GOS 1389010

From Metagenes
Warning: this metagenomic sequence has been carefully annotated by students during bioinformatics assignments. These quality annotations are therefore the result of a teaching exercise that you are most welcome to amend and extend if necessary!


Sequence
CAMERA AccNum : JCVI_READ_1092963887466
Annotathon code: GOS_1389010
Sample :
  • GPS :2°34'55s; 97°51'5w
  • Tropical South Pacific: Tropical South Pacific - International
  • Open Ocean (-1.8m, 28.4°C, 0.1-0.8 microns)
Authors
Team : Algarve
Username : 768990bio1
Annotated on : 2010-07-30 14:30:16
  • a37076 AnaSofiaCarraçoCosta
  • a37089 LilianaSofiaGriloSantos
  • a37090 ManuelAlexanderGuerreiroVieira

Synopsis

Genomic Sequence

>JCVI_READ_1092963887466 GOS_1389010 Genomic DNA
TCACTGGTAAACCAAAAAGCTTTTTTTCTTTTTTATATTTTATTAGGTTTTTGGTAAGGCGATCTGAATTCTTAACTTCAGAAAAGATTTTTAGTCTATG
GTGAATCTCAAAGGCAATACCAAACTTATCCAGCAAGACAGGTGCCTGATGTGCATAATCAAAATCAAATTTCCTTAATTCCTTTTTATTGGAATTTATA
AAAACGTAGCCGTTTTTAAGCATAATATTTATTATTCTCAGAAAACTAGCCTCTTCAACCAATACATCAATATCTCGCATTATGCGCATAGAGAAATTTG
GGTAAACGAAATTTGACATAAATGCTCCCTTTAAAAGACAAACATCAATATTGTTGGTTTTAGCTAATTTTAAAAAAGACTTAAGTGAGGATTGATACTG
TAAAGATTTTTTTTGAGCAAATAATATGCTTTCTCTAAAATCTTGATCATCCATCGCAGACCTAAATTCTTCACAAGGCCTAGCGAAAAAAAAACTGGCT
GTATTGGTTTTGATGCAATAATCAAAAAAAGATCTTTTTGATTCTTTGTCTTCTAAAGCAAAGTTATTTGTTTTTAACTTAGATAGATAATTTTTAATTA
GTGTCATGTCTATTCTTTTATTAATAATTTTCTAATCCTGATAACTTGAATTTCTAATTTATGCGAAGGATAAATTTTATTCTAACTTCTTTAAGATCAG
AATTTCTATTTTTTCATTTCTTTCCTGATATCTGTTTGACGAATTAAGCACACTATAAAAATTAACTTCATCATCAAGGTTTAGAATTCTCTTTGATTAC
TTGCTCATCAAAATTTTTATCGTCTAGAAGTGGTAGTGATTTAAATGAATTTTCGAAAATTAATGGTAC

Translation

[239 - 868/869]   indirect strand
>GOS_1389010 Translation [239-868   indirect strand]
KIINKRIDMTLIKNYLSKLKTNNFALEDKESKRSFFDYCIKTNTASFFFARPCEEFRSAMDDQDFRESILFAQKKSLQYQSSLKSFLKLAKTNNIDVCLL
KGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINIMLKNGYVFINSNKKELRKFDFDYAHQAPVLLDKFGIAFEIHHRLKIFSEVKNSDRLTKNLIKYK
KEKKLFGLPV

[ Warning ] 5' incomplete: does not start with a Methionine
[ Warning ] 3' incomplete: following codon is not a STOP

Annotator commentaries

The biggest putative ORF finded is probable a ORFan because is a very long sequence with more than 200aa (210aa)and the only significant results were on BLASTp with environmental data base. But we should notice that this could be a no coding sequence because exist a intensive repetition of regions with only one type of nucleotide. This possible ORF is incomplete on 3'end and the initiation codon can't be elected because there aren't enough data.

The "biological process","molecular function", "gene" and "taxonomy" were intentionally left undone.

ORF finding

PROTOCOL

a) SMS ORFinder / forward strand / frames 1, 2 & 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code

b) SMS ORFinder / reverse strand / frames 1, 2 3 / min 60 AA / 'any codon' initiation / 'standard' genetic code




RESULTS ANALYSIS


There are only two putative ORFs with more than 60 amino-acids, and none are of the forward strand.

The larger ORF finded only have true positive homologs in the BLAST results on BLASTp vs ENV_NR (with the E-values 6e-76 and 2e-116) with homology and don't have any hits on Protein Domains, and the smaller don't show any type of results. So the analysis are of the larger ORF.

The larger ORF finded is in reading frame 2, and the smaller is in reading frame 3 and is overlapping with the other ORF.

This ORF because have more than 200 codons is probably a ORFan (a ORF with no known homologs).

RAW RESULTS

a)forward strand

No ORFs were found in reading frame 1.

No ORFs were found in reading frame 2.

No ORFs were found in reading frame 3.

b)reverse strand

No ORFs were found in reading frame 1.

>ORF number 1 in reading frame 2 on the reverse strand extends from base 239 to base 868.
AAAATTATTAATAAAAGAATAGACATGACACTAATTAAAAATTATCTATCTAAGTTAAAA
ACAAATAACTTTGCTTTAGAAGACAAAGAATCAAAAAGATCTTTTTTTGATTATTGCATC
AAAACCAATACAGCCAGTTTTTTTTTCGCTAGGCCTTGTGAAGAATTTAGGTCTGCGATG
GATGATCAAGATTTTAGAGAAAGCATATTATTTGCTCAAAAAAAATCTTTACAGTATCAA
TCCTCACTTAAGTCTTTTTTAAAATTAGCTAAAACCAACAATATTGATGTTTGTCTTTTA
AAGGGAGCATTTATGTCAAATTTCGTTTACCCAAATTTCTCTATGCGCATAATGCGAGAT
ATTGATGTATTGGTTGAAGAGGCTAGTTTTCTGAGAATAATAAATATTATGCTTAAAAAC
GGCTACGTTTTTATAAATTCCAATAAAAAGGAATTAAGGAAATTTGATTTTGATTATGCA
CATCAGGCACCTGTCTTGCTGGATAAGTTTGGTATTGCCTTTGAGATTCACCATAGACTA
AAAATCTTTTCTGAAGTTAAGAATTCAGATCGCCTTACCAAAAACCTAATAAAATATAAA
AAAGAAAAAAAGCTTTTTGGTTTACCAGTG

>Translation of ORF number 1 in reading frame 2 on the reverse strand.
KIINKRIDMTLIKNYLSKLKTNNFALEDKESKRSFFDYCIKTNTASFFFARPCEEFRSAM
DDQDFRESILFAQKKSLQYQSSLKSFLKLAKTNNIDVCLLKGAFMSNFVYPNFSMRIMRD
IDVLVEEASFLRIINIMLKNGYVFINSNKKELRKFDFDYAHQAPVLLDKFGIAFEIHHRL
KIFSEVKNSDRLTKNLIKYKKEKKLFGLPV

>ORF number 1 in reading frame 3 on the reverse strand extends from base 318 to base 500.
AAGACAAAGAATCAAAAAGATCTTTTTTTGATTATTGCATCAAAACCAATACAGCCAGTT
TTTTTTTCGCTAGGCCTTGTGAAGAATTTAGGTCTGCGATGGATGATCAAGATTTTAGAG
AAAGCATATTATTTGCTCAAAAAAAATCTTTACAGTATCAATCCTCACTTAAGTCTTTTT
TAA

>Translation of ORF number 1 in reading frame 3 on the reverse strand.
KTKNQKDLFLIIASKPIQPVFFSLGLVKNLGLRWMIKILEKAYYLLKKNLYSINPHLSLF*


Multiple Alignement

PROTOCOL



RESULTS ANALYSIS

There are no enough and consistent results on BLAST to make a sequence multiple alignement.

RAW RESULTS


Protein Domains

PROTOCOL

a) InterProScan; default parameters at EBI


RESULTS ANALYSIS

There wasn't hits on InterProScan.


RAW RESULTS

a)InterProScan
No hits reported

Phylogeny

PROTOCOL



RESULTS ANALYSIS

There are no enough and consistent results.

RAW RESULTS

Taxonomy report

PROTOCOL

a)BLASTp vs. SWISSPROT; defaut NCBI parameters / *"1000 Max target sequence"

b)BLASTP vs. NR; defaut NCBI parameters / *"1000 Max target sequence"

c)BLASTx; defaut NCBI parameters / *"1000 Max target sequence"

d)BLASTx vs. SWISSPROT; defaut NCBI parameters / *"1000 Max target sequence"

e)BLASTp vs. ENV_NR; defaut NCBI parameters / *"1000 Max target sequence"


RESULTS ANALYSIS

The taxonomy results are heterogeneous and, with the exception of the result on BLASTp vs. ENV_NR, the number of hits are all under 4.


RAW RESULTS

a)BLASTp vs. SWISSPROT
cellular organisms
. Bacteria           [bacteria]
. . Bacilli            [firmicutes]
. . . Streptococcus      [firmicutes]
. . . . Streptococcus mutans ------------------   34 1 hit  [firmicutes]            RecName: Full=30S ribosomal protein S6
. . . . Streptococcus pneumoniae R6 ...........   33 1 hit  [firmicutes]            RecName: Full=30S ribosomal protein S6 >gi|54041979|sp|P666
. . . . Streptococcus pneumoniae ..............   33 1 hit  [firmicutes]            RecName: Full=30S ribosomal protein S6 >gi|54041979|sp|P666
. . . . Streptococcus pneumoniae D39 ..........   33 1 hit  [firmicutes]            RecName: Full=30S ribosomal protein S6 >gi|54041979|sp|P666
. . . . Streptococcus pneumoniae Hungary19A-6 .   33 1 hit  [firmicutes]            RecName: Full=30S ribosomal protein S6 >gi|54041979|sp|P666
. . . . Streptococcus pneumoniae CGSP14 .......   33 1 hit  [firmicutes]            RecName: Full=30S ribosomal protein S6 >gi|54041979|sp|P666
. . . . Streptococcus pneumoniae 70585 ........   33 1 hit  [firmicutes]            RecName: Full=30S ribosomal protein S6 >gi|54041979|sp|P666
. . . . Streptococcus pneumoniae ATCC 700669 ..   33 1 hit  [firmicutes]            RecName: Full=30S ribosomal protein S6 >gi|54041979|sp|P666
. . . . Streptococcus pneumoniae JJA ..........   33 1 hit  [firmicutes]            RecName: Full=30S ribosomal protein S6 >gi|54041979|sp|P666
. . . . Streptococcus pneumoniae P1031 ........   33 1 hit  [firmicutes]            RecName: Full=30S ribosomal protein S6 >gi|54041979|sp|P666
. . . . Streptococcus pneumoniae Taiwan19F-14 .   33 1 hit  [firmicutes]            RecName: Full=30S ribosomal protein S6 >gi|54041979|sp|P666
. . . . Streptococcus pneumoniae G54 ..........   32 1 hit  [firmicutes]            RecName: Full=30S ribosomal protein S6
. . . . Streptococcus sanguinis SK36 ..........   32 1 hit  [firmicutes]            RecName: Full=30S ribosomal protein S6
. . . . Streptococcus gordonii str. Challis ...   31 1 hit  [firmicutes]            RecName: Full=30S ribosomal protein S6
. . . . Streptococcus suis 98HAH33 ............   31 1 hit  [firmicutes]            RecName: Full=30S ribosomal protein S6
. . . . Streptococcus uberis 0140J ............   30 1 hit  [firmicutes]            RecName: Full=30S ribosomal protein S6
. . . Bacillus subtilis -----------------------   31 1 hit  [firmicutes]            RecName: Full=Uncharacterized oxidoreductase ykwC
. . Sinorhizobium medicae WSM419 --------------   31 1 hit  [a-proteobacteria]      RecName: Full=Bifunctional enzyme ispD/ispF; Includes: RecN
. . Sinorhizobium meliloti ....................   31 1 hit  [a-proteobacteria]      RecName: Full=Bifunctional enzyme ispD/ispF; Includes: RecN
. . Buchnera aphidicola (Schizaphis graminum) .   30 1 hit  [enterobacteria]        RecName: Full=Cold-shock DEAD box protein A homolog; AltNam
. Dictyostelium discoideum --------------------   33 1 hit  [cellular slime molds]  RecName: Full=Probable DNA topoisomerase 2; AltName: Full=D
. Drosophila melanogaster .....................   32 1 hit  [flies]                 RecName: Full=Axin; AltName: Full=Axis inhibition protein; 
. Homo sapiens (man) ..........................   30 1 hit  [primates]              RecName: Full=Histone demethylase UTY; AltName: Full=Ubiqui
. Pan troglodytes .............................   30 1 hit  [primates]              RecName: Full=Histone demethylase UTY; AltName: Full=Ubiqui
. Xenopus laevis (common platanna) ............   30 1 hit  [frogs & toads]         RecName: Full=Breast cancer anti-estrogen resistance protei
. Saccharomyces cerevisiae (yeast) ............   30 1 hit  [ascomycetes]           RecName: Full=Dolichyl-diphosphooligosaccharide--protein gl
. Rattus norvegicus (brown rat) ...............   30 1 hit  [rodents]               RecName: Full=Conserved oligomeric Golgi complex subunit 7;

--------------------------------------------------------------------------------
b)BLASTP vs. NR
cellular organisms
. Bacteria                   [bacteria]
. . Proteobacteria             [proteobacteria]
. . . delta/epsilon subdivisions [proteobacteria]
. . . . Deltaproteobacteria        [d-proteobacteria]
. . . . . Desulfuromonadales         [d-proteobacteria]
. . . . . . Pelobacter propionicus DSM 2379 -----------------   53 2 hits [d-proteobacteria]       hypothetical protein Ppro_0062 [Pelobacter propionicus DSM 
. . . . . . Geobacter uraniireducens Rf4 ....................   40 2 hits [d-proteobacteria]       hypothetical protein Gura_2702 [Geobacter uraniireducens Rf
. . . . . Desulfobacterium autotrophicum HRM2 ---------------   43 2 hits [d-proteobacteria]       hypothetical protein HRM2_25450 [Desulfobacterium autotroph
. . . . Sulfurovum sp. NBC37-1 ------------------------------   40 2 hits [e-proteobacteria]       hypothetical protein SUN_1515 [Sulfurovum sp. NBC37-1] >gi|
. . . . Campylobacter jejuni subsp. jejuni 414 ..............   40 2 hits [e-proteobacteria]       hypothetical protein C414_000430050 [Campylobacter jejuni s
. . . . Campylobacter jejuni subsp. jejuni 260.94 ...........   36 2 hits [e-proteobacteria]       conserved hypothetical protein [Campylobacter jejuni subsp.
. . . . Campylobacter jejuni RM1221 .........................   36 2 hits [e-proteobacteria]       hypothetical protein CJE0328 [Campylobacter jejuni RM1221] 
. . . . Campylobacter jejuni subsp. jejuni CF93-6 ...........   36 2 hits [e-proteobacteria]       hypothetical protein CJE0328 [Campylobacter jejuni RM1221] 
. . . . Campylobacter jejuni subsp. jejuni HB93-13 ..........   36 2 hits [e-proteobacteria]       hypothetical protein CJE0328 [Campylobacter jejuni RM1221] 
. . . . Campylobacter jejuni subsp. jejuni 84-25 ............   36 2 hits [e-proteobacteria]       hypothetical protein CJE0328 [Campylobacter jejuni RM1221] 
. . . . Campylobacter jejuni subsp. jejuni 81-176 ...........   36 3 hits [e-proteobacteria]       hypothetical protein CJE0328 [Campylobacter jejuni RM1221] 
. . . . Campylobacter jejuni subsp. jejuni CG8486 ...........   36 2 hits [e-proteobacteria]       hypothetical protein CJE0328 [Campylobacter jejuni RM1221] 
. . . . Campylobacter jejuni subsp. jejuni 81116 ............   36 2 hits [e-proteobacteria]       hypothetical protein CJE0328 [Campylobacter jejuni RM1221] 
. . . . Campylobacter jejuni subsp. jejuni CG8421 ...........   36 2 hits [e-proteobacteria]       hypothetical protein CJE0328 [Campylobacter jejuni RM1221] 
. . . . Campylobacter jejuni subsp. jejuni NCTC 11168 .......   36 2 hits [e-proteobacteria]       hypothetical protein CJE0328 [Campylobacter jejuni RM1221] 
. . . . Campylobacter jejuni subsp. jejuni IA3902 ...........   36 1 hit  [e-proteobacteria]       hypothetical protein CJE0328 [Campylobacter jejuni RM1221] 
. . . . Campylobacter jejuni subsp. doylei 269.97 ...........   35 2 hits [e-proteobacteria]       hypothetical protein JJD26997_1691 [Campylobacter jejuni su
. . . . Campylobacter jejuni subsp. jejuni 1336 .............   34 2 hits [e-proteobacteria]       hypothetical protein C1336_000060013 [Campylobacter jejuni 
. . . Erythrobacter litoralis HTCC2594 ----------------------   52 2 hits [a-proteobacteria]       hypothetical protein ELI_12175 [Erythrobacter litoralis HTC
. . . Novosphingobium aromaticivorans DSM 12444 .............   47 2 hits [a-proteobacteria]       hypothetical protein Saro_3239 [Novosphingobium aromaticivo
. . . Acidovorax avenae subsp. avenae ATCC 19860 ............   45 2 hits [b-proteobacteria]       conserved hypothetical protein [Acidovorax avenae subsp. av
. . . Sphingomonas wittichii RW1 ............................   43 2 hits [a-proteobacteria]       hypothetical protein Swit_3377 [Sphingomonas wittichii RW1]
. . . Rhodospirillum rubrum ATCC 11170 ......................   43 2 hits [a-proteobacteria]       hypothetical protein Rru_A3101 [Rhodospirillum rubrum ATCC 
. . . Oceanibulbus indolifex HEL-45 .........................   43 2 hits [a-proteobacteria]       hypothetical protein OIHEL45_16911 [Oceanibulbus indolifex 
. . . Nitrosomonas eutropha C91 .............................   39 2 hits [b-proteobacteria]       hypothetical protein Neut_0482 [Nitrosomonas eutropha C91] 
. . . Francisella novicida U112 .............................   39 2 hits [g-proteobacteria]       hypothetical protein FTN_0929 [Francisella tularensis subsp
. . . Francisella novicida FTE ..............................   39 2 hits [g-proteobacteria]       hypothetical protein FTN_0929 [Francisella tularensis subsp
. . . Hahella chejuensis KCTC 2396 ..........................   38 2 hits [g-proteobacteria]       hypothetical protein HCH_06056 [Hahella chejuensis KCTC 239
. . . Roseobacter litoralis Och 149 .........................   38 2 hits [a-proteobacteria]       hypothetical protein RLO149_14538 [Roseobacter litoralis Oc
. . . Halorhodospira halophila SL1 ..........................   37 2 hits [g-proteobacteria]       hypothetical protein Hhal_1539 [Halorhodospira halophila SL
. . . Nitrosomonas europaea ATCC 19718 ......................   37 2 hits [b-proteobacteria]       hypothetical protein NE1634 [Nitrosomonas europaea ATCC 197
. . . Magnetococcus sp. MC-1 ................................   36 2 hits [proteobacteria]         hypothetical protein Mmc1_0595 [Magnetococcus sp. MC-1] >gi
. . . Alteromonas macleodii 'Deep ecotype' ..................   36 2 hits [g-proteobacteria]       hypothetical protein MADE_01319 [Alteromonas macleodii 'Dee
. . . Roseobacter denitrificans OCh 114 .....................   36 2 hits [a-proteobacteria]       hypothetical protein RD1_3844 [Roseobacter denitrificans OC
. . . Azoarcus sp. BH72 .....................................   36 2 hits [b-proteobacteria]       hypothetical protein azo0984 [Azoarcus sp. BH72] >gi|119669
. . . Rhizobium etli Brasil 5 ...............................   35 1 hit  [a-proteobacteria]       hypothetical protein RetlB5_04104 [Rhizobium etli Brasil 5]
. . . Gallionella capsiferriformans ES-2 ....................   35 2 hits [b-proteobacteria]       hypothetical protein GalfDRAFT_1091 [Gallionella ferruginea
. . . Photorhabdus luminescens subsp. laumondii TTO1 ........   35 2 hits [enterobacteria]         hypothetical protein plu2412 [Photorhabdus luminescens subs
. . . Rhizobium etli GR56 ...................................   35 1 hit  [a-proteobacteria]       hypothetical protein RetlG_26101 [Rhizobium etli GR56]
. . . Rhizobium etli 8C-3 ...................................   35 1 hit  [a-proteobacteria]       hypothetical protein Retl8_20581 [Rhizobium etli 8C-3]
. . . Rhizobium etli Kim 5 ..................................   35 1 hit  [a-proteobacteria]       hypothetical protein RetlK5_19232 [Rhizobium etli Kim 5]
. . . Mesorhizobium opportunistum WSM2075 ...................   35 2 hits [a-proteobacteria]       conserved hypothetical protein [Mesorhizobium opportunistum
. . . Rhizobium etli CFN 42 .................................   35 2 hits [a-proteobacteria]       hypothetical protein RHE_PD00348 [Rhizobium etli CFN 42] >g
. . . Rhizobium etli CIAT 652 ...............................   35 2 hits [a-proteobacteria]       hypothetical protein RHECIAT_PB0000377 [Rhizobium etli CIAT
. . . Rhizobium etli CIAT 894 ...............................   35 1 hit  [a-proteobacteria]       hypothetical protein RetlC8_23333 [Rhizobium etli CIAT 894]
. . . Mesorhizobium loti MAFF303099 .........................   34 2 hits [a-proteobacteria]       hypothetical protein mlr5260 [Mesorhizobium loti MAFF303099
. . . Xanthomonas axonopodis pv. citri str. 306 .............   34 2 hits [g-proteobacteria]       hypothetical protein XAC0068 [Xanthomonas axonopodis pv. ci
. . . Magnetospirillum gryphiswaldense MSR-1 ................   34 1 hit  [a-proteobacteria]       galactosyltransferase [Magnetospirillum gryphiswaldense MSR
. . Bacillus cereus Rock3-44 --------------------------------   50 2 hits [firmicutes]             hypothetical protein bcere0022_43060 [Bacillus cereus Rock3
. . Victivallis vadensis ATCC BAA-548 .......................   49 2 hits [bacteria]               hypothetical protein Vvad_PD2278 [Victivallis vadensis ATCC
. . Rhodococcus erythropolis SK121 ..........................   45 2 hits [high GC Gram+]          hypothetical protein RHOER0001_1348 [Rhodococcus erythropol
. . Ruminococcus lactaris ATCC 29176 ........................   44 2 hits [firmicutes]             hypothetical protein RUMLAC_02743 [Ruminococcus lactaris AT
. . Kytococcus sedentarius DSM 20547 ........................   44 2 hits [high GC Gram+]          hypothetical protein Ksed_18810 [Kytococcus sedentarius DSM
. . Spirosoma linguale DSM 74 ...............................   42 2 hits [CFB group bacteria]     hypothetical protein Slin_0569 [Spirosoma linguale DSM 74] 
. . Cyanothece sp. PCC 7425 .................................   41 4 hits [cyanobacteria]          hypothetical protein Cyan7425_4333 [Cyanothece sp. PCC 7425
. . Clostridium perfringens D str. JGS1721 ..................   41 2 hits [firmicutes]             conserved hypothetical protein [Clostridium perfringens D s
. . Herpetosiphon aurantiacus ATCC 23779 ....................   41 2 hits [GNS bacteria]           hypothetical protein Haur_4324 [Herpetosiphon aurantiacus A
. . Clostridium perfringens B str. ATCC 3626 ................   41 2 hits [firmicutes]             conserved hypothetical protein [Clostridium perfringens B s
. . Ethanoligenens harbinense YUAN-3 ........................   41 2 hits [firmicutes]             hypothetical protein EthhaDRAFT_0263 [Ethanoligenens harbin
. . Clostridium perfringens E str. JGS1987 ..................   41 2 hits [firmicutes]             conserved hypothetical protein [Clostridium perfringens E s
. . Clostridium perfringens str. 13 .........................   41 2 hits [firmicutes]             hypothetical protein CPE0465 [Clostridium perfringens str. 
. . Bacillus cereus AH603 ...................................   40 2 hits [firmicutes]             hypothetical protein bcere0026_33580 [Bacillus cereus AH603
. . Clostridium papyrosolvens DSM 2782 ......................   40 4 hits [firmicutes]             hypothetical protein CpapDRAFT_1930 [Clostridium papyrosolv
. . Clostridium nexile DSM 1787 .............................   40 2 hits [firmicutes]             hypothetical protein CLONEX_02314 [Clostridium nexile DSM 1
. . Bacillus cereus NVH0597-99 ..............................   40 2 hits [firmicutes]             conserved hypothetical protein [Bacillus cereus NVH0597-99]
. . Bacillus thuringiensis serovar andalousiensis BGSC 4AW1 .   40 2 hits [firmicutes]             hypothetical protein bthur0009_34300 [Bacillus thuringiensi
. . Rhodococcus erythropolis PR4 ............................   40 2 hits [high GC Gram+]          hypothetical protein RER_31170 [Rhodococcus erythropolis PR
. . Bacillus cereus R309803 .................................   39 2 hits [firmicutes]             hypothetical protein bcere0009_33180 [Bacillus cereus R3098
. . Bacillus cereus Rock3-29 ................................   39 2 hits [firmicutes]             hypothetical protein bcere0020_33670 [Bacillus cereus Rock3
. . Bacillus cereus Rock1-3 .................................   39 4 hits [firmicutes]             hypothetical protein bcere0020_33670 [Bacillus cereus Rock3
. . Bacillus mycoides DSM 2048 ..............................   39 2 hits [firmicutes]             hypothetical protein bmyco0001_51730 [Bacillus mycoides DSM
. . Bacillus pseudomycoides DSM 12442 .......................   39 2 hits [firmicutes]             hypothetical protein bpmyx0001_46820 [Bacillus pseudomycoid
. . Lactococcus lactis subsp. lactis KF147 ..................   38 2 hits [firmicutes]             hypothetical protein LLKF_1295 [Lactococcus lactis subsp. l
. . Clostridium spiroforme DSM 1552 .........................   38 2 hits [firmicutes]             hypothetical protein CLOSPI_01298 [Clostridium spiroforme D
. . Bacillus cereus Rock4-18 ................................   38 2 hits [firmicutes]             hypothetical protein bcere0024_33950 [Bacillus cereus Rock4
. . Bacillus cereus Rock3-28 ................................   38 4 hits [firmicutes]             hypothetical protein bcere0019_33770 [Bacillus cereus Rock3
. . Bacillus mycoides Rock1-4 ...............................   38 2 hits [firmicutes]             hypothetical protein bmyco0002_44270 [Bacillus mycoides Roc
. . Bacillus weihenstephanensis KBAB4 .......................   38 2 hits [firmicutes]             hypothetical protein BcerKBAB4_3382 [Bacillus weihenstephan
. . Bacillus mycoides Rock3-17 ..............................   38 2 hits [firmicutes]             hypothetical protein bmyco0003_45820 [Bacillus mycoides Roc
. . Acaryochloris marina MBIC11017 ..........................   38 4 hits [cyanobacteria]          hypothetical protein AM1_0388 [Acaryochloris marina MBIC110
. . Lentisphaera araneosa HTCC2155 ..........................   38 4 hits [bacteria]               hypothetical protein LNTAR_14567 [Lentisphaera araneosa HTC
. . Bacillus cereus AH621 ...................................   37 2 hits [firmicutes]             hypothetical protein bcere0007_33700 [Bacillus cereus AH621
. . Candidatus Kuenenia stuttgartiensis .....................   37 1 hit  [planctomycetes]         hypothetical protein [Candidatus Kuenenia stuttgartiensis]
. . Desulfotomaculum acetoxidans DSM 771 ....................   37 6 hits [firmicutes]             hypothetical protein Dtox_2336 [Desulfotomaculum acetoxidan
. . Ruminococcus torques ATCC 27756 .........................   36 4 hits [firmicutes]             hypothetical protein RUMTOR_02795 [Ruminococcus torques ATC
. . Acholeplasma laidlawii PG-8A ............................   36 2 hits [mycoplasmas]            hypothetical protein ACL_1088 [Acholeplasma laidlawii PG-8A
. . Streptomyces roseosporus NRRL 15998 .....................   36 1 hit  [high GC Gram+]          hypothetical protein SrosN15_19281 [Streptomyces roseosporu
. . Streptomyces roseosporus NRRL 11379 .....................   36 1 hit  [high GC Gram+]          hypothetical protein SrosN15_19281 [Streptomyces roseosporu
. . Bacillus cereus AH1271 ..................................   36 2 hits [firmicutes]             hypothetical protein bcere0028_54840 [Bacillus cereus AH127
. . Enterococcus gallinarum EG2 .............................   35 2 hits [firmicutes]             multidrug resistance-like ATP-binding protein mdlA [Enteroc
. . Clostridium cellulolyticum H10 ..........................   35 2 hits [firmicutes]             hypothetical protein Ccel_2515 [Clostridium cellulolyticum 
. . Chitinophaga pinensis DSM 2588 ..........................   35 2 hits [CFB group bacteria]     beta-lactamase [Chitinophaga pinensis DSM 2588] >gi|2560398
. . Bacteroides thetaiotaomicron VPI-5482 ...................   35 2 hits [CFB group bacteria]     chaperone protein dnaK [Bacteroides thetaiotaomicron VPI-54
. . Bacteroides sp. 1_1_6 ...................................   35 2 hits [CFB group bacteria]     chaperone protein dnaK [Bacteroides thetaiotaomicron VPI-54
. . Bacteroides pectinophilus ATCC 43243 ....................   35 2 hits [CFB group bacteria]     hypothetical protein BACPEC_00233 [Bacteroides pectinophilu
. . Chlorobium limicola DSM 245 .............................   34 2 hits [green sulfur bacteria]  hypothetical protein Clim_1908 [Chlorobium limicola DSM 245
. . Rhodothermus marinus DSM 4252 ...........................   34 2 hits [CFB group bacteria]     hypothetical protein Rmar_1587 [Rhodothermus marinus DSM 42
. . Prevotella oris F0302 ...................................   34 2 hits [CFB group bacteria]     conserved hypothetical protein [Prevotella oris F0302] >gi|
. . Streptococcus mutans UA159 ..............................   34 2 hits [firmicutes]             30S ribosomal protein S6 [Streptococcus mutans UA159] >gi|2
. . Streptococcus mutans NN2025 .............................   34 2 hits [firmicutes]             30S ribosomal protein S6 [Streptococcus mutans UA159] >gi|2
. . Streptococcus mutans ....................................   34 1 hit  [firmicutes]             30S ribosomal protein S6 [Streptococcus mutans UA159] >gi|2
. Methanocella paludicola SANAE -----------------------------   40 2 hits [euryarchaeotes]         hypothetical protein MCP_0888 [Methanocella paludicola SANA
. Paramecium tetraurelia strain d4-2 ........................   35 1 hit  [ciliates]               hypothetical protein [Paramecium tetraurelia strain d4-2] >
. Paramecium tetraurelia ....................................   35 1 hit  [ciliates]               hypothetical protein [Paramecium tetraurelia strain d4-2] >
. Populus trichocarpa (black cottonwood) ....................   35 2 hits [eudicots]               predicted protein [Populus trichocarpa] >gi|222866536|gb|EE
. Caenorhabditis elegans (nematode) .........................   34 2 hits [nematodes]              hypothetical protein C32F10.8 [Caenorhabditis elegans] >gi|

--------------------------------------------------------------------------------------------
c)BLASTx vs NR
cellular organisms
. Bacteria            [bacteria]
. . Proteobacteria      [proteobacteria]
. . . Alphaproteobacteria [a-proteobacteria]
. . . . Sphingomonadales    [a-proteobacteria]
. . . . . Erythrobacter litoralis HTCC2594 ------------------   45 2 hits [a-proteobacteria]       hypothetical protein ELI_12175 [Erythrobacter litoralis HTC
. . . . . Novosphingobium aromaticivorans DSM 12444 .........   38 2 hits [a-proteobacteria]       hypothetical protein Saro_3239 [Novosphingobium aromaticivo
. . . . . Sphingomonas wittichii RW1 ........................   36 2 hits [a-proteobacteria]       hypothetical protein Swit_3377 [Sphingomonas wittichii RW1]
. . . . Oceanibulbus indolifex HEL-45 -----------------------   36 2 hits [a-proteobacteria]       hypothetical protein OIHEL45_16911 [Oceanibulbus indolifex 
. . . . Mesorhizobium opportunistum WSM2075 .................   35 2 hits [a-proteobacteria]       conserved hypothetical protein [Mesorhizobium opportunistum
. . . . Mesorhizobium loti MAFF303099 .......................   35 2 hits [a-proteobacteria]       hypothetical protein mlr5260 [Mesorhizobium loti MAFF303099
. . . Pelobacter propionicus DSM 2379 -----------------------   45 2 hits [d-proteobacteria]       hypothetical protein Ppro_0062 [Pelobacter propionicus DSM 
. . . Desulfobacterium autotrophicum HRM2 ...................   43 2 hits [d-proteobacteria]       hypothetical protein HRM2_25450 [Desulfobacterium autotroph
. . . Francisella novicida U112 .............................   41 2 hits [g-proteobacteria]       hypothetical protein FTN_0929 [Francisella tularensis subsp
. . . Francisella novicida FTE ..............................   41 2 hits [g-proteobacteria]       hypothetical protein FTN_0929 [Francisella tularensis subsp
. . . Sulfurovum sp. NBC37-1 ................................   38 2 hits [e-proteobacteria]       hypothetical protein SUN_1515 [Sulfurovum sp. NBC37-1] >gi|
. . . Francisella novicida GA99-3549 ........................   36 2 hits [g-proteobacteria]       conserved hypothetical protein [Francisella tularensis subs
. . . Magnetococcus sp. MC-1 ................................   36 2 hits [proteobacteria]         hypothetical protein Mmc1_0595 [Magnetococcus sp. MC-1] >gi
. . . Legionella drancourtii LLAP12 .........................   36 2 hits [g-proteobacteria]       hypothetical protein LDG_0276 [Legionella drancourtii LLAP1
. . . Photorhabdus luminescens subsp. laumondii TTO1 ........   36 2 hits [enterobacteria]         hypothetical protein plu2412 [Photorhabdus luminescens subs
. . Bacillus cereus Rock3-44 --------------------------------   43 2 hits [firmicutes]             hypothetical protein bcere0022_43060 [Bacillus cereus Rock3
. . Victivallis vadensis ATCC BAA-548 .......................   42 2 hits [bacteria]               hypothetical protein Vvad_PD2278 [Victivallis vadensis ATCC
. . Clostridium papyrosolvens DSM 2782 ......................   41 4 hits [firmicutes]             hypothetical protein CpapDRAFT_1930 [Clostridium papyrosolv
. . Spirosoma linguale DSM 74 ...............................   41 2 hits [CFB group bacteria]     hypothetical protein Slin_0569 [Spirosoma linguale DSM 74] 
. . Ruminococcus lactaris ATCC 29176 ........................   40 2 hits [firmicutes]             hypothetical protein RUMLAC_02743 [Ruminococcus lactaris AT
. . Bacillus cereus Rock3-28 ................................   40 4 hits [firmicutes]             hypothetical protein bcere0019_54120 [Bacillus cereus Rock3
. . Chlorobium limicola DSM 245 .............................   40 2 hits [green sulfur bacteria]  hypothetical protein Clim_1908 [Chlorobium limicola DSM 245
. . Cyanothece sp. PCC 7425 .................................   39 2 hits [cyanobacteria]          hypothetical protein Cyan7425_4333 [Cyanothece sp. PCC 7425
. . Bacillus cereus Rock1-3 .................................   39 4 hits [firmicutes]             hypothetical protein bcere0017_53400 [Bacillus cereus Rock1
. . Bacillus cereus R309803 .................................   39 2 hits [firmicutes]             hypothetical protein bcere0009_33180 [Bacillus cereus R3098
. . Lentisphaera araneosa HTCC2155 ..........................   39 4 hits [bacteria]               hypothetical protein LNTAR_14567 [Lentisphaera araneosa HTC
. . Herpetosiphon aurantiacus ATCC 23779 ....................   37 2 hits [GNS bacteria]           hypothetical protein Haur_4324 [Herpetosiphon aurantiacus A
. . Bacillus thuringiensis serovar andalousiensis BGSC 4AW1 .   37 2 hits [firmicutes]             hypothetical protein bthur0009_34300 [Bacillus thuringiensi
. . Bacillus cereus AH603 ...................................   37 2 hits [firmicutes]             hypothetical protein bcere0026_33580 [Bacillus cereus AH603
. . Bacillus cereus NVH0597-99 ..............................   37 2 hits [firmicutes]             conserved hypothetical protein [Bacillus cereus NVH0597-99]
. . Rhodococcus erythropolis SK121 ..........................   36 2 hits [high GC Gram+]          hypothetical protein RHOER0001_1348 [Rhodococcus erythropol
. . Kytococcus sedentarius DSM 20547 ........................   36 2 hits [high GC Gram+]          hypothetical protein Ksed_18810 [Kytococcus sedentarius DSM
. . Clostridium perfringens D str. JGS1721 ..................   36 2 hits [firmicutes]             conserved hypothetical protein [Clostridium perfringens D s
. . Clostridium butyricum 5521 ..............................   36 2 hits [firmicutes]             conserved hypothetical protein [Clostridium butyricum 5521]
. . Clostridium butyricum E4 str. BoNT E BL5262 .............   36 2 hits [firmicutes]             conserved hypothetical protein [Clostridium butyricum 5521]
. . Bacillus mycoides Rock3-17 ..............................   36 2 hits [firmicutes]             hypothetical protein bmyco0003_45820 [Bacillus mycoides Roc
. . Bacillus mycoides DSM 2048 ..............................   36 2 hits [firmicutes]             hypothetical protein bmyco0001_51730 [Bacillus mycoides DSM
. . Bacillus cereus Rock3-29 ................................   36 2 hits [firmicutes]             hypothetical protein bcere0020_33670 [Bacillus cereus Rock3
. . Clostridium perfringens B str. ATCC 3626 ................   36 2 hits [firmicutes]             conserved hypothetical protein [Clostridium perfringens B s
. . Clostridium perfringens E str. JGS1987 ..................   36 2 hits [firmicutes]             conserved hypothetical protein [Clostridium perfringens E s
. . Clostridium perfringens str. 13 .........................   36 2 hits [firmicutes]             hypothetical protein CPE0465 [Clostridium perfringens str. 
. . Bacillus pseudomycoides DSM 12442 .......................   36 2 hits [firmicutes]             hypothetical protein bpmyx0001_46820 [Bacillus pseudomycoid
. . Bacillus cereus Rock4-18 ................................   36 2 hits [firmicutes]             hypothetical protein bcere0024_33950 [Bacillus cereus Rock4
. . Bacillus cereus AH621 ...................................   36 2 hits [firmicutes]             hypothetical protein bcere0007_33700 [Bacillus cereus AH621
. . Bacillus mycoides Rock1-4 ...............................   35 2 hits [firmicutes]             hypothetical protein bmyco0002_44270 [Bacillus mycoides Roc
. . Desulfotomaculum acetoxidans DSM 771 ....................   35 2 hits [firmicutes]             hypothetical protein Dtox_2336 [Desulfotomaculum acetoxidan
. . Bacillus cereus AH1271 ..................................   35 2 hits [firmicutes]             hypothetical protein bcere0028_54840 [Bacillus cereus AH127
. Methanocella paludicola SANAE -----------------------------   38 2 hits [euryarchaeotes]         hypothetical protein MCP_0888 [Methanocella paludicola SANA

--------------------------------------------------------------------------------------------------
d)BLASTx vs. SWISSPROT

cellular organisms
. Buchnera aphidicola (Schizaphis graminum) -   34 1 hit  [enterobacteria]  RecName: Full=Cold-shock DEAD box protein A homolog; AltNam
. Vigna mungo (urd-bean) ....................   31 1 hit  [eudicots]        RecName: Full=Maturase K; AltName: Full=Intron maturase
. Schizosaccharomyces pombe .................   31 1 hit  [ascomycetes]     RecName: Full=Phosphomannomutase; Short=PMM

-----------------------------------------------------------------------------------------------------
e)e)BLASTp vs. ENV_NR

marine metagenome [metagenomes]
. marine metagenome -  419 35 hits [metagenomes]  hypothetical protein GOS_9909365 [marine metagenome]

BLAST

PROTOCOL

a)BLASTp vs. SWISSPROT; defaut NCBI parameters/ *"1000 Max target sequence"

b)BLASTP vs. NR; defaut NCBI parameters / *"1000 Max target sequence"

c)BLASTx vs. NR; defaut NCBI parameters / *"1000 Max target sequence"

d)BLASTx vs. SWISSPROT; defaut NCBI parameters / *"1000 Max target sequence"

e)BLASTp vs. ENV_NR; defaut NCBI parameters / *"1000 Max target sequence"


RESULTS ANALYSIS

There are almost no true positive homologs. Only have four homologs on BLASTp vs. NR with acceptable E-values on e-04 and e-05, but with identity under 35% on almost half of the 210aa of the query; and two true positive homologs (but of hypothetical protein of unknow organism on BLASTp vs. ENV_NR with the E-values: 6e-76 and 2e-116.

The BLAST results and the in-existent results on Protein Domains are insufficient to go on.

RAW RESULTS

a)BLASTp vs. SWISSPROT
No significant results
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q8DSD7.1|RS6_STRMU  RecName: Full=30S ribosomal protein S6      34.3    0.53 
sp|Q55BP5.1|TOP2_DICDI  RecName: Full=Probable DNA topoisomera...  33.9    0.68 
sp|P66603.1|RS6_STRR6  RecName: Full=30S ribosomal protein S6 ...  33.1    1.3  
sp|B5E6A6.1|RS6_STRP4  RecName: Full=30S ribosomal protein S6      32.7    1.4  
sp|A3CL32.1|RS6_STRSV  RecName: Full=30S ribosomal protein S6      32.7    1.6  
sp|Q9V407.1|AXN_DROME  RecName: Full=Axin; AltName: Full=Axis ...  32.3    2.1  
sp|A8AZD7.1|RS6_STRGC  RecName: Full=30S ribosomal protein S6      32.0    3.0  
sp|A4W3Q2.1|RS6_STRS2  RecName: Full=30S ribosomal protein S6      31.6    3.3  
sp|O34948.1|YKWC_BACSU  RecName: Full=Uncharacterized oxidored...  31.6    3.9  
sp|A6U8F8.1|ISPDF_SINMW  RecName: Full=Bifunctional enzyme isp...  31.2    4.6  
sp|Q92Q90.2|ISPDF_RHIME  RecName: Full=Bifunctional enzyme isp...  31.2    5.1  
sp|B9DVK4.1|RS6_STRU0  RecName: Full=30S ribosomal protein S6      30.8    5.9  
sp|O14607.2|UTY_HUMAN  RecName: Full=Histone demethylase UTY; ...  30.8    5.9  
sp|Q6B4Z3.1|UTY_PANTR  RecName: Full=Histone demethylase UTY; ...  30.8    6.0  
sp|Q8K9H6.1|DEAD_BUCAP  RecName: Full=Cold-shock DEAD box prot...  30.4    7.5  
sp|Q6INP9.1|BCAR3_XENLA  RecName: Full=Breast cancer anti-estr...  30.4    7.9  
sp|Q02795.1|OSTD_YEAST  RecName: Full=Dolichyl-diphosphooligos...  30.4    8.6  
sp|Q3T1G7.1|COG7_RAT  RecName: Full=Conserved oligomeric Golgi...  30.0    9.2  

ALIGNMENTS
>sp|Q8DSD7.1|RS6_STRMU RecName: Full=30S ribosomal protein S6
Length=96

 Score = 34.3 bits (77),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 0/72 (0%)

Query  23  NFALEDKESKRSFFDYCIKTNTASFFFARPCEEFRSAMDDQDFRESILFAQKKSLQYQSS  82
           N   E K +  + FD  +  N A+   ++  E+ R A + QDFRE +        +   +
Sbjct  13  NIEEEAKNALVARFDAVLTDNGATIVESKDWEKRRLAYEIQDFREGLYHVINVETEDAHA  72

Query  83  LKSFLKLAKTNN  94
           L  F +L+K NN
Sbjct  73  LNEFDRLSKINN  84


>sp|Q55BP5.1|TOP2_DICDI RecName: Full=Probable DNA topoisomerase 2; AltName: Full=DNA 
topoisomerase II
Length=1521

 Score = 33.9 bits (76),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 46/98 (46%), Gaps = 1/98 (1%)

Query  26    LEDKESKRSFFDYCIKTNTASFFFARPCEEFRSAMDDQDFRESILFAQKKSLQYQSSLKS  85
             +E+++SK+  +D  + T     +  R  +    A+DDQD  +  L  Q +SL+ ++  K+
Sbjct  1247  IEERDSKKKEWDILLSTPIQEIY-KRDLDALEKALDDQDAYDESLKNQTESLKKRTKTKA  1305

Query  86    FLKLAKTNNIDVCLLKGAFMSNFVYPNFSMRIMRDIDV  123
               +  K +   V   K A ++  V P   +    D +V
Sbjct  1306  LPRAKKISAKVVKDTKEAPLTKLVKPTVKIPTTTDSNV  1343


>sp|P66603.1|RS6_STRR6 RecName: Full=30S ribosomal protein S6
 sp|P66602.1|RS6_STRPN RecName: Full=30S ribosomal protein S6
 sp|Q04JK8.1|RS6_STRP2 RecName: Full=30S ribosomal protein S6
 sp|B1ICW1.1|RS6_STRPI RecName: Full=30S ribosomal protein S6
 sp|B2IR60.1|RS6_STRPS RecName: Full=30S ribosomal protein S6
 sp|C1C8D0.1|RS6_STRP7 RecName: Full=30S ribosomal protein S6
 sp|B8ZLE1.1|RS6_STRPJ RecName: Full=30S ribosomal protein S6
 sp|C1CFC2.1|RS6_STRZJ RecName: Full=30S ribosomal protein S6
 sp|C1CLP0.1|RS6_STRZP RecName: Full=30S ribosomal protein S6
 sp|C1CSF9.1|RS6_STRZT RecName: Full=30S ribosomal protein S6
Length=96

 Score = 33.1 bits (74),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 0/71 (0%)

Query  23  NFALEDKESKRSFFDYCIKTNTASFFFARPCEEFRSAMDDQDFRESILFAQKKSLQYQSS  82
           N   E K +  + FD  +  N A+   ++  E+ R A + QDFRE +           ++
Sbjct  13  NIEEEAKNALVARFDSILTDNGATVVESKTWEKRRLAYEIQDFREGLYHIVNVEANDDAA  72

Query  83  LKSFLKLAKTN  93
           LK F +L+K N
Sbjct  73  LKEFDRLSKIN  83


>sp|B5E6A6.1|RS6_STRP4 RecName: Full=30S ribosomal protein S6
Length=96

 Score = 32.7 bits (73),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 0/71 (0%)

Query  23  NFALEDKESKRSFFDYCIKTNTASFFFARPCEEFRSAMDDQDFRESILFAQKKSLQYQSS  82
           N   E K +  + FD  +  N A+   ++  E+ R A + QDFRE +           ++
Sbjct  13  NIEEEAKNALVARFDSILTDNGATVVESKTWEKRRLAYEIQDFREGLYHIVXVEANDDAA  72

Query  83  LKSFLKLAKTN  93
           LK F +L+K N
Sbjct  73  LKEFDRLSKIN  83


>sp|A3CL32.1|RS6_STRSV RecName: Full=30S ribosomal protein S6
Length=96

 Score = 32.7 bits (73),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 0/71 (0%)

Query  23  NFALEDKESKRSFFDYCIKTNTASFFFARPCEEFRSAMDDQDFRESILFAQKKSLQYQSS  82
           N   E K +  + FD  +  N A+   ++  E+ R A + QDFRE +           ++
Sbjct  13  NIEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEIQDFREGLYHIVNVEANDDAA  72

Query  83  LKSFLKLAKTN  93
           LK F +L+K N
Sbjct  73  LKEFDRLSKIN  83


>sp|Q9V407.1|AXN_DROME RecName: Full=Axin; AltName: Full=Axis inhibition protein; AltName: 
Full=d-Axin; Short=dAxin
Length=745

 Score = 32.3 bits (72),  Expect = 2.1, Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 11/89 (12%)

Query  14   NYLSKLKTNNFALEDKESKRSFFDYCIKTNTA-----SFFFARPCEEFRSAMDDQDFRES  68
            +YL+  +T N  LED++    F  Y  +   A     +F+FA  CE  +   D +  ++ 
Sbjct  47   SYLNWARTLNHLLEDRDGVELFKKYVEEEAPAYNDHLNFYFA--CEGLKQQTDPEKIKQI  104

Query  69   I----LFAQKKSLQYQSSLKSFLKLAKTN  93
            I     F +K  L     L++ +K  KTN
Sbjct  105  IGAIYRFLRKSQLSISDDLRAQIKAIKTN  133


>sp|A8AZD7.1|RS6_STRGC RecName: Full=30S ribosomal protein S6
Length=96

 Score = 32.0 bits (71),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 0/71 (0%)

Query  23  NFALEDKESKRSFFDYCIKTNTASFFFARPCEEFRSAMDDQDFRESILFAQKKSLQYQSS  82
           N   E K +  + FD  +  N A+   ++  E+ R A + QDFRE +            +
Sbjct  13  NIEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEIQDFREGLYHIVNVEANDDVA  72

Query  83  LKSFLKLAKTN  93
           LK F +L+K N
Sbjct  73  LKEFDRLSKIN  83


>sp|A4W3Q2.1|RS6_STRS2 RecName: Full=30S ribosomal protein S6
Length=96

 Score = 31.6 bits (70),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 0/72 (0%)

Query  23  NFALEDKESKRSFFDYCIKTNTASFFFARPCEEFRSAMDDQDFRESILFAQKKSLQYQSS  82
           N   E K +  + FD  +  N A+   ++  E+ R A + +DFRE +            +
Sbjct  13  NIEEEAKNALVARFDSILTDNGATIVESKAWEKRRLAYEIKDFREGLYHIVNVEANNDEA  72

Query  83  LKSFLKLAKTNN  94
           LK F +L+K N 
Sbjct  73  LKEFDRLSKING  84


>sp|O34948.1|YKWC_BACSU RecName: Full=Uncharacterized oxidoreductase ykwC
Length=288

 Score = 31.6 bits (70),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 39/83 (46%), Gaps = 8/83 (9%)

Query  53   CEEFRSAMDDQDFRESILFAQKKSLQYQSSLKSFLKLAKT----NNIDVCLLKGAFMSNF  108
            C +   A       E++ +AQK  L+ ++ LKS    A      +N+   +L+G F   F
Sbjct  174  CNQIAIAAGMIGVAEAMAYAQKSGLEPENVLKSITTGAAGSWSLSNLAPRMLQGNFEPGF  233

Query  109  VYPNFSMRIMRDIDVLVEEASFL  131
               +F    ++D+ + +EEA  +
Sbjct  234  YVKHF----IKDMGIALEEAELM  252


>sp|A6U8F8.1|ISPDF_SINMW RecName: Full=Bifunctional enzyme ispD/ispF; Includes: RecName: 
Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; 
AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT; 
Includes: RecName: Full=2-C-methyl-D-erythritol 2,4-cyclodiphosphate 
synthase; Short=MECPS; Short=MECDP-synthase
Length=404

 Score = 31.2 bits (69),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 55/127 (43%), Gaps = 25/127 (19%)

Query  52   PCEEFRSAMDDQDFR-ESILFAQKKSL-QYQSSLKSFLKLAKTNNIDVCLLKGAFMSNFV  109
            P  +  +A   Q FR E+IL A +++    Q+       +A+   I V L++G+      
Sbjct  163  PRTDLHAAQTPQCFRLEAILSAHRQAAASGQADFTDDASIAEWAGIPVHLVEGS------  216

Query  110  YP-NFSMRIMRDIDVLVEEASFLRIINIMLKNGY---------------VFINSNKKELR  153
             P NF + + RD+ +  E+ + + I ++   NGY               VFI  ++K   
Sbjct  217  -PDNFKLTLRRDLSMADEKLTRMAIPDVRTGNGYDVHQLVEGDGVTLCGVFIPHDRKLSG  275

Query  154  KFDFDYA  160
              D D A
Sbjct  276  HSDADVA  282


>sp|Q92Q90.2|ISPDF_RHIME RecName: Full=Bifunctional enzyme ispD/ispF; Includes: RecName: 
Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; 
AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT; 
Includes: RecName: Full=2-C-methyl-D-erythritol 2,4-cyclodiphosphate 
synthase; Short=MECPS; Short=MECDP-synthase
Length=410

 Score = 31.2 bits (69),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 53/129 (41%), Gaps = 23/129 (17%)

Query  52   PCEEFRSAMDDQDFR-ESILFAQKKSL-QYQSSLKSFLKLAKTNNIDVCLLKGAFMSNFV  109
            P  +  +A   Q FR E IL A +++    +S       +A+   I V L++GA      
Sbjct  163  PRTDLYAAQTPQCFRLEPILSAHRRAAASGRSDFTDDASIAEWAGIPVLLVEGAVD----  218

Query  110  YPNFSMRIMRDIDVLVEEASFLRIINIMLKNGY---------------VFINSNKKELRK  154
              NF + + RD+ +  E+ + + I ++   NGY               VFI   +K    
Sbjct  219  --NFKLTLRRDLSMADEKLTRMAIPDVRTGNGYDVHQLVDGDGVTLCGVFIPHGRKLSGH  276

Query  155  FDFDYAHQA  163
             D D A  A
Sbjct  277  SDADVALHA  285


>sp|B9DVK4.1|RS6_STRU0 RecName: Full=30S ribosomal protein S6
Length=96

 Score = 30.8 bits (68),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 0/72 (0%)

Query  23  NFALEDKESKRSFFDYCIKTNTASFFFARPCEEFRSAMDDQDFRESILFAQKKSLQYQSS  82
           N   E K +  S FD  +  N A+   ++  E+ R A +  DFRE +        +   +
Sbjct  13  NIEEEAKNALVSRFDSILTDNGATIVESKDWEKRRLAYEINDFREGLYHIVNVESEDAVA  72

Query  83  LKSFLKLAKTNN  94
           L  F +LAK N 
Sbjct  73  LNEFDRLAKING  84

----------------------------------------------------------------------------------
b)BLASTP vs. NR
No significant results
                                                                 Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|YP_899760.1|  hypothetical protein Ppro_0062 [Pelobacter p...  53.5    1e-05
ref|YP_459324.1|  hypothetical protein ELI_12175 [Erythrobacte...  52.8    2e-05
ref|ZP_04219869.1|  hypothetical protein bcere0022_43060 [Baci...  50.4    1e-04
ref|ZP_06243675.1|  hypothetical protein Vvad_PD2278 [Victival...  49.3    3e-04
ref|YP_498508.1|  hypothetical protein Saro_3239 [Novosphingob...  47.4    0.001
ref|ZP_06209654.1|  conserved hypothetical protein [Acidovorax...  45.8    0.003
ref|ZP_04387390.1|  hypothetical protein RHOER0001_1348 [Rhodo...  45.1    0.004
ref|ZP_03169038.1|  hypothetical protein RUMLAC_02743 [Ruminoc...  44.3    0.007
ref|YP_003149648.1|  hypothetical protein Ksed_18810 [Kytococc...  44.3    0.009
ref|YP_001263861.1|  hypothetical protein Swit_3377 [Sphingomo...  43.5    0.013
ref|YP_428183.1|  hypothetical protein Rru_A3101 [Rhodospirill...  43.5    0.014
ref|YP_002603803.1|  hypothetical protein HRM2_25450 [Desulfob...  43.5    0.015
ref|ZP_02155071.1|  hypothetical protein OIHEL45_16911 [Oceani...  43.1    0.019
ref|YP_003385432.1|  hypothetical protein Slin_0569 [Spirosoma...  42.4    0.033
ref|YP_002485004.1|  hypothetical protein Cyan7425_4333 [Cyano...  42.0    0.036
ref|ZP_02952405.1|  conserved hypothetical protein [Clostridiu...  41.6    0.051
ref|YP_001547084.1|  hypothetical protein Haur_4324 [Herpetosi...  41.6    0.054
ref|ZP_02634574.1|  conserved hypothetical protein [Clostridiu...  41.6    0.060
ref|ZP_06470185.1|  hypothetical protein EthhaDRAFT_0263 [Etha...  41.2    0.062
ref|ZP_02630362.1|  conserved hypothetical protein [Clostridiu...  41.2    0.068
ref|NP_561381.1|  hypothetical protein CPE0465 [Clostridium pe...  41.2    0.070
ref|ZP_04198617.1|  hypothetical protein bcere0026_33580 [Baci...  40.8    0.089
ref|ZP_05495760.1|  hypothetical protein CpapDRAFT_1930 [Clost...  40.8    0.091
ref|YP_003355943.1|  hypothetical protein MCP_0888 [Methanocel...  40.8    0.093
ref|YP_001358823.1|  hypothetical protein SUN_1515 [Sulfurovum...  40.8    0.095
ref|ZP_03290101.1|  hypothetical protein CLONEX_02314 [Clostri...  40.4    0.11 
ref|ZP_03105836.1|  conserved hypothetical protein [Bacillus c...  40.0    0.14 
ref|ZP_04097807.1|  hypothetical protein bthur0009_34300 [Baci...  40.0    0.14 
ref|YP_002766564.1|  hypothetical protein RER_31170 [Rhodococc...  40.0    0.15 
ref|YP_001231449.1|  hypothetical protein Gura_2702 [Geobacter...  40.0    0.15 
ref|ZP_06372748.1|  hypothetical protein C414_000430050 [Campy...  40.0    0.18 
ref|ZP_04290507.1|  hypothetical protein bcere0009_33180 [Baci...  39.7    0.21 
ref|YP_746724.1|  hypothetical protein Neut_0482 [Nitrosomonas...  39.3    0.24 
ref|ZP_04229081.1|  hypothetical protein bcere0020_33670 [Baci...  39.3    0.26 
ref|YP_898571.1|  hypothetical protein FTN_0929 [Francisella t...  39.3    0.27 
ref|ZP_04171883.1|  hypothetical protein bmyco0001_51730 [Baci...  39.3    0.27 
ref|ZP_04153861.1|  hypothetical protein bpmyx0001_46820 [Baci...  39.3    0.30 
ref|YP_003353734.1|  hypothetical protein LLKF_1295 [Lactococc...  38.9    0.32 
ref|YP_437131.1|  hypothetical protein HCH_06056 [Hahella chej...  38.9    0.33 
ref|ZP_02867468.1|  hypothetical protein CLOSPI_01298 [Clostri...  38.9    0.35 
ref|ZP_04208572.1|  hypothetical protein bcere0024_33950 [Baci...  38.9    0.36 
ref|ZP_04234901.1|  hypothetical protein bcere0019_33770 [Baci...  38.9    0.37 
ref|ZP_04165143.1|  hypothetical protein bmyco0002_44270 [Baci...  38.9    0.39 
ref|YP_001646184.1|  hypothetical protein BcerKBAB4_3382 [Baci...  38.5    0.43 
ref|ZP_04159601.1|  hypothetical protein bmyco0003_45820 [Baci...  38.5    0.45 
ref|YP_001514759.1|  hypothetical protein AM1_0388 [Acaryochlo...  38.5    0.48 
ref|ZP_02142092.1|  hypothetical protein RLO149_14538 [Roseoba...  38.5    0.50 
ref|ZP_05496519.1|  hypothetical protein CpapDRAFT_2689 [Clost...  38.1    0.54 
ref|ZP_01873444.1|  hypothetical protein LNTAR_14567 [Lentisph...  38.1    0.55 
ref|ZP_01873942.1|  hypothetical protein LNTAR_10801 [Lentisph...  38.1    0.66 
ref|ZP_04296137.1|  hypothetical protein bcere0007_33700 [Baci...  37.7    0.81 
ref|ZP_04236867.1|  hypothetical protein bcere0019_54120 [Baci...  37.7    0.83 
ref|YP_001003108.1|  hypothetical protein Hhal_1539 [Halorhodo...  37.7    0.87 
emb|CAJ74434.1|  hypothetical protein [Candidatus Kuenenia stu...  37.4    0.88 
ref|ZP_04248420.1|  hypothetical protein bcere0017_53400 [Baci...  37.4    0.93 
ref|NP_841668.1|  hypothetical protein NE1634 [Nitrosomonas eu...  37.4    1.0  
ref|YP_003191770.1|  hypothetical protein Dtox_2336 [Desulfoto...  37.4    1.1  
ref|YP_864522.1|  hypothetical protein Mmc1_0595 [Magnetococcu...  37.0    1.2  
ref|ZP_01969210.1|  hypothetical protein RUMTOR_02795 [Ruminoc...  37.0    1.2  
ref|YP_002125627.1|  hypothetical protein MADE_01319 [Alteromo...  37.0    1.3  
ref|YP_001621074.1|  hypothetical protein ACL_1088 [Acholeplas...  37.0    1.3  
ref|ZP_01967950.1|  hypothetical protein RUMTOR_01516 [Ruminoc...  37.0    1.3  
ref|YP_683992.1|  hypothetical protein RD1_3844 [Roseobacter d...  36.6    1.5  
ref|ZP_04695082.1|  hypothetical protein SrosN15_19281 [Strept...  36.6    1.7  
ref|ZP_01069514.1|  conserved hypothetical protein [Campylobac...  36.6    1.8  
ref|YP_178348.1|  hypothetical protein CJE0328 [Campylobacter ...  36.6    1.8  
ref|YP_001516226.1|  hypothetical protein AM1_1892 [Acaryochlo...  36.6    1.9  
ref|ZP_04189393.1|  hypothetical protein bcere0028_54840 [Baci...  36.2    2.0  
ref|YP_932488.1|  hypothetical protein azo0984 [Azoarcus sp. B...  36.2    2.1  
ref|ZP_05648336.1|  multidrug resistance-like ATP-binding prot...  35.8    2.9  
ref|YP_002506823.1|  hypothetical protein Ccel_2515 [Clostridi...  35.8    3.2  
ref|YP_001398672.1|  hypothetical protein JJD26997_1691 [Campy...  35.8    3.3  
ref|ZP_03504713.1|  hypothetical protein RetlB5_04104 [Rhizobi...  35.4    3.6  
ref|XP_001461240.1|  hypothetical protein [Paramecium tetraure...  35.4    3.6  
ref|ZP_04830651.1|  hypothetical protein GalfDRAFT_1091 [Galli...  35.4    3.7  
ref|YP_003125600.1|  beta-lactamase [Chitinophaga pinensis DSM...  35.4    3.9  
ref|NP_813513.1|  chaperone protein dnaK [Bacteroides thetaiot...  35.4    4.1  
ref|NP_929656.1|  hypothetical protein plu2412 [Photorhabdus l...  35.4    4.2  
ref|ZP_03524347.1|  hypothetical protein RetlG_26101 [Rhizobiu...  35.4    4.3  
ref|YP_003193077.1|  hypothetical protein Dtox_3746 [Desulfoto...  35.0    4.5  
ref|ZP_03512741.1|  hypothetical protein Retl8_20581 [Rhizobiu...  35.0    4.5  
ref|ZP_03501588.1|  hypothetical protein RetlK5_19232 [Rhizobi...  35.0    4.6  
ref|ZP_03461178.1|  hypothetical protein BACPEC_00233 [Bactero...  35.0    4.6  
ref|XP_002325102.1|  predicted protein [Populus trichocarpa] >...  35.0    4.8  
ref|ZP_05810997.1|  conserved hypothetical protein [Mesorhizob...  35.0    5.0  
ref|YP_003192280.1|  hypothetical protein Dtox_2894 [Desulfoto...  35.0    5.0  
ref|NP_660045.2|  hypothetical protein RHE_PD00348 [Rhizobium ...  35.0    5.4  
ref|YP_001984628.1|  hypothetical protein RHECIAT_PB0000377 [R...  35.0    5.4  
ref|ZP_03529462.1|  hypothetical protein RetlC8_23333 [Rhizobi...  35.0    5.6  
ref|NP_105954.1|  hypothetical protein mlr5260 [Mesorhizobium ...  34.7    5.9  
ref|YP_001943919.1|  hypothetical protein Clim_1908 [Chlorobiu...  34.7    6.4  
ref|YP_002484043.1|  hypothetical protein Cyan7425_3358 [Cyano...  34.7    7.0  
ref|NP_001021022.1|  hypothetical protein C32F10.8 [Caenorhabd...  34.7    7.0  
ref|NP_640424.1|  hypothetical protein XAC0068 [Xanthomonas ax...  34.7    7.0  
ref|YP_003290862.1|  hypothetical protein Rmar_1587 [Rhodother...  34.3    7.5  
ref|ZP_06255180.1|  conserved hypothetical protein [Prevotella...  34.3    8.3  
ref|NP_722175.1|  30S ribosomal protein S6 [Streptococcus muta...  34.3    8.4  
emb|CAM75261.1|  galactosyltransferase [Magnetospirillum gryph...  34.3    8.8  
ref|ZP_06373193.1|  hypothetical protein C1336_000060013 [Camp...  34.3    9.6  

ALIGNMENTS
>ref|YP_899760.1| hypothetical protein Ppro_0062 [Pelobacter propionicus DSM 2379]
 gb|ABK97702.1| hypothetical protein Ppro_0062 [Pelobacter propionicus DSM 2379]
Length=424

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 54/112 (48%), Gaps = 5/112 (4%)

Query  75   KSLQYQSSLKSFLKLAKTNNIDVCLLKGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRII  134
            ++L+  + L+  L   +   I + LLKG F++  VY +  +R M DIDVL       RI 
Sbjct  92   RNLRLYAELRRLLTALEGEGIPLILLKGIFLAEAVYGDMGLREMNDIDVLARPGDVTRIS  151

Query  135  NIMLKNGYVFINSNKKELRKFDFDYAHQA-PVLLDKFGIAFEIHHRLKIFSE  185
             I+   GYV ++    ++       AHQ  P ++ +   AFEIH  L    E
Sbjct  152  EILEGMGYVSLHPLSADIAL----KAHQHLPRMVKEGQAAFEIHWNLTSPGE  199


>ref|YP_459324.1| hypothetical protein ELI_12175 [Erythrobacter litoralis HTCC2594]
 gb|ABC64527.1| hypothetical protein ELI_12175 [Erythrobacter litoralis HTCC2594]
Length=405

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 44/94 (46%), Gaps = 5/94 (5%)

Query  89   LAKTNNIDVCLLKGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINIMLKNGYVFINSN  148
            L +   I    LKGA+ +   YP  S R MRDID+LV     L    I+L+NG+      
Sbjct  93   LLRKRGITPVALKGAWCAWHAYPAASERPMRDIDLLVGHDRALDAFAILLENGF---RQE  149

Query  149  KKELRKFDFDYAH--QAPVLLDKFGIAFEIHHRL  180
                R  +   AH    P L+   G+ FE+H RL
Sbjct  150  AASARTPEASLAHDKHLPPLVSPEGVRFELHMRL  183


>ref|ZP_04219869.1| hypothetical protein bcere0022_43060 [Bacillus cereus Rock3-44]
 gb|EEL48443.1| hypothetical protein bcere0022_43060 [Bacillus cereus Rock3-44]
Length=384

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 54/112 (48%), Gaps = 10/112 (8%)

Query  77   LQYQSSLKSFLKLAKTNNIDVCLLKGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINI  136
            LQ  + ++   KL   +NI +  LKG  ++  +Y + S+R  +D+DVL+EE +  +   I
Sbjct  92   LQLSAEMERVSKLFTKSNIRLLFLKGPVIAREIYGDISLRTSKDLDVLIEEINLKKAEEI  151

Query  137  MLKNGY----VFINSNKKELRKFDFDYAHQAPVLLDKFGIAFEIHHRLKIFS  184
            +   GY    V    N+K+ R     Y H       K G+  EIH R + F 
Sbjct  152  LFGLGYKREDVPTILNEKKWRHHHVLYYH------PKIGMQIEIHWRTQPFP  197


>ref|ZP_06243675.1| hypothetical protein Vvad_PD2278 [Victivallis vadensis ATCC BAA-548]
 gb|EFB00242.1| hypothetical protein Vvad_PD2278 [Victivallis vadensis ATCC BAA-548]
Length=389

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 58/120 (48%), Gaps = 11/120 (9%)

Query  64   DFRESILFAQKKSLQYQSSLKSFLKLAKTNNIDVCLLKGAFMSNFVYPNFSMRIMRDIDV  123
            +F+++     + SL       S  KL   N+I     KGA ++  VYP+ S+R+M D+D+
Sbjct  70   EFQKAGRAVSQNSLPLFHQFDSIRKLLNENSIRFVPFKGAELAREVYPDLSLRLMGDLDI  129

Query  124  LVEEASFLRIINIMLKNGYVFINSNKKELRKFDFDYAHQAPVLLDKFGIAFEIHHRLKIF  183
            L+      R I ++  +G+           +F +D+ H AP  L + G+  EIH  L  F
Sbjct  130  LIHPGDIDRAIALLRADGWTG--------DEFRYDH-HFAP--LKRKGVNVEIHFDLPGF  178


>ref|YP_498508.1| hypothetical protein Saro_3239 [Novosphingobium aromaticivorans 
DSM 12444]
 gb|ABD27674.1| hypothetical protein Saro_3239 [Novosphingobium aromaticivorans 
DSM 12444]
Length=414

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 52/107 (48%), Gaps = 6/107 (5%)

Query  76   SLQYQSSLKSFLKLAKTNNIDVCLLKGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRIIN  135
             L+   +LK  + +         +LKG  +++  YP+ ++R +RD+D+L+         +
Sbjct  92   GLRQAVALKRLIGVLAQGGFHPIVLKGLGLAHRDYPDQALRPLRDVDLLLTPDEAPAAQD  151

Query  136  IMLKN-GYVFINSNKKELRKFDFDYAHQAPVLLD-KFGIAFEIHHRL  180
            ++L+  GY            +  +Y HQ P L D +F +  E+HHR+
Sbjct  152  LLLRTEGYRLAPWAG----TYGVEYGHQMPELQDVEFELTIEVHHRI  194


>ref|ZP_06209654.1| conserved hypothetical protein [Acidovorax avenae subsp. avenae 
ATCC 19860]
 gb|EFA41270.1| conserved hypothetical protein [Acidovorax avenae subsp. avenae 
ATCC 19860]
Length=385

 Score = 45.8 bits (107),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 59/126 (46%), Gaps = 9/126 (7%)

Query  56   FRSAMDDQDFRESILFAQKKSLQYQSSLKSFLKLAKTNNIDVCLLKG-AFMSNFVYPNFS  114
             R+ + D+  R ++     ++LQ+ S+L+      +   I  CL+KG  + + F  P   
Sbjct  61   LRAVLRDRQRRMAL-----RALQHASALRGIADALRAAGIRYCLVKGQGYAALFGDP--L  113

Query  115  MRIMRDIDVLVEEASFLRIINIMLKNGYVFINSNKKELRKFDFDYAHQAPVLLDKFGIAF  174
             R   DIDVLV+  S  R +  +   GY   ++   +L ++   + H  P+     G+  
Sbjct  114  RREASDIDVLVDPESIARALPPLQALGYQPDSAAVADLDRYGIRH-HDLPLRHAATGVVV  172

Query  175  EIHHRL  180
            E+H RL
Sbjct  173  ELHQRL  178


>ref|ZP_04387390.1| hypothetical protein RHOER0001_1348 [Rhodococcus erythropolis 
SK121]
 gb|EEN85402.1| hypothetical protein RHOER0001_1348 [Rhodococcus erythropolis 
SK121]
Length=376

 Score = 45.1 bits (105),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 56/120 (46%), Gaps = 15/120 (12%)

Query  65   FRESILFAQKKSLQYQSSLKSFLKLAKTNNIDVCLLKGA-FMSNFVYPNFSMRIMRDIDV  123
             R S L AQ+  LQ         +L  +N      LKGA  +   V+PN + R M DID+
Sbjct  88   IRISDLDAQRVELQ---------ELLHSNGFPTVALKGAALLERNVWPNPAARRMTDIDL  138

Query  124  LVEEASFLRIIN-IMLKNGYVFINSNKKELRKFDFDYAHQAPVLL--DKFGIAFEIHHRL  180
            LV + +     N  +L  GY  +  ++ +    D D  HQ P LL  D+ G + EIH  L
Sbjct  139  LVVDPAHAVPANEAILDFGYRMVRPDEVDSDAIDHDD-HQEPALLRDDRHG-SVEIHSHL  196


>ref|ZP_03169038.1| hypothetical protein RUMLAC_02743 [Ruminococcus lactaris ATCC 
29176]
 gb|EDY31542.1| hypothetical protein RUMLAC_02743 [Ruminococcus lactaris ATCC 
29176]
Length=398

 Score = 44.3 bits (103),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 45/99 (45%), Gaps = 13/99 (13%)

Query  82   SLKSFLKLAKTNNIDVCLLKGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINIMLKNG  141
            S+   L   + + ID   LKG +M  F YP+ S+R M D+D+   +    +I  +++  G
Sbjct  87   SIDEILDAFEKDKIDCVPLKGIYMKEF-YPDSSLRTMSDLDIFYRQGDEEKIEKVLVSKG  145

Query  142  YVFINSNKKELRKFDFDYAHQAPVLLDKFGIAFEIHHRL  180
            YV           FD D  H   V   K  +  E+HH L
Sbjct  146  YV-----------FDHDGPHH-DVYQRKPFMNVEMHHHL  172


>ref|YP_003149648.1| hypothetical protein Ksed_18810 [Kytococcus sedentarius DSM 20547]
 gb|ACV06883.1| hypothetical protein Ksed_18810 [Kytococcus sedentarius DSM 20547]
Length=247

 Score = 44.3 bits (103),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 57/123 (46%), Gaps = 15/123 (12%)

Query  89   LAKTNNIDVCLLKG-AFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINIMLKNGYVFINS  147
            LA + +I   L+KG A      Y   SM    D+DVLVE   F  +++++  +G+V    
Sbjct  4    LAGSADIRTLLVKGPAAEQALGYSRLSM----DVDVLVEPGRFQDLLDLLCAHGFVGDLG  59

Query  148  NKKELRKFDFDYAHQAPVLLDKFGIAFEIHHRLKIFSEVK-NSDRLTKNLIKYKKEKKLF  206
              KE       +AH   V+ D++ IA ++H   + F  +   +DR  + L       +L 
Sbjct  60   AVKE------SWAHSVEVVSDEWSIAIDVH---RWFPGIDVPADRAFEVLWSCAAPVELA  110

Query  207  GLP  209
            G P
Sbjct  111  GRP  113


>ref|YP_001263861.1| hypothetical protein Swit_3377 [Sphingomonas wittichii RW1]
 gb|ABQ69723.1| hypothetical protein Swit_3377 [Sphingomonas wittichii RW1]
Length=363

 Score = 43.5 bits (101),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 2/67 (2%)

Query  92   TNNIDVCLLKGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINIMLKNGYVFIN--SNK  149
               + V LLKGA +   VYPN ++R   D+D+LV  A      +I+L +G+      ++ 
Sbjct  98   AGGVPVILLKGAGLGLTVYPNTTLRPYDDVDLLVPHARIEAARDILLADGFALHGDFAHS  157

Query  150  KELRKFD  156
              LRK D
Sbjct  158  IGLRKAD  164


>ref|YP_428183.1| hypothetical protein Rru_A3101 [Rhodospirillum rubrum ATCC 11170]
 gb|ABC23896.1| conserved hypothetical protein [Rhodospirillum rubrum ATCC 11170]
Length=382

 Score = 43.5 bits (101),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 51/134 (38%), Gaps = 2/134 (1%)

Query  58   SAMDDQDFRESILFAQKKSLQYQSSLKSFLKLAKTNNIDVCLLKGAFMSNFVYPNFSMRI  117
             A   +  R ++L AQ+   +    +       +   + + LLKGA       P    R 
Sbjct  67   PAAPARHLRSALLLAQRHQREVHFEITELAAALRPLGVPLVLLKGAAYVQAALPAGWGRT  126

Query  118  MRDIDVLVEEASFLRIINIMLKNGYVFINSNKKELRKFDFDYAHQAPVLLDKF-GIAFEI  176
             +DID  V  A    + N ++  G+     N  + R +   + H+ P L     G   ++
Sbjct  127  FQDIDFCVPRARLAEVENALIIAGWHPTEKNAYD-RGYYRRWMHEIPPLRHAVRGTVIDV  185

Query  177  HHRLKIFSEVKNSD  190
            HH L   +  +  D
Sbjct  186  HHALTPLTARRPVD  199


>ref|YP_002603803.1| hypothetical protein HRM2_25450 [Desulfobacterium autotrophicum 
HRM2]
 gb|ACN15639.1| hypothetical protein HRM2_25450 [Desulfobacterium autotrophicum 
HRM2]
Length=348

 Score = 43.5 bits (101),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 36/66 (54%), Gaps = 7/66 (10%)

Query  94   NIDVCLLKGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINIMLKNGYVFINSNKKELR  153
             I V  LKG F+S  VY N S+R   DID+ V+E+  +   ++++ NGY       + L 
Sbjct  49   GILVMPLKGPFLSYVVYGNDSLRFSSDIDIFVKESHAIEARDLLIANGY-------QSLD  101

Query  154  KFDFDY  159
            K DF Y
Sbjct  102  KIDFKY  107

-----------------------------------------------------------------------------------
c)BLASTx vs. NR
No significant results
                                                                  Score     E
Sequences producing significant alignments:                       (Bits)  Value

ref|YP_459324.1|  hypothetical protein ELI_12175 [Erythrobacte...  45.8    0.006
ref|YP_899760.1|  hypothetical protein Ppro_0062 [Pelobacter p...  45.1    0.010
ref|ZP_04219869.1|  hypothetical protein bcere0022_43060 [Baci...  43.9    0.022
ref|YP_002603803.1|  hypothetical protein HRM2_25450 [Desulfob...  43.9    0.022
ref|ZP_06243675.1|  hypothetical protein Vvad_PD2278 [Victival...  42.4    0.065
ref|ZP_05495760.1|  hypothetical protein CpapDRAFT_1930 [Clost...  41.6    0.11 
ref|YP_003385432.1|  hypothetical protein Slin_0569 [Spirosoma...  41.6    0.11 
ref|YP_898571.1|  hypothetical protein FTN_0929 [Francisella t...  41.6    0.11 
ref|ZP_03169038.1|  hypothetical protein RUMLAC_02743 [Ruminoc...  40.8    0.19 
ref|ZP_04236867.1|  hypothetical protein bcere0019_54120 [Baci...  40.0    0.32 
ref|YP_001943919.1|  hypothetical protein Clim_1908 [Chlorobiu...  40.0    0.32 
ref|YP_002485004.1|  hypothetical protein Cyan7425_4333 [Cyano...  39.7    0.42 
ref|ZP_04248420.1|  hypothetical protein bcere0017_53400 [Baci...  39.3    0.55 
ref|ZP_04290507.1|  hypothetical protein bcere0009_33180 [Baci...  39.3    0.55 
ref|ZP_01873444.1|  hypothetical protein LNTAR_14567 [Lentisph...  39.3    0.55 
ref|YP_003355943.1|  hypothetical protein MCP_0888 [Methanocel...  38.9    0.72 
ref|YP_001358823.1|  hypothetical protein SUN_1515 [Sulfurovum...  38.9    0.72 
ref|YP_498508.1|  hypothetical protein Saro_3239 [Novosphingob...  38.1    1.2  
ref|YP_001547084.1|  hypothetical protein Haur_4324 [Herpetosi...  37.7    1.6  
ref|ZP_04097807.1|  hypothetical protein bthur0009_34300 [Baci...  37.4    2.1  
ref|ZP_04198617.1|  hypothetical protein bcere0026_33580 [Baci...  37.4    2.1  
ref|ZP_03105836.1|  conserved hypothetical protein [Bacillus c...  37.4    2.1  
ref|ZP_04387390.1|  hypothetical protein RHOER0001_1348 [Rhodo...  37.0    2.7  
ref|YP_003149648.1|  hypothetical protein Ksed_18810 [Kytococc...  37.0    2.7  
ref|ZP_02952405.1|  conserved hypothetical protein [Clostridiu...  37.0    2.7  
ref|ZP_02951617.1|  conserved hypothetical protein [Clostridiu...  37.0    2.7  
ref|ZP_02155071.1|  hypothetical protein OIHEL45_16911 [Oceani...  37.0    2.7  
ref|YP_001263861.1|  hypothetical protein Swit_3377 [Sphingomo...  37.0    2.7  
ref|ZP_04159601.1|  hypothetical protein bmyco0003_45820 [Baci...  36.6    3.6  
ref|ZP_04171883.1|  hypothetical protein bmyco0001_51730 [Baci...  36.6    3.6  
ref|ZP_04229081.1|  hypothetical protein bcere0020_33670 [Baci...  36.6    3.6  
ref|ZP_02634574.1|  conserved hypothetical protein [Clostridiu...  36.6    3.6  
ref|ZP_02630362.1|  conserved hypothetical protein [Clostridiu...  36.6    3.6  
ref|ZP_04988378.1|  conserved hypothetical protein [Francisell...  36.6    3.6  
ref|ZP_01873942.1|  hypothetical protein LNTAR_10801 [Lentisph...  36.6    3.6  
ref|NP_561381.1|  hypothetical protein CPE0465 [Clostridium pe...  36.6    3.6  
ref|YP_864522.1|  hypothetical protein Mmc1_0595 [Magnetococcu...  36.6    3.6  
ref|ZP_05108824.1|  hypothetical protein LDG_0276 [Legionella ...  36.2    4.7  
ref|ZP_04153861.1|  hypothetical protein bpmyx0001_46820 [Baci...  36.2    4.7  
ref|ZP_04208572.1|  hypothetical protein bcere0024_33950 [Baci...  36.2    4.7  
ref|ZP_04234901.1|  hypothetical protein bcere0019_33770 [Baci...  36.2    4.7  
ref|ZP_04296137.1|  hypothetical protein bcere0007_33700 [Baci...  36.2    4.7  
ref|NP_929656.1|  hypothetical protein plu2412 [Photorhabdus l...  36.2    4.7  
ref|ZP_04165143.1|  hypothetical protein bmyco0002_44270 [Baci...  35.8    6.1  
ref|ZP_05810997.1|  conserved hypothetical protein [Mesorhizob...  35.4    8.0  
ref|ZP_05496519.1|  hypothetical protein CpapDRAFT_2689 [Clost...  35.4    8.0  
ref|YP_003191770.1|  hypothetical protein Dtox_2336 [Desulfoto...  35.4    8.0  
ref|ZP_04189393.1|  hypothetical protein bcere0028_54840 [Baci...  35.4    8.0  
ref|NP_105954.1|  hypothetical protein mlr5260 [Mesorhizobium ...  35.4    8.0  

ALIGNMENTS
>ref|YP_459324.1| hypothetical protein ELI_12175 [Erythrobacter litoralis HTCC2594]
 gb|ABC64527.1| hypothetical protein ELI_12175 [Erythrobacter litoralis HTCC2594]
Length=405

 Score = 45.8 bits (107),  Expect = 0.006
 Identities = 33/94 (35%), Positives = 44/94 (46%), Gaps = 5/94 (5%)
 Frame = -2

Query  367  LAKTNNIDVCLLKGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINIMLKNGYVFINSN  188
            L +   I    LKGA+ +   YP  S R MRDID+LV     L    I+L+NG+      
Sbjct  93   LLRKRGITPVALKGAWCAWHAYPAASERPMRDIDLLVGHDRALDAFAILLENGF---RQE  149

Query  187  KKELRKFDFDYAH--QAPVLLDKFGIAFEIHHRL  92
                R  +   AH    P L+   G+ FE+H RL
Sbjct  150  AASARTPEASLAHDKHLPPLVSPEGVRFELHMRL  183


>ref|YP_899760.1| hypothetical protein Ppro_0062 [Pelobacter propionicus DSM 2379]
 gb|ABK97702.1| hypothetical protein Ppro_0062 [Pelobacter propionicus DSM 2379]
Length=424

 Score = 45.1 bits (105),  Expect = 0.010
 Identities = 31/87 (35%), Positives = 44/87 (50%), Gaps = 5/87 (5%)
 Frame = -2

Query  349  IDVCLLKGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINIMLKNGYVFINSNKKELRK  170
            I + LLKG F++  VY +  +R M DIDVL       RI  I+   GYV ++    ++  
Sbjct  112  IPLILLKGIFLAEAVYGDMGLREMNDIDVLARPGDVTRISEILEGMGYVSLHPLSADIAL  171

Query  169  FDFDYAHQ-APVLLDKFGIAFEIHHRL  92
                 AHQ  P ++ +   AFEIH  L
Sbjct  172  ----KAHQHLPRMVKEGQAAFEIHWNL  194


>ref|ZP_04219869.1| hypothetical protein bcere0022_43060 [Bacillus cereus Rock3-44]
 gb|EEL48443.1| hypothetical protein bcere0022_43060 [Bacillus cereus Rock3-44]
Length=384

 Score = 43.9 bits (102),  Expect = 0.022
 Identities = 30/95 (31%), Positives = 47/95 (49%), Gaps = 10/95 (10%)
 Frame = -2

Query  355  NNIDVCLLKGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINIMLKNGY----VFINSN  188
            +NI +  LKG  ++  +Y + S+R  +D+DVL+EE +  +   I+   GY    V    N
Sbjct  108  SNIRLLFLKGPVIAREIYGDISLRTSKDLDVLIEEINLKKAEEILFGLGYKREDVPTILN  167

Query  187  KKELRKFDFDYAHQAPVLLDKFGIAFEIHHRLKIF  83
            +K+ R     Y H       K G+  EIH R + F
Sbjct  168  EKKWRHHHVLYYH------PKIGMQIEIHWRTQPF  196


>ref|YP_002603803.1| hypothetical protein HRM2_25450 [Desulfobacterium autotrophicum 
HRM2]
 gb|ACN15639.1| hypothetical protein HRM2_25450 [Desulfobacterium autotrophicum 
HRM2]
Length=348

 Score = 43.9 bits (102),  Expect = 0.022
 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 7/60 (11%)
 Frame = -2

Query  334  LKGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINIMLKNGYVFINSNKKELRKFDFDY  155
            LKG F+S  VY N S+R   DID+ V+E+  +   ++++ NGY       + L K DF Y
Sbjct  55   LKGPFLSYVVYGNDSLRFSSDIDIFVKESHAIEARDLLIANGY-------QSLDKIDFKY  107


>ref|ZP_06243675.1| hypothetical protein Vvad_PD2278 [Victivallis vadensis ATCC BAA-548]
 gb|EFB00242.1| hypothetical protein Vvad_PD2278 [Victivallis vadensis ATCC BAA-548]
Length=389

 Score = 42.4 bits (98),  Expect = 0.065
 Identities = 30/95 (31%), Positives = 48/95 (50%), Gaps = 11/95 (11%)
 Frame = -2

Query  367  LAKTNNIDVCLLKGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINIMLKNGYVFINSN  188
            L   N+I     KGA ++  VYP+ S+R+M D+D+L+      R I ++  +G+      
Sbjct  95   LLNENSIRFVPFKGAELAREVYPDLSLRLMGDLDILIHPGDIDRAIALLRADGWTG----  150

Query  187  KKELRKFDFDYAHQAPVLLDKFGIAFEIHHRLKIF  83
                 +F +D+ H AP  L + G+  EIH  L  F
Sbjct  151  ----DEFRYDH-HFAP--LKRKGVNVEIHFDLPGF  178


>ref|ZP_05495760.1| hypothetical protein CpapDRAFT_1930 [Clostridium papyrosolvens 
DSM 2782]
 gb|EEU59281.1| hypothetical protein CpapDRAFT_1930 [Clostridium papyrosolvens 
DSM 2782]
Length=385

 Score = 41.6 bits (96),  Expect = 0.11
 Identities = 18/51 (35%), Positives = 32/51 (62%), Gaps = 0/51 (0%)
 Frame = -2

Query  355  NNIDVCLLKGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINIMLKNGYV  203
            N I + +LKG F+++ VYP+   R   D+D L++     +I+NI+ + GY+
Sbjct  106  NGIRLAILKGNFLASKVYPSVETRTFNDLDFLIDVRDGDKIVNILEELGYI  156


>ref|YP_003385432.1| hypothetical protein Slin_0569 [Spirosoma linguale DSM 74]
 gb|ADB36633.1| hypothetical protein Slin_0569 [Spirosoma linguale DSM 74]
Length=389

 Score = 41.6 bits (96),  Expect = 0.11
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 0/61 (0%)
 Frame = -2

Query  367  LAKTNNIDVCLLKGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINIMLKNGYVFINSN  188
            L   N+ID   LKG  ++   YP+ S+RI  DID+LV      R I ++  N Y   N  
Sbjct  96   LLTENDIDHLPLKGVHLAEQYYPDSSLRISGDIDILVRREDAFRTIRLLQANEYQLNNQQ  155

Query  187  K  185
            +
Sbjct  156  R  156


>ref|YP_898571.1| hypothetical protein FTN_0929 [Francisella tularensis subsp. 
novicida U112]
 ref|ZP_03079225.1| EF hand domain protein [Francisella tularensis subsp. novicida 
FTE]
 gb|ABK89817.1| hypothetical protein FTN_0929 [Francisella novicida U112]
 gb|EDX27406.1| EF hand domain protein [Francisella tularensis subsp. novicida 
FTE]
Length=367

 Score = 41.6 bits (96),  Expect = 0.11
 Identities = 31/108 (28%), Positives = 53/108 (49%), Gaps = 21/108 (19%)
 Frame = -2

Query  355  NNIDVCLLKGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINIMLKNGY----------  206
            +NI+  +LKG  +   +Y +   R+ +DID+LV+E     + NI+L  G+          
Sbjct  105  HNIENVVLKGLPLDKKLYGSQGKRVYKDIDILVKENQLNIVHNILLSMGFDISKHIRYSL  164

Query  205  VFINS---NKKELRKFDFDYAHQAPVLLDKFGIAFEIHHRLKIFSEVK  71
             FI     +KK ++  D  Y H++        IA E+H R+ I  ++K
Sbjct  165  EFIEKYPLSKKGIK--DLTYVHKS------LNIALELHWRITIIDDLK  204


>ref|ZP_03169038.1| hypothetical protein RUMLAC_02743 [Ruminococcus lactaris ATCC 
29176]
 gb|EDY31542.1| hypothetical protein RUMLAC_02743 [Ruminococcus lactaris ATCC 
29176]
Length=398

 Score = 40.8 bits (94),  Expect = 0.19
 Identities = 28/88 (31%), Positives = 41/88 (46%), Gaps = 13/88 (14%)
 Frame = -2

Query  355  NNIDVCLLKGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINIMLKNGYVFINSNKKEL  176
            + ID   LKG +M  F YP+ S+R M D+D+   +    +I  +++  GYV         
Sbjct  98   DKIDCVPLKGIYMKEF-YPDSSLRTMSDLDIFYRQGDEEKIEKVLVSKGYV---------  147

Query  175  RKFDFDYAHQAPVLLDKFGIAFEIHHRL  92
              FD D  H   V   K  +  E+HH L
Sbjct  148  --FDHDGPHH-DVYQRKPFMNVEMHHHL  172


>ref|ZP_04236867.1| hypothetical protein bcere0019_54120 [Bacillus cereus Rock3-28]
 gb|EEL31413.1| hypothetical protein bcere0019_54120 [Bacillus cereus Rock3-28]
Length=377

 Score = 40.0 bits (92),  Expect = 0.32
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 3/60 (5%)
 Frame = -2

Query  355  NNIDVCLLKGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINIMLKNGY---VFINSNK  185
            N I+  LLKG  +S ++Y +F +R   D D+LV      R  +I+L  GY    +I+ NK
Sbjct  108  NKIEYVLLKGISLSKYIYEDFGLRDFNDNDILVHPNDIERAKSIILSLGYEQGEYIHHNK  167


>ref|YP_001943919.1| hypothetical protein Clim_1908 [Chlorobium limicola DSM 245]
 gb|ACD90940.1| hypothetical protein Clim_1908 [Chlorobium limicola DSM 245]
Length=413

 Score = 40.0 bits (92),  Expect = 0.32
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 3/88 (3%)
 Frame = -2

Query  349  IDVCLLKGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINIMLKNGYVFINSNKKELRK  170
            ID  +LKG  +S  +Y N + R+M D+D+LV ++  LR   ++   G   I  +  +  +
Sbjct  105  IDCIVLKGMHLSMLIYDNPADRMMSDLDLLVRQSDLLRAAELLAARG---IAPHDYKPVE  161

Query  169  FDFDYAHQAPVLLDKFGIAFEIHHRLKI  86
             +  + H         G + EIH  LK+
Sbjct  162  AETAHCHHLVPFTTNRGNSLEIHWTLKL  189

>ref|YP_002485004.1| hypothetical protein Cyan7425_4333 [Cyanothece sp. PCC 7425]
 gb|ACL46643.1| hypothetical protein Cyan7425_4333 [Cyanothece sp. PCC 7425]
Length=434

 Score = 39.7 bits (91),  Expect = 0.42
 Identities = 22/93 (23%), Positives = 45/93 (48%), Gaps = 1/93 (1%)
 Frame = -2

Query  367  LAKTNNIDVCLLKGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINIMLKNGYV-FINS  191
            L +   I V   KG  ++ F++ N S+R   D+D+LV +A   + I+++   GY+  +  
Sbjct  112  LFQAEGIPVLTFKGPVLAQFIHANLSLRQFIDLDLLVHQAQLPQAIDLLTTEGYIPGVVD  171

Query  190  NKKELRKFDFDYAHQAPVLLDKFGIAFEIHHRL  92
                 + +   Y H+   +  + G+  ++H  L
Sbjct  172  LTPAQQAYYTRYFHEFTFVHPEKGVQIDLHWEL  204

-----------------------------------------------------------------------------
d)BLASTx vs. SWISSPROT
No significant results
                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

sp|Q8K9H6.1|DEAD_BUCAP  RecName: Full=Cold-shock DEAD box prot...  34.7    0.79 
sp|Q6PSB9.1|MATK_VIGMU  RecName: Full=Maturase K; AltName: Ful...  31.6    6.7  
sp|Q9UTJ2.1|PMM_SCHPO  RecName: Full=Phosphomannomutase; Short...  31.2    8.7  

ALIGNMENTS
>sp|Q8K9H6.1|DEAD_BUCAP RecName: Full=Cold-shock DEAD box protein A homolog; AltName: 
Full=ATP-dependent RNA helicase deaD homolog
Length=601

 Score = 34.7 bits (78),  Expect = 0.79
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 9/60 (15%)
 Frame = -2

Query  631  KIINKRIDMTL---IKNYLSKLKTNNFALEDKESKRSFFD------YCIKTNTASFFFAR  479
            KI+NK+I++ L   IKNY ++    +   +DK +KR F D        IK  T S FF R
Sbjct  539  KILNKKINIKLLRDIKNYETRTHNRSIFNKDKNNKRRFSDNRLNKSSSIKNETKSSFFRR  598


>sp|Q6PSB9.1|MATK_VIGMU RecName: Full=Maturase K; AltName: Full=Intron maturase
Length=504

 Score = 31.6 bits (70),  Expect = 6.7
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 14/83 (16%)
 Frame = -2

Query  322  FMSNFVYPN-FSMRIMRDIDV-LVEEASFLRIINIMLKNGYVFINSNKKELRKFDFDYAH  149
            F+ N  Y N FS+ I++ +   + ++  F+  +N   KN +V             ++Y  
Sbjct  39   FIENVDYNNNFSLLIVKRLSTRMYQQTHFILFVNDSKKNTFV------------GYNYHF  86

Query  148  QAPVLLDKFGIAFEIHHRLKIFS  80
             + ++L+ FGI  EI   L++FS
Sbjct  87   YSQIILEGFGIVVEILFSLQLFS  109


>sp|Q9UTJ2.1|PMM_SCHPO RecName: Full=Phosphomannomutase; Short=PMM
Length=257

 Score = 31.2 bits (69),  Expect = 8.7
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 9/74 (12%)
 Frame = -2

Query  298  NFSMRIMRDIDVLVEEASFLRIINIMLKNGYVFINSNKKELRKFD-FD-----YAHQAPV  137
            NF +  + D+D+ V+  +F+   N M+    V  N+N +E  +F+ FD      A    V
Sbjct  111  NFCLHYIADLDIPVKRGTFIEFRNGMINISPVGRNANTEERNEFERFDKGRKIRATMVDV  170

Query  136  LLDKF---GIAFEI  104
            L +KF   G+ F I
Sbjct  171  LREKFKDYGLTFSI  184

------------------------------------------------------------------------
e)BLASTp vs. ENV_NR

                                                                 Score     E
Sequences producing significant alignments:                       (Bits)  Value

gb|EBD56172.1|  hypothetical protein GOS_9909365 [marine metag...   419    2e-116
gb|EBH15069.1|  hypothetical protein GOS_9312067 [marine metag...   285    6e-76 
gb|ECA01760.1|  hypothetical protein GOS_3061997 [marine metag...  46.6    4e-04 
gb|EBE56946.1|  hypothetical protein GOS_9741798 [marine metag...  41.6    0.012 
gb|EBM92743.1|  hypothetical protein GOS_8329917 [marine metag...  40.8    0.021 
gb|ECA58511.1|  hypothetical protein GOS_4269532 [marine metag...  39.3    0.062 
gb|ECH30796.1|  hypothetical protein GOS_5783359 [marine metag...  38.9    0.079 
gb|EBO00413.1|  hypothetical protein GOS_8152739 [marine metag...  38.9    0.083 
gb|ECJ79591.1|  hypothetical protein GOS_6413996 [marine metag...  37.4    0.23  
gb|EBI86694.1|  hypothetical protein GOS_9020615 [marine metag...  36.6    0.47  
gb|ECY24246.1|  hypothetical protein GOS_2393120 [marine metag...  36.2    0.53  
gb|EBH48953.1|  hypothetical protein GOS_9253962 [marine metag...  36.2    0.62  
gb|ECG08257.1|  hypothetical protein GOS_3698675 [marine metag...  35.4    0.87  
gb|EDD86862.1|  hypothetical protein GOS_1230775 [marine metag...  34.7    1.5   
gb|ECY38019.1|  hypothetical protein GOS_2370045 [marine metag...  34.7    1.7   
gb|ECN69272.1|  hypothetical protein GOS_4892967 [marine metag...  34.3    1.9   
gb|EBQ78631.1|  hypothetical protein GOS_7698032 [marine metag...  33.9    2.4   
gb|EBD52512.1|  hypothetical protein GOS_9915268 [marine metag...  33.9    2.6   
gb|ECN46328.1|  hypothetical protein GOS_5832703 [marine metag...  33.1    4.4   
gb|ECQ37889.1|  hypothetical protein GOS_5891549 [marine metag...  33.1    4.7   
gb|EDB59103.1|  hypothetical protein GOS_1629609 [marine metag...  32.7    5.6   
gb|ECY42804.1|  hypothetical protein GOS_2362033 [marine metag...  32.7    5.6   
gb|EBM04927.1|  hypothetical protein GOS_8471502 [marine metag...  32.7    5.6   
gb|ECZ22546.1|  hypothetical protein GOS_2220382 [marine metag...  32.7    5.7   
gb|ECW58806.1|  hypothetical protein GOS_2693661 [marine metag...  32.7    6.3   
gb|ECA74425.1|  hypothetical protein GOS_3636676 [marine metag...  32.7    6.5   
gb|ECZ91948.1|  hypothetical protein GOS_2096428 [marine metag...  32.3    7.6   
gb|ECX67926.1|  hypothetical protein GOS_2495468 [marine metag...  32.3    7.6   
gb|ECB01953.1|  hypothetical protein GOS_6025745 [marine metag...  32.3    8.0   
gb|ECF44641.1|  hypothetical protein GOS_6227755 [marine metag...  32.3    8.2   
gb|ECO05915.1|  hypothetical protein GOS_3486099 [marine metag...  32.3    8.3   
gb|EBW43886.1|  hypothetical protein GOS_6746866 [marine metag...  32.3    8.4   
gb|EBG70892.1|  hypothetical protein GOS_9387546 [marine metag...  32.3    8.5   
gb|ECV66975.1|  hypothetical protein GOS_2855984 [marine metag...  32.0    9.2   
gb|EBV01654.1|  hypothetical protein GOS_6969646 [marine metag...  32.0    9.9   

ALIGNMENTS
>gb|EBD56172.1| hypothetical protein GOS_9909365 [marine metagenome]
Length=209

 Score =  419 bits (1078),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 208/209 (99%), Positives = 209/209 (100%), Gaps = 0/209 (0%)

Query  2    IINKRIDMTLIKNYLSKLKTNNFALEDKESKRSFFDYCIKTNTASFFFARPCEEFRSAMD  61
            +INKRIDMTLIKNYLSKLKTNNFALEDKESKRSFFDYCIKTNTASFFFARPCEEFRSAMD
Sbjct  1    MINKRIDMTLIKNYLSKLKTNNFALEDKESKRSFFDYCIKTNTASFFFARPCEEFRSAMD  60

Query  62   DQDFRESILFAQKKSLQYQSSLKSFLKLAKTNNIDVCLLKGAFMSNFVYPNFSMRIMRDI  121
            DQDFRESILFAQKKSLQYQSSLKSFLKLAKTNNIDVCLLKGAFMSNFVYPNFSMRIMRDI
Sbjct  61   DQDFRESILFAQKKSLQYQSSLKSFLKLAKTNNIDVCLLKGAFMSNFVYPNFSMRIMRDI  120

Query  122  DVLVEEASFLRIINIMLKNGYVFINSNKKELRKFDFDYAHQAPVLLDKFGIAFEIHHRLK  181
            DVLVEEASFLRIINIMLKNGYVFINSNKKELRKFDFDYAHQAPVLLDKFGIAFEIHHRLK
Sbjct  121  DVLVEEASFLRIINIMLKNGYVFINSNKKELRKFDFDYAHQAPVLLDKFGIAFEIHHRLK  180

Query  182  IFSEVKNSDRLTKNLIKYKKEKKLFGLPV  210
            IFSEVKNSDRLTKNLIKYKKEKKLFGLPV
Sbjct  181  IFSEVKNSDRLTKNLIKYKKEKKLFGLPV  209


>gb|EBH15069.1| hypothetical protein GOS_9312067 [marine metagenome]
Length=228

 Score =  285 bits (728),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 137/206 (66%), Positives = 169/206 (82%), Gaps = 0/206 (0%)

Query  5    KRIDMTLIKNYLSKLKTNNFALEDKESKRSFFDYCIKTNTASFFFARPCEEFRSAMDDQD  64
            KR  M+L  +Y+SKLKTNNF LED+ SK    +YCI + TA+FF  R  +EF SAMD++D
Sbjct  3    KRFKMSLASDYISKLKTNNFILEDENSKNFLLNYCINSGTANFFLGRADKEFESAMDNKD  62

Query  65   FRESILFAQKKSLQYQSSLKSFLKLAKTNNIDVCLLKGAFMSNFVYPNFSMRIMRDIDVL  124
            FRE+IL  +KKSLQ+QSSLKSFLKL KTNNI+VCLLKGAFMSNF+Y +F+MR MRDID+L
Sbjct  63   FRENILLVKKKSLQHQSSLKSFLKLTKTNNINVCLLKGAFMSNFMYQDFTMRSMRDIDIL  122

Query  125  VEEASFLRIINIMLKNGYVFINSNKKELRKFDFDYAHQAPVLLDKFGIAFEIHHRLKIFS  184
            VEE+  +R INIML+NGY F+NS +KELRKF+F+Y+HQAP+L+DKFG AFE+HHRLK + 
Sbjct  123  VEESELIRTINIMLENGYYFLNSTEKELRKFNFNYSHQAPILVDKFGNAFELHHRLKTYP  182

Query  185  EVKNSDRLTKNLIKYKKEKKLFGLPV  210
            E++NSD L KNLIK KKE  LF  PV
Sbjct  183  ELENSDNLAKNLIKQKKETILFNTPV  208


>gb|ECA01760.1| hypothetical protein GOS_3061997 [marine metagenome]
Length=263

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 36/69 (52%), Gaps = 0/69 (0%)

Query  82   SLKSFLKLAKTNNIDVCLLKGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINIMLKNG  141
            S +   ++   NN D  LLKGA +   VY +   R + DIDVLV  +  L  I  + KN 
Sbjct  61   SAQDATQILSANNFDFVLLKGAALGLRVYGDIGARRLTDIDVLVRHSCRLGAIQALTKNN  120

Query  142  YVFINSNKK  150
            Y  + SN+K
Sbjct  121  YKCVFSNRK  129


>gb|EBE56946.1| hypothetical protein GOS_9741798 [marine metagenome]
Length=277

 Score = 41.6 bits (96),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 43/86 (50%), Gaps = 5/86 (5%)

Query  96   DVCLLKGAFMSNF-VYPNFSMRIMRDIDVLVEEASFLRIINIMLKNGYVFINSNKKELRK  154
            D  LLKGA    + +Y N   R++ DID LV++ S   I NI  KNGY  +N NK     
Sbjct  36   DWVLLKGAANIKYEIYNNIGDRMIGDIDFLVQKNSAENIFNIFKKNGYKPLNENK----F  91

Query  155  FDFDYAHQAPVLLDKFGIAFEIHHRL  180
            F+  Y H   ++      A EIH  L
Sbjct  92   FNEHYRHLTRMVNPDKLFAIEIHKSL  117


>gb|EBM92743.1| hypothetical protein GOS_8329917 [marine metagenome]
Length=276

 Score = 40.8 bits (94),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query  74   KKSLQYQSSLKSFLKLAKTNNIDVCLLKGAFMSNFVY-PNFSMRIMRDIDVLVEEASFLR  132
            K+++     +     L ++NNID   LKGA + + +Y  +  +R++ DIDVL++    L+
Sbjct  77   KRNINLVKEVNEISNLFRSNNIDHVFLKGAALLSSIYKESLGIRMIGDIDVLIKNDQILK  136

Query  133  IINIMLKNGYVFINS  147
              ++M  +GY FI+ 
Sbjct  137  AKSLMENHGYKFIDG  151


>gb|ECA58511.1| hypothetical protein GOS_4269532 [marine metagenome]
Length=279

 Score = 39.3 bits (90),  Expect = 0.062, Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query  74   KKSLQYQSSLKSFLKLAKTNNIDVCLLKGAFMSNFVYP-NFSMRIMRDIDVLVEEASFLR  132
            +++L+    +     L ++NNID   LKGA + + VY  +  +R++ DID+L+ +   L+
Sbjct  55   ERNLELVKEVNEISDLFRSNNIDHVFLKGAALVSSVYKKSLGIRMVGDIDILITDDQILK  114

Query  133  IINIMLKNGYVFI  145
              ++M   GY FI
Sbjct  115  AKSLMEDYGYKFI  127


>gb|ECH30796.1| hypothetical protein GOS_5783359 [marine metagenome]
Length=297

 Score = 38.9 bits (89),  Expect = 0.079, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 41/74 (55%), Gaps = 1/74 (1%)

Query  74   KKSLQYQSSLKSFLKLAKTNNIDVCLLKGAFMSNFVYP-NFSMRIMRDIDVLVEEASFLR  132
            K++L+    +     L  +NNID   LKGA + + VY  +  +R++ DID+L+     L+
Sbjct  77   KRNLELVKEVNEISDLFNSNNIDHVFLKGAALVSSVYKKSLGIRMVGDIDILINNDQILK  136

Query  133  IINIMLKNGYVFIN  146
              ++M   GY F++
Sbjct  137  AKSLMEDYGYKFVD  150


>gb|EBO00413.1| hypothetical protein GOS_8152739 [marine metagenome]
Length=352

 Score = 38.9 bits (89),  Expect = 0.083, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 0/62 (0%)

Query  87   LKLAKTNNIDVCLLKGAFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINIMLKNGYVFIN  146
            + L K   IDV ++KGA M    Y + SMR M D+D+LV  ++      ++L+ G+V  N
Sbjct  58   VHLLKQAGIDVMVIKGAAMVIDYYYDESMRPMEDLDILVRYSNKRSASRLLLEQGWVIKN  117

Query  147  SN  148
             +
Sbjct  118  KH  119


>gb|ECJ79591.1| hypothetical protein GOS_6413996 [marine metagenome]
Length=281

 Score = 37.4 bits (85),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 56/112 (50%), Gaps = 11/112 (9%)

Query  73   QKKSLQYQSSLKSFLKLAKTNNIDVCLLKG-AFMSNFVYPNFSMRIMRDIDVLVEEASFL  131
            ++++L+    +K   KL   NNI    LKG A +   +Y + + R++ DID +  +  + 
Sbjct  82   RERNLKIILQVKELNKLLLMNNIKPIFLKGSANLIAGIYVDIAERMVGDIDFIFSKEDYP  141

Query  132  RIINIMLKNGYVFINSNKKELRKFDFDYAHQ---APVLLDKFGIAFEIHHRL  180
            + I I+  NGY        E++K+D+   H+     +  DK   A EIH+ +
Sbjct  142  KAIAILKDNGY-------SEVKKYDYYLPHERHYERLRKDKCIAAVEIHYEI  186


>gb|EBI86694.1| hypothetical protein GOS_9020615 [marine metagenome]
Length=193

 Score = 36.6 bits (83),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 36/56 (64%), Gaps = 1/56 (1%)

Query  93   NNIDVCLLKG-AFMSNFVYPNFSMRIMRDIDVLVEEASFLRIINIMLKNGYVFINS  147
            +N+D   LKG A + +  +   + R++ DID+L+ + S L+  ++++KNGY F N+
Sbjct  102  HNVDHIFLKGSALLLSNKFDVINERMIGDIDILIRKESILKARDLIVKNGYKFFNT  157


>gb|ECY24246.1| hypothetical protein GOS_2393120 [marine metagenome]
Length=532

 Score = 36.2 bits (82),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query  79   YQSSLKSFLKLAKTNNIDVCLLKGAF---MSNFVYPNFSMRI-MRDIDVLVEEASFLRII  134
            Y ++++SFL+L K +N DV LL   F   M++F+      +I + D+D  +++  F   +
Sbjct  285  YITTVQSFLQLGKPDN-DV-LLYWPFHDVMNSFLEGKLMQQIAIHDLDTWLKKTPFYEAV  342

Query  135  NIMLKNGYVF  144
            N +L NGY F
Sbjct  343  NWLLNNGYGF  352


>gb|EBH48953.1| hypothetical protein GOS_9253962 [marine metagenome]
Length=285

 Score = 36.2 bits (82),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 55/114 (48%), Gaps = 23/114 (20%)

Query  112  NFSMRIMRDIDVLVEEASFLRIINIMLKNGYVFINSN-------KKELRKFDFDYA-HQA  163
            N+++ ++ D+        +L I N +L   ++F   N        K  +KF FDY  H A
Sbjct  1    NYNVIVIDDLST----GKYLNIKNFLLNKNFIFFKGNVNNSIFINKIFKKFKFDYVFHYA  56

Query  164  PVLLDKFGIAFEIHHRLKIFSEVKNSDRLTKNLIKYKKEK-------KLFGLPV  210
             V+    G+   I + + + +++K  + +  N++KYK +K       +++G PV
Sbjct  57   AVV----GVERTIKNPILVLNDIKGFENILNNMVKYKSKKIFYASSSEIYGEPV  106