPase AAA-2 domain protein [Thermosinus carboxydivorans No
. . . Gloeobacter violaceus PCC 7421 .................................  259  2 hits [cyanobacteria]       endopeptidase Clp ATP-binding chain [Gloeobacter violaceus 
. . . Cyanothece sp. PCC 7425 ........................................  259  2 hits [cyanobacteria]       ATPase AAA-2 domain protein [Cyanothece sp. PCC 7425] >gi|2
. . . Ammonifex degensii KC4 .........................................  258  2 hits [firmicutes]          ATPase AAA-2 domain protein [Ammonifex degensii KC4] >gi|26
. . . Cyanothece sp. PCC 7822 ........................................  258  2 hits [cyanobacteria]       ATPase AAA-2 domain protein [Cyanothece sp. PCC 7822] >gi|1
. . . Cyanothece sp. PCC 7424 ........................................  258  4 hits [cyanobacteria]       ATPase AAA-2 domain protein [Cyanothece sp. PCC 7424] >gi|2
. . . Lyngbya sp. PCC 8106 ...........................................  258  4 hits [cyanobacteria]       ATP-dependent Clp protease regulatory subunit [Lyngbya sp. 
. . . Arthrospira platensis str. Paraca ..............................  257  1 hit  [cyanobacteria]       ATPase AAA-2 [Arthrospira platensis str. Paraca]
. . . Synechocystis sp. PCC 6803 .....................................  257  2 hits [cyanobacteria]       ATP-dependent Clp protease regulatory subunit [Synechocysti
. . . Thermosynechococcus elongatus BP-1 .............................  257  2 hits [cyanobacteria]       ATP-dependent Clp protease regulatory subunit [Thermosynech
. . . Acaryochloris marina MBIC11017 .................................  257  2 hits [cyanobacteria]       ATP-dependent protease, ATP-binding subunit ClpC [Acaryochl
. . . Synechococcus elongatus PCC 6301 ...............................  257  2 hits [cyanobacteria]       ATP-dependent Clp protease regulatory subunit ClpC [Synecho
. . . Arthrospira maxima CS-328 ......................................  256  4 hits [cyanobacteria]       Clp domain protein [Arthrospira maxima CS-328] >gi|20949271
. . . Microcystis aeruginosa PCC 7806 ................................  256  1 hit  [cyanobacteria]       clpC [Microcystis aeruginosa PCC 7806]
. . . Microcystis aeruginosa NIES-843 ................................  256  2 hits [cyanobacteria]       ATP-dependent Clp protease ATPase subunit [Microcystis aeru
. . . Synechococcus elongatus PCC 7942 ...............................  256  3 hits [cyanobacteria]       ClpC [Synechococcus elongatus PCC 7942]
. . . Microcoleus chthonoplastes PCC 7420 ............................  255  4 hits [cyanobacteria]       ATPase, AAA family [Microcoleus chthonoplastes PCC 7420] >g
. . . Synechococcus sp. JA-2-3B'a(2-13) ..............................  255  2 hits [cyanobacteria]       Clp protease, ATP-binding subunit ClpC [Synechococcus sp. J
. . . Synechococcus sp. JA-3-3Ab .....................................  255  2 hits [cyanobacteria]       Clp protease, ATP-binding subunit ClpC [Synechococcus sp. J
. . . Paenibacillus sp. oral taxon 786 str. D14 ......................  254  2 hits [firmicutes]          ATPase AAA-2 domain-containing protein [Paenibacillus sp. o
. . . Nodularia spumigena CCY9414 ....................................  254  4 hits [cyanobacteria]       endopeptidase Clp ATP-binding chain [Nodularia spumigena CC
. . . Synechococcus sp. PCC 7002 .....................................  254  2 hits [cyanobacteria]       endopeptidase Clp, ATP-binding chain C, protease regulatory
. . . Paenibacillus sp. JDR-2 ........................................  253  2 hits [firmicutes]          ATPase AAA-2 domain protein [Paenibacillus sp. JDR-2] >gi|2
. . . Synechococcus sp. PCC 7335 .....................................  253  4 hits [cyanobacteria]       ATPase, AAA family [Synechococcus sp. PCC 7335] >gi|1961900
. . . Cyanothece sp. PCC 8802 ........................................  253  4 hits [cyanobacteria]       ATPase AAA-2 domain protein [Cyanothece sp. PCC 8802] >gi|2
. . . Cyanothece sp. PCC 8801 ........................................  253  4 hits [cyanobacteria]       ATPase AAA-2 domain protein [Cyanothece sp. PCC 8801] >gi|2
. . . Trichodesmium erythraeum IMS101 ................................  253  4 hits [cyanobacteria]       ATPase AAA-2 [Trichodesmium erythraeum IMS101] >gi|11016711
. . . Desulfotomaculum reducens MI-1 .................................  253  2 hits [firmicutes]          ATPase [Desulfotomaculum reducens MI-1] >gi|134050758|gb|AB
. . . Prochlorococcus marinus str. NATL2A ............................  252  2 hits [cyanobacteria]       Clp protease ATP-binding subunit [Prochlorococcus marinus s
. . . Prochlorococcus marinus str. NATL1A ............................  252  2 hits [cyanobacteria]       ClpC [Prochlorococcus marinus str. NATL1A] >gi|123961266|gb
. . . Cyanothece sp. ATCC 51142 ......................................  252  2 hits [cyanobacteria]       ATP-dependent Clp protease, regulatory subunit [Cyanothece 
. . . Paenibacillus larvae subsp. larvae BRL-230010 ..................  252  1 hit  [firmicutes]          class III stress response-related ATPase [Paenibacillus lar
. . . Cyanothece sp. CCY0110 .........................................  252  2 hits [cyanobacteria]       ATP-dependent Clp protease regulatory subunit [Cyanothece s
. . . Nostoc sp. PCC 7120 ............................................  251  4 hits [cyanobacteria]       endopeptidase Clp ATP-binding chain [Nostoc sp. PCC 7120] >
. . . Nostoc punctiforme PCC 73102 ...................................  251  4 hits [cyanobacteria]       ATPase [Nostoc punctiforme PCC 73102] >gi|186468476|gb|ACC8
. . . Anabaena variabilis ATCC 29413 .................................  251  4 hits [cyanobacteria]       UvrB/UvrC protein [Anabaena variabilis ATCC 29413] >gi|7570
. . . cyanobacterium UCYN-A ..........................................  251  2 hits [cyanobacteria]       ATPase with chaperone activity, ATP-binding subunit [cyanob
. . . 'Nostoc azollae' 0708 ..........................................  251  4 hits [cyanobacteria]       ATPase AAA-2 domain protein ['Nostoc azollae' 0708] >gi|224
. . . Geobacillus sp. Y412MC10 .......................................  251  2 hits [firmicutes]          ATPase AAA-2 domain protein [Geobacillus sp. Y412MC10] >gi|
. . . Oceanobacillus iheyensis HTE831 ................................  251  2 hits [firmicutes]          ATP-dependent Clp protease [Oceanobacillus iheyensis HTE831
. . . Oceanobacillus iheyensis .......................................  251  1 hit  [firmicutes]          ATP-dependent Clp protease [Oceanobacillus iheyensis HTE831
. . . Cylindrospermopsis raciborskii CS-505 ..........................  251  4 hits [cyanobacteria]       UvrB/UvrC protein [Cylindrospermopsis raciborskii CS-505] >
. . . Raphidiopsis brookii D9 ........................................  251  2 hits [cyanobacteria]       UvrB/UvrC protein [Raphidiopsis brookii D9] >gi|281198797|g
. . . Crocosphaera watsonii WH 8501 ..................................  250  2 hits [cyanobacteria]       UvrB/UvrC protein:AAA ATPase, central region:Clp, N termina
. . . Carboxydothermus hydrogenoformans Z-2901 .......................  249  2 hits [firmicutes]          negative regulator of genetic competence clpC/mecB [Carboxy
. . . Cyanobium sp. PCC 7001 .........................................  249  2 hits [cyanobacteria]       ATPase, AAA family [Cyanobium sp. PCC 7001] >gi|197625633|g
. . . Prochlorococcus marinus subsp. pastoris str. CCMP1986 ..........  249  2 hits [cyanobacteria]       ClpC [Prochlorococcus marinus subsp. pastoris str. CCMP1986
. . . Bacillus cereus AH1134 .........................................  248  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus cereus m1550 ..........................................  248  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus cereus m
. . . Bacillus thuringiensis serovar kurstaki str. T03a001 ...........  248  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus thuringi
. . . Bacillus cereus F65185 .........................................  248  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus thuringi
. . . Bacillus cereus B4264 ..........................................  248  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus thuringiensis serovar huazhongensis BGSC 4BD1 .........  248  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus cereus 172560W ........................................  248  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus cereus ATCC 10876 .....................................  248  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus cereus A
. . . Bacillus cereus AH676 ..........................................  248  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus cereus A
. . . Bacillus cereus ATCC 14579 .....................................  248  2 hits [firmicutes]          negative regulator of genetic competence clpC/mecB [Bacillu
. . . Bacillus thuringiensis serovar pakistani str. T13001 ...........  248  2 hits [firmicutes]          negative regulator of genetic competence clpC/mecB [Bacillu
. . . Bacillus cereus Rock1-15 .......................................  248  2 hits [firmicutes]          negative regulator of genetic competence clpC/mecB [Bacillu
. . . Bacillus cereus BDRD-Cer4 ......................................  248  2 hits [firmicutes]          negative regulator of genetic competence clpC/mecB [Bacillu
. . . Bacillus cereus BDRD-ST24 ......................................  248  2 hits [firmicutes]          negative regulator of genetic competence clpC/mecB [Bacillu
. . . Bacillus mycoides DSM 2048 .....................................  248  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus mycoides
. . . Bacillus cereus AH603 ..........................................  248  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus mycoides
. . . Bacillus weihenstephanensis KBAB4 ..............................  248  2 hits [firmicutes]          ATPase [Bacillus weihenstephanensis KBAB4] >gi|229131089|re
. . . Bacillus cereus BDRD-ST196 .....................................  248  2 hits [firmicutes]          ATPase [Bacillus weihenstephanensis KBAB4] >gi|229131089|re
. . . Bacillus cereus AH621 ..........................................  248  2 hits [firmicutes]          ATPase [Bacillus weihenstephanensis KBAB4] >gi|229131089|re
. . . Prochlorococcus marinus str. MIT 9202 ..........................  248  2 hits [cyanobacteria]       ATPase, AAA family [Prochlorococcus marinus str. MIT 9202] 
. . . Bacillus cereus Rock4-18 .......................................  248  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus cereus R
. . . Bacillus cereus Rock3-29 .......................................  248  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus cereus R
. . . Bacillus cereus Rock3-28 .......................................  248  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus cereus R
. . . Bacillus cereus Rock1-3 ........................................  248  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus cereus R
. . . Bacillus thuringiensis serovar israelensis ATCC 35646 ..........  248  2 hits [firmicutes]          Negative regulator of genetic competence clpC/mecB [Bacillu
. . . Bacillus thuringiensis IBL 4222 ................................  248  2 hits [firmicutes]          Negative regulator of genetic competence clpC/mecB [Bacillu
. . . Alicyclobacillus acidocaldarius LAA1 ...........................  248  2 hits [firmicutes]          ATPase AAA-2 domain protein [Alicyclobacillus acidocaldariu
. . . Bacillus cereus G9842 ..........................................  248  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus thuringiensis IBL 200 .................................  248  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus thuringiensis serovar sotto str. T04001 ...............  248  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Prochlorococcus marinus str. MIT 9215 ..........................  248  2 hits [cyanobacteria]       ClpC [Prochlorococcus marinus str. MIT 9215] >gi|157388134|
. . . Bacillus mycoides Rock3-17 .....................................  248  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus mycoides
. . . Bacillus mycoides Rock1-4 ......................................  248  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus mycoides
. . . Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 ..  248  2 hits [firmicutes]          ATPase AAA-2 domain protein [Alicyclobacillus acidocaldariu
. . . Bacillus cereus Rock3-44 .......................................  248  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus cereus R
. . . Bacillus pseudomycoides DSM 12442 ..............................  248  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus pseudomy
. . . Bacillus thuringiensis serovar berliner ATCC 10792 .............  247  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus thuringi
. . . Bacillus thuringiensis serovar thuringiensis str. T01001 .......  247  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus thuringi
. . . Bacillus thuringiensis Bt407 ...................................  247  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus thuringi
. . . Bacillus cereus AH1273 .........................................  247  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus cereus A
. . . Bacillus cereus AH1272 .........................................  247  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus cereus A
. . . Listeria monocytogenes FSL J2-003 ..............................  247  1 hit  [firmicutes]          endopeptidase Clp ATP-binding chain C [Listeria monocytogen
. . . Bacillus sp. SG-1 ..............................................  247  2 hits [firmicutes]          ClpC [Bacillus sp. SG-1] >gi|148848792|gb|EDL63014.1| ClpC 
. . . Prochlorococcus marinus str. MIT 9312 ..........................  247  2 hits [cyanobacteria]       Clp protease ATP-binding subunit [Prochlorococcus marinus s
. . . Bacillus cereus AH1271 .........................................  247  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus cereus A
. . . Natranaerobius thermophilus JW/NM-WN-LF ........................  247  2 hits [firmicutes]          ATPase AAA-2 domain protein [Natranaerobius thermophilus JW
. . . Bacillus anthracis str. Ames ...................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus cereus ATCC 10987 .....................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus anthracis str. 'Ames Ancestor' ........................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus cereus G9241 ..........................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus anthracis str. Sterne .................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus thuringiensis serovar konkukian str. 97-27 ............  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus anthracis str. A2012 ..................................  247  1 hit  [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus thuringiensis str. Al Hakam ...........................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus anthracis str. A0488 ..................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus anthracis str. A0442 ..................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus anthracis str. A0193 ..................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus anthracis str. A0465 ..................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus anthracis str. A0389 ..................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus anthracis str. A0174 ..................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus anthracis Tsiankovskii-I ..............................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus cereus W ..............................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus cereus NVH0597-99 .....................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus cereus 03BB108 ........................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus cereus H3081.97 .......................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus cereus AH187 ..........................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus cereus AH820 ..........................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus cereus Q1 .............................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus cereus 03BB102 ........................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus anthracis str. CDC 684 ................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1 .......  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus thuringiensis serovar andalousiensis BGSC 4AW1 ........  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus thuringiensis serovar monterrey BGSC 4AJ1 .............  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus thuringiensis serovar tochigiensis BGSC 4Y1 ...........  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus cereus Rock3-42 .......................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus cereus 95/8201 ........................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus cereus BDRD-ST26 ......................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus cereus ATCC 4342 ......................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus cereus BGSC 6E1 .......................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus cereus m1293 ..........................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus anthracis str. A0248 ..................................  247  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus anthracis str. CNEVA-9066 .............................  247  1 hit  [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus anthracis str. A1055 ..................................  247  1 hit  [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus anthracis str. Western North America USA6153 ..........  247  1 hit  [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus anthracis str. Kruger B ...............................  247  1 hit  [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus anthracis str. Vollum .................................  247  1 hit  [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Bacillus anthracis str. Australia 94 ...........................  247  1 hit  [firmicutes]          negative regulator of genetic competence ClpC/MecB [Bacillu
. . . Prochlorococcus marinus str. MIT 9515 ..........................  247  2 hits [cyanobacteria]       ClpC [Prochlorococcus marinus str. MIT 9515] >gi|123200778|
. . . Bacillus cereus MM3 ............................................  246  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus cereus M
. . . Synechococcus sp. WH 5701 ......................................  246  2 hits [cyanobacteria]       endopeptidase Clp ATP-binding chain C [Synechococcus sp. WH
. . . Bacillus thuringiensis serovar pulsiensis BGSC 4CC1 ............  246  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus thuringi
. . . Bacillus selenitireducens MLS10 ................................  246  2 hits [firmicutes]          ribosomal protein S8 [Bacillus selenitireducens MLS10] >gi|
. . . Prochlorococcus marinus str. MIT 9301 ..........................  246  2 hits [cyanobacteria]       ClpC [Prochlorococcus marinus str. MIT 9301] >gi|126543576|
. . . Bacillus cereus R309803 ........................................  246  2 hits [firmicutes]          Negative regulator of genetic competence [Bacillus cereus R
. . . Prochlorococcus marinus str. MIT 9303 ..........................  246  2 hits [cyanobacteria]       ClpC [Prochlorococcus marinus str. MIT 9303] >gi|123962984|
. . . Listeria monocytogenes EGD-e ...................................  246  2 hits [firmicutes]          endopeptidase Clp ATP-binding chain C [Listeria monocytogen
. . . Listeria monocytogenes str. 1/2a F6854 .........................  246  2 hits [firmicutes]          endopeptidase Clp ATP-binding chain C [Listeria monocytogen
. . . Listeria monocytogenes Finland 1988 ............................  246  1 hit  [firmicutes]          endopeptidase Clp ATP-binding chain C [Listeria monocytogen
. . . Listeria monocytogenes FSL R2-561 ..............................  246  1 hit  [firmicutes]          endopeptidase Clp ATP-binding chain C [Listeria monocytogen
. . . Listeria monocytogenes FSL N3-165 ..............................  246  2 hits [firmicutes]          endopeptidase Clp ATP-binding chain C [Listeria monocytogen
. . . Listeria monocytogenes 10403S ..................................  246  1 hit  [firmicutes]          endopeptidase Clp ATP-binding chain C [Listeria monocytogen
. . . Listeria monocytogenes J0161 ...................................  246  1 hit  [firmicutes]          endopeptidase Clp ATP-binding chain C [Listeria monocytogen
. . . Listeria monocytogenes J2818 ...................................  246  1 hit  [firmicutes]          endopeptidase Clp ATP-binding chain C [Listeria monocytogen
. . . Listeria monocytogenes F6900 ...................................  246  2 hits [firmicutes]          endopeptidase Clp ATP-binding chain C [Listeria monocytogen
. . . Listeria monocytogenes 08-5578 .................................  246  2 hits [firmicutes]          endopeptidase Clp ATP-binding chain C [Listeria monocytogen
. . . Listeria monocytogenes 08-5923 .................................  246  2 hits [firmicutes]          endopeptidase Clp ATP-binding chain C [Listeria monocytogen
. . . Listeria welshimeri serovar 6b str. SLCC5334 ...................  246  2 hits [firmicutes]          ClpB ATPase [Listeria welshimeri serovar 6b str. SLCC5334] 
. . . Dethiobacter alkaliphilus AHT 1 ................................  246  2 hits [firmicutes]          ATPase AAA-2 domain protein [Dethiobacter alkaliphilus AHT 
. . . Listeria monocytogenes HCC23 ...................................  246  2 hits [firmicutes]          negative regulator of genetic competence ClpC/mecB [Listeri
. . . Listeria monocytogenes FSL N1-017 ..............................  246  1 hit  [firmicutes]          negative regulator of genetic competence ClpC/mecB [Listeri
. . . Listeria monocytogenes FSL J2-071 ..............................  246  2 hits [firmicutes]          negative regulator of genetic competence ClpC/mecB [Listeri
. . . Listeria monocytogenes FSL J1-175 ..............................  246  1 hit  [firmicutes]          endopeptidase Clp ATP-binding chain C [Listeria monocytogen
. . . Prochlorococcus marinus str. AS9601 ............................  246  2 hits [cyanobacteria]       ClpC [Prochlorococcus marinus str. AS9601] >gi|123198837|gb
. . . Bacillus subtilis subsp. subtilis str. 168 .....................  246  4 hits [firmicutes]          class III stress response-related ATPase, AAA+ superfamily 
. . . Bacillus subtilis subsp. subtilis str. NCIB 3610 ...............  246  1 hit  [firmicutes]          class III stress response-related ATPase, AAA+ superfamily 
. . . Bacillus subtilis subsp. subtilis str. JH642 ...................  246  1 hit  [firmicutes]          class III stress response-related ATPase, AAA+ superfamily 
. . . Bacillus subtilis subsp. subtilis str. SMY .....................  246  1 hit  [firmicutes]          class III stress response-related ATPase, AAA+ superfamily 
. . . Bacillus subtilis ..............................................  246  5 hits [firmicutes]          class III stress response-related ATPase, AAA+ superfamily 
. . . Listeria monocytogenes FSL R2-503 ..............................  246  2 hits [firmicutes]          ClpC ATPase [Listeria monocytogenes FSL R2-503] >gi|2586068
. . . Listeria monocytogenes str. 4b F2365 ...........................  246  2 hits [firmicutes]          ClpC ATPase [Listeria monocytogenes str. 4b F2365] >gi|4709
. . . Listeria monocytogenes str. 4b H7858 ...........................  246  2 hits [firmicutes]          ClpC ATPase [Listeria monocytogenes str. 4b F2365] >gi|4709
. . . Listeria monocytogenes Clip80459 ...............................  246  2 hits [firmicutes]          ClpC ATPase [Listeria monocytogenes str. 4b F2365] >gi|4709
. . . Listeria monocytogenes FSL J1-194 ..............................  246  1 hit  [firmicutes]          ClpC ATPase [Listeria monocytogenes str. 4b F2365] >gi|4709
. . . Listeria monocytogenes HPB2262 .................................  246  1 hit  [firmicutes]          ClpC ATPase [Listeria monocytogenes str. 4b F2365] >gi|4709
. . . Prochlorococcus marinus subsp. marinus str. CCMP1375 ...........  246  2 hits [cyanobacteria]       Clp protease ATP-binding subunit [Prochlorococcus marinus s
. . . Listeria monocytogenes .........................................  246  1 hit  [firmicutes]          ClpC ATPase [Listeria monocytogenes]
. . . Bacillus cytotoxicus NVH 391-98 ................................  246  2 hits [firmicutes]          ATPase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|15
. . . Prochlorococcus marinus str. MIT 9313 ..........................  246  2 hits [cyanobacteria]       ClpC [Prochlorococcus marinus str. MIT 9313] >gi|33640781|e
. . . Synechococcus sp. WH 8102 ......................................  246  2 hits [cyanobacteria]       endopeptidase Clp ATP-binding chain C [Synechococcus sp. WH
. . . Listeria seeligeri serovar 1/2b str. SLCC3954 ..................  246  2 hits [firmicutes]          ClpC ATPase [Listeria seeligeri serovar 1/2b str. SLCC3954]
. . . Synechococcus sp. RS9916 .......................................  246  2 hits [cyanobacteria]       ATPase [Synechococcus sp. RS9916] >gi|116068350|gb|EAU74102
. . . Listeria innocua Clip11262 .....................................  245  1 hit  [firmicutes]          endopeptidase Clp ATP-binding chain C [Listeria innocua Cli
. . . Listeria innocua ...............................................  245  1 hit  [firmicutes]          endopeptidase Clp ATP-binding chain C [Listeria innocua Cli
. . . Synechococcus sp. CC9605 .......................................  245  2 hits [cyanobacteria]       ATPase [Synechococcus sp. CC9605] >gi|78197611|gb|ABB35376.
. . . Synechococcus sp. RCC307 .......................................  245  2 hits [cyanobacteria]       ATP-dependent Clp protease ATP-binding subunit clpA-like pr
. . . Bacillus pseudofirmus OF4 ......................................  245  2 hits [firmicutes]          class III stress response-related ATPase [Bacillus pseudofi
. . . Prochlorococcus marinus str. MIT 9211 ..........................  245  2 hits [cyanobacteria]       ClpC [Prochlorococcus marinus str. MIT 9211] >gi|159888815|
. . . Synechococcus sp. WH 8109 ......................................  245  2 hits [cyanobacteria]       chaperone protein ClpB 1 [Synechococcus sp. WH 8109] >gi|26
. . . Bacillus cereus E33L ...........................................  245  2 hits [firmicutes]          negative regulator of genetic competence clpC/mecB (ATP-dep
. . . Synechococcus sp. RS9917 .......................................  245  2 hits [cyanobacteria]       endopeptidase Clp ATP-binding chain C [Synechococcus sp. RS
. . . Bacillus cellulosilyticus DSM 2522 .............................  245  2 hits [firmicutes]          ATPase AAA-2 domain protein [Bacillus cellulosilyticus DSM 
. . . Synechococcus sp. CC9311 .......................................  245  2 hits [cyanobacteria]       putative Clp protease, ATP-binding subunit ClpC [Synechococ
. . . Bacillus licheniformis ATCC 14580 ..............................  245  4 hits [firmicutes]          class III stress response-related ATPase [Bacillus lichenif
. . . Bacillus coagulans 36D1 ........................................  244  2 hits [firmicutes]          ATPase AAA-2 domain protein [Bacillus coagulans 36D1] >gi|2
. . . Bacillus amyloliquefaciens FZB42 ...............................  244  2 hits [firmicutes]          ClpC [Bacillus amyloliquefaciens FZB42] >gi|154350455|gb|AB
. . . Bacillus coahuilensis m4-4 .....................................  244  1 hit  [firmicutes]          class III stress response-related ATPase [Bacillus coahuile
. . . Bacillus sp. NRRL B-14911 ......................................  244  2 hits [firmicutes]          class III stress response-related ATPase [Bacillus sp. NRRL
. . . Synechococcus sp. CC9902 .......................................  244  2 hits [cyanobacteria]       ATPase [Synechococcus sp. CC9902] >gi|78169256|gb|ABB26353.
. . . Bacillus halodurans C-125 ......................................  244  2 hits [firmicutes]          class III stress response-related ATPase [Bacillus halodura
. . . Geobacillus sp. Y4.1MC1 ........................................  244  2 hits [firmicutes]          ATPase AAA-2 domain protein [Geobacillus sp. Y4.1MC1] >gi|2
. . . Geobacillus sp. WCH70 ..........................................  244  2 hits [firmicutes]          ATPase AAA-2 domain protein [Geobacillus sp. WCH70] >gi|239
. . . Synechococcus sp. BL107 ........................................  244  2 hits [cyanobacteria]       ATPase [Synechococcus sp. BL107] >gi|116064991|gb|EAU70750.
. . . Geobacillus sp. Y412MC52 .......................................  243  2 hits [firmicutes]          ATPase AAA-2 domain protein [Geobacillus sp. Y412MC52] >gi|
. . . Geobacillus sp. Y412MC61 .......................................  243  2 hits [firmicutes]          ATPase AAA-2 domain protein [Geobacillus sp. Y412MC52] >gi|
. . . Geobacillus kaustophilus HTA426 ................................  243  2 hits [firmicutes]          ATP-dependent Clp protease ATPase subunit [Geobacillus kaus
. . . Thermomicrobium roseum DSM 5159 ................................  242  2 hits [GNS bacteria]        ClpC ATPase [Thermomicrobium roseum DSM 5159] >gi|221155441
. . . Bacillus pumilus SAFR-032 ......................................  242  2 hits [firmicutes]          class III stress response-related ATPase [Bacillus pumilus 
. . . Bacillus pumilus ATCC 7061 .....................................  242  2 hits [firmicutes]          class III stress response-related ATPase [Bacillus pumilus 
. . . Brevibacillus brevis NBRC 100599 ...............................  241  2 hits [firmicutes]          negative regulator of genetic competence [Brevibacillus bre
. . . Bacillus weihenstephanensis ....................................  241  3 hits [firmicutes]          ClpC [Bacillus weihenstephanensis]
. . . Synechococcus sp. WH 7805 ......................................  241  2 hits [cyanobacteria]       ATPase [Synechococcus sp. WH 7805] >gi|88786855|gb|EAR18013
. . . Anoxybacillus flavithermus WK1 .................................  240  2 hits [firmicutes]          Class III stress response-related ATPase, ClpC [Anoxybacill
. . . Thermoanaerobacter tengcongensis MB4 ...........................  239  2 hits [firmicutes]          ATPase with chaperone activity, ATP-binding subunit [Thermo
. . . Carboxydibrachium pacificum DSM 12653 ..........................  239  2 hits [firmicutes]          ATPase with chaperone activity, ATP-binding subunit [Thermo
. . . Listeria grayi DSM 20601 .......................................  239  2 hits [firmicutes]          ClpB ATPase [Listeria grayi DSM 20601] >gi|229312624|gb|EEN
. . . Thermoanaerobacterium thermosaccharolyticum DSM 571 ............  239  2 hits [firmicutes]          ATPase AAA-2 domain protein [Thermoanaerobacterium thermosa
. . . Halothermothrix orenii H 168 ...................................  238  2 hits [firmicutes]          ATPase AAA-2 domain protein [Halothermothrix orenii H 168] 
. . . Candidatus Desulforudis audaxviator MP104C .....................  238  2 hits [firmicutes]          ATPase [Candidatus Desulforudis audaxviator MP104C] >gi|169
. . . Bacillus clausii KSM-K16 .......................................  238  2 hits [firmicutes]          ATP-dependent Clp protease ATP-binding subunit ClpC [Bacill
. . . Geobacillus thermodenitrificans NG80-2 .........................  237  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Geobaci
. . . Geobacillus sp. G11MC16 ........................................  237  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Geobaci
. . . Sphaerobacter thermophilus DSM 20745 ...........................  237  2 hits [GNS bacteria]        ATPase AAA-2 domain protein [Sphaerobacter thermophilus DSM
. . . Exiguobacterium sp. AT1b .......................................  236  2 hits [firmicutes]          ATPase AAA-2 domain protein [Exiguobacterium sp. AT1b] >gi|
. . . Exiguobacterium sibiricum 255-15 ...............................  236  2 hits [firmicutes]          ATPase [Exiguobacterium sibiricum 255-15] >gi|171988633|gb|
. . . Desulfotomaculum acetoxidans DSM 771 ...........................  235  2 hits [firmicutes]          ATPase AAA-2 domain protein [Desulfotomaculum acetoxidans D
. . . Thermoanaerobacter ethanolicus CCSD1 ...........................  235  2 hits [firmicutes]          ATPase AAA-2 domain protein [Thermoanaerobacter ethanolicus
. . . Thermoanaerobacter italicus Ab9 ................................  235  2 hits [firmicutes]          ATPase AAA-2 domain protein [Thermoanaerobacter italicus Ab
. . . Thermoanaerobacter mathranii subsp. mathranii str. A3 ..........  234  2 hits [firmicutes]          ATPase AAA-2 domain protein [Thermoanaerobacter mathranii s
. . . Thermobaculum terrenum ATCC BAA-798 ............................  234  2 hits [bacteria]            ATPase AAA-2 domain protein [Thermobaculum terrenum ATCC BA
. . . Pelotomaculum thermopropionicum SI .............................  234  2 hits [firmicutes]          ATPase with chaperone activity, ATP-binding subunit [Peloto
. . . Thermoanaerobacter pseudethanolicus ATCC 33223 .................  233  2 hits [firmicutes]          ATPase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi
. . . Thermoanaerobacter sp. X514 ....................................  233  2 hits [firmicutes]          ATPase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi
. . . Thermoanaerobacter sp. X513 ....................................  233  2 hits [firmicutes]          ATPase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi
. . . Thermoanaerobacter sp. X561 ....................................  233  2 hits [firmicutes]          ATPase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi
. . . Thermoanaerobacter brockii subsp. finnii Ako-1 .................  233  2 hits [firmicutes]          ATPase AAA-2 domain protein [Thermoanaerobacter brockii sub
. . . Blastopirellula marina DSM 3645 ................................  233  2 hits [planctomycetes]      negative regulator of genetic competence ClpC/MecB [Blastop
. . . Candidatus Kuenenia stuttgartiensis ............................  231  1 hit  [planctomycetes]      strongly similar to negative regulator of genetic competenc
. . . Gemmata obscuriglobus UQM 2246 .................................  230  1 hit  [planctomycetes]      negative regulator of genetic competence ClpC/MecB [Gemmata
. . . Clostridium kluyveri DSM 555 ...................................  229  2 hits [firmicutes]          ClpC [Clostridium kluyveri DSM 555] >gi|146345715|gb|EDK322
. . . Clostridium kluyveri NBRC 12016 ................................  229  2 hits [firmicutes]          hypothetical protein CKR_0156 [Clostridium kluyveri NBRC 12
. . . Pirellula staleyi DSM 6068 .....................................  229  2 hits [planctomycetes]      ATPase AAA-2 domain protein [Pirellula staleyi DSM 6068] >g
. . . Synechococcus sp. WH 7803 ......................................  226  4 hits [cyanobacteria]       ATP-dependent Clp protease ATP-binding subunit clpA-like pr
. . . Planctomyces maris DSM 8797 ....................................  226  2 hits [planctomycetes]      negative regulator of genetic competence ClpC/MecB [Plancto
. . . Selenomonas sputigena ATCC 35185 ...............................  225  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Selenom
. . . Planctomyces limnophilus DSM 3776 ..............................  223  2 hits [planctomycetes]      ATPase with chaperone activity, ATP-binding subunit [Planct
. . . Macrococcus caseolyticus JCSC5402 ..............................  223  2 hits [firmicutes]          truncated stress response-related Clp ATPase ClpC [Macrococ
. . . Heliobacterium modesticaldum Ice1 ..............................  221  2 hits [firmicutes]          clpc ATPase [Heliobacterium modesticaldum Ice1] >gi|1675921
. . . Alkaliphilus metalliredigens QYMF ..............................  221  2 hits [firmicutes]          ATPase [Alkaliphilus metalliredigens QYMF] >gi|149952056|gb
. . . Alkaliphilus oremlandii OhILAs .................................  221  2 hits [firmicutes]          ATPase [Alkaliphilus oremlandii OhILAs] >gi|158139706|gb|AB
. . . Anaerobaculum hydrogeniformans ATCC BAA-1850 ...................  220  2 hits [bacteria]            negative regulator of genetic competence ClpC/MecB [Anaerob
. . . Bacillus sp. B14905 ............................................  220  2 hits [firmicutes]          ATP-dependent Clp protease ATPase subunit [Bacillus sp. B14
. . . Lysinibacillus sphaericus C3-41 ................................  219  2 hits [firmicutes]          negative regulator of genetic competence clpC/mecB [Lysinib
. . . Rhodopirellula baltica SH 1 ....................................  219  2 hits [planctomycetes]      negative regulator of genetic competence ClpC/MecB [Rhodopi
. . . Clostridium cellulovorans 743B .................................  219  2 hits [firmicutes]          ATPase AAA-2 domain protein [Clostridium cellulovorans 743B
. . . Staphylococcus hominis SK119 ...................................  216  2 hits [firmicutes]          negative regulator of genetic competence ClpC/mecB [Staphyl
. . . Syntrophomonas wolfei subsp. wolfei str. Goettingen ............  216  2 hits [firmicutes]          ATPases with chaperone activity, ATP-binding subunit [Syntr
. . . Staphylococcus lugdunensis HKU09-01 ............................  216  2 hits [firmicutes]          ATP-dependent Clp protease, ATP-binding subunit ClpC/Negati
. . . Staphylococcus warneri L37603 ..................................  215  2 hits [firmicutes]          negative regulator of genetic competence ClpC/mecB [Staphyl
. . . Staphylococcus haemolyticus JCSC1435 ...........................  214  3 hits [firmicutes]          endopeptidas Clp ATP-binding chain C [Staphylococcus haemol
. . . Staphylococcus capitis SK14 ....................................  214  2 hits [firmicutes]          ATPase family associated with various cellular activities (
. . . Staphylococcus carnosus subsp. carnosus TM300 ..................  214  2 hits [firmicutes]          ClpC ATPase family protein [Staphylococcus carnosus subsp. 
. . . Clostridium thermocellum ATCC 27405 ............................  214  2 hits [firmicutes]          ATPase AAA-2 [Clostridium thermocellum ATCC 27405] >gi|2560
. . . Clostridium thermocellum DSM 2360 ..............................  214  2 hits [firmicutes]          ATPase AAA-2 [Clostridium thermocellum ATCC 27405] >gi|2560
. . . Clostridium thermocellum JW20 ..................................  214  2 hits [firmicutes]          ATPase AAA-2 [Clostridium thermocellum ATCC 27405] >gi|2560
. . . Staphylococcus aureus A9635 ....................................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus A9635] >gi|257847201|g
. . . Staphylococcus aureus subsp. aureus MW2 ........................  214  3 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus MW2] >gi
. . . Staphylococcus aureus subsp. aureus TCH70 ......................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus MW2] >gi
. . . Staphylococcus aureus RF122 ....................................  214  3 hits [firmicutes]          endopeptidase [Staphylococcus aureus RF122] >gi|282915846|r
. . . Staphylococcus aureus subsp. aureus D139 .......................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus RF122] >gi|282915846|r
. . . Staphylococcus aureus subsp. aureus Mu50 .......................  214  3 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus N315 .......................  214  3 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus MRSA252 ....................  214  3 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus MSSA476 ....................  214  3 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus USA300_FPR3757 .............  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus NCTC 8325 ..................  214  3 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus JH9 ........................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus JH1 ........................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus str. Newman ................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus Mu3 ........................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus USA300_TCH1516 .............  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus str. JKD6008 ...............  214  1 hit  [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus str. JKD6009 ...............  214  1 hit  [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus MN8 ........................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus TCH60 ......................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus USA300_TCH959 ..............  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus TCH130 .....................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus Mu50-omega .................  214  1 hit  [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus A9781 ....................................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus A9763 ....................................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus A9719 ....................................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus A9299 ....................................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus A8115 ....................................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus A6300 ....................................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus A6224 ....................................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus A5948 ....................................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus A5937 ....................................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus ED98 .......................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus A8117 ....................................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus C160 .......................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus Btn1260 ....................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus WW2703/97 ..................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus WBG10049 ...................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus C427 .......................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus A10102 ...................................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus A017934/97 .................  214  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus 132 ........................  214  1 hit  [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus USA300 .....................  214  1 hit  [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus COL ........................  214  1 hit  [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus TW20 .......................  214  1 hit  [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus ST398 ......................  214  1 hit  [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus 04-02981 .................................  214  1 hit  [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus Mu50] >g
. . . Staphylococcus aureus subsp. aureus H19 ........................  214  2 hits [firmicutes]          ATP-dependent Clp protease ATP-binding subunit clpC [Staphy
. . . Staphylococcus aureus A9765 ....................................  214  2 hits [firmicutes]          ATP-dependent Clp protease ATP-binding subunit clpC [Staphy
. . . Staphylococcus aureus subsp. aureus str. CF-Marseille ..........  213  1 hit  [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus str. CF-
. . . Staphylococcus epidermidis BCM-HMP0060 .........................  213  2 hits [firmicutes]          ClpB ATPase [Staphylococcus epidermidis BCM-HMP0060] >gi|28
. . . Staphylococcus epidermidis SK135 ...............................  213  2 hits [firmicutes]          ClpB ATPase [Staphylococcus epidermidis BCM-HMP0060] >gi|28
. . . Staphylococcus epidermidis M23864:W1 ...........................  213  2 hits [firmicutes]          ClpB ATPase [Staphylococcus epidermidis M23864:W1] >gi|2423
. . . Opitutus terrae PB90-1 .........................................  213  2 hits [verrucomicrobia]     ATPase [Opitutus terrae PB90-1] >gi|177841707|gb|ACB75959.1
. . . Staphylococcus aureus subsp. aureus E1410 ......................  213  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus E1410] >
. . . Staphylococcus aureus subsp. aureus 55/2053 ....................  212  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus 55/2053]
. . . Staphylococcus aureus subsp. aureus 65-1322 ....................  212  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus 55/2053]
. . . Staphylococcus aureus subsp. aureus 68-397 .....................  212  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus 55/2053]
. . . Staphylococcus aureus subsp. aureus M876 .......................  212  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus 55/2053]
. . . Staphylococcus aureus subsp. aureus M899 .......................  212  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus 55/2053]
. . . Staphylococcus aureus subsp. aureus C101 .......................  212  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus 55/2053]
. . . Staphylococcus aureus subsp. aureus M1015 ......................  212  1 hit  [firmicutes]          endopeptidase [Staphylococcus aureus subsp. aureus 55/2053]
. . . Clostridium carboxidivorans P7 .................................  212  2 hits [firmicutes]          ATPase AAA-2 domain protein [Clostridium carboxidivorans P7
. . . Verrucomicrobiae bacterium DG1235 ..............................  211  2 hits [verrucomicrobia]     ATPase, AAA family [Verrucomicrobiae bacterium DG1235] >gi|
. . . Staphylococcus aureus D30 ......................................  210  2 hits [firmicutes]          endopeptidase [Staphylococcus aureus D30] >gi|259162307|gb|
. . . Staphylococcus epidermidis ATCC 12228 ..........................  210  3 hits [firmicutes]          endopeptidase [Staphylococcus epidermidis ATCC 12228] >gi|5
. . . Staphylococcus epidermidis RP62A ...............................  210  3 hits [firmicutes]          endopeptidase [Staphylococcus epidermidis ATCC 12228] >gi|5
. . . Staphylococcus epidermidis W23144 ..............................  210  2 hits [firmicutes]          endopeptidase [Staphylococcus epidermidis ATCC 12228] >gi|5
. . . Opitutaceae bacterium TAV2 .....................................  210  2 hits [verrucomicrobia]     ATPase AAA-2 domain protein [Opitutaceae bacterium TAV2] >g
. . . Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 ...  206  3 hits [firmicutes]          putative stress response-related Clp ATPase [Staphylococcus
. . . Chloroflexus aurantiacus J-10-fl ...............................  205  2 hits [GNS bacteria]        ATPase [Chloroflexus aurantiacus J-10-fl] >gi|222525912|ref
. . . Chloroflexus sp. Y-400-fl ......................................  205  2 hits [GNS bacteria]        ATPase [Chloroflexus aurantiacus J-10-fl] >gi|222525912|ref
. . . Anaerocellum thermophilum DSM 6725 .............................  204  2 hits [firmicutes]          ATPase AAA-2 domain protein [Anaerocellum thermophilum DSM 
. . . Gemmatimonas aurantiaca T-27 ...................................  203  2 hits [bacteria]            ATP-dependent Clp protease ATP-binding subunit ClpC [Gemmat
. . . Caldicellulosiruptor saccharolyticus DSM 8903 ..................  203  2 hits [firmicutes]          ATPase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|
. . . Chloroflexus aggregans DSM 9485 ................................  202  2 hits [GNS bacteria]        ATPase AAA-2 domain protein [Chloroflexus aggregans DSM 948
. . . Chthoniobacter flavus Ellin428 .................................  202  2 hits [verrucomicrobia]     Clp domain protein [Chthoniobacter flavus Ellin428] >gi|196
. . . Clostridium tetani E88 .........................................  201  2 hits [firmicutes]          negative regulator of genetic competence mecB/clpC [Clostri
. . . Clostridium cellulolyticum H10 .................................  201  2 hits [firmicutes]          ATPase AAA-2 domain protein [Clostridium cellulolyticum H10
. . . bacterium Ellin514 .............................................  201  2 hits [verrucomicrobia]     ATPase AAA-2 domain protein [bacterium Ellin514] >gi|223890
. . . Dehalococcoides sp. GT .........................................  200  2 hits [GNS bacteria]        ATPase AAA-2 domain protein [Dehalococcoides sp. GT] >gi|28
. . . Clostridium sporogenes ATCC 15579 ..............................  200  2 hits [firmicutes]          hypothetical protein CLOSPO_00059 [Clostridium sporogenes A
. . . Clostridium botulinum Bf .......................................  199  2 hits [firmicutes]          negative regulator of genetic competence MecB/ClpC [Clostri
. . . Clostridium botulinum Ba4 str. 657 .............................  199  2 hits [firmicutes]          negative regulator of genetic competence MecB/ClpC [Clostri
. . . Clostridium botulinum B1 str. Okra .............................  199  2 hits [firmicutes]          negative regulator of genetic competence MecB/ClpC [Clostri
. . . Roseiflexus sp. RS-1 ...........................................  199  2 hits [GNS bacteria]        ATPase [Roseiflexus sp. RS-1] >gi|148567976|gb|ABQ90121.1| 
. . . Clostridium botulinum F str. Langeland .........................  199  2 hits [firmicutes]          negative regulator of genetic competence MecB/ClpC [Clostri
. . . Clostridium botulinum A str. ATCC 3502 .........................  199  2 hits [firmicutes]          negative regulator of genetic competence MecB/ClpC [Clostri
. . . Clostridium botulinum A str. ATCC 19397 ........................  199  2 hits [firmicutes]          negative regulator of genetic competence MecB/ClpC [Clostri
. . . Clostridium botulinum A str. Hall ..............................  199  2 hits [firmicutes]          negative regulator of genetic competence MecB/ClpC [Clostri
. . . Clostridium botulinum A3 str. Loch Maree .......................  199  2 hits [firmicutes]          negative regulator of genetic competence MecB/ClpC [Clostri
. . . Clostridium botulinum NCTC 2916 ................................  199  2 hits [firmicutes]          negative regulator of genetic competence MecB/ClpC [Clostri
. . . Dehalococcoides ethenogenes 195 ................................  199  2 hits [GNS bacteria]        ATP-dependent Clp protease, ATP-binding subunit ClpC [Dehal
. . . Dehalococcoides sp. CBDB1 ......................................  199  2 hits [GNS bacteria]        ATP-dependent Clp protease, ATP-binding subunit [Dehalococc
. . . Clostridium botulinum A2 str. Kyoto ............................  199  2 hits [firmicutes]          negative regulator of genetic competence MecB/ClpC [Clostri
. . . Dehalococcoides sp. VS .........................................  199  2 hits [GNS bacteria]        ATP-dependent Clp protease, ATP-binding subunit [Dehalococc
. . . Dehalococcoides sp. BAV1 .......................................  198  2 hits [GNS bacteria]        ATPase [Dehalococcoides sp. BAV1] >gi|146269651|gb|ABQ16643
. . . Methylacidiphilum infernorum V4 ................................  198  2 hits [verrucomicrobia]     ATP-binding subunits of Clp protease and DnaK/DnaJ chaperon
. . . Roseiflexus castenholzii DSM 13941 .............................  197  2 hits [GNS bacteria]        ATPase [Roseiflexus castenholzii DSM 13941] >gi|156233321|g
. . . Clostridium acetobutylicum ATCC 824 ............................  196  2 hits [firmicutes]          ABC transporter ATPase [Clostridium acetobutylicum ATCC 824
. . . Clostridium papyrosolvens DSM 2782 .............................  192  2 hits [firmicutes]          ATPase AAA-2 domain protein [Clostridium papyrosolvens DSM 
. . . Elusimicrobium minutum Pei191 ..................................  192  2 hits [bacteria]            ATPase [Elusimicrobium minutum Pei191] >gi|186972088|gb|ACC
. . . Thermus aquaticus Y51MC23 ......................................  189  2 hits [bacteria]            ATPase AAA-2 domain protein [Thermus aquaticus Y51MC23] >gi
. . . Moorella thermoacetica ATCC 39073 ..............................  187  2 hits [firmicutes]          ATPases with chaperone activity, ATP-binding subunit [Moore
. . . Thermodesulfovibrio yellowstonii DSM 11347 .....................  187  2 hits [bacteria]            ClpC ATPase [Thermodesulfovibrio yellowstonii DSM 11347] >g
. . . Ethanoligenens harbinense YUAN-3 ...............................  187  2 hits [firmicutes]          ATPase AAA-2 domain protein [Ethanoligenens harbinense YUAN
. . . Dictyoglomus turgidum DSM 6724 .................................  186  2 hits [bacteria]            ATPase AAA-2 domain protein [Dictyoglomus turgidum DSM 6724
. . . Dictyoglomus thermophilum H-6-12 ...............................  186  2 hits [bacteria]            negative regulator of genetic competence ClpC/mecB [Dictyog
. . . Dethiosulfovibrio peptidovorans DSM 11002 ......................  186  2 hits [bacteria]            ATPase AAA-2 domain protein [Dethiosulfovibrio peptidovoran
. . . Akkermansia muciniphila ATCC BAA-835 ...........................  186  2 hits [verrucomicrobia]     ATPase AAA-2 domain protein [Akkermansia muciniphila ATCC B
. . . Veillonella parvula ATCC 17745 .................................  185  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Veillon
. . . Clostridium difficile 630 ......................................  185  2 hits [firmicutes]          ATP-dependent Clp protease [Clostridium difficile 630] >gi|
. . . Clostridium difficile QCD-32g58 ................................  185  1 hit  [firmicutes]          ATP-dependent Clp protease [Clostridium difficile 630] >gi|
. . . Clostridium difficile QCD-66c26 ................................  185  1 hit  [firmicutes]          ATP-dependent Clp protease [Clostridium difficile 630] >gi|
. . . Clostridium difficile CIP 107932 ...............................  185  1 hit  [firmicutes]          ATP-dependent Clp protease [Clostridium difficile 630] >gi|
. . . Clostridium difficile QCD-63q42 ................................  185  1 hit  [firmicutes]          ATP-dependent Clp protease [Clostridium difficile 630] >gi|
. . . Clostridium difficile ATCC 43255 ...............................  185  1 hit  [firmicutes]          ATP-dependent Clp protease [Clostridium difficile 630] >gi|
. . . Clostridium difficile QCD-76w55 ................................  185  1 hit  [firmicutes]          ATP-dependent Clp protease [Clostridium difficile 630] >gi|
. . . Clostridium difficile QCD-97b34 ................................  185  1 hit  [firmicutes]          ATP-dependent Clp protease [Clostridium difficile 630] >gi|
. . . Clostridium difficile QCD-37x79 ................................  185  1 hit  [firmicutes]          ATP-dependent Clp protease [Clostridium difficile 630] >gi|
. . . Veillonella parvula DSM 2008 ...................................  184  2 hits [firmicutes]          ATPase AAA-2 domain protein [Veillonella parvula DSM 2008] 
. . . Meiothermus ruber DSM 1279 .....................................  184  1 hit  [bacteria]            ATPase AAA-2 domain protein [Meiothermus ruber DSM 1279]
. . . Deinococcus geothermalis DSM 11300 .............................  184  2 hits [bacteria]            ATPase AAA-2 [Deinococcus geothermalis DSM 11300] >gi|94555
. . . Clostridium difficile QCD-23m63 ................................  184  1 hit  [firmicutes]          ATP-dependent Clp protease [Clostridium difficile QCD-23m63]
. . . Victivallis vadensis ATCC BAA-548 ..............................  183  2 hits [bacteria]            ATPase AAA-2 domain protein [Victivallis vadensis ATCC BAA-
. . . Mitsuokella multacida DSM 20544 ................................  183  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Mitsuok
. . . Deinococcus radiodurans R1 .....................................  182  2 hits [bacteria]            ATP-dependent Clp protease, ATP-binding subunit ClpC [Deino
. . . Thermotoga neapolitana DSM 4359 ................................  182  2 hits [thermotogales]       ATP-dependent Clp protease, ATPase subunit [Thermotoga neap
. . . Leptospirillum rubarum .........................................  182  1 hit  [bacteria]            putative ATP-dependent Clp protease, ATPase subunit [Leptos
. . . Leptospirillum sp. Group II '5-way CG' .........................  182  1 hit  [bacteria]            putative ATP-dependent Clp protease, ATPase subunit [Leptos
. . . Deinococcus deserti VCD115 .....................................  182  2 hits [bacteria]            putative ATP-dependent Clp protease, ATP-binding subunit Cl
. . . Carnobacterium sp. AT7 .........................................  181  2 hits [firmicutes]          ATP-dependent Clp protease, ATP-binding subunit ClpC [Carno
. . . Peptoniphilus lacrimalis 315-B .................................  180  2 hits [firmicutes]          negative regulator of genetic competence ClpC/MecB [Peptoni
. . . Thermus thermophilus HB27 ......................................  180  2 hits [bacteria]            ATP-dependent Clp protease ATP-binding subunit clpA [Thermu
. . . Thermus thermophilus HB8 .......................................  180  2 hits [bacteria]            ATP-dependent Clp protease ATP-binding subunit clpA [Thermu
. . . Verrucomicrobium spinosum DSM 4136 .............................  177  1 hit  [verrucomicrobia]     negative regulator of genetic competence ClpC/MecB [Verruco
. . . Aquifex aeolicus VF5 ...........................................  177  2 hits [aquificales]         ATP-dependent Clp protease [Aquifex aeolicus VF5] >gi|29837
. . . Bacillus cereus ................................................  176  3 hits [firmicutes]          stress-related ATPase [Bacillus cereus]
. . . Enterococcus faecalis AR01/DG ..................................  176  2 hits [firmicutes]          UvrB/UvrC protein [Enterococcus faecalis AR01/DG] >gi|25715
. . . Leptospirillum ferrodiazotrophum ...............................  176  1 hit  [bacteria]            putative ATP-dependent Clp protease, ATPase subunit [Leptos
. . . Candidatus Protochlamydia amoebophila UWE25 ....................  176  2 hits [chlamydias]          endopeptidase ATP-binding chain clpC [Candidatus Protochlam
. . . Bacteroides capillosus ATCC 29799 ..............................  175  2 hits [CFB group bacteria]  hypothetical protein BACCAP_02681 [Bacteroides capillosus A
. . . Hydrogenivirga sp. 128-5-R1-1 ..................................  175  2 hits [aquificales]         ATP-dependent Clp protease [Hydrogenivirga sp. 128-5-R1-1] 
. . . Thermotoga naphthophila RKU-10 .................................  175  2 hits [thermotogales]       ATPase AAA-2 domain protein [Thermotoga naphthophila RKU-10
. . . Listeria monocytogenes FSL J1-208 ..............................  174  2 hits [firmicutes]          endopeptidase Clp ATP-binding chain C [Listeria monocytogen
. . . Desulfitobacterium hafniense Y51 ...............................  174  2 hits [firmicutes]          hypothetical protein DSY0438 [Desulfitobacterium hafniense 
. . . Desulfitobacterium hafniense DCB-2 .............................  174  2 hits [firmicutes]          hypothetical protein DSY0438 [Desulfitobacterium hafniense 
. . . Enterococcus faecalis Merz96 ...................................  174  2 hits [firmicutes]          UvrB/UvrC protein:AAA ATPase [Enterococcus faecalis Merz96]
. . . Enterococcus faecalis T2 .......................................  174  2 hits [firmicutes]          ATP-dependent Clp protease, ATP-binding subunit [Enterococc
. . . Hydrogenobacter thermophilus TK-6 ..............................  174  2 hits [aquificales]         ATP-dependent Clp protease [Hydrogenobacter thermophilus TK
. . . Thermotoga maritima MSB8 .......................................  174  2 hits [thermotogales]       ATP-dependent Clp protease, ATPase subunit [Thermotoga mari
. . . Thermotoga petrophila RKU-1 ....................................  174  2 hits [thermotogales]       ATPase [Thermotoga petrophila RKU-1] >gi|254484702|ref|ZP_0
. . . Marinitoga piezophila KA3 ......................................  174  2 hits [thermotogales]       ATPase [Thermotoga petrophila RKU-1] >gi|254484702|ref|ZP_0
. . . Thermotoga sp. RQ2 .............................................  174  2 hits [thermotogales]       ATPase [Thermotoga sp. RQ2] >gi|170176050|gb|ACB09102.1| AT
. . . Thermanaerovibrio acidaminovorans DSM 6589 .....................  174  2 hits [bacteria]            ATPase AAA-2 domain protein [Thermanaerovibrio acidaminovor
. . . Enterococcus faecalis ATCC 29200 ...............................  173  2 hits [firmicutes]          ATPase/chaperone ClpC, specificity factor for ClpP protease
. . . Parachlamydia acanthamoebae str. Hall's coccus .................  173  2 hits [chlamydias]          hypothetical protein pah_c207o057 [Parachlamydia acanthamoe
. . . Kosmotoga olearia TBF 19.5.1 ...................................  173  2 hits [thermotogales]       ATPase AAA-2 domain protein [Kosmotoga olearia TBF 19.5.1] 
. . . Clostridium botulinum C str. Eklund ............................  173  2 hits [firmicutes]          negative regulator of genetic competence ClpC/mecB [Clostri
. . Guillardia theta -------------------------------------------------  252  3 hits [cryptomonads]        Clp protease ATP binding subunit [Guillardia theta] >gi|592
. . Rhodomonas salina ................................................  250  2 hits [cryptomonads]        Clp protease ATP binding subunit [Rhodomonas salina] >gi|13
. . Emiliania huxleyi ................................................  245  3 hits [haptophytes]         Clp protease ATP binding subunit [Emiliania huxleyi] >gi|52
. . Porphyra yezoensis ...............................................  241  3 hits [red algae]           Clp protease ATP binding subunit [Porphyra yezoensis] >gi|1
. . Porphyra purpurea ................................................  240  3 hits [red algae]           Clp protease ATP binding subunit [Porphyra purpurea] >gi|17
. . Cyanidioschyzon merolae strain 10D ...............................  236  2 hits [red algae]           Clp protease ATP binding subunit [Cyanidioschyzon merolae s
. . Cyanidium caldarium ..............................................  235  3 hits [red algae]           Clp protease ATP binding subunit [Cyanidium caldarium] >gi|
. . Gracilaria tenuistipitata var. liui ..............................  231  2 hits [red algae]           Clp protease ATP binding subunit [Gracilaria tenuistipitata
. . Paulinella chromatophora .........................................  229  2 hits [cercozoans]          endopeptidase Clp ATP-binding chain C [Paulinella chromatop
. . Cryptomonas paramecium ...........................................  221  2 hits [cryptomonads]        Clp protease ATP binding subunit [Cryptomonas paramecium] >
. . Solanum lycopersicum (tomato) ....................................  216  4 hits [eudicots]            RecName: Full=ATP-dependent Clp protease ATP-binding subuni
. . Populus trichocarpa (black cottonwood) ...........................  213  3 hits [eudicots]            unknown [Populus trichocarpa]
. . Ricinus communis .................................................  211  2 hits [eudicots]            ATP-dependent clp protease, putative [Ricinus communis] >gi
. . Arabidopsis thaliana (thale-cress) ...............................  211  9 hits [eudicots]            CLPC1; ATP binding / ATP-dependent peptidase/ ATPase [Arabi
. . Brassica napus (rapeseeds) .......................................  211  2 hits [eudicots]            RecName: Full=ATP-dependent Clp protease ATP-binding subuni
. . Pisum sativum (peas) .............................................  210  2 hits [eudicots]            RecName: Full=ATP-dependent Clp protease ATP-binding subuni
. . Oryza sativa Japonica Group (Japanese rice) ......................  209 13 hits [monocots]            OSJNBa0039C07.4 [Oryza sativa (japonica cultivar-group)]
. . Oryza sativa Indica Group (Indian rice) ..........................  209  3 hits [monocots]            hypothetical protein OsI_15716 [Oryza sativa Indica Group]
. . Sorghum bicolor (milo) ...........................................  208  2 hits [monocots]            hypothetical protein SORBIDRAFT_06g014590 [Sorghum bicolor]
. . Physcomitrella patens subsp. patens ..............................  207  8 hits [mosses]              predicted protein [Physcomitrella patens subsp. patens] >gi
. . Vitis vinifera (wine grape) ......................................  207  3 hits [eudicots]            unnamed protein product [Vitis vinifera]
. . Zea mays (maize) .................................................  207  1 hit  [monocots]            unknown [Zea mays]
. . Spinacia oleracea ................................................  206  1 hit  [eudicots]            ClpC protease [Spinacia oleracea]
. . Aureoumbra lagunensis ............................................  204  2 hits [pelagophytes]        ATP-dependent clp protease ATP-binding subunit [Aureoumbra 
. . Ostreococcus lucimarinus CCE9901 .................................  204  2 hits [green algae]         chaperone, Hsp100 family, ClpC-type [Ostreococcus lucimarin
. . Micromonas sp. RCC299 ............................................  202  2 hits [green algae]         predicted protein [Micromonas sp. RCC299] >gi|226520820|gb|
. . Micromonas pusilla CCMP1545 ......................................  201  1 hit  [green algae]         predicted protein [Micromonas pusilla CCMP1545]
. . Aureococcus anophagefferens ......................................  198  2 hits [pelagophytes]        ATP-dependent clp protease ATP-binding subunit [Aureococcus
. . Vaucheria litorea ................................................  193  2 hits [yellow-green algae]  caseinolytic-like Clp protease [Vaucheria litorea] >gi|1944
. . Odontella sinensis ...............................................  182  3 hits [diatoms]             Clp protease ATP binding subunit [Odontella sinensis] >gi|1
. . Fucus vesiculosus ................................................  180  1 hit  [brown algae]         ATP-dependent clp protease ATP-binding subunit [Fucus vesic
. . Phaeodactylum tricornutum ........................................  179  2 hits [diatoms]             ATP-dependent clp protease ATP-binding subunit [Phaeodactyl
. . Thalassiosira pseudonana .........................................  179  2 hits [diatoms]             ATP-dependent clp protease ATP-binding subunit [Thalassiosi
. . Ectocarpus siliculosus ...........................................  175  3 hits [brown algae]         ATP-dependent Clp protease ATP-binding subunit clpA homolog
. Mycobacterium phage Myrna ------------------------------------------  243  2 hits [viruses]             gp251 [Mycobacterium phage Myrna] >gi|197311860|gb|ACH62218
. uncultured marine microorganism HF4000_APKG7H23 ....................  237  1 hit  [unclassified]        putative Clp [uncultured marine microorganism HF4000_APKG7H

BLAST

PROTOCOL


BLASTp versus NR, NCBI default parameters apart from "Number of descriptions_1000"



RESULTS ANALYSIS



Hit list is complete and the list of twelve best results is also complete.

The e-value is quite low, as the lowest e-value is 8e-109. That e-value corresponds to the first alignment which has a score _ 396 bits (1017) and identities of 95%. The identities is an indication of the ratio between the total number of identical residues and the total number of residue of alignment.

Identities > 40% it’s a high identity. Identities of 95% between sequences tell us that exists 95 identical aminoacids which means that those sequences have high proximity. Those alignments has an E-value similar, so those sequences have high homology.

The probable function of this protein is a biochemical function with catalytic action.

Protocol is right and was correctly elaborated.


Note that ingroups and outgroups were detected in taxonomy report.

RAW RESULTS

Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|ZP_05516740.1|  putative ATP-dependent Clp protease [Strep...   396    7e-109
ref|ZP_05013969.1|  ATP-dependent Clp protease [Streptomyces p...   396    8e-109
ref|YP_003489580.1|  putative Clp family ATP-binding protease ...   395    2e-108
ref|ZP_05019313.1|  ATP-dependent Clp protease [Streptomyces s...   395    2e-108
ref|ZP_05539687.1|  Clp-family ATP-binding protease [Streptomy...   395    2e-108
ref|NP_627581.1|  Clp-family ATP-binding protease [Streptomyce...   395    2e-108
ref|ZP_05533272.1|  ATP-dependent Clp protease [Streptomyces v...   395    2e-108
ref|ZP_04686696.1|  ATP-dependent Clp protease [Streptomyces g...   395    2e-108
ref|NP_825874.1|  ATP-dependent Clp protease [Streptomyces ave...   394    2e-108
ref|YP_483458.1|  ATPase AAA-2 [Frankia sp. CcI3] >gb|ABD13729...   392    1e-107
ref|YP_716806.1|  ATP-dependent protease, Hsp 100, part of mul...   391    2e-107
ref|ZP_06240151.1|  ATPase AAA-2 domain protein [Frankia sp. E...   391    2e-107
ref|ZP_06475494.1|  ATPase AAA-2 domain protein [Frankia symbi...   391    3e-107
ref|ZP_06414787.1|  ATPase AAA-2 domain protein [Frankia sp. E...   391    3e-107
ref|YP_001504563.1|  ATPase [Frankia sp. EAN1pec] >gb|ABW09657...   390    3e-107
ref|ZP_05488833.1|  ATP-dependent Clp protease [Streptomyces s...   390    5e-107
ref|ZP_04995597.1|  ATP-dependent Clp protease [Streptomyces s...   390    5e-107
ref|ZP_06278571.1|  ATPase AAA-2 domain protein [Streptomyces ...   390    7e-107
ref|ZP_04702819.1|  ATP-dependent Clp protease [Streptomyces a...   390    7e-107
ref|ZP_06275376.1|  ATPase AAA-2 domain protein [Streptomyces ...   389    7e-107
ref|ZP_05803504.1|  ATPase AAA-2 domain protein [Streptomyces ...   389    9e-107
ref|YP_001825630.1|  putative ATP-dependent Clp protease [Stre...   389    9e-107
ref|ZP_05008829.1|  ATP-dependent Clp protease [Streptomyces c...   389    1e-106
ref|YP_003384232.1|  ATPase AAA-2 domain protein [Kribbella fl...   389    1e-106
ref|YP_003407790.1|  ATPase AAA-2 domain protein [Geodermatoph...   388    2e-106
emb|CAH60133.1|  putative Clp-family ATP-binding protease [Str...   388    2e-106
ref|YP_871980.1|  ATPase [Acidothermus cellulolyticus 11B] >gb...   388    2e-106
ref|ZP_05001776.1|  clp-family ATP-binding protease [Streptomy...   388    3e-106
ref|YP_003302040.1|  ATPase AAA-2 domain protein [Thermomonosp...   387    3e-106
ref|ZP_05507295.1|  putative ATP-dependent Clp protease [Strep...   387    3e-106
ref|YP_003313303.1|  ATPase with chaperone activity, ATP-bindi...   387    3e-106
ref|NP_823776.1|  ATP-dependent Clp protease [Streptomyces ave...   387    3e-106
ref|ZP_04694131.1|  putative ATP-dependent Clp protease [Strep...   387    3e-106
ref|YP_001539453.1|  ATPase [Salinispora arenicola CNS-205] >g...   387    4e-106
ref|YP_001161081.1|  ATPase [Salinispora tropica CNB-440] >gb|...   387    5e-106
ref|YP_003200257.1|  ATPase AAA-2 domain protein [Nakamurella ...   386    6e-106
ref|YP_001537044.1|  ATPase [Salinispora arenicola CNS-205] >g...   386    6e-106
ref|YP_003272068.1|  ATPase AAA-2 domain protein [Gordonia bro...   386    8e-106
ref|YP_116621.1|  putative Clp protease [Nocardia farcinica IF...   386    8e-106
ref|YP_290932.1|  ATPase [Thermobifida fusca YX] >gb|AAZ56909....   386    9e-106
ref|YP_003344512.1|  class III stress response-related ATPase ...   386    9e-106
ref|YP_003135329.1|  ATPase with chaperone activity, ATP-bindi...   386    1e-105
ref|YP_001360348.1|  ATPase AAA-2 domain protein [Kineococcus ...   385    2e-105
ref|YP_704367.1|  ATP-binding subunit of ATP-dependent Clp pro...   384    3e-105
ref|YP_003160417.1|  ATPase AAA-2 domain protein [Jonesia deni...   383    7e-105
ref|YP_002781531.1|  ATP-dependent Clp protease ATP-binding su...   383    7e-105
ref|YP_001102688.1|  putative ATP-dependent Clp protease [Sacc...   382    1e-104
ref|YP_002764093.1|  ATP-dependent Clp protease ATP-binding su...   382    1e-104
ref|YP_829669.1|  ATPase [Arthrobacter sp. FB24] >gb|ABK01569....   381    2e-104
ref|ZP_04026227.1|  ATPase with chaperone activity, ATP-bindin...   381    3e-104
ref|ZP_06045929.1|  ATPase [Aeromicrobium marinum DSM 15272]        380    4e-104
ref|YP_945989.1|  putative ATP-dependent Clp protease, ATP-bin...   380    5e-104
ref|ZP_06564200.1|  putative ATP-dependent Clp protease [Sacch...   378    2e-103
ref|YP_003324960.1|  ATPase AAA-2 domain protein [Xylanimonas ...   378    2e-103
ref|YP_002486421.1|  ATPase AAA-2 domain protein [Arthrobacter...   378    2e-103
ref|ZP_04751499.1|  ClpC [Mycobacterium kansasii ATCC 12478]        378    2e-103
ref|ZP_04366940.1|  ATPase with chaperone activity, ATP-bindin...   377    3e-103
ref|YP_890312.1|  negative regulator of genetic competence Clp...   376    8e-103
ref|YP_001701299.1|  ATP-dependent Clp protease ATP-binding su...   375    1e-102
ref|YP_003098150.1|  ATPase AAA-2 domain protein [Actinosynnem...   375    1e-102
ref|ZP_05479902.1|  ATPase AAA-2 domain protein [Streptomyces ...   375    1e-102
ref|ZP_05483697.1|  putative ATP-dependent Clp protease [Strep...   375    2e-102
ref|YP_001073397.1|  ATPase [Mycobacterium sp. JLS] >gb|ABO009...   375    2e-102
ref|YP_001364062.1|  ATPase AAA-2 domain protein [Kineococcus ...   374    2e-102
ref|YP_641916.1|  ATPase AAA-2 [Mycobacterium sp. MCS] >ref|YP...   374    3e-102
ref|YP_001626326.1|  hemolysin [Renibacterium salmoninarum ATC...   374    5e-102
ref|YP_003119035.1|  ATPase AAA-2 domain protein [Catenulispor...   372    1e-101
ref|ZP_00996068.1|  putative ATP-dependent Clp protease [Janib...   372    1e-101
ref|YP_956135.1|  ATPase [Mycobacterium vanbaalenii PYR-1] >gb...   372    1e-101
gb|ADD45929.1|  ATPase AAA-2 domain protein [Stackebrandtia na...   371    2e-101
ref|ZP_05223183.1|  putative ATP-dependent Clp protease ATP-bi...   371    3e-101
ref|ZP_06217512.1|  ATPase AAA-2 domain protein [Micromonospor...   371    3e-101
ref|YP_907684.1|  ATP-dependent protease ATP-binding subunit C...   371    3e-101
ref|NP_959395.1|  ClpC [Mycobacterium avium subsp. paratubercu...   371    3e-101
ref|ZP_05228226.1|  ATP-dependent protease ATP-binding subunit...   370    3e-101
ref|YP_001853359.1|  ATP-dependent protease ATP-binding subuni...   370    4e-101
ref|ZP_06523153.1|  ATP-dependent protease ATP-binding subunit...   370    5e-101
ref|YP_001132700.1|  ATPase [Mycobacterium gilvum PYR-GCK] >gb...   370    6e-101
ref|ZP_03422192.1|  ATP-dependent protease ATP-binding subunit...   370    6e-101
ref|NP_857266.1|  ATP-dependent Clp protease ATP-binding subun...   370    6e-101
ref|NP_338246.1|  ATP-dependent Clp protease, ATP-binding subu...   369    1e-100
ref|NP_301295.1|  putative ATP-dependent Clp protease [Mycobac...   369    1e-100
emb|CAA37573.1|  unnamed protein product [Mycobacterium leprae]     369    1e-100
ref|ZP_03434686.1|  negative regulator of genetic competence C...   369    2e-100
ref|ZP_05770279.1|  negative regulator of genetic competence C...   368    2e-100
ref|YP_002883408.1|  ATPase AAA-2 domain protein [Beutenbergia...   367    3e-100
ref|YP_921695.1|  ATPase [Nocardioides sp. JS614] >gb|ABL80008...   363    8e-99 
ref|ZP_03927298.1|  ATP-dependent protease, ATPase subunit [Ac...   362    2e-98 
ref|ZP_05914749.1|  ATPase [Brevibacterium linens BL2]              360    5e-98 
ref|YP_003150191.1|  ATPase with chaperone activity, ATP-bindi...   356    1e-96 
ref|YP_001221597.1|  ATP-dependent protease, ATPase subunit [C...   353    8e-96 
ref|YP_001708900.1|  Clp family ATP-binding protease [Clavibac...   353    8e-96 
ref|ZP_03393329.1|  ATPase family associated with various cell...   348    3e-94 
ref|ZP_05846325.1|  ATP-dependent Clp protease, ATP-binding su...   347    4e-94 
ref|ZP_01129430.1|  ATP-dependent Clp protease, ATP-binding su...   346    1e-93 
ref|YP_062934.1|  ATP-dependent Clp protease, ATP-binding subu...   345    2e-93 
ref|ZP_06502076.1|  negative regulator of genetic competence C...   344    3e-93 
ref|YP_250069.1|  ATP-dependent Clp protease [Corynebacterium ...   344    3e-93 
ref|ZP_04606140.1|  ATPase [Micromonospora sp. ATCC 39149] >gb...   344    3e-93 
ref|ZP_04332053.1|  ATPase with chaperone activity, ATP-bindin...   344    4e-93 
ref|YP_003154736.1|  ATPase with chaperone activity, ATP-bindi...   343    1e-92 
ref|YP_002905659.1|  ATP-dependent Clp protease [Corynebacteri...   342    1e-92 
ref|YP_001855768.1|  ATP-dependent Clp protease ATP-binding su...   341    3e-92 
ref|NP_739139.1|  putative endopeptidase Clp ATP-binding chain...   338    1e-91 
ref|ZP_06262671.1|  negative regulator of genetic competence C...   338    2e-91 
ref|YP_054994.1|  Clp family ATP-binding protease [Propionibac...   338    2e-91 
ref|NP_601874.1|  ATPase with chaperone activity, ATP-binding ...   337    5e-91 
ref|ZP_04835206.1|  negative regulator of genetic competence C...   335    2e-90 
ref|ZP_03711316.1|  hypothetical protein CORMATOL_02157 [Coryn...   335    2e-90 
ref|YP_002956273.1|  ATPase with chaperone activity, ATP-bindi...   333    8e-90 
ref|NP_940314.1|  ATP-dependent Clp protease ATP-binding subun...   332    2e-89 
ref|ZP_03936006.1|  ATPase with chaperone activity, ATP-bindin...   330    5e-89 
ref|YP_001139496.1|  hypothetical protein cgR_2580 [Corynebact...   330    6e-89 
ref|YP_879836.1|  negative regulator of genetic competence Clp...   330    8e-89 
ref|ZP_03919687.1|  ATP-dependent protease, ATPase subunit [Co...   328    2e-88 
ref|ZP_03971011.1|  ATP-dependent protease, ATPase subunit [Co...   328    3e-88 
ref|YP_002835758.1|  ATP-dependent Clp protease [Corynebacteri...   328    3e-88 
ref|YP_001801078.1|  ATP-dependent Clp protease [Corynebacteri...   327    7e-88 
ref|ZP_03922843.1|  ATPase with chaperone activity, ATP-bindin...   326    1e-87 
ref|ZP_05367199.1|  negative regulator of genetic competence C...   324    3e-87 
ref|YP_003361820.1|  ATPase with chaperone activity, ATP-bindi...   324    4e-87 
ref|ZP_05708684.1|  ATP-dependent Clp protease ATP-binding sub...   322    1e-86 
ref|ZP_03924801.1|  ATPase with chaperone activity, ATP-bindin...   320    8e-86 
ref|ZP_06162027.1|  negative regulator of genetic competence C...   319    1e-85 
ref|ZP_03994423.1|  ATPase with chaperone activity, ATP-bindin...   318    2e-85 
ref|ZP_03932128.1|  ATPase with chaperone activity, ATP-bindin...   318    3e-85 
ref|ZP_05366950.1|  negative regulator of genetic competence C...   313    6e-84 
ref|ZP_03921044.1|  ATPase with chaperone activity, ATP-bindin...   313    6e-84 
ref|NP_787193.1|  ATP-dependent Clp protease ATP-binding subun...   304    3e-81 
ref|ZP_05965807.1|  negative regulator of genetic competence C...   295    2e-78 
gb|ADC85690.1|  Negative regulator of genetic competence clpC/...   295    2e-78 
ref|ZP_02963166.1|  probable ATP-dependent Clp protease ATP-bi...   295    3e-78 
ref|YP_002322184.1|  ATPase AAA-2 domain protein [Bifidobacter...   292    2e-77 
gb|AAW49584.1|  ClpC [Bifidobacterium breve UCC2003]                291    3e-77 
ref|ZP_03646065.1|  ATPase AAA-2 domain protein [Bifidobacteri...   288    3e-76 
ref|YP_003373951.1|  negative regulator of genetic competence ...   287    4e-76 
ref|ZP_00121578.1|  COG0542: ATPases with chaperone activity, ...   285    3e-75 
ref|NP_695241.1|  protease [Bifidobacterium longum NCC2705] >g...   285    3e-75 
gb|AAM94782.1|  CalR4 [Micromonospora echinospora]                  285    3e-75 
ref|ZP_03937523.1|  ATPase with chaperone activity, ATP-bindin...   283    6e-75 
ref|YP_003360265.1|  clpC Negative regulator of genetic compet...   280    5e-74 
ref|ZP_02919135.1|  hypothetical protein BIFDEN_02459 [Bifidob...   280    5e-74 
ref|YP_003110481.1|  ATPase AAA-2 domain protein [Acidimicrobi...   279    1e-73 
ref|ZP_02028458.1|  hypothetical protein BIFADO_00889 [Bifidob...   279    1e-73 
ref|YP_909436.1|  ATP-dependent Clp protease ATP-binding subun...   279    2e-73 
ref|ZP_04447119.1|  hypothetical protein BIFANG_02085 [Bifidob...   276    7e-73 
ref|ZP_03325060.1|  hypothetical protein BIFCAT_01876 [Bifidob...   275    2e-72 
ref|ZP_03743774.1|  hypothetical protein BIFPSEUDO_04381 [Bifi...   275    3e-72 
ref|YP_076959.1|  class III stress response-related ATPase [Sy...   272    2e-71 
ref|YP_003393484.1|  ATPase AAA-2 domain protein [Conexibacter...   271    3e-71 
ref|YP_644935.1|  ATPase AAA-2 [Rubrobacter xylanophilus DSM 9...   270    6e-71 
ref|ZP_02044158.1|  hypothetical protein ACTODO_01017 [Actinom...   270    9e-71 
ref|ZP_01667506.1|  ATPase AAA-2 domain protein [Thermosinus c...   260    7e-68 
ref|NP_925010.1|  endopeptidase Clp ATP-binding chain [Gloeoba...   259    1e-67 
ref|YP_002485370.1|  ATPase AAA-2 domain protein [Cyanothece s...   259    2e-67 
ref|YP_003239877.1|  ATPase AAA-2 domain protein [Ammonifex de...   258    2e-67 
ref|ZP_03156449.1|  ATPase AAA-2 domain protein [Cyanothece sp...   258    2e-67 
ref|YP_002377176.1|  ATPase AAA-2 domain protein [Cyanothece s...   258    3e-67 
ref|ZP_01620901.1|  ATP-dependent Clp protease regulatory subu...   258    3e-67 
ref|ZP_06382108.1|  ATPase AAA-2 [Arthrospira platensis str. P...   257    5e-67 
ref|NP_442112.1|  ATP-dependent Clp protease regulatory subuni...   257    5e-67 
ref|NP_681098.1|  ATP-dependent Clp protease regulatory subuni...   257    6e-67 
ref|YP_001516278.1|  ATP-dependent protease, ATP-binding subun...   257    6e-67 
ref|YP_171963.1|  ATP-dependent Clp protease regulatory subuni...   257    7e-67 
ref|ZP_03275362.1|  Clp domain protein [Arthrospira maxima CS-...   256    8e-67 
emb|CAO87778.1|  clpC [Microcystis aeruginosa PCC 7806]             256    9e-67 
ref|YP_001660969.1|  ATP-dependent Clp protease ATPase subunit...   256    1e-66 
gb|AAB67745.1|  ClpC [Synechococcus elongatus PCC 7942]             256    2e-66 
ref|ZP_05028239.1|  ATPase, AAA family [Microcoleus chthonopla...   255    2e-66 
ref|YP_399279.1|  ATPase [Synechococcus elongatus PCC 7942] >g...   255    2e-66 
ref|YP_476859.1|  Clp protease, ATP-binding subunit ClpC [Syne...   255    2e-66 
ref|YP_474132.1|  Clp protease, ATP-binding subunit ClpC [Syne...   255    2e-66 
ref|ZP_04854468.1|  ATPase AAA-2 domain-containing protein [Pa...   254    3e-66 
ref|ZP_01631992.1|  endopeptidase Clp ATP-binding chain [Nodul...   254    4e-66 
ref|YP_001733411.1|  endopeptidase Clp, ATP-binding chain C, p...   254    6e-66 
ref|YP_003014407.1|  ATPase AAA-2 domain protein [Paenibacillu...   253    6e-66 
ref|ZP_05036270.1|  ATPase, AAA family [Synechococcus sp. PCC ...   253    6e-66 
ref|YP_003137199.1|  ATPase AAA-2 domain protein [Cyanothece s...   253    7e-66 
ref|YP_002371632.1|  ATPase AAA-2 domain protein [Cyanothece s...   253    7e-66 
pdb|3FH2|A  Chain A, The Crystal Structure Of The Probable Atp...   253    8e-66 
ref|YP_722125.1|  ATPase AAA-2 [Trichodesmium erythraeum IMS10...   253    8e-66 
ref|YP_001111554.1|  ATPase [Desulfotomaculum reducens MI-1] >...   253    9e-66 
ref|YP_291854.1|  Clp protease ATP-binding subunit [Prochloroc...   252    1e-65 
ref|YP_001015314.1|  ClpC [Prochlorococcus marinus str. NATL1A...   252    2e-65 
ref|YP_001805661.1|  ATP-dependent Clp protease, regulatory su...   252    2e-65 
ref|ZP_02329452.1|  class III stress response-related ATPase [...   252    2e-65 
ref|ZP_01728203.1|  ATP-dependent Clp protease regulatory subu...   252    2e-65 
ref|NP_050661.1|  Clp protease ATP binding subunit [Guillardia...   252    2e-65 
ref|NP_487039.1|  endopeptidase Clp ATP-binding chain [Nostoc ...   251    3e-65 
ref|YP_001869220.1|  ATPase [Nostoc punctiforme PCC 73102] >gb...   251    3e-65 
ref|YP_321429.1|  UvrB/UvrC protein [Anabaena variabilis ATCC ...   251    3e-65 
ref|YP_003421971.1|  ATPase with chaperone activity, ATP-bindi...   251    3e-65 
ref|ZP_03767551.1|  ATPase AAA-2 domain protein ['Nostoc azoll...   251    3e-65 
ref|YP_003245792.1|  ATPase AAA-2 domain protein [Geobacillus ...   251    3e-65 
ref|NP_691014.1|  ATP-dependent Clp protease [Oceanobacillus i...   251    3e-65 
ref|ZP_06308498.1|  UvrB/UvrC protein [Cylindrospermopsis raci...   251    4e-65 
ref|ZP_06304323.1|  UvrB/UvrC protein [Raphidiopsis brookii D9...   251    5e-65 
ref|ZP_00514408.1|  UvrB/UvrC protein:AAA ATPase, central regi...   250    5e-65 
ref|YP_001293474.1|  Clp protease ATP binding subunit [Rhodomo...   250    7e-65 
ref|YP_361153.1|  negative regulator of genetic competence clp...   249    1e-64 
ref|ZP_05044883.1|  ATPase, AAA family [Cyanobium sp. PCC 7001...   249    1e-64 
ref|NP_893205.1|  ClpC [Prochlorococcus marinus subsp. pastori...   249    1e-64 
ref|ZP_03233173.1|  negative regulator of genetic competence C...   248    2e-64 
ref|ZP_04276747.1|  Negative regulator of genetic competence [...   248    2e-64 
ref|ZP_04112764.1|  Negative regulator of genetic competence [...   248    3e-64 
ref|YP_002364931.1|  negative regulator of genetic competence ...   248    3e-64 
ref|ZP_04315415.1|  Negative regulator of genetic competence [...   248    3e-64 
ref|ZP_04189750.1|  Negative regulator of genetic competence [...   248    3e-64 
ref|NP_829983.1|  negative regulator of genetic competence clp...   248    3e-64 
ref|ZP_04166817.1|  Negative regulator of genetic competence [...   248    3e-64 
ref|YP_001642973.1|  ATPase [Bacillus weihenstephanensis KBAB4...   248    3e-64 
ref|ZP_05139109.1|  ATPase, AAA family [Prochlorococcus marinu...   248    3e-64 
ref|ZP_04207189.1|  Negative regulator of genetic competence [...   248    3e-64 
ref|ZP_00740659.1|  Negative regulator of genetic competence c...   248    3e-64 
ref|ZP_03494211.1|  ATPase AAA-2 domain protein [Alicyclobacil...   248    3e-64 
ref|YP_002443628.1|  negative regulator of genetic competence ...   248    4e-64 
ref|YP_001484425.1|  ClpC [Prochlorococcus marinus str. MIT 92...   248    4e-64 
ref|ZP_04155141.1|  Negative regulator of genetic competence [...   248    4e-64 
ref|YP_003186133.1|  ATPase AAA-2 domain protein [Alicyclobaci...   248    4e-64 
ref|ZP_04215749.1|  Negative regulator of genetic competence [...   248    4e-64 
ref|ZP_04149281.1|  Negative regulator of genetic competence [...   248    4e-64 
ref|ZP_04100030.1|  Negative regulator of genetic competence [...   247    6e-64 
ref|ZP_04172482.1|  Negative regulator of genetic competence [...   247    6e-64 
ref|ZP_05298727.1|  endopeptidase Clp ATP-binding chain C [Lis...   247    6e-64 
ref|ZP_01861926.1|  ClpC [Bacillus sp. SG-1] >gb|EDL63014.1| C...   247    6e-64 
ref|YP_397594.1|  Clp protease ATP-binding subunit [Prochloroc...   247    6e-64 
ref|ZP_04184082.1|  Negative regulator of genetic competence [...   247    7e-64 
ref|YP_001916333.1|  ATPase AAA-2 domain protein [Natranaerobi...   247    7e-64 
ref|NP_842649.1|  negative regulator of genetic competence Clp...   247    7e-64 
ref|YP_001011493.1|  ClpC [Prochlorococcus marinus str. MIT 95...   247    7e-64 
ref|ZP_04298534.1|  Negative regulator of genetic competence [...   246    7e-64 
ref|ZP_01086208.1|  endopeptidase Clp ATP-binding chain C [Syn...   246    8e-64 
ref|ZP_04076468.1|  Negative regulator of genetic competence [...   246    8e-64 
ref|ZP_02171825.1|  ribosomal protein S8 [Bacillus selenitired...   246    8e-64 
ref|YP_001091419.1|  ClpC [Prochlorococcus marinus str. MIT 93...   246    8e-64 
ref|ZP_04287279.1|  Negative regulator of genetic competence [...   246    8e-64 
ref|YP_001017005.1|  ClpC [Prochlorococcus marinus str. MIT 93...   246    9e-64 
ref|NP_463763.1|  endopeptidase Clp ATP-binding chain C [Liste...   246    9e-64 
ref|YP_848397.1|  ClpB ATPase [Listeria welshimeri serovar 6b ...   246    9e-64 
ref|ZP_03729254.1|  ATPase AAA-2 domain protein [Dethiobacter ...   246    9e-64 
ref|YP_002351359.1|  negative regulator of genetic competence ...   246    1e-63 
ref|ZP_05387561.1|  endopeptidase Clp ATP-binding chain C [Lis...   246    1e-63 
ref|YP_001009585.1|  ClpC [Prochlorococcus marinus str. AS9601...   246    1e-63 
ref|NP_387967.1|  class III stress response-related ATPase, AA...   246    1e-63 
ref|ZP_05242849.1|  ClpC ATPase [Listeria monocytogenes FSL R2...   246    1e-63 
ref|YP_012854.1|  ClpC ATPase [Listeria monocytogenes str. 4b ...   246    1e-63 
ref|NP_875499.1|  Clp protease ATP-binding subunit [Prochloroc...   246    1e-63 
gb|AAC44446.1|  ClpC ATPase [Listeria monocytogenes]                246    1e-63 
ref|YP_001373446.1|  ATPase [Bacillus cereus subsp. cytotoxis ...   246    1e-63 
ref|NP_894892.1|  ClpC [Prochlorococcus marinus str. MIT 9313]...   246    1e-63 
ref|NP_897031.1|  endopeptidase Clp ATP-binding chain C [Synec...   246    1e-63 
ref|YP_003463459.1|  ClpC ATPase [Listeria seeligeri serovar 1...   246    1e-63 
ref|ZP_01470307.1|  ATPase [Synechococcus sp. RS9916] >gb|EAU7...   246    1e-63 
ref|NP_469609.1|  endopeptidase Clp ATP-binding chain C [Liste...   245    2e-63 
ref|YP_381931.1|  ATPase [Synechococcus sp. CC9605] >gb|ABB353...   245    2e-63 
ref|YP_001227044.1|  ATP-dependent Clp protease ATP-binding su...   245    2e-63 
ref|YP_003426631.1|  class III stress response-related ATPase ...   245    2e-63 
ref|YP_001550983.1|  ClpC [Prochlorococcus marinus str. MIT 92...   245    2e-63 
ref|YP_277337.1|  Clp protease ATP binding subunit [Emiliania ...   245    2e-63 
ref|ZP_05789511.1|  chaperone protein ClpB 1 [Synechococcus sp...   245    2e-63 
ref|YP_081693.1|  negative regulator of genetic competence clp...   245    2e-63 
ref|ZP_01080600.1|  endopeptidase Clp ATP-binding chain C [Syn...   245    3e-63 
ref|ZP_06363377.1|  ATPase AAA-2 domain protein [Bacillus cell...   245    3e-63 
ref|YP_730239.1|  putative Clp protease, ATP-binding subunit C...   245    3e-63 
ref|YP_077372.1|  class III stress response-related ATPase [Ba...   245    3e-63 
ref|ZP_04431293.1|  ATPase AAA-2 domain protein [Bacillus coag...   244    3e-63 
ref|YP_001419765.1|  ClpC [Bacillus amyloliquefaciens FZB42] >...   244    3e-63 
ref|ZP_03224913.1|  class III stress response-related ATPase [...   244    3e-63 
ref|ZP_01173582.1|  class III stress response-related ATPase [...   244    4e-63 
ref|YP_377397.1|  ATPase [Synechococcus sp. CC9902] >gb|ABB263...   244    4e-63 
ref|NP_240969.1|  class III stress response-related ATPase [Ba...   244    4e-63 
ref|ZP_05373217.1|  ATPase AAA-2 domain protein [Geobacillus s...   244    4e-63 
ref|YP_002948289.1|  ATPase AAA-2 domain protein [Geobacillus ...   244    6e-63 
ref|ZP_01469736.1|  ATPase [Synechococcus sp. BL107] >gb|EAU70...   244    6e-63 
ref|ZP_04393580.1|  ATPase AAA-2 domain protein [Geobacillus s...   243    1e-62 
ref|YP_145931.1|  ATP-dependent Clp protease ATPase subunit [G...   243    1e-62 
ref|YP_002225128.1|  gp251 [Mycobacterium phage Myrna] >gb|ACH...   243    1e-62 
ref|YP_002522245.1|  ClpC ATPase [Thermomicrobium roseum DSM 5...   242    2e-62 
ref|YP_001485331.1|  class III stress response-related ATPase ...   242    2e-62 
ref|YP_002769669.1|  negative regulator of genetic competence ...   241    3e-62 
gb|ABC02412.1|  ClpC [Bacillus weihenstephanensis]                  241    4e-62 
gb|ABC02403.1|  ClpC [Bacillus weihenstephanensis]                  241    4e-62 
ref|YP_537014.1|  Clp protease ATP binding subunit [Porphyra y...   241    4e-62 
ref|ZP_01124422.1|  ATPase [Synechococcus sp. WH 7805] >gb|EAR...   241    5e-62 
gb|ABC02421.1|  ClpC [Bacillus weihenstephanensis]                  241    5e-62 
ref|YP_002314446.1|  Class III stress response-related ATPase,...   240    6e-62 
ref|NP_053942.1|  Clp protease ATP binding subunit [Porphyra p...   240    7e-62 
ref|NP_623864.1|  ATPase with chaperone activity, ATP-binding ...   239    1e-61 
ref|ZP_04442721.1|  ClpB ATPase [Listeria grayi DSM 20601] >gb...   239    1e-61 
ref|ZP_05336011.1|  ATPase AAA-2 domain protein [Thermoanaerob...   239    2e-61 
ref|YP_002507843.1|  ATPase AAA-2 domain protein [Halothermoth...   238    3e-61 
ref|YP_001716377.1|  ATPase [Candidatus Desulforudis audaxviat...   238    3e-61 
ref|YP_173625.1|  ATP-dependent Clp protease ATP-binding subun...   238    4e-61 
gb|ABZ09336.1|  putative Clp [uncultured marine microorganism ...   237    5e-61 
ref|YP_001124210.1|  negative regulator of genetic competence ...   237    5e-61 
ref|YP_003318756.1|  ATPase AAA-2 domain protein [Sphaerobacte...   237    7e-61 
ref|YP_002886032.1|  ATPase AAA-2 domain protein [Exiguobacter...   236    1e-60 
ref|NP_849021.1|  Clp protease ATP binding subunit [Cyanidiosc...   236    1e-60 
ref|YP_001812572.1|  ATPase [Exiguobacterium sibiricum 255-15]...   236    2e-60 
ref|YP_003189831.1|  ATPase AAA-2 domain protein [Desulfotomac...   235    2e-60 
ref|NP_045112.1|  Clp protease ATP binding subunit [Cyanidium ...   235    2e-60 
ref|ZP_03977972.1|  conserved hypothetical protein [Corynebact...   235    2e-60 
ref|ZP_05493347.1|  ATPase AAA-2 domain protein [Thermoanaerob...   235    3e-60 
ref|YP_003477810.1|  ATPase AAA-2 domain protein [Thermoanaero...   235    3e-60 
ref|ZP_05379223.1|  ATPase AAA-2 domain protein [Thermoanaerob...   234    3e-60 
ref|YP_003323078.1|  ATPase AAA-2 domain protein [Thermobaculu...   234    3e-60 
ref|YP_001210833.1|  ATPase with chaperone activity, ATP-bindi...   234    4e-60 
ref|YP_001664347.1|  ATPase [Thermoanaerobacter pseudethanolic...   233    9e-60 
ref|ZP_04788814.1|  ATPase AAA-2 domain protein [Thermoanaerob...   233    9e-60 
ref|ZP_01091456.1|  negative regulator of genetic competence C...   233    1e-59 
ref|YP_063564.1|  Clp protease ATP binding subunit [Gracilaria...   231    3e-59 
emb|CAJ73829.1|  strongly similar to negative regulator of gen...   231    4e-59 
ref|ZP_02733990.1|  negative regulator of genetic competence C...   230    6e-59 
ref|YP_002049416.1|  endopeptidase Clp ATP-binding chain C [Pa...   229    9e-59 
ref|YP_001393599.1|  ClpC [Clostridium kluyveri DSM 555] >gb|E...   229    9e-59 
ref|YP_002470621.1|  hypothetical protein CKR_0156 [Clostridiu...   229    9e-59 
ref|YP_003370418.1|  ATPase AAA-2 domain protein [Pirellula st...   229    2e-58 
ref|ZP_01630543.1|  UvrB/UvrC protein [Nodularia spumigena CCY...   228    4e-58 
ref|YP_722954.1|  ATPase AAA-2 [Trichodesmium erythraeum IMS10...   228    4e-58 
ref|YP_001225258.1|  ATP-dependent Clp protease ATP-binding su...   226    1e-57 
ref|ZP_01853541.1|  negative regulator of genetic competence C...   226    2e-57 
ref|ZP_05899718.1|  negative regulator of genetic competence C...   225    3e-57 
ref|ZP_04430000.1|  ATPase with chaperone activity, ATP-bindin...   223    1e-56 
ref|YP_001105154.1|  putative ATP-dependent Clp protease [Sacc...   223    1e-56 
ref|YP_002561289.1|  truncated stress response-related Clp ATP...   223    1e-56 
ref|YP_001679932.1|  clpc ATPase [Heliobacterium modesticaldum...   221    3e-56 
ref|YP_001322243.1|  ATPase [Alkaliphilus metalliredigens QYMF...   221    3e-56 
ref|YP_003359282.1|  Clp protease ATP binding subunit [Cryptom...   221    3e-56 
ref|YP_001512014.1|  ATPase [Alkaliphilus oremlandii OhILAs] >...   221    4e-56 
ref|ZP_06439165.1|  negative regulator of genetic competence C...   220    7e-56 
ref|ZP_01725571.1|  ATP-dependent Clp protease ATPase subunit ...   220    9e-56 
ref|YP_001700223.1|  negative regulator of genetic competence ...   219    9e-56 
ref|NP_867440.1|  negative regulator of genetic competence Clp...   219    1e-55 
ref|ZP_03768257.1|  ATPase AAA-2 domain protein ['Nostoc azoll...   219    1e-55 
ref|ZP_01621575.1|  ATP-dependent Clp protease regulatory subu...   219    2e-55 
ref|ZP_04807341.1|  ATPase AAA-2 domain protein [Clostridium c...   219    2e-55 
ref|NP_486003.1|  endopeptidase Clp ATP-binding chain [Nostoc ...   218    3e-55 
ref|YP_001866914.1|  ATPase [Nostoc punctiforme PCC 73102] >gb...   218    3e-55 
ref|YP_324841.1|  UvrB/UvrC protein [Anabaena variabilis ATCC ...   217    5e-55 
ref|ZP_06306540.1|  UvrB/UvrC protein [Cylindrospermopsis raci...   216    9e-55 
ref|YP_003182587.1|  ATPase AAA-2 domain protein [Eggerthella ...   216    9e-55 
ref|ZP_04059992.1|  negative regulator of genetic competence C...   216    1e-54 
ref|YP_755027.1|  ATPases with chaperone activity, ATP-binding...   216    1e-54 
sp|P31542.1|CLPAB_SOLLC  RecName: Full=ATP-dependent Clp prote...   216    1e-54 
ref|YP_003472579.1|  ATP-dependent Clp protease, ATP-binding s...   216    2e-54 
ref|ZP_04677920.1|  negative regulator of genetic competence C...   215    2e-54 
sp|P31541.1|CLPAA_SOLLC  RecName: Full=ATP-dependent Clp prote...   215    3e-54 
ref|YP_254399.1|  endopeptidas Clp ATP-binding chain C [Staphy...   214    3e-54 
ref|ZP_03612966.1|  ATPase family associated with various cell...   214    4e-54 
ref|YP_002633279.1|  ClpC ATPase family protein [Staphylococcu...   214    4e-54 
ref|YP_001038203.1|  ATPase AAA-2 [Clostridium thermocellum AT...   214    5e-54 
ref|ZP_05685535.1|  endopeptidase [Staphylococcus aureus A9635...   214    6e-54 
ref|NP_645297.1|  endopeptidase [Staphylococcus aureus subsp. ...   214    6e-54 
ref|ZP_03430490.1|  ATP-dependent Clp protease, ATP-binding su...   214    6e-54 
ref|YP_415973.1|  endopeptidase [Staphylococcus aureus RF122] ...   214    6e-54 
ref|NP_371049.1|  endopeptidase [Staphylococcus aureus subsp. ...   214    6e-54 
ref|ZP_06342572.1|  ATP-dependent Clp protease ATP-binding sub...   214    6e-54 
ref|ZP_06332109.1|  ATP-dependent Clp protease ATP-binding sub...   214    7e-54 
ref|ZP_04838847.1|  endopeptidase [Staphylococcus aureus subsp...   213    7e-54 
ref|ZP_04824414.1|  ClpB ATPase [Staphylococcus epidermidis BC...   213    7e-54 
ref|ZP_04818315.1|  ClpB ATPase [Staphylococcus epidermidis M2...   213    8e-54 
gb|ABK95905.1|  unknown [Populus trichocarpa]                       213    1e-53 
ref|YP_001819559.1|  ATPase [Opitutus terrae PB90-1] >gb|ACB75...   213    1e-53 
ref|ZP_05609004.1|  endopeptidase [Staphylococcus aureus subsp...   213    1e-53 
ref|ZP_05601065.1|  endopeptidase [Staphylococcus aureus subsp...   212    2e-53 
ref|ZP_05394138.1|  ATPase AAA-2 domain protein [Clostridium c...   212    2e-53 
ref|XP_002511102.1|  ATP-dependent clp protease, putative [Ric...   211    4e-53 
ref|NP_568746.1|  CLPC1; ATP binding / ATP-dependent peptidase...   211    4e-53 
ref|ZP_05030305.1|  ATPase, AAA family [Microcoleus chthonopla...   211    4e-53 
sp|P46523.1|CLPA_BRANA  RecName: Full=ATP-dependent Clp protea...   211    4e-53 
ref|ZP_05059757.1|  ATPase, AAA family [Verrucomicrobiae bacte...   211    5e-53 
ref|ZP_06022436.1|  endopeptidase [Staphylococcus aureus D30] ...   210    7e-53 
ref|NP_763842.1|  endopeptidase [Staphylococcus epidermidis AT...   210    7e-53 
ref|ZP_03725810.1|  ATPase AAA-2 domain protein [Opitutaceae b...   210    9e-53 
sp|P35100.1|CLPC_PEA  RecName: Full=ATP-dependent Clp protease...   210    9e-53 
emb|CAE05148.2|  OSJNBa0039C07.4 [Oryza sativa (japonica culti...   209    2e-52 
gb|EEC77204.1|  hypothetical protein OsI_15716 [Oryza sativa I...   209    2e-52 
gb|EAZ30583.1|  hypothetical protein OsJ_14634 [Oryza sativa J...   208    3e-52 
gb|EEC69045.1|  hypothetical protein OsI_37876 [Oryza sativa I...   208    3e-52 
ref|XP_002447724.1|  hypothetical protein SORBIDRAFT_06g014590...   208    3e-52 
ref|XP_001779162.1|  predicted protein [Physcomitrella patens ...   207    5e-52 
emb|CBI15747.1|  unnamed protein product [Vitis vinifera]           207    6e-52 
gb|AAC04687.1|  ClpC [Arabidopsis thaliana]                         207    6e-52 
gb|ACN34070.1|  unknown [Zea mays]                                  207    6e-52 
ref|XP_002284518.1|  PREDICTED: hypothetical protein [Vitis vi...   207    7e-52 
gb|EEE52971.1|  hypothetical protein OsJ_35634 [Oryza sativa J...   207    7e-52 
ref|NP_001066442.1|  Os12g0230100 [Oryza sativa (japonica cult...   207    7e-52 
ref|XP_001756645.1|  predicted protein [Physcomitrella patens ...   206    9e-52 
gb|AAD02267.1|  ClpC protease [Spinacia oleracea]                   206    1e-51 
ref|NP_566912.2|  HSP93-III; ATP binding / ATPase/ DNA binding...   206    1e-51 
ref|YP_302321.1|  putative stress response-related Clp ATPase ...   206    1e-51 
gb|AAL10478.1|  AT3g48870/T21J18_140 [Arabidopsis thaliana]         206    2e-51 
ref|XP_001766888.1|  predicted protein [Physcomitrella patens ...   205    2e-51 
emb|CAB87915.1|  AtClpC [Arabidopsis thaliana]                      205    3e-51 
ref|YP_001636069.1|  ATPase [Chloroflexus aurantiacus J-10-fl]...   205    3e-51 
ref|YP_003002285.1|  ATP-dependent clp protease ATP-binding su...   204    3e-51 
ref|ZP_03567834.1|  ClpC ATPase [Atopobium rimae ATCC 49626] >...   204    3e-51 
ref|XP_001766010.1|  predicted protein [Physcomitrella patens ...   204    4e-51 
ref|YP_002573691.1|  ATPase AAA-2 domain protein [Anaerocellum...   204    4e-51 
ref|ZP_03271549.1|  ATPase AAA-2 domain protein [Arthrospira m...   204    5e-51 
ref|XP_001422509.1|  chaperone, Hsp100 family, ClpC-type [Ostr...   204    7e-51 
ref|YP_002761096.1|  ATP-dependent Clp protease ATP-binding su...   203    7e-51 
ref|YP_001181136.1|  ATPase [Caldicellulosiruptor saccharolyti...   203    1e-50 
emb|CAN78847.1|  hypothetical protein [Vitis vinifera]              203    1e-50 
ref|YP_002462779.1|  ATPase AAA-2 domain protein [Chloroflexus...   202    1e-50 
ref|ZP_03130264.1|  Clp domain protein [Chthoniobacter flavus ...   202    2e-50 
ref|XP_002505550.1|  predicted protein [Micromonas sp. RCC299]...   202    2e-50 
ref|XP_002322299.1|  predicted protein [Populus trichocarpa] >...   202    2e-50 
ref|NP_783145.1|  negative regulator of genetic competence mec...   201    4e-50 
ref|YP_002504694.1|  ATPase AAA-2 domain protein [Clostridium ...   201    4e-50 
gb|EEH52031.1|  predicted protein [Micromonas pusilla CCMP1545]     201    5e-50 
ref|ZP_03632272.1|  ATPase AAA-2 domain protein [bacterium Ell...   201    5e-50 
ref|YP_003461879.1|  ATPase AAA-2 domain protein [Dehalococcoi...   200    7e-50 
ref|YP_003180205.1|  ATPase AAA-2 domain protein [Atopobium pa...   200    8e-50 
ref|ZP_02993020.1|  hypothetical protein CLOSPO_00059 [Clostri...   200    8e-50 
ref|ZP_02616497.1|  negative regulator of genetic competence M...   199    1e-49 
ref|YP_001783151.1|  negative regulator of genetic competence ...   199    1e-49 
ref|YP_001276071.1|  ATPase [Roseiflexus sp. RS-1] >gb|ABQ9012...   199    1e-49 
ref|YP_001392864.1|  negative regulator of genetic competence ...   199    1e-49 
ref|YP_001255992.1|  negative regulator of genetic competence ...   199    1e-49 
ref|YP_001788851.1|  negative regulator of genetic competence ...   199    1e-49 
ref|ZP_02613465.1|  negative regulator of genetic competence M...   199    1e-49 
ref|YP_180810.1|  ATP-dependent Clp protease, ATP-binding subu...   199    1e-49 
ref|YP_307248.1|  ATP-dependent Clp protease, ATP-binding subu...   199    2e-49 
ref|YP_002806054.1|  negative regulator of genetic competence ...   199    2e-49 
ref|YP_003329558.1|  ATP-dependent Clp protease, ATP-binding s...   199    2e-49 
ref|YP_001213521.1|  ATPase [Dehalococcoides sp. BAV1] >gb|ABQ...   198    2e-49 
ref|YP_003002123.1|  ATP-dependent clp protease ATP-binding su...   198    3e-49 
ref|YP_001938900.1|  ATP-binding subunits of Clp protease and ...   198    4e-49 
ref|YP_003151682.1|  ATPase with chaperone activity, ATP-bindi...   197    6e-49 
ref|YP_001432122.1|  ATPase [Roseiflexus castenholzii DSM 1394...   197    7e-49 
ref|NP_349786.1|  ABC transporter ATPase [Clostridium acetobut...   196    1e-48 
ref|YP_002327552.1|  caseinolytic-like Clp protease [Vaucheria...   193    9e-48 
ref|ZP_05494391.1|  ATPase AAA-2 domain protein [Clostridium p...   192    1e-47 
ref|YP_001876410.1|  ATPase [Elusimicrobium minutum Pei191] >g...   192    2e-47 
ref|NP_001067671.1|  Os11g0267400 [Oryza sativa (japonica cult...   189    2e-46 
ref|ZP_03497165.1|  ATPase AAA-2 domain protein [Thermus aquat...   189    2e-46 
gb|AAX96334.1|  Clp amino terminal domain, putative [Oryza sat...   188    2e-46 
gb|EAY80574.1|  hypothetical protein OsI_35755 [Oryza sativa I...   188    2e-46 
ref|YP_429043.1|  ATPases with chaperone activity, ATP-binding...   187    6e-46 
ref|YP_002248100.1|  ClpC ATPase [Thermodesulfovibrio yellowst...   187    8e-46 
ref|ZP_06469963.1|  ATPase AAA-2 domain protein [Ethanoligenen...   187    9e-46 
ref|YP_002353368.1|  ATPase AAA-2 domain protein [Dictyoglomus...   186    1e-45 
ref|YP_002251189.1|  negative regulator of genetic competence ...   186    1e-45 
ref|ZP_06392953.1|  ATPase AAA-2 domain protein [Dethiosulfovi...   186    2e-45 
ref|YP_001876686.1|  ATPase AAA-2 domain protein [Akkermansia ...   186    2e-45 
ref|ZP_06259688.1|  negative regulator of genetic competence C...   185    2e-45 
gb|AAA25352.1|  ORFIII [Mycobacterium leprae]                       185    3e-45 
ref|ZP_05039045.1|  ATPase, AAA family [Synechococcus sp. PCC ...   185    3e-45 
ref|YP_001086489.1|  ATP-dependent Clp protease [Clostridium d...   185    3e-45 
ref|YP_003311982.1|  ATPase AAA-2 domain protein [Veillonella ...   184    4e-45 
gb|ADD28614.1|  ATPase AAA-2 domain protein [Meiothermus ruber...   184    4e-45 
ref|YP_604681.1|  ATPase AAA-2 [Deinococcus geothermalis DSM 1...   184    4e-45 
ref|ZP_05399519.1|  ATP-dependent Clp protease [Clostridium di...   184    6e-45 
ref|ZP_06242018.1|  ATPase AAA-2 domain protein [Victivallis v...   183    8e-45 
ref|ZP_05404813.1|  negative regulator of genetic competence C...   183    9e-45 
ref|NP_294841.1|  ATP-dependent Clp protease, ATP-binding subu...   182    1e-44 
ref|NP_043587.1|  Clp protease ATP binding subunit [Odontella ...   182    2e-44 
ref|YP_002534030.1|  ATP-dependent Clp protease, ATPase subuni...   182    2e-44 
pdb|2K77|A  Chain A, Nmr Solution Structure Of The Bacillus Su...   182    2e-44 
gb|EAY56161.1|  putative ATP-dependent Clp protease, ATPase su...   182    2e-44 
ref|YP_002785941.1|  putative ATP-dependent Clp protease, ATP-...   182    3e-44 
ref|ZP_02186039.1|  ATP-dependent Clp protease, ATP-binding su...   181    5e-44 
ref|ZP_06291661.1|  negative regulator of genetic competence C...   180    8e-44 
ref|ZP_04446166.1|  hypothetical protein COLINT_02895 [Collins...   180    8e-44 
ref|YP_004149.1|  ATP-dependent Clp protease ATP-binding subun...   180    1e-43 
emb|CAX12451.1|  ATP-dependent clp protease ATP-binding subuni...   180    1e-43 
ref|YP_874483.1|  ATP-dependent clp protease ATP-binding subun...   179    1e-43 
ref|YP_003144313.1|  ATPase with chaperone activity, ATP-bindi...   179    1e-43 
ref|YP_874614.1|  ATP-dependent clp protease ATP-binding subun...   179    1e-43 
ref|ZP_02926068.1|  negative regulator of genetic competence C...   177    6e-43 
ref|NP_213889.1|  ATP-dependent Clp protease [Aquifex aeolicus...   177    7e-43 
ref|YP_003341498.1|  hypothetical protein Sros_6021 [Streptosp...   176    1e-42 
dbj|BAB88968.1|  stress-related ATPase [Bacillus cereus]            176    1e-42 
ref|ZP_05594369.1|  UvrB/UvrC protein [Enterococcus faecalis A...   176    1e-42 
gb|EES53093.1|  putative ATP-dependent Clp protease, ATPase su...   176    1e-42 
ref|YP_008510.1|  endopeptidase ATP-binding chain clpC [Candid...   176    1e-42 
ref|YP_003289271.1|  ATP-dependent Clp protease ATP-binding su...   175    2e-42 
ref|ZP_02037068.1|  hypothetical protein BACCAP_02681 [Bactero...   175    3e-42 
ref|ZP_02178006.1|  ATP-dependent Clp protease [Hydrogenivirga...   175    3e-42 
ref|YP_003346334.1|  ATPase AAA-2 domain protein [Thermotoga n...   175    3e-42 
ref|ZP_05294712.1|  endopeptidase Clp ATP-binding chain C [Lis...   174    4e-42 
ref|YP_516671.1|  hypothetical protein DSY0438 [Desulfitobacte...   174    4e-42 
ref|ZP_05564768.1|  UvrB/UvrC protein:AAA ATPase [Enterococcus...   174    4e-42 
ref|ZP_05424715.1|  ATP-dependent Clp protease, ATP-binding su...   174    4e-42 
ref|YP_003433222.1|  ATP-dependent Clp protease [Hydrogenobact...   174    4e-42 
ref|YP_002375353.1|  ATPase AAA-2 domain protein [Cyanothece s...   174    4e-42 
ref|NP_228013.1|  ATP-dependent Clp protease, ATPase subunit [...   174    5e-42 
ref|YP_001244322.1|  ATPase [Thermotoga petrophila RKU-1] >ref...   174    5e-42 
ref|YP_001738785.1|  ATPase [Thermotoga sp. RQ2] >gb|ACB09102....   174    5e-42 
ref|YP_003135830.1|  ATPase AAA-2 domain protein [Cyanothece s...   174    6e-42 
ref|YP_002370288.1|  ATPase AAA-2 domain protein [Cyanothece s...   174    6e-42 
ref|YP_003317915.1|  ATPase AAA-2 domain protein [Thermanaerov...   174    6e-42 
ref|ZP_03297371.1|  hypothetical protein COLSTE_01268 [Collins...   174    7e-42 
ref|ZP_04436613.1|  ATPase/chaperone ClpC, specificity factor ...   173    9e-42 
ref|ZP_06300598.1|  hypothetical protein pah_c207o057 [Parachl...   173    9e-42 
ref|ZP_06234747.1|  Clp domain protein [Frankia sp. EuI1c] >gb...   173    1e-41 
ref|ZP_06161053.1|  negative regulator of genetic competence C...   173    1e-41 
ref|YP_002941723.1|  ATPase AAA-2 domain protein [Kosmotoga ol...   173    1e-41 
ref|ZP_02622342.1|  negative regulator of genetic competence C...   173    1e-41 
emb|CAI44405.1|  ATP-dependent Clp protease, ATPase subunit [T...   173    1e-41 
ref|ZP_04436034.1|  ATPase/chaperone ClpC, specificity factor ...   172    1e-41 
ref|ZP_05421132.1|  UvrB/UvrC protein:AAA ATPase [Enterococcus...   172    2e-41 
ref|ZP_04646741.1|  ClpC ATPase [Enterococcus faecalis TUSoD E...   172    2e-41 
emb|CAT03204.1|  ClpC protein [Bacillus sp. AKG]                    172    2e-41 
ref|YP_001995218.1|  ATPase AAA-2 domain protein [Chloroherpet...   171    3e-41 
ref|ZP_05577433.1|  ATP-dependent Clp protease, ATP-binding su...   171    3e-41 
ref|ZP_05501490.1|  ATP-dependent Clp protease, ATP-binding su...   171    3e-41 
ref|ZP_01692471.1|  ATPase [Microscilla marina ATCC 23134] >gb...   171    4e-41 
ref|NP_816879.1|  ATP-dependent Clp protease, ATP-binding subu...   171    4e-41 
ref|ZP_05567266.1|  UvrB/UvrC protein:AAA ATPase [Enterococcus...   171    4e-41 
ref|ZP_03212232.1|  ATP-binding subunit of Clp protease and Dn...   171    4e-41 
ref|YP_002015034.1|  ATPase AAA-2 domain protein [Prosthecochl...   171    5e-41 
ref|NP_924488.1|  endopeptidase Clp ATP-binding chain [Gloeoba...   171    5e-41 
ref|YP_001657609.1|  ATP-dependent Clp protease ATPase subunit...   171    6e-41 
ref|YP_001958803.1|  ATPase AAA-2 domain protein [Chlorobium p...   171    6e-41 
ref|YP_003473450.1|  ATPase AAA-2 domain protein [Thermocrinis...   170    7e-41 
ref|YP_002019395.1|  ATPase AAA-2 domain protein [Pelodictyon ...   170    7e-41 
ref|YP_001942329.1|  ATPase AAA-2 domain protein [Chlorobium l...   170    7e-41 
ref|ZP_04780180.1|  ATPase with chaperone activity ATP-binding...   170    8e-41 
ref|ZP_03967992.1|  ATPase with chaperone activity ATP-binding...   170    8e-41 
ref|ZP_06566705.1|  putative ATP-dependent Clp protease [Sacch...   169    1e-40 
ref|ZP_04441416.1|  ATP-binding Clp protease subunit [Lactobac...   169    2e-40 
ref|YP_003172245.1|  ATP-binding subunit of Clp protease and D...   169    2e-40 
ref|YP_001931727.1|  ATPase AAA-2 domain protein [Sulfurihydro...   169    2e-40 
ref|ZP_04862467.1|  negative regulator of genetic competence C...   169    2e-40 
ref|ZP_02210610.1|  hypothetical protein CLOBAR_00174 [Clostri...   169    2e-40 
ref|ZP_05560294.1|  ATP-dependent Clp protease [Enterococcus f...   168    4e-40 
ref|YP_001988606.1|  ATP-dependent Clp protease, ATP-binding s...   168    4e-40 
ref|YP_807695.1|  ATP-binding subunit of Clp protease and DnaK...   168    4e-40 
ref|ZP_03963995.1|  ATP-binding Clp protease subunit [Lactobac...   168    4e-40 
ref|YP_910817.1|  ATPase [Chlorobium phaeobacteroides DSM 266]...   168    4e-40 
ref|ZP_05574673.1|  ATP-dependent Clp protease, ATP-binding su...   168    4e-40 
ref|ZP_04673395.1|  ATP-binding subunit of Clp protease and Dn...   168    4e-40 
ref|ZP_01385923.1|  UvrB/UvrC protein:AAA ATPase, central regi...   167    5e-40 
ref|YP_001999440.1|  ATPase AAA-2 domain protein [Chlorobaculu...   167    6e-40 
ref|YP_722419.1|  TPR repeat-containing protein [Trichodesmium...   167    7e-40 
ref|YP_877171.1|  negative regulator of genetic competence clp...   167    8e-40 
ref|YP_677696.1|  ATP-dependent Clp protease, ATP-binding subu...   167    8e-40 
ref|ZP_05647784.1|  ATP-dependent Clp protease [Enterococcus c...   166    1e-39 
ref|ZP_05650805.1|  ATP-dependent Clp protease [Enterococcus g...   166    1e-39 
ref|YP_003091412.1|  ATPase AAA-2 domain protein [Pedobacter h...   166    1e-39 
ref|ZP_01884909.1|  ATP-dependent Clp protease, ATP-binding su...   166    1e-39 
ref|YP_001131092.1|  ATPase [Prosthecochloris vibrioformis DSM...   166    2e-39 
gb|ADD69027.1|  ATPase AAA-2 domain protein [Denitrovibrio ace...   166    2e-39 
ref|YP_002122151.1|  ATPase AAA-2 domain protein [Hydrogenobac...   165    3e-39 
ref|YP_002721411.1|  hemolysin B; ClpA, ATPases with chaperone...   165    3e-39 
ref|ZP_04034560.1|  ATP-dependent Clp protease ATP-binding sub...   165    3e-39 
ref|YP_001305289.1|  ATPase [Thermosipho melanesiensis BI429] ...   165    3e-39 
ref|NP_661097.1|  ATP-dependent Clp protease, ATP-binding subu...   165    3e-39 
ref|YP_002334082.1|  ClpC ATPase [Thermosipho africanus TCF52B...   164    4e-39 
emb|CAO89978.1|  unnamed protein product [Microcystis aerugino...   164    5e-39 
ref|YP_001839931.1|  ATPase ClpC, ATP-binding subunit [Leptosp...   164    5e-39 
ref|YP_001470419.1|  ATPase [Thermotoga lettingae TMO] >gb|ABV...   164    6e-39 
ref|ZP_03759160.1|  hypothetical protein CLOSTASPAR_03184 [Clo...   164    6e-39 
ref|ZP_06114240.1|  negative regulator of genetic competence C...   164    6e-39 
ref|ZP_04666598.1|  ATPase AAA-2 domain-containing protein [Cl...   164    7e-39 
ref|ZP_06462942.1|  ATPase AAA-2 domain protein [Hydrogenobacu...   163    8e-39 
ref|YP_003290620.1|  ATPase AAA-2 domain protein [Rhodothermus...   163    8e-39 
ref|ZP_02082908.1|  hypothetical protein CLOBOL_00423 [Clostri...   163    9e-39 
ref|ZP_04599586.1|  hypothetical protein VEIDISOL_01023 [Veill...   163    1e-38 
ref|ZP_01728226.1|  ATP-dependent Clp protease regulatory subu...   163    1e-38 
ref|YP_001543282.1|  ATPase [Herpetosiphon aurantiacus ATCC 23...   163    1e-38 
sp|Q54316.1|HLYB_TREHY  RecName: Full=Hemolysin B >emb|CAA5165...   163    1e-38 
ref|YP_001409886.1|  ATPase [Fervidobacterium nodosum Rt17-B1]...   162    2e-38 
ref|ZP_06345469.1|  ATPase [Clostridium sp. M62/1] >gb|EFE1307...   162    3e-38 
ref|ZP_01772028.1|  Hypothetical protein COLAER_01021 [Collins...   162    3e-38 
ref|YP_795806.1|  ATP-binding subunit of Clp protease and DnaK...   161    3e-38 
ref|ZP_00515365.1|  AAA ATPase, central region:Clp, N terminal...   161    4e-38 
ref|YP_375817.1|  ATPase [Chlorobium luteolum DSM 273] >gb|ABB...   161    4e-38 
ref|YP_001802418.1|  ATP-dependent Clp protease, regulatory su...   161    4e-38 
ref|YP_003062424.1|  ATP-dependent Clp protease, ATP-binding s...   161    5e-38 
ref|ZP_04014564.1|  ATPase with chaperone activity, ATP-bindin...   160    6e-38 
ref|NP_784715.1|  ATP-dependent Clp protease, ATP-binding subu...   160    7e-38 
ref|YP_001307269.1|  ATPase [Clostridium beijerinckii NCIMB 80...   160    8e-38 
ref|ZP_02951321.1|  negative regulator of genetic competence C...   160    1e-37 
ref|ZP_01874899.1|  probable endopeptidase ATP-binding chain c...   160    1e-37 
ref|ZP_05129494.1|  ATPase AAA-2 domain-containing protein [Cl...   159    1e-37 
ref|ZP_03462989.1|  hypothetical protein BACPEC_02075 [Bactero...   159    1e-37 
ref|ZP_02079104.1|  hypothetical protein CLOLEP_00542 [Clostri...   159    2e-37 
ref|ZP_01720103.1|  ATPase [Algoriphagus sp. PR1] >gb|EAZ80552...   159    2e-37 
ref|ZP_05514721.1|  ATPase AAA-2 domain protein [Streptomyces ...   159    2e-37 
ref|ZP_03957949.1|  ATP-binding Clp protease subunit [Lactobac...   158    4e-37 
ref|ZP_05766129.1|  ATP-dependent Clp protease, ATP-binding su...   158    4e-37 
ref|YP_002728304.1|  negative regulator of genetic competence ...   157    5e-37 
ref|ZP_03755006.1|  hypothetical protein ROSEINA2194_03436 [Ro...   157    6e-37 
ref|YP_003386219.1|  ATPase AAA-2 domain protein [Spirosoma li...   157    7e-37 
ref|YP_445441.1|  ATP-dependent Clp protease, ATPase subunit [...   157    7e-37 
ref|ZP_04743091.1|  negative regulator of genetic competence C...   157    8e-37 
ref|ZP_00604499.1|  UvrB/UvrC protein:AAA ATPase, central regi...   157    9e-37 
ref|ZP_05923525.1|  uvrB/uvrC protein/AAA ATPase [Enterococcus...   157    9e-37 
ref|ZP_03982883.1|  ATPase/chaperone ClpC, specificity factor ...   157    9e-37 
ref|ZP_05679468.1|  UvrB/UvrC protein/AAA ATPase [Enterococcus...   157    1e-36 
ref|ZP_04452516.1|  hypothetical protein GCWU000182_01820 [Abi...   156    2e-36 
ref|YP_001560551.1|  ATPase [Clostridium phytofermentans ISDg]...   156    2e-36 
ref|NP_925014.1|  endopeptidase Clp ATP-binding chain [Gloeoba...   155    2e-36 
ref|ZP_03779759.1|  hypothetical protein CLOHYLEM_06839 [Clost...   155    2e-36 
ref|YP_001919641.1|  negative regulator of genetic competence ...   155    2e-36 
dbj|BAI81574.1|  ATP-dependent Clp protease, ATP-binding subun...   155    3e-36 
ref|ZP_04821814.1|  putative negative regulator of genetic com...   155    3e-36 
ref|YP_823552.1|  ATPase [Solibacter usitatus Ellin6076] >gb|A...   154    5e-36 
ref|NP_219791.1|  ClpC protease ATPase [Chlamydia trachomatis ...   154    6e-36 
ref|ZP_04009690.1|  ATP-dependent Clp protease, ATP-binding su...   154    6e-36 
ref|YP_219762.1|  negative regulator of genetic competence clp...   154    6e-36 
ref|ZP_06403556.1|  ATPase AAA-2 domain protein [bacterium S5]...   154    7e-36 
ref|YP_535094.1|  negative regulator of genetic competence [La...   154    7e-36 
ref|XP_001752142.1|  predicted protein [Physcomitrella patens ...   154    7e-36 
ref|YP_002887903.1|  ATP-dependent Clp protease [Chlamydia tra...   154    7e-36 
ref|YP_001884443.1|  negative regulator of genetic competence ...   154    7e-36 
ref|YP_002930151.1|  ATP-dependent Clp protease ATP-binding su...   154    8e-36 
ref|ZP_05380653.1|  ATP-dependent Clp protease [Chlamydia trac...   153    9e-36 
ref|YP_328094.1|  negative regulator of genetic competence [Ch...   153    9e-36 
ref|ZP_05353657.1|  ATP-dependent Clp protease [Chlamydia trac...   153    9e-36 
ref|ZP_05382503.1|  ATP-dependent Clp protease [Chlamydia trac...   153    1e-35 
ref|YP_001654615.1|  ATP-dependent Clp protease [Chlamydia tra...   153    1e-35 
ref|ZP_06194742.1|  ATP-dependent Clp protease, ATP-binding su...   153    1e-35 
ref|NP_296935.1|  ATP-dependent Clp protease, ATP-binding subu...   153    1e-35 
ref|YP_796845.1|  ATP-dependent Clp protease [Leptospira borgp...   152    2e-35 
ref|YP_001728873.1|  ATPase with chaperone activity, ATP-bindi...   152    2e-35 
ref|ZP_03960241.1|  ATP-binding Clp protease subunit [Lactobac...   152    2e-35 
ref|YP_003089384.1|  ATPase AAA-2 domain protein [Dyadobacter ...   152    2e-35 
ref|ZP_03990933.1|  ATPase with chaperone activity, ATP-bindin...   152    2e-35 
ref|ZP_01996861.1|  hypothetical protein DORLON_02886 [Dorea l...   152    2e-35 
ref|ZP_04782516.1|  ATPase with chaperone activity, ATP-bindin...   152    3e-35 
ref|ZP_05745422.1|  conserved hypothetical protein [Lactobacil...   151    4e-35 
ref|NP_444865.1|  ATP-dependent Clp protease, ATP-binding subu...   151    4e-35 
ref|ZP_05855033.1|  negative regulator of genetic competence C...   151    4e-35 
ref|NP_224637.1|  ClpC protease [Chlamydophila pneumoniae CWL0...   151    5e-35 
ref|YP_001272077.1|  ATPase [Lactobacillus reuteri DSM 20016] ...   151    5e-35 
ref|ZP_03072953.1|  ATPase AAA-2 domain protein [Lactobacillus...   150    6e-35 
gb|ACZ33417.1|  negative regulator of genetic competence ClpC/...   150    6e-35 
ref|XP_001757304.1|  predicted protein [Physcomitrella patens ...   150    8e-35 
ref|YP_002755785.1|  ATP-dependent Clp protease, ATP-binding s...   150    8e-35 
ref|YP_001576819.1|  ATP-dependent Clp protease [Lactobacillus...   150    8e-35 
ref|ZP_05752584.1|  conserved hypothetical protein [Lactobacil...   150    8e-35 
ref|NP_300494.1|  ClpC protease [Chlamydophila pneumoniae J138...   150    1e-34 
ref|NP_829225.1|  ATP-dependent Clp protease, ATP-binding subu...   150    1e-34 
gb|AAP68613.1|  ClpC [Bacillus cereus]                              150    1e-34 
gb|ABO32597.1|  ATP-dependent Clp protease ATP-binding subunit...   149    1e-34 
ref|ZP_03974462.1|  ATP-binding Clp protease subunit [Lactobac...   149    1e-34 
gb|ABB97103.1|  ClpC [Bacillus cereus]                              149    1e-34 
gb|ABB97114.1|  ClpC [Bacillus cereus]                              149    1e-34 
gb|AAP68609.1|  ClpC [Bacillus weihenstephanensis]                  149    1e-34 
gb|AAP68604.1|  ClpC [Bacillus cereus] >gb|AAP68605.1| ClpC [B...   149    1e-34 
gb|AAP68602.1|  ClpC [Bacillus thuringiensis serovar israelens...   149    2e-34 
ref|ZP_03942905.1|  ATPase/chaperone ClpC [Lactobacillus buchn...   149    2e-34 
ref|ZP_04449661.1|  hypothetical protein GCWU000282_00891 [Cat...   149    2e-34 
gb|ABB97123.1|  ClpC [Bacillus thuringiensis] >gb|ABB97125.1| ...   149    2e-34 
ref|ZP_06197365.1|  ATP-dependent Clp protease ATP-binding sub...   149    2e-34 
gb|ABB97128.1|  ClpC [Bacillus thuringiensis] >gb|ABB97137.1| ...   148    3e-34 
ref|NP_710572.1|  ATPase (clpc) [Leptospira interrogans serova...   148    3e-34 
gb|ABB97124.1|  ClpC [Bacillus thuringiensis]                       148    3e-34 
ref|YP_515569.1|  ATP-dependent Clp endopeptidase ATP-binding ...   148    3e-34 
ref|YP_000329.1|  hemolysin B [Leptospira interrogans serovar ...   148    3e-34 
ref|ZP_03939971.1|  ATP-binding Clp protease subunit [Lactobac...   148    3e-34 
gb|AAP68611.1|  ClpC [Bacillus weihenstephanensis] >gb|AAP6861...   148    4e-34 
ref|ZP_03290610.1|  hypothetical protein CLONEX_02826 [Clostri...   148    4e-34 
ref|ZP_05852723.1|  negative regulator of genetic competence C...   148    4e-34 
ref|ZP_03953032.1|  ATP-binding Clp protease subunit [Lactobac...   147    7e-34 
ref|YP_193207.1|  ATPase [Lactobacillus acidophilus NCFM] >ref...   147    7e-34 
gb|ABB97147.1|  ClpC [Bacillus thuringiensis]                       147    8e-34 
ref|ZP_05863635.1|  ATP-dependent Clp protease ATP-binding sub...   147    1e-33 
ref|ZP_03945525.1|  ATP-binding Clp protease subunit [Lactobac...   147    1e-33 
ref|ZP_06380164.1|  ATPase AAA-2 [Arthrospira platensis str. P...   146    1e-33 
ref|ZP_02433789.1|  hypothetical protein CLOSCI_04074 [Clostri...   146    1e-33 
ref|YP_002938174.1|  ATPase AAA-2 [Eubacterium rectale ATCC 33...   146    1e-33 
ref|YP_001844342.1|  ATP-dependent Clp protease ATP-binding su...   145    2e-33 
ref|YP_817689.1|  ATP-binding subunit of Clp protease and DnaK...   145    2e-33 
ref|ZP_04012317.1|  ATPase [Lactobacillus ultunensis DSM 16047...   145    3e-33 
ref|YP_804906.1|  ATP-binding subunit of Clp protease and DnaK...   145    3e-33 
ref|YP_396392.1|  ATPase/chaperone ClpC, putative specificity ...   145    3e-33 
ref|YP_592648.1|  ATPase AAA-2 [Candidatus Koribacter versatil...   145    3e-33 
ref|ZP_03913405.1|  ATP-binding Clp protease subunit [Leuconos...   145    3e-33 
ref|YP_003126235.1|  ATPase AAA-2 domain protein [Chitinophaga...   144    4e-33 
ref|ZP_01106314.1|  ATP-dependent Clp protease, ATP-binding su...   144    4e-33 
gb|AAL00952.1|AF401667_2  chaperone ATP-dependent protease [La...   144    4e-33 
ref|ZP_05553197.1|  ATP-dependent chaperone ClpB [Lactobacillu...   144    5e-33 
ref|YP_001372995.1|  ATPase [Ochrobactrum anthropi ATCC 49188]...   144    5e-33 
ref|YP_002731503.1|  negative regulator of genetic competence ...   144    7e-33 
ref|ZP_03707652.1|  hypothetical protein CLOSTMETH_02407 [Clos...   144    8e-33 
ref|ZP_02040339.1|  hypothetical protein RUMGNA_01103 [Ruminoc...   144    8e-33 
ref|YP_002967067.1|  protein disaggregation chaperone [Methylo...   143    1e-32 
ref|NP_964351.1|  ATP-dependent Clp protease ATP-binding subun...   143    1e-32 
ref|ZP_00051159.2|  COG0542: ATPases with chaperone activity, ...   143    1e-32 
ref|ZP_02233480.1|  hypothetical protein DORFOR_00317 [Dorea f...   142    2e-32 
emb|CAI65391.1|  ATP-dependent Clp protease, ATP binding subun...   142    2e-32 
ref|ZP_01544252.1|  stress response-related ATPase, class III ...   142    2e-32 
ref|ZP_04047792.1|  ATPase with chaperone activity, ATP-bindin...   142    2e-32 
ref|YP_002247205.1|  negative regulator of genetic competence ...   142    3e-32 
ref|ZP_02179382.1|  ATP-dependent Clp protease [Hydrogenivirga...   141    4e-32 
ref|ZP_03798856.1|  hypothetical protein COPCOM_01112 [Coproco...   141    4e-32 
ref|ZP_01734625.1|  ATP-dependent Clp protease, ATP-binding su...   141    5e-32 
ref|ZP_03459915.1|  hypothetical protein BACEGG_02716 [Bactero...   140    6e-32 
ref|YP_003292499.1|  ATP-dependent Clp protease [Lactobacillus...   140    6e-32 
ref|YP_001543655.1|  ATPase [Herpetosiphon aurantiacus ATCC 23...   140    7e-32 
ref|ZP_04006666.1|  ATP-binding Clp protease subunit [Lactobac...   140    1e-31 
ref|XP_002511055.1|  ERD1 protein, chloroplast precursor, puta...   139    1e-31 
ref|ZP_06553071.1|  hypothetical protein AWRIB429_0461 [Oenoco...   139    1e-31 
ref|YP_810129.1|  ATP-binding subunit of Clp protease and DnaK...   139    1e-31 
ref|ZP_01890904.1|  ATP-dependent Clp protease, ATP-binding su...   139    2e-31 
ref|ZP_06264713.1|  negative regulator of genetic competence C...   139    2e-31 
ref|ZP_01048921.1|  ATP-dependent Clp protease, ATP-binding su...   139    2e-31 
ref|ZP_01966631.1|  hypothetical protein RUMTOR_00170 [Ruminoc...   139    2e-31 
ref|ZP_02163159.1|  ATP-dependent Clp protease, ATP-binding su...   139    2e-31 
gb|AAK59865.1|  AT5g51070/K3K7_27 [Arabidopsis thaliana]            139    2e-31 
ref|YP_001567428.1|  ATPase [Petrotoga mobilis SJ95] >gb|ABX31...   138    3e-31 
ref|NP_568750.1|  ERD1 (EARLY RESPONSIVE TO DEHYDRATION 1); AT...   138    3e-31 
ref|YP_003195584.1|  ATP-dependent Clp protease, ATPase subuni...   138    3e-31 
ref|ZP_01251824.1|  ATP-dependent Clp protease, ATP-binding su...   138    3e-31 
gb|EFD99983.1|  negative regulator of genetic competence ClpC/...   138    4e-31 
ref|ZP_03010135.1|  hypothetical protein BACCOP_02005 [Bactero...   138    4e-31 
ref|ZP_05732794.1|  negative regulator of genetic competence C...   138    5e-31 
ref|NP_809811.1|  ATP-dependent Clp protease [Bacteroides thet...   138    5e-31 
ref|ZP_05787238.1|  negative regulator of genetic competence C...   137    6e-31 
ref|ZP_05281524.1|  negative regulator of genetic competence [...   137    7e-31 
ref|ZP_03955719.1|  ATPase [Lactobacillus jensenii JV-V16] >re...   136    1e-30 
ref|ZP_05737738.1|  negative regulator of genetic competence C...   136    1e-30 
ref|ZP_05549907.1|  ATPase [Lactobacillus crispatus 125-2-CHN]...   136    1e-30 
ref|ZP_03997105.1|  ATPase [Lactobacillus crispatus JV-V01] >r...   136    1e-30 
ref|ZP_03951685.1|  ATP-binding Clp protease subunit [Lactobac...   136    2e-30 
ref|YP_861542.1|  ClpA/ClpB family chaperone [Gramella forseti...   136    2e-30 
ref|ZP_03701202.1|  ATPase AAA-2 domain protein [Flavobacteria...   136    2e-30 
ref|ZP_04856747.1|  ATPase AAA-2 domain-containing protein [Ru...   135    2e-30 
ref|ZP_04645387.1|  negative regulator of genetic competence C...   135    2e-30 
ref|XP_002283802.1|  PREDICTED: hypothetical protein [Vitis vi...   135    2e-30 
ref|ZP_06261984.1|  negative regulator of genetic competence C...   135    2e-30 
emb|CAN67541.1|  hypothetical protein [Vitis vinifera] >emb|CB...   135    2e-30 
ref|ZP_05254723.1|  ATP-dependent Clp protease [Bacteroides sp...   135    2e-30 
ref|ZP_04643869.1|  negative regulator of genetic competence C...   135    2e-30 
ref|YP_001300550.1|  negative regulator of genetic competence ...   135    2e-30 
ref|YP_814127.1|  ATP-binding subunit of Clp protease and DnaK...   135    2e-30 
ref|YP_001889219.1|  ATPase AAA-2 domain protein [Burkholderia...   135    3e-30 
ref|ZP_03014417.1|  hypothetical protein BACINT_01990 [Bactero...   135    3e-30 
ref|ZP_03680528.1|  hypothetical protein BACCELL_04901 [Bacter...   135    3e-30 
ref|YP_366688.1|  putative ClpA/B protease, ATPase subunit [Bu...   135    3e-30 
ref|XP_002318194.1|  predicted protein [Populus trichocarpa] >...   135    4e-30 
gb|ACB15390.1|  ClpC [Bifidobacterium longum]                       135    4e-30 
ref|ZP_03809212.1|  ATP-binding subunit of Clp protease and Dn...   135    4e-30 
ref|ZP_01202814.1|  ATP-dependent Clp protease [Flavobacteria ...   134    4e-30 
ref|YP_003117879.1|  Clp domain protein [Catenulispora acidiph...   134    5e-30 
ref|YP_002822316.1|  amino-terminus of ATPase with conserved A...   134    7e-30 
ref|ZP_03631048.1|  oxidoreductase domain protein [bacterium E...   133    9e-30 
ref|YP_559130.1|  putative ATP-dependent Clp protease, ATP- bi...   133    9e-30 
ref|ZP_03783010.1|  hypothetical protein RUMHYD_02469 [Blautia...   133    1e-29 
ref|YP_002478013.1|  Clp domain protein [Arthrobacter chloroph...   133    1e-29 
ref|ZP_04943955.1|  AAA ATPase, central region [Burkholderia c...   132    2e-29 
ref|ZP_04540410.1|  ATP-dependent Clp protease [Bacteroides sp...   132    2e-29 
ref|ZP_04555885.1|  ATP-dependent Clp protease [Bacteroides sp...   132    2e-29 
ref|ZP_03301315.1|  hypothetical protein BACDOR_02697 [Bactero...   132    2e-29 
ref|ZP_06088935.1|  ATP-dependent Clp protease [Bacteroides sp...   132    2e-29 
ref|YP_621285.1|  ATPase AAA-2 [Burkholderia cenocepacia AU 10...   132    2e-29 
ref|YP_001774681.1|  ATPase [Burkholderia cenocepacia MC0-3] >...   132    2e-29 
ref|YP_001889891.1|  ATPase AAA-2 domain protein [Burkholderia...   132    2e-29 
ref|YP_840901.1|  ATP-dependent protease Clp, ATPase subunit [...   132    2e-29 
ref|YP_001862948.1|  ATPase [Burkholderia phymatum STM815] >gb...   132    3e-29 
ref|ZP_03584772.1|  negative regulator of genetic competence C...   132    3e-29 
ref|YP_001431053.1|  ATPase [Roseiflexus castenholzii DSM 1394...   132    3e-29 
ref|ZP_03571635.1|  negative regulator of genetic competence C...   132    3e-29 
ref|YP_632993.1|  ATP-dependent Clp protease, ATP-binding subu...   131    4e-29 
ref|ZP_02442811.1|  hypothetical protein ANACOL_02104 [Anaerot...   131    4e-29 
ref|YP_618512.1|  ATP-dependent Clp protease, ATP-binding subu...   131    5e-29 
ref|YP_812435.1|  ATP-binding subunit of Clp protease and DnaK...   131    5e-29 
ref|ZP_06237177.1|  Clp domain protein [Frankia sp. EuI1c] >gb...   131    5e-29 
ref|YP_709001.1|  ATP-binding protease [Rhodococcus jostii RHA...   131    6e-29 
ref|YP_001816399.1|  ATPase [Burkholderia ambifaria MC40-6] >g...   130    6e-29 
ref|NP_190131.1|  Clp amino terminal domain-containing protein...   130    6e-29 
ref|ZP_02891919.1|  ATPase AAA-2 domain protein [Burkholderia ...   130    7e-29 
ref|ZP_04948712.1|  ATPase with chaperone activity ATP-binding...   130    7e-29 
ref|YP_001585373.1|  ATPase [Burkholderia multivorans ATCC 176...   130    7e-29 
ref|YP_545279.1|  ATPase AAA-2 [Methylobacillus flagellatus KT...   130    8e-29 
ref|ZP_05143157.1|  ATP-dependent Clp protease ATP-binding sub...   130    9e-29 
ref|YP_517901.1|  hypothetical protein DSY1668 [Desulfitobacte...   130    1e-28 
ref|YP_003346908.1|  ATPase AAA-2 domain protein [Thermotoga n...   130    1e-28 
ref|YP_001936403.1|  Clp protease ATP binding subunit [Heteros...   130    1e-28 
ref|YP_001278585.1|  ATPase [Roseiflexus sp. RS-1] >gb|ABQ9263...   130    1e-28 
ref|YP_960651.1|  ATPase [Marinobacter aquaeolei VT8] >gb|ABM2...   130    1e-28 
gb|AAN78327.1|  ATP-dependent Clp protease ATP-binding subunit...   129    2e-28 
ref|YP_389901.1|  ATPase [Desulfovibrio desulfuricans subsp. d...   129    2e-28 
emb|CAD32531.1|  putative clp protease [uncultured bacterium]       129    2e-28 
ref|NP_001046997.1|  Os02g0526400 [Oryza sativa (japonica cult...   129    2e-28 
ref|YP_003213080.1|  ATP-dependent Clp protease [Clostridium d...   129    2e-28 
ref|YP_777549.1|  ATPase [Burkholderia ambifaria AMMD] >gb|ABI...   129    2e-28 
ref|YP_001338508.1|  ATPase with chaperone activity, ATP-bindi...   129    2e-28 
ref|YP_001580470.1|  Clp domain-containing protein [Burkholder...   129    2e-28 
ref|YP_002008334.1|  ATP-dependent protease [Cupriavidus taiwa...   129    2e-28 
ref|ZP_03541676.1|  ATPase AAA-2 domain protein [Comamonas tes...   129    2e-28 
ref|ZP_04871398.1|  ATPase with chaperone activity [Escherichi...   129    2e-28 
ref|ZP_03168900.1|  hypothetical protein RUMLAC_02603 [Ruminoc...   129    2e-28 
ref|XP_002504270.1|  ATP-dependent clp protease [Micromonas sp...   129    2e-28 
ref|YP_002940597.1|  ATPase AAA-2 domain protein [Kosmotoga ol...   129    2e-28 
ref|YP_001244982.1|  ATPase [Thermotoga petrophila RKU-1] >ref...   129    2e-28 
ref|ZP_03631128.1|  ATP-dependent chaperone ClpB [bacterium El...   129    3e-28 
ref|ZP_03702403.1|  ATPase AAA-2 domain protein [Flavobacteria...   129    3e-28 
ref|YP_002459274.1|  ATP-dependent chaperone ClpB [Desulfitoba...   129    3e-28 
ref|ZP_02909429.1|  ATPase AAA-2 domain protein [Burkholderia ...   129    3e-28 
ref|YP_706636.1|  ATP-binding subunit of heat shock protein Cl...   128    3e-28 
ref|YP_001739465.1|  ATPase [Thermotoga sp. RQ2] >gb|ACB09782....   128    3e-28 
ref|NP_229192.1|  ATP-dependent Clp protease, ATPase subunit [...   128    3e-28 
ref|XP_002321773.1|  predicted protein [Populus trichocarpa] >...   128    3e-28 
ref|YP_002352794.1|  ATPase AAA-2 domain protein [Dictyoglomus...   128    3e-28 
ref|XP_001698633.1|  ClpD chaperone, Hsp100 family [Chlamydomo...   128    3e-28 
gb|ACN34106.1|  unknown [Zea mays]                                  128    4e-28 
gb|ABP48137.1|  putative ATP-dependent Clp protease [Rhodococc...   128    4e-28 
ref|ZP_05791703.1|  ATP-dependent Clp protease ATP-binding sub...   128    4e-28 
ref|YP_002250615.1|  ATPase, AAA family [Dictyoglomus thermoph...   128    5e-28 
ref|ZP_02632840.1|  negative regulator of genetic competence M...   128    5e-28 
ref|ZP_06220724.1|  ATP-dependent chaperone ClpB [Micromonospo...   128    5e-28 
ref|ZP_02640355.1|  negative regulator of genetic competence M...   127    5e-28 
ref|YP_002534742.1|  ATP-dependent Clp protease, ATPase subuni...   127    5e-28 
ref|YP_003343842.1|  ATP-dependent Clp protease ATP-binding su...   127    6e-28 
ref|YP_697129.1|  negative regulator of genetic competence Mec...   127    6e-28 
ref|NP_563357.1|  negative regulator of genetic competence Mec...   127    6e-28 
ref|YP_003275465.1|  ATP-dependent chaperone ClpB [Gordonia br...   127    6e-28 
ref|ZP_01118020.1|  ATP-dependent Clp protease, ATP-binding su...   127    7e-28 
ref|YP_003322946.1|  ATP-dependent chaperone ClpB [Thermobacul...   126    1e-27 
ref|YP_002463181.1|  ATPase AAA-2 domain protein [Chloroflexus...   126    1e-27 
ref|ZP_01289463.1|  AAA ATPase, central region:Clp, N terminal...   126    1e-27 
ref|YP_002478011.1|  Clp domain protein [Arthrobacter chloroph...   126    2e-27 
ref|ZP_04385140.1|  ATP-dependent chaperone protein ClpB [Rhod...   126    2e-27 
ref|YP_003097018.1|  ATP-dependent Clp protease, ATP-binding s...   126    2e-27 
ref|YP_001542808.1|  ATPase [Herpetosiphon aurantiacus ATCC 23...   126    2e-27 
ref|YP_699699.1|  negative regulator of genetic competence Mec...   126    2e-27 
ref|YP_001634655.1|  ATPase [Chloroflexus aurantiacus J-10-fl]...   125    2e-27 
ref|YP_293114.1|  AAA ATPase, central region:Clp, N terminal [...   125    3e-27 
ref|YP_003154686.1|  ATPase with chaperone activity, ATP-bindi...   125    3e-27 
ref|YP_001187860.1|  ATPase [Pseudomonas mendocina ymp] >gb|AB...   125    4e-27 
emb|CAL56865.1|  Chaperone HSP104 and related ATP-dependent Cl...   125    4e-27 
ref|NP_745459.1|  chaperone-associated ATPase, putative [Pseud...   125    4e-27 
ref|YP_001172855.1|  chaperone-associated ATPase, putative [Ps...   125    4e-27 
ref|ZP_02733892.1|  ATPase AAA-2 domain protein [Gemmata obscu...   124    5e-27 
ref|YP_001431315.1|  ATPase [Roseiflexus castenholzii DSM 1394...   124    6e-27 
ref|ZP_02422906.1|  hypothetical protein EUBSIR_01757 [Eubacte...   124    8e-27 
ref|YP_731101.1|  ATP-dependent Clp protease, Hsp 100, ATP-bin...   124    8e-27 
ref|XP_002446394.1|  hypothetical protein SORBIDRAFT_06g015220...   123    9e-27 
emb|CAE05369.1|  OJ000315_02.14 [Oryza sativa (japonica cultiv...   123    1e-26 
ref|ZP_05476574.1|  Clp domain-containing protein [Streptomyce...   123    1e-26 
gb|EEC77225.1|  hypothetical protein OsI_15769 [Oryza sativa I...   123    1e-26 
emb|CAH66527.1|  H0502B11.7 [Oryza sativa (indica cultivar-gro...   123    1e-26 
ref|YP_003408710.1|  Clp domain protein [Geodermatophilus obsc...   123    1e-26 
ref|ZP_03946902.1|  ATPase with chaperone activity, ATP-bindin...   123    2e-26 
ref|YP_001861618.1|  ATPase [Burkholderia phymatum STM815] >gb...   122    2e-26 
ref|ZP_01125074.1|  ATP-dependent Clp protease, Hsp 100, ATP-b...   122    2e-26 
ref|YP_003117124.1|  ATP-dependent chaperone ClpB [Catenulispo...   122    2e-26 
ref|ZP_05860160.1|  negative regulator of genetic competence C...   122    2e-26 
ref|YP_001278364.1|  ATPase [Roseiflexus sp. RS-1] >gb|ABQ9241...   122    2e-26 
ref|YP_821800.1|  ATPase [Solibacter usitatus Ellin6076] >gb|A...   122    2e-26 
ref|ZP_02025949.1|  hypothetical protein EUBVEN_01205 [Eubacte...   122    2e-26 
ref|YP_182121.1|  chaperone ClpB [Dehalococcoides ethenogenes ...   122    3e-26 
ref|YP_001530576.1|  ATPase [Desulfococcus oleovorans Hxd3] >g...   122    3e-26 
ref|YP_001377827.1|  ATPase [Anaeromyxobacter sp. Fw109-5] >gb...   121    4e-26 
ref|ZP_06004236.1|  ATPase with chaperone activity, ATP-bindin...   121    4e-26 
ref|ZP_01313912.1|  ATPase AAA-2 [Desulfuromonas acetoxidans D...   121    5e-26 
gb|EEH56038.1|  ATP-dependent clp protease [Micromonas pusilla...   121    5e-26 
ref|YP_002490837.1|  ATP-dependent chaperone ClpB [Anaeromyxob...   121    5e-26 
ref|YP_463598.1|  AAA ATPase, ClpA/B [Anaeromyxobacter dehalog...   121    5e-26 
ref|YP_643458.1|  ATPase AAA-2 [Rubrobacter xylanophilus DSM 9...   121    6e-26 
ref|YP_376921.1|  ATPase [Synechococcus sp. CC9902] >gb|ABB258...   121    6e-26 
ref|YP_003330634.1|  ATP-dependent Clp protease ATP-binding su...   120    7e-26 
ref|ZP_02076146.1|  hypothetical protein CLOL250_02934 [Clostr...   120    7e-26 
ref|YP_002461696.1|  ATP-dependent chaperone ClpB [Chloroflexu...   120    1e-25 
ref|NP_683242.1|  endopeptidase Clp ATP-binding chain B [Therm...   120    1e-25 
ref|YP_002432590.1|  ATP-dependent chaperone ClpB [Desulfatiba...   120    1e-25 
ref|YP_001469653.1|  ATPase [Thermotoga lettingae TMO] >gb|ABV...   120    1e-25 
ref|ZP_04046742.1|  ATP-dependent chaperone ClpB [Brachyspira ...   120    1e-25 
ref|YP_308336.1|  ATP-dependent Clp protease, ATP-binding subu...   120    1e-25 
ref|XP_002452189.1|  hypothetical protein SORBIDRAFT_04g021410...   120    1e-25 
ref|YP_001214677.1|  ATPase [Dehalococcoides sp. BAV1] >gb|ABQ...   120    1e-25 
ref|YP_473669.1|  ATP-dependent chaperone protein ClpB [Synech...   120    1e-25 
ref|YP_001180831.1|  ATPase [Caldicellulosiruptor saccharolyti...   119    1e-25 
ref|ZP_06416807.1|  ATP-dependent chaperone ClpB [Frankia sp. ...   119    1e-25 
sp|Q7U637.2|CLPB1_SYNPX  RecName: Full=Chaperone protein clpB 1     119    2e-25 
ref|YP_478720.1|  ATP-dependent chaperone protein ClpB [Synech...   119    2e-25 
ref|NP_897596.1|  endopeptidase Clp ATP-binding chain B [Synec...   119    2e-25 
ref|ZP_06074899.1|  conserved hypothetical protein [Bacteroide...   119    3e-25 
ref|YP_002132784.1|  ATP-dependent chaperone ClpB [Anaeromyxob...   119    3e-25 
ref|YP_001812971.1|  ATP-dependent chaperone ClpB [Exiguobacte...   119    3e-25 
ref|ZP_06192891.1|  hypothetical protein SOD_i00430 [Serratia ...   119    3e-25 
gb|AAD25872.1|AF027500_2  ATP-dependent Clp protease regulator...   118    3e-25 
ref|ZP_04658011.1|  ATPase with chaperone activity, ATP-bindin...   118    3e-25 
ref|YP_003317591.1|  ATP-dependent chaperone ClpB [Thermanaero...   118    3e-25 
ref|ZP_05788440.1|  ATP-dependent chaperone ClpB [Synechococcu...   118    4e-25 
ref|ZP_05085639.1|  ATP-dependent chaperone ClpB [Pseudovibrio...   118    4e-25 
ref|XP_001690745.1|  hypothetical protein CHLREDRAFT_110360 [C...   118    4e-25 
ref|YP_002886613.1|  ATP-dependent chaperone ClpB [Exiguobacte...   118    4e-25 
ref|ZP_01468117.1|  ATPase [Synechococcus sp. BL107] >gb|EAU72...   118    5e-25 
ref|ZP_01079874.1|  ATP-dependent Clp protease, Hsp 100, ATP-b...   117    5e-25 
ref|ZP_05536411.1|  ATP-dependent Clp protease [Streptomyces v...   117    6e-25 
ref|YP_002137394.1|  ATP-dependent chaperone ClpB [Geobacter b...   117    6e-25 
ref|YP_002249718.1|  chaperone ClpB 1 [Thermodesulfovibrio yel...   117    6e-25 
ref|ZP_05016280.1|  chaperone protein clpB [Streptomyces svice...   117    6e-25 
ref|YP_506019.1|  ClpB protein [Neorickettsia sennetsu str. Mi...   117    7e-25 
ref|YP_379783.1|  ATPase [Chlorobium chlorochromatii CaD3] >gb...   117    7e-25 
ref|ZP_04288227.1|  Chaperone protein clpB 1 [Bacillus cereus ...   117    8e-25 
ref|ZP_03627188.1|  AAA ATPase central domain protein [bacteri...   117    9e-25 
ref|ZP_04232569.1|  Chaperone protein clpB 1 [Bacillus cereus ...   117    9e-25 
ref|YP_002573379.1|  ATP-dependent chaperone ClpB [Anaerocellu...   117    1e-24 
ref|ZP_05519426.1|  ATP-dependent Clp protease [Streptomyces h...   117    1e-24 
ref|ZP_06467136.1|  putative ATP-dependent Clp protease, ATP-b...   116    1e-24 
ref|NP_828417.1|  ATP-dependent Clp protease [Streptomyces ave...   116    1e-24 
ref|ZP_04095428.1|  Chaperone protein clpB 1 [Bacillus thuring...   116    1e-24 
ref|ZP_05091410.1|  ATP-dependent chaperone ClpB [Carboxydibra...   116    1e-24 
ref|ZP_05482232.1|  ATP-dependent Clp protease [Streptomyces s...   116    1e-24 
ref|YP_873877.1|  ATPase [Acidothermus cellulolyticus 11B] >gb...   116    2e-24 
ref|ZP_03154871.1|  Clp domain protein [Cyanothece sp. PCC 782...   116    2e-24 
emb|CBH38955.1|  chaperone clpB [uncultured archaeon]               115    2e-24 
ref|YP_001550958.1|  ATP-dependent Clp protease, Hsp 100, ATP-...   115    2e-24 
ref|NP_894282.1|  ATP-dependent Clp protease, Hsp 100, ATP-bin...   115    2e-24 
ref|YP_001017839.1|  ATP-dependent Clp protease, Hsp 100, ATP-...   115    3e-24 
ref|YP_712816.1|  ATP-dependent protease, Hsp 100, part of mul...   115    3e-24 
ref|ZP_04244121.1|  Chaperone protein clpB 1 [Bacillus cereus ...   115    3e-24 
ref|YP_003198720.1|  ATP-dependent chaperone ClpB [Desulfohalo...   115    3e-24 
ref|YP_002720783.1|  ATP-dependent Clp protease, ATP-binding s...   115    3e-24 
ref|ZP_04226736.1|  Chaperone protein clpB 1 [Bacillus cereus ...   115    3e-24 
ref|ZP_06370967.1|  ATP-dependent chaperone ClpB [Desulfovibri...   115    3e-24 
ref|YP_001625018.1|  ClpB [Renibacterium salmoninarum ATCC 332...   115    3e-24 
ref|ZP_05709069.1|  ATP-dependent chaperone ClpB [Desulfurivib...   115    3e-24 
emb|CBH37545.1|  chaperone clpB [uncultured archaeon]               115    3e-24 
ref|YP_461928.1|  clpB protein [Syntrophus aciditrophicus SB] ...   115    4e-24 
ref|YP_001636713.1|  ATP-dependent chaperone ClpB [Chloroflexu...   115    4e-24 
ref|YP_593838.1|  ATPase AAA-2 [Candidatus Koribacter versatil...   115    4e-24 
ref|ZP_06566706.1|  putative ATP-dependent Clp protease [Sacch...   115    4e-24 
ref|YP_002521690.1|  chaperone clpB 1 [Thermomicrobium roseum ...   114    4e-24 
ref|YP_002954444.1|  chaperone ClpB [Desulfovibrio magneticus ...   114    5e-24 
ref|ZP_05033581.1|  ATPase, AAA family [Brevundimonas sp. BAL3...   114    5e-24 
ref|YP_002450202.1|  ATP-dependent Clp protease, ATP-binding s...   114    5e-24 
ref|YP_003323127.1|  ATPase AAA-2 domain protein [Thermobaculu...   114    5e-24 
ref|ZP_04995991.1|  chaperone protein clpB [Streptomyces sp. M...   114    5e-24 
ref|ZP_03103623.1|  ATP-dependent Clp protease, ATP-binding su...   114    5e-24 
ref|ZP_03104595.1|  ATP-dependent Clp protease, ATP-binding su...   114    5e-24 
ref|ZP_05367749.1|  ATP-dependent chaperone protein ClpB [Roth...   114    5e-24 
ref|YP_003250704.1|  ATPase AAA-2 domain protein [Fibrobacter ...   114    5e-24 
gb|ABD52004.1|  ClpB [Methanohalophilus portucalensis FDF-1]        114    6e-24 
ref|YP_947629.1|  ATP-dependent chaperone protein ClpB [Arthro...   114    7e-24 
ref|ZP_04100999.1|  Chaperone protein clpB 1 [Bacillus thuring...   114    8e-24 
ref|YP_001345959.1|  putative ClpA/B protease ATP binding subu...   114    8e-24 
ref|YP_001305849.1|  ATPase [Thermosipho melanesiensis BI429] ...   114    8e-24 
ref|YP_003493933.1|  chaperone [Streptomyces scabiei 87.22] >e...   114    9e-24 
ref|YP_002535244.1|  ATPase AAA-2 domain protein [Thermotoga n...   113    1e-23 
ref|ZP_01472677.1|  ATP-dependent Clp protease, Hsp 100, ATP-b...   113    1e-23 
ref|YP_001818833.1|  ATP-dependent chaperone ClpB [Opitutus te...   113    1e-23 
ref|YP_003361930.1|  ATPase with chaperone activity, ATP-bindi...   113    1e-23 
ref|YP_003318702.1|  ATP-dependent chaperone ClpB [Sphaerobact...   113    1e-23 
ref|ZP_05517581.1|  Clp domain-containing protein [Streptomyce...   113    1e-23 
ref|ZP_05484108.1|  ATP-dependent chaperone ClpB [Streptomyces...   113    1e-23 
pdb|3FES|A  Chain A, Crystal Structure Of The Atp-Dependent Cl...   113    1e-23 
ref|ZP_05045288.1|  ATP-dependent chaperone ClpB [Cyanobium sp...   113    1e-23 
ref|YP_002316488.1|  Class III stress response-related ATPase ...   112    2e-23 
ref|YP_003384550.1|  ATP-dependent chaperone ClpB [Kribbella f...   112    2e-23 
ref|ZP_05312270.1|  ATP-dependent chaperone ClpB [Geobacter sp...   112    2e-23 
ref|YP_002334499.1|  negative regulator of genetic competence ...   112    2e-23 
ref|YP_001129751.1|  ATPase central domain-containing protein ...   112    2e-23 
ref|YP_003297877.1|  ATP-dependent chaperone ClpB [Thermomonos...   112    2e-23 
ref|YP_002129617.1|  ATP-dependent Clp protease, ATP-binding s...   112    2e-23 
ref|YP_917774.1|  ATPase [Paracoccus denitrificans PD1222] >gb...   112    2e-23 
ref|YP_966736.1|  ATPase [Desulfovibrio vulgaris subsp. vulgar...   112    2e-23 
ref|NP_972639.1|  AAA family ATPase [Treponema denticola ATCC ...   112    2e-23 
ref|YP_011091.1|  ATP-dependent Clp protease, ATP-binding subu...   112    2e-23 
ref|ZP_00391506.1|  COG0542: ATPases with chaperone activity, ...   112    2e-23 
ref|YP_788632.1|  putative ClpA/B protease ATP binding subunit...   112    2e-23 
ref|ZP_01363362.1|  hypothetical protein PaerPA_01000456 [Pseu...   112    2e-23 
ref|NP_830954.1|  ClpB protein [Bacillus cereus ATCC 14579] >r...   112    2e-23 
ref|YP_002438063.1|  putative ClpA/B protease ATP binding subu...   112    2e-23 
ref|ZP_04221462.1|  Chaperone protein clpB 1 [Bacillus cereus ...   112    2e-23 
ref|ZP_04305062.1|  Chaperone protein clpB 1 [Bacillus cereus ...   112    2e-23 
ref|YP_001738099.1|  ATPase [Thermotoga sp. RQ2] >gb|ACB08416....   112    2e-23 
ref|ZP_04930634.1|  hypothetical protein PACG_03381 [Pseudomon...   112    2e-23 
ref|ZP_04202122.1|  Chaperone protein clpB 1 [Bacillus cereus ...   112    2e-23 
ref|ZP_03228720.1|  ATP-dependent Clp protease, ATP-binding su...   112    2e-23 
ref|YP_893902.1|  ATP-dependent Clp protease, ATP-binding subu...   112    2e-23 
ref|YP_082667.1|  ATP-dependent Clp protease, ATP-binding subu...   112    3e-23 
ref|NP_249150.1|  putative ClpA/B protease ATP binding subunit...   112    3e-23 
ref|NP_843655.1|  ATP-dependent Clp protease, ATP-binding subu...   112    3e-23 
ref|ZP_01545920.1|  endopeptidase Clp ATP-binding chain B, clp...   112    3e-23 
ref|ZP_03132808.1|  ATP-dependent chaperone ClpB [Chthoniobact...   112    3e-23 
ref|YP_003135624.1|  ATP-dependent chaperone ClpB [Saccharomon...   112    3e-23 
ref|YP_003226882.1|  ATP-dependent chaperone ClpB [Zymomonas m...   112    3e-23 
ref|ZP_03310632.1|  hypothetical protein DESPIG_00521 [Desulfo...   112    3e-23 
ref|YP_001679928.1|  chaperone clpb [Heliobacterium modestical...   112    3e-23 
ref|ZP_04185042.1|  Chaperone protein clpB 1 [Bacillus cereus ...   112    3e-23 
ref|ZP_04316380.1|  Chaperone protein clpB 1 [Bacillus cereus ...   112    3e-23 
ref|ZP_03291463.1|  hypothetical protein CLONEX_03685 [Clostri...   112    3e-23 
ref|ZP_00239072.1|  ATP-dependent Clp protease, ATP-binding su...   112    3e-23 
ref|YP_163159.1|  ATP-dependent chaperone ClpB [Zymomonas mobi...   112    3e-23 
ref|YP_001831962.1|  ATP-dependent chaperone ClpB [Beijerincki...   112    4e-23 
ref|YP_446924.1|  ATP-dependent chaperone protein ClpB [Salini...   111    4e-23 
ref|YP_003204426.1|  Clp domain protein [Nakamurella multipart...   111    4e-23 
ref|ZP_04083345.1|  Chaperone protein clpB 1 [Bacillus thuring...   111    4e-23 
ref|ZP_04299483.1|  Chaperone protein clpB 1 [Bacillus cereus ...   111    4e-23 
ref|YP_002768744.1|  hypothetical protein RER_52970 [Rhodococc...   111    4e-23 
emb|CAO87136.1|  unnamed protein product [Microcystis aerugino...   111    4e-23 
ref|YP_002777567.1|  hypothetical protein ROP_03750 [Rhodococc...   111    4e-23 
ref|YP_001381349.1|  ATPase [Anaeromyxobacter sp. Fw109-5] >gb...   111    4e-23 
ref|ZP_04196301.1|  Chaperone protein clpB 1 [Bacillus cereus ...   111    5e-23 
ref|YP_001232674.1|  ATPase [Geobacter uraniireducens Rf4] >gb...   111    5e-23 
ref|ZP_05347227.1|  negative regulator of genetic competence C...   111    5e-23 
ref|YP_901407.1|  ATPase [Pelobacter propionicus DSM 2379] >gb...   111    5e-23 
ref|YP_002815991.1|  ATP-dependent Clp protease, ATP-binding s...   111    5e-23 
ref|ZP_03853962.1|  ATPase with chaperone activity ATP-binding...   111    5e-23 
ref|YP_951503.1|  ATPase [Mycobacterium vanbaalenii PYR-1] >gb...   111    5e-23 
ref|YP_001243659.1|  ATPase [Thermotoga petrophila RKU-1] >ref...   111    6e-23 

ALIGNMENTS
>ref|ZP_05516740.1| putative ATP-dependent Clp protease [Streptomyces hygroscopicus 
ATCC 53653]
Length=840

 Score =  396 bits (1018),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 200/210 (95%), Positives = 203/210 (96%), Gaps = 1/210 (0%)

Query  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKGLEALGISLEAVR  60
            MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAK LE+LGISLEAVR
Sbjct  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKALESLGISLEAVR  60

Query  61   SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120
             QVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA
Sbjct  61   QQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120

Query  121  AQVLVKLGADLNRVRQQVIQLLSGYQGKEAVSAGAP-EGTPATSLVLDQFGRNLTVAARE  179
            AQVLVKLGADLNRVRQQVIQLLSGYQGKEA +AG P EGTP+TSLVLDQFGRNLT AARE
Sbjct  121  AQVLVKLGADLNRVRQQVIQLLSGYQGKEAATAGGPAEGTPSTSLVLDQFGRNLTQAARE  180

Query  180  GKLDPVIGREKEIERVMQVLSRRTKNNPVL  209
             KLDPVIGREKEIERVMQVLSRRTKNNPVL
Sbjct  181  SKLDPVIGREKEIERVMQVLSRRTKNNPVL  210


>ref|ZP_05013969.1| ATP-dependent Clp protease [Streptomyces pristinaespiralis ATCC 
25486]
 gb|EDY66533.1| ATP-dependent Clp protease [Streptomyces pristinaespiralis ATCC 
25486]
Length=841

 Score =  396 bits (1017),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 200/210 (95%), Positives = 203/210 (96%), Gaps = 1/210 (0%)

Query  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKGLEALGISLEAVR  60
            MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAK LE+LGISLEAVR
Sbjct  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKALESLGISLEAVR  60

Query  61   SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120
             QVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA
Sbjct  61   QQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120

Query  121  AQVLVKLGADLNRVRQQVIQLLSGYQGKEAVSAGAP-EGTPATSLVLDQFGRNLTVAARE  179
            AQVLVKLGADLNRVRQQVIQLLSGYQGKEA +AG P EGTP+TSLVLDQFGRNLT AARE
Sbjct  121  AQVLVKLGADLNRVRQQVIQLLSGYQGKEAATAGGPAEGTPSTSLVLDQFGRNLTQAARE  180

Query  180  GKLDPVIGREKEIERVMQVLSRRTKNNPVL  209
             KLDPVIGREKEIERVMQVLSRRTKNNPVL
Sbjct  181  SKLDPVIGREKEIERVMQVLSRRTKNNPVL  210


>ref|YP_003489580.1| putative Clp family ATP-binding protease [Streptomyces scabiei 
87.22]
 emb|CBG71029.1| putative Clp-family ATP-binding protease [Streptomyces scabiei 
87.22]
Length=841

 Score =  395 bits (1015),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 199/210 (94%), Positives = 202/210 (96%), Gaps = 1/210 (0%)

Query  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKGLEALGISLEAVR  60
            MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAK LE+LGISLEAVR
Sbjct  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKALESLGISLEAVR  60

Query  61   SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120
             QVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA
Sbjct  61   QQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120

Query  121  AQVLVKLGADLNRVRQQVIQLLSGYQGKEAVSAGAP-EGTPATSLVLDQFGRNLTVAARE  179
            AQVLVKLGADLNRVRQQVIQLLSGYQGKE  +AG P EGTP+TSLVLDQFGRNLT AARE
Sbjct  121  AQVLVKLGADLNRVRQQVIQLLSGYQGKETATAGGPAEGTPSTSLVLDQFGRNLTQAARE  180

Query  180  GKLDPVIGREKEIERVMQVLSRRTKNNPVL  209
             KLDPVIGREKEIERVMQVLSRRTKNNPVL
Sbjct  181  SKLDPVIGREKEIERVMQVLSRRTKNNPVL  210


>ref|ZP_05019313.1| ATP-dependent Clp protease [Streptomyces sviceus ATCC 29083]
 gb|EDY57871.1| ATP-dependent Clp protease [Streptomyces sviceus ATCC 29083]
Length=841

 Score =  395 bits (1014),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 199/210 (94%), Positives = 202/210 (96%), Gaps = 1/210 (0%)

Query  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKGLEALGISLEAVR  60
            MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAK LE+LGISLEAVR
Sbjct  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKALESLGISLEAVR  60

Query  61   SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120
             QVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA
Sbjct  61   QQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120

Query  121  AQVLVKLGADLNRVRQQVIQLLSGYQGKEAVSAGAP-EGTPATSLVLDQFGRNLTVAARE  179
            AQVLVKLGADLNRVRQQVIQLLSGYQGKE  +AG P EGTP+TSLVLDQFGRNLT AARE
Sbjct  121  AQVLVKLGADLNRVRQQVIQLLSGYQGKETATAGGPAEGTPSTSLVLDQFGRNLTQAARE  180

Query  180  GKLDPVIGREKEIERVMQVLSRRTKNNPVL  209
             KLDPVIGREKEIERVMQVLSRRTKNNPVL
Sbjct  181  SKLDPVIGREKEIERVMQVLSRRTKNNPVL  210


>ref|ZP_05539687.1| Clp-family ATP-binding protease [Streptomyces griseoflavus Tu4000]
Length=841

 Score =  395 bits (1014),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 199/210 (94%), Positives = 202/210 (96%), Gaps = 1/210 (0%)

Query  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKGLEALGISLEAVR  60
            MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAK LE+LGISLEAVR
Sbjct  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKALESLGISLEAVR  60

Query  61   SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120
             QVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA
Sbjct  61   QQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120

Query  121  AQVLVKLGADLNRVRQQVIQLLSGYQGKEAVSAGAP-EGTPATSLVLDQFGRNLTVAARE  179
            AQVLVKLGADLNRVRQQVIQLLSGYQGKE  +AG P EGTP+TSLVLDQFGRNLT AARE
Sbjct  121  AQVLVKLGADLNRVRQQVIQLLSGYQGKETATAGGPAEGTPSTSLVLDQFGRNLTQAARE  180

Query  180  GKLDPVIGREKEIERVMQVLSRRTKNNPVL  209
             KLDPVIGREKEIERVMQVLSRRTKNNPVL
Sbjct  181  SKLDPVIGREKEIERVMQVLSRRTKNNPVL  210


>ref|NP_627581.1| Clp-family ATP-binding protease [Streptomyces coelicolor A3(2)]
 ref|ZP_05525452.1| Clp-family ATP-binding protease [Streptomyces lividans TK24]
 ref|ZP_06530292.1| Clp-family ATP-binding protease [Streptomyces lividans TK24]
 emb|CAB40873.1| putative Clp-family ATP-binding protease [Streptomyces coelicolor 
A3(2)]
 gb|EFD68542.1| Clp-family ATP-binding protease [Streptomyces lividans TK24]
Length=841

 Score =  395 bits (1014),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 199/210 (94%), Positives = 202/210 (96%), Gaps = 1/210 (0%)

Query  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKGLEALGISLEAVR  60
            MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAK LE+LGISLEAVR
Sbjct  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKALESLGISLEAVR  60

Query  61   SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120
             QVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA
Sbjct  61   QQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120

Query  121  AQVLVKLGADLNRVRQQVIQLLSGYQGKEAVSAGAP-EGTPATSLVLDQFGRNLTVAARE  179
            AQVLVKLGADLNRVRQQVIQLLSGYQGKE  +AG P EGTP+TSLVLDQFGRNLT AARE
Sbjct  121  AQVLVKLGADLNRVRQQVIQLLSGYQGKETATAGGPAEGTPSTSLVLDQFGRNLTQAARE  180

Query  180  GKLDPVIGREKEIERVMQVLSRRTKNNPVL  209
             KLDPVIGREKEIERVMQVLSRRTKNNPVL
Sbjct  181  SKLDPVIGREKEIERVMQVLSRRTKNNPVL  210


>ref|ZP_05533272.1| ATP-dependent Clp protease [Streptomyces viridochromogenes DSM 
40736]
Length=841

 Score =  395 bits (1014),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 199/210 (94%), Positives = 202/210 (96%), Gaps = 1/210 (0%)

Query  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKGLEALGISLEAVR  60
            MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAK LE+LGISLEAVR
Sbjct  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKALESLGISLEAVR  60

Query  61   SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120
             QVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA
Sbjct  61   QQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120

Query  121  AQVLVKLGADLNRVRQQVIQLLSGYQGKEAVSAGAP-EGTPATSLVLDQFGRNLTVAARE  179
            AQVLVKLGADLNRVRQQVIQLLSGYQGKE  +AG P EGTP+TSLVLDQFGRNLT AARE
Sbjct  121  AQVLVKLGADLNRVRQQVIQLLSGYQGKETAAAGGPAEGTPSTSLVLDQFGRNLTQAARE  180

Query  180  GKLDPVIGREKEIERVMQVLSRRTKNNPVL  209
             KLDPVIGREKEIERVMQVLSRRTKNNPVL
Sbjct  181  SKLDPVIGREKEIERVMQVLSRRTKNNPVL  210


>ref|ZP_04686696.1| ATP-dependent Clp protease [Streptomyces ghanaensis ATCC 14672]
Length=841

 Score =  395 bits (1014),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 199/210 (94%), Positives = 202/210 (96%), Gaps = 1/210 (0%)

Query  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKGLEALGISLEAVR  60
            MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAK LE+LGISLEAVR
Sbjct  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKALESLGISLEAVR  60

Query  61   SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120
             QVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA
Sbjct  61   QQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120

Query  121  AQVLVKLGADLNRVRQQVIQLLSGYQGKEAVSAGAP-EGTPATSLVLDQFGRNLTVAARE  179
            AQVLVKLGADLNRVRQQVIQLLSGYQGKE  +AG P EGTP+TSLVLDQFGRNLT AARE
Sbjct  121  AQVLVKLGADLNRVRQQVIQLLSGYQGKETATAGGPAEGTPSTSLVLDQFGRNLTQAARE  180

Query  180  GKLDPVIGREKEIERVMQVLSRRTKNNPVL  209
             KLDPVIGREKEIERVMQVLSRRTKNNPVL
Sbjct  181  SKLDPVIGREKEIERVMQVLSRRTKNNPVL  210


>ref|NP_825874.1| ATP-dependent Clp protease [Streptomyces avermitilis MA-4680]
 dbj|BAC72409.1| putative ATP-dependent Clp protease [Streptomyces avermitilis 
MA-4680]
Length=841

 Score =  394 bits (1013),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 199/210 (94%), Positives = 202/210 (96%), Gaps = 1/210 (0%)

Query  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKGLEALGISLEAVR  60
            MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAK LE+LGISLEAVR
Sbjct  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKALESLGISLEAVR  60

Query  61   SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120
             QVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA
Sbjct  61   QQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120

Query  121  AQVLVKLGADLNRVRQQVIQLLSGYQGKEAVSAGAP-EGTPATSLVLDQFGRNLTVAARE  179
            AQVLVKLGADLNRVRQQVIQLLSGYQGKE  +AG P EGTP+TSLVLDQFGRNLT AARE
Sbjct  121  AQVLVKLGADLNRVRQQVIQLLSGYQGKETAAAGGPAEGTPSTSLVLDQFGRNLTQAARE  180

Query  180  GKLDPVIGREKEIERVMQVLSRRTKNNPVL  209
             KLDPVIGREKEIERVMQVLSRRTKNNPVL
Sbjct  181  SKLDPVIGREKEIERVMQVLSRRTKNNPVL  210


>ref|YP_483458.1| ATPase AAA-2 [Frankia sp. CcI3]
 gb|ABD13729.1| ATPase AAA-2 [Frankia sp. CcI3]
Length=834

 Score =  392 bits (1007),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 199/211 (94%), Positives = 203/211 (96%), Gaps = 2/211 (0%)

Query  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKGLEALGISLEAVR  60
            MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAK LE+LGISLE VR
Sbjct  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKALESLGISLEGVR  60

Query  61   SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120
            SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA
Sbjct  61   SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120

Query  121  AQVLVKLGADLNRVRQQVIQLLSGYQGK-EAVSAGAP-EGTPATSLVLDQFGRNLTVAAR  178
            AQVLVKLGADLNRVRQQVIQLLSGYQGK E  ++GAP EGTP+TSLVLDQFGRNLT AAR
Sbjct  121  AQVLVKLGADLNRVRQQVIQLLSGYQGKGETATSGAPAEGTPSTSLVLDQFGRNLTAAAR  180

Query  179  EGKLDPVIGREKEIERVMQVLSRRTKNNPVL  209
            E KLDPVIGREKEIERVMQVLSRRTKNNPVL
Sbjct  181  ESKLDPVIGREKEIERVMQVLSRRTKNNPVL  211


>ref|YP_716806.1| ATP-dependent protease, Hsp 100, part of multi-chaperone system 
with DnaK, DnaJ, and GrpE [Frankia alni ACN14a]
 emb|CAJ65303.1| ATP-dependent protease, Hsp 100, part of multi-chaperone system 
with DnaK, DnaJ, and GrpE [Frankia alni ACN14a]
Length=834

 Score =  391 bits (1004),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 199/211 (94%), Positives = 203/211 (96%), Gaps = 2/211 (0%)

Query  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKGLEALGISLEAVR  60
            MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAK LE+LGISLE VR
Sbjct  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKALESLGISLEGVR  60

Query  61   SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120
            SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA
Sbjct  61   SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120

Query  121  AQVLVKLGADLNRVRQQVIQLLSGYQGK-EAVSAGAP-EGTPATSLVLDQFGRNLTVAAR  178
            AQVLVKLGADLNRVRQQVIQLLSGYQGK E  ++GAP EGTP+TSLVLDQFGRNLT AAR
Sbjct  121  AQVLVKLGADLNRVRQQVIQLLSGYQGKGETATSGAPAEGTPSTSLVLDQFGRNLTAAAR  180

Query  179  EGKLDPVIGREKEIERVMQVLSRRTKNNPVL  209
            E KLDPVIGREKEIERVMQVLSRRTKNNPVL
Sbjct  181  ESKLDPVIGREKEIERVMQVLSRRTKNNPVL  211


>ref|ZP_06240151.1| ATPase AAA-2 domain protein [Frankia sp. EuI1c]
 gb|EFA58565.1| ATPase AAA-2 domain protein [Frankia sp. EuI1c]
Length=836

 Score =  391 bits (1004),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 199/211 (94%), Positives = 203/211 (96%), Gaps = 2/211 (0%)

Query  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKGLEALGISLEAVR  60
            MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAK LE+LGISLE VR
Sbjct  1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKALESLGISLEGVR  60

Query  61   SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120
            SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA
Sbjct  61   SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA  120

Query  121  AQVLVKLGADLNRVRQQVIQLLSGYQGK-EAVSAGAP-EGTPATSLVLDQFGRNLTVAAR  178
            AQVLVKLGADLNRVRQQVIQLLSGYQGK +  +AGAP EGTP+TSLVLDQFGRNLT AAR
Sbjct  121  AQVLVKLGADLNRVRQQVIQLLSGYQGKGDPATAGAPSEGTPSTSLVLDQFGRNLTAAAR  180

Query  179  EGKLDPVIGREKEIERVMQVLSRRTKNNPVL  209
            E KLDPVIGREKEIERVMQVLSRRTKNNPVL
Sbjct  181  EAKLDPVIGREKEIERVMQVLSRRTKNNPVL  211